4HAGA

Crystal structure of fc-fragment of human igg2 antibody (centered crystal form)
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
208
structure length
208
Chain Sequence
GPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTFRVVSVLTVVHQDWLNGKEYKCKVSNKGLPAPIEKTISKTKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPMLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ig gamma-2 chain C region
publication title IgG2 Fc structure and the dynamic features of the IgG CH2-CH3 interface.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 35
structure length 208
sequence length 208
ec nomenclature
pdb deposition date 2012-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4hagA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4hagA01
1KB5A 4ZXBB 3VGBA 4EUPH 1ZEAL 1A7NH 1CFBA 2EE6A 2V5TA 3ILQD 4K9EH 1KELH 4FFVD 4NUGL 5KW9H 5DSCB 1OT1A 5HXMA 1BFOA 5I0DA 3MV7E 3BGAA 3H42H 2APBA 4DN3L 2M26A 3GSRB 3MSPA 1KN4H 4OGYH 2JIXA 1DUZB 2E7BA 4I48A 4Z76A 3P30L 4LHUD 3SE9H 3F6LA 1G7HB 3FB6B 2A0LD 5D2LF 3ULVC 2LAGB 3ULVL 4NYLB 1CGUA 4C4KO 3TZVA 1MQKL 4UT6L 2NY6C 1AGEB 2EDKA 1HXYB 3ZE2F 4YDKL 3CMOL 2EC9U 3PGFH 5E8PA 3LHPH 2NY7H 3HAEG 1HOCB 3PWVB 2D7NA 2X4OB 4NQEA 2DQIL 5IMMA 1K2DA 4UT9H 4G6AD 4I77H 1I7UA 1P4IL 4PJ5D 5EU6E 5F8QC 2QADB 4D9RE 5KSBE 1CK0H 3DX6B 5KSVB 1AY1L 3RUGB 3DTXB 3D2UA 5I74C 2GJ6A 4O51A 4NQSA 4RNRB 2Z35B 4RAUA 5LCVL 4DWHA 1QSVA 1BIIB 2VH5L 2CIIB 3BIKA 3LCYA 1MCJA 2FDBP 2YA1A 3L3JB 3BKCL 2Z8WC 3MRBB 5E24E 4QKXB 2DKUA 1OGTB 2DJSA 5DHYA 1HQ4B 3G04B 2DQJH 4GKZA 4PJ9B 4L3CA 3ES6B 5CILL 3PWNA 4OV5B 1H0DA 4Z7UF 5FUOL 1X5GA 3RWGA 5IFAH 3BW9B 5F1NB 4X6CB 4WO4D 2VL5B 1UYWH 1HIMH 2ZJSL 4JFPA 3BXNA 2G60H 3S37X 1AGCA 3UO1L 5DRNB 1ZA3A 3GKWH 2V5MA 3KPOB 3PP3H 5E94A 4L8CA 2PN5A 2QSQA 3QNXA 1EEZB 1WUNT 4QHMB 1AQDA 2Y7QA 3VH8G 1U8PB 2CUIA 1VFAB 1KJMA 1YMHA 3BZ4B 3NIGF 3OKOB 4G6KL 2B5IC 4RFEB 3STLA 3W2DL 5GRJL 4UILH 4Z0BH 5EG6C 1N4XH 5BZDB 4LFHD 1FNEB 5ALBL 4URTB 3WS6A 1RUPH 1G6VK 2VNCA 2EXWC 4LCWB 1YEIH 2FX9L 3IDMA 2ITCA 3CSYB 4IMLA 3V0VA 2A73A 2JELH 5EPMB 3D85A 3FMGL 3DX9B 4U1JB 4KKCC 4R2GB 1FDLL 5HY9A 4HIIA 2P5WB 1SJEB 4NQVB 4OCYH 4PUBL 1BWWA 5IHBA 2XYCA 1DBAL 3DBXA 3QNYA 1SQ2N 4F33A 4XTRC 2QLVB 3EGSA 5FCUL 2APXA 4WFED 2GI7A 5KTEH 3QNZB 4KK6C 4HSQA 3REWA 4LP5A 2BFVH 3MLSL 4FXGA 4G42A 5IF0B 5IEKA 4RIRB 4CNIB 1TPXC 3CFEB 3MRPA 3QQ4A 4KK5D 3CXHK 4M93B 4PRBB 4ORGA 2H1PH 1ZHBB 5EZJB 1I3GH 2AERT 3BPOB 5HSFA 4UV7L 2GK0A 2UWEF 5JW5B 1IGTA 4Y16B 4LLWB 4YR6A 1HHKA 4M00A 5I1KL 4QXWA 1B4JL 4O2FB 4LBEB 1D9KC 4M6ML 3TA3A 1OT2A 2RFXA 3P77B 4IOFC 4DKFL 1S78C 1P4BH 4PGBB 4U6XB 2X6MA 4GRLD 3B3IB 1HNGA 2I9LA 4I18B 4APQA 5E1AA 5F96H 3T0DA 1M4KA 3KPMB 4OQTA 3TVMB 1VSCA 4MD0A 4PJ8D 5HPOA 4B5EA 1S7XB 5KG9B 4KQ3L 4KWUA 4FQ2L 3W9EB 1O7VA 4MQXC 4OZIE 3WDHA 3MJ7B 3GJFK 2GCYA 1QP1A 1IM3A 2FEDD 1NCWH 3GI8H 3MUY1 1JGVH 5J6GA 1P2CA 3LDBC 4Z7VE 1K9TA 1PDKA 5HHOB 5L7XH 2L4OA 5F1IB 4UAOB 4JR9L 1F4XL 5BS0B 4WW2F 5EZIH 4QOKA 2BVYA 1FVCB 3QWRD 4NZUL 4XCEB 5IT2L 1RMFL 5FCSH 5DXWA 2HP4A 4YHNA 2VLME 4PJXB 5JHDA 5E8OA 4FMFA 1HSBA 1C1EL 5K9KB 2VIRB 2MPAH 5C0BD 3IXTB 4DEPB 2Q76A 2ZWLT 5ERWB 4IRJA 4U1SB 4C56E 4UOW0 1TZIB 3CXDH 2BSSB 2XN9D 3O4LB 1FN4A 2R69L 3PWPA 5B8CB 3ALPA 3DRTB 4MXVF 2I9TA 4RSVA 3RRQA 3L3DA 5I17B 2WSKA 2C3XA 4PP1D 1R0AL 2UZIL 2FJFA 2WLZA 1U0QA 2Y07L 4Y5XA 3O8XC 5TQ0L 4L1HA 5EWIL 5CINL 1AI1L 3WHXA 1QD0A 3LQZA 2ZCHL 2P8PA 2YRPA 1JK8B 1CIUA 4K3EH 2P44B 1FVDA 2EDHA 2G75A 3L1OH 1QQDA 5FGCB 3UAJD 1MCPL 2R1XA 3CVHA 3LKSA 3O3AB 3T8XA 2ZNWA 2IANA 1IE5A 5K59F 4IRSC 4MQ7B 3K8MA 1JJUA 3VRJA 3ZE0F 2K9UA 4Z7NE 3BJ91 3MRIB 4WHDA 4XC1L 3VG9B 4S0SD 1KNOA 1NJ9B 2GHWB 5D1QD 5L2KA 2X4SA 3LV3A 4EI5B 1FFNA 1OAZL 4HKXA 4CW1A 3X13B 1DBML 4PD4J 1C5BH 3GNML 1KTRL 5T5FL 1H3WM 2YR3A 1BP3B 1RURL 4WHYH 2AQ2A 1ZE3C 3MBED 4R7NB 4HX1B 3FOMA 4M7LL 3FB5A 3QEQA 1OAQH 1OGAD 2XZZA 3RU8L 1KCSH 4WFGD 1LDPH 1F42A 3GMNA 2FL5B 4NSKB 3MRMB 4P3CL 3U9PL 4X4MA 5DEZA 1KIPB 2DYPB 5D7IF 5J3HC 3HI6L 5BV7L 1FYTB 1CLZL 2NXYD 1YEGH 4K3HA 1CGSH 1G1YA 2BY3A 3EDJA 3VFGH 4P46C 5EUKA 1OPGL 3SE8H 2HFGL 4XPGH 5C0JB 3D18A 5BO1H 4O5LL 4MXWH 1H5BA 2W9EL 3ARFB 4NQXA 2W9DL 5F97E 3ARTA 3OKEB 1E4XH 1Q9OB 2CJUL 3T0EA 4YUEH 1JNHB 4GMSH 1W0VB 5IB2A 2PR4H 4D9LL 2GJZB 1NFDE 2WBKA 3U36A 3NCJH 4GUPB 4JVPA 4TULL 3KVQA 2Q86A 1CD1B 2JCCE 1IAIL 1L9MA 3QIBA 4E5XA 4PJFB 5EIIB 1KPUA 2BY1A 3L5WA 4HT1H 5L0QC 3ALWA 3ARGD 2NY2C 1ZSDB 2ATPB 1AXSA 4LLVA 1JRHL 4HBQA 2VLKA 4HC1A 1HHJA 3KPTA 5CJOL 4JO1L 4WHYG 4PJBE 5GQBA 4P9HL 3WD5H 3IDJA 3NCMA 1S3KH 3D39B 5KVDH 3CVIL 1EGJA 3QUML 4JDVB 2GTZA 1RAMA 4JN1H 3LRHA 5DUMH 2C26A 1FFPA 3N1MC 4Y1AB 2UZXB 1J7VR 4JM2B 3V79C 2HRPH 1T7VA 1RK1B 2QQNH 1EO8L 4WFEE 3N1FC 1RHHB 4LLMB 3HNSL 1K6QH 1EHNA 3DVFA 5CBEB 4ZUSA 2H32B 2FWOB 5GSVB 3QUYC 3TCLA 4ZFFA 4YBQD 3S8WA 3NBNA 1BMGA 1JUFA 3V6ZB 1R3JA 1A6WH 4MJ5A 4WNQB 4HCRL 4X9IA 3AS0A 1NDMB 4GAGL 4GW4A 1T7YA 1VA9A 3WIFB 4AL8H 4K94C 4K94L 4HPYL 1D6EA 5EUOA 1A1NA 3R06B 5JIHA 3U48A 1CU4H 1W72B 4KXZI 4OIAA 4PJHB 4AK1A 2A6IA 1IGFH 5D9SB 4R97C 3IDNB 4OFKA 2JJTC 2M8XA 2FEEL 5LGKA 1IM9D 1MJ7H 3ROLB 3IDXH 1XZ0A 3VCLB 1G6RL 3HI5L 3DHMA 5HHMB 2YA0A 3OV6A 4O2CB 3S5LB 5DI8B 1VEOA 4JPIB 2GIYA 4PYGA 1CLYH 4N8PA 3VI4E 3AMLA 3SDAA 4YBHA 1UKSA 1EK3A 4QRTB 2Y06L 1MHPH 3VXMA 5C3TA 2UV3A 3WLWD 2R4RL 1I1RA 4HKBB 4HG4K 3BUYB 3BP4A 3MRJB 4JHAH 5A3ID 4RGOH 3SGKC 1CIDA 2HT4C 2JJVA 3DO7B 1EXUA 5EC1A 2E9BA 4MJ6A 4R90L 2RQ8A 5HBBA 5CHNA 4PRAA 5ESQA 2FLRT 4PJGE 4MLIA 5HHXH 2NY1D 1DLHB 3SO3C 4ZOCA 1LD9B 4DZBB 3PQYD 2Y36L 1JPGA 4R4BA 5ACZA 2CKNA 3Q0HA 1TNMA 4QNPE 1YUHA 5C0BE 2YUZA 2GAZB 4Z77B 5L8JB 3MRLA 5HGDB 3PGCB 3GSNB 5MP6L 3ILPA 5FOJA 2XN9E 1CD0A 3MNZA 3QDMB 5EORL 1U8LA 3L3KA 1HKFA 4JJ5B 4NQDA 1MLBA 3B9DA 4JY4A 4MNGE 4YJZL 5I19H 4NRZB 4JFOA 5FO7A 2BRQA 1SY6A 2ENYA 1ND0A 3IGAA 3P4MB 5D72H 4AJ0A 3G6JB 1CFTA 3GFUA 4PRPB 2OBGA 5BZWA 4UQ2A 1P1ZB 1JF6A 1KGCD 2A77L 1Y18B 2P42B 1YPZE 4HUMB 4ONFH 2LVEA 3QJHA 1TLKA 2X4QB 3VGAC 1S7VA 4LSTL 2XKNB 4J7RA 3RVXC 4X8JB 5H2BB 4QRUB 1PG7L 3CDGB 3P4NB 2FECL 2FD6H 3O41B 4PPTA 5AUMB 4RRPA 1DQJB 1OP5K 1PZUB 3LD8C 4ONHA 5F7FA 4HPOH 2HT2C 3P4OA 3S96A 1U2CA 3V6OE 4P4RB 2X89D 5K33A 2XWTB 4WRLA 2VE6A 3TH2T 4ZUVA 4PREB 3IDUA 5CJQH 3TNNA 1MCOL 2HKFL 3OZ9L 2W59A 3C5ZD 3QJFA 3BKYL 3O2DL 4LVOC 4WI6A 3OKYA 1HK6A 3QCUH 4OT1L 4KKBD 4DGVL 3LPWA 4LHQB 5B21A 1QOKA 5TF1H 2NY4B 4LVNC 1R5VA 4PRNB 3ARBC 1B88A 3GMMB 4KDTC 4L8BB 1MI5D 4WFGE 4HWBA 5KSAB 5SWQA 1Q1JL 4OAWB 2F54D 4XC3H 4X4YA 4GRMB 2KZWA 3BZFB 5EBLB 2I26N 2OSLB 4M7KH 4OZFA 2E7HA 1T2QL 2W0FA 1RZIA 5EO0B 3PHQA 1MUJA 2OK0L 5FF6B 4GG6F 4WHTA 1HZHH 2VDNH 5IVNA 2AJVL 5MEPA 3W5MA 4J2XA 4X7CC 1AGFB 1PG7X 2FHBA 4X0KA 1DVFD 2Z8VC 4U3HA 3MQIA 1KJ3L 1F8TL 1I8IB 3A67L 4NQCB 1K85A 5E56A 5HVHB 2FR4A 2XV6B 3V5KA 1I8KB 1XGTB 1BGXH 3KPRD 3RPIB 2A38A 1QEWA 2ICCA 2CRMA 4LRIA 4FHBD 4P48A 4LK4A 5AYUL 3VXOA 2NY0B 1Q0XH 5ISZA 2J4WH 1E6JH 1N2RA 3ZTNL 2YZ8A 4KHTH 3EJYD 5E2VH 3R1GH 3BEVA 1XGPA 3RZCC 4YDVB 3TM6A 1HH6A 1JGLL 5K9JL 1NCTA 5F9AC 3PWUB 3KS0J 3QI9B 4ZSOB 3HR5A 5ID1B 2CK0L 5TH2A 1I7RB 1UWGH 3BQUD 3NFPB 4XVSH 3THML 2IMNA 4QT5B 1FGVH 5DYOA 4ELMB 1E4WL 3B5HA 3TO4A 1NGYA 3B6SA 4HH9B 3UZVB 5JLZB 3KWWB 3MGTB 2X4RA 4OIBA 1FL5B 4AQOA 1CD8A 3JV0A 2G9HA 2AVGA 3D0VB 2PXYC 5T1KB 5F7UA 1QZ1A 4JO3L 3PL6B 3I6LD 3L3GA 4UTBL 5AZ2L 4OTXL 5DJ6B 1FYHB 2FO4A 2BNUA 3MNWB 4I0PB 2IC2A 4JDZA 2EKSA 1GGIH 4H1LB 3WLBB 2ZCLL 1B90A 2QHRL 5JQHC 1G7PA 1XGRB 3HE6B 5I1CL 1I8LC 3ULVF 5DK2B 2OM5A 5IKCA 1L6XA 2ZSWB 2R9HD 5DLMH 1NGXB 3HNTH 4JPKL 2FRGP 2APTA 1PKOA 3EYOB 2YSSA 3IFOB 4U6VH 4Y4HD 5TE4L 1YYMH 2CKBL 1OSZA 3QHZH 4S2SA 5GS2D 2VO5A 2EEBA 3O11B 3S6CA 5IV2B 4D8PA 1Z3GH 2OL3H 4U6TA 5C0NC 4DKEH 3MRFA 2KH2B 1VEPA 4J1UB 1MEXL 3TFKD 1OAKL 1ROWA 3IVKB 4R4FL 1CICD 1LO0H 3HZKB 3IRZA 1RZ7H 1J87A 4TUJB 2E3VA 1M71A 3D1MC 1AR1C 3E6HB 4YHYC 1TZGH 5BVPL 1GOGA 1I85A 5D2LA 3ARWA 3T1WA 3UAJC 4IM8A 1RSFA 5I1DA 3QWQB 5DD6A 2KPNA 1RZ8B 3X17A 3MOBL 2HMID 3WO4C 4X4XA 2V7NB 1XCQB 3JTTA 5CCKH 3RVUD 5HJ3A 2HJLB 2CLZB 4L4JA 5HHVH 5IMKA 5C0IA 5F9OL 4HS6B 4PRDB 2AGJH 1C08B 4JEGB 1IQDA 4NZDA 4BQ6A 3OAUL 1NCCL 1KJ2L 2EIDA 5I1JH 5DJXB 4XPTL 2VLJB 2WWKT 3A6BH 1UGNA 3QFJA 1MHHB 5FGSA 5E1HB 3O2WL 2AEQH 3L7EA 1UACL 3FQNB 4YGVA 2F53B 5JA8B 2BXZA 4FTVE 1DZBA 2R2EA 3TV3H 1HWHB 3TH4T 2P24B 3ZMRA 2ZPKL 1FNGB 3S5LG 2N56A 3I9GH 4XBPA 4X7DC 4GFTB 3O3UN 3QRFM 4DFIA 3UTTB 1DLFH 5GRZA 2ARJB 1U8KA 2ZKHH 4P2RD 5I8EA 3HMXH 3VXRA 1RZFL 3VWKA 4WDIB 2PYEB 1KGCE 5DMIL 4WGVB 3H9SA 2W60A 3RWIB 4JO2H 1WQVT 2H6PB 5HHNB 4BZ2L 3HLAA 4TUOB 1IKNC 1JZ2A 3VE0A 3DETC 1ERNA 2HYMA 5D1XA 4TSAH 1LEKA 1NKRA 4PJ7B 1JTOA 3D25A 4A6YH 4WWKA 4Z7UA 2CIKB 1EUUA 4P23D 4QRPD 4NN7B 1T0MA 5L2JA 3WSQL 3IU3A 4EXPX 5GZOD 4KKNA 1HHHA 4PY8I 3WNNA 3IU4H 2CMRL 5CZVH 1XIWD 2FJGA 3HHRB 5ITFA 4MHHI 1GAFH 5I8OL 3MLZH 5I6XB 4KI5C 3FFCA 4D9QD 3CGTA 4NZRL 3EFFA 2F5AL 3OR7A 4HH8A 3V5HA 4B7LA 3OKLB 2LABA 1VACA 3IFNH 1CXKA 2V17L 3O6FC 1MI5E 4MAUL 1M05A 5D7SH 4GBXB 2F54E 4YHPB 1MSPA 1MVUA 1UEMA 1SBBA 2VDOH 4YAQB 3ZKSD 4MA3A 2HLAA 2EYSA 2A83B 4ODXB 4RMVA 1AD9B 4JFFA 4XCCH 5ADPH 4WV1B 4ODTH 4Z7WE 4EDXA 3UP1A 5BJTB 1Z2KA 4PTTB 3DVGB 5IMLB 3RI5K 4JRYB 5CIPH 4JHWL 4S1QL 2GEEA 3BO8B 5IB3B 2WBJA 2B0SH 3RGVD 4YEEA 1N64H 1G9NH 2VQUA 3KPRE 1B4RA 3GMOB 4HDIA 3TGXA 1OP9A 1XF3B 1KACB 3MYJA 3RTQC 4HD9A 1NC2A 3PP4H 4ZXBD 3MLWH 3MRDA 3ETBF 1Q8MA 2J1KA 4CADB 1MELA 2ENSA 3MTRA 1S9VB 4X83A 3QEUB 3BRGC 1KENH 4LQFL 2W9LA 3C08H 5IG7A 1ZS8B 2IPKA 2EYTB 3I3BA 3WFCL 4NFCA 1EMTH 5F3BA 1QSED 3PF2A 1I9IH 2YBRA 4S1RH 3EDKA 2UWEA 4JFEA 3MXVH 1JWMB 1NCNA 3T3MF 3VFPA 3O45A 2VZUA 4LKXA 1NAMA 3RKPA 2C4FU 3NA9L 2DJ4A 4WUKL 4OCWH 4OLYH 3HI1B 3S98A 2XRAL 2H3NA 3L5XH 2VR9A 2R8SL 4GXVH 4GMTH 5KN5A 2XFXB 5CUSH 4PBVC 3SE4C 3UPAA 4E0RA 4MJID 2IAMA 4BSWB 5JIIA 1JNLH 1M7DA 1NGWA 2C1OA 2HG5A 5E03A 1WEJL 3ABZA 1VKXB 2IALA 3I6LE 1SMAA 2GT9A 1SEBB 1AHWB 4YDLC 3ZTJG 2WNGA 1G9NC 3H7BA 1IZKA 3LS5H 5DVOA 3NAAH 2NY5L 5C09B 2B8OT 2OR9L 4XAWL 3FQTB 2ZUVA 4I48B 5DRWB 3MRHA 3RP1A 3NZHL 4OFYD 1I1AC 4LCUA 2YD8A 3G5YA 2E9IA 2QADD 1GGCL 1ZT1B 2AK4A 1ZT4A 3WFBH 5GGRY 1KN2L 4OD1L 1FBIH 1GSMA 4XNZB 1LNUA 4WW2A 1IMHC 1J10A 1MCFA 2OI9B 3ZYOA 4HWZA 3G5ZA 5CP7A 1EA9C 1N6QL 5DFVD 4NO0D 3UEZA 5E8PB 1V7ML 3BPLC 2X05A 2P5EE 4M6NH 5IROC 5JOFA 3U7WL 1N5YH 4UTAL 2YA2A 3BKML 4PGEB 1P7QA 1FE8L 1QNZH 3EOTH 2CGRH 5SWSD 4M1GH 3C9NB 1I7UB 4N0UA 2GKIA 1WFNA 1HHGA 1T04A 4UZGA 1QPPA 5AWNH 3VRLE 5CEZH 1ZVSA 3MLVL 3P0YL 4J23A 2D3VA 1TJGH 3VD9A 2VLRD 4O51B 4CN6A 1N59A 4OZHF 4RAUB 4H1LG 2EXYC 3OAZK 5JPMA 2QSCH 4FNLH 1RIVH 3ZO0A 5M95B 4UDTA 5IW6A 4NP4H 3DV6B 1BVKA 4AG4H 1A7BA 5TDOB 3RDTB 3L3IA 1X5YA 2ZNXA 4PJCE 3T4AB 3LMJH 4GKZB 1JPST 3TPUB 5E6ID 3PWNB 4EBQL 3UBXB 1AGDA 4P5KB 1QBAA 2O26U 1JRHI 3C5ZC 4OM0H 3VFMB 2MWCA 1KB9J 5DQDH 5E4EC 3VXTA 5K9OA 3BXNB 5HYFA 1J1PH 4I8DA 5E5RB 5HHQA 4L8CB 4LCWD 3JWDH 3QNXB 2WP3O 4G8GA 4XMPL 3B9KA 2D0FA 1AQDB 4GSDH 3MV8E 4RQQB 1A6UH 1YMHB 4EN3B 4R2GD 5GS1A 4TNWK 1G0YR 1FCCA 4P2RE 3MJ9L 4LARL 1F4HA 4Y4FD 5ADOL 2P5WD 2HTKD 2EE3A 3BISA 4KROB 3ROOA 3WN5C 3KLAB 4M8QB 3EO9L 5CGYD 3Q2CA 5KVGH 1KIQB 1E4XI 4MAYB 1YQVH 3UTSA 3W11C 3UTPD 3L6FA 2YMXL 1I7ZA 4HWEL 3O6MH 4KRPB 5D7IA 3VXUB 2BSTB 3WE6A 4QRPE 1ES0A 3QA3B 4IMLB 3V0VB 4UT7L 4N9GB 5J12B 4UINL 2VDQH 3D85B 3W0WA 4Y16D 4BSJA 3ZYJA 3O6LL 4DZ8A 5FM4A 4H25A 5DWUL 3IRPX 5I75B 2VUYA 1IFHH 3MJGX 4G6JL 4OZIF 4UDUA 4D9QE 3DBXB 5F7DB 2X4NA 3OKKB 4HGWA 3EGSB 3F8UB 1KELL 1I4FB 3WIIL 4FFWD 2R2HA 2QQLL 1MPAL 3REWB 5DC4B 5E00A 2EIZA 1FLRL 3SJVB 4FXGB 5FIEA 3TVMD 2PTTA 4IIQC 3EO0B 3MRPB 3QQ4B 4MA8L 3CFBB 5DK0B 3QR2A 2FH8A 3P9MA 4HS8L 4X6FB 4ZD3H 5GGRA 1NH6A 4Q9QH 1LO5A 3OXRA 1HEZB 4U1MA 1UENA 4YHLH 2D0HA 1IEBA 3BDYH 3TO2A 3JWOL 4YR6B 4QHNA 5T1LB 1HHKB 4X6DF 2AJUH 5HI4C 4OZGE 1CXIA 1LQSR 2G2RA 4JAMA 1IGIH 1MFCL 2FBJL 1INEL 1BVLB 2RFXB 4NN6B 5DEFA 2VXUH 1XGUA 4Z8FL 1WT5C 3OWEA 1IQWL 5JW4M 4JZOA 1JCKA 3NACL 1XGQB 3DMMA 2GITB 1OM3L 5FOBA 2EC9T 2XZQH 4APQB 5E1AB 2BVPA 1UM5L 3S97C 4ZG1A 5IB5B 3FT2A 1T89A 4MD0B 5GJSL 2IJ0C 1NGPH 3D0LA 4ODVH 1YEHL 4RFOH 1J05B 3QDGD 4HQQL 2W0LA 4Y2DC 3O9WD 1V3JA 1F6FB 2UUDH 4HIXL 4PLOB 5GGSY 1F97A 1DL7H 3CAFA 3MODH 1IM3B 5C9KA 4YE4H 2LU4A 3DI3B 5J6GB 4LDEB 3O4LD 4KZEH 5E8DL 4OLUH 4M7ZC 2NY3C 1R3HA 1G7QB 2JKXA 1KB5H 3BH8A 3CK0H 1HILB 5E9DA 2Q7YA 3FRPG 5CD5D 3MRKA 4XHQA 4XNMA 3RWJB 1JE6A 2JB6A 4MJIE 5C9JA 1KEML 1CT8A 5ESAA 1HSBB 5E99H 4U7KA 5MENB 2ZOKA 3BMVA 1PJ9A 4XNQB 5IFAL 3BP6A 2Z9TA 1QHPA 2HVJA 4ZAKA 3VU2A 1CBVH 2G5BA 3DSFL 3GSVA 4GKNA 1FN4B 3QDAA 4G43A 1MCEA 5DR5L 4ZDHA 1I7TB 1NFIB 2ZUTA 5C0GA 2I9TB 5D70L 3OG6B 2BK8A 1V05A 1CL7H 1JI2A 4WW1B 3L3DB 4IHOA 5DJ0A 3QUXD 2FJFB 3NN8B 4M3JA 1ORSA 2ERJC 1RZGB 3RUGE 2BC4B 1DFBL 3K0WA 3MRCB 1F58H 1IGMH 3ARDA 1UWXH 3AROA 4FZEL 2BVTA 1JTTA 1G7MA 1QQDB 2Z93B 3QXDB 2R1XB 2OS7A 2Y5EA 1MCKA 3TT3L 1DBBL 3MOQA 2N7AA 5EOTB 4ZPVA 3SDDA 1YEIL 1QFUH 3CX5K 4QLRA 3CC5A 2KDGA 5EC2B 5BOPA 2DYPD 2JELL 1FC2D 1NFDF 3N50A 1N3NB 2WUBH 4M9PA 3NIFF 2M2DA 2V2XB 4PY7A 1A3QA 5L2KB 1YMMD 3LV3B 5ID0A 2NR6D 1FFNB 4HKXB 1H3PL 3RX7A 5FM5M 3PDDA 1J0YA 1F90L 1IKFL 3RWHB 4NKQB 1V3KA 1R3IH 3LKQA 5KS9B 3GSOB 5I30H 1A3LL 1QACA 3OGOE 3QG6A 1RJZA 1W0YT 1KBGL 3LKRA 4DGYH 1PLGH 4JFXA 5FKAB 1ODAA 2MKWA 1YEEH 3FOMB 3U6RB 4L9LA 4NUJA 3QEQB 4WI5A 3UX9B 2YKLH 1FO0A 4WI2A 3BSZL 3GMNB 25C8H 3DUUA 4P2OA 5DMGC 4HUNB 2X4PB 2B39A 4F7TB 2VDKH 2DBJA 4H8WC 4H8WL 5EUKB 3VFVA 1A02N 4UNTA 4Y5VC 3DROB 4LCWE 3U9UA 2NNAB 3FB7B 4U1GC 4I2XA 1H5BB 4FABL 3ULUD 4NQXB 5D2NC 2GJJA 4JKLA 1GOHA 4I13B 2IFGA 5IB2B 4WU5A 4OIIH 3P4LA 4XH2A 2P5WE 2R29L 5D7JB 5GGSA 4Y1AD 5GZNC 2F8XC 4JM2D 1LK3H 1PGRB 4KAQL 5IHUH 4P4KB 3BGFB 5HI3D 4KUZH 3QIBB 1IILE 4E5XB 3EW3B 1DANU 4PLKC 1KPUB 1MWAB 3B2UC 3L5WB 5HYJA 3N9GH 2BY0A 2DWEA 3UTPE 2VZSA 1AXSB 2R56H 4LLVB 4XNXH 3UJTL 4HBCH 2VLKB 3X14B 3OJ2C 3MROA 4BA8A 1W0WA 1G9EA 3CSBA 5DD3H 4GG6A 1UXWA 5BW7A 2MQCA 4Y4KC 5JXAH 4O4YH 3IDJB 1NBZB 1U8JB 1A0QH 1DQLH 3UBXG 3VI4F 2X7LB 1EH9A 5SWZA 2PO6D 3AS1A 3W9DA 1P6AB 2JLLA 1DQML 4PG2C 5IIEB 4NGHH 1FLTX 1QVOA 4JY6B 1GGTA 5ILTL 1MF2H 2DQCH 3EAKA 2DQDL 4ZUSB 3S34H 1Q9LA 1QLEL 5HHMD 4ZFFB 1MAKA 1U91B 4JVWA 3RWFA 2X1OA 2X4UA 2VLLA 5E2WL 12E8H 4PJGF 3C60A 5KAQF 3FONA 2V6HA 1J8HA 4M43L 1X4XA 2FZ3B 5EUOB 4YXKH 1A1NB 4X5WA 4JFYA 2W91A 3MGAA 2A6IB 4U6HA 3SCMB 5KVEL 4QNPF 1JHKH 3DHJA 4WIQA 2AS5M 5HHOE 2P43B 4OQTH 5F9WB 5EBGA 2BHUA 2HKHL 4P57A 1MFAL 2QHLA 4YO0B 1X5LA 2Y72A 4RGNB 3TIEB 2I5YH 1U8HB 3D48R 3Q6GH 4XGZA 3E8UH 3WKNA 3CIQA 1JN6A 3VXMB 1NMBH 4IOIB 3ET9F 5EBWA 5T3XD 3BP4B 2FB4H 4L3AA 4MX7A 5GRUL 3WJJC 1TJIH 3QDMD 3O4LE 5HDBE 4FFYL 4KMTL 5DJAB 3U82B 1C5BL 5EC1B 5EN2A 5FO9A 1EO5A 3KAAA 5KSUA 1MRDL 3GIVA 2YHGA 3NMEA 1MJ8L 2HN7A 4PRAB 4PTUB 2PF6A 4PJIF 1OAQL 4PJ9C 5HGHA 1KCSL 2R0LL 3F5WB 1JPGB 4R4BB 3GMQA 2R0WL 3JWNC 3HE7B 5EO9B 5FGCE 5HYEA 2E8YA 3FQRB 4Z6AT 2YWYA 3KJ6H 1CGSL 2L7JA 3MRLB 3VFGL 2AQ3A 4O9HL 1F3JB 4KU1A 3ILPB 4FOMA 5HVWA 3GM0A 1U8LB 4NQDB 4XCYA 1MLBB 2NTFB 5JDJA 2R1YA 2NZ9D 2E6JA 1RUQH 3VGHA 1ND0B 3IGAB 1EX0A 4GMSL 1ZHLB 2PR4L 1T20A 1CE1L 1CFTB 3NCJL 1UJ3A 4JN2A 5BZWB 1WWWX 3V0AC 2NXZB 4HULB 1AXTH 1YECH 4UUJA 1Z9SA 4FQ1L 2XY2A 3CVHH 1BZ9A 2YD5A 1WZMA 1LE5B 3QJHB 3STZA 3HPJB 3QWOA 2BNRA 1S7VB 2NY4D 3ZKXB 1U8NA 1AKJA 3RIFK 5L88H 2DQEL 1OQXA 3MV7B 4R2GC 3IJHA 2J8UF 1T21A 2R2CA 4IRZL 3S96B 3AY4C 1HE7A 1YMME 2AXFA 4MMZC 2VE6B 2YPLA 4Q0XH 5CGYC 3EOBB 2Y6SC 2VXQL 1K5NB 3B2VH 1T3FB 3QJFB 3GSXB 5CSZA 2D31A 1NGZA 4KI5F 4WI8A 1BREA 4XP4H 5F89A 1L0XA 4NQCD 3GBNL 4M6AA 1P7KB 2F8OA 1MHEB 2IMMA 3J8F7 1DEDA 1R5VB 4Z7OE 3BPOC 4ZTPL 3QQ3B 1T1ZA 3RAJL 5FYJH 3T65B 4F7MA 4ZS7L 1KLGA 2UY7A 1J1OL 4Y16C 2BJML 3T04D 2IH3A 3QFDA 4B50A 4PJFE 4LCIL 1CFVL 3BH9A 2HLFD 2W0FB 1WWAX 4ODHL 1CU4L 2ZUWA 1NUFA 3PHQB 1MUJB 3BPNB 2LTQB 5EB9A 5KVMC 2XA8H 3O81A 2AJXH 4PP2A 1ETZB 3UPRB 3QI9D 5FECA 5KSBB 5C6WH 2APVA 2X9XA 4WI3A 3ULUE 4YXLL 3D39E 4KJWD 4QTHA 1EHXA 4TVPH 3CFJA 2W0PA 3PIQA 4K3JH 1YY8A 4Y1AE 5C0RL 3HPLA 4DUVA 1S9WB 1X5IA 4ACPA 2LVCA 1N2RB 5DHVB 5T1KD 3LKNA 1E4KC 4OLWH 4NJ9H 1XGPB 2O61A 3PL6D 4RGOL 1TTFA 1IGCL 3OJDA 5E5MA 3S88H 5KVFL 4I3RL 2YD4A 4UAOC 2BVQB 1E6OH 2ESVA 5ACMA 5FA4A 2EDOA 1MFDH 1EGJH 2ORBH 3GMLA 1G7JA 4ODBD 5TH2B 4N8CH 1X5HA 4I0CC 1HHIB 1ACYL 1D9KA 2F15A 4YQXH 4OGAD 5IFJB 4KZDH 3KHQA 1MIEL 1T83C 4PJHE 5JQ6L 1AD0A 2D4DA 1ZMYA 1NGYB 3B6SB 5F21B 5J89A 4DEPC 1UCBH 1B9ZA 2X4RB 2P7TB 1Z6JT 1VFOA 2XG5A 5HPMA 3ISWA 1FNAA 1XCTB 4U7SA 5B8CC 1X3DA 5HHME 3L3GB 2IGFH 5D1ZB 1F2XK 4EQ3A 1RUMH 2FO4B 4ESKA 3QPXL 2BNUB 4N0FA 4MSWB 4NHCL 4U49A 4XP6H 2HTLC 5DC9B 4JDZB 4M7LT 2Y23A 5GS0H 1PQZB 3QHTC 4LCCB 1G7PB 1PVHA 2J5LB 4H88H 2CLVB 5DUBB 1EV2E 5JPNA 5ACLA 5IKCB 1ZA6A 4XWOD 5JORA 2IADB 2YSSB 1YEKH 3MCKA 2C9AA 4XPFH 3VXNB 3SEPA 1YN7A 1WWBX 15C8L 3LRGA 4FXLA 1MCBA 1CLOL 3AREB 2J6EH 2R23B 3CFCH 4X5XA 4AEHH 2PYFB 4OSUH 2AXGB 1LK2B 3K4ZA 4K71B 5LXGL 2BZDA 4PJAB 4ALAH 1OY3B 4EI5C 1X7QA 2EIBA 5DGQA 2VLJD 1K3IA 4NO3A 1YDPA 5T3XE 4FQCH 3B43A 3K2UH 3QDME 3T77A 5TDPA 3MV9A 1BD2A 5DQ9A 4RMRA 4KY1H 3DI2B 4DN4H 3O8XA 5CJ8A 5DD6B 1XF1A 5J56B 2ADJA 2CUMA 2ED7A 5C07A 2VQTA 3G6JE 4PRPE 1BJ1J 5HJ3B 3QXVA 3SKNA 3IAQA 4HKJB 4NCC1 5IMKB 3ARQA 5C0IB 3BAEH 4UQ3A 3I6GA 1MCHA 2PYED 4G9FD 5K9QG 2DICA 3OSKA 2NR6C 1KTDB 5B39A 2OQJB 1B0RA 3IJSA 3RL1B 3EKCA 1RPQA 3EZJB 4U3XA 4J8RA 5GGVH 3UPCA 3TT1H 3T2NL 1UXSB 2APWA 3ARFC 4RZCA 4CBPA 1D7FA 4ENED 3RHWK 2R2EB 1A22B 3JSSA 3BKJH 1A9BA 4ZS6D 3DGGB 5GHWH 3I3DA 4MB5A 3WBDA 5FHAL 4Z7VB 4CU6A 1U8IA 3SDCB 4QXGL 3CU7A 1MIML 4XCFL 2NW3A 1QRNA 4U1HA 1NBYA 5EOCJ 1UADC 1U8KB 3BIBX 4OZHA 5I8EB 3VWKB 3RI5F 1HQRA 3EOYG 1GIGH 1N0XL 4KHTL 4NZTH 5ICXA 3FT4B 5D71H 4DQOH 1ZANL 3HG1D 4X8XA 1C5DA 3VE0B 2V7HB 3KLHC 5DQJA 5D1XB 4Z5RA 3ULUC 3ULUL 1T6VN 5TE6H 5CJXC 4GBXD 4POUB 1ZLVK 4G6MH 4EI6A 1JZ5A 3NZ8A 4XXDA 4KKLD 1FV1B 2DDQH 4M1CC 4LEXL 4P46A 4XPHH 4XVSL 2OJZH 3IDIA 3MXWL 4XNUH 4DJMA 1T0MB 3IU3B 3C6SB 5C0CD 1IRAY 1XR9A 5HI3C 3ARVA 2EH8L 3MNVB 3QHFH 3JUYA 4OCSH 3EJZC 4WENB 2AI0L 4F9PC 2WW8A 2FJGB 4JRYD 1E28A 4EJ1C 4FG6C 1ZGLA 3G6DH 4YX2L 4NQCE 5IR1A 1N8ZA 1VENA 1TIUA 5AD0A 2RB8A 3V5HB 1VACB 3VFTA 4LSQH 4OZFH 4GS7B 3V6FA 1OARL 3CFKB 4ZUTA 5GSRB 1KCVH 3E0GA 5HDOA 1W72L 3JV6A 5GGTA 3V4PL 5H37G 1WAAE 4RDQF 3WKMH 3VD7A 3ZHDA 5EOQH 1OAXL 4PJ5B 5DLML 2KUTA 3HNTL 5TE7L 1KCLA 1RFDL 5GISH 4ZSOE 1FSKC 4JFDD 2Q8BL 5F7EL 1HN1A 4HMCA 3DXAA 3PNWB 2WBJB 3CCHA 4RRPG 5MERA 3ARYA 3OX8B 1HDMA 3ZDXF 4OZIA 4KDVA 1A7PH 4ELME 1S9XB 2IPTH 1P84J 4HDIB 4LSSL 1X6NA 2VERN 3MYJB 3T1FA 1Q72L 2Y5TA 2HFEA 2ZUXA 1PKQA 4JB9H 1I75A 3U4BH 1JPTL 3QUYA 3H2WA 4HXBL 3KYOA 2VDPH 5IG7B 2IPKB 4NRXB 3E1F1 4OF0A 1BQLH 1I9JH 1MY5A 5F3BB 3DV4A 4HHAB 2YBRB 1TZGL 4P9MH 5IW1B 2JIXD 1AGBA 5ITBH 2XZCH 1JZ3A 1FL6B 4X6DA 4X9HA 3VFPB 1KIRA 3IB4A 4LKXB 3HC0A 1NAMB 3KXFA 4U1NA 4NKDA 4IS6B 5FYLE 4UIMA 5DJYA 4G80A 1QSFA 3TZVD 3UJIH 1X9QA 3T2QA 4C56A 3PGDA 5KN5B 5DFTA 3AAZA 4E0RB 3BT2L 1IAKA 5T3XL 5IP4A 1M7DB 1NGWB 3GSNL 5DVNA 4R7DA 4YXHL 3A6BL 4R9HA 4CKVX 4YDJA 5MI0B 3VRLF 2JCCB 4MVBC 4RCAA 2LQRA 2DKMA 3FB8A 3SGDI 2MHAA 5FYKH 1I8MA 2ITDA 1S8DA 3U0WL 5JW3H 4OF8A 3T08A 1VERA 4TPRH 3MLRH 5JA9A 3FQWB 3SGKA 3MJ8A 2FCBA 3FT3A 5ICYB 4HEME 4LCUB 3S35H 1T80A 3HS0B 1YNLH 4ZFGL 1ZT4B 1CGXA 3A6CH 4KQ4H 4R96B 1JZ8A 2O5YH 4YC2B 3EYQC 3EZ8A 1SYSB 3D2UD 3C6LC 2GJ6D 2C1PA 1NANH 4XCNA 1W2KT 1K4DB 3MCLH 1BQUA 2GFBA 3INUL 4OGZA 5DFWH 4PS4H 2W38A 2BMKA 4PR5A 4TSAL 5KZCB 5JUEH 5C7XH 1BM3L 4WI9A 1TZHB 1P7QB 1T66D 1I9RH 2OP4H 3GSWA 2VLJE 1RZKH 2X70A 4E42A 4IOSD 4HLZH 1HCFX 1HHGB 2R2BA 2A1WH 4MYWB 3RWEA 1LMKA 5FUCC 4Y8DC 5ETUA 1GAFL 1TCRA 1U42A 3KNBB 4LNRA 4G3YH 1FGNL 4PJDF 3VG0H 1QR4A 1PEWA 3T09A 1JNNL 3Q1SL 4O58L 1HKLL 5KSAC 4MCYA 4EN3D 1JWSA 4GRLB 2COQA 1BVKB 3WMSA 2PYEE 3RVTD 4UU9A 4G9FE 4KROD 3WUWA 1IJ9A 2FX7L 5AG9A 1AC0A 1JV5B 1YJDC 1YJDL 1Y0LA 2AJYL 4OCRH 4LSRH 1KTLA 3WFHA 2XXCB 1OSPL 4DVBA 1S7TB 3U7YL 3LRSA 2WIIB 3V7MA 2B2XH 1MCQA 5I1AB 4KRPD 5IJVB 1NFDA 5CZXD 5HVHC 1NCBH 2OTUA 3NPSB 1QA9A 5HDQH 3AXLB 4P2YA 3WIHH 1GPOH 2DOCA 4JG0L 3TH3T 4OKVB 2NY0C 3FO0L 3D85D 1MREH 3RIAF 1EVUA 3R4DA 5KANG 1A7RH 1NFKA 5DDHB 1A47A 3SQOL 1Y6MR 5HGAA 3BD5A 1ADQL 2W92A 4LMQE 3KYNA 3WS3B 3WV0A 3MR9A 2FSEA 1M6OA 3LS4L 3MLWL 3ROOB 4TTDD 3SDYL 3KPPA 2BCKB 3ARBA 3ZSTA 3HG1E 4KDTA 3IAGC 4YDIH 4BUGA 4MWFA 1I9IL 5I8KL 3SQBA 1I7ZB 2F19H 4I1NB 5D7IB 1E27A 5DMYA 1TJHH 2CKBB 4QYOB 4F7PA 1BBDL 1KC5H 4K07A 3OXSA 2YD1A 3CD4A 1UWEH 1ES0B 3DIFB 1OWWA 2X1QA 3R8BB 4HLJA 4MNGB 5C0CE 5B3NA 5JW4N 3ECBA 2EDNA 2EDRA 2WWMD 2C4FT 5JW4R 1NDGB 2CQVA 3L5XL 5CUSL 3GZKA 3TA3D 4JRYE 1MRCH 5BQ7B 4Y2OA 4UDUB 4UIKL 1NPUA 1V3MA 3QXTA 2AEPL 3HRZB 4U1LA 2X4NB 4HGWB 1CXEA 3TN0C 3O3DA 4I0PC 4APQD 3UCRA 2E7MA 3CLFH 5E00B 3HC3L 2PTTB 2XTJC 3HE6C 1EFXA 4Q6YA 4XX1G 5FYLL 1OLLA 5I76A 5GGRB 3RZCA 2CRIA 1VPOH 4OLVH 5DZNA 3MLUL 3OXRB 3MBXH 1IC1A 1IEBB 4HXAL 1T22A 5C6TL 1EEUA 1NC4A 3F7YA 4QHNB 4YPGA 5EFIB 5GJTH 1T1XB 4G8FB 5CMAA 4P59H 2AV7A 2G2RB 4JAMB 5D1QB 2BDNL 4JFDE 4ZOEA 5DEFB 4HUXB 1XGUB 2CK2A 2VWEE 1F4WH 4OJFL 1IBGH 4S1SH 4WEBH 4JZOB 3KDMB 3DMMB 1KPVA 1YQ2A 5F1KC 5FOBB 3KYMA 5DK3A 1OB1A 1FH5L 4QOKD 1NGQL 1LE9B 3FT2B 2PXYA 2AK1L 3MBEB 1RUKL 3WUZA 3QUKA 1OGAB 4PV8B 3BN9C 1BX2B 4ZNEE 5AYQA 4XWOC 2L0DA 4P5MB 4W70A 4IRJD 3EHBD 4PJGA 4ISVB 3UJJH 2NXYB 3QH3B 1A2YA 2H9GA 3FJTA 4HGKC 3DRQA 2FIKB 4CVZA 4JKPH 1JF5A 1A5FH 5IHZB 5IMOA 4JQVC 4G9DB 3ZKMD 1S5IH 1RIVL 3ZE1F 1N6UA 3BH8B 4L9DA 1V3LA 5E9DB 1OAYL 5I18H 3H0TB 4MA1C 4AG4L 4YEFA 4YBLC 2VABA 3KPSA 1CQYA 2XN9A 4K23H 1QFOA 5C9JB 4DAGL 2VITB 1CT8B 4X6CF 3WXWL 4M6OH 3MRNA 2DQHH 1GH7A 1J1XL 4ZAKB 5HVGB 1GC1H 3IETB 2IAND 3ARGB 3GSVB 1J1PL 3U4EA 1UC6A 3NA4A 3JWDL 3GHEL 5FM5O 5C0GB 3QQ9C 1NMAL 1A7QL 2QV2A 1NEZA 4EDWH 5C0FA 4L3EA 4R26L 4IHOB 5L2KD 1UA6L 1GHFL 1B3JA 2DIBA 4TUKL 3IJYA 3VXQA 4MDJA 2VDML 1K8DA 4Q9RL 2GJ6E 3QZWA 2VXSH 3IT8D 4PJIA 3TIDA 3ARDB 3L3OA 2E7CA 3HR6A 2A74B 4WEMB 4F3FA 1K4CA 3GUTA 3GB7B 3VWJC 1DBJL 3QEQD 1KJ2A 4CDHA 5CD3A 1A4JA 4NN7C 1DDHA 2IG2L 3QBTB 5F7NC 3U4AA 4OD3L 1JF1B 4RBPK 1FZJA 5I9QB 3WFZA 4AMKH 4XBGA 1TQBC 2HFFA 1YN6B 1P4LB 2LE9A 5E2UL 4PY7B 4RWYL 3BUTA 4QWWD 1KIUA 2DQGH 1PFCA 5GIRA 4N0YL 5I6XC 1T1YB 1RZJL 5HYSA 4O2EB 1BJ1H 1UVQB 4J12A 3FQUB 1Q9WB 3QDHA 4QHUB 4WUUA 2FATL 3LKQB 5E2JA 1ZLUH 1SHMA 1FNSL 1EERB 3BX7C 1RJZB 1EHAA 2R0ZH 4D0DA 1WF5A 5TDNA 2CLRB 5DD0L 2A6KB 3SOBL 1QLFA 3T0ED 1GVIA 4NUJB 5D7JD 4Z0XA 5EU3A 3HA0A 4TVPD 3MYZA 1F6AA 1H3GA 1IKNA 1HINL 3BZEB 4WV1C 3DUUB 3HB3C 4JO4H 3HNVH 4JFZL 3QIBD 5L6YH 1WTLA 4YHZL 1MAML 3BP5B 1PSKL 3U1SL 5HI5D 2J8UA 3VXUE 3I6KB 4U6YA 5F7LB 4TRPH 4TYUA 4NPYB 2VLKD 3O3EA 5EOCH 2VDRL 4ZTOL 1G7IA 2QKIA 1S5HA 3BE1H 3MACL 2DB8A 3L95A 4PRHA 4ZFOA 4HJ0D 5IB4B 1FRGH 2OR8A 4I2XB 4QF1B 2XT1B 4K7FA 3ZHKA 5JXEC 5F7YC 5IOPA 1OTSD 2JF1A 3D69B 4XH2B 5GGSB 4YNYA 4ODVL 5LG1A 2NY1B 2QR0A 5J0BA 3FN0H 1RULL 3PQYB 3O6FA 1OCWL 1WBYB 3QP3A 1NEUA 1YC8A 3HMXA 2Q3AA 3SJVE 3ZDZE 2VWEC 2HRLA 4M61A 1YY9D 2VMFA 3QB7C 4CMHB 5DJ8A 5I73C 5I1EH 1W0WB 2DI9A 5HVFB 1INDL 3BRDA 1H15A 2FLBT 4XPBH 1UXWB 1Z0MA 3QPQD 3CK0L 5DO2D 4KKAD 4PJXF 4A6YA 1T03H 4FZ8H 4FFZH 1YNTA 5AAMA 1BJMA 5GS0D 2B1AH 2GUOB 3LN5B 3V5DA 4PY8J 4LLYB 1KCRH 3B8SA 4BZ1H 5I16A 1AHWC 4XHJD 1T1WB 5F88A 4O02L 3RTQA 1CFNB 1DUYA 4ETYA 1NKOA 2VC2L 4NBXB 4NO2A 4ZOAA 5C70A 4DVRL 1Q9LB 1LO4H 3VGGA 4RGND 1UZ6E 4TSBL 3Q6FB 4GRWH 3SDAD 1U8QB 1HWGB 1CFSA 3C60B 4H20L 3IDGB 4ERSH 5T1MA 1HI6B 3TBWA 3VXMD 2WLYA 1I1FA 2BRRH 1H3XA 4JFYB 5DT1L 2OI9C 5IVZA 3FCTA 1JPSH 4NC1E 3D9AL 5EZLB 1U3JA 4JZNA 5J7CC 2G5RA 4BFIA 3LQAH 1TFHA 3S36L 5I1LA 3QUZB 5JDSA 1DSFH 5L9DH 5FAAA 1QLRB 2O5ZL 4GXUN 4XP5H 3ZDYF 5H35B 3T0AA 2J8HA 2OYPA 3SKUD 4HUWA 5SX4I 3TPKA 5DRZA 5DTFA 5E2TL 4I5BA 4F57H 5I0ZA 5JHLH 3MFFA 2DKSA 4HF5H 5MENE 1Q9KA 5L8LB 3C5SA 3RVWC 4H26B 1JN6B 3V9FA 3LB6C 3IAPA 1CI5A 5C0EB 1J0KA 3AVEA 1I1AA 4RISL 2YEZA 4NQDD 4KK9D 4Z7WB 5EN2B 4KJPD 2ZOLB 3E2HB 4QTIH 3MJ6A 4LLUB 3GIVB 4ONGH 3RDTC 5A2FA 1DR9A 1DVFB 5J9PB 1ONQA 3CDCA 1P9MC 5BRZA 3ZL4L 4FS0A 5HGHB 3OAYH 3LKPA 4JZJC 4N1EA 4FTVA 5IROA 4NNPL 3Q5TA 5IBLC 3S36X 2VDKL 5TGBA 1A3RL 4G8EB 4NM4H 4EUPB 2IANE 4L8DA 2R1WA 5JR1L 4IEFB 4KXZH 4OLEA 3QEHA 5LGHH 4HV8B 4POZC 4EN3C 2X10A 5IFHH 3HMWL 1BAFL 3QCTL 5I66A 4ZO9A 4OCLC 4EIGB 4JPVL 1JYVA 1IL1A 1MOEA 1ZVHA 5L2KE 4OM1L 1JZ7A 1T20B 4NC0B 1T0NB 1UJ3B 2JK5A 4MAYC 4K8RD 2EDQA 5KS9E 3V95A 3U79A 2IEPA 4BH8A 3KJ4B 1JGEA 5CZXC 3EYUH 3QWOB 2X89A 3QEQE 1U8NB 5LBSH 1SM3L 5JNYA 2DTML 3D3VA 2VN4A 1U2HA 4XRCA 1OTUD 4ZUWA 2I60H 4JY5H 4X4ME 3IJHB 4F58L 5F71A 2Q20A 5I75C 3CUPB 1AQKL 1DBKL 4KJQD 4KPHH 4TTDC 8FABA 1FNHA 2C3VA 2WM0A 3AUVA 4N1HB 4N0RA 5J1AA 5F1OB 3PABA 3CXHJ 1NBVL 4M5ZL 2F54A 1NLBL 4NGHL 4O00A 5CSZB 2D31B 2DM4A 2QQQA 3VD4A 1R24A 3KYKH 4POYA 1RIHH 5F89B 1FO0H 1OHQA 4GG8B 3MLTB 3PWLA 2MFNA 1RJYA 3WN5A 1FAIL 7FABL 4TVPE 5M7QA 1NCDL 1VGKB 4GLRI 4X99A 5ISZD 2A9NL 1J0HA 3LEVL 2IH3B 3QFDB 3OR6B 3BH9B 4XMLH 1KFAH 2H41A 4RX4A 5E08L 3HAEA 2VDLH 3GMPA 3GIZH 2UVEA 2VLKE 2DQUH 3IF1B 4NWUH 2ADIB 3QISA 2FIRT 3ZT6A 5IESH 3OG4B 5FECB 1EJOL 5I71B 4OQTL 3FO9B 4M48L 1O0VA 2V9QA 2BSRA 2EYRB 1D5XB 1YY8B 2WWKO 4BH7A 5EIQA 1AE6H 1FPTL 3HPLB 4R3SA 4HIJA 4UV4L 4JRXA 2ZUQB 3GSUA 2YZ1A 2R0KH 1FL3A 1D5IL 4WCYL 3LKNB 1NL0H 1NMBL 5EO1A 4YZFE 4IIQA 4NC1C 1TPXB 4D0BA 1ZLWH 4N68A 1BZ7A 4ZYKA 1IAIM 1LO2L 1IAMA 1RIUH 4Z78B 3AU1A 1I3RA 5F3HB 4ZQKA 1RK0A 4M62L 4HFUH 5J8OA 2BVEA 1KPRA 3GMLB 5DD5H 1G7JB 5FYKD 4R4ND 5A16B 5DMJB 3QEGL 4PJEF 5EUOE 1QR1B 1WT5A 5IVXF 2V5YA 4J3XA 1LEGA 4QRSB 3KHOA 3RL2B 1MJUH 1AD0B 4XI5C 1GGBL 2EDJA 1V7NH 2AP2A 2XXMB 1FJ1A 5B22A 35C8H 1T4KB 2VSDA 4F7EA 5EU7C 1S7QB 3PXHA 2XWBB 2ZSVB 5MHSE 4XVUC 5IBTL 4RAHA 5F9JB 4LDOB 4PGDA 1JWUA 5T33H 1JL8A 1SJVA 5FUZL 4Y19A 3SPVA 4RGNE 3VFUA 4Y2DA 3LY6A 4U1KA 1F4YL 4YHOL 3G6JF 2ADGA 3WHE1 3V52L 1L7IH 4X80L 3OB0H 3VXME 3OKNA 1EEYB 1UB5B 2NX5A 3WEXA 4QRPB 2P5EA 1FNLA 4WHCA 5T5NF 4JANB 1QBMH 1BQHA 1ZTXH 4PLJD 3MCKB 1ZEAH 1Y6KR 4XAKD 1AJ7L 1YN7B 1MJJA 2FYYB 1X5KA 5GGQL 2PKDA 4Q7DA 2A9ML 5DMKB 4CJ0A 3UDWC 1F45A 2XPGB 4X5XB 3U2SA 3LPGA 3BYTA 2WUCH 3DJ9A 4M4PA 4DN3H 3FRUA 2IH1A 3HZMB 4F8TA 4NQUA 3U0TA 4FQIL 2YXMA 3EYSL 3P30H 3ARPA 3BGMA 1YDPB 1JNJA 3I75A 1KJVB 5E8NA 3ULVH 5DUPL 3V4VL 3F12A 1UM4L 4ETQB 4P99A 3T77B 5TDPB 1MQKH 2X41A 3LN4A 4NQDE 3MV9B 2XICA 4LLQB 4UT6H 5DQ9B 3GHBL 3O8XB 4OUUA 4XP4L 3H7LA 1PZ5A 2ADJB 4DOHE 2D7OA 3CMOH 4LIQE 4YDKH 4X7TA 2Q3ZA 4JLRB 3MLXL 3DX7A 4DTGL 1MLCA 3FHQA 3GMRB 4U0RB 2W07A 3S37H 3SKNB 4D3CL 3MUJA 4G8IB 3VXRD 3VWKD 1U8MB 4UQ3B 3AC0A 3I6GB 2DQIH 5SV4A 3H9SD 3QAZC 5H8DA 3UC0H 3DYMA 3L9RB 1JHLL 4IDJL 4G7VL 1B0RB 1CCZA 1P4IH 1ZWIA 4OBRA 3MV8A 1C12B 5D1XD 4U7MA 1WBXB 4Y5YC 4P2RA 4RZCB 1MY7A 3OMZA 4NCC2 5CLTA 4WWKD 4F37K 3K8LA 1QSEB 5GRXG 1BFSA 1T5WB 1WZKA 2FJHA 1MCNA 1SVCP 1A9BB 2IQAB 4OZ4A 5D7JC 2WINB 4TVPL 5LCVH 4BQCA 1U8IB 4P4KC 4PJDA 3REVA 3X3FL 3BKCH 6FABL 4OZHB 3CFDB 1A7OL 3E3QC 1MWAL 1A6TB 4FRWA 4A2MA 5SX5H 4MJIB 4OLWL 4NT6A 4HC1L 1C5DB 5AEAA 2NYYD 5FUOH 1GGUA 3QDJA 3KPNA 4Z5RB 1U8OA 1WBZB 4L5FL 3MGOA 2ZJSH 2RJMA 4EI6B 3UO1H 4XXDB 1Q94A 4PBWD 4ELMF 1OTSC 2Y1VA 4P46B 4TQEH 3W82A 1UFUA 4Y5VA 3IDIB 4HZLB 4JFFD 2BVOA 4PLNC 1EO7A 4HUUA 1MNUL 1UCBL 5D2NA 4EUPG 4G6KH 4ZPTB 3MUGA 1E28B 3W2DH 5GRJH 4LF3A 2WBJD 4S11A 5CGTA 4HZAA 1N8ZB 2IQ9H 4YHIA 4EEEA 4KK8D 5IQ7L 5D5MF 4Z7QE 4RWHA 3X11A 1UEYA 4NO0B 3VFTB 4TNVF 4AIZB 4KKAC 1NC2D 4XP6L 4UBDD 5L0QB 3MA7A 2FX9H 2NPLX 3SCMC 5SWSB 1SYVA 3KR3L 4PB0L 4NQTA 3VXSA 5FB8A 1FDLH 1N7ML 1AC6A 4Y4KA 2ICWA 3IKCB 5F9WC 1M7XA 4JFED 4I3SL 3CZFA 4OCXL 4IDLA 4PUBH 1DBAH 1OP3K 3CLEL 3AB0B 2V5RA 3CCHB 4RGNC 1P53A 2VLRB 3T0WA 1EAPB 5DSCA 4PG2A 3SY0B 3T1FB 3GSRA 3MLSH 4K3DL 1QFWM 2IAMD 1DUZA 3P0GB 3QUYB 2X4TB 4UV7H 2XZAH 3OTTA 3GK8L 4M4RA 5E6IB 1ZKAA 4NKIL 5I1KH 3K81A 5MEOB 4WFHD 1CZ8H 3DV4B 1B4JH 4KRNA 2A6DB 1AGEA 1AGBB 4M6MH 4KY1L 4P2QB 1HXYA 5FYKE 4RMUA 4DKFH 1KIRB 4U1NB 1ZK9A 4OF6A 4NKDB 4KVCH 4UIMB 4G80B 2F74A 2AK4D 4NJAH 1QBLL 3HE7C 3P73A 1HOCA 3PGDB 1X5AA 4BSVB 2EO1A 2X4OA 4NFBA 3GI9L 4HW6A 1S9YB 4Y4FB 1IVLA 5C1MB 1IAKB 2V2TB 3F6IA 4KQ3H 1JYNA 3WFEL 4R7DB 4FQ2H 3AS2A 4M1DL 4OCNC 2MKLC 4LPCA 2PW1A 4N1CA 3VI3F 5KZCD 4C83B 5C08A 1JTPA 1LP9F 2LU3A 1F00I 1SY6L 1P7QD 1ZLSL 4PJAE 1R3KA 5T1DL 1OLZA 1S8DB 2ITDB 5GGUB 5KSVA 4LIQL 3P40A 1S7RA 4RNRA 1LILA 1I1CA 3WJJA 4LMQI 3FT3B 2NXZC 1BIIA 2CIIA 5GS3A 4JR9H 5LWYL 3FFDB 1FQ9C 1G9ML 4NNXB 4NZUH 1OGTA 5IT2H 4XVJL 4DGIL 1RMFH 1M1SA 3RWCB 2X9YA 4XAKE 4PJ9A 4XCNB 3ES6A 5D71L 4PJ7F 3MC0A 3SO3B 1C1EH 2GFBB 3M1BB 2HH0L 5FA3B 2BMKB 3BW9A 4PR5B 43C9A 5IGXL 4X6CA 2VL5A 1X5XA 1QFPA 3BHBB 5DRNA 2FNBA 2DDQL 3VD5A 4F9LC 4GKSA 5T3ZD 3GSWB 1EEZA 2OJZL 4E42B 4CVUA 1U8PA 4XXCC 4K8RL 1VFAA 3QIUC 1R0AH 4JPWL 2UZIH 3RWEB 2Y07H 3EYFB 2DLIA 5E70A 5TQ0H 5EWIH 2I25N 1VFBA 4GAJL 1AI1H 1F11B 4RMSA 4JM4L 1XF5A 4G8GD 4FXKB 2AJ3B 2ZCHH 3BOVA 4HWBL 3MRQB 3QRGL 3H3KA 1KOAA 4XX1E 4E41B 1MCPH 3HUJF 4S10A 3VXRE 4J4PC 2DQTL 4UU9B 3VGAB 4FQJL 3H9SE 2B4CL 3BPNC 3CSYA 1KTLB 3QDGB 5EPMA 4JCLA 4DVBB 5EOQL 3DX9A 3O9WB 3RWDB 3MO1A 4N0CD 3CZJA 2UYLB 3EYVB 4Z7UE 1OAZH 4DK6A 1SJEA 3P2TA 5I1HL 3V4UL 3AY4A 1QA9B 1U3HC 2Q8AL 3GNMH 3QIWC 2OXGA 5T5FH 1A7PL 2DI8A 3W0WD 4NRYA 2IPTL 4HUVB 1RURH 3WNLA 1A6VH 4M7LH 1K8IB 4N5ED 5IF0A 4RIRA 5HGAB 1RJLB 3CFEA 3LH2L 3KYNB 4L8SB 4CNIA 3NIGE 2FSEB 1M6OB 3RU8H 2I07A 4LVNB 5EZJA 3ARBB 3CDYA 4P3CH 3HC4L 3U9PH 1HH9A 2CDGA 3HI6H 4Y16A 4LLWA 5BV7H 1BQLL 1ORQA 1CLZH 2OMNA 1UZ8B 4S1DD 4O2FA 5I1GL 4LBEA 3RKDD 4P9ML 1OPGH 3TBSA 2HFGH 2XZCL 3MMEA 1CDHA 1B6UA 5IWLC 4F7PB 3P77A 4O5LH 4PGBA 1QFHA 3OXSB 3TYGL 4KUCF 1NMCB 3IXAB 2W9EH 3PWJB 4PJ5E 3B3IA 3TYFA 2M1KA 3ECBB 2CJUH 3RVVC 4MD4B 3QUXB 4D9LH 1EZVX 4TULH 2AV1A 1J5OL 1IARB 1H3TA 1S7XA 2K7QA 4XT1C 5KG9A 2X09A 5D1ZC 4LL9A 4XZUA 3W9EA 3DMMD 5AG8A 3SGJC 1R5WB 1VADB 5J4MA 4LHJB 3NIDF 5E4IA 3GO1L 3S4SA 3I3EA 1AO7A 1BEYL 3NCFB 3C87A 5GGTH 1E4KA 4LCCC 1JRHH 1Z5LA 2J5LC 2DBLL 4KTDL 4F15B 2YPKA 3FZUC 1QKZL 4XNYL 5CJOH 4JO1H 5E95B 5HHOA 4MS8C 4OLXL 5F1IA 1T22B 5BS0A 2NW2B 1NC4B 3F7YB 4YPGB 5BV7C 3GJFH 3CVIH 5CMAB 3QUMH 1FVCA 2AV7B 2O5YL 2UWEE 4XCEA 1YMMB 3RA7L 4LOUD 4WEUD 1ITCA 3C8HA 3AREC 1D5ZA 2P46B 4PJXA 2VYRE 1T83A 2VZ3A 4NHUA 4LVHC 4XP1L 5A2LH 1X4YA 4YH6A 1EO8H 2VIRA 3HNSH 3DVIA 2GSGB 2XY1A 3IXTA 1IC4L 5E9DD 5ERWA 1OB1B 3NTCL 5C7XL 4U1SA 3DX8B 2ZG3A 3G5VA 1TZIA 2GSIA 2PXYB 3UBXI 2BSSA 5GGVY 5CKAA 2OP4L 3AS3A 5I8CA 4HCRH 4C54A 3FTGB 4GAYB 4GAGH 4XVTL 5I17A 4PV9B 2RHEA 3EBAA 4K94H 1I85C 3G5XB 4HPYH 4ZAKD 4WFHE 4L4VA 2MMXA 4M7JL 3EFDL 1FFOB 4LPTA 4FQPA 3HCVB 3LSOB 4GRWF 4U3CA 1VB9A 4U1IA 5EDXA 5IMOB 1JK8A 3JV5A 5H94B 4KVNL 4P9HC 3W39A 1G6RH 3HI5H 2AK4E 5INCA 1IT9H 2E5EA 3NABL 3O0RL 2MTPA 2VABB 3K8KA 4P5TC 5ALCL 3KPSB 4MQ7A 4KHXL 2AABL 4YK4C 4TVSa 4WVRA 1WFTA 4OCRL 2L7UA 3ARDD 4J3TA 2Y06H 1NJ9A 2O5XL 1A6PA 2R4RH 1TVBB 3DYOA 1UQSA 4EI5A 1NLDL 2AKRA 4YHKL 3X13A 3GRWA 3U4EB 3SDDD 1YEJL 1FAKT 3SDCC 1LWRA 3ESVF 3TJHD 3WDJA 1IZJA 4YGAB 4N0UE 1CR9L 3IS0X 3H6JA 5C0FB 4YHYB 4HK0B 4MXVE 3UXFA 4HX1A 1A7RL 3VJ6A 2VUOA 4LU5L 4XB8A 3VXPA 4E9LA 2A6JA 4GQ9L 5F6HI 4XMKL 3PDOA 3IJYB 1S7SA 4U0QB 2XQBL 3ZKND 4TOYH 2FL5A 3ILQC 3LVEA 2Y36H 4BJLA 2PO6B 4NSKA 2FX8H 3HZVA 4PJIB 4XB7A 4FFVC 4QRRA 2EDYA 3CH1B 1FYTA 4AH2B 4F3FB 1K4CB 4KI1A 3V6BR 5MP6H 5GRYA 1A4JB 5EORH 1DDHB 4W4OC 4XBEL 3W81A 4NNYA 1EBPA 4F7CB 1CN4A 4G6FB 4MXQD 5T3ZE 4P3DB 4ZODA 3L5HA 2OL3B 2J6EA 2A0LC 5DRXB 1FZJB 3ARFA 4XBGB 3UYPA 2HFFB 1W0VA 5D8JL 4ODSL 3BEWA 1AIFA 4JHBA 2KQMA 1FORL 5F72S 2DD8L 1CD1A 4G8GE 4ZO6A 3B9VA 5C2BH 2A77H 4OF3A 1DEEA 2VXTL 4LAQL 4D0DB 5C92A 5TDNB 1JPFB 1ZT7A 3PHOA 4GS7C 1OF2B 3CLFL 1KEGL 1ZSDA 2ATPA 1WFOA 4LSTH 4Z0XB 4WJ5B 4G6AC 1PG7H 1VPOL 3MBXL 2W65A 5CJXA 4TTGA 3D39A 5A1AA 4BQ8A 3BVNA 4JDVA 3MZTA 2ILLA 2GY7B 1ZHKA 3LEXB 2PW2A 2J8UB 5D7IE 4Q6IB 1U58A 3O3EB 4MA7L 2GTWA 2HT3D 4YIQA 4WEBL 1MCOH 5FYKU 4DK3A 1RK1A 1S5HB 3OZ9H 1C16B 1KYOJ 4HS3A 4PRHB 3BKYH 3O2DH 1RHHA 1LEIB 4F9PA 2ZCKH 4K7FB 3JBG7 4OT1H 5CBEA 1UZ6F 2H32A 3PE9A 4DGVH 2FWOA 5IOPB 2YS4A 5SWZD 2QR0B 4Q74A 4DCQB 3JVGC 3G9VA 4HFWA 1MFEL 5ICZB 1UM6L 4WO4C 4R8WL 3R06A 3UZEA 1W72A 4PIRF 2OK0H 1NAML 4M61B 2KKQA 4NIKB 4WTXA 3IDNA 1MRFH 1CF8L 2AJVH 1NCUA 3ROLA 1YYLL 2XNAB 3C60D 4JDTL 3BIAX 4M5YH 2ICEB 5C2UB 1KJ3H 1J8HD 3A67H 4JQIL 4A6YB 5TQ2L 3HFML 4HK3N 4XP9L 3F7RA 3EOAB 3D6GA 2D03L 3V5DB 4V2BA 1HSAA 2JB5H 5I16B 5DI8A 4JPIA 2YD7A 1M7IB 4MQTB 3QUZD 5F88B 2AJZA 3RTQB 3ZTNH 1DUYB 3JV4A 3BUYA 3G9AB 3GJEA 1GC1L 2FO1A 5K9JH 3SDXF 1OGAE 5DA0B 3DO7A 1CFSB 2CK0H 4GW1B 3TC9A 4KJYA 1I1FB 4QXUL 2NQCA 3NFSH 2VN7A 3THMH 4CN1A 1XGYL 1DQQB 3FCTB 4ZFZA 1DLHA 4PJEA 3RNQA 2DLFL 3S3PA 2D7TL 2WIMA 2VXSL 5IVXA 3MLPA 5I1LB 4OFPA 2NY6D 5E9DE 3KPLA 4HMDA 4K2UL 2GAZA 1WWCA 5MEQB 1QFWL 1NSNL 5CIPB 3GSNA 4KK5C 4UTBH 1IEAB 4MNHA 5DJDB 5AZ2H 3BMWA 3QDMA 4OTXH 4X4ZA 2F5BL 4OUOA 4UB0L 4HEPG 1EJ6A 5DRZB 1J18A 1AR2A 4I5BB 4NRZA 5FDWB 2YN5A 3MFFB 4AMKL 1J0IA 1Q9KB 2ZCLH 2QHRH 4J3OC 3P4MA 4HJJL 4J6RL 1BLNB 5I1CH 5KS9F 3G6JA 4PRPA 1SBSL 4JPKH 2YEZB 1BF2A 2RCSL 4GRLC 2OZ4L 1Y18A 3UTQB 2X4QA 3X12B 1ONQB 2XKNA 4PFEA 4PJ8C 4ZUUA 3C6LA 4BYHA 5T3ZL 5H2BA 1LO3H 1WCBA 3P4NA 1D5BB 3I2CL 4JO4L 1MEXH 1DQJA 5L6YL 2GW5A 1OAKH 4BQBA 5INDA 2FEDC 3MREA 1U95B 4R4FH 4P4RA 4BELD 2ED9A 2XWTA 1AKJD 3IYLW 4L8DB 2YK1L 4PREA 1L6ZA 5C0DA 1O5DT 2H45A 1VCAA 3BE1L 3WJLC 5B3JF 3QEHB 3NCEB 4MZ3A 5BVPH 5I66B 1J88A 4QRQB 1OP5H 3I50L 3T0XA 1IL1B 1XH3B 5C6PB 1IC7L 5D6CA 5EZOL 2R4SL 3FN9A 4PRNA 3NGBC 3UYRL 2YPLD 3GMMA 5IQ9B 1CGVA 2BNQA 4KH2A 3RY5A 5KSAA 1IAOB 1YA5A 5F9OH 5KAQG 1R5IB 3B8YA 4GRMA 3BZFA 4LSVH 2OSLA 4GW5A 1NCCH 1KJ2H 5EH1A 4XPTH 1U6AH 5CWSB 2CXGA 5EO0A 3QQNA 5FF6A 1BHGA 3O2WH 1DE4B 1VGEL 4X7SL 4FQXB 1AGFA 1I1YA 5AZEL 5F9DC 2ZPKH 4XPBL 3BWAB 3O6KL 4PP1C 5K9QI 2CXKA 5E4EB 1I8IA 2QBWA 5KJRL 2F58L 2FGWL 5A40E 4FZ8L 2EXWD 1I8KA 1XGTA 3RPIA 3K1KC 5DZLA 2C3VB 4JG1L 5FV2A 3PABB 4M3KB 1SEQL 3ME0A 1RZFH 4KKCD 5C0AA 3NCYP 3P11L 4I2XE 4QO1A 4FA8A 3SKJL 5BXFA 1ADQA 3U0PA 4BZ2H 1NQBA 4FP8L 3PWLB 1RJYB 4XTRD 3IFLL 4L4TA 5JZ7D 3M8OL 4KK6D 4X99B 3PQYE 5ID1A 1U92B 1I7RA 1WK0A 3VFNB 2RAMA 5D1QC 3V6OC 4AENB 5FXCH 3WSQH 4LSUL 4QT5A 4G5ZL 2MCPL 5HHPA 4ELMA 3GMPB 32C2B 4ODUB 3WNKA 1WIUA 3P9WB 3K4DA 4HH9A 3FO2B 3KWWA 3MGTA 3LQAL 4LCYB 2CMRH 1FL5A 2ESVD 5I8OH 2ICWJ 3MBEC 1D9KD 3TBVA 1X44A 2B1HL 2B20A 2BSRB 2GY5A 4IOFD 5IK3B 1S78D 2F5AH 3WIHA 3S7GA 4MAUH 2VZ1A 3K74B 3MNWA 3TN0A 1VESA 5D5MA 4I0PA 5LGJB 3GSUB 1FL3B 3VFWB 4H5SB 3WLBA 2NXYC 4G9FB 5EO1B 4MMXC 4IIQB 1G7LB 4ELKA 3HE6A 2BOCB 4D0BB 1RHFA 5CAYB 1U36A 3L3HA 4ZYKB 1F02I 2WBWB 2ZSWA 5I1IL 4MQXD 1RVFL 3EYOA 3AU1B 1I3RB 1FVEB 3OJMB 1FIGL 1IGJB 2H26B 1CE6A 1KPRB 1RD6A 1JGUL 1S7UB 1J8HE 3O11A 4RAVB 5AAWA 3KGRA 3NH7L 3F58L 5EA0L 2VXVH 4BK4A 2VAJA 4J3UA 1XAUA 4DUXA 3SKOA 1FJ1B 3CPLA 1YEDA 1JFQL 2LFGA 4KTEL 4F7EB 3OB0K 5I15L 5C8JA 4GKOA 3ARGC 3IVKA 5IVOA 1EHLL 1YNKH 4PGDB 5FKPB 4LQFH 2VQ1B 1JWUB 3HG1B 4FQHB 4LSPH 4Y2DB 3WFCH 4U1KB 3E6HA 5IFHL 3LN9A 3LZFL 4Y88A 1RZ8A 1KCUH 4G7YL 2NX5B 3WEXB 3NA9H 1AFVL 4WUKH 2HJLA 2CLZA 4M7ZB 4PGCA 2NY3B 3ARDC 2XRAH 4JQVA 5C0CB 2R8SH 2CRYA 4NBYB 3MV9D 4HS6A 1BQHB 1BD2D 4PRDA 3FAWA 1NAKL 1C08A 3O8XD 4NDMB 1YC7A 4AIOA 5C07D 1CWVA 4YBQC 1GCFA 2RIKA 1MHHA 2WQRA 4QGYA 3FQNA 2F53A 3U2SB 4N8VB 2NY5H 3MX0A 1FNGA 2OR9H 4XAWH 3RJDA 2HWZL 1EPFA 1LP9A 3MUHL 1WISA 5E8EB 3NZHH 5E8NB 5TFSL 1T5XA 1L4IA 1GGCH 3UTTA 2ARJA 1IGYB 3LN4B 4LASL 1KN2H 5GRWA 4IJ3B 2QQKL 4OD1H 4XPAH 2ERJB 2CR3A 4JFDB 5FHBL 2YRZA 4OB5L 3WFDL 5FEBA 3RWIA 5F7KC 1PZ5B 2H6PA 1FO0L 4TUOA 1N6QH 4X7TB 3IFPA 3QO1B 1TTGA 1V7MH 2BERA 2BHZA 1MLCB 1QRND 3U7WH 4PJ7A 4UTAH 4WY7L 3BKMH 2AXHA 3WNPA 1P5VA 3VWJA 1FE8H 1KB5B 3P0VH 3VGDA 3WLWC 3N85L 1BFVL 1OVZA 5A3IC 2MOVA 1UH4A 2VDLL 1ZWIB 1TETL 3GIZL 4LLDA 5KSBF 2BOBA 4YFLI 5KOVC 1T2JA 4K7PY 1BFOB 3OF6A 3MLVH 2NY5C 5J06A 2FJHB 5SX5K 3GDBA 2GK2A 2JIXB 4OZ4B 4P46D 4NOBA 3T0BA 1L7TL 2BY2A 3MA9L 4Z76B 2NY1C 4OD2A 4PJDB 6CGTA 2IBGA 3SHSA 3QG7L 1AE6L 1FC1A 1XR8A 3TZVB 2CO6B 4JREB 1VFMA 1Z9OA 3HUJA 2A83A 4NT6B 4ODXA 3FRPA 5F6IB 4EBQH 4WV1A 4RFNC 3KPNB 5BW7C 4AQ1B 4YFLF 4PBXA 3DVGA 3MGOB 5IMLA 2FHFA 5BMFL 4HFUL 2NY2D 1Q94B 4NQEB 3BO8A 5IMMB 4XMPH 1K2DB 2IBZX 4Y5VB 1J0JA 3GMOA 5D93B 4HUUB 1V7NL 4W6YB 2ZUUA 4U1GB 2F9BT 3MJ9H 5D2NB 4EQ2A 4LARH 5ADOH 5DD1L 4LPVA 3SE3C 5JXEA 1N6VA 2XKSA 3DXAD 3E6FA 2IPUK 3D2UB 2EH7L 3EO9H 1S9VA 2GJ6B 3TP4A 4F80A 4LPUA 4NQSB 1H8NA 2NLJA 2EYTA 1DTUA 3X11B 3BIKB 1YEFL 1HCVA 3DECA 2YMXH 4AZ8A 4HWEH 3RY6C 3PJSA 3PP3K 3HAEH 3MOAL 1IAII 3QUYD 5DHYB 3OHXA 3X3GH 5J1SC 5D7LA 4AEIL 4UT7H 4R0LC 4L3CB 4UINH 3HI1A 1A14H 3QUZC 3O6LH 1H0DB 3LKOA 2J88L 5DWUH 3RWGB 4Y4KB 2ICWB 3O2VH 2ESVE 5BOZG 4P2QD 4G6JH 3CZFB 4JFPB 3F7PC 1AGCB 2VLMD 3QCVH 4KKBC 4BSWA 1ZA3B 3TF7C 4ZNEA 5E94B 2ADFL 3KXFD 5TPWH 1VKXA 1SEBA 1AHWA 4PJAF 1QSFD 3WIIH 2Y7QB 2QQLH 1MPAH 4Y8AA 3M45A 1KJMB 2WUCL 1FLRH 1AP2A 1JMZA 3ZYZA 4C56D 1OWRM 5C09A 2DL2A 5J13B 1CDBA 3FQTA 4MA8H 4HS8H 4CJ1A 5DRWA 3STLB 1E4JA 2D7PA 3H3PL 3JWOH 1R6VA 4B7IA 1ZT1A 1F3DJ 3E2HC 5FO8A 4X7FC 1MFCH 1DVFC 2FBJH 1INEH 4FMKA 4Z8FH 1IQWH 1C5CL 3EDFA 2HT4D 3NACH 1JI1A 3IDMB 2ITCB 1OM3H 2A73B 1CFQA 2F74B 3T3ME 3RJQB 3S37L 1NUNB 1UM5H 4PGEA 3P73B 2Q1EA 4TSCL 3EJYC 4BFBD 5GJSH 5HY9B 4HIIB 2FEEI 1YEHH 1VDGA 3UC0L 3C9NA 4HQQH 1A7NL 4X98A 3QNYB 4F33B 1A6AA 4HIXH 2PW1B 4K9EC 4K9EL 5KW9L 5C08B 3H42L 2YUXA 1R3KB 4Z7VF 5CJBA 4G42B 5GS2H 1KN4L 4OGYL 5IEKB 3BQUC 1S7RB 5E8DH 3OL2A 1UJ3C 1ULVA 4ORGB 3SE9L 3LIZH 2GK0B 1GYAA 3JWOC 5HYQA 3DV6A 1IGTB 2KL6A 3BESR 3KJ4C 3MV9E 1BD2E 3SN6N 3RDTA 5TDOA 4JQXC 3T4AA 4RDQG 1P9MA 3TA3B 2ZG2A 3TPUA 1KEMH 2DS4A 5C07E 5ANMA 4JZJA 5SV3A 3UBXA 4P5KA 3JTSA 3OAZH 3PGFL 3ELAT 3VFMA 43C9B 4E41D 2CPCA 3LHPL 2I9LB 2NY7L 3DSFH 1XF2A 3EDEA 5DR5H 3RVXD 4PRIA 1FIEA 2PNDA 4GKSB 4TQEL 4C57C 5D70H 1T6WA 4UT9L 4I77L 5EBMA 2R9HC 4D0CA 4RQQA 4ORZC 2ARWA 2DLTA 4W81A 4EN3A 4Y4HC 2NCMA 2GCYB 3BWUC 1QSEE 2DM2A 2HT2D 1ZAGA 1CK0L 5IB1A 1VFBB 1DFBH 3KLAA 4M8QA 4LKCA 1XF5B 1P2CB 1U3YA 2IQ9L 4JFQA 4DW2H 1KIQA 2CH8A 4MAYA 3CU1A 2DQFA 3S3SA 1QRNE 4FZEH 4MB3A 1MHCA 4OZHE 4M03A 3TT3H 1GOFA 4QOKB 3TFKC 3VXUA 4Z7NF 1DBBH 1B0GA 2D4FA 2BSTA 2VKXA 3SGDH 1CICC 3STBA 1BQHG 3D87B 3ARBD 2DQJL 4YHNB 3QA3A 4N9GA 1KTKE 5JHDB 5E8OB 2WMPA 3MO1B 2Q76B 5I71C 1PBYA 3RY4A 4IRJB 1H3PH 1UYWL 1HIML 2Z8RA 1F90H 2FECI 2G60L 1IKFH 4N8VG 3GKWL 5F7DA 2HMIC 1A3LH 3PWPB 3OKKA 2CR6A 3RVUC 5JZ7C 1KBGH 2EC8A 5ECJE 1I4FA 2ZUQC 3I85A 4NRYB 2EO9A 1J9CT 3SJVA 1NBQA 4HUKB 4Y5XB 3TCXA 3EO0A 5DK0A 3CFBA 4X6FA 4JGMA 3BSZH 2I07B 2ID5A 1HEZA 3WHXB 4UILL 4NC2B 4Z0BL 1X6LA 2XZAL 1HH9B 4AYFA 2CDGB 3LQZB 1N4XL 2P8PB 3CSPA 5T1LA 1ORQB 1FVDB 1CZ8L 2G75B 5DHXB 1L0YA 1GZQA 2Z31A 4H8WH 3CVHB 3TBSB 1BVLA 1EFXD 2DWDA 3LKSB 3MMEB 3MCG1 3T8XB 3RZCD 1RUPL 2IANB 2O93L 3VRJB 1XGQA 5SWSE 2Y4SA 4KVCL 3RNKA 2GITA 4FABH 3TYFB 1NC4D 3B9AA 4NJAL 1KNOB 5IB5A 2Q87A 1U93A 1FZOA 2R29H 3H9ZA 2X4SB 2AV1B 2JCCF 4CW1B 3RQ3A 3DXAE 4LVEA 4OCYL 1J05A 4KAQH 4XZUB 2VLRE 1NUDA 1QFWI 3UTZA 5KTEL 1TMCB 3S4SB 3UTOA 1AO7B 2PXYD 1FFQA 2PETA 2BFVL 2X5PA 3T4YA 1Z5LB 4P23C 4NBZB 5FGRA 3UJTH 1PKQE 3FB5B 4PJBF 4RGMC 2YPKB 2VOTA 1G7QA 2H1PL 1I3GL 3SGEI 5GZOC 2X2YA 1QG3A 4LEOA 1HILA 1XIWC 5IEHA 5JW4Q 3RWJA 4P2QE 3M07A 1D5ZB 4X6DE 3D18B 1WICA 1DQMH 3KXFE 1J86A 4NHUB 1P4BL 1MCLA 2E7LC 1URLA 5MENA 4XNQA 1QSFE 4H0GA 5ILTH 2C7UA 2DQDH 1XT5A 3G5VB 1QLEH 3T0EB 5F96L 2GSIB 2X1XR 3KPSD 2CSPA 3U36B 1I7TA 1NFIA 1TENA 5E2WH 1BF8A 5C0ND 1Y6NR 5I8CB 2Q86B 4GH7B 4AM0A 4WW1A 4MNQA 3SDXA 2SEBA 1MQ8A 2NMSA 3NN8A 4M43H 4L4VB 1RZGA 2EICA 3CJJA 1NCWL 3GI8L 4H0IA 1JGVL 4QHKI 2BC4A 3AFLA 5KVEH 5LAXA 3RGVC 3MRCA 5EU5A 4U0RC 2IFFH 1HHJB 4U1IB 1AR1D 4L3ED 5L7XL 3D5OF 1PG7W 3W39B 1OW0C 2Z93A 3QXDA 5INCB 5EZIL 4ZXBC 1KLUA 2HKHH 2GTZB 1JZ4A 1MFAH 5EOTA 1FFPB 4V1DA 3HN3A 2VTFA 3JXAA 3UDWA 5EC2A 4HGMA 3B4NA 3VFSA 4C55A 1N3NA 2MPAL 2V2XA 4LPWA 1UQSB 2AKRB 5GRUH 3C2AH 3TCLB 3CXDL 3RWHA 4AIXA 4FFYH 4G6FD 4KMTH 5KS9A 1JUFB 3GSOA 1R3JB 4MJ5B 1MRDH 1PYWA 5F70A 4GW4B 4X6EA 5FKAA 4UOJA 1MJ8H 1A6VL 2UZYB 3VJ6B 1D6EB 3U6RA 4J3WA 5E7FA 3VXPB 2A6JB 3PDOB 4YLQT 4JKWA 1S7SB 2R0LH 4WUUD 5D7KD 4W6WB 3HZVB 4QRRB 2R0WH 4GT7A 1KUMA 2X4PA 4K3EL 1XZ0B 4F7TA 4E41E 5CGMA 3L1OL 4O9HH 3DROA 3VW3H 3DETD 3C5JA 4NNYB 2NNAA 3FB7A 5HYIA 1B0WA 2YD6A 4WTZA 1DQDH 3QDGE 4Y5YA 2QADC 1XEDA 3SDAB 2VISA 5D7JA 1CE1H 4Q97A 3BEWB 4NN5B 1AIFB 3NIFE 4BQ9A 1YPZF 1ZXQA 1ZVYA 2VZVA 4P4KA 5DFVC 4FQ1H 4PRHD 4D2NA 1JIBA 1EXUB 1KG0A 1DEEB 3T2PA 3VFRA 1ZT7B 3PHOB 4MJ6B 1MWAA 4OKDA 1A1MA 5CHNB 1Q0YH 4KI5D 3AM8C 5GGTL 4Q58C 5ESQB 2YC1A 1T7ZA 4JKMA 2CO7B 1WC7A 4RMTA 3X14A 2DQEH 2K7PA 5I2IA 4GQPH 1LDPL 2HJFA 3O6FD 2P8MA 2W65B 1NBZA 1U8JA 4IRZH 5ACZB 1BOYA 3BVNB 4GXUM 5DJZA 1YUHB 2P1YA 1ED3A 1GGYA 1ZHKB 1YEGL 2X7LA 2PW2B 3AB0C 3DWTA 5B38A 3SE8L 4XPGL 3LAFA 1U58B 1CD9B 5HTSA 2GTWB 4YIQB 3MNZB 5BO1L 5IIEA 3L3KB 2VXQH 4HS3B 3QXUA 4JY6A 4NKMA 1N5AA 4JY4B 4MXWL 4JFOB 5FO7B 1QO3A 3SKMA 3GBNH 2VL4A 5CBAA 2Z0BA 1E4XL 3K46A 4YUEL 4DOHB 4ZTPH 1U91A 3VDAA 3RAJH 1CG9A 4ZS7H 1J1OH 5E6IC 5FGBC 4MCZA 4UQ2B 2BJMH 4HFWB 3RTQD 1CGYA 4LCIH 1CFVH 1WIPA 2FZ3A 1WCQA 2OLDA 1CXFA 4ODHH 3GEWB 4HT1L 5FK9A 3JZ7A 5DEGA 3SCMA 3LPFA 2E27H 1W8OA 1UG9A 3V7AG 4YXLH 3WD5