4HAGA

Crystal structure of fc-fragment of human igg2 antibody (centered crystal form)
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
208
structure length
208
Chain Sequence
GPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTFRVVSVLTVVHQDWLNGKEYKCKVSNKGLPAPIEKTISKTKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPMLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ig gamma-2 chain C region
publication title IgG2 Fc structure and the dynamic features of the IgG CH2-CH3 interface.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 35
structure length 208
sequence length 208
ec nomenclature
pdb deposition date 2012-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4hagA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4hagA01
5GRJL 3AS3A 5DFVD 5I73B 3WUWB 3TYFB 1ZSDB 2EZ0D 2JJSA 2JE8A 2Y5TB 1WISA 3FB8A 1IGFH 5J8OA 3OXSA 5HYSA 1KG0A 4FFYH 2GTZB 1A4KB 3N0PB 1FAKT 1RUPH 1Y18A 32C2B 5CGMA 4I77L 3VFWA 3GSQA 2EE2A 3QI9A 2C3VA 1WAAA 4Y19A 4HS8H 2PN5A 3SJVD 5J13C 3Q2CA 1FDLL 4XNXH 4NQCB 2VITB 4R0LB 1JTPA 2P8PA 1J11A 2W65A 3WHXA 1EIBA 4OIAA 4I0PA 4ODUB 4Y89A 3GK8L 4HF5L 4N68A 5B4MC 1OGTA 1QKZL 4PRBA 4F9PA 2XI9A 4LHUA 3PP3H 2ED9A 1QQDB 3O3AB 2ZSWB 3OAUH 2J4WH 4O02H 3X3GL 3UYOD 5IMMB 4AMKL 4MD4B 2BSRB 1MJUH 4NO3B 4ZTOH 1JGDB 1T21B 5J11C 2OL3H 2QHRL 2R0LH 3O3DA 1IT9L 2JCCF 2VLJE 4QF1B 5AYQA 4Z9KB 3GJFH 3BZ4B 1RIHH 1DVFB 3GMPA 3P73A 4KZDL 3U7YH 1SY6A 5EPMB 3QDGB 1LMKA 4K8RD 3GZKA 1QFWM 2CIKB 4NGHL 2DL2A 3MO1A 2APFA 5IVZB 4CMMB 1V3KA 3EO0A 3MGTA 3RUGA 2GK0A 5TGBA 4OF8A 2Z4QA 5CZVL 3IDNA 3BOVA 1YC8A 4MA1B 4BQ6A 5D7LD 5B39B 4H20H 4L4TA 1Q94B 1KGCE 3MGAA 2V17H 3CFJA 3K4AA 1K5NB 5B38B 3WNNA 1XGPA 1KXQE 3HUJB 3LKQA 4OLYL 3SO3B 3QUKB 4ZFZB 4F7TB 1OCWH 2ZJSL 4GW1A 3PWVA 2Z31A 4DGIH 5EO9B 4X6CE 1NC4D 3VXQA 3VE0A 3WNMA 3ULUE 1AR1D 3JV0A 4U6HB 4OLEA 3VCLA 2GHWB 5CINH 5E8PB 3FTGA 2OSLB 4JKMA 2BNUA 1KJMA 1Z0MA 1FAIL 4OI9A 1TTFA 3WJLC 2HT3C 4PTTB 3LD8C 3UC0L 4OJFL 4Y16A 3MLUH 4Z7WE 4L3AA 2Z35B 2WUBH 2ZOKA 3L3HA 4KPHH 1MFEL 4UB0H 4XRCB 1E27B 4M6OL 2GKIA 5T1KB 4HCRL 4JHWH 3QXUA 2VISB 3DHMA 5HDBF 1FVDA 1XH3A 4B7LA 2VDKL 4PJ5A 3C5ZC 1I85C 3TESA 4GUPB 1FZJA 1J1PH 3ARED 1ZLSL 1H15B 2VWEE 1G84A 4NRZA 3P4NA 5JHDA 4QKXB 3BJLA 1F5WA 1VENA 4BA8A 2DQTH 3KPSD 4ERSL 1X5HA 3PQYE 5ENWB 4YUEL 3Q1SL 2R4RH 3JV4B 1SJEB 2BNRE 3CNKA 2P1YA 1K8DA 3DSNA 5F7WC 3BKMH 1BQUA 5J6HB 4LSSH 4I5BB 5DUBB 5GRZA 5FF6A 2D0FA 1N64H 4G80A 1X3DA 3C9NA 3WL9B 5IB3B 1CFNA 5HYEA 4KI1A 1NFDA 2APTA 3SPVA 4LLQB 1S5HB 2YSSA 1GPOL 2C1PB 1U8JB 2XPGA 1F4YH 1CDBA 5A2FA 3ULVH 4N1HB 3W11C 1YECL 3QI9D 2VZ1A 4JANB 4NRXB 3SJVE 2B0SL 1FHGA 1BVKA 4OUUB 1S7XA 4GMSH 1N6UA 4AM0B 1E4WH 4I9WD 4QTIH 4I0PD 1UM6L 4M1CD 1H3WM 4MB3A 1FNEA 3CH1A 4ZOEA 2WMPA 3F7YB 4FXKB 1W0VA 3N1MC 4GAYB 4LHUD 1XR9B 1CGYA 2BCKB 4FNLH 2LV4A 1UEYA 3RWJA 1T89C 2D0GA 2HJLB 1Q38A 3RVWD 2DTSA 3BGMB 3GRWH 3O3EA 4YGVB 2OTUB 1RJCA 4AH2B 4I8DA 5E00B 8FABB 5ISZA 2JKXA 5JNYA 3WFEH 1HHJB 4XVUC 5H35A 1KB5H 4PJ7F 2VYRE 4TTDC 3AGVA 1CGSH 2WP3O 5F9AC 3FQNA 4HIIB 1QD0A 5FFLA 3WFHB 3VGFA 1IM3A 4PJ8B 2FWOA 5MP6L 3VFOB 4LFHG 2QL1A 4LVHC 1OP9A 2RR3A 5JXAL 4G6AC 2V2XB 4G8IB 1FYTE 5JDSB 3LKNB 1J0HA 4K8RL 5D7LE 4YC2C 4F57H 4PJCB 3E2HC 1Z9MA 3BPNB 3RFZC 3I6KA 5AZ2H 1X5LA 2ERJB 3VFSA 5DD1L 5F7NC 1D9KB 1TZHB 1KELH 1TCMA 4UUJB 3S97C 3D85D 3RWGB 3A6BH 3BMWA 5TFSH 4PJEB 1F3JA 4N0UE 4LARH 1UYWH 3DI3B 2FZ3B 3P4OB 4HZLB 1I3RA 1PLGL 3TT3H 5EZIL 3NGBB 1TETL 4ODVH 1RZFH 1HILB 3GMLA 4Y7MA 2AEQH 3E6HB 3QPXH 3PABA 1N6VA 1YYMH 4QRPD 1U0QA 4U0RB 1FNLA 2ICCA 1KENH 3MODH 4HHAA 1F6AA 4G9FE 1MJJB 2F5BL 3ESVF 2DAVA 4NT6B 3NFSL 4FMKA 5DJDB 3JV6A 4P57B 5HVFB 4M5ZH 1MAMH 3GIVB 4GBXC 4Y16D 5GQBA 3ZDYF 3DARA 4MQ7B 4QHUA 2CKBA 3CVHA 3KXFD 5DJZB 2DKMA 3FRPA 5ETUB 4EUPG 2JB5L 3O2WH 2H9GB 2HH0H 4NQXA 1T03H 3KLDA 3GUTA 1MVUB 3RNKB 2RHEA 4RGOH 3KS0J 3Q5OA 2IGFH 1E4XH 2W0LA 5EU4A 2AAVA 3BWAA 4P9HH 3O9WB 4X7EC 4WI9A 3MRRB 2AJSH 2LU3A 3WUZA 2DWDB 1L9NA 1SQ2N 1HHGB 1NGWB 3KPSE 2X70B 3D2UA 5IT2H 1NL0L 3QEHA 4M03A 1EHXA 4YE4H 5ANMB 3FAWA 1LEGA 4K55A 1B4JH 4TVPH 1M4KA 3NCJH 5LGJA 3QH3A 2Q6WB 1A3LL 3V6OC 3BRDA 4M6NL 2XWBB 3ROOA 3RPIB 4GRMB 2XRAH 3ARGA 5IMOA 5CKAA 1YEEH 3QUZA 3WXWL 2GJZA 5E8EB 3B6SA 1C08B 1MFCL 3D39D 5E2VH 3D69A 4ONFL 2NTSP 1BFSA 4YZFF 4Y8DC 5CJ8A 4X0KB 3EYUL 3VRLE 2MWCA 5CJXC 1TTUA 1T66C 1X5IA 5INCB 1VACB 4V2CB 5T1MB 2BMKA 4DUXA 1B88A 4I9WE 1XR8B 3OG6B 3CFIC 3P40A 4P2OA 3IFNH 4UMGA 3MOBH 5FECB 3OJDB 1YEJL 1IAKB 1R3KA 2DM3A 5DQ9B 4F37K 4B50A 5GGRA 1CICD 4XAKE 2AXGB 5IQ9B 3QPQC 2CGRH 1MEXL 3IB4A 1SEBB 5L2JA 5I1IH 4K9EC 3KHQA 4NCC2 4DKAA 1KLUA 12E8H 3CCHA 3WUWG 3G08A 2A73B 5EH1A 1P1ZB 5ICZA 3I02A 2JJUA 3LKOB 4KVNH 4WI6A 2BOBB 3T2QA 4WV1B 3PP4L 4EVNB 2X44D 3FFCE 1RJYB 1A1NB 3GSOA 4AEIL 1QPXA 4LIQE 1XF2A 4R4BB 2BVYA 4TPRH 5CIPA 2DI8A 1QLEH 2AJYL 3CFEA 3MRHB 3L3KB 4ZUSB 1QHOA 5IOPA 3R1GH 3IS0X 5F8QC 1R5IB 1ACYH 3I50L 4B41A 2X1QA 2ICES 4DUWA 4PJHF 2YKLL 2FEEI 4LIQL 3MBXH 1F00I 4WU5A 2NY1B 2VABB 5C0BD 2C26A 1Q72H 3IFLL 1MY7A 3KDMA 2DQGL 1ZMYA 3QAZB 5H37H 3QO1A 5BJTB 3MRPA 3IDXH 1J05B 4OD2B 4KMLB 4Z5RB 4P3DA 5DSCA 1UJ3B 4JRYE 2Y7QA 4QHLA 1P2CB 4GRWB 4K7PL 1S7SA 3F7VB 4L5FH 4QRPE 4OLVH 4XCYA 1ZT7B 3KGRA 2EE3A 4LGPB 3KPOA 2DQIL 4HH9B 3ARDA 2PCPA 2QHLA 4UAOC 4KTEL 3L3OB 1U58B 5EU7E 5DRXA 3CVIH 4QRRD 4DCQB 1P69B 1U95A 3MV7B 1A4JB 1CD1A 2FHCA 5MI0C 3PIQB 3KJ4B 3STLA 3KXFE 4RRPG 5GSRA 1ZHKB 1A0QH 3FKUS 1S7VA 5JR1L 4RFNC 2C3XA 4K7FB 4KROB 1FZMA 4RQQA 1U6AL 1S9YB 5D6DC 4F15B 4I48B 3I85A 3DX9B 5DEFA 1MLCA 1BP3B 3LVEA 5C09B 2EYSB 3JXAA 1U9KA 1VCAA 4FFZH 2QQKH 3T0AA 5F7DB 3FB6B 9CGTA 1NGXB 5C0IA 1IGJA 5MEPB 4NBZB 3D2UD 5F97E 4OQTA 5F1NB 3SKJH 1P4IL 4XGZA 2YPKB 5CWSB 2ADIB 5HHXL 1AD9B 1AP2B 1WICA 1T1WA 5TE4L 2I9TA 2A77L 4BSWA 4ZO8A 1G7LB 4PB0L 3MXWL 2R2BB 3WKML 3ARGD 2HG5B 1YJDC 2Y5EA 3QUZD 3I2CH 5F1SA 5JXEA 4QRTA 3BWUC 3UPCA 3D39E 4NO2B 4J3OC 1GZQA 1QACA 4G43B 3LEVL 5FM5O 1RD6A 4TVSa 1GCFA 3PHOA 3EYSH 6FABH 5DVOA 4PLJC 4XBEL 4ZFOB 3C6LD 2ZP0T 5BS0A 4FQHA 3JSSA 3VFRA 3EGSB 4CU7A 2A1WH 5I71B 2VSCA 2E7HA 1BZ9B 3O6FA 5F7HA 4D9LH 2EIBA 1RUKL 5C6PB 3ARFD 1SJHA 1EH9A 2X4SB 5B8CB 4OFYD 4PGDB 3KPMA 4QOKB 2A9ML 1FNSL 1BQSA 3FONB 3VXUA 1V3MA 4C54A 1N0XL 1OAQH 4CVXB 4OGAC 4OIIL 1B4RA 4MDJA 3H3KA 3LPFA 5J12C 3MRDA 3VFMB 5LXGL 2NPLX 5DJ6A 1ZEAH 3GM8A 4R7DB 1T2JA 3UPAA 4BKLB 4LCCA 5E03A 3RWFB 3BGFC 1I1YA 3O4LE 5FYLD 3GM0A 3HFML 5HHMD 1LP9A 3GEWB 4HIJB 4JM2F 3T0EA 2Y36H 1D5IH 4DAGL 1YPZB 4XPFL 2VQ1B 3B2UD 5IB5A 1RHHB 1RIVH 1H3TA 1RUAL 4Y5YA 5C0BE 5D1XC 3QWRA 3L3IA 1FGVL 4Y1AD 5JLZB 1U8PA 4JY4A 5DD5L 5A40E 1FO0B 4L8BB 3C5JA 5EUOF 4NYLA 4H0IA 1ZLUH 1TJGL 5C9KA 2YA2A 3STZA 5IVNA 2IAMD 1FE8L 3WJJC 2YPVL 5C0NC 3SDDC 4GRWH 1JF1B 5CD3B 1G9NH 4KU1A 4CW1B 1FN4B 4P4KD 2YXMA 1H0DB 1JPGA 3QIUC 4W6WB 3ARDD 3DV6B 4N90D 4NRYA 4L3CB 3JTTA 2MSPA 3T3ME 1A6VL 4QRRE 1QNZH 1LO2L 4XP1L 2NXZC 4L4VA 3SGJA 2XZCH 5SWSB 3ZE0E 1XGUA 4AG4L 1DBJL 1TJHH 3AS1A 2W0FA 5KVGH 5F7EH 2Z91B 4N9OB 1DUZB 2NY5C 5EO0A 5HPMA 1MIML 3NZ8B 3UYRH 5FA3B 2VDMH 1KBGH 5DC4B 3T77B 4NO5B 5EOTA 2UWEA 3NABH 3WN5B 5C0EB 4TSAH 1K3ZA 3CVHL 3QQ3B 3OSKA 4YIQB 3THMH 2CDEB 4NUGL 1EEUA 1KIPB 4XP9L 5E8OB 4ZODA 1HQRB 3W2DH 3HC0A 3QQNA 3GMQB 2AJXL 3UTTE 2WP3T 1M1SA 4P3CL 1QBAA 4XX1E 2VMFA 4HUXA 2AJVL 3WS3B 1N5AA 2A6DB 1KCRH 5D9SB 2ZNWA 2C4XA 1IBGL 3MBEB 4KKLD 2YBRB 4OLUH 3RWEA 3QNZA 3B9KC 5DLML 1H5BC 1DJSA 3QULA 4GG8A 2E7MA 5IESL 4HUWB 4K23L 1HHHB 1T1ZB 4LEOA 4ZNEA 2P43B 2HLAA 2VKXA 4PRPD 5FYKU 1J0KA 3PGDA 2Y1VA 3RVTD 1CT8A 2Y07H 4JO3H 3DRTB 2EDOA 4M5YH 3GMNB 1LDSA 3DYPA 3QUYC 1YQVH 4S2SB 5T1LB 2HWZL 1WITA 3TP4A 3KYOA 3QXDA 1G1CA 2B1HL 3AM8A 1S9VA 3O6FD 2QKIB 3MCG1 4O51B 2NY4D 4EBQH 4QHMA 3EHBD 5EN2A 2DLGA 5E6ZA 4D3CL 1WBYA 5TH2B 3VXTB 4JZJB 1G9EA 1NCDH 3CAFA 3PJSB 1KN4H 4NWTH 4NQDB 2Z9TA 3FT2B 3G5VB 1JGVH 5JW4R 5I8OH 2X1OA 1YY9D 1OTUD 3MPCA 5EU5B 4KK5D 3NN8B 1QSEB 4N8VA 2FSEA 4XP4L 4X8XA 3B5HA 5K9QG 5KSBB 3Q6GH 4HIHB 2APVA 5D7SH 4GMTL 4ZYKB 4H5SB 5ID1B 2PO6A 4EI5D 5HHME 4DKEL 5BW7A 1KLFA 5E08L 1OAUL 3T0ED 3UTSD 4JREC 4YQXL 3V5KB 1CL7L 5EB9A 5FK9A 2GY7B 3BEWB 1VFAB 2QSCL 5FYLL 3RX5A 3QWRD 3NA4A 1NBZA 4Y1AE 5DMGD 4WI7A 4FQCL 1CLYL 4JN2A 4X6DF 1MPAH 4DGVL 5HGAA 3IVKA 2AXJA 2C1OA 3MRCA 4WJ5B 1Y0LA 4YO0B 4ODBD 5BQ7A 3RIFF 4XP5L 3QNXA 4MS8C 5DRWB 3TT1L 3MACH 4LLUB 1N5YH 3VMPA 1IQWL 4WUUB 3C60B 3FMGL 3BZEB 1QFWL 5MEOA 1NANH 1VPOH 2ESVA 3TJEH 3LRSB 3BRGC 1R3JB 4MD0A 3W81A 3P9LA 4N90E 1KCVH 1F8TL 1JWSA 3BP4A 5L0QB 1A5FH 1GVIA 5EZOH 4OM0H 4GG6E 1AJ7L 3DBXA 1VESA 5EA0H 5HI4C 3DGGB 4P46D 3BPCA 5DA4A 4CVUA 5DJAA 1QVOB 4XAWL 4QRUB 2R2HA 2DQFA 1CL7I 3JUZA 2DQUL 4OZIB 1AO7A 4FQXD 5FYJL 3AC0A 4YXKH 2G75B 3MGOA 1WWAX 5AYUL 4MA7H 5E94A 2HLFD 3V52L 1BD2D 3G5XB 3FHQA 3SQOH 1UH2A 3I6GB 3U0PB 3K80A 2ED8A 4EDXB 5SX5K 3CFDA 4JGMA 1QEWA 2IQAA 3VXNB 5DR5L 2COQA 2BVEA 5ITBH 1QFWI 3NCYS 4NUJA 4TUKH 2K9UA 3QIBB 5BV7L 3U2SB 3SY0A 4LDLB 2HTKC 5ESAB 1JYXA 2ZUQB 4R4FH 5ACMA 2L7UA 4OQTL 2IF7A 2WANA 2IALB 1UA6L 1T6VN 4Q58C 3GI8H 1CDUA 1IE5A 2OJEB 4JJHA 4PRPE 1WT5C 4CBPA 1REIA 3RJQB 1HIMH 2J8UB 4HK3J 4RIRB 2DD8L 4OD3L 1I9RL 3DVIA 5M7QA 4Q6IC 2FJHA 1FL3B 2WBJC 3HMXA 1MWAL 3UAJD 4JJ5A 1FCGA 1OAKH 2X4PB 2R0KL 2GY5A 5IW6A 1IGCH 1H3XA 2VH5H 2XFXB 1BFOB 1M05B 1X5AA 4UTBL 3V7AE 4ZFGH 3RDTB 5DRNB 2WWKT 3QCVH 3QFJE 5F6HJ 4PBWD 4WI8A 2V2TA 1VHPA 4X98B 4KK8C 2IG2H 4NKIH 4JPKL 3JVGC 4ELMF 1S9WA 5CJQH 3WDIA 4C4KT 5D2NA 1MRFH 2EDLA 2E7LA 1F4WH 3CDCA 1RU9L 3IDGA 3T3PF 4PJFE 5I8EA 4PRNB 3TM6A 4JFOB 5KS9A 2F19L 1YUHA 5CHNA 3BH9A 4CKVX 1LDPH 3MLRL 3HC3H 3O3UN 4KRPC 2YRZA 5BZWA 4U49A 2OR9H 1LP9E 2LVCA 5DDHB 5EO1A 3T0EE 3MRJA 3UTSE 2MCPL 4WI5A 5GS1A 4HUUA 1VEMA 1MF2H 2WIIB 3I3BA 4YDIL 3U82B 4X4YB 4J12A 4OGYH 1OT1A 1M6OB 1MOEA 4PJ9D 1KXTB 3FB5B 5I1AA 2PW2B 3DOSA 3C2AL 4H26B 2PXYC 5EWIL 3MRIB 3I3EA 3O6KH 3MLSL 2BDNH 1MCPH 3EFDH 4M48L 4ZAKC 3EKCA 1PAMA 3OF6D 2AJZB 4C83A 1G7IB 4KJWC 4QXWA 4ETYA 4PGBB 4PY7A 2X42A 3TBSA 1KACB 2WM0A 1AI1L 4KUZH 4ODHL 1W72B 1KTRL 5LCVL 4WHTB 1IARB 1T7ZA 4OGXH 4FQ2H 3X3FH 2ESVD 4JFFA 1SMAA 3EJYD 5IMKA 5IBUB 1IL1B 4P9ML 3FN0L 5D7JA 1FVCA 1GGIL 5IV2B 2VXSH 2IPKA 5ALCL 5K33A 1FNGA 1JI2A 1RZIB 4UDTA 3MV8A 1WFTA 3VFNA 1FL5A 5LGHH 1I8KA 2CXGA 3KJ6H 5TE7L 5GZNC 5D2LA 3ARRA 3HNVL 4WGVB 5E1HB 5ICYB 1S3KL 1E4KC 1A64A 2IANB 4JHZA 2B8OT 3S6CA 3Q3GA 3E8UH 3EFFA 1BD2E 4UV7H 1IC4H 1ZLWH 4LRIC 2P5WB 5HYJD 4M3KB 3P9MA 1NKRA 4PP2A 2D7OA 1TVHA 1F58H 3LKPB 1WV7T 2EDTA 5INDA 5T1DL 4L3EA 3T4YB 4RBPK 1UXSB 4QNPE 3ARBB 2FLBT 2DYPD 4ZG1A 4P5MB 4BUGA 1VERA 2R0ZL 4MNQA 4F3FB 3FB7A 2NZ9C 3OX8B 3WNPA 4NN5C 4XXDB 4QCIB 1PZUB 4GAGL 1U8LA 1KPUB 1EEQA 5TDOB 5T5FH 2LFGA 1KEGH 1IGIL 1F97A 4OZFB 3OZ9L 2VDQH 1ZHLB 3VW3L 1A8JH 3MSPA 4EZMA 2QSTA 4QTHA 3KPRA 4PJGB 4F9LA 1JPSL 4LCUB 3RKDD 1UZ8B 2W92A 4GRLC 4XHJC 5AWNH 4NHUA 5ACLA 3S4SB 5GGSA 2FX9H 1NC2A 3MV9B 5DK2B 1NCAH 4HDIA 4U3XA 5FAAA 5IIEB 1M7DB 2X5PA 1CXFA 1JNLL 1F42A 3BP7B 2L0DA 5FDWB 5DMKA 1UWXH 5KSUB 2CMRH 4JAMB 4LLVA 1NGZA 1A7NL 3QZWA 3IAPA 3BAEH 2GSIB 3DETC 2W38A 3ZDZF 5JW4N 3QG7L 2FBJL 4PG2C 5EC2B 4OI7A 2D2OA 1HHIB 3QFDA 2ATPA 2B1AH 1S78D 2OZ4A 3VI4F 2D7TL 3ZKSD 1E28B 3D3VD 5E9DE 5D1QA 4ESKA 1DQQB 4Z7QF 1LE5B 1D6EB 4O58L 1YMMB 1T83C 3O4OB 3PP3K 1CE1L 2HFFA 1FJ1A 2CDFB 2F58H 1BFVH 3P0VL 4HV8B 1MY5A 3DSFL 3D25A 5DVMA 1WIPA 2NNAA 1EXUA 4RFOL 4X80L 5DO2D 1F6FB 5HDQH 5EC1B 2R1YB 5EBWB 1Q9OA 4NQED 1CXEA 4JKWA 5FUZL 2DQEH 1T20A 2ZKHL 4JFDB 3RY4A 3ZT7A 2EC8A 1FG9C 1DZBA 3TLRA 3TN0D 4WWKC 1NH6A 2ORBL 3GJFK 5FV1L 3WEXA 4JDVA 1A6AB 5K9OB 2RJMA 1EERB 1U92A 5F9JB 4OCNC 5IQ7H 3BH8B 1W72H 1W8OA 1AR2A 4ENEC 3HG1B 5IM7B 3BIBX 2YPLA 4HLJA 3CLEH 4MQXD 1ZAGA 5I73C 5I2IA 4HJJL 4JFFD 2BSED 3PDOA 4S0TD 4NSKB 1CLZL 1Y6NR 1MQKL 4J3SA 3WLWD 3O45B 1BF8A 5D7JD 4HJGA 4KKAC 3CXHK 2NW2A 2F54B 4M7KL 2YN5A 4MA3B 5GRUL 5F21B 1N2RA 1YA5A 4QHNA 1FPTH 2ZNXA 3HZVA 1JJUA 3MV8D 4MJ5B 4CGTA 1LE9A 4JCLA 3DXAA 3GMMB 3ULVC 3TBWA 3QHFL 5IW1A 5I9QB 3S36L 3HNTH 1JV5B 4U1GC 1EAPA 4LAQL 5CBAA 1XFPA 3U1SH 1UWEH 3HTLX 4PJDE 5IROC 5J7CC 1QO3A 1IKFH 3MFFB 4NBXB 4HUVA 3WJLA 4I3SH 2JCCA 3V4PL 1I4FB 1U8HB 1UEMA 2HTLD 4O5LH 5F6HI 5HYJE 2VDNH 3LN9A 1KT2A 3O41B 3OHXB 5SWZA 3S35H 4K71C 3LDBB 4V1DA 3LKRB 4Z7UB 4HIXL 2ICWA 4L3ED 1B0GA 1CDCA 3Q6FA 3PUCA 1F11B 5DK0B 1CR9L 3FOLB 4G3YH 4HBQA 1I85A 1FVEA 3BW9A 4JO2L 1RJZB 4ZNCD 3ARTA 3CFCH 4TYUA 1MHEB 3VU2A 1KCUH 2CRMA 4LF3B 4HUKB 5FEBA 4RAUB 1OSZA 5CGYC 4NPYB 2I5YH 3QXVA 1G7MB 4PPTA 3WS6C 4OZFH 1RZ7H 1QRNB 2GSGB 4MB5A 3QCUL 3RWHA 2P7TB 4UV4H 4JFQB 4EOWL 4L8CA 4UTAL 2FGWL 3HAEA 1EEZA 1BX2B 3S8WA 5KSVB 4J4PC 3V4VL 4MA1C 4H1LB 4MJ6B 3STBA 3HB3C 4LLAA 4YAQA 4HLZG 4NWUH 3LQZB 5IJVB 3BIKA 3C8HA 3KVQA 5C07B 3E6FA 5TF0A 1NC2D 4X5WB 3VXSA 4R2GB 1S7TB 2ZWLT 3GO1H 5BRZB 4FFWC 4NNXA 1G6RL 3HMXL 2D03L 5KSAB 2P5EA 1HXMA 3ZTNH 3VGDA 2DM2A 3V5DB 3HE7D 4Z78B 5LJYH 3VFUA 3G6JE 4N0FB 4XC3H 1OAXH 3BXNB 4HUNB 4XCCL 1LILA 5FYKH 1NLBH 1CFQA 1WTGT 3WE6A 1JN6A 2I27N 3CMOL 3S34H 3BQUB 2VC2L 1AGBB 5DJ8A 5AD0A 2R4SH 4I1NB 3PWLB 3D3VE 4HPOH 1T89A 2OQJA 5D1QD 4OV5A 1BGXH 5IW3A 1S7QA 2ZZUT 3VH8A 3ZLQC 2YZ8A 3BYTA 3QP3A 3ZDXF 4ODXB 2AK4A 4TUOA 1TNMA 5ESVB 4ZXBB 1CTOA 4LOUC 4ETQA 5FUCE 3MCLL 3RWCB 1KPRB 4NQEE 2EYRB 4Z7OE 2O5YH 2N4IA 5TDNA 4NN7C 5H8DA 3ILPA 4LKXA 1OTTC 4P9HC 4PYHA 4S1SL 3T04D 3VRIA 3FL7A 2E8YA 4DN3L 1MCOH 4H8WH 5AZEH 3HZMB 1RZGB 1LK3L 1AE6H 1FFOA 1NGYB 3MZTA 2EIEA 4ZQKB 2LTQB 2OP4L 1LNUB 3ESUF 5DT1L 4S0SD 3HE6D 1XCTA 2ZCHH 5FM5M 4B0MM 3J7HA 4G8EB 4Y5XB 7FABH 2PETA 2XWTB 4YXHH 5IFHL 4CJ0A 1A1OB 3BHBB 3WIHH 1BZ7A 1MRCH 3NCCB 1MCRA 5FCUL 1P4LB 2Q7NA 3H9ZA 4BQBA 4RSVA 2Z92A 2VLRD 5DZLA 3MV8E 2R1WB 1INDL 5EIQA 4MHHG 1L7IH 4RDQG 3PGCB 2VAAB 2VLJB 4NBYB 4WENB 1X44A 4NM4L 3HA0A 1FNHA 4F7MB 4NNYB 2MPAH 1U8NB 4PJEF 4KFZC 2ILLA 3B3IB 4JR9L 4Z95H 2AGJL 2HT3D 2GAZB 5EOCL 4GBXA 4CN6A 1DLHA 3LZFL 5LQBL 4JFEA 1F90H 4I3GA 3PE9A 5SWZD 5IVXE 4XVSL 3P30L 4LSVL 3T4AA 1NAML 1IFHH 4OCSH 3ZE1E 4GLRH 5F1IB 4QRQB 3UTQA 1J1OH 3OGCA 1W8NA 1J8HA 2OCFD 3KPPB 4R90L 1ONQA 5IMLA 1QSFE 2R8SL 1AXSB 4UBDC 5FV2A 5IBUG 5CP7A 1XT5A 1AGEB 2Y25A 3P4MB 1T6WA 3EW3B 4JLRA 1T1YB 5JIKA 5IP4A 1K4DB 5K59E 4BZYA 4O2EA 4QXGH 3X11B 5C0FA 3EYFB 1F4AA 2M8XA 2DTML 1FV1B 1ORQB 1PX4A 4PJ8C 3ABZA 1Z2KA 1GH7A 4UIMB 1JGLL 1N6QH 3RNQA 3BP6B 4NZTL 4H1LH 4QT5A 1EVUA 3V6OA 4ZSOA 5I17A 3BPNC 1T80A 3UXFA 4YHZL 2YWZA 3VXSD 4Z7WB 2ERJC 1D9KC 5L9DH 3DUUB 3EDKA 1JZ2A 2MMXA 2P5ED 3MC0A 4KI5F 4Z77B 3NIFF 1U3YA 3NGBC 5JOPD 5CJXA 2YRPA 5HSFA 4TOYH 4LRNH 5C0CA 1Q9KB 4EN3C 4M1DH 5A16B 3BDYL 5GRJH 5HHQA 5T3ZD 5JUEL 5FGCE 5A2IH 4DFHA 1BLNA 5DYOB 3TO4A 5C0DA 5JW4M 4N8CL 5FKPB 1A1MB 5KG9B 1MFDL 1U8QA 1U2CA 2ZCKL 3QUXC 2BNRB 3VGHA 2CJUL 4I77H 2BFVL 1D5XA 3UTZA 5EIIB 4FZEL 4WWID 4G9DA 1U8IB 2J6EL 4Q9CA 3X12A 1FDLH 4M3JA 4D9QE 4QHKJ 2ZUXA 3OBAA 4JB9L 3T09A 4TTDD 3VDBA 1DBML 4R8WL 3O9WC 5I1GH 3GK8H 4HF5H 4HFWA 4EI6A 4G6KL 1QKZH 4KMTL 3SJVB 4MSWB 3TA3B 1INEL 3MROB 1K9TA 3X3GH 1J1XL 4G6AD 2CDGA 4AMKH 1MCBA 4PJBF 5D72L 3QJHA 1K85A 1MELA 1KPVB 1Q0XL 1MNUL 2FJGB 1HINL 2QHRH 4IRZL 1IEHA 1GGUA 1UKTA 1IT9H 2ATKA 4R96A 3LN4A 3QDHA 4MA8L 1BF2A 4KZDH 3ZE2F 2FX7L 2EDDA 2NMSA 2VLRE 2GITB 5E8NA 4MGXA 1D3CA 4NO0D 4IS6B 4JFZL 4NGHH 2CR3A 1EHLL 4F7PA 1TFHA 4PD4K 5CZVH 5HGBA 1R3LB 5EFIA 4UU9A 4Q0XL 2FJFB 1NPUA 3RX7A 4WW2F 5HVHB 3HZKA 5JTWA 3DX8B 4MDIA 5BMFL 5D96B 3MLPA 1H8NA 2DWEB 4JFED 4OLYH 5SWZE 3QDGE 2XN9A 1BVZA 2YS4A 2ZJSH 5D7LB 3IJHB 1AQDB 5CEYB 4HQQL 5CEZD 2Q7YA 4HAGA 1J8KA 5T3XD 5EBMB 2X10A 1U3HD 4BFGA 5D6DA 5C0RL 4PJHA 4N0UB 4LLDB 4WV1C 1LO0H 4TNVK 4XNUL 3H6JA 4C58B 1NC4B 3U9UA 3WFCL 2BVPB 3UC0H 1SEQL 4UT7L 4AT6A 4OJFH 3BE1L 2P8MB 1TZIA 3CX5J 3ZYIA 4KRLB 1D5BB 1MFEH 4YHLL 1CXKA 1MJ7L 2DQDL 2UV3A 4Z0BL 1U8OA 2IPTL 4HCRH 3U30B 3RWIA 4Y2OA 2X4UB 1QBLL 2NY1C 3TO2A 2VDKH 3AS0A 1EPFA 4U1NA 5ICXA 4Z76A 1AH1A 4KHTL 2P8LA 1VEOA 3QAZC 4YPGB 3DVNB 1R5VB 1TPXB 2F74B 1ZLSH 4LKCB 2P5EE 1DE4B 2E6JA 5TQ2L 3FOMB 3IDIB 5EULV 3PWNB 1TQBC 4WW2C 5JOPE 3EDFA 4Q2ZA 4PJAB 4XI5C 4ERSH 4WFFD 4KZEL 1T66D 1UJ3C 3MYJA 1WWCA 3OKKB 2NR6D 5DHVB 2FD6L 4YUEH 3Q1SH 1G9NC 3AREB 5C08A 1RK1B 5T3ZE 2ICWI 2GJ6A 4PGCB 5HDBE 3SQBA 2X4QA 3KPSB 2ZG3A 3TO4D 4Y4HC 3EUUA 4LBEA 4UINL 1T5XA 4X6BB 1GGCL 1BVKB 2NCMA 1GPOH 3KJ4C 3VD3A 5T3ZL 2WBKA 3T0WA 4NC1E 5I1JL 1UVQA 4ZPTB 1YECH 2P46B 2A6IA 1P84K 5HYSB 1KG0B 2B0SH 4RNRB 4QYOB 4F15C 4TVPE 3B9AA 1UM6H 5EUKB 2CR6A 2V5MA 2GT9A 4UILL 1WAAF 4I2XE 3QI9B 1NUFA 2C3VB 5IF0B 3QCTL 3DURB 1QFPA 2BP3A 5FO9A 1V3LA 3SKNB 1F2QA 7CGTA 1OM3L 4Y4FD 4K2UL 2P8PB 2W65B 3WHXB 3AFLA 3WIIL 3GKWL 4I0PB 5I76B 1YNLL 3OAZH 2QQNL 5GRWA 1OGTB 4LHUB 5D1XA 4M7ZB 5C0JA 1YQ2A 3MOAL 5KOMC 5GZOC 3H3BC 2M1KA 2KUTA 5BVPL 3W0WD 5I15L 4R3SA 3CUPA 2VUOA 3TJHC 3D5OF 3MRGB 1BIHA 1OTSC 2E9IA 3O3DB 3WJJA 5C70A 3SDDA 1P5VA 4NZJA 5MP6H 4L9LB 3LB6C 1ORSA 1ZLUK 3TF7C 5JXAH 3P73B 2RFXA 1CF8L 3QIUA 1C8PA 3L5WB 4K8RH 1O0VA 1TLKA 5IB1B 5I71C 1WZLA 3X13A 1SBSL 1ZHNA 2XACC 4RMSA 5C86A 4DTGL 1G7QB 2HMIC 3G9VA 5DD1H 3L6FA 3RUGB 2VXUL 4Y4KA 4PGJA 5TGBB 1HDMB 4PJ7E 2X4NB 3DJ9A 3FT3A 5B8CC 4AEEA 5HVWA 1PLGH 2VZVA 3MLZL 5EZIH 1VEPA 1TETH 5FYJU 3BX7C 1ZS8A 5T3XE 3V9FA 1XGPB 4JM2A 3ALXA 3I84A 3D85B 3LKQB 3FN3A 5D5MF 4GW1B 5E5MA 2F5BH 3NFSH 1I7RB 4YBLC 1KLGA 2W60B 5GRVL 5CEZL 5T3XL 5JW5B 4IHOA 1CLCA 4AQ1B 2C4FT 4QRPB 4JE4B 4FG6D 3L7EA 2GJJA 3HR5B 2OTWB 3HN3A 3IT8D 3HRPA 3VCLB 5DMIH 1AD0A 5CSZA 2JB5H 2QV2A 2OMBA 4QHKI 3REWA 5JIPA 2XWJA 4LMQI 4ONHA 1NQBA 1TJIH 1G6VK 1H5BA 1MI5D 3KXFB 1F4XL 3L3HB 1YN7B 2EEBA 4DGYL 5MERA 2BSTA 1V7ML 1JK8A 2AV7A 1XH3B 2W91A 1OP5H 2VJXA 3B8YA 4NDMA 2BVOA 4WFFE 3ZDYE 4HEME 4G8GD 5JPMB 4S1QL 2D7PA 1NL0H 5DHVH 1VGKA 3QUYA 3VFPB 4NJ9L 4JHAL 5C08D 3PXHA 1JTOA 2J3SA 4NRZB 1WGOA 5CFHA 1A3LH 3BUYB 4M6NH 4KJQD 3WXWH 3U36B 1QG3A 1Q9LA 4D0DA 1MFCH 4U1SB 4QXUL 4ONFH 2H3NA 1I75A 4D94A 2Z0BA 3MLVL 4OGAD 3KPLA 5D71L 1NFDF 1QLFA 4JPWL 4XMKL 1UB6B 1UB5B 1KSRA 3WN5C 1JGEB 1XCQA 2EEAA 3IYLW 2XPGB 3D39B 3K7UA 2EH7L 4K9EL 1CDGA 2XKUA 2OI9C 1RZ8B 4NKMA 1ADQA 1T0NA 2F53A 4MNGE 3D9AL 4WDIA 1JWUA 4RCAA 3MYZA 2VN7A 1MEXH 5J6GB 2H1PL 5ITFA 3V4UL 3U79A 1V05A 1FL6A 5FA4B 1W0VB 3RWDA 2KKQA 5AG8A 1CICB 2P44B 3EOBB 3W0WE 4NFBA 4WFEE 1OWWA 4YDVA 3PP4H 3DWTA 4OIBA 2VL5A 3O3EB 4LLWA 4AEIH 4P59L 3IDJA 1NDMB 2AJYH 3VRJA 5K9JL 3D18A 1YN6A 4PBVC 5F7KC 5ADOL 2X7LA 4OZHA 4LGRB 4CJ1A 2YKLH 3CGTA 3L7FA 3QIUD 4LIQH 5I1HL 4U31A 3CDGA 1GZPB 3SDCD 2ARJA 5KW9L 3RIAK 2NXZD 4MVBC 1AKJB 3O4LB 3P77A 1OB1B 3BSZL 4XNZB 1AIFB 3DMMA 3IFLH 1N3NB 2DQGH 4Y4KD 4RFEA 4NQUA 5DWUL 5DD6B 1JZ7A 3RZCB 1VADB 5TF1L 4OM1L 3SKUD 2I9LB 4JZJC 3MQIA 1C7SA 1WFOA 4QRSA 3IKKA 5C0BB 5IEHA 3DUHA 1T1XA 1MHPL 3VFSB 2D31A 3OR6A 2DJUA 4K7PH 4JM2D 2BHYA 1ACZA 4PJHE 5HHOE 4F7EA 4N8PA 3ARUA 2DQIH 1I3RB 4W81A 1JPFA 2CIIA 2DL9A 3NFNA 1EEYB 3L1OL 4KTEH 5DEGA 5I74B 5EU6A 5I8KL 3FO1A 3EO9L 2UVFA 1Q9WA 2AQ1A 4X6DA 5DJCA 3BMVA 4XVJL 4K3DL 2P24A 3V6BR 2PW1A 4PLOB 3JV6B 2YMXL 3CH8A 3R06A 4U1KB 5JR1H 4G7YL 5MENA 4QRRB 1A3QA 5C7XL 1HSAA 4GRWE 4OGZA 1F6LL 1MI5E 3CVHB 4XZUA 2HVJB 3TPUA 5DMYA 2GFBB 1WT5A 1NBYA 3VGAB 5E2WL 4PP1C 3AU1B 3QDMD 1DQJB 2CLRA 1MFAL 3HNSL 4Q6IA 4A6YL 4G8GE 1YJDL 2WBJA 4OF0A 4FQJL 3KWWA 3QUYD 3C60C 3BD3A 1P4IH 1F45A 4LCYA 1CN4A 3V0WL 3H7LA 4U1MA 1SMOA 2A0LC 5HHXH 5BXFB 1JE6A 2V7NA 5E4IA 1H9VA 5TE4H 2A77H 2EDWA 4PB0H 3MXWH 4WO4C 2R2EA 3WKMH 4LLYA 3QEHB 5CSBA 1R24A 4PRID 4N0RA 1BEYL 4P23B 1KB9K 4HJ0D 4XTRD 2IH1B 4HKXA 3LEVH 4G7VL 1VA9A 1B0RA 3REVA 3ARGB 3QUZB 5EZLB 1DBBL 2XXMB 4NQSA 4XBEH 3B6SB 2AKRB 2CLVB 1B3JA 2Q86B 1GOGA 3C6SA 3D69B 4Z7VA 5IG7A 2EIZB 3GSXA 2F53D 1R0AH 3DO7A 1FFNA 4DW2L 3TFKD 3O6ML 1IAII 3C6LB 2ICEA 4W4OC 1MCWM 2A74A 4HS6A 2A9MH 5ERWA 1FNSH 1JWMA 3KYNA 4BZ2L 2AXFB 2EC9T 3QIBC 4GW5A 4R6UA 1R3KB 2GCYA 1N0XH 3TIEA 3ARFB 1DBKL 2PXYA 4OIIH 1EZVX 5KBNC 4ZAKA 5LXGH 4FXLA 1AY1L 1XEDA 1T5WA 4FTVA 4RDQF 3CCHB 5DMJB 3G08B 4YHPA 1OL0A 1FBIL 2FX8L 3I02B 3HFMH 4JPVH 1JL8A 1MLBA 4IBLT 3VJ6A 2VLKD 1V3JA 3GSOB 4DAGH 2X89A 4XPFH 1PD6A 2ADGB 4DVRL 1PYWA 2BC4A 1IEBA 1RUAH 3DRQA 1BQLL 4GKZB 4BM7A 1SYSA 5HHMB 4Y88A 1FGVH 3DMMD 5HI4D 3V6FA 4J3XA 3RDTC 4WEBL 1X4YA 3MRQA 5DD5H 4DKDC 1U8KA 4P5TD 1KNOA 1HXYA 1TJGH 1K4CB 2VTFA 3EIFA 4PJIA 4GH7B 5F88B 3KLHC 1FE8H 4Y1AB 4I4WA 2YPVH 3KDMB 1PKQE 1UACL 1E4KA 2ENYA 4OF7A 2YXFA 3VXRA 3KR3L 1AHWB 1HI6A 3MRPB 3BD5A 1A6ZA 3DV4B 2ADJA 5I1EL 4X4XA 4P3DB 2IAMB 4LRIA 4XP1H 1LO2H 5MHSE 2DBJA 3CSYA 2YUWA 5GHWL 4AG4H 1DBJH 1I1FB 2BHZA 4NJAL 4XCYB 4P4KB 2PTTA 2WUCL 1ZLWK 5EUOE 2G5BA 1MIMH 5DRXB 1FGNL 4GG6B 2BOCA 3DVFA 1CD1B 4OCWL 2NY7L 3L3DA 1W0WA 3CVHH 5CBEA 4NUGH 4PS4L 4XP9H 1ZOXA 3BJ91 4XCEA 4OQ1A 5D1ZC 3QDME 2AJXH 4EUPA 4PR5A 4P3CH 4RQQB 4GRLA 1BVLA 2WBJD 3U4AA 5DEFB 2AJVH 3EBAA 2LAGB 3T65B 4OAWB 1IBGH 3MNWB 5BV7B 5EBLB 2W1NA 1K6QL 1K3IA 1YEGL 5DLMH 2BSSA 2YC1A 1TXKA 4HFUL 4PTUA 3LQAL 1LWRA 1N59B 5IESH 4PRIE 3DPBA 4K23H 4PV9A 5CP3H 3G04B 4IMKC 2WNGA 2CXKA 4W68A 2I9TB 1UWXK 3LY6A 4PG2A 4U33A 2JJWA 5DD3L 4RX4D 5FO7A 1OHQA 4KXZI 2FHFA 1MWAB 1E6JL 3KLSA 2HWZH 3MLWL 2PYEA 5JZ7C 4PRPB 1GZQB 4UZGA 2B1HH 5FKAA 3SDXF 4R97B 5D7IA 4F2MB 4PGEA 2BY0A 3LMJL 1T83A 3VXME 1EV2E 4D3CH 3HAEG 4MWFB 4FQHB 2KQNA 5KVDL 1Z9SA 2BX5A 3CX2A 1ADQL 3IRZA 3ARBC 3HRZB 3IETB 3OJ2C 5LAXB 1DLFL 2NY4B 2PYFA 4X99A 3V5HA 4YFEA 4YDKL 2PXYD 5FGRA 4U05A 3IJYA 4JZOA 3QFJB 2HKHL 4WWKA 5C9JA 4XP4H 3KPMB 4IOSD 4MJID 3PHQA 4KJWD 2H41A 5L2KA 4YX2L 4GMTH 3EO1A 1I9EA 4OBRA 4YDLB 4YBQC 2X05A 4NCDA 1V7NL 5E08H 3MLXL 3MUGA 4MDJB 2FIRT 1OAUH 2VLKE 3U46B 3MRDB 4PJFB 3WUWA 4YNYB 4NQDE 1ZSDA 4YQXH 2Y5TA 4KY1L 1VKXB 4XWGL 1CL7H 3GSWB 2QSCH 5FYLH 4EI5B 2YEZB 1I8LC 4TUJA 1LP9B 4LU5L 4FQCH 1CLYH 3T0EB 2NY2D 3UTSB 5E56A 32C2A 1DSFL 4DGVH 2UY6A 4U1IA 1IC1A 2B4CL 3GJEB 3OKMB 2FIKA 4LFHD 1KJ3L 3IDMB 2XTLA 5GZND 1NAKL 5HYQB 4NQCA 3L3IB 3TT1H 4XP5H 3HCVB 1IQWH 4Z7NE 5BOZG 3FMGH 3BUTA 1QFWH 5IROA 4ODUA 4MXWL 4I18A 1F8TH 1KJVA 1QQDA 3O3AA 2ZSWA 1AJ7H 5DFTA 5A3IC 5IMMA 4MD4A 3WHE0 4X6DE 5EOQL 3DGCR 3V95A 1T21A 4XAWH 1WWWX 4U6VL 4PRHD 2DQUH 4QF1A 1XGUB 2XG4A 4XMLL 3BZ4A 2O5XL 4P46B 3LKSB 5AYUH 5AUMB 3WS6A 2CIKA 4RMWA 3V52H 5HPMB 4P5KB 1WC7B 2DM4A 4EKXA 2UWEF 1S7WA 5EOTB 3RVVC 4FQXB 4RRPA 3V0AC 5IJKC 5E5UB 4J4PA 5DR5H 5E99H 1CDJA 3QQ4B 3AB0B 5B39A 3K74B 5KANI 5E2UL 1Q94A 3FQXB 1BOGB 3UPRB 5BV7H 1BD2B 3H2WA 1K5NA 4G6JL 2VQUA 4ZUUB 3HUJA 3TVMB 4OFKA 3GSRA 3S5LB 4M7LL 3QUKA 4ZFZA 1C16A 4F7TA 4AIZB 1N5AB 5I0ZA 4OT1L 3RTQC 2W07A 1UA6H 3OAYH 4EDWL 4M7LT 4BELD 4FQIL 2DD8H 4OD3H 1I9RH 2IC2A 4D9RE 1MCIA 5E8PA 4HWNA 1MWAH 4LEOB 3DO3A 3BKJL 5TPWL 4OCYL 4XPTL 2R0KH 1VB9A 3C8KB 1EMTL 3PGDB 1AFVL 4PTTA 4UTBH 5HYFA 1CT8B 2Z35A 2Q8BL 3T8XB 1AQKL 1E27A 3EYVB 3LDBC 1DL7L 5T1KA 4ZOBA 3KYOB 4N5UA 1Q1JL 2VISA 4X5XB 4UT6L 1D6VL 4HWZB 1S9VB 4JPKH 5DVNA 2HFGL 3F62A 1S9KC 3BN9D 4LPCA 4GUPA 4OI8A 2Y06L 1NEUA 1I1RA 1RU9H 4N0CC 3KHOA 4O2CB 4P2RD 1H15A 4XX1G 2IADA 2ZSVA 3EJZC 5E6YA 4MJIE 4AIOA 4D2NA 1GGTA 2F19H 2KBGA 4KWUA 3MLRH 5ENWA 3JV4A 1UQSB 4N8VB 3H9SD 2MCPH 5BZDB 4IRSD 1NUDA 3B9DA 43C9A 4NOBA 5J6HA 2VDPL 1ZA3B 4Y8AA 4YDIH 4ELME 4I5BA 5DUBA 1NMBL 2OX5A 3WL9A 5HXMA 4KKAD 3C2AH 5JIHA 5FB8B 2C1PA 1U8JA 5EWIH 5KSAC 4M48H 1LD9B 4JANA 4D0CB 3D0VA 4DWHA 5FK9B 5CMAB 2ZPKH 1LO3L 4PJ9B 2C3GA 5HHPB 1NBZB 1AI1H 3NACL 4ODHH 5LCVH 4OUUA 1EJ6A 4DZBA 3H42L 1YYLL 2WAHA 3FFDA 5HGAB 3AXLB 4XHQA 5JORB 3F7YA 4FXKA 3DUSB 4P9MH 3FN0H 4GAYA 4JY6B 1XR9A 2BCKA 2FCBA 3O8XB 3SDAD 1GGIH 4F58L 4KK6C 5GRYA 5ALCH 2X2YA 2HJLA 3MUJA 1P53A 4E42B 5MEOB 2ESVB 4ZDHB 1YDPA 4YGVA 3CC5B 3RA7L 3B8SA 2IWGA 4MD0B 1YY8B 2OTUA 1FORL 3P9LB 1J86A 4AH2A 5F9DC 1MCFA 1JWSB 5TE7H 5E00A 5I19L 3OJVC 8FABA 1JYWA 1C5BL 5D6CB 2J4WL 1HHJA 4PRHE 1S5IL 3DBXB 4WUKH 1EBPA 2YUXA 5GISL 3HNVH 1RAMA 1KN2L 1S3KH 4HIIA 1U42A 4DN4L 1KOAA 1VFMA 4G42A 4OKVB 4P48A 3V79C 3MNVA 5DJAB 3WFHA 5IUSA 2NY6C 1PJ9A 1XGRB 5SV4A 2FH8A 4PJ8A 2R2HB 3MLTB 3WFZA 5GIRA 1RVFL 1ZWIB 1A2YA 2V2XA 5C0AD 4PJDB 3IKCA 1UXWB 3SCMC 2XKNB 5JDSA 3SGEH 3QDJD 3LKNA 5F89B 5T1DH 3S96A 4PJCA 5E94B 1LEIB 3PXJA 4X6CF 3NIGE 4Y5XC 4R4ND 2NYYC 3H3PH 3ULUF 5HYJB 1D9KA 4UUJA 2R0ZH 3ZTJH 3RWGA 1MFBL 3CFDB 4MXQC 1A9BA 4PJEA 4GAGH 2IANE 4RZCB 4HZLA 2HN7A 3A6CL 3O6LL 2CD0A 3AY4C 2QEJA 5JOFB 1IGIH 3D48R 2DYPB 3OZ9H 2M26A 4LDOB 3D0LA 3VW3H 4OZGF 1ZGLM 2OS7A 4JRXD 4EN3A 3QRGL 1JPSH 4X7FC 4X5LA 1MJJA 2HT2C 5IHBA 1SJXA 4NT6A 4WFGD 4BSVB 4DQOL 2BRRL 2FATL 2PNDA 3GIVA 4YHYB 2WLYA 3QUXA 1P7QD 4MQ7A 1RFDH 2FJHB 2H2PD 5J3HC 1G6RB 5ETUA 1JNLH 2H9GA 5T1KD 4AJ0A 4LOUD 4J6RL 5C2BL 5IW6B 1MVUA 1MHHA 1A7NH 2XA8L 3ORJA 3RNKA 1F3RB 3QG7H 1OF2B 2DMKA 2FBJH 2W9EL 4KJYA 1OTTD 3O9WA 4C56D 2DICA 3MRRA 3HZYB 3FCTB 4P2RE 2I60L 1BQHB 2GTWA 2V2TB 2DWDA 3G6JB 2D7TH 1BFTA 4PB9L 1HHGA 5DF0A 3ULUC 4ELKA 3ALWA 4G5ZL 2X70A 2G2RB 5D2NB 4XB8A 4O58H 2JIXD 2VOTA 4K94L 2VO5A 1CE1H 5ANMA 2AK1L 1JBJA 3ZYZA 3H9SE 3P0VH 3DSFH 1RZJL 1XF5A 3RP1A 2J88L 4X80H 4RFOH 5FYKE 3D3VB 2Q6WA 4U6TA 1MCJA 4GO6B 5KS9B 1XF1A 2XWBA 5FUZH 4GRMA 4NQVA 2ZKHH 5E8EA 4U1JA 1C08A 1NCBH 2IPUG 5ABDE 5GS1B 1ERNA 1HWGB 1D5ZA 2ORBH 2E5EA 5HI5D 4X0KA 4NQEB 2V7HB 4TN9A 4Z7QE 5INCA 5I1AB 1UCBL 5CEXB 2DLFL 3V7AG 1UGNA 2NXYD 3WO3B 3FT4A 4GT7A 1XR8A 3TN0B 1BAFL 3IJSB 4HJJH 2VWEC 3ES6A 3OJDA 1CLZH 1MQKH 3B2VL 4LVOB 5DQ9A 1I3VA 3TBSB 3HS0A 5IQ9A 3HI6L 4M7KH 5JDJA 5GRUH 5DFVC 4JFFB 5I1KL 5IMKB 5J1AB 3QHFH 3UJIL 4NIKB 2A73A 4UBDD 1P1ZA 5HGGS 1YEHL 5D7JB 3S36H 4AQOA 2CO6B 1KULA 1O5DT 4Y5VB 2BOBA 4PJBA 2EXWD 1X5FA 1FNGB 4LAJH 4LAQH 4WV1A 2WK2A 4PD4J 1RJYA 3MV8B 5I1LB 3MRHA 3BPLC 3V4PH 4X83A 4YHNA 5D2LF 4O00A 1R5IA 3TA3C 3SOBL 4RWHA 2X40A 4FA8A 4KDWA 2OL3B 5C0AE 1NAMB 4HIXH 2EDJA 3QDJE 1PVHA 1OLZA 2EDBA 2VABA 3Q3GB 1CR9H 2LU7A 3ROLA 1S8DB 3MRMB 4H0GA 3P9MB 5JA8B 1JF6A 1VFUA 4JO2H 2FDBP 5IVXB 3CFKB 1TVHB 3GBNL 5K9KB 2DDQL 1G0YR 5INDB 5L8JB 2BZDA 4L3EB 1J05A 4WW2A 4Z5RA 2DKUA 3GSVA 2FB4L 2DBLL 1QSFB 3LV3A 4JRXE 1P2CA 3QCUH 1CGUA 3F7VA 4EN3D 2CRIA 2FO4A 2XQBL 3NFPB 1KJ2A 1QOKA 4EOWH 4UTAH 1U8LB 2FGWH 3V4VH 4WTZA 1R5WA 4WFGE 3L3OA 1U58A 4Y4HA 4LP4A 4L8SB 3MV7A 5HVHC 1A4JA 5D96C 3QUXD 2GIYA 1KENL 1QLRA 1F3DH 1G6RH 3HMXH 1VFOA 2D03H 4R7NB 4HXBL 4NHUB 1BJ1H 3BN3B 3MRKA 3SBWC 4K7FA 5GGSB 4XCCH 1NC2B 3W9EB 1FQ9C 2DB8A 5ILTL 1S9YA 3DX9A 3NCMA 3DX6B 3O9WD 3CMOH 5C09A 4TSCL 4C56E 2EYSA 2HH0L 4IIQA 4E0RA 1MJ8L 4PV8B 5F7UA 3HE7B 1ULVA 5J13B 5J0BA 2AJ3B 1NGZB 4RBPH 3O81A 5DI8A 4IJ3C 1NGXA 4ISVA 1TITA 4BSJA 2N56A 1ZLVH 3DVGB 5I0DA 5AAMA 4KI5D 2YPKA 2VB5A 5CWSA 2ATPB 5FGCB 5FHAL 2ADIA 1AP2A 3U30C 5HHNB 3OL2A 3RGVD 3MCLH 4MX7B 3OAZK 4WHYH 5D1QB 2H32B 3GSNL 4PLKC 3OKNA 4EXPX 4PRAB 4NO2A 4S1SH 1CFSB 1TPXC 1BIIA 3ZYOA 4DN3H 1EXUB 1FSKC 3TPKA 1PBYA 1LK3H 1Q9OB 3QHTC 4POZC 5DVKA 1UM5L 2OP4H 1HYRC 2B2XL 2XV6B 5DT1H 3QEGL 3ZDXE 3AREC 3HPJA 3EGSA 2YD7A 4JN1L 1BZ9A 5F3BA 5IFHH 4I0KA 1YC7A 1U92B 3KNBA 3T0XA 5FCUH 3E3QE 2X4SA 2X41A 1E4XI 4PGDA 1JYVA 4FP8H 4HK3N 3HE6B 4QOKA 5F3HB 4GAJL 1RY7B 3PDOB 1INDH 2E7BA 4X7SL 4WW1B 5HBBA 3KLAA 1TVDA 4HJGB 4NM4H 5DJXB 3MRBB 4FABL 4XMPL 3E0GA 4QHNB 3UJJH 2VLRB 5FUOL 1AGCA 1LO5A 4JPIB 1E4JA 1T7XA 4JR9H 4BKLA 2EDNA 2AGJH 4LCWD 4KVCL 4J8RA 5IW1B 3RWFA 5EOCH 2QJDA 3RHWK 2J8HA 3FHAA 3LZFH 1IEAA 5LQBH 5FM8A 4HIJA 4HH8A 2V5TA 4XVSH 3P30H 4LSVH 4Z8FL 1OD9A 1NAMH 2PR4L 1XIWA 1OAZL 2IH3B 4M1CC 2D4FA 3M17A 3TZVD 3LS4L 1RHHA 2JCCB 4FQ1L 4P2QE 3UDWC 1KB5B 4R90H 4M7ZC 5JLZA 1KT2B 4MZ3A 1CDYA 3UP1A 5SWZB 4HC1A 3RVWC 3IFPA 1FO0A 3SE4C 4L8BA 5KANG 1TQCB 2ICWB 4TNWK 5IWLA 3C08L 1B0GB 1DFBL 4HK0A 1WCQA 2DTMH 3TNMA 2FYYB 3EOAB 3QT2A 3VGEA 1I1AD 1JGLH 4L9LC 5CD3A 4CW1A 1RZKC 3NA9L 1OP5K 4WFHD 1H0DA 2BJML 3DV6A 4IDLA 1HZHL 3I75B 5ADPL 4Y4HD 2OR8A 3EYOA 4E41A 5SWSA 4YHZH 3RWHB 5D5MA 1AC6A 4MMXC 3FQUB 4L8CB 2VDLL 1N4XL 2J12B 2JB6A 4LPYA 1KIQA 4CUCA 1ZGLA 4QWWD 1FRGL 1HCFX 1WZKA 3NZ8A 5FA3A 3T77A 4NO5A 3F12B 3VXSB 4MAUL 3P9WB 3G6AB 3WN5A 5C0EA 2DI9A 3A6OA 3QQ3A 3NVQA 4YIQA 3BDYH 5ACZA 2CDEA 3EZJB 2P5EB 1HXMB 4YLQT 1KIPA 1CFVL 5JUEH 1HSBA 2HAZA 5HY9B 3VG0H 4N5ED 5JHLL 5DGRA 2EC9U 4JKLA 1XF4A 1X9QA 4WRLA 1WK0A 1MFDH 2ZCKH 4PG9A 3WE6B 4KKCD 3WS3A 2A6DA 1NEZG 2CJUH 2HRPL 1XGTA 4KI5E 5D9SA 2BFVH 1QA9B 3NIFE 4JFHE 3TYGL 4ODTL 5DJ8B 5AD0B 3B5GA 2YBRA 5EU7C 1NMCC 2J6EH 5GZOD 4M9PA 5F96L 1ZANL 2OQJB 4OV5B 4J23A 2H32H 4JB9H 1QYGL 3VH8B 3QXAB 1A14L 4HUWA 4MB4A 1DBMH 1HHHA 4R8WH 4M62L 2QTEA 5GGTA 4G6KH 4ETQB 1KC5L 4KMTH 1H8OA 2HYMA 1INEH 3H7BB 5TDNB 3MRFB 1J1XH 2NQCA 3ILPB 1EK3A 3GMNA 5T1LA 4S2SA 3K0WA 4HKJB 3VRIB 4I2XB 3IXAB 5D72H 3OR7B 1NLDL 1CGWA 1OARH 4O2FA 1Q0XH 4V2BA 1MNUH 1BQHG 1HINH 2QKIA 4IRZH 2HMID 4O51A 1JNHA 5L6YL 3N1FC 4LPUA 3CIQA 4MA8H 3QYCA 2FX7H 2A6KB 1PZ5B 1MCHA 1OPGH 4JZJA 4Y19D 1XCTB 4QOKD 1KCSL 3PJSA 2JF1A 1PGRB 4JFZH 2YHGA 3G5VA 4X9BA 2Y23A 4O9HL 1EHLH 3GFUA 2D0HA 1IAOA 3NN8A 1J88A 1QSEA 2YUZA 4ZTPL 3GMOB 1WSST 4G6ML 1HWHB 5DQDL 3MJ8B 2Y6SC 1CBVL 3FO9B 4NO0B 4Q0XH 5KSBA 1BZQK 3MA7A 3TNNB 1OQXA 4LCWE 4LNVA 4ZYKA 4H5SA 1OAQL 5ID1A 1RMFL 5BMFH 5D93C 2YR3A 3VFTB 4LSDA 4NN6B 2HT4C 5FO8A 4F37F 5DJ0A 5K9QI 1XIWD 4MQTB 4OLZL 3V5KA 4HQQH 3IXTA 4YEEA 1VFAA 3GIZL 1DLHB 1YEFL 4N9GB 4YWGL 4PJ7B 4KV5F 4U7KA 5C0RH 1CICC 2BHUA 3T4AB 3NIDE 2RBLA 1A7QL 4BJLA 2WV3A 4XNUH 1MH5B 3OGCB 5DQJA 1RIVL 3WFCH 2BNQA 1SVCP 1U3HB 4HIEB 4YO0A 5IMLB 1SEQH 5GGUB 3QA3A 4WUUA 3BZEA 4YFDB 4HGKC 4DEPC 3W9DB 4L4TD 4WFHE 4YHLH 3W5MA 3LRSA 1MJ7H 1R3JA 2DQDH 3P11L 4GXVL 4Z0BH 1NGQH 2IPTH 3BP5A 1JNJA 1OOAA 4OD1L 3WMSA 3ULSA 5IBLD 3ZKMC 1QBLH 3OQ3B 5ESQB 4E41D 1DQDH 4WO4A 2Z31D 1KJ2L 4KHTH 5GS0D 5KJRL 5D7KD 2NW3B 2DLHA 1B2WH 3RZCC 1NCTA 1T4KA 1WJ3A 3QQ9D 5TQ2H 4QRUA 2C7UB 4KZEH 3EYQC 4OZIA 4FQQA 4YFLF 1DN0B 5E4EC 3UTPD 2APXA 3QXTA 2FD6H 2G75A 3S88L 1MCNA 3G5XA 3ILQD 4QY8B 3UBXG 3WIFA 3I6GA 1NSNL 5GS2D 3SHSA 3KG5A 1CFTB 1L0YA 4UINH 3G9AB 1GGCH 4W4OA 3VXNA 1UENA 5T3ZH 1MUJB 5I1JH 1GGBL 2FRGP 4PJAE 3QIBA 4PJ5D 3M1BA 3QDAA 3U2SA 1KB9J 3LEYL 1BLNB 5ESAA 3TO4B 1BHGA 4CL7A 5C0DB 4YHOL 4POYA 3ARVA 1D5MA 5EZJB 4KGLA 4BK5A 5JHDD 4BH8B 4XPHL 4UILH 4HBCL 2OJEA 2YK1L 2DLIA 5GS3A 3VGAC 2Q87A 4G9DB 3QCTH 2J8UA 4KKBC 5DZOA 4RIRA 4IRJB 4PJXF 1OM3H 4K2UH 1FL3A 5J4MA 1QRKA 1S7UA 3WIIH 3GKWH 1H3PL 4FRWA 1WZ1L 4ONGL 4HFWB 4EI6B 1YNLH 2QQNH 3S37L 4MVBD 2XFXA 4MNGB 1BFOA 2DS4A 4P2YA 3MOAH 3S3SA 3BISA 3RDTA 3WNKA 5DRNA 4Y4FB 1JP5A 5BVPH 5I15H 2AVGA 4X98A 4Y19E 1WAAE 1RQ5A 1S9XB 4P23C 4X4MA 3N9GL 1EFQA 5F9OL 2ATKB 4R96B 2FEEL 5IVOA 3C5SB 3ARXA 3W0WB 2I07B 1FFQA 3CPLB 1QSED 1JPTL 1CF8H 2MTPA 4PRNA 5E8NB 3QNYA 1WCBB 3LCYA 3V6ZA 1SBSH 4HWUA 4DTGH 1JGVL 5FXCH 2ADFL 2VXUH 2MKLC 4F7PB 5JW3L 1ODAA 5HGBB 5EFIB 2FL5A 5DDHA 3C6LC 2A9NL 4M8QB 1KTKE 1I9IL 3MLZH 4UAOB 4KRMB 5ISZD 2WIIA 4X4YA 1ZTXL 5D7SL 1U91B 5D70L 1KCLA 5DHYB 4JDTL 5H2BA 3T1WA 3V7MA 3VXPA 3FB5A 4LHJB 2PW2A 4H26A 3ARFC 1CDHA 1U93A 2R39A 1O7VA 3P3YA 4PP1D 5CEZH 5D1ZA 2Q7YB 2AJZA 5T3XH 2BNQD 3DX7A 1UCTA 3RUGE 1UWGL 4PGBA 3U6RB 1SY6L 1W72A 4HC1L 4PJHB 5HHOB 1FO0L 1BM3L 4L4TE 4OZ4B 4HULB 3JWNC 4NCC1 3U4EA 5C92A 2DMCA 1IL1A 3VFVB 4AT6B 4WO4D 4BQCA 4LSTL 2WINA 4KDTA 1DQML 5D5ME 1F4XH 1RZIA 1KF9B 4XWOC 1FC1A 4IMKA 4DGYH 5D7KE 3BT2L 3A67L 5ELIA 3B2UC 3RWIB 1V7MH 1TNNA 2BK8A 3TO2B 3V0VB 4A6YB 4AENB 1MI5B 4C59B 4S1QH 3LRGA 2WWKO 4FFVC 3UTPE 4Z76B 5I16A 5JIIA 2AW2A 5DC0A 2UYLB 4JEGB 4X7DC 5GS0L 3MRLB 3E1F1 4JHAH 2FEDD 3WDJA 1MCWW 5F7MC 5A43C 1AHWC 2IFFL 3MA9L 1O7SA 2IAMC 2P5WA 4G8GB 3MYJB 3WKNA 4C4KO 5I6XB 1JMZA 1IGTA 3LKPA 2ZUVA 5C08B 3CK0H 4P4KC 4QXUH 5B39G 3RL1B 1UXSA 2A6JA 4WI2A 3ARBA 1IM9A 1DANT 3QIBD 4PJ5E 4P5MA 4DOHE 3MLVH 3HI5L 5E2TL 5B38G 1P4BL 4NZUH 5D71H 3CSBA 3OX8A 4JPWH 2YD4A 2CUHA 4XMKH 4XXDA 1KPUA 1I7TB 1RK0A 2EH7H 3PV7A 1NANI 4K9EH 2HFTA 5JHDE 2VR4A 1A7PL 4U1LB 3F6LA 4OZFA 2K3TA 4AL8L 1UH3A 3D9AH 2A6IB 4PFEA 4PJGA 4BFBD 1L9MA 4K3GA 2KL6A 4LCUA 2IEPA 4UIKL 3DROA 1UZ8A 5J12B 5IK3B 4KHXL 2H1PH 3V4UH 3P4LA 5E95B 1PG7L 5GGTL 3IU4L 3S4SA 3BGFB 5BV7C 1A7OL 25C8L 1NFDE 1I8LA 2KZWA 3MV9A 5DK2A 3GHEL 5IIEA 3RL2A 5FOBB 1M7DA 5I8CB 1X5JA 3BP7A 4Y2DC 1NCNA 5FDWA 4P59H 5KSUA 3ZKND 1G7PB 3SDXA 4JAMA 5TE6L 2UZIL 3EJJX 3PWJB 1G9ML 1HE7A 3KLHD 5K9JH 1EJOL 3L95B 3WV0A 1CK0L 2ZCLL 2EECA 3QJFA 3RY5A 5ADOH 1HHIA 4P2OD 3CUPB 1YEKL 5I1HH 2Z93B 3PGFL 4RGNC 5KW9H 1KTDA 1E28A 3W82A 2CRYA 5JO5B 3RVTC 3BSZH 1DQQA 3ZHLA 1LE5A 3OKOB 5GGQL 4JZNB 2VIRB 4YHIB 4ORZC 1Z0NA 5DWUH 2RFXB 4J7RA 2CDFA 3QIUB 5TF1H 4OM1H 3SDCB 2X1PA 5J9PA 1JZ8A 5ISZE 3X13B 2R1YA 2NXZB 1HOCA 2XTJD 1MHPH 2NY4C 3WHE1 3L6FB 4Y4KB 4JFDA 4CADB 3R0NA 3EHBC 4K3JL 5AG9A 1HYSD 5CZKA 4UOW0 2VR5A 4GW4B 2D9CA 3PNWB 3PWUA 1NCUA 4HX1B 4JVWA 3L1OH 5D1ZD 1A6AA 5K9OA 3U0WL 4XT1C 4ZO6A 3O2VL 5I8KH 1JHKL 5IJKA 4KJPC 1PKQB 4JM2B 3BH8A 2MKWA 4YDLC 1ES0B 1OTUC 3HG1A 5IM7A 1FYHB 1E0OB 1EGJA 4XVJH 4K3DH 5F7FA 5F93C 4NSKA 2YMXH 2XNAA 4U6XB 4G7YH 2PUQT 5C7XH 2UY7A 3L7EB 4EI5C 3VWKB 2F54A 4YPJA 2VXQL 4S1DC 3RTQA 5EUOB 4MJ5A 3KYKL 1R3IL 3I9GL 4JG1L 2XWJB 4MAYC 4ONHB 3CJJA 5E2WH 4JO4L 1WF5A 4WCYH 1QFUL 1MFAH 1FFPA 3OAYK 2VZOA 3HNSH 4A6YH 1JZ4A 1JV5A 1YJDH 1Y6KR 5DMGC 1H3GA 3MUZ1 3WNOA 1ZVSB 4FQJH 2WW8A 5ID0B 5MERB 3MFFA 3V0WH 2ITCA 3AMKA 4CN1A 1U8HA 1JK8B 4HT1L 2AV7B 3QDMB 5FYJD 1HNGA 1XF3B 1ND0A 3L5IA 3O41A 3OHXA 1ZXQA 4KK9C 3QUYB 4PUBL 1BEYH 3FQRA 1XAUA 3BIAX 4FN0A 1F11A 1IM9D 1L0QA 3ARBD 3FOLA 5DK0A 4G7VH 2CKBL 1RJZA 1X4XA 1DBBH 1LQSR 5H37G 4LF3A 4NM8L 4PRIB 4D0DB 3N06B 4P46C 1KTLA 4RAUA 1G7MA 1Q0YL 4DK3A 2H3NB 5D8JL 3SKMB 3KYMB 3QEUB 2H26A 2QQQA 3MJ7B 1QRNA 2GSGA 4NZRL 3KPLB 2P7TA 4DW2H 3BVNA 4FQXC 3O6MH 1XCQB 1BX2A 3RBGA 3AB0C 4MJ6A 5SX4H 2HLFC 4NKMB 3LQZA 5IJVA 2F53B 4BZ2H 3MREB 4OBSA 5JXED 1S7TA 3VI3E 3VXMB 1DBKH 3TVMC 5FGBC 4JREB 5KSAA 1AY1H 4Z78A 2Y9RT 1FL6B 1T0MB 4ZS7L 3BEVB 3BXNA 3K2MC 2FX8H 1FBIH 3QIWC 2ZUSA 5BS0D 4YHML 4BH7A 3I3DA 1EX0A 1X6NA 4YDVB 2MQ3A 1FG2B 4BZ1L 2O61B 3BYYA 4CVZA 4LLWB 3IDJB 2K1MA 3S9DB 1S7RA 4DVRH 3PWLA 4UNUA 1BQLH 1IC5L 1CGVA 4OZHF 4WEBH 2VLKB 3UAJC 3L7FB 4JG0L 1NBVL 5HJ3A 4ODXA 3CDGB 3VXUD 3PWPA 3B9VA 4OF6A 2IQ9L 4NKQB 4ZPVB 1KPRA 3RWCA 2XTJE 3P77B 4F8QA 3DMMB 1UACH 2VNCA 5KAQG 3ZHKA 2M2DA 1MREL 3KR3H 4P5TB 5HDQL 5FYLE 3HZMA 5I1EH 1JHLL 1RZGA 1I8MB 4ZUTB 1NGYA 1T1XB 2HFEB 3OR6B 4ZQKA 1MCSA 3FO2B 5GHWH 5EU3B 3SCMA 4NJAH 1LNUA 3K8LA 2WUCH 2P48B 2CIIB 4Y5XA 4XBPA 4JDZB 5DEGB 1A1OA 1YMHB 3BHBA 3GSUB 1FGNH 4U2YA 4KXZH 3T2PA 4OCWH 2NY7H 4OB5L 4X6DB 3IGAA 1OLLA 5DJCB 1C7TA 3RTQD 2A83B 3AY4A 4AK1A 3C87A 3VD5A 3TWCL 4PS4H 1TZGL 2R1WA 1HSAB 3PGCA 1EFXA 1X6LA 2VLJA 1DQLL 1AXTL 4PJ9C 3AAZB 4F7MA 4NNYA 3QG6B 2GI7A 5HGHB 3B3IA 2XZAH 4MHHI 2XIDA 4RISL 3WYRA 5L7XH 3MNZA 4L4VD 5I1DA 2CK2A 3UO1H 5FYJE 2FNBA 2AERT 4LLMB 1YEGH 3O8XC 3VWJB 3DYMA 4HFUH 1M7IA 5BO1H 2WBJB 2XZQL 3LQAH 4H88L 1M71A 1XMWA 1YNKL 2OK0L 1ZHBA 3MLYL 4PRDA 3KPPA 1AXSA 2H8PB 4UQ2B 1AGEA 2OBGA 3P4MA 5DD3H 4LLYB 4WI3A 4N0CD 1FNFA 1P6AB 4D8PB 4X6CA 1XZ0B 3EYFA 3MLWH 3QO0A 1C5DB 2KQMA 4LSQL 2BY3A 4NNPL 4X8JB 4HKXB 1ORQA 2B39A 1NKOA 5E5RB 1ZT1A 1HQ4A 3LSOA 1B0RB 3T0BA 1YZZA 3SE8L 2Q20A 3LMJH 4UIMA 5FHBH 3GHBL 2NY0D 2DIBA 4NQSB 3BP6A 1U8MA 5C71A 4Z7VF 4LQ1A 4HCRA 1PW3A 5KVDH 4WTZG 4JVPA 1ADQH 4OZGA 4X9IA 1DLFH 3DO7B 3N50A 4OCXL 1JHTB 4Z7WA 2N7AA 1FZKA 1FFNB 1V5JA 4YDKH 3DUUA 3GB7B 4I13B 3O11A 2HKHH 2V2WB 4HS6B 4L4JA 4Z77A 1W0YT 4NWUL 2JJTC 3KYNB 3SDXE 1R3HB 2CK0L 4AEFA 1Q9KA 2PXYB 2ZOLA 5A16A 1V7NH 5BS0E 4MLSA 1FLRL 3JWDH 3MLXH 4LSRL 1GHFL 3K4ZA 4MJIB 3RI5F 5DYOA 4KY1H 4XWGH 4YHPB 3TBVB 5FKPA 1ETZB 3PQYA 4Z7OF 4YHYC 3U7WL 5KG9A 3VJ6B 4XB7A 5DFWH 2BNRA 4LU5H 2E7CA 3RKDC 3DHJA 1DSFH 1A7BA 2B4CH 2H6PB 2UZYB 3VXUE 4ELMB 3K2UL 3PWPD 3SN6N 1L7TL 1A6WL 3NZHL 5EIVA 1KJ3H 5JQ6L 1A3RL 4KAQL 3DRQB 5E6IC 1ITBB 1NAKH 2WBWB 1C12B 2NY2B 5IHZB 2YZ1A 5MEQA 3ZL4L 1U8KB 4KQ4H 3KPNB 4MXWH 2NY6D 1ZT4B 2SEBB 2D7NA 4PJIF 1KNOB 1HXYB 3SJVA 2PO6D 1IQDB 4MSWA 2F8VA 3TA3A 5KVEH 4MJ4A 3MROA 4XNYL 1CXHA 4APQC 1TENA 3SCMD 5HGDA 5F8RC 1DUYB 5EOQH 3NPZB 3QUMA 1A6ZB 1KPVA 2FJGA 2E9JA 4U6VH 2UZXB 4LGSB 4ZFFB 2X4RB 1CU4L 4YHKL 2O5XH 1H3VA 1EGJL 1T3FB 2GITA 3PL6B 3K8KA 5GS1C 2DMBA 3OV6A 3HHRB 5DO2C 3MV01 5FUCC 4PRHB 3TV3L 1EFXD 1QZ1A 2VLJD 1L6XA 2BOCB 4Z0XB 4CDHA 3L3DB 1W0WB 4PREB 2HT2D 3UCRA 1GC1H 1OVZA 4PIRF 4AYFA 2HJFB 2FJFA 1HN1A 5E2UH 3TN0C 2GQHA 1AGFB 1RI8A 4L4VE 3BRFA 3BZFB 3NCEB 4MNHB 4M02A 4LVOC 4EUPB 4M7LH 1BVLB 1FYTA 4JFYB 5D7LA 4OT1H 3IJHA 1AQDA 1KGCD 4EDWH 1TTGA 3SBWA 5L8KB 2UWEE 1AO7D 4KH2A 5EBMA 5LVEA 1PG7W 3U0TA 2IMMA 2YC1B 3CXDL 4N0UA 4Y5VC 4YH6A 4LLDA 2AQ2A 3EAKA 5TPWH 3BKJH 5C8JA 4OCYH 3WFBH 4L29A 1NC4A 4XPTH 1EMTH 5F9WC 1AFVH 3ULUD 2BVPA 4LL9A 1IVLA 3OKEA 4KC3B 1QBML 4UDUB 2Q8BH 2AQ3A 4G9FA 5FO7B 1AQKH 2V9RA 1ZLVK 1Q1JH 4UT6H 1D6VH 5D7IF 2HTLC 2HFGH 1UG9A 4PGEB 1RJLA 3FO0L 2Y06H 4YPGA 4ZNEE 3DVNA 3MMEB 4LKCA 1TIUA 5E7FA 1OGAA 3FOMA 35C8L 1RV6X 4BFIB 4RMQA 4X6EB 3S98A 2Q3AA 5L9DL 1JVKA 3IJYB 1OSPL 4JY5L 3AREA 1JPST 4P2RB 1WIOA 2NLJB 1HEZA 3FZUD 4HMCA 5H94A 5C9JB 4FMFA 4E5XA 2NY3D 2VDPH 4GLRI 1W2KT 3BPOC 4I3RL 4L8SC 3T0DA 3PQYD 1UM4L 4X6BA 3ELAT 2BNRD 3MUGB 3AS2A 3H9SB 4IRSB 4ZD3L 4ZPTA 4WNQB 2G9HB 3PWPE 1LO3H 4RNRA 4QYOA 3NACH 4TUJB 4RAVB 3HI1A 4PY8J 4KKNA 3H42H 4OF5A 1MIEL 1YYLH 3ECBB 2YD1A 5EUKA 3ULVF 4U1IB 3HLAA 1SM3L 2DI7A 2FIKB 3HE7C 2X4OB 5IF0A 4NP4L 3DURA 3VA2C 3SKNA 1WEJL 3QISA 1CDIA 4RMVA 4U1GB 3TA3D 4F58H 5FCSH 4CN4A 3F7RA 3QHZL 5DUML 5I1GL 3K8MA 5I76A 4MD5B 3RA7H 3UDWA 4DKFL 2KPNA 1FORH 4I18B 4Q9BA 3OPZL 5GSVB 5I19H 1KJVB 1INQB 3SDAB 4ZMAT 1QUNA 1C5BH 2QADB 3PDGA 4KMQA 4IDJL 1CZ8L 1S5IH 5D1QC 3SE9L 2DLEA 4K71B 3SE4A 5GISH 1V8HA 1AGDB 3DLQR 1KN2H 4KTDL 4DN4H 4HMDA 3MRGA 5EORL 1YEIH 5TQ0L 4S1RL 4L9LA 2OMNA 4U0QB 1RVFH 2ESVE 3FFCA 2R1XB 3MOQA 5HDLA 5BVJB 3L5WA 5IFAL 1JRHH 3JTSB 1M7XA 4MCYA 2VLLB 5IB1A 1S7WB 1G7QA 1OAYL 3RU8L 4MXVF 4EUPH 1HDMA 4CNIA 1WBZB 1MFBH 2X4NA 4HGMA 5C0AB 2J2ZA 2L4OA 3TC9A 1FYTD 3F5WB 3QDJB 3DTXA 3A6CH 3O6LH 5CZXC 3HE6C 3JWOL 2VZ3A 3HC4L 1AO7E 4R0LC 3HUJF 2GUOB 4M9OA 4Y0GA 3D85A 3QRGH 4Q9QL 3GSRB 1TCRA 4U4BA 4X6FB 3K1KC 2MHAB 1C16B 4NC2B 2DIJA 5DC9B 1QP1A 4POUB 1X5XA 1I7RA 1HH6B 2W60A 5IGXL 4P99A 5JW5A 4JRYA 4DQOH 1RUQH 2BRRH 2FATH 4JRXB 4QRPA 3UX9B 1JUFB 3HR5A 2OTWA 3O0RH 1WBXB 4G9FD 1LO0L 5IFJB 4U1HA 3RQ3A 3C5ZA 1QTYT 5C2BH 4J6RH 2HVKB 3L5JA 4MNQD 3ULUL 4OZGE 4OFIA 2XA8H 4ZOAA 1DVFC 2BXYA 4GJTB 4PLKD 1P7QB 1HHKB 1IAIM 3KXFA 2AI0L 2W9EH 1YN7A 2DQCL 2R23B 4LASL 1IGYB 2I60H 1TQCC 1MHCA 1OGAD 3FAXA 15C8L 4PB9H 3KPRD 4POZD 2ZG1A 3WSQL 4UT9L 4G5ZH 5JPMA 2O5ZL 4NN7B 4JFXA 4K94H 4XH2B 1JFQL 3VFPA 4C56B 5DJYB 5JW4Q 2AK1H 2IADB 2ZSVB 3MCKB 3FQTA 3TH3T 1RZJH 2J88H 1CE6A 4FXGA 4WIQA 3BUYA 3DI2B 3TIDB 3SO3C 2JIXB 3GSNB 4K3EL 3U36A 4JFPB 4OLXL 4PBXA 4U1SA 3BZDA 3K1DA 4XCNB 2R2CA 43C9B 1P7KA 3VFGL 2V5SA 1Y6MR 5D2NE 4UQ3A 1JZ6A 1UB5A 1UB6A 1UCBH 2DLFH 5B4MD 1JGEA 2DOCA 4RGMB 4WGWB 4HG4K 3D39A 4IOIA 5LWYL 4YXLL 2D7MA 1BAFH 1RZ8A 5KS9E 2JK5B 4HPYH 3WLBB 3D0VB 3B2VH 4J1UB 2I24N 3HMWL 1RHFA 5TDPB 5E7BA 5HHVL 4D0BB 1T2QH 5IR1B 3PV6A 4DZBB 2NXYB 3HI6H 4YBHA 5J6GA 1NCCL 2ITDB 1J7VR 3FFDB 2ARJQ 2NTFA 5I1KH 2BY2A 5FA4A 1Z3GL 3UJIH 2XQYK 1YEHH 5F1OB 4HGWA 4IMLB 1CICA 3EOBA 4XAKD 4F7CA 2ED7A 4U6YB 1A9EA 1SYVB 4AZ8A 1YDPB 2VDRL 3CZJA 4NC1C 3RVUC 1NDMA 1A6PA 3QUML 4I0CC 3VXOA 1HH9A 3RVXC 1KIRB 2YPLD 2QLVB 3U9PL 3SOBH 4LNRB 4HKZA 5DS8B 4JFFE 3FFCD 1CD0A 4G42B 5CJ5A 1GZPA 3MNVB 2MOVA 5CILL 1PEZA 2YUVA 3ETBF 4LDEB 2Q8AL 4XC1L 1AKJA 3O4LA 3QR2A 3MR9B 1DBAL 1OB1A 2AXHA 1AIFA 1N3NA 5GIRB 1A2YB 3GBNH 5DD6A 3S3JA 1JIBA 3RZCA 1VADA 4J2XA 3IKCB 3DXAD 5ALBL 2DDQH 4PJCF 2I9LA 4O4YL 3S96B 5CUSL 4P2QB 5KN5A 2R69L 2OM5A 2FB4H 5C0BA 5D2LE 2DBLH 2HA1A 5SWQB 4GQPH 2ZUYA 4M61A 6CGTA 2FH6A 2XQBH 1UFUA 1A9BB 1I3GL 3WXVL 2EYTA 4R26L 4YR6B 2HN7B 1EEYA 3F8UB 1B6UA 3D0LB 4JRYD 4Z18A 1DANU 3S35X 4EN3B 4V1DD 4L3EE 4NN6C 2G60L 4U1KA 4HXBH 3C5ZD 1FIGL 4PY8I 2OJZL 3ZYJA 4QRRA 4MNQE 4M43L 4W70A 3QUXB 5ILTH 5DMIL 5JA9A 4J3TA 4BUHA 2DKSA 2XY1A 2HVJA 3ZZ1A 4TSCH 1C5CL 2GFBA 1MJ8H 1TJIL 2YRLA 1OGAE 4NKOA 1MHHB 4TNVF 3AU1A 3D6GA 1DQJA 3KPRE 1IRAY 1U3HC 3OKLB 3ME0A 4ZO9A 4KJYB 2MQ0A 5FHAH 2GTWB 3OMZA 5DJ2B 5BXFA 3H8NA 1DP0A 3UTTA 1G1YA 4ELKB 2BVTA 1N7ML 3GSNH 3LN5A 3W11D 1PSKL 3CDFA 3RBSA 1L6ZA 2EEDA 4P23A 5CP3A 5T5NG 4XP6L 1XF5B 2IH1A 2VDOL 4EQ3A 4LCIL 2BVQB 3RGVB 4RMUA 2MFNA 3L3JA 3MUY1 2OR7A 4HWBA 4U0RC 3HPLA 2VXTL 3CFBB 4NQVB 1UM5H 1T22B 5EZLA 5KAQF 4U1JB 4WHCA 2AKRA 2CLVA 2Q86A 2B2XH 2FHBA 2Y6SD 3QEGH 1CG9A 4OSUL 2D3VA 1D5ZB 2EIZA 4JN1H 4OZFG 3IAGC 4RWYL 2NR6C 2HT4D 2LABA 4GKSB 5J06A 3C6LA 4L9DA 3OKYA 3FT4B 2OZ4L 2AK4D 4N0YL 4GAJH 2QQLL 4XNQA 3ES6B 4XVUD 3W39B 2AXFA 4X7SH 3S4SG 3SKOB 4PJXA 3TO4C 4F33B 1EUTA 3ARFA 2PTUA 2EH8L 3HS0B 1CIUA 4CMHB 4FABH 1N8ZB 4OFYA 4XMPH 4W6XB 3H0TB 3FQWA 5DRZB 5FUOH 3O3BA 4BQ9A 4KVCH 1CD8A 2YPLE 5GRVK 4IRJC 5BOPA 1BBJA 1UZ6F 4PJBB 1NDGB 3N85L 4Z8FH 2PR4H 1NFIB 4Q9RL 1OAZH 2X1XR 2ADGA 3LS4H 3OXRB 4LCWB 4XVTL 5EDXA 1SVZA 4FQ1H 3ZKMD 4YHNB 2WIMA 4GKZA 1AKJD 3O4LD 2MNUA 1QR1B 1OWRM 1RZKL 2Q76B 4HS3A 4X9HA 1KYOK 2RGSA 4LSUL 4Y4FC 3MRNA 3H9HB 3RZCD 3DXAE 2KH2B 4LQFL 4X7TA 3C08H 3T1FB 1DFBH 3TZVB 2KZ1B 1K4CA 4XPBL 3ROLB 3EYQD 5F88A 1FH5L 4P3WA 5TJWK 4Y1AA 3WFDL 3NA9H 1T04B 2HJKA 1AHWA 2BJMH 2JCCE 3RX8A 4GBXD 1TQBB 4WW2B 1HZHH 3DV4A 3GSVB 5ADPH 1RUML 2IAMA 4L8DB 4EIGB 3LV3B 3OWEA 4GRWF 1I1AB 4RAHA 1PEWA 3K3QA 3T0VA 4V1DE 4KUC