4HAGA

Crystal structure of fc-fragment of human igg2 antibody (centered crystal form)
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
208
structure length
208
Chain Sequence
GPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTFRVVSVLTVVHQDWLNGKEYKCKVSNKGLPAPIEKTISKTKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPMLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Immune system
molecule keywords Ig gamma-2 chain C region
publication title IgG2 Fc structure and the dynamic features of the IgG CH2-CH3 interface.
pubmed doi rcsb
source organism Homo sapiens
total genus 35
structure length 208
sequence length 208
ec nomenclature
pdb deposition date 2012-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4hagA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4hagA01
1LEGB 2P8LA 2OJZH 1ZT1B 5CP7B 1HSBB 3QXVA 3KDMB 3LV3A 3FCTB 3EJYD 3KPSE 4F8QA 1P5VA 2DRUA 2ICWB 1G1CA 3BWAB 4KHXH 4LLMB 3NPZB 5C0AD 1HK6A 2JE8A 3QXTA 1YC7A 2W0LA 1F5WA 4H8WC 3UO1H 5C07D 5CILL 2XXCB 5I9QB 3NIDF 1MCFA 4DCQB 2F5BL 1JCKA 4P3DA 4QHMA 4LLQA 1CLOH 3L1OL 1AE6H 4LKCA 5FOBA 2NXYB 3DUSA 1Y18A 5GQBA 5TE4L 4KI5D 5IT2H 3BPLB 1IT9L 3ZDXE 2YUVA 2GSGB 3D3VB 3KWWA 1NFKA 4ZDHA 5DQJA 5FYJD 5CJ5A 4R4FL 1AFVH 1UEYA 3T04D 1P5UA 4MAUL 3UXFA 5E08H 4G6KL 1DANT 4KY1H 3L5XH 4HUVA 1MQKH 1IL1A 4MD0A 1B4RA 1CLZH 3TZVC 3NFPB 4IIQC 3F65A 4OZFA 4TTDC 4FG6C 3RI5F 2W65B 5DD5L 3IF1A 3AS0A 3KPSB 1WWAX 4YLQT 2QLVB 1K8DB 3HMXA 3KPRB 4O58L 1N6QL 3ZKMC 3QHZL 3MXWL 4XP9L 3ZL4H 2VDML 4JM4L 3LZFL 3HMWL 3P4OA 1DEEB 5E8EA 1G7JA 4AM0B 4LLVA 2H41A 3O3BB 1JN6B 4JO3H 3H3PH 1RZJH 3FONA 4OF8A 4YNYA 3MRKB 5IQ9A 3NIFF 2NCMA 3U83A 5ITBL 4NOBA 3GJFB 4GMTH 2LE9A 4KV5F 2K7PA 1NJ9B 5JUEL 4MS8C 3HZKA 4Q6IA 3PWLB 3F7YB 3KPNA 4ISVB 3QHFH 3ARGB 1CFSB 2KL6A 2V2WA 3AU1A 2XN9E 3TCLA 4A6YL 2ORBL 5IJVA 1PD6A 5KS9F 3CMOH 3IJSA 3QXDA 4NKIH 2XA3A 4E0RA 4PR5B 5HDBE 3EDEA 3SDXA 3U7WL 3VW3L 5LXGH 3CXDH 3RWJA 2M8XA 1JYNA 3SY0B 3MLWH 3GFUA 3P4MA 1B6DA 4HV8A 5A2LH 4OZ4A 3X12A 3VXOA 1JL8A 1EAPA 3QRGH 1U93A 4JDVB 1INQA 1J0IA 5C6TL 4U1IA 3TA3C 3SKMB 5IVXA 5ID1A 2PR4L 3RHWK 2IAMD 2PETA 1BQHG 5EOCH 2UVFA 2DQGL 2DMCA 5A2JH 1MFEL 3BISA 4YXKL 2P24A 2GT9B 3MROA 3CVIH 3UPCA 3ARDD 4WCYL 1CK0L 3RFZC 1J11A 2OXHA 2XN9B 4NT6B 2Z31A 4IRSD 4N9GB 4QYOB 4JGMA 1IVLA 5I1LA 1U95B 1ZE3C 1G9NC 4PFEA 4DUXA 3DETD 4XGZA 3BVNA 4LMQE 4X98A 5GZOC 2CKBB 3VRLE 4TYUA 1AR1D 3S37X 1S5HB 1TIUA 4M48H 2M26A 3W5MA 1KJMB 3HHRB 3S5LA 2VITA 4RMTA 2WP3T 3QEUA 4B50A 5I9QC 3TC9A 5JZ7C 2FEEL 1MOEA 4MGXA 2HN7A 2NTSP 1HHKB 2IPKB 4JZNA 4HCRH 4OKVB 1AGEA 4KMTL 5MI0B 2NXYC 3TLRA 1IQDA 4OCWH 2BXYA 5TF1L 4R0LA 3BPLC 5DJ8A 2E7LA 2FZ3A 3LIZL 5TH2B 1Q0XL 3MUJA 1D6EA 2OL3L 5ISZE 3VFGH 3UJTL 4NHCH 3EYVA 5ESQB 3K4AA 3KWWB 1NCBL 3C5JA 2P5WE 1KB5B 3LS4H 3PWNB 4LPVA 3S5LG 3EHBD 4GRLB 4X80H 1PKQA 1L9MA 4QRUA 3V5KB 3SO3B 5JW4R 3A6CH 3BKJL 4N8CL 3HN3A 4ONFH 4E42A 3MLSL 3HE7A 1S9KC 1M05B 1ES0A 3L3KB 3DIFB 3MLTA 1MCCA 4OD1L 4DGVH 1BF8A 1UYWL 5DFTA 4OB5H 4OGAC 3WE6A 2CLZA 2R56L 4PP1C 5JTWA 5E8EB 4JFOA 1ZLVK 4Z7VF 4QEGA 1FNGB 4I5BA 3TZVD 3WL9B 4HK0A 4KVNH 3FONB 3O9WA 2FJFB 5HDQH 4TTDD 5BRZE 2GW5A 3WUZA 3ZHDA 1B0GB 2DJSA 1Q9WA 2ZSWA 3ILPB 3C09C 5ISZB 4U7SA 5GRJL 3ZKMD 5F3BB 3MJ7A 2X09A 1NBYB 3ARGC 4LEOA 2P5WB 3H3BC 1KELL 4MXVF 4Z7QE 5T1KA 1Q38A 5HVFB 5CJ8A 2R1XA 1T2JA 4NN5B 3WNMA 3G5XA 5C0IB 4MJ6A 1TXKA 4UMGA 4E0RB 4M5ZH 5DMGC 1H3PH 2VUYA 5C0NC 1CXKA 1F90L 2HAZA 1N8ZA 2A1WL 2XNAB 1R3LA 2DQHL 2XFXA 4H26B 3X12B 4PRBA 4MS8D 3VFVB 1INQB 4PY8J 4U1IB 5T3ZH 4ZO8A 3HC3L 1RIUH 1VFOA 2EDFA 4BYHA 4OSUL 3GI9L 2NNAA 4K3JH 4RGMB 4RRPG 2A6IB 1DR9A 1GC1C 5C70A 4PJAF 4Y5VA 5BRZB 3CVHH 1KB9J 3LSOB 3TBWA 3ZDXF 4NKOA 4UBDC 1VACA 1SJEB 1T21B 1JVKA 5KN5B 2X4PA 1YUHA 3MLRH 2WBJB 4PRPE 5EZJB 4M1DL 3T0XA 1I7ZB 5EO0B 2R1WB 1YYLH 2FJHB 5KSAB 5D7JA 4UB0L 3V6OE 2EECA 5F7MC 1GHFL 3TA3D 4KXZH 4TNWK 4YE4H 2FIKA 4PJ9A 3DV4B 1NFDA 3BKCL 1D9KB 1N7ML 1AY1H 1PKQE 4WJ5B 1F4XL 2WSKA 4CVXB 1DE4A 1DZBA 1WFTA 3VXNB 3ULUH 3BVNB 1CD0A 4H0GA 3P30L 5IJKC 5FA3B 5F72S 4Y2DB 2XTJC 2VXTL 5IIEB 2BSTB 4Q0XH 4XWGH 4FFVC 3MJ9L 2JIXA 4Z8FL 1E4XI 3ZSSA 1ERNA 4QGTA 3QEUB 1Q9LA 2JJUA 4QRQB 1CGSH 3JUYA 4GQPH 4YIQB 1DBKH 4DW2L 4GAJH 4CN6A 5E2UL 1AQKL 3B9EA 4U6YA 3S37L 5GZOD 4XH2B 2VDNH 1HILB 2FZ3B 4PRPB 3HFMH 5C0FA 2G60H 3MRQA 1D6EB 4EJ1C 3DSNA 1RK0B 4L4VE 2B20A 1BREA 2R1YB 4GRLC 5H94A 3SO3C 3W9DB 4X6FB 5DEFB 3B5HA 7CGTA 5JZ7D 1P4IL 3AMKA 3X11B 4LHQB 5CZKA 4AH2A 1PKQB 1KFAL 5D93B 1E27B 2NXYD 1EK3A 1F3RB 4R7DB 4K7PX 5I1CH 3MLTB 3D3VD 4MJ5A 2YMXH 2EO1A 1BJMA 5HHNA 4WY7L 2IGFL 1QYGH 1J7VR 3R1GH 5TE6L 1KOAA 1S8DB 3EFFB 4LKXB 4QCIA 1FNSL 2J8UE 4HUXB 4HK3N 1LE9B 2Y25A 3P0YL 5IQ7L 1EMTL 1XCQA 2BRRL 3QIWA 3KPSD 1M4KA 4D8PB 1FZMB 5KG9A 3KPRD 1E4WL 7FABH 5AAMA 1MUJB 4H8WL 2LVCA 4OGAD 3KYOA 4L4VB 3WO4B 5EA0H 4LEOB 1OQXA 5IB3A 4PP1D 4NN5C 1AC6A 1DTUA 3GRWH 1U8OA 4V2BA 3KXFA 2Y06H 3G5XB 1Q72H 4LPXA 4MNHB 4Q9RH 3VRLF 5IMLA 4ESKA 4PV9A 1Q9OB 1I85C 2Y23A 3UTSE 4OFKA 3B9KA 1J1XH 4F37K 2CK2A 4FZ8L 2FCBA 1E0OB 2IPUK 4BA8A 4XBPA 1IMHC 4YHLH 3FB8A 3PP4H 4YXHH 2J8UB 3O2WH 3TM6A 3MRNA 5EBLB 4RGMC 5HI3C 4Z95L 3MOBH 1U8PA 4J4PA 5DLMH 2MFNA 2QEJA 1DCLA 2OK0L 2X70A 1WAAE 4HX1A 2LAGB 3NTCH 5DMGD 5HYFA 4NKOB 3OMZA 1VACB 2WBJC 5C0ND 3GO1L 3AS1A 1WICA 3V6FA 1YUHB 5KSAC 5E8PA 3PGCB 5I17B 5GRVL 1C16B 1S7SB 4Z9KB 2HKFH 1CZ8H 3GGWB 5D7JB 3LRSA 1D9KC 5KOMC 1KCVL 3FQRA 4K9EC 3GDBA 2JJTC 4ZOEA 3SDXF 4N0FB 4XB8A 4ETQA 2AJYL 1PEWA 4OF6A 1LGVA 4URTB 3ARXA 3HI5L 5C9JA 1DE4B 3T0DA 3GSXB 5H8DA 4UBDD 1SMOA 3VJ6A 3QI9D 4Y2DC 2YRZA 2YZ8A 5HHVH 3UTSB 1CDIA 1G1YA 4PGDB 1UADC 1N2RA 1YEIL 4PBVC 3BQUA 1GIGL 4PJFA 2GY7B 2XN9D 4DAGH 4HKXB 3Q3GB 3OHXB 1T1ZB 2XKUA 5K9QG 3HZMA 2ICEA 4ZTPH 1LO3H 1R3JA 1MCSA 1KBGL 4R0LC 2X4OA 4G6AC 2GQHA 5A1AA 4PPTA 4Z7QF 3V6OC 2XA8L 4FXLA 4JY4B 2F19H 4OFYD 4G42A 3RTQA 4WU5B 1HXMB 5D93C 2FX9H 2I5YH 3QZWG 5D6DC 3E1F1 4R26L 4YBHA 1UWXH 3RAJH 1CF8H 1UFUA 4XCNB 3QEQA 1N6VA 5EOTA 4NQCA 4HCRA 3A67L 3LQAL 5ICXB 4OBSA 4HUUB 1A02N 3ZMRA 2GAZB 2ZUXA 3BPOC 3C2AL 1LP9E 4OZGE 5IVOA 5F3HB 2XRAL 2FLBT 2H3NB 2DWDA 1KJ3L 5DHVB 4JR9H 2V2TB 5E99H 1TQCB 1E6OH 5HHNB 5C0CA 3NN8B 1G9NL 4GRLD 1FLRL 3D39A 3G9VA 3FT3A 3MODL 4HS8L 4CRPA 3W2DH 5JQHC 1QFWH 1JHTB 4O51B 4HFUL 4K7PL 3O9WC 3PGDA 3VXTB 3V7AG 4NZTL 4PJ5B 3E8UH 1XCQB 4OFIA 2PTVA 4HUMB 3ZLQC 5FKPB 4GH7B 4I0PB 4NUGL 4WUKL 4DVBA 3GHEL 1QFUL 3L7FB 3WO4C 5HHOE 3JXAA 1F6AA 1A5FL 4X6BA 3IDXL 1QPXA 1TPXC 4HDIA 1NANH 4XPFL 3JTSB 5BO1L 3VMNA 1BJ1J 1WF5A 4BZ2H 3MV8D 2E7MA 3ZYOA 1QFHA 3LB6C 4CADA 4FQCH 5LAXB 1U8MB 5J12B 1O7SA 5HHPA 1LP9B 3DXAA 5ISZD 1BD2A 4OZGB 5C0EB 4JRWA 2FGWL 3D6GA 2SEBA 3E3QE 2P5WD 4G6ML 1NC4B 1DQQA 2D9QB 5I1DB 3SO5A 3S98A 4OAWA 3WIFB 4ZODA 4AENA 3U30B 1MSPA 4XBPB 3FB8B 4W4OC 3B8YA 5C0JA 3MRNB 1MFBL 4KTEL 1QBML 5GGVY 4NNYB 3ROOA 2BY2A 3UJJH 4IOFC 4KAQL 4FFYL 4FMKA 4Q74A 3LHPL 3AM8C 1A6WL 1N5AA 1U3ZA 1WBYB 1XF1A 1MJ7L 3MFGB 3WMSA 5HHOB 4QXGL 4JQXA 4OLWH 2YPVH 3V6FB 5D7KE 5D7JC 5E8PB 5KOVC 3ULVE 1E28A 3IT8D 4WHTA 1GOFA 3QDGE 4PTTA 5DRXB 4UIKH 5F9JA 3WNNA 1X9QA 5HI3D 5BRZD 1MCKA 1N4XL 3EZJB 5EUOB 4IM8A 4LCUA 3BAEH 3HRZB 1RUPL 3QEQE 2D31B 3EYQC 3VGEA 3HTLX 3CXHK 2YD7A 2WBJD 2W9LA 2Z35A 4DN4L 2VXUH 1B0WA 5JW4Q 5KSAD 1KUMA 4LVNB 4TQEL 2J8UF 2ZUSA 1UCBL 4O2CB 1J0JA 5AUMA 1U8IA 5EH1A 3RIAK 1D9KD 1T4KA 4Q9CA 3S97C 2FR4B 2OTWA 1RUAH 3PWJB 1A1NA 1RURL 1D6VL 4F7PB 4RBPK 1JMXA 1D5ZA 2BSRA 3MRJA 4P3CL 4PJ8D 5D7IE 3PV6A 1MCQA 4Y2DD 3H8NA 1CL7L 2DBLH 2FL5A 2L7UA 1QOKA 2HKHL 4FQXB 4EDWH 4PV8B 3H9SA 1T5WB 4RCAA 1IC4L 3QDGB 1NFDF 1FPTL 2KZ1B 1EHLH 3KJ6L 2GKIA 3RTQB 4D0CA 3MA9H 1I7RB 1RZGB 1YEJL 1RULL 4NZDA 3QEQB 1EUUA 1DSFL 2AJXL 3MNWA 4G6AD 3WKNA 1IC7L 1N26A 4XNQA 4PRPD 1Q8MA 5KSBA 3DXAE 4C56A 3VD4A 5E2WH 1TQCC 3RKPA 1FZJA 3FAXA 1P69B 2LV4A 2OJEA 4ODVL 3CX2A 1ZGLB 4LRIC 1JUFA 4GSDH 4HULB 1JPST 3PHOA 3DPBA 3NFNA 1N59B 3DUUB 3DRQB 3SGDI 3OG4B 3IU3B 4NQSB 2ZUUA 1G7HA 2CKBL 4UT7H 4LCYA 4C55A 4JPVH 1VFAB 3KYKL 1OCWH 5HJ3A 5K9JL 3PGDB 4I0PC 5D7IB 4DZ8A 2DJ4A 2BVPB 1J1PH 3D5OF 3MV7E 2YKLH 5HYJA 5I16A 4X99A 1EEZA 3ZT5A 1ZEAH 1VKXA 3P4LA 3RVWC 1WV7T 4MA7H 4H0IA 4JKMA 5TPWH 3BN9C 4JDZB 4MNGA 3HAEA 4P48A 1H3WM 4L4TE 3VFMA 4MHHG 1PW3A 1GYAA 4JO1H 5MEPA 5J12C 2PW1A 5CWSB 1OT1A 2A9NH 3TV3L 3EYSH 3OKDA 4RMQA 4Y4KA 1YA5A 3MQIA 1KB5L 2X44D 3DXAB 2ZCKH 2QHLA 1V3MA 1EEYB 2GITB 3S4SA 5CJBA 4L4VD 5D2LA 3OJDA 3K2MC 1P7KB 4QHKI 1DN2A 2ITCB 2E9WA 5ADOH 4JQVC 5EU5B 4TSAH 4AENB 4WWKA 3L6FB 4J4PC 3GRWA 1C1EH 1B6UA 1NGXA 2VL5A 5BW7A 1MH5B 4PG9B 4LCCB 3LB6D 3GSNH 3QNZA 2MKLC 3ZE1E 3MV7B 1R5WA 1VEMA 4JVWA 2EDKA 5CGYC 4AL8L 5F1KC 1TZGH 1HH9B 3MGOB 1RHHA 1RFDL 5D71L 3NBNA 3I50H 1BZ9A 4M7LT 3WFHB 1MCBA 2AXGB 4TNVK 1EXUB 2WP3O 3TJHC 3CDGA 3RWGB 2HVKA 4WFEE 1IM9A 5H2BA 2ADIB 4L4TB 3ALXA 1JYWA 1GJIA 1IBGH 3H9SE 1S9WB 5ELIA 4Z7UE 3KR3L 1HSAB 3SHSA 2D03L 1OAUL 4HIXL 1LP9F 5GGVH 3DHMA 1XF2A 4OZGF 4O02H 3REWA 1A4JB 2VL4A 4OI7A 2FHCA 2FB4L 2WUBL 4NZRH 5E9DD 4LVNC 4ZOBA 1SEQL 4NM4H 1IAMA 4JZOB 4FQQB 1T20B 4HT1L 4X9GA 4CGTA 3GBNH 3QPQD 3BFOA 2XZZA 4JQIL 1L7TL 1J18A 1NKRA 1R3KA 1U8IB 2X9XA 1T5XB 4J6RL 1QBLL 3VGDA 4ZYKB 3ULSA 3TO4A 2NY4D 2FH6A 4PRNB 4OZIB 1CD1A 5IHBA 5EZOL 4ZPTA 3UTSD 4G8GA 4HXAH 3ULVC 4FQXC 2J3SA 3NACL 5HGHA 1C12A 6CGTA 4NQUA 1KCRH 3L5IA 3RTQC 4OF5A 1NCNA 3H9SB 1S7VB 4F9PC 1U3HA 4MNGE 4Z7UB 2HFFA 2IFFL 1ADQA 2LFGA 3BKYH 2DB8A 4XP6H 4XHJC 4ZFOB 5E00A 1FRGL 4BQ9A 1IC5L 4U1NA 2DICA 1KIPA 4UILH 4XNQB 1XCTA 2VZUA 4JY6A 2C4FT 5EU7E 5TFSH 3VG9B 4XB7A 1I1FA 4LASH 2YUXA 4PJFF 2I9TA 1IM3A 1FE8H 4ZUUA 5HYSA 4HHAB 4K9EL 1JV5B 1RUML 4WI6A 3TPKA 4LLYA 3UYPA 3QO0A 3IRZA 3MCLL 4CJ0A 1R0AH 3OX8B 4JG0H 3WJJA 2VLJA 3GK8L 3VGAB 1A7NH 5F44A 4YK4B 3DX8A 5HI5C 2ZNXA 3C8KB 3QULB 2D0FA 3NAAL 2HFTA 2Y6SC 3K74B 4F7CA 3WFCL 3RJDA 5JW4N 1N64H 4YH6A 3ULVF 4P9MH 4PRDB 1WISA 4XNMA 3AUVA 3LPWA 4KUCF 2HLAA 4GAGL 4G8FB 3T0BA 5HYSG 2ARJB 2PXYB 4Z0XA 3V52L 2X4RB 4MNGB 3HAEB 2X4UA 4Y16B 1YNKL 5DR5H 5I66B 2CLVA 3K1KC 4C83B 4PJ5D 3WHXA 1CDUA 4I0PD 4U0RB 3PIQA 3DVGA 1R3IH 1JMZA 1A4KB 2VR4A 1UJ3B 3ECBA 4LSVL 5IHZA 3RVWD 1SYVA 1HDMB 3UBXB 2K7QA 4NWUL 1HHIA 15C8L 3MTRA 4DN3L 5EBMA 5FYKE 1U92B 3KPPA 3IDGA 4LQ1A 5DJ6B 3Q2CA 2ZOLB 1NCUA 3L3DA 4JFXA 3QNZB 3M1BA 4Z76A 3CC5A 4G8GE 4JQXC 1NC4D 2JCCA 2YHGA 4JFYA 4R8WH 1BZ9B 3AFLA 1A3RL 3BESR 4JGJA 4FQJL 4KDTC 2O5XL 2WIIA 3D18A 3T1FA 3MC0A 2NY2B 3CDGB 5HTSA 1VESA 1IM9B 5DRNA 2XV6B 4CDGC 1ZHKA 5ICZA 1XF4A 4JANA 3SKNA 1XF2B 3VDAA 1UM4L 1NAKH 4F3FB 1XF3A 2R23B 5CGYD 3REWB 5ALBL 1B2WH 5HHOD 3O2VH 4U0QB 2RFXA 5B38G 1KENL 4UIMA 3RZCA 1HYRC 3U0PA 5EU3A 3TJHD 5JW5A 5F21B 1IQWH 3BH8B 5IMKA 2IQAB 4K23L 1BOGB 2AV1B 4LIQL 4X5XA 4XC3H 2ICWI 1R3HA 2BVQB 3CCHB 4CVWA 4WDIA 1Q94A 4ODSL 4JHAH 1AIFA 2AXFA 3UYOD 4CMMA 1HH6B 5F88A 3M45A 1ZHNB 3LCYA 4G8GB 3BD3A 4OM0H 2NY5C 3CZJA 5HHME 3OF6A 4RQQB 2J1KA 4WI4A 5FGBC 1ZLUK 5ENWA 5HGHB 4WI7A 3TO2B 1FZOB 5DK2A 2JKXA 3EGSB 3NFSL 4FQ2L 4YGVA 3T4AB 1W72B 3Q6FA 4PJ7A 4N8VB 4MX7B 5HY9A 1CFQB 2D0HA 3IDYB 2BMKA 2NW3A 1UWEL 4HUNB 3LN4B 3BE1H 3VG9C 4AMKL 3CH1A 1KACB 1MELA 4KKBC 5J7CC 4JPKH 2ATPA 1JHLH 3BRFA 5D7KD 3EBAA 4DVRL 2AK1H 3UTPE 1BJ1H 4FQXD 4LSQL 5SV3A 3CFKA 1IM3B 1Z3GL 3QDGD 4FN0A 1K9TA 1JNJA 3WS3B 1WFUA 2FWOB 3HB3D 1U91B 4U31A 1BQUA 2FSEA 3VGAC 3QO0B 4YK4C 2FX7L 4XHJD 3WXWL 4B5EA 4XX1E 4S11A 2F53A 3DX8B 5E6YA 5E24E 4JFZL 5FO8B 4JKLA 3ZO0A 4NCC1 3TBYB 5HHMB 4F7CB 3QYCA 2XICA 1MF2L 3P4NA 1EBPA 3TPUA 1E4KA 3PG2A 4W6WB 2HLAB 4LPYA 2Z8SA 3LEYL 2AEWA 1WZ1L 1YPZE 4OCRL 4DUWA 4M61B 2ADGB 5J1AA 2IBZY 2X4UB 3BP5B 2CLVB 4LU5H 4U0RC 2VQ1A 1BP3B 5EU7C 1M7XA 5HI5D 5DFVC 5KAQF 1JWSA 3THML 1FVDB 1YDPB 2WINA 2Z8WC 3IDMB 5KSBF 1S7RB 3G6AB 4HWZA 1LDPL 2FHFA 1UJ3C 3PIQB 1R24B 1MRFL 3HNTL 2G5BA 3IDIA 1RHFA 3RY4A 5GISL 4ZUTA 5I1KH 1ZXQA 3EDDA 4HGWA 2EDBA 2Z4QA 1UQSA 4RZCA 4WWKC 2VKXA 4XMLL 1FL5B 4DGIH 2AI0L 1PG7W 3MBEB 3WD5L 2OXGA 1QRKA 4NQXA 1X5KA 3D0VA 3U36B 4X4YA 3IJYA 5IFAH 2DQFA 1QRNA 3WKML 4N5EC 1KTRL 1YECH 4JFXB 4B53A 1FG2B 3V6BR 4JFHE 2DQIL 2FHBA 2EEAA 1KPRB 5FYLE 2NY2C 4PD4K 4MQ7B 1YPZB 1IZKA 1P7QB 5C7XL 1ND0A 2VR9A 1KCUL 4XMKH 1PBYA 5TQ0L 2Z8VC 3C08L 5DQ9B 3L3IA 1SBSL 3MV7D 3RWHB 3O2DL 1BIHA 3GSNA 3IYLW 5E6IA 3SKNB 4X9BA 1T7VA 5D2LF 3H7LA 2RFXB 4M6OH 4FABL 2MNUA 3NZ8A 5DEGB 2CR6A 1U8KA 1T03L 2ARWA 4L4TD 3FO0H 3WBDA 5E70A 4U05A 3B4NA 3VRJB 2OSLA 4NO2A 1S9XA 4LCWA 4WDIB 4XT1C 4MDJB 2X9WA 1FAIL 3BPCB 1FN4A 3VA6A 2WV3A 4HS3A 25C8H 2VC2L 4HSQA 4NN7B 3DECA 4I77H 1KGCE 4M5YL 1WEJL 3MRFA 1CGYA 1FC2D 1F6LL 1K5NA 2O5YH 3S3JA 2DM7A 5EC1A 5BVPL 4XPAL 1GVIA 4KQ4L 3GKWL 3SBWA 4WTZA 3IDYC 3PJSA 4HS6B 2BNRE 3LS5H 3MJ8A 3U1SH 1IKFH 1MFCH 3PGFL 4YGVB 2VAAA 3OXRB 4QHUB 4YAQA 3AS3A 2V5SA 1BAFH 2B0SH 1JTPA 3CH1B 1KC5H 4GKZB 4LMQI 1U8JB 1OGAA 1WBXB 2O61B 3JWDH 1A3LH 4WFED 2VRAA 3MA7A 4Y1AE 5C0RH 1MCOH 4C4KT 5DDHB 3WJJC 3X3GH 3KPOA 1P6AB 1ZSDA 2NZ9D 4P2QE 1ITBB 2VZVA 3F12B 4ODXA 3BGMA 4U1GB 1NC2A 1JWMA 4IS6B 2DQJL 5E95B 1QRNE 3F7RA 3CAFA 2HT3C 1PYWA 4V1DE 1RJLB 2CXKA 5EG6C 2R29H 1DANU 4UQ3A 1KIUA 1MCJA 1NBVH 5H37H 3DROB 3FO1A 2IADB 1Z6JT 3HE6A 4Y19A 5ILTH 1LHZA 3NH7L 3V4PH 1HEZA 1T22B 2B5IB 1DBML 4NJAH 2VERN 3VXQA 2BNRB 1KJ2H 5JPNA 2AEQH 3EOTH 3BP6A 3GNMH 1JPSL 2R0KH 3CK0L 4YHKL 5JQ6H 1FV1A 3N85H 1JK8B 4GRWE 4FNLL 4QXTA 3FO2B 2VLKA 4Y1AB 2QQLH 3LKOA 2PXYD 4ZMAT 5M95B 2B8OT 4HLZH 4Y16D 4HGWB 3MBEC 3O3DB 4L8DB 4P2QB 2YEZB 5F1IA 4Y4FB 3Q6GH 2EDHA 4X4YB 5JA8B 1DJSA 4JN2B 4HBQA 4PRIE 2P8PB 2DQFB 1QRNB 3MLYH 5F70A 4JCLA 4MJIA 1DUYA 1NCDL 3E6HA 4BJLA 1Y0LA 1IGJA 1T0MA 4QHLB 4V1DB 4YEEA 3PQYE 3SOBH 2AJSL 2C7UA 1KN4L 2VLRB 5GS0H 1I9JL 1T1YB 3RIFK 4G3YL 3DYPA 2JB6A 3IFNH 1RUQL 4WI8A 4KDVA 4PBWD 1ND0B 5GRYA 1G6RH 3WFDH 3EOBA 1IAIM 5E2JA 1BQHB 4NYLB 1CGXA 5LGHL 2UWEA 4N5ED 4ZUSA 1XGRB 3HS0A 3U6RA 3QO1A 4OQ1A 4ALAL 4GRWB 4YX2L 3G6JA 3RZCC 1I8LC 4U1SA 5LCVL 2H32H 2ZUWA 1OGAE 1S7QB 3TYGL 4S10A 4KI1A 4RBPH 5T1LA 4PG2A 4NWTL 3M8OH 4QF1B 1YJDL 1XT5A 5IVZA 4DQOL 3FB7A 3TIEA 1A9EA 3KHQA 5I1HL 4KHTH 2VDRL 3LKSA 4PRIB 4YDIH 3CFCL 4F57L 1OAXH 4RA0C 5EZIL 2Q76B 1ZOXA 1N3NB 3F7VB 1BFVH 3V4VH 2XWJA 8FABA 1FN4B 2JCCF 5IW6A 3PQYB 1KT2A 4NQEA 3PXHA 1J87A 3BJ91 3L3JA 1KIRB 5AWNH 1PX4A 4ZS7H 3X13A 1HHHB 3P77A 3EOYG 3MRFB 5FYKD 1SHMA 4HWUA 1RSFA 5I8CB 4LBEA 4JJ5A 1A64A 4N0YL 4ZQKB 4MLIA 4Y19E 1BX2B 1MREH 4BFEA 4HIEB 5DJAA 4X0KA 3H3KA 1YMHB 2G9HB 1QKZL 3V5DA 1MRDH 2I07B 1OGAB 5E8DH 2XZCH 4MMXC 4Q7DA 5GRVK 5E2TH 4L8CA 2R0WH 3QUYB 1T7WA 1PZ5A 1ZLSL 1ZSDB 2PTUA 1IAOB 1T0NA 1IC1A 4MCYB 4IRJA 1DFBL 1OAZL 4U1GC 2VQTA 4HBCH 3EFDH 1UH4A 3ZHLA 1FGNH 3QUMH 2APFA 2VB5A 4YFEA 4MJIE 5T5FH 3O6ML 5D72L 2DQDL 1FVEA 4MWFB 4ZAKB 5GS1A 1XGYL 3QJFB 2V9QA 4LFHD 1FZKA 1YY9C 4Y19B 3L7EA 4HC1L 4PJ7F 3TNNA 3O6KH 4XPBL 3K4DA 4XXDA 2E9IA 1MHPH 3QFJE 2J88H 4OLVH 2C1PA 5MERB 4RNRB 5HHMD 1FNHA 2Q86A 2WWMD 2EYTA 4P57B 1KCKA 1XAUA 2EH8H 1I7UA 1MVFA 2HT3D 4DKEH 1RIHL 3G6JE 3BUYA 4ZFOL 1KTDA 5IB4B 3IGAB 4I48A 4LQFH 4FQHA 1WUNT 4QHKJ 3OKOA 1DVFB 4Y4FC 3PABA 1EO8H 1A0QH 3X17A 3RY6A 4ODTH 3GSRA 1A6AA 4NO3A 5DSCA 4LSPH 1N5YH 1QSFA 5GIRB 3UTPD 1FFQA 2V5YA 5CBAA 3O6FB 4MJIB 1V7MH 3WIHL 4DGYL 1DUYB 1IEAB 3AB0B 3W0WE 5HPMB 4S1DC 4DKFH 1CBVL 4JO2H 5GGRB 2ZPKL 1E4XH 2CRYA 4K71B 3G6DL 3INUH 4XP4L 3HI1A 1RJYB 1LK3H 5IV2A 3MBED 1YYML 3MACH 2YC1A 3QCVH 5K9KB 3QFJB 3VWJB 2CJUL 2MHAB 3L95A 2AABL 3LY6A 2BERA 1J1OH 4R9HA 5C86A 3MO1A 4UU9A 2DWEA 3L5JA 3I9GL 1KPVA 3G6JB 3SQOL 3L3GB 3MR9B 1JNLL 1TZHB 4PJEE 1U8HA 2XYCA 1GZQA 2HYMA 2VABA 4POUB 1MCPL 2X4SB 4BSVB 1P7QD 3T3MF 4OGXL 2H1PH 4LLWA 3ES6B 1DQMH 4J3SA 3F62A 2Z92A 3BW9A 4EI5B 4JPWH 4RGOL 4HH8A 1U2HA 1WIOA 4R4BB 3R0MA 1MJ8L 3MLZL 2L0DA 5AYQA 1XF5B 4IDLA 3WFBL 3RDTB 1GXEA 2XZQL 4O4YL 4MSWA 3W0WB 5HHXL 4JKKA 43CAB 4KZEL 3IVKB 2ZCLL 4AT6A 3RHWF 3NVQA 4HUKB 3QT2A 2PYFA 4M7JL 1UKTA 3N1GC 1OHQA 4JJ5B 2PCPA 3MLVH 3I6KA 3KPMB 1FIGL 4MJ4A 4P46B 1YEFH 4JFHD 4BQBA 5AD0A 2R8SL 5H35A 4Y0GA 1DQJA 5FYLD 4MQTB 4JPIA 4TULH 3J8F7 2VTFA 3GUTB 5KJRH 4PJEB 3N1PC 3IAQA 2XWTB 3T2OA 3QUYC 4RISL 3RNKA 3H9ZA 3HPJA 2VOTA 1NGWB 3QQ4A 4HFWB 3GJFK 35C8H 2YR3A 3C2SA 2H9GA 4H1LH 2DQEH 1X7QA 1UM6L 1I1YB 1MCRA 2K3TA 2RB8A 4M1GL 3UTTE 2EYSA 2D7PA 2ARJQ 2Q7NA 3VXRA 4JB9H 5TDPA 3GMOA 3VXUE 2CDGA 1TITA 2J7LA 5I8KL 5IROA 3F8UB 3LEXA 1KIQA 5TE7L 3OB8A 2F5BH 4NQDE 3L1OH 5L6YL 4LNVA 4GW1B 4F7EA 1HWHB 2HJFA 2RHEA 4UV7L 3U46B 3MRBA 5DD1L 3MRIA 1HXYA 2EDXA 4XXDB 3STZB 3BPNB 4R4FH 1LO5B 3CD4A 5ACZB 1N0XH 1KGCD 5CD3B 1DLHA 2JJSA 3V9FA 2DD8H 1KLGB 1W72L 2OQJB 4KUZL 1DVFC 4LSSH 4PB0H 1JWUB 4DK6A 4L8SA 2BNRD 2RCSH 4FQHB 1LEKA 4FQIH 3MRMA 1J5OL 3CSYB 1AXIB 4O58H 5DUBA 1N6QH 1KJ2A 3S7GA 4Y5YA 3QHZH 3TFKD 1S9YA 3MXWH 4NO3B 4XP9H 1T6WA 2YBRA 3O6FC 1HE7A 4HXBL 3UTTB 1BVKB 4JM4H 3HMWH 3AB0C 3VXUB 5JIPA 4Y1AD 3KPLA 2P5EE 3ARED 4ODUB 4K71C 5ERWB 1QR1B 1KJVB 1PSKL 3VDCA 5C71A 3LRHA 3UPAA 4NQDB 4OCXL 4P2QD 2VH5L 3EYUL 3KYNA 3BI9X 4EN3A 5ITBH 4Y4FD 3VWJC 5KSVA 1AGFA 4U1LA 5INDB 4JLRA 1QA9A 1UA6L 1INDL 2HTKC 4ELMA 4XAKD 4AYFA 5JUEH 4LARH 3BSZL 4NOFA 5EOQL 3IKCA 3QNYB 4V1DD 3MO1B 3ZE0E 4RWHA 1Z5LB 5HYIA 2E7HA 3GSVB 4DTGL 2VLRD 4GMSH 1NLBL 2YA1A 4ZUVA 2GK0B 4PG2C 3DSFH 1A7PH 4M3JA 3TN0A 2PNDA 3EJZC 3U7WH 3U4BL 2MCPL 1RZKH 4JM2D 4EI5C 1G7QA 5HGAA 3CLEL 4K8RH 2ICWJ 3G04B 1G6RA 4HLZG 1GH7A 8CGTA 5CJOL 5INCA 1EGJH 2EIZA 3AMLA 4G43A 3RDTC 3VFSA 1ZLUH 2GJJA 2X7LB 2Q6WA 4L8BB 4MQXC 2OYPA 2P5EB 4L3AA 4PJBA 4QRSA 3B2VH 3CFEA 4MSWB 1F58L 1OB1A 4G6FB 2ADFL 3VI4E 2BCKB 1OPGL 3QP3A 1LK2B 2QBWA 2DQGH 4KRLB 4UINL 4P46C 4PRID 1MFEH 4HIHA 1D5MB 1OP5K 3UX9B 4ZFGH 4EXPX 2WK2A 3JWOL 3UTZA 3FFCA 4WIQA 5JNYA 3PQYD 3VFOA 1CK0H 3G6JF 1NDMB 3O41A 5CP3H 4TNWF 2H8PA 1RZ7L 4JPIB 4K3EH 2AP2A 2RBLA 3VXMA 4D9LL 2OR9L 5DD0L 1TVDA 1ZT4A 1HNGA 3QZWB 3TBVA 5DYOA 2A83A 3UPRB 4K94H 2YD9A 3ZTJG 4E41E 4G7VL 3FN9A 1V05A 2Z91A 2H9GB 5IFHL 1UZ6E 2HVJB 3F58L 5CEXA 4L1DA 5JDSB 1I9IL 2CDGB 4AIZA 3LPGA 5FA4A 2KPNA 3QA3B 3QUYD 5D5MA 1CTOA 4LPWA 3QDAA 1FYTA 5E7FA 5CBEB 4LCIL 1FL3A 4JRYA 4U6VL 4GW4B 3WFEL 3BPNC 2OL3H 1FC1A 5FYLL 1MIEL 1GPOL 2EIBA 3UJTH 2JB5L 3MX0A 1TZIA 3MRIB 5BMFL 5L2KE 4PJEF 1NCBH 4R4NC 1RZ8B 1JF1A 5D2NA 1OT2A 1Q0YH 3QUMA 5DJ2A 1OQOA 1A6PA 1I7TA 3TT3L 1YEDA 3T0EE 4WUUA 4ZAKD 3DTXB 3W39A 4CW1A 4J1UA 4Q9QL 1ZA6A 1WCBA 2Z0BA 5T3XH 2Q1EA 3LEVH 5C0BA 1NMBL 1SQ2N 5IG7B 1MRCL 1NH6A 4E41B 3RY6C 1GL4B 2X6MA 3MRMB 1UYWH 5HVGB 2X4NA 4P99A 1BBJB 3H0TA 5LBSL 1JZ6A 3P9MA 2R56H 3B9VA 1ONQB 4Q97A 4W4NA 3WS6A 3C60B 1F11B 5AZEL 2HWZH 2DLEA 1NAMH 1I9EA 4P5TB 4D3CL 4M43H 3S88L 1MFDH 3CUPA 4JVPA 3MCKB 1DVFD 3BMVA 5J11B 1YEGL 2BSED 5EDXA 5I71C 1BVLB 5FYJH 4PGBA 4I3GA 4HUWB 1QUNA 1ITCA 1X5GA 4P23B 1QA9B 2YS4A 1CICB 4M4PA 5GRJH 2NX5E 1CD9B 5L2KB 3O6FD 2R4RL 4D94A 2AJZB 1VFUA 1KELH 5I1JL 4K7FA 3T0EB 5I19H 2A6KA 3RVUC 3IDNA 3RL2B 3CZFB 1QSZA 1MCEA 3MJ6A 4ZD3L 5I73B 3IXTB 3TWCH 4YUEL 1K4CA 1F90H 3QFJD 3VWJD 2DQHH 1X4YA 4Y88A 1JZ3A 4KKCC 2DKSA 1OGTA 5JW4M 2LQRA 4F37F 4NJ9L 5INCB 3UMTA 5HYQA 4G43B 1MQ8A 1Q9KA 4L3EA 5F89A 3FN0L 4UNUA 5E5MB 5L8JB 4NNXA 1WT5C 1QLRB 4LGSB 4XPHH 5I1IL 1LQSR 3HC3H 4C4KO 4BFIB 4H88L 1SY6H 2X1WL 5SX5K 3GI9H 2ZCHL 3WNKA 3SGDH 1FORH 5K33A 3EJZD 3QIUA 5D5ME 4I2XE 3DVNA 4LPCA 3O11B 4EI5D 1FYTE 5LJYH 1SM3L 2GJZA 2KBGA 1X5HA 1J12A 4F7MB 2NX5B 5JOEA 1L9NA 2IG2L 1S9VA 2NY7L 3RDTD 3UTZB 3OR7A 3W0WD 1CR9L 3GMRB 5JNYB 2BNQE 3F6LA 4MQXD 3SGKC 3O45A 4GG6A 5D2NE 3IETB 3BKCH 4E9LA 5I0DA 1LO2L 1F4XH 1XMWA 2WUCH 3L3HA 5MENE 5C0BE 3FQXA 3P30H 4P46D 4WWID 5D9SB 4FXKA 5ETUA 3FTGB 2VXTH 3QUZA 2P44B 5DGRA 3S36X 3L5WB 1LO0L 3I6GB 3W9EA 5CEXB 5IROC 4HJJL 4S0TD 5GRWA 4Z8FH 3OB0K 4Q2ZB 1H3TA 5FA4B 1AQDA 4FFWC 2EDTA 5D5MB 1AQKH 4I2XB 2IWGA 3LKRA 2C3VB 4OV5B 2A2QT 1FYTB 1D3CA 1BF2A 4UUJA 5DURB 3BD4A 4APQB 4JAMB 5D7LA 2MQ3A 1CFNA 5JOFB 5L2JA 4H1LA 5IOPA 2BNQB 2DYPA 5DD3L 5I8EA 3V5HA 1JF1B 1WGOA 2WQ8A 4Y4HB 5D2NB 5A2IH 2N7BA 4G8EB 1VGKA 3SJVE 3O3UN 4MAYA 4K7PY 2E7CA 3VG0L 4G6JL 4CW1B 4J1UB 4WFHE 4XCCL 5MENB 5I2IB 2HRPL 5C0BB 4M93B 1UENA 1FHGA 4J3WA 4QT5A 4I4WB 1ED3B 4PY7A 3UBXI 3GMPB 1HNFA 4FZEH 5DJ0A 3SDDA 2D7TH 3FT2A 3I3BA 3C60C 3MOAL 3PWUA 4PRHA 5FO9A 3SE3A 4R4ND 2IGFH 3VI4F 2ZOKB 5TE6H 4P5TC 3VMOA 3FFDB 1FNSH 2GFBB 5J11C 5IQ7H 1FBIL 2BRRH 4KTDL 1JZ7A 3DI3B 4P23C 5E6ZA 1E4WH 3HNVL 1CICC 1ZS8B 3QCTL 4ZFZA 3UTTD 1ZA3B 4H8WH 3VXPB 3FZUC 1D5XB 1QVOB 1QHOA 2X4QA 3T4YB 3VXUD 1WIUA 4GS7B 4G8IB 3T0EC 1C5DB 4YHOH 2BOBB 1K3IA 3SJVB 1Z9LA 3IXAA 4NQDD 5TDOA 1R5IB 1NKOA 3TN0C 3RWEA 2VJXA 3B2UC 3MYZA 3VI3E 5IFJA 5HXMA 3MRLA 1IILE 4GBXA 3ARBD 3X14A 4ERSL 3SGJC 4KK9C 4CNIB 4XCEA 4FZ8H 5CSBA 3PWPE 5TDNA 5HYQB 4XAWL 1Q9KB 3VXSA 2VQUA 5IVNA 2ED8A 3ALWA 1GAFL 1X5JA 4NNXB 4A6YA 2FX8L 5IMOB 2KUTA 4JFFE 2OK0H 1M7IB 3PP3K 2HRLA 4X7FC 4BKLA 1E6JL 1GZPA 3GIZH 2AJVH 3DVNB 4ELMF 2J12B 1EZVX 3IJHA 3GO1H 2GJZB 1J88A 1ACYH 5IK3B 1BOYA 1PAMA 1A2YB 1EGJA 2P5ED 1MCWM 4QTHA 3OR7B 5EWIL 2ZKHL 2P1YA 4G6FD 1WTGT 2R4SL 1IGFH 5B3JE 2B4CC 4NO0A 3T2QA 1WITA 3O45B 1VPOL 4AG4L 3T3PE 2Q20A 2IF7A 1I1AA 1SYSA 2AJYH 3EYFB 3EO9H 3EO1A 1P4LB 2PO6A 3C5ZA 5EIVA 4NC2B 4OKDA 3L3HB 3WJLA 4GXVL 4AY0A 1YEIH 4PBXA 4FXKB 5ALCH 1G9MC 1X5ZA 1DBJL 2R9HC 3PWPB 3QUZB 4LLUB 1T6VN 3AY4A 5KBNC 3MGTA 1MI5E 3RIAF 5E8NB 4PRHE 5ANME 1NFIA 4LRNH 2VE6A 4X83A 2VLLA 3DO7B 4JFFB 2XPGA 1AQDB 1K2DA 1YEEL 3IFPB 5JHLH 3KYMB 4APQC 3QDJE 3S36L 3P73B 5FECA 4PGEA 5FK9B 3MRGB 4WI5A 2R0LL 3D2UA 3JTTA 4Y4HC 5BVJA 5D2NC 5DTFA 1MY5A 3QQ9C 5FUZL 2VDPH 1F4YL 1CT8A 2QADB 3WSQH 3RGVA 2DTMH 1QFWI 1YNLL 2BVUA 2DI7A 4HG4J 1NDGB 4FFWD 4M93C 2WM0A 2RIKA 4UDUA 3OV6A 5HGGS 1FLTX 5FB8A 3H42L 1CGWA 2AXJA 2AV7B 1KYOK 1JPGA 4TUJA 4ZO7A 4ZXBB 2NY0B 5LWYH 1JGUH 4F58L 3P0VL 4BUGA 2OL3A 3ARFB 4YHNB 3BOVA 5DJ0B 2H6PB 5I1AB 2AJ3B 1G9NH 1MI5B 1FLRH 3CSPA 4PRHB 3MODH 5ANMB 3VXSE 1LO4L 5D5MF 4QXUL 5BV7B 3TBTA 4HFUH 1EJOH 4IRZH 1KG0A 4E41D 5JR1L 2OM5A 2EDLA 1P1ZB 1CXFA 3NA9H 3QDJB 5C0AA 3GHEH 2EKJA 3DX7B 2VZ3A 3JUZA 1QFUH 4GS7C 3E6FB 4POZC 3HR6A 5IB5A 4E5XA 4QOKA 1I3VA 2BOCB 4XVSH 2CR3A 1A5FH 5C07A 4XVJL 3C60D 4XPFH 1GGUA 3QG6A 1NPUA 4YZFE 5BO1H 4P5TD 2C3WA 1TFHA 4QXWA 4KRPB 1FJ1A 5LQBH 1OF2A 4PJHA 5EPMA 4X6DE 5I6XC 3S34L 2FBOJ 4OCMC 3NA4A 5IEHA 2VISA 4CJ1A 4IDJL 1U8LB 1CLOL 4P23D 1CICD 3MRLB 3RPIB 2FGWH 1FNEA 5L2KD 4HIIA 3FZUD 5K9OA 4OGYH 4UTAL 4F7TB 5B38B 3IFOB 4K55A 3T0ED 3BDXA 1AFVL 5TDNB 2Z9TA 3VXSB 4X8XA 3R8QA 1YY8B 5E08L 4KY1L 3REVB 5IW1A 1C08B 1DQDH 1MVUA 1QBMH 4A6YB 1I4FA 3B2UD 4YBQD 3QIUC 4BUHA 1CLZL 2APWA 4FFYH 4KAQH 5SX4H 2RQ8A 3LHPH 1HHJA 4BKLB 2YD6A 1GZPB 1IKNC 1MJ7H 1MHEA 4JREB 3TIDB 3IJHB 5BZWB 5FKAB 1QLEH 4TNVF 3VH8A 2AW2A 4RAVA 5C1MB 4KK9D 3ZL4L 4YO0A 5B8CA 5KANI 3HZVA 4DZBA 2FO4A 4ELKA 3GJFH 4ZUWB 4K3HA 1IAKA 5DMJB 4NO0B 4HKBA 4X6DB 4IJ3B 3F5WA 4OZHA 1N4XH 3QUXB 1SYSB 4JO3L 2NTFA 3EO1B 1RZJL 3VWKD 1A6UH 2NX5D 5EIIA 1EH9A 4DN4H 3OBAA 4GMTL 3IB4A 3QUZC 3N1QC 1CXHA 3G9AB 4HMDA 2OP4H 3K80A 3S96A 3TESA 4TQEH 3VH8G 1AD9A 2EDWA 5EFIB 2CDEA 2CRMA 1KTLB 1RV6X 2X1QA 1VENA 1VSCA 3CNKA 1ZWIA 1RURH 1T7ZA 3EYOB 1MHCA 4LVHB 1D5BA 4OUUB 4MZ2A 2VXVL 1X5IA 3CXDL 3DURB 2J6EL 3GSQB 1MJJA 4UQ2B 3MLWL 4PGEB 3TF7C 2H26B 5C0AE 4QHNB 4NQVB 1M6OA 2R9HD 2QADC 3RWFA 1B0RB 4QOKE 1ZTXL 4GG6F 1IC4H 3QEHB 3B3IA 3DV6B 1FPTH 2ATKA 1GC1H 2XACC 3LH2H 5B39A 2IAMA 3QXAB 1YEJH 1RULH 2E9BA 3UTQB 3TBSB 3MRRA 1U3JA 2F8XC 2ZSVB 1DSFH 4PJHE 4U4BA 2GTWA 3VD7A 5DURD 4ZXBC 1RJZA 3MFFB 4KI5E 4BFGA 2NY0C 5FB8B 1ZT7A 5SV4A 4APQD 3OAZK 4I3SL 3ARFC 3ARDA 2BNQD 2V17L 3Q0HA 5IEKA 4CMHB 4IRSA 5DZOA 4ODVH 5C0GA 2XQYK 1UXWA 4Y4HD 3CVIL 3QQ9D 1NQBA 1K4DA 1CE6A 4ORGA 5BV7C 2CKBH 4OCYL 2BNUB 1QR4A 5MEND 3KYKH 5IBLC 2LTQB 5C0BD 1DBAL 3P3YA 1JZ4A 5T33H 4YHML 1XR9A 5IBUB 2W0FB 1HCFX 3OG6B 1IGCH 5J89A 5C0AB 4ZPVA 3VCLA 4HF5H 4QOKB 4JG1L 3T3PF 4IHOA 4KRPC 4EBQH 1ROWA 3UDWC 4X6CA 4NGHL 2OZ4L 3FQNB 1FJ1B 2X89D 4YHYB 2F74B 3TV3H 1JGEA 4OCLC 4OCWL 2VISB 5EOCJ 2E8ZA 4UNVA 1NEZB 5DRZB 2AEPH 4R3SA 2LVEA 5SWSD 1FNEB 4IMLA 4POZD 4HIIB 3VFGL 4WENB 3BEVB 5K9OB 3Q5OA 3SJVD 3ROLB 5DVKA 5HYEA 5B4MD 1WFNA 1I8MA 3LS4L 3LKNA 1F2XK 1ETZA 1T7XA 5DJDA 1OP5H 4X80L 3HMXH 3I85A 3K0WA 4S1QL 4JREC 4O00A 3OJ2C 2EE6A 4ONFL 3NCCB 1RIVH 1VFBA 3VFWA 3VGFA 1TJGH 2J4WL 4DGVL 4PJDE 4OB5L 4WI9A 5IESH 5A16A 3S8WA 1ZLWH 4Z7NE 1CG9A 4MXWL 3A0OA 1T2QL 4IJ3C 4DZBB 3JWNC 3TZVA 5KVEH 3QUXC 5IGXH 1I1AC 3KR3H 4HIXH 1H3GA 5GHWH 4X7DC 3VFTA 2NTFB 3CPLA 3MLUL 5HDQL 3LPFA 2AEIT 2FB4H 3FL7A 1AC0A 1SEQH 3U4EA 4HT1H 3Q5YA 5CSGA 2V7HB 3UZEA 1J8KA 4XBGA 3S96B 2R69H 4Z5RB 2GY5A 3PWVB 4JQIH 1TDQA 5JLZB 1IZJA 3MRHA 4LVHC 4M8QA 1AXSA 4S1SL 1U8QB 4WV1B 1ZWIB 3O8XB 4PTUA 3P9LB 4O5LH 5EU4A 1D5BB 3STLB 2VDQH 4LHUG 3Q1SH 3K8KA 1QO3B 4PJDB 3PWPD 4NZUH 2FECI 1NBZB 1G0XA 4YZFF 1C7TA 4R96B 4PB9H 1XEDA 1KXQE 1DL7H 3B3IB 1KCLA 4JFFD 2ATKB 1B88A 4J23A 1JZ8A 5T3ZL 1MCDA 5B39B 1RIUL 3ZYZA 1FRGH 2R2BB 4K3JL 3MV11 3HUJE 2MOVA 4J7RA 3CVHL 2HJLB 1CFVH 4WHYH 2DAVA 5CAYB 4CMHC 1AP2A 3MLRL 3ME0A 3VFPB 3AVEA 3GMNA 3TA3A 5I1EL 4K9EH 3PL6B 2QADD 4J8RB 1YYLL 5C08E 5DJYB 3MCLH 3UJIH 1MWAB 3MMEA 2R2EB 2LU7A 1W0VB 3GK8H 2LTQC 4YE4L 5IR1A 3BDYH 1HHGA 5L7XL 4Z7OE 1AY1L 2PW2A 2EICA 1AGBA 1K8IA 3ULUL 4ZXBD 2NY0D 3QFDA 1CXLA 1J0KA 1YMME 5KVDH 2YWYA 3MPCA 4OD2B 2IH3A 2IMNA 1WTLA 3ARFD 3JV4A 3CFBA 1MI5D 5F7DA 4GAGH 3VCLB 1A1OA 4Q0XL 3C9NA 2UZIH 5DT1H 3V52H 4C54A 4N68A 1ZT1A 4RAHA 5CP7A 1HSBA 4M6MH 3KDMA 3FCTA 1CGSL 4KI5C 2MCG1 5JW3H 4O2EB 2Q7YB 1DBKL 5IBLD 2ICWA 3QDJD 3HUJB 1RMFL 5MP6L 3BWAA 5F1NB 3QBTB 5CD5C 1DBBH 1UH3A 4LLMA 2I25N 2DQUL 3SKUD 3HFML 4LSVH 2BFVH 3JSSA 4IMLB 5C08B 3TVMB 15C8H 4DCQA 3WDHA 4DN3H 5MEOB 1ETZB 1JP5A 1UWGL 5DMKB 1HQ4B 2X40A 5DFWH 3QSKB 3IFLH 3D87B 2GSGA 2O93L 3D3VA 1OD9A 5DHYB 1YMMB 3RPKA 4FFZL 4HGKC 3SEPA 4RX4D 1A3RH 1HI6B 2F5AH 2C5DC 5SWZE 4FQJH 3LDBB 1T1WA 2O5XH 1S7TB 5A16B 3NFPA 4OLXH 1JF6A 2LAAA 3V8CA 3U0WL 4PJHF 2W65A 3KPSA 1JRHI 3BD5A 4KI5F 1K8DA 4GT7A 3KPRA 5GPRA 1OP3H 1DQTA 1IGML 1UM4H 4ZSOE 3OKMB 3ZTNH 4XXCC 2E6JA 3VFTB 3CPLB 5ALBH 1DEEA 4XNXL 7FABL 1A7BA 4JY5H 4AM0A 3CJJA 4PGJA 2FD6H 4KQ3L 3LKQB 4HD9A 5DF0A 3C6LB 1FCCA 2WW8A 3O3BA 4K23H 1JN6A 3C5SA 4I3RH 4CVZA 4LPUA 4NUJB 3MRKA 1FH5H 1LMKA 5J9PB 3QUXD 3O8XC 3GJFA 4YGAB 4ODSH 5F7EH 4GAFB 1NJ9A 4GO6B 5J57B 1S5IL 2Y06L 1Q72L 4Q9RL 1KEGL 2DQTH 3PWLA 2A6JB 3F7YA 3MUGB 4KVCL 4ISVA 3A6OA 1CFSA 1EVTC 5SWZB 4P5KB 1J1XL 4UDTB 4XNYL 3ZYJA 1RY7B 1MJUH 2IAMC 4YHLL 2EXWC 3PP4L 4YXHL 4OZHF 3PHSA 3O2WL 3SY0A 2BVOB 2ESVE 4D0BB 5HVWA 4ZSOB 1UWEH 4JDVA 2GUOB 2KDGA 3FN3A 4NO5B 4KU1A 2ZWLT 5LGJB 4HKJB 5C8JA 2F58H 3PL6C 4LSQH 3MLXH 1Z3GH 1C5CH 1Y6KR 2HKFL 1CZ8L 3HC0B 1CFTB 5D1XB 3WXWH 1AGDB 1NUFA 1JPTH 5IB1B 3QI9A 2GT9A 4U1JB 4PJDF 5GXBB 3NIGE 4YEFA 1AGBB 2HT2C 2ZJSH 2XN9A 4NT6A 4OT1L 4U1HB 5HHVL 3SPVB 4N9GA 4QYOA 4Z7NF 2QHRH 3CFBB 1U95A 5JHDD 4DAGL 5J56B 1WZ1H 4MB3A 3C9NB 2F54E 5LVEA 4Y2OA 2ESVB 3ARYA 5JORB 2CKBA 3QB7C 4ZTPL 1MCWW 2QSCL 4FA8A 2V6HA 4H5SB 1S5HA 1UT9A 3KPRE 3THMH 5IJKA 2QTEA 1KJMA 2ZUYA 5ICYB 1ZANL 2APVA 5AYUH 4QOKD 3TVMC 4U6HB 5GISH 3EHBC 4OFYA 3CDCA 3OKEB 1HHKA 2IPKA 4OKVA 3PP3H 3V0AC 2BHZA 2QV2A 4ONOA 1FYHB 2AI0H 2W9DH 4GG8B 3WD5H 5GGQL 5TH2A 2FX9L 2MQCA 1IGYB 4NKMB 5KVGH 1H0DB 3AAZB 1WJ3A 5DHVH 1WZKA 4RFOL 5CD5D 5ESQA 5DS8B 4YDKH 4TVPE 1W2KT 1KB5A 4CBPA 3NABH 3LDBC 3LN5B 3PWNA 1F45A 5JO5B 4GRLA 5BV7L 1VEOA 3V5KA 4R90L 5C09E 3T0VA 3RIFF 4JR9L 4H20L 5E99L 1T1WB 2CK0L 3VMPA 5EBGA 2HA1A 4XVTH 1IE5A 5C7XH 2F54B 4MJ2A 5CHNB 4X6CF 1M05A 3C08H 3L3KA 3DIFA 3W2DL 1DP0A 3UTOA 1UG9A 2I24N 4YXLL 1EFXB 3BP4B 5IKCB 1IAIL 2DTSA 2IAND 3E8UL 4RWYL 3QDHA 1FO0B 3C6LC 3DX9B 4FABH 5EO1B 3U4AA 1FNGA 4W68A 1T03H 3V79C 2YUZA 4FMFA 3WL9A 3C5SB 3MV8A 4Z7OF 5DUPL 2FJFA 4CVZB 1B0GA 4OF7A 3ILPA 5ISZA 4OZFG 3W11C 4U3HA 5F3BA 4FQCL 1NBYA 2P5WA 3QDME 3RNQB 4F8TA 2VC2H 4Z78A 3QPXL 2E7BA 4M5YH 5C09B 1KPUB 1WEJH 1TETH 1JYVA 3G5VA 5C0IA 3FB6B 1S7XB 4P4KD 1FFOB 5BVPH 3HKFA 2IPTH 5BOZG 3O8XD 3QR2A 2XNAA 3PGFH 4H26A 2D7QA 1I85A 2VIRA 3UJJL 3T77B 1AGCA 3VFVA 3HI6H 5J1SC 4PJGE 4M4RA 3UCRA 3MV9D 4Z77B 5C8JB 1GGYA 1KXTB 3RWCB 1RZIB 4LP5A 4OLWL 2YPVL 1KSRA 3MGAA 4XNUH 2P48B 2VXQH 2A77H 2A6IA 5D1XC 5BRZA 5FM8A 3LSOA 4N1EA 4F2MB 1SJEA 2EXWD 5T1DL 2FEDC 4UIKL 1T21A 4JRXD 5FDYA 1NCCH 5KN5A 2CLRB 2WBJA 5EZJA 2VDKH 1FDLL 1UEMA 3LQAC 3QI9B 1I7ZA 5EO0A 2R1WA 3BAEL 2FJHA 1DUZB 3QDMB 2Z93B 5KSAA 3O4LE 3C8DA 3ILQC 2ADJA 2VXUL 3PL6D 3DV4A 1BFOB 1D9KA 1J86A 3JV6B 1CDBA 3GIVA 4WJ5A 2CDFB 2JJTA 4NDMB 4CVXA 3NH7H 3VXNA 1JNHB 4YR6B 3OKKA 3ARVA 4NKDB 2EEDA 1DQLH 1A1MB 4NKQB 4PJ8A 3TNMB 3VFUB 5BXFB 5FA3A 5FIEA 1LDSA 1WFOA 1JPSH 3ULVH 4Y2DA 4X4ME 4PJGB 3U9UB 5IIEA 2BSTA 1NGPH 1H5BB 3MRCB 2HT2D 1PEZA 3RL1B 3H6JA 4HH9B 4FNLH 3QJHB 2GSIB 4QRQA 4LAQH 4YIQA 3SDYH 1PZUB 3DJ9A 1OVZA 3TYFB 4OLEA 3WNPA 3MV8E 4NM8H 1FNAA 1EHLL 4KZDL 4XH2A 3MA9L 2P8MB 1HILA 4PRPA 4H0HB 2UV3A 4LSTL 1RK0A 4OIAA 1NCDH 3O4LB 5GGUA 2R1YA 3V6OA 4QWWC 2W9EH 2AJSH 3W9DA 4X6FA 4JEGB 2XG4A 5DEFA 5E2WL 5C08D 3TVMD 2XTLA 4OI9A 3X11A 5KVFL 1RU9H 4FQLH 4HW6A 3VD9A 1E27A 4CN1A 4JDTL 5D6DA 3S6CA 3QRFM 2Y72A 3NCYP 4KKNA 3QWQB 4EEEA 4R7DA 1MLCA 4KJQC 3ARUA 2XQBL 5A40E 1YMMD 3OGOE 1CGVA 4A2LA 5DMIH 1J1PL 1JI1A 2YKLL 4YX2H 3FT4B 1ZEAL 5A2FA 4OLZH 3EFFA 1S8DA 4LKXA 4HUXA 1G7IB 1LE9A 12E8H 3DYOA 3SQBA 1XIWB 5ID0A 5TPWL 1B90A 5J6HB 4M7LH 2BY1A 3G5ZB 3W82A 3MV8B 4D8PA 1DLFL 1FZMA 4HZLA 2RJMA 5I1HH 4JO1L 3FQUB 2JELL 3SKJL 5EZIH 4OI8A 1MUJA 2FO1A 1X5AA 3BH9B 3FHAA 3EYSL 4L4VA 2CXGA 1IRAY 2ZCKL 4P0DA 3T8XB 5F1OB 3C6LD 3W81A 2XKNA 4Z78B 4MQSB 4JHWH 1F97A 3G5VB 3C6SB 4MNHA 4AQ1B 3BO8B 1Q9OA 4TSAL 4XC1L 4Z7WA 3FAWA 1NGYB 1FFNB 5EU6E 3W11D 1CI5A 2IH1B 1L0XA 2VIRB 3BIKB 4NCC2 1QKZH 1IEBB 1UB5B 4X8JA 1AGCB 4OJFH 5SWZD 4JFQB 4LSDA 1F4WH 2J8UA 1FCGA 5EBLA 5DJZA 3AS2A 4ETYA 1BM3L 4W4OA 1CDHA 1IBGL 5IHLB 1INEH 5JOPE 1DFBH 4QRRE 1TMCB 3QI9C 3V95A 3AM8A 3RBSA 3O0RH 1Q1JH 5E9DA 3SN6N 3PGCA 4O02L 5I17A 1G84A 5DJXB 1C16A 1S7SA 1T3FA 3GGWA 4NZRL 4EVNB 2DQDH 2ADJB 5DUML 2XZAH 3KPTA 3RUGE 3PUCA 4N0FA 5FGCE 2G75A 3D9AL 3OWEA 3GIVB 3GBNL 5D1XD 4JFPA 3GSXA 4HC1H 2V9TA 3OKKB 2FEDD 3VFRB 5EU6B 3UTSA 4PGDA 4PJ8B 2NY5H 1H5BC 2X2YA 1TJHL 1PQZA 2QR0B 4P2OB 2X1XR 4DJMA 1Z0MA 3OAYK 5K59E 1MIMH 4HKXA 3RWIB 3Q3GA 5GGTL 3OHXA 1T1ZA 3ILQD 3O3EB 4MZ3A 1RIHH 5JXED 4DK3A 3O6LL 3DGGA 1Z9OA 5MI0C 4RSVA 1KCRL 3RRQA 1WAAA 2ESVD 5D1QB 4QRRB 5BS0E 2QSVA 1IARB 4ZO9A 3BEWB 4XP6L 1VFMA 4X4ZA 4GW5B 4KJYB 2M1KA 2RGSA 5E5RB 3WIHH 1MWAL 4UILL 5GGUB 4JY4A 1WK0A 4LASL 4WU5A 1HXMA 1UKSA 4LSRH 3RUGB 1WWWX 5HDBF 5FGCB 4XP4H 4XCNA 2VDOH 2DQCL 5TJWK 5ICXA 3RBGA 1AO7E 4HUUA 2R2HB 1AR2A 4LIQE 2GAZA 2BVEA 4JG0L 2CJUH 1J8HE 5F3HA 1MLCB 4KJPD 2CMRL 2AABH 1A7NL 2H3NA 1H3UA 4Z7WE 3DRTB 1OSPH 2CRIA 5DHVA 2V2TA 2ENYA 2I9LB 1QZ1A 3NN8A 4QWWD 3HAEH 2GIYA 3SQOH 1XIWC 4LRIA 1JNLH 3NGBB 4TN9A 4ODWB 4P9ML 4XP5L 1IGTB 2F54D 1JHTA 4O51A 1X5XA 3VXTA 5F93C 4PJ5A 3EZ8A 5ID0B 1TVBB 5BS0B 4BQCA 5JXAH 1EFXD 1TTFA 4GRMA 5MEQA 5FKPA 5KW9H 4I0PA 4HZLB 4RGOH 4KJQD 1MJ8H 3L7FA 1KLUB 2XY1A 5E0QA 3MREB 1T1XB 3ZZ1A 3DYMA 5E9DE 2NLJB 2X10A 3G08B 4O4YH 2VDLL 2VNCA 3JTSA 2BVYA 4X7TA 4PYHA 2WWKT 4S2SA 4UT9H 2XKNB 5DVLA 5LAXA 1U8MA 1AO7B 3LMJH 4QGYA 3VD5A 1QD0A 4ONHB 1LP9A 1OL0A 3DGCR 4OZGA 1J8HB 2QQKH 5C0EA 1FIGH 2R15A 4Z7WB 4XMPH 2MKWA 4TVPD 1NC4A 5IB2B 4JN1H 3FOLA 2R8SH 5I1DA 2BC4B 3B5GA 4S0SD 4X8JB 4GJTB 3WIFA 5C09D 4R8WL 4R97B 4RISH 5CIPB 4JQVA 5DJZB 3WEXB 3GMMB 4NNYA 4KGLA 2AQ3A 1B4JL 1SJHB 2HFGH 4AJ0A 1WBYA 1BBDH 1UM6H 1OAYH 5HHOA 4M1GH 4POYA 5E9DB 2YD8A 1NAKL 3U0TB 1T3FB 5FYKH 4DEPB 5DRXA 3QQ3B 1S78C 1U6AL 5TE7H 1PGRB 1IQWL 5DA0B 5EUOA 2G75B 1X5LA 2NY6B 3HRZA 1BECA 4BH8B 2NY4B 2D31A 4JFPB 4PJ8C 1NBQA 4MCZB 4UV7H 4RMWA 1XGTB 3ZSTA 3TT1H 1X5YA 2Y07L 3FRUB 1X3DA 4P2OC 5DD1H 1TLKA 1EHAA 3QDMD 4JHAL 5EBWB 3BZFB 1MFNA 4C59B 1PQZB 3CU7A 1A6ZA 4O2CA 4YFLF 1UVQB 2PYEE 1FNFA 2FR4A 1ADQH 3PWJA 5JMRA 1W72H 1HINL 2E6PA 3DGGB 5D1QC 4F7PA 2OR7A 5C2BL 3GMLA 4NC1E 4WNQB 4PJ5E 1J5OH 3R4DA 1NLDL 4NFCA 2VXSL 4HXBH 3QUKB 4ZOCA 4HEME 5F7LB 2WNGA 4FQXA 4PV8A 1T5WA 1JHLL 3QDGA 5TQ2H 2YSSA 2IALB 3DLQR 3D85D 1YZZA 1I7RA 1RZGA 4F9PA 2VH5H 1CGTA 1AHWB 3VE0B 2XIDA 3OKNB 4G9DB 4TSBH 4XPGL 1VADB 5EOQH 3O4LD 5I8OH 2OS7A 5AZ2H 5IF0A 1ZGLA 5ESAA 2PYEB 3NGBC 2BDNL 2OTUB 1N59A 2D0GA 3DRQA 3DUUA 4NQSA 3IU3A 2D9CA 1M71B 4FQ1H 4TTGA 1VFAA 2BHUA 3U4BH 1CE1H 2EO9A 3IS0X 2IEPA 5D7IA 3S35H 4D9RE 2YRPA 2G2RB 2BVPA 4RFEB 4YHIB 4GRMB 4U7MA 5MEQB 1GGBL 5CJOH 1XGUB 3ZKQD 5CMAB 1WQVT 3GJEB 4PS4L 2BHYA 2IBZX 4JDZA 2XWBB 2VAJA 4FTVE 1XIWD 1DDHB 3D69B 2ADFH 4X6EB 4X7TB 4G80A 4S2SB 3O4OB 1P2CB 5I1KL 5CWSA 4GKSB 2Y7QB 1CLYH 1JPFB 4UINH 4FRWA 5EUOE 4DGIL 1EEYA 2GITA 2EYRB 5K59F 5IFAL 3B43A 4KROB 5F7WC 1P7KA 3FOLB 1YECL 3MNVB 2ITCA 2FEEI 3T2NL 4NRYB 4R97C 5EU5A 3RU8L 4NP4H 2VN7A 2CGRH 3L6FA 3OXSB 4H25A 2VLME 2OR9H 4OCNC 1MH5A 2JK5A 4LCCA 4PG9A 5CZXC 1S7UB 5I18H 3MV7A 5L8LB 4XMKL 1FO0L 4FOMA 4G7VH 3MGOA 1HH9A 5ADPH 1UB6B 1KTKE 4YHZH 3WFHA 2WQRA 2AXGA 3FO9A 1EXUA 3UYRH 3RWGA 4DEPC 2HH0L 4TUKH 2ADIA 3QPQC 4FTVB 4KDTA 4L4TA 3QG7L 4RMUA 1S9WA 1G7MA 3B6SB 4M6OL 5IBTL 2NY6C 1HSAA 3OZ9L 4CU8A 2EC8A 2NY4C 3SCMB 4JKWA 5LG1A 3Q48A 4TVPL 4Z7WF 4TSCH 1A4JA 2B2XH 3SGEI 5FYLH 4MDIB 3MXVH 4IOSD 1MIEH 1GPOH 5GZND 4O2FA 4JZOA 4FQQA 1T20A 2P43B 5DZNA 1A7RL 3ZDYE 1LE5B 3CFJB 2HG5B 4G9FE 4LDEB 4NNPL 5IMMB 1A6ZB 4N0CC 5F7HA 2XQYG 1T5XA 1S78D 5E2VH 4Q9QH 4I77L 4ZYKA 2WBWB 4UT6H 2ZUQB 3IDJB 1NMBH 3R06B 4PRNA 2O5YL 4OZIA 5EU6D 4OUOA 3WLBB 3GMLB 9CGTA 4HC1A 3RA7L 2XKSA 4ODHH 3LS5L 3U1SL 1IKFL 1MFCL 4P2OD 3PDGA 5LBSH 1BAFL 2IQ9H 2KQNA 1QP1A 3QIBD 2B0SL 2ILLA 1RZFL 1XZ0B 5FGBA 1S7VA 4I8DA 3QQNA 2HMIC 2YSSB 3JWDL 1A3LL 4Z7UA 4ZFOA 4U49A 43C9B 5C0RL 5D1QD 5JOPD 1AHWC 4QRRD 1MCOL 1W0WB 2F9BT 4PJIE 2EH7H 4WW2B 5BQ7B 2Y1VA 1OD7A 1P9MC 1NAMB 5F1SA 3ZDZE 4P4RA 1N0LA 4G9FB 1WBZB 4HHAA 4M6NH 1JV5A 1X4XA 5IF0B 5I1JH 5ESAB 3WIHA 5DD6B 4LF3B 3OX8A 1QNZL 1F13A 3VRIB 3ARRA 4NC1C 4BM7A 1M7DA 1NBVL 1WAAF 4YUEH 5F9WB 3C8KA 3QULA 5ILTL 4GAYB 4GQ9H 4NJAL 2DM2A 5EO9B 1KJ2L 1OW0C 4WVRA 4PRDA 3GSUB 4NJ9H 5GGRY 3EOTL 4ZNEE 4L29A 2EXYD 3GNML 3TJEL 5KAQG 3SKOB 2R0KL 3VFNB 4HQQH 5J13B 1UZ8B 3FOMA 3FN0H 4G8FA 2UZYB 3HG1E 2ARJA 4Y8DC 2PXYA 2UYLB 2X4RA 2E27L 3O4OC 4Y16A 5I66A 4H88H 2UY6A 1GGCL 5F6IB 4C83A 4LLAA 4G80B 5E1AB 5BS0D 1A9BB 4PJIB 1G6VK 2CO7B 5CJXC 5GGSB 5DO2C 4QRTB 5DMYA 4KROC 1I3RB 1A4KA 3Q6GL 4X4XB 1XR8B 1UJ3A 1RJCA 1T80A 1CR9H 1BWWA 3MLYL 1HDMA 1QSVA 2DLFH 3UBXA 3U30C 2FATH 4N8PA 4HMEA 3BHBB 2Q8AH 3I2CL 1I8KB 4MNQE 1U92A 2EE2A 3IAGC 1MLBB 1AO7D 4H25B 1JZ5A 3HAEG 5DJ6A 1HKFA 5J3HC 2ZOLA 2JK5B 1J8HD 3IFNL 2NPLX 4G5ZL 4JJHA 3K8MA 2ZG1A 4GRWH 1I3UA 4OZIE 1G6RL 4KFZC 3FO9B 1PG7H 1OM3H 3HG1B 3S4SG 4XZUB 1EFQA 3V0VB 4PP2B 1ZK9A 4ENEC 3WUWB 5FUCE 3UBXG 3LOWA 2DMBA 2DMKA 5J06A 1G7MB 1KEMH 4W6XB 5CZXD 5B21A 3M8OL 4OM1H 4F3FA 2WAHA 2R23A 4JCMA 1MCIA 3V7MA 3E3QC 4MB5A 4CVUA 1VHPA 2UUDK 4YDIL 1NUNB 4JFDE 4O2FB 4MYWB 3V4VL 3BH8A 2IQAA 1N6UA 1BOGA 2AV1A 4YDVB 3S9DB 5DD3H 2X4TB 1NL0H 3P11H 2ZZUT 2BVQA 4MNQB 2ZUQC 3CCHA 1WCQA 3VG0H 1F3DJ 1X6NA 1EDQA 2NY6D 3MRPB 3HPLA 4G6JH 5FF6B 5AWNL 4QRPE 2HRPH 5DK0B 4ZS7L 2KQMA 3WHE1 2AXHA 1HH6A 3BP7B 1ZHNA 5F96L 3CXHJ 2NZIA 4F15B 4L9LB 1ZAGA 4RQQA 3WXVL 1ZHLB 3L5HA 4KV5E 3I02B 4N0UE 1S3KL 3TO2A 4PREB 1D5IH 1FZOA 3HB3C 4N0CD 3CFDB 3OGCA 4PRAB 1MRDL 4UNTA 3EGSA 1T04B 5E8DL 4KK5D 4L3CB 5EUOF 1FBIH 3T4AA 5ACLA 5FO7B 1W72A 4WW2C 5E94B 4FP8H 4KTDH 4MX7A 1CFQA 4N8VA 3RWDA 3BXNB 5KS9E 3U2SB 3LN4A 2VYRE 4K2UH 1AJ7H 3QCTH 3MYJB 4L1HA 4TUOB 3GMQB 5T5NF 5DA4A 4JFDB 2V5RA 4RAUB 5CUSH 4HBCL 3IKKA 3D25B 1QG3A 1ZLVH 3EFDL 2NXZB 5CKAA 4P4RB 5CLWA 3RJQB 3QH3B 3WS3A 2W0PA 1FGNL 2FWOA 3QUML 1U91A 5T5FL 1H15B 2HMID 5GSRB 4LVEA 4KKAC 5F9WC 4QRPB 1A7QL 1OTSC 1M7DB 1HQRB 5FO8A 3A6BH 1BGXH 2EEBA 3TBYA 3RVXD 1LD9B 5J13C 4HWBL 1MHPL 1V3LA 3OJVC 2PYED 3LQZA 4L29B 4N0UB 4BH7B 2AK4E 2E6QA 2W60B 3FOMB 5F6IC 4M61A 4MA3B 1QFPA 4KMQA 4DKEL 2ADGA 1EZVY 5F7NC 3BP5A 1SEBB 1A6TA 2C26A 4LFHG 1I8IB 3T09A 5KS9B 1YJDC 3BZ4B 4EUPA 1FVDA 1YDPA 3IDMA 2YK1H 1RK1B 1EO8L 1A0QL 1S7RA 1YN7B 3G6AA 4F33B 4ONGL 4M7KH 4RA3A 3EO0B 1UWXK 3ZDYF 1R24A 1O7VA 4LHUB 4NRZB 5C0DB 5EUKA 4P2CG 3KNBB 4JFEE 3D0LB 2DI9A 5EWIH 5DI8B 4K8RD 1ZVSB 1V7ML 1V3KA 2R4SH 3PV7A 1FL5A 3WFZA 3MBEA 4LCCC 3U36A 4DKFL 5EC2B 5D7IF 1E4XL 3LRGA 3X3FH 1UACH 5E4IA 3MACL 1FG2A 1JNNL 4GXVH 5DO2D 3QCVL 4KROD 1DBJH 2FJGB 1KPRA 4O9HL 2AK4B 4MQ7A 5ESVA 2AGJL 3QCUH 1YPZA 1P7QA 2WIMA 4JO4L 5IHUL 4DFIA 4PJIF 4YDJB 5DQ9A 4J3OC 4D9RD 1UXSB 3RWHA 1YEEH 5J3HD 4Y89A 1H8SA 1KLFA 3VGBA 2H1PL 4XX1G 3U7YL 3IU4L 4MD5A 4TPRH 3ZDZF 2YPLE 5CEZE 1NGQH 3BGFB 1ORSB 4JPWL 3DMMD 4JFEB 5E5UB 1LNUA 5DEGA 4FTVD 1I8LA 3T65B 1F4YH 5DVOA 2R0ZH 3VRJA 4ENED 4IEFB 2DS4A 2HLFC 5BCAA 3SCMD 3HPLB 1JRHH 4MDJA 3MUZ1 2AJUH 4Z7VE 3BPCA 4F15C 5TF0A 4L9LC 5D1ZB 2CO6B 4XI5D 3BT2H 1NGZB 4F58H 4OLYL 3QISA 2HFEB 5FUCC 1TJIH 1MAKA 2V7NB 2VLMD 4TULL 5CLTA 4QXUH 5KJRL 3OGCB 2NZ9C 3AC0A 4EIGB 1B3JA 3MRDB 3PF2A 4HS6A 4AIOA 4MXVE 3OXRA 1TCRA 3PNWA 4QHUA 5D7SH 4GOSA 3RWDB 4BZ1H 2YPLB 1FFPA 3LD8B 35C8L 4P2YA 4GKZA 2Y5TB 3HR5B 4N90E 5T3XD 2NXZC 1U8JA 1WBXA 2O61A 5I76B 2DQEL 2HJKB 4XVJH 2WWKO 1A14H 3H7BB 4P5MB 4JB9L 3HC4L 5DDHA 3ARZA 5CJQL 2C9AA 1JTTA 3F12A 3ZE1F 2MWCA 3S34H 3HZYB 5SX4I 4OZIF 4HJGB 2Q8BL 4Z7VB 2MQ0A 4IDJH 4IS6A 4WO4B 5KANG 3U48A 4FQPA 3SE8H 3CLFL 3HNSL 3DUHA 3MCG1 2YPKB 3O3AB 4PJAE 4YQXH 4G9FD 1RJLA 4GKNB 1YEKH 2B1HL 4UTAH 1AKJB 2RR3A 5IWLA 3LQZB 3V4UL 3DROA 2PXYC 2IADA 1CN4A 1N0XL 4Y16C 3GSWB 4Z7UF 4OQTH 1T22A 2ITDB 3WIIH 4UAOB 2BNRA 4LNRB 4KKAD 2DD8L 1A6VH 4WEUD 1A6TB 3WN5B 3L3OB 4LSSL 3FQWB 4PB0L 3RP1A 5JPMB 1OTSD 4P9HC 1BMGA 1U8NA 4EUPB 2RCSL 2YA0A 1WC7B 2PTTA 4FQIL 1XGQB 1JK8A 3DX6B 4XPTL 3FO2A 4Y1AA 3AREA 2XG5A 5EUKB 5HHQB 4NHUB 3O3DA 4L8DA 4P2QA 3MUHL 2YEZA 1RPQA 4Y4FA 5D96B 1BLNA 4JN2A 5I74B 2LU4A 2MMXA 2P8PA 5CEYA 2IMMA 4LP4A 2R2CA 1CL7I 4PJAB 4IOIB 2W0KA 4V1DA 5HDLA 4QHLA 2YD5A 5HVHB 5IM7B 1F8TH 4LARL 5KSUB 3C09B 4NPYB 3SE9H 2CIKA 2VLRA 1I3GH 1T1YA 5T1MB 2FBJH 4XRCB 1PDKA 5ESVB 3I75A 2FGZA 3QHTC 4GMSL 4JM2A 2W91A 5EORH 1BQHA 2DKUA 2BY0A 4NYLA 3DSFL 1A7PL 3G5YB 4P2RE 1AI1H 1JFQL 2VXVH 1RZKL 2Q3ZA 3NCJH 1XGRA 1KB9K 2GTZB 3BGFC 2J6EH 1Z2KA 1NCWH 4MD5B 4K8RL 1YEHL 2A74B 4ZOAA 3HG1D 1EGJL 3GBMH 5F71A 2BX5A 4WEMB 1ZTXH 1S7QA 4Y7MA 1LNUB 3H9HB 4QF1A 2XTJE 4UTBH 4EKXA 4R7NB 1JGLL 2YXFA 3B2VL 4HKZB 5EN2B 4OIIH 3V0WL 4LK4A 2N56A 2PF6A 4PRIA 1YN6A 5D1ZC 2Q76A 1JGDB 1N3NA 3F7VA 4HK3J 3P0GB 3PHQB 4WW1B 3OKLB 4I3SH 3BX7C 4X7SH 4ZFGL 3PQYA 3EOAB 4Y8AA 4PIRF 4OLUH 2V17H 3SDCB 4MA1B 4EI6B 3GZKA 1KIRA 5EZLB 1HHHA 1KNOB 4MNQD 5CSZB 5I8CA 5JMOC 4OCYH 4K3EL 4ZQKA 2HLFD 3QWRD 2EKSB 1BX2A 4HIEA 4P2RB 1DBAH 3LD8C 4X0KB 1TCRB 5E03A 3PNWB 2P8LB 1L6ZA 1KCSH 1YMHA 4M62H 4YHMH 2G9HA 1FFPB 4K94L 2O5ZH 5AG8A 3LV3B 1OTTC 2I07A 3N9GH 4HPYL 4JG1H 5GRUL 3LKPA 2XTJB 2D4DA 3QUYA 4NGHH 1F3JA 1IAOA 2OZ4H 3MJGX 4MCYA 2ID5A 1CGUA 4WO4C 2D3VA 3DVFA 2YN5A 3AXLA 1DEDA 1P4BH 4QHMB 4P3DB 3NCMA 4WTZG 4LLQB 4LKCB 4XAKE 4JFDD 5DEZA 5FOBB 2WWMC 1Y18B 3DUSB 2NXZD 3N0PB 4Z0BH 1AH1A 4MWFA 5CKGA 4ZAKA 4ZDHB 5DQJB 4U2YA 3QJFA 4TVSa 4UI2A 3GSOA 4UAOC 2VLRE 1Q0YL 4QRPD 3WN5C 2YA2A 1DN0A 4ZG1A 3OQ3B 5DXWA 3OAUH 5DQDH 5T3XL 4S1QH 4HUVB 1IL1B 4MD0B 1MY7A 3T0AA 3LEVL 5MERA 4N5UA 4RNRA 3SDXE 4OZFB 1U8NB 1CQYA 4P57A 3IF1B 1JI2A 2J4WH 2PTTB 5BJTA 1QSED 5B3NA 3CSGA 3SDAA 5IB4A 5CZVH 3AREB 3IGAA 2L7JA 4MXWH 1T2QH 3P4OB 2I27N 3E0GA 4PUBH 1G7JB 1DVFA 2EC9U 5D96C 1ULVA 1G9EA 2HWZL 5I74C 4LLVB 1NAML 4M43L 5IVXE 1MFDL 3OSKA 1BLNB 2AQ2A 2OTPA 3MLUH 4YNYB 4YFLI 4FG6D 5GIRA 5CEYB 5HVHC 5IQ9B 4LHUD 2UY7A 3O6FA 5FYJL 2E5EA 1IEAA 4U2ZA 2DLTA 3JWOC 1NEUA 5HPMA 4LSUL 1GGIH 1A47A 2A9MH 2VKWA 4PJCA 1CU4L 1HN1A 5GGRA 1F3DH 3HZKB 1ZVHA 2CIKB 4Q6IB 1RJYA 4EQ3A 3DHJA 3KPNB 3I75B 5I19L 3AU1B 2V2WB 1QFWM 4RRPA 3TCLB 4AEHH 4S1SH 2HT4C 4JM2B 5IJVB 3OKYA 5K9KA 3QFJA 3VWJA 2MHAA 3IJSB 1KN2L 3QXDB 3TWCL 2Y4SA 3SDXB 2P49B 2DOCA 4WEBH 3RWJB 5FUOH 3P4MB 2AK4D 3L3GA 3MR9A 4HV8B 1TZHA 4OZ4B 4BSVA 2X4SA 3VXOB 1EAPB 3BRDA 1U93B 4PD4J 5DRWA 4XHQA 3ES6A 1EAJA 4XPHL 3QNXA 1K3ZA 4EI5A 5IVXB 2BJMH 1KV3A 1SY6L 4KGJA 1NCAL 5ID1B 4R4BA 1FORL 1YN6B 5GJTL 2VO5A 1HZHL 1XF5A 3BWUC 3RDTA 3SDCC 6FABL 4MA1C 3M17A 4S1RH 1F00I 4NN7C 3W0WA 4JFED 4M9OA 3JVGA 43CAA 2B4CH 2P24B 5GS2D 5I1EH 3MROB 1YPZF 1AXTL 4OCSL 3IVKA 1TNNA 2P4AB 4KH2A 5D6CA 5D8JL 5D70H 3MBXL 2Z31B 4UV4H 5L7XH 4U1KA 1HIML 5I1LB 3KPMA 4OD3H 4P46A 2DL9A 5D1ZD 4XGZB 4X98B 1G9MH 2WUCL 1T83A 4TRPH 3R8BB 3GUTA 1BJ8A 4PJEA 1X6LA 2XWTA 1L7IH 4WGVB 3BYTA 1NGWA 3LKPB 5FHAH 5L9DH 3S5LB 2EZ0C 2VITB 4J3VA 4HFWA 4BSWA 1F3JB 5F9DC 1MCNA 1O5DT 1RMFH 2HN7B 2YPLD 5MP6H 4JZNB 5CEZD 1I1YA 1AGEB 3AXLB 1IQDB 2DQUH 4R0LB 1HKLH 5DJ8B 4R6UA 2ZUTA 4RMVA 5C9KA 1OTTD 2QJDA 5IWLC 3QXWA 3B9DA 3EYVB 2QSQA 1OLLA 4KPHH 4PJCE 2B5IC 3C5JB 3GSOB 1UWGH 4GW1A 4X5LA 5F7UA 1DN0B 4QRUB 4WO4D 3U46A 3RVTC 5L88L 3TFKC 3STZA 1NMAH 1GSMA 1LEIA 1F4HA 3QEGL 4E42B 4FFZH 3HE7B 1H9VA 1LO5A 1ES0B 5ACZA 2D7OA 2FRGP 4GXUN 4EDXA 1AKJD 3BPOB 1JGVL 3AREC 2BK8A 5BJTB 5CD3A 2QQNL 3BJLA 4FZEL 2YD4A 2IC2A 5A43C 1HYSC 1KLGA 2OQJA 3SDAB 2D7TL 1G0YR 5F9OL 1JWUA 2B1AH 3WE6B 1U42A 2CLZB 3U0WH 1C5BL 4JFOB 4N1HB 4OQTA 3CSYA 1ORQA 4X7CC 5FM4A 1IGMH 4I5BB 4N90D 4WU7A 3UTTA 4HK0B 1BVKA 3O9WB 3U9PL 4XNXH 3VXUA 3L9RA 1CDGA 1Q9WB 2ZSWB 3U82B 4ODUA