3HRZB

Cobra venom factor (cvf) in complex with human factor b
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
233
structure length
233
Chain Sequence
DGFIADSDIISRSDFPKSWLWLTKDLTEEPNSQGISSKTMSFYLRDSITTWVVLAVSFTPTKGICVAEPYEIRVMKVFFIDLQMPYSVVKNEQVEIRAILHNYVNEDIYVRVELLYNPAFCSASTKGQRYRQQFPIKALSSRAVPFVIVPLEQGLHDVEIKASVQEALWSDGVRKKLKVVPEGVQKSIVTIVKLDPRAKGVGGTQLEVIKARKLDDRVPDTEIETKIIIQGDP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Cobra venom factor
publication title Insights into complement convertase formation based on the structure of the factor B-cobra venom factor complex
pubmed doi rcsb
source organism Homo sapiens
total genus 28
structure length 233
sequence length 233
ec nomenclature
pdb deposition date 2009-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00207 A2M Alpha-2-macroglobulin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.130.20 Mainly Beta Single Sheet S-adenosyl-L-methionine-dependent methyltransferases S-adenosyl-L-methionine-dependent methyltransferases 3hrzB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3hrzB02
5BV7C 4ODBD 3CMOL 3WFZA 1AGBA 4BH7A 1F45A 4ZDHB 3O8XC 2G9HA 5KVMC 4R3SB 1X5HA 2VAJA 1K8IA 5FDWB 2XA3A 1OW0A 3GBLA 3WFDL 4MJ4A 5DQ9B 2G2RA 3G9AB 2DYPB 5C6TL 1C12A 1A4JB 5MENA 3MRDA 1T80A 1ZT7B 2CJUH 2UWEE 4ONGL 5CMAB 3VXMD 3LQAL 2B2XL 5EA0L 1I7UA 4Y16C 3UPRA 4MJIA 5EFIB 2NLJA 1KCSL 5TDNA 4XCNA 1TJIH 2VZOA 1G7IA 2YPVL 5GHWL 2ICWJ 1U8IA 4XP6L 1SBSH 3IFOB 1U8HB 1HWHB 2ERJB 2FBOJ 5KSBB 4X98A 1UB5A 1J1PL 2BVQA 4NKQB 2M2DA 5E7BA 1OT1A 1JV5A 4G6FD 1OGAB 4HJGB 1MHHB 7CGTA 3VFSA 3TBTB 2NW2A 2Q8BL 4G8GA 4YHML 1XF3A 4D9RE 4DN3L 2O93L 5JW4M 4KROD 4MXWL 4IOSD 2BMKA 3EKCA 4A6YA 5L8KB 1ZT4B 1WFUA 1AQKL 3ZLQC 2W0LA 4OT1H 1ED3A 1FVDA 4P49A 2FX7H 2X89A 3BKJL 5DJAA 4ZOBA 2X05A 3SCMD 5BRZE 3ET9F 2Q1EA 4MHHI 3RVXC 4LCCC 3U9UA 1FL5A 4D9QE 4M5ZH 3V7AG 4X8JA 4AYFA 2ZUXA 3N1PC 1LNUA 1CFNA 5I1CL 1DBJH 2R69H 4R7NB 4HC1L 1EZVX 3T65B 1TTGA 3UPCA 2OL3L 3UYRH 4MAYB 1T1YB 1BJMA 4OGAD 3QDJA 5I73B 5M7QA 3B4NA 1YEKH 4XCYB 3VXNA 5IQ9A 1JPSH 3WFBL 3WIFB 4NPYB 4M1DL 2B0SL 1DE4A 5E9DD 5ANMB 1WAAF 1J8HE 4U1JB 3V9FA 3NCFB 5F1SA 2Y5EA 1H3UA 4DFHA 1NCAH 5AAWA 3SDYH 5KANG 3IXTB 4FQPA 4MVBD 2NY1B 4HCRH 4BSVA 4XVTL 4OLXH 2FZ3A 3HMWL 2XXCB 5JHDE 1SEQH 3VGHA 4YHKL 2JJSC 4OFDA 2XWTA 1PSKL 3L9RB 3BOVA 1FFOB 4BFIB 4G8IA 4I2XB 5DEFA 2ZCKL 3ETBF 2APFA 2QQNL 1L7IL 2P24A 2HJLB 2CK2A 4Y5VB 4HFUH 4X6CF 5E7FA 1FIEA 4JJHA 3ARED 3L3HA 3U7AA 1JHTB 5B8CB 3LAFA 5C86A 2V2WA 5IW6A 5HGHA 1KB5A 3RI5F 2NY5C 2C3VA 2PTVA 3NGBC 3GKZA 4QHLB 3UTSA 3U7YL 2C3HA 2HLAA 5C6PB 1B2WH 5JOFB 3RVVC 1XIWB 2GTZA 3AU1A 4G3YL 4RA3A 1BIIA 1E27B 1ZHBA 1YA5A 1HKLH 4JFYA 3L1OL 2Q6WA 4QRRE 4Y4HC 3LY6A 5IB2B 1LE5B 3T0EE 3F62A 1Q1JH 3RUGA 4NFBA 1L6ZA 1N4XL 4L8CB 5T1KB 2RAMA 3BVNB 3TA3C 4CN6A 3LEYL 4ZUTB 4R7DA 4WI4A 1XEDA 3MV8D 3FFDB 1LK2A 4NO2A 3CDYA 1JPTL 1ZAGA 1AGEA 2FSEB 1GZPB 5C3LD 3GMPB 1TQCC 5DJ2B 3G08A 3VG9C 5I1IH 3O41B 4J2XA 2NY7H 4ODHL 3GSWB 3PWPE 3FAWA 5D2LF 5I19L 5KAQF 2F8XC 5L0QB 2A9NH 3WHXA 1S7TA 2X4NB 1ZT1A 3L3KA 4FQLL 3JWOL 3U2SA 3KPSE 2NY2C 3SE3C 5HYQB 1A7RL 4U1NA 2WAHA 3CX2A 2PW2B 4LCCA 4RX4D 1E4XI 5IBTH 1HQ4A 2DQIH 2PYEB 2GYSA 1KIQA 5I8CA 1T03L 1XGPA 5GS0H 4X6EA 4HUUA 1CLOH 2CKBB 2X4OB 3AMLA 4P5TA 4LFHD 4K7FA 4XCEA 3RU8H 4TSBH 4I3SL 2NXZB 3FO2A 4FQQB 4L9LA 5F6HJ 1WWCA 4YDKL 1E28B 3NCJH 5JOEA 4EKXA 3FB7B 3PWLA 3UEZA 2ARJA 3KPRE 1BGXL 4L1DA 5T33L 1HI6A 3P4LA 4HKZA 4ENEC 3VXUB 3OJDA 4TNWF 4F2MA 4P3DB 1KLUA 3QG6A 4FQXC 4WNQB 4Y1AB 3WO4C 1U8KA 3IDJA 5DUPL 5GS3A 5FCSH 5TFSH 3R06B 2QL1A 5K9KB 1FNGA 5CUSH 2JJSA 3BI9X 3PHOA 4R26L 4NWUL 3DX8A 2AEPH 2QSCH 4ZYKB 2Y7QB 1NMAH 2A0LD 3P4MA 1BD2A 1M4KA 4POZD 1F00I 1YEGH 1QFWM 1K2DA 4G9FE 2IGFL 3QIUA 4M7JH 1INEL 5C0DA 4IRZH 4JFXB 3HUJA 1NGXB 1T6VN 3E6HA 4GG6F 5E94B 4JRXE 4LSRH 3VFGH 1RJLA 4PJGE 3FRUA 5CZXD 4LSPL 5DSCB 2X9XA 1U3HC 5JMRA 1CBVH 1RUKL 4LLDB 1JGUL 1YEIH 3WIHL 1PG7W 1YY9D 4K7PL 4Y4HA 5JORB 1NC4D 3DETD 2FRGP 4MNHA 4RQQB 3MRMA 3QNZB 3TM6A 5FUZH 1Z0MA 3QDHA 4XC3H 5I66A 2UZYB 3HG1D 3VXPB 3WUWG 1U8OB 4YZFE 5DR5L 3VE0A 5F7WC 1JGLH 4LVNC 5E99H 3D85B 2CRIA 1DFBL 1AD0A 4ETQB 3D39B 2AK1H 2V7NB 1NFKA 1MWAL 4G5ZH 3OAYK 2FL5A 1F4XH 1J86A 1MFBH 3T77A 4PJ5A 3P4NA 2CR3A 1CDGA 4HKBA 3EYOB 3S36X 4PRHB 3QUMH 3TNMB 4NSKA 3MLWH 2VLRB 3GM0A 3D6GA 3ZHKA 4PB0L 5FUOL 5DD3L 2O61B 3LS5H 1HQRB 3GMNA 4FQ2H 5C0BD 1D6EA 3MV9D 1LO0L 3VRLE 3SKNB 1WWAX 3V4PL 1DEEB 1ZS8A 5FYLH 4DOHB 3EDJA 4PFEA 4KHXL 2H9GB 2FX9L 2NTFA 1KCVL 5EU5B 5K93A 4MXQC 4YFLF 1IQWL 3H8NA 1AHWC 3WNOA 4JFDD 3KYNA 5FKPA 2OM5A 1X4XA 1CDHA 1MCIA 5DD0H 1KNOA 5TE7L 1CR9H 1WQVT 4XWGH 4G6MH 4YFLI 4FQXA 3ARDC 4OZFB 2R4SL 3I02B 1J12A 4NKIL 1JWSA 1A9EB 1WWBX 5D70L 2D7NA 2HKFL 2CDEA 2ZUWA 3QXWA 3JV4B 2JCCB 2YD3A 4PJCB 2CK0L 3EOAB 2ZJSL 2GK0A 3OGOE 1L6XA 4N5EC 3GEWB 1GL4B 4LASH 3GSVA 1QEWB 4PJ7B 1RK0B 5LQBL 4KJQD 2WQRA 4CJ0A 4OGXL 3U6RB 4CL7A 3CX5J 5KSBF 3OV6A 2FCBA 3O0RL 3BP7B 2DD8H 2HH0H 1G7HB 3O6FB 3VFUA 4GO6B 5ICXA 2AAVA 1X5GA 5GGTH 3VXQA 4JN2B 2FATH 3LZFL 1UKSA 3WYRA 3MRBB 4DKFL 3QAZC 4JQXA 4FABH 3LRHA 4OLYL 2XA8H 1TZHA 1OTUC 1FZJA 4KK6D 4UDUA 1J1OH 3GJFK 3WDJA 3GJEA 3N1GC 2N7BA 5DUBB 3KXFE 3S88L 1OAXL 4JFFA 1J0JA 5EO1B 2YWZA 1FL3A 4UOW1 2E7LA 2FWOA 1FNAA 1F6FB 5GSRA 3BPCA 1JK8B 3BHBA 3SE9H 1EO5A 5EDXA 5HI3C 5D7LE 1P9MC 3O11A 5TPWH 3KNBA 1MJUH 1NCDL 4GRWE 2JELH 5C08E 3MA9L 2M8XA 5ADOH 3BQUB 3RAJH 1VFBA 2CLVA 5BVJA 2BNQB 4DAGH 1S7SB 4NZJA 3ZZ1A 5T5FL 5LWYL 4S1DC 2AGJL 2R1WA 5BZWA 5BMFH 3MNWA 1KTKE 3BMWA 1MELA 4NHCH 3IXAB 2ICCA 3KPOB 4BUHA 2WBJA 2VXSH 2X7LB 2VKXA 2IBZX 1LP9E 1PG7L 1MFDL 3BUYB 4NZRL 3RIFK 1MIMH 3FN3A 4K07A 5KS9E 3MRFB 3MLRL 4D9LL 4JVPA 4EXKA 2GT9B 3LD8B 4ZFGL 3FB8B 3N0PB 1KV3A 5J56B 5KVGH 1NCCH 5IP4A 5I0ZA 1QSVA 3C8KA 1ODAA 3SBWC 2PO6A 1MLCA 4DQOL 4PTTA 4WU7A 3RP1A 3WLWD 3UDWC 1OWWA 4HX1A 4PLJC 1FRGH 5F6HI 1B4RA 2ZKHH 3MRCA 4JG0L 4HZLA 4IRSD 5IVXE 5IEKA 1BQHG 5DYOA 4DGVL 1VHPA 1DLHA 2IAMC 1JGVL 2NY1C 2BSRB 3TCLB 3SDXE 3RTQA 3GI8H 4MMXC 3H9SE 5E4EC 5B39A 2APTA 3JV6A 4NQTA 3DYOA 4HXAL 1YEEH 3EGSB 4YHLH 4NRYA 2W0FB 2VQUA 3TV3H 3I75B 3CFCL 3WXVH 4K3GA 5I1JH 2E7CA 2D0FA 1CICD 1KLGB 3QHZL 2Q3ZA 2Q76A 4U1KA 4KQ3H 4AEIL 4Z7WB 5LGKA 4NQCA 2Y1VA 1T20A 3TJEH 4L29B 3JTTA 4Y2DB 2PXYC 2EXYC 3E8UL 4MS8D 4YDVB 3WJJC 3EBAA 4Z95L 1PGRB 3D69A 3KLAB 4LAQL 5HHNA 1WBZB 1JYNA 2J8OA 4WHDA 4KKLC 3ZYOA 3C8DA 1KIUA 1BVLB 4LCWE 3P40A 1O7SA 4N8PA 2F53E 5FGCE 5DHYA 1UQSB 3CLEL 4ONFL 4G42B 1P9MA 4PJ8B 4JGMA 2VDMH 3BYYA 5F3HB 3PGFL 4Z7OF 5JW4R 3SDDB 4HWNA 4FXKA 4YXHL 4OUUB 2DBLL 4M6AA 1PZ5A 4L4TD 4NUGH 3L5HA 5D7IA 3JBG7 3WV0A 1IVLA 4X5LA 1YDPA 5IMLA 3MJ8B 2Q7YB 4F9PC 2Y06H 4O2EA 1AGBB 4HS8H 4C83A 3IU3B 3SKUD 2G9HB 4LPVA 3VA2C 2KDGA 3BE1H 2IADA 4HPYL 4QTHA 3OAYH 4CVZB 3RI5K 2G2RB 1N0XH 5DD6A 5ID1A 1A7PL 2DKMA 1WIOA 4OIBA 4U3CA 4XVUC 3OPZH 4W4OA 1OM3H 1CFQB 2C3XA 5HVFB 3NCCB 4MJIB 4XI5D 1DQML 3MV7D 5GXBB 3GI9L 5DRZA 4LSQL 2V5MA 3VMNA 1LEGB 2Z93B 2ADFL 4TUKL 3V5DA 3C6SB 3CMOH 1FNHA 3GZKA 2R9HD 4L3AA 3QDME 4X98B 4H1LB 4AEHL 5KVFL 2BVQB 2CMRL 3ZE2E 1UZ6F 3A6BL 3WFDH 3HAEB 3VFSB 3WBDA 1H0DA 4XPGL 1RD6A 3LQZA 5C6TH 4XP5L 1XF3B 3Q2CA 4GRWH 5DVLA 4AQOA 4KJPD 4ONGH 4A6YB 3LQAH 2B2XH 5AD0B 5EA0H 3DUSB 1KCSH 2UYLA 4QNPF 5ESVB 5D1QB 4HK3J 1GC1L 1BWMA 5IROC 2YPVH 5GHWH 4JM2A 3D1MC 3LH2L 3EYVA 4XP6H 3QXVA 2NY4B 2PXYA 4ZFFA 3WJJA 5FEBA 2YD2A 3PWJA 1FIGL 1J1PH 1KJMB 4ZUUB 3BEWB 4UTBL 4JRYE 3TZVC 3GBML 1CFNB 2Q8BH 1RZ8B 1NLDL 4YHMH 3FFCE 1CXIA 4DN3H 1A3RL 2QV2A 4LF3A 1PBYA 2AQ2A 3QDJB 1UEYA 3RBGA 1AQKH 3B2VL 4JY6B 1Q9KA 3CU1A 3VGEA 3LV3B 2HJKB 1HN1A 4NN5C 3L5IA 2Z8SA 3BKJH 3FONA 1P7QD 4OCNC 3KPMA 2W91A 1FN4A 5EOCJ 1P84J 4RMUA 2CRZA 2XN9E 4Y8DC 2DRUA 3RL2A 1KN4L 5I1CH 5HVGB 2QR0B 5ISZE 2FZ3B 1ZVSA 4HC1H 3TIEB 2OL3H 5I8EB 1CT8A 2B1HL 5I8KL 5SX4H 4GBXB 4PPTA 3HC4L 2EXWD 1WWWX 3E2HC 3MCLL 3QZWA 4QRPA 3CDFA 2JCCF 1BLNA 5TGBB 1RI8A 2GSGA 4MB4A 1X44A 3WFBH 4PJCF 3L3HB 1JYVA 4M1DH 2B0SH 4BM7A 1KTDB 2V2WB 3WNNA 1I9EA 4PJ7F 1KB5B 4YGAB 3KJ6L 1M7DB 1LDPL 1IQDB 4HBQA 5HVHB 2OS7A 4XVTH 3HMWH 3ULUE 1ETZB 4NKDA 4YHKH 4GKSB 1YMMA 2Q6WB 1PSKH 3BRGC 3K8MA 3GHBL 1KOAA 3QXTA 1X5JA 2ZCKH 2QQNH 5C0ND 2CGRL 1L7IH 1HDMA 4NO2B 1RJYA 5T1KD 4TTDD 1AGEB 1BOGB 2X6MA 4DZ8B 4PJBA 2A6IB 3AFLA 1X5YA 3AB0C 3ARZA 4NJ9L 4E41E 1ONQA 3ULVC 4WU5A 4N1CA 1FG9C 5HDQL 1X5ZA 3U7YH 1QZ1A 3ROLA 5L2JA 2YBRA 5IROA 4OKVB 4NO5A 4G3YH 4HHAB 2AJVL 4MA1C 1HK6A 1I3RB 1ZT1B 3SHSA 5C0CD 3L3KB 4YDJA 3VA6A 3U2SB 1F3JA 3L1OH 1NPUA 4PJ9A 4HS6A 4X5WA 4M1CD 4U1NB 3FOMA 5DQDL 1N4XH 2P5WB 2X70B 5I8CB 2OP4L 3LEYH 4ODVH 1XGPB 5HYIA 1UWEL 3TZVA 5EU6B 4YK4C 1JPTH 4LCIL 2PYED 4F15C 1TQBB 1QSFA 4P5TB 4ODHH 4LCYB 4ZSOB 5LAXB 1MF2L 2Z31D 1EHAA 1C5DB 3Q1SL 4M5YL 2NXZD 2C1OB 2JIXA 3HLAB 1C5CL 5I19H 5DK0A 2CO7B 4MJ5A 1J11A 3QFJA 3FQTA 4FQLH 3JWOH 2IANE 1DQQB 2ARJB 1A7RH 1F4WL 2AI0L 1HI6B 5FV2A 4HKZB 3L5JA 1T03H 3L7EA 1JF1B 1DBAL 3NVQA 4LVHB 4OBSA 5D7KD 3VCLA 4IJ3B 4BQ8A 3S35H 5KW9L 4K3DL 2G5BA 1NAML 2I9TA 1LE9A 3KJ4B 4L5FL 4I3SH 1VCAA 3VXSE 2G75A 4CU7A 1FZMA 3DX8B 1D5BB 3EYSL 1MHEB 1H8NA 2C1PB 1BD2B 3RNKA 5JXEA 3V6ZB 4YDKH 1K2DB 5CSBA 3L5WA 3QIUB 3TIDA 3ZDZE 3HUJB 5JIPA 3FCTA 5D93C 3TT3L 2J8UA 4IRJC 1BGXH 1RHHB 5T33H 1RJLB 3HB3D 4P46C 4G80B 4UBDD 4OI7A 5H94A 3QIBA 1YN7B 4L3EA 3ZKSD 5DUPH 4LHUB 4BQ6A 4X4MA 3ARFD 4GAYA 5CGMA 4Q7DA 5I75B 3A6OA 3F6IA 4R26H 4NWUH 1HWGB 4PD4J 1ORQB 4IBLT 3MRMB 5DEZA 3VMPA 4HUXB 4Z7WF 3H7BB 2B4CL 2IGFH 4PJFE 4AK1A 3IT8D 4QRSB 1INEH 2OLDA 1MCKA 3VE0B 3MXWL 3LOWA 1YJDL 4P3CL 1SM3L 2ZPKL 5CP3A 3D85D 3WMSA 4LSPH 3T77B 5J13B 1INQB 3QUZA 1RUKH 2J6EL 4GQPH 4N8VA 1JGUH 3DV4B 3WIHH 2BVPA 3DVNB 2R56L 2XIDA 4K7PH 4XHQA 3VWKD 4PRHD 5E2WL 4ELKA 2BXZA 3TBYA 4R90L 3TPUA 1NGYA 3SGKC 4I3GA 1VERA 3C87A 2CDGB 1JTPA 5DR5H 4I0KA 4ODUA 1OHQA 5EORL 1B6UA 3HZKB 1DFBH 3P9LA 5DVMA 4EVNB 4X80L 3QI9C 1OQOA 1MWAH 3MRQA 4PJXE 4HIHB 3BP6A 3RVWC 1TCMA 3OR7A 5AAMA 4FG6C 4U6TA 1IRAY 3K2MC 2Z8RA 4PREB 4JFEA 1KNOB 4DUVA 1EH9A 4PJ8C 4PB0H 4Z7UA 1JTOA 3BO8B 5FUOH 4P2RE 3ZKXB 3N1MC 4C56A 4H26A 3ARQA 5DD3H 1B0RB 1LO0H 5GGRY 5ICZA 3UBXA 3VG0L 3V4PH 1CGWA 2FEEL 4ZAKD 5DHVB 4KHXH 1I9IL 3T0WA 1ZHNB 1ZSDA 2FX9H 1KCVH 4GSDL 4U6YB 3VFNA 1JUFA 1I75A 4G43A 2EYSA 2GK0B 5LG1A 4KRMB 3BAEL 1JYWA 1RZFL 4QRUA 4D3CL 4BFEA 2DTSA 1IQWH 5C0AE 4ELMB 2R4RL 4ZTOL 2D31B 3QYCA 3FZUC 4JY4A 4IRJA 3VH8G 5TE7H 5DFVC 3FB5B 2V2XA 3VFUB 5ICXB 2EIEA 1T7XA 2EH8L 5D1XD 3VFMA 1A1OA 4QEGA 2R4SH 1DUYB 3VXQB 4NKIH 3VJ6B 3O6FD 4CW1A 1A21A 3MRJB 4ZO6A 5D70H 2HKFH 2VDPL 4Q2ZB 2R29L 3U0WL 3G9VA 1A6PA 5I18L 3HC0A 4PGBA 3UTTD 4CN1A 1TZHB 4KK9D 2CK0H 1S9WA 2ZJSH 3UAJD 1AIFA 4CMMA 5LQBH 3DV6A 5D71L 1J8KA 4XXCA 4JFFB 5E24E 1BFOB 2PUQT 3EO1B 4OGXH 5IJVA 2W92A 4FFVC 1FL3B 2FWOB 2VN7A 3LKOA 3O0RH 3O9WC 2EECA 5GSRB 3BPCB 1G7LA 1U8QA 4LPTA 5F44A 2DLHA 1FSKB 3V0VB 5IB3A 1JPGB 3HE7B 1QG3A 3QEQB 3UTQA 2OTWA 1DL7L 4WW1B 2CDFA 3LZFH 5BS0B 4DKFH 4G6AC 1VFBB 2CLVB 5HDLA 4X6FA 4OLYH 1URLA 5J1SC 4OZGE 1M7IA 4WVRA 3QA3A 3MNWB 4KZDL 5D1QC 3QPXL 3DUHA 3IDMA 3S88H 1OAXH 4M3KB 2WBJB 2NY4C 1BVZA 1CFSA 3WL9A 1YNTA 2XWJA 3V52L 1XGTA 2VE6A 2AQ3A 2HJFA 4H0GA 1NCDH 2RHEA 5HD8C 3MA9H 4M8VA 2BVOA 4HAFA 2YPKB 4L4VE 5FFLA 5T5FH 1JGEB 1NEZG 5LWYH 2X10A 2AGJH 4KI5F 2HTLC 3CFBB 3BIKB 5EZOL 1SYSA 5EO0A 4B7LA 1JVKA 3O4OB 4D94A 5CKAA 4U1IA 3RWHA 1PG7H 4NZRH 3F5WB 4WV1A 3MLRH 5I1DA 5DYOB 4D9LH 3MOAL 1IGIL 5TH2A 5IHUL 1HILB 4NRXA 3RTQB 4ZFGH 4JG1H 3TVMA 1DP0A 1EVTC 3CX5K 4NFDA 5I15L 3PHQA 4TNVK 3MRIB 3QP3A 1TNMA 4P4KB 4FQCL 3I6LD 3D3VA 4NRYB 1SMAA 3W0WA 2Z92B 3TO4B 3BUTA 4U6VL 4R0LB 1AC0A 3GSXA 4YGVA 4DQOH 1SY6A 4N0UE 5EIIB 1LO5A 2Z0BA 4M02A 4JG0H 4OV5B 1JRHI 4NQCB 3QULB 1U8LA 1T20B 4DGVH 1MCCA 2WIMA 3O3BA 4HQQH 3RWIA 3ARBC 2YEZB 2QHLA 1JMZA 1JGVH 1G84A 1N6UA 3D69B 4MD5A 4Y2DD 5HHNB 3VGBA 4XCCL 2JJWA 1RULL 3F7QA 3VFOA 4OUOA 3O9WA 3QQ9D 4HXAH 2Q20A 3NOIA 1C08B 4IDLA 3GMQA 1HNGA 1DBML 4P9ML 4WFEE 2DM2A 3CFCH 5F1OB 3QHZH 5MEPA 2KH2B 5E6ID 3RNQB 4EUPG 1F5WA 4AEIH 1Q0YL 5SWZA 3CIQA 3PQYD 3B6SB 4Z0XA 4Z5RB 3SDDD 1QSEE 3E8UH 1NC2B 4Z95H 5F7UA 3GO1L 4GMTL 4LAQH 2Y23A 5HYJA 3E3QC 4IOFC 4P2OA 5EOQL 4PJIA 4XWOD 4UNUA 2XWBB 5F7MC 3BH8A 3L95A 3HCVA 3TF7C 2APXA 4QOKA 1JYXA 2ENYA 2NR6C 3CLEH 4ONFH 1WISA 5DZLA 5BV7L 4JQIL 4AG4L 5DWUL 1D9KC 4RGMB 1CLZL 3T0BA 5IF0A 2L7JA 4F7TB 4QTHB 4FQIL 4JN1L 3QEGL 3PGFH 1FE8L 4HK3N 4UQ2A 5F96L 2ZUQB 4YPJA 4YXHH 2DBLH 3GRWL 2H2PD 1A6VL 3BESR 4HV8A 5I2IA 1MCBA 1AO7B 1BQLL 3HUJF 3X3FL 5MEND 4LRNL 3BPNC 2CSPA 1WC7A 1L9NA 2YA2A 5L6YL 4MJID 1MVUA 4M03A 1WK0A 4TVSa 3MR9B 1P2CB 3IAPA 5ERWA 5B38A 4KKBD 3S4SA 4NP4L 4D8PB 2QADD 1FH5L 3RKPA 4UQ3A 4HPYH 4ERSL 1QRNA 1A7PH 3BIAX 4PRPB 3LSOA 4YHZL 1L7TL 4MAUL 2VO5A 2H1PL 1XGYL 3DMMC 1I85C 4G8GD 3IB4A 1DQMH 1XAUA 4JGUA 4WFHE 3GI9H 2J5LC 4TRPL 4Q58C 4LSQH 5C09E 4EOWL 4NQEA 5IR1B 4JM2B 4TN9A 5A3ID 3IFPA 2ADFH 4TUKH 3D25A 3V8OA 2ZSVA 1Q38A 4QYOA 4ZFFB 4EI6B 1BHGA 5J1TC 2BXYA 4GW1A 2X89D 2HG5A 3PWJB 4KGJA 1HHJA 4ORZC 4QHNA 5I9QB 5IBLC 4AEHH 5KVFH 2CMRH 4NQVA 4M1GL 4FMKA 3A6BH 4U2YA 5I1HL 1B0GB 1YECL 1FNEA 4KJWD 4XPGH 1KLFA 1FGNL 3S96A 5C0RL 4AEFA 3MYJA 2V9QA 3F7PC 3OJVC 4XP5H 1XGQB 1XH3A 3HI1A 1KJ2A 6CGTA 2DB8A 4TSAL 2DQFA 2BY2A 3OKLA 5K59F 5I16B 1MCWW 3NIFE 4ZUSB 1GC1H 1SJXA 4NYLB 1Q9KB 1DSFL 2D9QB 3IJYA 4RRPA 2MHAB 1T3FA 5GGVL 3LH2H 3H3BC 3QWRA 3UYPA 4FTVA 1UEMA 25C8L 3QUXB 2NY3B 3RDTA 1FFQA 4XRCA 3EHBC 1FIGH 4N0FA 4UTBH 1BVKB 3REVB 1KIRA 3GBMH 3ZHLA 3AY4A 4EUPH 5M94B 3HPJA 5C0EA 1NLDH 2XQBL 5CGYD 1CT8B 1SBBA 1A3RH 4MNQE 2IPUK 3SKOA 5D5MA 4BQ9A 1FVEB 1ZTXL 5E8PA 4QRPB 3B2VH 2P8PB 2GTWB 2DICA 1TVDA 1KN2L 4LOUC 5FB8A 2C5DC 1IGYA 3O3UN 4ELMF 3C09B 4KUCF 5E8EA 4F57L 1ZWIB 5CZKA 2OTPA 4YO0B 2Y6SC 2D0GA 2NY5L 4FRWA 2APBA 1F6LL 1KN4H 2UWEA 1K8DB 4OF5A 5GRWA 4KKAD 3UTSD 4UU9B 4WI3A 1F3DH 2B1HH 4NKDB 5I8KH 5B4MC 5HPMA 2KQMA 3HR5A 3HC4H 4PR5B 5F1IA 1FO0L 3MCLH 3PGCA 2XTJE 2LFGA 3ARGC 4LDLB 1RJYB 5JXAL 2DQEL 2XACC 3T0EC 3EAKA 1QPPA 3L3GB 4HLZG 2JB6B 1I85A 5IVZA 2PF6A 2Y5TB 3KJ6H 1JHLL 1LDPH 5DJZB 4RMSA 4U1SA 4JKMA 5L2JB 4RGNC 4NO5B 5DRXA 5IHZA 4S10A 2DIAA 1JPST 1QFUL 4PJ9B 4HS6B 3EYQC 3Q48A 3IDGA 1MEXL 3GHBH 3LEXA 2C7UA 4IS6B 4XPFL 4YDIH 4OFKA 1MJ8L 2CGRH 3KPQA 1IGJA 2R1XA 5BRZA 3CXDL 1S9XA 4LIQE 5ENWA 1FYTA 4OLWL 3NCMA 2X1PA 1PY4A 4NJ9H 1LD9B 4P5TD 4HF5L 5HDQH 4I77L 1J10A 2HT3C 4MJ5B 1ROWA 3FQTB 1IZJA 2VDKL 3HZVA 5DJCA 3PXJA 4U49A 1I3UA 4QHMA 5JPNA 1MI5E 5DJ8A 5DMGC 5DQDH 1P84K 1S7VB 3ZTNL 2N1KA 2OP4H 3L7EB 3O3EB 4BSWB 1UWEH 1J8HA 1YZZA 3VXME 4LCIH 2I26N 4DGYL 5C9KA 4R2GB 2MPAL 2DQCL 2XZQL 1MF2H 1UVQB 3TYFA 4CMHB 5GGSY 3PWVA 4ZXBB 3Q1SH 4M5YH 1TZGL 5JHDA 2K3TA 2W9LA 1NFDE 2IBZY 1WBXB 5GRVL 1C5CH 3RVTC 2UUDK 2ZSWB 3TIDB 1W8OA 2HFEB 1BD2D 3CZJA 3GMLA 4OGZA 3FCTB 3PDOB 3QIUD 2XNAA 3VFTB 2P46B 3WFHA 2AI0H 4F7MB 2IPUG 3M17A 3EJZC 4X99B 1DBAH 5H94B 2VUYA 4I5BA 2D0HA 3QIBB 1JCKA 3T2PA 4YJZL 2HRLA 4K3DH 5KW9H 1NAMH 2GITA 1CF8L 4KKNA 3RVVD 4HG4J 4L5FH 3AXLA 3G04A 3I3EA 2AJUL 1CWVA 5FO7B 5ITFA 4OZIA 4I0PA 2FHBA 3IDUA 1T21B 3EYSH 1M05A 1AXSA 2SEBA 3ARGA 4Y4HD 5I74C 2RQ8A 3PWUA 4GUPA 5D8JL 3VFVB 3CDCA 5DJ0B 2PW1B 5GJTL 3TA3D 3HI5L 3T0EA 1MCFA 4JO1L 2VLJE 3TT3H 4NJAL 5GISL 1BP3B 1Z6JT 4PLKC 5HGAA 3DRQB 4JB9L 5JOPD 5DVOA 1LEKA 3DX7A 3QUZB 3PWPA 4P4KC 5KBNC 1QVOB 3M45A 3ZTJG 4PJ5D 4HLZH 3TBYB 3TPUB 1NGYB 3KPSA 2B4CH 4U4BA 3QUKB 5TE4L 5BXFA 4JPKL 4ODUB 3MXWH 3O45B 5IJKA 3MMEB 1YJDH 4P3CH 2DBJA 1SM3H 3HKFA 2ZPKH 4FOMA 2LU4A 2H41A 1YQ2A 1DVFC 3PE9A 2J6EH 2QQKL 2WNGA 3N06B 3G5XA 2R56H 5MEQB 4JFEB 1GGBL 5E2WH 3I3BA 3ZYZA 1F3RB 4RFEA 4R90H 3HE6B 3UBXB 1T7YA 1KIPA 1V8HA 2A6JA 3KPRA 1GGUA 3WUWA 4NT6A 4FQXD 5I76B 5A2KH 2C3WA 4Z6AT 1QLFA 3PUCA 3VFNB 5EORH 1JUFB 4HH9B 4X80H 1GXEA 3GSUB 3TBWB 4AT6A 2YUXA 4OAWA 2AJSL 3U46A 3V0AC 4GXUM 2HT2C 1PX4A 4DWHA 3V6OE 4FA8A 3MA7B 1WCBB 3KYMB 1G7QB 3Q3GB 2AQ1A 5D7SL 2GCYA 3B9AA 3SEPA 1N5YH 5A2LH 4RGMC 2V2XB 3BDBA 1AGDA 1A1OB 3RZCB 4ZOEA 1X5XA 3VG0H 4LDEB 4JRXA 3NIGE 4PJGA 1I9IH 2E6QA 4X0KA 1U3HD 2QHRL 4GSDH 1R3KB 1LILA 5IFHL 4PD4K 3TCXA 1S9WB 1HHHA 3BAEH 4JM2F 1RZFH 4D3CH 3C8HA 5KSUB 4CMMB 2R4RH 4ORGB 4ZTOH 3QQ4A 5GQBA 4NQDB 4NOBA 1V3KA 4CGTA 2ZUSA 4PY7B 1MY7A 4G9DA 1G7LB 4CUCA 2W65A 1U8QB 4FFWC 3ILPA 4K3JL 4Y4FC 3VWJC 4DN4L 3RGVB 3UTQB 2VDPH 2CDFB 1VFMA 2ADJB 2R29H 3U0WH 2AV1A 5I18H 4YBQC 4AMKL 5T5NG 4OLUL 3BP5A 1M7IB 2H32B 5MI0B 4XGZA 5DK3A 4OFIA 1JGDA 2H26A 1O0VA 3LN4B 3IDNB 1SMOA 3IDMB 2VN4A 5D71H 2Z35B 4WGVB 2HYMA 1Y6MR 4LLVA 2W38A 2XWJB 3ZTJH 1S7RA 2R8SL 2ADIB 1JNNL 4CVXA 4QCIB 1INDL 2K1MA 1DVFA 2HJFB 5CJQL 4Z77A 3KWWB 5IFJA 4NN6C 1DL7H 4MXQD 2BVOB 2DIBA 1HSBA 3HFML 2BDNL 3L7FB 5FA4A 3FMGL 3BEVA 4JHBA 2XV6B 1U2CA 1AR1C 4KZDH 3KG5A 3QPXH 5HHOE 2UY6A 3KPPA 5I1LA 4LPWA 5IQ7L 2OZ4L 5T3XL 3TN0C 3ARDD 2NY3C 3RWHB 2PO6D 4F58L 2AJYL 5INCB 4WV1B 3DVGA 1GVIA 3V52H 5I1DB 2F74B 1KGCD 4TSCL 5TH2B 4N5ED 4O51A 3OJMB 1VA9A 3SKMB 3TVMB 1MCPL 5DJDA 3RTQD 1AH1A 5D1ZC 1MREL 1T0MB 4PP1C 4KXZI 3D3VB 1I1YB 1TNNA 1CL7I 3EO9L 4GLRI 5EZOH 5L2KB 2GJ6B 4GKZB 3BKCL 1JNHB 5F3BB 4X5XA 2X44D 4JZOB 1CS6A 3SY0A 1MLBB 2MOVA 3O3BB 4W68A 1JWMB 1U36A 3MOAH 1KJ3H 2IPTL 1IGIH 3CFEB 4XNYL 3MNZB 4J3VA 1OTUD 5IHUH 2HFFA 3S37X 2GAZA 4FFYL 3DVFA 1I9JL 4PBXA 2FEDC 4IIQA 3SDCA 4F3FA 5I15H 4Z8FL 2UUDH 2P8MB 1HXMA 2B39A 3KHOA 2HTKC 3KXFA 3KR3L 4FQCH 4D0CA 1S7UB 3HTLX 3GMQB 2ZOKA 1VB9A 4Y4FA 5EUOB 3VWJA 4U6VH 3G6AA 4JO4L 2GEEA 4MD0A 4LLWA 5HI3D 3F7VA 5SV4A 3BSZL 1J88A 5D96C 5D7LA 4GXVL 1F13A 4PTUA 4QHKI 4PGDA 8FABA 4DEPB 1WAAE 1BQHA 5J11B 2VSCA 3RX8A 5HHPA 1HSAB 2A77L 1I3VA 1KCUL 2I9LA 4S1DD 1RURH 4P2OB 5ADPL 4XCCH 1NH6A 1RULH 4N0CD 4Y5XC 4MHHG 1QTYT 5KN5B 3HCVB 1IAOA 4QOKB 1GAFL 2P5EA 2IH1A 5DURD 1DBMH 4P9MH 1LP9A 3CVHA 3PWNB 4Y5YC 4ODXA 2BY3A 5KS9A 2FIRT 1EV2E 1IEAA 1FCGA 4XMLL 4Q74A 5FUCE 4X6CE 4YC2B 1Q0YH 3UTOA 2A83B 4PJEA 4JJ5A 3O4LB 5C71A 2D3VA 4HT1L 2CXGA 3T3PF 1I1AC 3GO1H 4GMTH 4HWZA 2AXGB 5EOQH 3F65A 5T3XD 1OSZB 1IM9B 3PV6B 3UMTA 3RY4A 1WC7B 4Y0GA 2F8OA 5E5RB 4J7RA 2EZ0C 2BNRA 1X7QA 4PLJD 3DROA 1A6TA 1E4WL 3DTXB 3NACL 2L7UA 1LVEA 3CPLB 5BV7H 5ERWB 4JQIH 1U8MB 5DWUH 4AG4H 2VYRE 1CLZH 5IVXA 1J05A 3AAZA 4FQIH 4JN1H 3VRJA 3QEGH 2NZ9C 4P2YA 3DXAB 1FE8H 2XI9A 4HC1A 5F96H 2IMNA 1S5IH 2FECL 4F37K 3QBTB 1CFBA 3PIQA 4WDIB 3GRWH 3H9SA 5EUKA 1A6VH 1KCLA 4LSDA 5SWSA 5FGRA 3MCKA 1BQLH 5D2LE 3X3FH 4LGRB 4LRNH 4I1NB 1DQJA 5DRNB 1H5BA 1K6QL 1XCTA 2CXKA 4NQEB 5L6YH 4URTB 5FYJL 2ZSVB 3C9NA 5MEOA 4GW1B 2HG5B 3CUPA 4JZJC 4NP4H 2PXYD 5E6ZA 1FH5H 1TETL 2AKRA 2EXYD 2YUWA 3C60C 4GRLC 1HEZA 4ERSH 4HXBL 3KPNB 2EYRA 2E7MA 4YHZH 1HHGA 4X8XA 1L7TH 1JN6B 4MAUH 3RA7L 3SGEH 2H1PH 3SJVB 1XGYH 3V6FB 4LCWA 2APWA 2DQFB 1VACA 2F53A 3OKLB 5KG9A 3MGOB 1U3ZA 4TRPH 4EOWH 2VDQL 3I2CL 1KEML 2VLMD 3IJYB 5HTSA 1DQTA 2DQTL 5C07B 3FQXB 1CXEA 3RDTB 3WJLC 5AZEL 4PRIE 4NHUA 1YMHB 4MSWA 4M1GH 4DVBA 3T3MF 4JY5L 4F33A 5I1HH 3MBEC 1YECH 3FT2A 3KYAA 1VEMA 1JWUA 4WUUE 5C0RH 2YD8A 3KYKL 5E8OB 1U8JA 3ZT7A 5KAQG 4QKXB 3DNKA 4NKOB 4DK6A 4YAQA 1YEJL 4HZAA 3C6LC 4TSAH 5K9QG 1UXWB 3MACL 3I84A 5I6XC 3NFPB 1GGYA 5JW3L 3VD9A 5GGVH 1XGUB 3BWAB 25C8H 4HIIA 4GG6E 1HHKB 4LNRA 1AGFA 5E8EB 5INDB 1I1AA 1OL0A 5F89A 2VQ1A 2D7TL 1MIEL 4XVUD 1ZA6A 1SJVA 4X4XB 1J7VR 4QRQA 2XQBH 5ELIA 1M6OA 3HE6C 2CLZA 4MMZC 1U95B 1NDGA 1OP5K 3DGGB 1DUZB 2BVYA 4RNRB 1ZTXH 1YMMD 3ULUC 4P4RA 5E5MB 4OF3A 5C0BA 3MV9A 5C9JB 3GFUA 2JE8A 1OAYL 4JM4L 4APQB 1GZQB 4WO4A 2A1WL 2N4IA 3HR6A 1KN2H 3OHXB 4S1RL 1IE5A 4F57H 2F19L 4P0DA 5IVZB 2LTQC 3VXRE 4K8RC 3LQMA 4P23C 2NY5H 4U1SB 3O2VL 5EU3A 3MFFA 5DEGA 1K5NA 1QBLL 3IKKA 3ULVL 5T1MA 3S3PA 5IHZB 1Y6NR 4JFOA 4NUJB 1SEBB 1IM3A 2A74B 2Z4QA 3IDGB 2WIIA 1FO0H 3SE4C 4GRLA 5IMMA 1OAKL 3BPLC 4HFWA 4P2QE 2R1XB 3FO1A 4X9IA 2GSIA 4BZ1L 4I4WB 5ENWB 2DQEH 5JXAH 2WK2A 1O7VA 1FYTB 1AQDA 3TZVD 4Q97A 4PUBL 3CSPA 4TQEL 1QSFD 1JHLH 4KRLB 5BJTB 3P4OB 1EBAA 5F6IC 1FZOB 2GUOB 5CEZE 4QWWC 3PGDA 4Z9KB 5HI4C 2JIXD 3LKQB 1D5ZB 2FJHB 1QFUH 2WW8A 3WJLA 3AGVA 1QBBA 3QFJD 1MEXH 4XPFH 2HRPL 2OJEB 1MJ8H 3VFPA 5CIPA 1U0QA 3LB6C 1CGSL 5FGBC 1Z3GL 3CXDH 3EDDA 1A1MA 4OLWH 3LKRA 1NMCB 3QUMB 4RWYL 1N2RA 1MCQA 5HI5C 1I4FA 2XFXA 5ISZA 3RZWA 5HYEA 3X11B 4HF5H 3VFRB 3X14B 4I77H 1ES0A 4GKNB 1AR2A 4XBEL 1GOGA 2HVJA 4KJYA 3T08A 2VDKH 3FO9B 5JXED 5KSBE 3W39A 1M71B 3NTCL 1CFTB 3I6GB 1PJ9A 2FJGA 1OGAE 4LVOB 3ZTNH 2VNCA 5D6CA 4I5BB 3ZKNC 4WI2A 1QR1A 2NNAA 1F4YL 4DGYH 1WUNT 4ISVA 1X9QA 4L3ED 2MPAH 1FLRL 2DQCH 4D0DB 5B39G 5DT1L 2XZQH 2Y4SA 3BGFC 1I1FA 2MNUA 5FF6A 4OZIB 1TZGH 3RL1A 1QQDB 1AXSB 2FBJL 3Q5YA 4WIQA 6FABL 4OI9A 5HSFA 3E1F1 4GUPB 5DHXB 3WO3B 3ILQD 2CLRB 4UNVA 3U7WL 2EEAA 2PYFA 5CJBA 2EO9A 3B9KC 2VXUL 2YSSA 5F9AC 3QRFM 1MCWM 4FQHA 2P8LB 3FQNA 4HPOL 5CEXA 2HLFC 1T04B 4P23A 3B3IA 4Q6IA 4N90D 3VFWB 4XPHL 3ULVD 3K8LA 1VDGA 5EUOF 1CF8H 4JFPB 2B1AL 4ZOCA 5LBSL 2AJUH 4OI8A 1RUML 4OD2A 3X17A 2DKUA 3SE4A 3DVIA 1TZIA 4K94C 5HJ3B 4N1HB 2Q86A 5D8JH 5JIIA 5ANME 4KK5C 5GJTH 5IIEA 3HI5H 4JO1H 5D2NA 4ODSL 4NJAH 1Q9WA 5GISH 5CFHA 4J4PA 3UYOD 4JB9H 4N68A 2NPLX 1HYRC 5C92A 3TPKA 1PKQA 4I2XE 1IBGL 2LABA 4PV9B 5F8RC 1XF4B 4RWHA 5CP7B 1G7MB 1YC7A 4RFEB 2IANA 4HUWA 4JDZA 5D7JC 4C56D 4XPBL 3QWQB 5TE4H 3W5MA 4O4YL 3QEUA 4JPKH 5FIEA 4PJDB 2FO1A 1QLFB 1YN6A 5DD5L 1MCHA 1P1ZB 3NFSL 5EC1B 1IEHA 2IH3B 1S5HA 3RHWF 2V7HA 1QBAA 3U46B 2WWKT 4NM8L 3TT1L 4GKOA 2EIZB 3VXSA 4AENA 2QQKH 5CCKL 3VGFA 2WBKA 3DO7B 5MERB 1GGBH 1V05A 4IRJD 2A6DA 3BZEA 2VLKD 5GRYA 1A6WL 5TF1L 3BMVA 2QQQA 4QF1A 1HHIB 2QKIA 1SY6L 3QUYA 4EEEA 4PGEA 2AJSH 2NX5B 3T2OA 1ZA3A 1UC6A 4U1GC 5JDJA 4HK0A 3AMKA 3B9KA 3S5LA 4U6XB 2DJSA 2PYEE 5D7SH 4W6WB 3RQ3A 1KXQE 3W9DB 3NPSB 4PJFA 2UZXB 3KPTA 3ILPB 1G7JA 2RJMA 4BKLA 3ARPA 1V5JA 4Z7OE 4R4NC 5KSAC 1CLCA 4GAGL 2QHRH 4F80A 1I7ZB 1A2YB 5IFHH 3OAUL 4CBPA 3IKCB 1OTTD 4GG8B 4WW2A 3HPLB 4XGZB 4AM0B 1I8KA 1F4HA 3W9EA 1OP5H 4RFOL 1UJ3B 4O02L 3FB6A 3C5SB 1EFXA 4LLVB 7FABL 1YEFL 3MBXL 3VXUE 5J9PB 1SYVA 1S7RB 4I18A 4KGLA 4Y1AE 4CVXB 3RWGA 1GGCL 4K3JH 4DN4H 4PIRF 4Z77B 4XTRC 4F8TA 5IFJB 3ARYA 3QQNA 4G6FB 3ORJA 2H6PA 5FA4B 4AMKH 1CDIA 2PR4L 4PJXA 3BEVB 4FG6D 4OLUH 3BZDA 3RWFA 4LEOB 1NUGA 1ZHKB 2HWZL 3KPPB 5FYJE 4P2RA 4HJJL 5DC0A 4MQTB 3QZWG 3W5NA 1RZGA 5EG6C 4NNXA 3DVGB 2R8SH 1IKNA 4LKCA 5KVDL 1JNNH 5DQJA 2C3GA 3SCMB 1YQVL 1INDH 1D5IL 1IMHC 4NC2B 3HRPA 3GSQA 5CJQH 4ESKA 4WHTA 4PG2C 1UZ6E 43C9A 2FHFA 4WWID 5IMOB 3QO1A 1CE6A 3HFMH 2BDNH 1UENA 5DJDB 3AS2A 3FMGH 3FZUD 5IG7B 3TVMD 1F02I 3O2DA 5A43C 1OLLA 5CD5D 4ZO9A 5DFVD 3VGGA 1P53A 5FGSA 5IQ7H 1FFRA 1XF2A 2OZ4H 3D3VD 3MLSL 5T3XH 4QNPE 3W0WD 3OKDA 2VAAB 3D39E 4F58H 2AJYH 4L3CA 4NZUL 3STLB 3S9DB 5E03A 2CIKA 3QDGA 5E9DB 1DJSA 4J1UA 3SDAA 4TSCH 4PRHE 2HFFB 3U4BL 2GAZB 2VLRE 3MRKA 2P7TB 5D9SB 4CU6A 5A40E 3IDIA 2AXFA 1MCPH 4I3RL 1HXMB 1MREH 1NEZA 1B2WL 4FFVD 1G9NC 4D0CB 5KANI 2B5IB 4HDIA 3O9WD 3CDGA 4DOHE 1NKRA 2ZOKB 4Y4KA 1MCNA 3EO9H 1A6ZA 5ICYA 3GK8L 2V2TB 4L9DA 5HHVL 4MD0B 3BKCH 4QXTA 1KJ2L 4EN3C 1Q9OB 4XB8A 3DRTA 4HJ0C 3QPQD 1OD9A 3AREB 1WIUA 4NWTL 4PY8I 3RWCB 4PTUB 1QPXA 2Q3AA 3MNVA 4G6AD 4WEBL 4C54A 2ZUUA 4GRWB 5SWZD 2IPTH 4XNYH 4N5UA 4OCSL 1G6RA 2I9LB 3UP1A 1I8MB 4ONHA 3PDGA 2MQ3A 4FFYH 1J18A 4OLVL 2DJUA 1I9JH 4Z8FH 5HYJD 2FIKB 4P2OD 2HMIC 4M7LT 3BIBX 3KR3H 2P5EB 4FHBD 3P73A 3BGMA 4IDJL 3MREB 2UV3A 4JO4H 4ODXB 3GB7A 1PKOA 4MCZB 2JCCE 1HYSC 4YPGB 5J12C 3MV8B 1P69B 3BSZH 4PJCE 2HT4D 4W4NA 4GXVH 4PJEB 3VW3L 4JJ5B 2ORBL 4PJ7E 2A77H 2EICA 2ARJQ 4X9HA 2X4UA 1KCUH 4L4VA 3BZFA 2HTLD 4HIEA 4LARL 3T4AA 5ADPH 4RAUA 4HKXB 2NY0C 4JPWL 2D7MA 3KYOB 2BNRB 1FV1B 2R39A 3D48R 4P99A 1GAFH 3DROB 1EUTA 2R0KL 2VL5A 4PG2A 3AAZB 4HEME 4XMLH 3VRJB 3O3DB 2VJXA 1KPRB 2IPKA 4JANA 1OARL 4OZIF 1TVHB 2OL3B 2AK4A 1B3JA 3TNNA 1K4DA 3H9SB 4HT1H 1QRND 2EC9T 4F7CA 5EZLB 5SWSB 1SJHA 4KRPC 3VRIB 2Z31A 2XZCL 4U1HB 3MCKB 4YBLB 4EDWL 3VI4F 3OKMB 3MROA 1H5BB 4XNZB 3B9VA 1XCTB 2BERA 1RUPH 2LU7A 1E4WH 4NQED 3NACH 1IC7L 1CD8A 1ZVYA 4MXVF 3QQ3A 1QFWL 1KJVA 4YHYB 1QRKA 3ARBD 2AKRB 2BNQE 5CEYB 5DMIL 3QFDB 1NBYB 3GKWL 1HEZB 5CBEA 2EYRB 5EBWB 3HNVL 1HHGB 3MYZA 5IV2A 1IL1A 3WN5C 1G9MC 1MNUL 4CRPA 4N8VG 1YYLH 4M3JA 2IQAA 1VACB 3BD4A 4JLRA 1YYML 5KG9B 4EN3A 1II4E 4ZS7L 1XF5A 5EULV 4OF0A 4JFHE 1K6QH 3UJIL 4J6RL 2BHYA 4FNLL 2MKLC 5FYJH 3PXHA 3W11C 3QWRD 4FTVD 4NHUB 1XCQB 4MSWB 4OCXL 1TETH 1RIUL 4R9HA 3RDTD 5EO9A 5E99L 35C8L 4DVBB 4F33B 5EU7E 1QSEA 4HXBH 3FT2B 3RA7H 2YPLA 5DO2C 1AD9A 5B3NA 1KULA 2ED7A 1YPZB 4OSUL 4DKAA 2NR6D 4PJDF 4OV6F 3UZVB 2VDQH 4JPVL 4WWKA 3HG1B 2DQHL 1CG9A 2DQTH 1G9EA 3IGAB 5AZEH 1AGFB 1J0YA 1MH5B 4UT6L 5F89B 4XZUB 3MUGA 4YXLH 3RX7A 4JY5H 4MD4B 3UCRA 2VR9A 4KVNL 4XNUL 1PQZA 3KYKH 4QRQB 1ITBB 3VXOA 1YEJH 3CMGA 5HY9A 5BOPA 3Q6FB 3MACH 4Z7WE 4P4RB 3WS3B 5C0BB 2X4TA 3MV9B 5JW3H 2FJFB 4NKMA 3NN8A 4UI2A 4WO4B 1CXLA 2XTJC 2ILLA 2ZCLL 3NZ8A 1CD0A 2D7TH 3MRRA 2XOTA 1RQ5A 3PV7A 5IM7A 3EOTL 3M1BA 3MFFB 3BYTA 5I17A 1K5NB 2OTUA 1EHLL 5T1MB 4B53A 4JFDB 3RPIB 4D9RD 3H0TA 4LASL 3VGAC 1W2KT 3GSNL 4E0RA 1CK0L 2Z4QB 5C09A 4YX2L 3C5ZC 2WIIB 2EDHA 5T1LD 3L3IB 3QIWA 4OM1L 3QNXA 3IVKA 5CD3B 4QRTB 4NNYA 4HFWB 1CI5A 2GSIB 3BW9A 5IBLD 1OAYH 3FN9A 4JM4H 1K4CB 1KT2A 1U92A 1AQDB 2A1WH 3AS0A 5BRZD 4S1RH 3RWJB 1IILE 3GMOB 2F19H 1FYTD 2KUTA 4MA7L 3STBA 4N9GA 4D9QD 4P57A 2WV3A 4XVJL 3TLRA 1N8ZA 1LEIA 2MQCA 3O2VH 1TMCB 1QBLH 2E9WA 3ULVH 2GQHA 4XCFL 5CP3H 5EWIL 5F9WB 2FGZA 3HN3A 3T2QA 4HUKB 4P9HC 4Y89A 2KQNA 2HKHH 1PYWB 3DI2B 1MUJB 1OAKH 1T7ZA 5BO1L 5DDHA 2JK5B 4O2CA 5BQ7B 3WLBB 4BZ1H 1A1MB 3U0PA 4X9FA 1Z9LA 3OG4B 1J8HD 3WDIA 3MUY1 4CNIA 3LKRB 4EI5A 5FV1L 5I1AA 4X6BA 3INUL 4PUBH 4PJAB 4MJIE 1N2RB 3TYGL 3UTTA 2E6PA 1I4FB 2XFXB 4TQEH 4OZHB 2QTEA 2VZ3A 1Z9SA 4LLUA 5CJOL 2FB4L 3WEXA 1ES0B 3CFDB 1CGVA 1TTUA 3VI3F 3ZE0F 2HVJB 5JHDD 2NY6B 5H2BA 1YEHL 4DW2L 2UVFA 3MJ7A 2HRPH 4U3XA 1MWAB 3U30C 2IALB 1CGSH 3R0NA 1NBZA 1Z3GH 4XHJD 1ZGLM 15C8L 3ME0A 2Y6SD 5FM5M 2J6EA 4ISVB 1KTLB 4KRNA 5CBAB 5FHBL 4KROC 3P11L 4RWYH 2C26A 1DANT 1Y6KR 2X41A 3BN9D 1N59A 1I1FB 4YDLC 3WUZA 5FF6B 3CC5A 5B4MD 3RL1B 4XBEH 5I71C 5F7DB 5EB9A 1T5WA 4I0PD 3CU7A 2AS5M 2QSVA 3ARGD 3NTCH 4XXDA 4F7PA 2W1NA 1S7WA 4QRRD 2YSSB 4XP9L 3T0ED 4YIQB 4FQHB 3FQNB 4POYA 5CWSA 4Q6IB 1RVFL 1F4YH 2OJZL 3IETA 32C2A 4LLQB 5IUSA 2ICEA 3QDJE 4YNYB 1FLRH 1FFPB 3MRLA 4KTYA 5DT1H 4OGAC 3GI8L 3ZKQD 1Z2KA 4YEFA 4OD2B 2FX8L 3PWPD 4C4KT 3CH1B 1H3WM 3EYQD 1FNSL 2FBJH 6FABH 2Q86B 1JF5A 3KVQA 4EDXB 2OQJA 3QCUL 3U7WH 3FQRB 2V9RA 4PRAB 3KPSD 5D2NB 1TCRA 2VXUH 1A1NB 5AUMA 5GGVY 4IRSB 1ZGLP 4K2UL 4HPOH 3BZ4A 2HP4A 4QTIL 1IEBB 1UKTA 3VDBA 4XPHH 4LSSL 3VMOA 1PKQB 3X12A 5C0FA 1CN4A 1MFAL 2B1AH 5EOTA 5LBSH 1RUMH 1S78C 4KI5E 2D4DA 2WINA 1P7KA 1J1XL 3DBXA 3G5VA 3TC9A 4HUWB 4PJEF 3PL6C 4HIJB 3G5YA 1MI5A 1RJZA 4V1DA 3R8QA 1CICB 2A73B 1A22B 3QEUB 5GSVA 2BNUA 2BP3A 3QJFA 2BCKB 1AFVL 4ODSH 3KPRD 3OB8A 1F6AA 2ICWB 1S5HB 3EW3B 4JKWA 1X6NA 3O3AB 1EUUA 1R3IL 3IDXL 1S7QB 2OYPA 1UB6B 1LK3L 4AENB 3RVTD 3KLSA 1IBGH 2YUVA 3X13A 1A7QL 5KZCD 4YUEL 4AL8L 4JREC 1RK1B 5F9JA 3V6OC 5F88B 1W0WA 2A6DB 3BZEB 4G9FD 4XPBH 5DS8B 5HHQB 3RWDB 4O4YH 5JNYA 3EJZD 5B38G 1ND0B 3S4SG 4JR9L 5I1GL 3S34L 5DD5H 3EUUA 3NA4A 5GIRA 3NFSH 4JRXD 3T0VA 1FP5A 5FXCH 2DLFL 4HD9A 5IKCA 3VXTA 1QA9B 4L4TB 3R1GL 1EXUA 2ZOLA 2FH8A 4NM8H 1ZA3B 4Q9QL 1CDUA 3TT1H 4GAFB 5ALCL 1ZHLB 3KDMA 5SX4I 4H0HB 5CCKH 2P5WE 3QO0A 1N64L 5EU6E 3CFKA 4PLKD 4NIKB 2VLJA 1IGML 5F93C 3NFNA 4BKLB 4DK3A 1A6WH 1E4KA 1S3KL 4G7VL 4U1LA 4ZSOE 5TF1H 2BC4A 5LCVL 3RIFF 4X7CC 1IGTA 1SY6H 3V5KB 4WW2B 1EFQA 5T1DL 3MFGB 2EE9A 4TVPE 2OR7A 3V6BR 1OF2A 3MV7B 3JVGC 2Y72A 5ITBL 4RMQA 4ZD3L 1FFNB 1T5XA 1YUHA 3VH8B 5EZJB 4I18B 4JQVA 4YHYC 4PG9A 4RRPG 2BHUA 2Z8VC 2HN7A 1EAPB 2X1QA 3OZ9L 3UTPE 3DARA 4RAVB 2KKQA 3CVHL 4AJ0A 1IFHL 1DVFD 2H6PB 1NJ9A 1YPZF 4GAGH 5EPMA 2A6KA 3OAUH 1BD2E 2A0LC 2H3NA 3IS1X 2R2EB 3HUJE 4Z7VA 4RFOH 5GGSA 4O02H 5CSZB 1FZKA 4OF6A 3L3DB 4NQSB 1YEFH 4ODWA 7FABH 3MBXH 2LAAA 2XPGB 4AIZB 3IDYC 3I6KA 5DQJB 2C4FT 1X5LA 1GGCH 5EU4A 3GSQB 4UUJB 4U0QB 2XY2A 2HT2D 3HHRB 4PRNA 4Z76A 2R2BB 3BT2L 1YY9C 3QO1B 2OI9B 2PR4H 4PJHA 2X4RA 2AVGA 3DYMA 3V6OA 5C2UB 3NCEB 3AUVA 4E42A 2HWZH 4X6DB 1XR9A 2OXHA 4HJJH 3PABA 5JOPE 4I13B 4EIZC 5IGXL 2ZG1A 3DURA 3O2WL 3S6CA 3QDGB 1WT5C 2JJTA 2JF1A 1P7QB 5KVDH 1YQVH 1D5IH 4J1UB 3SDAB 5FM5O 5SX5H 3M07A 4JFQB 1EPFA 3MRKB 3DX6A 5EC2A 5J7CC 3IDIB 2EYTA 2XKNA 5JO5A 1JTTA 3C5JB 1I8IA 1NEZB 3FN0L 3SDCD 1A4KA 1VEPA 2BOBA 5GS1C 4Y4KB 1OSPL 3KXFD 4G6JL 5K59E 1H15A 2OXGA 3MLSH 1CTNA 4QXTB 3G5ZB 3O8XA 4W70A 4Y4FD 3VWJD 3I3DA 3DRTB 3MUZ1 4DZBA 1MQ8A 4NZUH 4HUVB 5ESQB 1T83C 2ITDB 2DWEA 4Q9RL 4WI5A 5IB4A 3GRWA 1CYGA 4YBQD 1M7XA 4PV8B 4M48L 5D7LD 4WTZG 4OQTA 3F8UB 3U4BH 5B3JF 4ONHB 4BUGA 4W6YB 3JVGA 1YY8B 1U8PA 3SN6N 4Y16A 3MJ6A 5ABDE 4I3RH 4I0CC 1QLEL 1QP1A 3O81A 1R5VA 3B5GA 3P73B 4XNMA 3IFNL 3LRSA 3GK8H 2P5ED 4M7ZB 5HHVH 4LKXA 1KJ2H 2UZIL 4PJAF 3IFLL 4GW4A 3OKOA 4X4YB 3QCVL 3AM8C 1T89C 4Z7NF 4NWTH 1BZQK 4OZHF 4ODVL 2FD6L 5CHNA 4DUWA 2ZUVA 4WEBH 4ELME 4LLMA 5FUCC 3HS0B 3GMMB 4OCSH 1F8TL 1U3YA 2X4UB 2H45A 3BZFB 3K1KC 1J0KA 4RGNE 1IAMA 1CE1L 4OLVH 4F7EB 1T2JA 1OTSC 1PLGL 5HHOA 4U6HB 3TN0D 5C0CB 1R3LA 4RMWA 5J6GA 1BBJA 1N3NB 3MOQA 3UJJL 4IDJH 2BNRD 3LKNB 3JV0A 3FQUA 4UOW0 3SO3B 1S7XA 4KDVA 5E2JA 5JR1L 4XNQB 3PP3K 1A7BA 4JCLA 4EUPB 4JANB 4L8SC 3VW3H 3KLHD 2AK4B 1FHGA 2ORBH 3Q6GL 1K4DB 5IOPA 3BXNB 3VDCA 4KPHL 4MNGA 5D1ZD 4JFFE 4Q6YA 3S35L 2Z31B 4X7EC 1T22B 4PP1D 5L8LB 3MGTA 4LARH 3H9SD 2EKJA 2V9TA 2ESVA 1XF1A 5SWSD 3S3JA 4J8RA 4JPWH 1S8DA 1WT5A 3N1QC 2FYYA 3QEQE 1SJEB 2R0KH 3QQ3B 1JPFA 3HZYB 5BS0E 1EEQA 1KJVB 1F11A 1OARH 3MOBL 2FEDD 3J8F7 1IL1B 5IV2B 5GS1A 1PEZA 4KU1A 4LBEA 2XZCH 2HTKD 4CADB 3MO1B 4JLRB 4EDWH 2DI9A 1XF5B 4LCWD 2X4QB 1T83A 2F53D 3DYPA 2UVEA 4L8BA 5T3ZE 1RMFL 3WXWL 1IC7H 2WWMD 5FKAA 3D0LB 1QFWH 1W0VB 4M7KL 5BZDA 1WAAA 5DMIH 4HGKC 3GKWH 1KENL 3MSPA 3FAXA 5CLTA 3HNVH 2YPLB 5E8DL 3ARFB 1I3GL 2EE6A 1ZK9A 3IRZA 1MNUH 1FO0A 3FO0L 4MDJB 4EZMA 2Z8WC 1JIBA 1YYMH 2HVKB 4ZS7H 1EMTL 4WWKB 3UJIH 4J6RH 4U0RB 3TA3A 4FNLH 1JNJA 1KEGL 2RR3A 2NYYD 5FYKE 2PN5A 3LN5A 4X6CA 4ZFZB 2YC1A 4I48A 4H25A 2IFFL 4OCXH 1R24A 3MUGB 1RIUH 3MRGA 4M93B 35C8H 5DA4A 1I1AD 2ICWI 3DHJA 3MV01 4PBWD 1T1XB 2YN5A 5J6HA 5IEHA 5JDSB 2EZ0D 1UZ8A 5C0IB 4PYGA 3T8XA 3VWKB 5HGBA 5IB5B 4OSUH 1BZ9A 3RY6C 2XYCA 3SE3A 4OBRA 3W2DL 1EEZA 4NQCE 3ZSTA 4R96B 3V5HA 4JPVH 4L8SA 5FYKU 1QFHA 3ULUL 1Y18A 4NKMB 5TDPA 2DQHH 3BP4A 4XPAL 3QSKB 1OCWL 3F12A 3QDMD 4WO4D 2DI8A 3ZKMC 4UT6H 1F3DJ 3ARUA 5HHXL 4DUXA 1CIDA 3NAAL 4YFDB 1K9TA 2AV7B 4KVNH 4K8RL 2EDTA 2YD1A 4WCYL 4XNUH 5EZIL 1I1RA 3WFCL 4S1QL 5JLZA 3QIWB 1DN0A 4BQBA 3STZA 3QNXB 5DZNA 3SPVA 4NNYB 4W81A 3BW9B 1Q8MA 4GRLD 4FZ8L 3C60D 4JFZL 2NXYD 4S0SD 4WTWA 12E8L 4WW2F 4ZAKB 4Q9CA 2I07B 2VIRA 1NAMB 3AVEA 4PYHA 2R0LL 2ZCLH 2XY1A 1MJ7L 2VTFA 4N9GB 1UXSB 4P57B 1T1ZB 4P3WA 1N8ZB 1LEIB 3EOTH 3SE8L 4NCC2 3T04D 1EHLH 5DJ6A 1MJJA 1XFPA 3FFCD 3NCYP 4JDVA 4M9PA 3GSNH 1CK0H 4PRBB 1T1WA 4YX2H 1J5OL 4QHUA 4IHOB 4OM1H 3QG7L 1AJ7L 5D1XB 5B21A 4G7YL 1LHZA 4R6UA 3GUTA 4L8DA 5GRJL 3FOLB 3OKEA 2VITB 4PRIA 1U3JA 1AO7E 4LMQI 4QY8A 1TENA 4EI5B 2RB8A 5I1AB 1JL8A 4X6BB 1U3HA 3UTTB 2HFTA 4MA7H 4CVUA 4WUUA 3ALWA 4JHAL 4LLUB 4XVJH 3ZDXF 4XMPL 5DK2B 43CAB 5ISZD 1UKQA 3TBVA 5DMKB 4XCFH 4NQXA 5EWIH 4IMLA 1BM3L 1VADA 4S2SA 3U9PL 5ETUA 2PKDA 3D0VB 3REWA 1D6VL 2NY6D 1OAZL 2ERJC 4PRPE 4YE4L 1Y0LB 3QXAA 4I9WE 4GG6A 5BO1H 5JPMA 5FM4A 3D2UA 2A2QT 1T0NB 3INUH 3CAFA 3TYGH 4X6DF 3U4EB 1N59B 3KHQA 1CFVL 3RY6A 1NUFA 5CJOH 1U93B 2EE2A 2FB4H 3K81A 4Y19A 3ULUD 3U0TB 1YEHH 4DW2H 4LVEA 4PB9L 4LPUA 1S7WB 3R4DA 1AY1L 4M7LL 5A16A 2ITCA 1EEYB 1Q9LA 3DUUB 5J3HC 1F2QA 3WKNA 15C8H 4G8EB 3HZMA 1OGTB 1D5MA 2GKIA 3IETB 4P23D 3VXRA 2ICEB 3GSOB 3O6KL 1AHWA 4ZPTA 3HRZB 1LQSR 5FHBH 4ETYA 3P11H 3PJSA 4KZEL 1I7RB 4E41D 5DD1L 4GS7B 3H9HA 4JG1L 1RHFA 1HE7A 4MAYC 1LDSA 4GJTB 4ZFOA 5ACMA 5I73C 4YHIB 4H0IA 4K94L 1Q0XL 3ARDA 2VXQL 4YHNA 5FA3A 5DJYB 3MLZL 3WHE1 3PP3H 4LCUB 3OXSA 1TCRB 1DLFL 4P2QA 4XP9H 2IJ0C 1F2XK 1UWGL 2P48B 3QWOA 4JZNA 4J4PD 1RVFH 3CFJA 4HQQL 2OJZH 4IOIB 3BPOB 2PNDA 1FJ1A 4N0YL 4F9LC 4QWWD 4QRPE 5I1KL 2FX8H 4ZDHA 4XP4L 3G5VB 1FNSH 1Q72L 2NMSA 5FDWA 3QCUH 4V1DB 2IAND 2BNUB 4NOFA 4Y5VC 3QJFB 5JW4Q 2Y07L 4JPIB 2DYPA 1B9ZA 4O2FA 5B8CC 4K2UH 1ZT7A 4QTIH 5CMAA 5HI5D 4NN7B 2CQVA 4U05A 5EFIA 3G6JB 4LSSH 1D3CA 1QSZA 1R3JB 1XIWC 2YR3A 1MFAH 3VXSD 1S9YA 1WFNA 2V5YA 3IFOA 5C0NC 1J1XH 2EE3A 2XQYK 5KSBA 1GYAA 1NCUA 3O2DL 1OGAA 4HJGA 1ULVA 1MHHA 5E6IB 2IG2L 1AFVH 2L0DA 1Z5LB 1F4AA 3PQYB 2AJ3B 3VXTB 3K1DA 1EXUB 2ZOLB 5ID0A 1PY9A 3QUYD 1R3IH 3IDXH 1ZT4A 1XZ0A 2OMBA 1LK3H 2VISB 2EC8A 3KDMB 3B5TA 5IHBA 4NGHL 2EDEA 5DC4B 4K71B 5L0QC 1P4BL 1A7QH 3QO0B 4YUEH 3B9KD 4AL8H 3IU4L 5FOBB 2H2SC 3T4YA 3WCYA 1I9RL 2HLFD 4BH7B 4JR9H 4HBCL 2BC4B 5I1GH 3S34H 1LO4L 3T65A 3GSRA 2DLFH 1K8IB 2QLVB 4MAYA 3R1GH 5SV3A 4WHYG 2NXZC 4QXGL 3MXVL 4Q9QH 4S0TD 5ALCH 1C12B 5K9JL 5MENB 1EEUA 3MRDB 2OZ4A 4XCYA 1OF2B 3SBWA 4U33A 2R2HA 3V8CA 1G6RL 1T7VA 1TJHL 1I7UB 3Q0HA 1KB9K 3UPRB 4NPYA 3UDWA 2NLJB 5TDNB 1JBJA 4U1JA 2YA0A 1N64H 4XCNB 1EFXD 1G7IB 2HN7B 3MLYL 5IHLB 1IGMH 5J57B 1U8IB 1UH2A 2E9IA 1S3KH 2IAMA 2QADB 4G7VH 1BQUA 3IXTA 5LCVH 3V7MA 1UB5B 1NJ9B 5EPMB 2A6KB 3OR6A 1WFTA 3ARWA 1JV5B 1N6VA 3L9RA 3T3PE 5T1DH 3KAAA 2NW2B 4Z7VB 4G8GB 2HJLA 1IC1A 4Y5VA 1FZKB 2BMKB 4TNVF 3RIAK 5ITBH 3EOYG 4ODWB 5B8CA 4ZD3H 1QD0A 1CXFA 4P2RD 3ZE1F 5BVPL 2AJXL 1ED3B 1FVDB 3OZ9H 5DJAB 1FBIL 1RZ7L 2X1WL 4PRNB 4YXKL 1XIWA 3CVHH 3QH3A 4Z76B 3HI6L 1IFHH 1NFIA 3U9UB 1FL5B 1E27A 3K7UA 3B83A 4PJHB 4X8JB 1LNUB 5IVOA 1FL6A 2ZUTA 5C0AD 1LE5A 1E6OL 4L8CA 4U0RC 1XR9B 3PABB 3L5XL 1DQDL 4UAOB 4JAMA 1GZPA 2VZTA 3GMPA 3DURB 2BFVL 1BECA 3VXNB 3O41A 2MQ0A 5IQ9B 5L7XL 1U8NA 2LQRA 4ZO7A 3QDGD 4U7SA 1IKFL 1DE4B 2HAZA 3OG6B 1QACA 3SDAD 2XQYG 3DX6B 5EC2B 1X4ZA 3BT2H 2XKNB 1Z9MA 4DCQA 3DHMA 1EGJL 3N85L 3QRGL 4DKEL 2VRAA 4BSVB 5HYQA 2BOBB 5BV7B 2PW2A 4F9PA 2W60A 1G9NL 4GAJL 2XWTB 4Y4KD 2CD0A 4G8IB 5IGXH 2CKBA 2X4OA 5DEFB 4DZBB 3MZGB 3O2WH 2P24B 4R4ND 5IB4B 3V2AR 3NCBB 3J7HA 4K7PX 4XBPA 1PFCA 2I60L 2EEBA 4FQQA 4WUKL 5IW6B 3DSNA 3ZYJA 4JFEE 3T3ME 5HGHB 1GOFA 1E28A 2EDDA 2C3VB 4KXZH 4XAWL 1WIPA 1QO3A 4Y16B 4NO3A 1P4IL 3UTSB 1VFAA 3FN0H 2HLAB 2GTZB 2YKLL 3AU1B 4WHYH 1BIIB 4XNMB 1OSPH 2F58L 1ZHBB 4TTGA 1OT2A 5FDYA 4G6JH 3VXUA 3F7YA 4JFYB 4P3DA 4ZAKC 4Y1AA 4LKXB 4LLAA 4GW4B 1FORL 4YDIL 3RUGB 4XTRD 4Q9RH 4R7DB 4KDTC 1LK2B 5H35A 5HBBA 4M48H 4P48A 4ZYKA 2Y7QA 3G08B 4N1EA 1YNKL 4L4VD 2H8PA 1R0AL 4JFXA 1QLEH 1WF5A 1OLZA 5E94A 3WHXB 1MVFA 1S7TB 1BBDL 5CJXC 1JNLL 3O6FC 3IFNH 2GJZA 1F42A 2R0WL 1S7XB 2E9JA 4J3TA 2UZIH 3IFLH 5DSCA 4LCCB 3QCVH 5JHLL 1HQ4B 5C0GA 1KIQB 1WJ3A 2FD6H 4Y88A 4X6EB 4TUJA 1WZMA 4HUUB 4JGJA 5JORA 4MNGB 1U58A 1F8TH 2AK4D 4RQQA 3QNZA 1KBGL 3MGTB 4NQDE 4K7FB 4XCEB 3B8SA 2ESVB 3FO2B 1CE1H 3VXPA 1PLGH 1U8OA 1S8DB 4EBQL 2F5AL 3H6JA 4L9LB 4E5XA 4NBZB 3UJJH 2OK0L 2F54A 5HGDA 3FRPA 3LKPA 4PS4L 1AI1L 3D39A 2V7NA 3PWLB 2J2ZA 3CNKA 4RDQG 4C57C 3ARTA 5JR1H 4FS0A 1A0QL 5JIHA 4RZCA 3OJDB 2RBLA 4F2MB 1KLUB 3QG6B 3BQUC 2VLRA 3Q6GH 1U8KB 3IDJB 4BH8A 5LVEA 5KOVC 2FDBP 4KPHH 1NGPL 5GRZA 3R8BB 1KELL 2O61A 4GQ9L 1FNGB 3PHOB 1G9ML 3SKNA 2BRRL 1DEEA 3O6LL 3BKML 3P4MB 4EN3D 4L8BB 1TTFA 4HJ0D 1KCRL 2ZG2A 2FEEI 1T6WA 5C0DB 5FKAB 1GHFL 5EU5A 1BFVL 5E95B 1C16A 3E6HB 5BZDB 4HS3A 3MRHA 3NGBB 3LD8C 3MOBH 3FRUB 3CFIC 4XH2A 4WGWB 1ZMYA 1QSED 5HVWA 5GZNC 2HMID 5EU7C 2YPLD 8CGTA 1FO0B 2YS4A 5F72S 4OZFA 4Y4HB 3BISA 1A9EA 2K7QA 4MNHB 2A9ML 2B20A 3TA3B 5EIVA 5JA8B 1HYSD 2YRZA 3JV4A 1RMFH 2JCCA 4WWKD 3WXWH 5I66B 3G6JF 4PJCA 4I48B 4H25B 1TQCB 3VG9B 4M7KH 1R24B 3MRGB 1GGIL 1QEWA 1KENH 4YLQT 1AD0B 5CIPH 3D3VE 1IGCL 5IEHB 5E8DH 2FL5B 2JJVA 3U6RA 1PG7X 5L2KE 3MLTA 3BP7A 1I3GH 1UZ8B 2GJ6E 4M6OL 5GZOC 4PJ5B 2DN7A 3P4NB 5CJXA 2DWDA 4HKBB 3FO0H 3OAZK 4NSKB 4OFPA 1HCFX 1EEZB 5IVNA 1EMTH 3V5HB 4JN2A 3GMNB 3MRBA 1D6EB 1BJ1H 1KEGH 2G5RA 1CIUA 1ZS8B 3A67L 5CGTA 4Y2DC 2IFFH 3AS1A 2NTFB 4KRPD 5DUBA 3QQ9C 2DQUL 2P4AB 1IAII 5EO1A 5EUOE 2YHGA 3KYNB 1JK8A 4RISL 5FKPB 5JLZB 2GHWB 3S5LG 4WFHD 3STZB 5F1NA 2WSKA 3W2DH 2E3VA 2QEJA 5C09D 2EDNA 1CCZA 2D2OA 3RX5A 4LU5L 3QIWD 1RZIA 2VZVA 4QGYA 3ULUH 1ZGLA 4FQXB 4XPAH 3BQUA 3WO4B 2BNQA 1S7SA 3SDDC 1JWSB 1OCWH 2OBGA 1UA6L 4BK4A 2CDEB 4J3XA 5HHXH 4NRZA 2IMMA 4JO2L 4X9BA 3NAAH 3KPOA 4QOKE 4LIQL 4K8RH 5DJ6B 2X7LA 4WCYH 5E00A 5EZIH 3MJ9L 3GSVB 2DL2A 1WGOA 2KZ1B 3BUYA 3WFCH 1FAKT 1T4KA 1CDCA 2ID5A 3MRFA 2E8ZA 4S1QH 1KG0A 4QHUB 3S36L 4BYHA 5JMOC 2BY1A 4P9HL 3W11D 1UYWL 3LN9A 2VLKA 3O4LE 2MFNA 3GUTB 2GT9A 4L8DB 4JFZH 4FZ8H 4P46A 4PLOB 12E8H 3DGCR 2DTML 2R0LH 3H9ZA 4Z7VF 1U3HB 2P43B 4NC0B 5E5UB 4S11A 1MJ7H 2DQJL 4LSTL 4EI5D 5CJ8A 3SE8H 1W72L 3TBVB 1FZJB 4UDUB 1HXYA 4RCAA 4MNQD 1KPVA 4S2SB 1REIA 1WZ1L 3GJEB 4OJFL 1J5OH 1KXVC 3DXAE 3QG7H 4RIRA 1AJ7H 4LVNB 4G7YH 2BSRA 3QXAB 1TDQA 1EJOL 4DFIA 5T5NF 5GRJH 3BHBB 3O11B 3KNBB 3EGSA 3EZJB 2W0FA 4JHAH 3WFEL 5BVJB 3I75A 5F9DC 4XMPH 5CJ5A 2X1OA 2R1WB 2VLLA 5BZWB 4Y19B 3SGDH 3SGKA 1BM3H 3C08L 3U9PH 4Z7WA 4B5EA 2OCFD 3CVIL 3UO1L 4K9EC 4L29A 1D6VH 1OAZH 2ITCB 4YE4H 2YD7A 4U7MA 2GIYA 3QI9A 1GPOL 3SJVE 1D5MB 2BJML 4BA8A 1AHWB 3PJSB 4XAKD 1MSPA 1UQSA 3B2UC 5E0QA 1CFVH 3LPGA 4O00A 4G42A 4M00A 4PJ8A 2COQA 3GNML 3N1FC 5C07E 4UT7L 3ARDB 3C8KB 3CSYA 5FA3B 3OTTA 4PB9H 2PO6B 1MLCB 3OXSB 4PTTB 4WU7B 4P2QB 1UT9A 1AY1H 4M7LH 4HX1B 1H3PL 1RZJC 5LKNA 3MRCB 2D03L 4HZLB 5IEKB 3QWOB 2MKWA 3BJLA 4UV7L 4HULB 1DLHB 1KJ3L 2DS4A 3JUZA 1FJ1B 3O6KH 3ABZA 4KZEH 2Q7YA 5DD1H 5B39B 4GXUN 3IU3A 3JV6B 4GBXC 3RUGF 5ACLA 1OAQL 5KTEL 2E8YA 2ED9A 4K94H 1Q0XH 4CVZA 4KI5C 2VXQH 3MLZH 1ZV5A 1MI5D 1DLFH 4O2FB 4V1DD 2Q76B 3V7AE 1T0PB 4U1KB 3OQ3B 3LEVL 1UWGH 3QAZB 5EN2A 1CFQA 1UFUA 3SGEI 5E1HB 3JTTB 4KKAC 1NGQL 1ITCA 5HVHC 1LEGA 2WWKO 2XKSA 2Z93A 2GI7A 1RURL 4N0YH 4WFFE 3C6SA 1S9YB 5I1KH 3G6DL 2WZPD 1RFDL 2VXTL 4XP4H 1OQXA 4HH8A 4H1LA 1Q72H 5DHYB 2EEDA 1KC5L 3K4DA 1MAJA 3HAEA 1YEDA 2Y07H 4JCMA 2ZWLT 3MODL 5ECJE 2IEPA 3Q5OA 9CGTA 1PEWA 4FXKB 5AD0A 5ID0B 3DUSA 1XZ0B 3IJHA 1DEDA 1PZ5B 2E7HA 4UOJA 4WFGE 5ESVA 5D1QA 3GGWA 4QT5A 5D7IB 2MCPL 2VDOL 1YDPB 5IMLB 5DURB 3T4YB 3OJ2C 1FYTE 3I50L 1KJMA 5F8QC 3BEWA 4ZUUA 4NC1C 4O2EB 4C83B 3O2DH 3MGAA 2VLJD 1FNLA 2IG2H 1NMBL 1PZUB 3GSRB 1RZ8A 1TQBC 2IADB 4P5TC 5F7HA 3H9YA 5DD6B 1MQKL 5ID1B 3HNSL 1K3ZA 4WEMB 1S5IL 4J23A 3PHSA 5LGJA 3OAZH 1MAML 2X9WA 4L9LC 4NGHH 4JY6A 2R2HB 4LGPB 4OQTL 3LV3A 1QR4A 1P4BH 2HJKA 1CQYA 2YD4A 4RMRA 3U79A 5DRZB 3QCTL 3IU4H 2DMCA 3PP4L 1BJ8A 3V5DB 1I9RH 2IAMB 2J12B 3EO0A 4LVHC 4HBCH 2QR0A 1LO4H 3TIEA 2Q7NA 3OR6B 5E4EB 4IJ3C 5I8EA 3KJ4C 4GBXA 5FYLE 4QXGH 1S78D 1H0DB 3MXVH 3OGCA 2PCPA 4UB0L 3LQZB 4CU8A 5DUML 5K9JH 5C2BL 4D2NA 2FGWL 5TGBA 3PL6D 1G6RH 1TJHH 2VERN 3QIUC 2Y9RT 2UYLB 1KTDA 3DX9A 1G7PA 3UTZA 3MLYH 5D6DC 3EYVB 1M7DA 1IQDA 1G0DA 2PXYB 3ARBA 1E4JA 1P5UA 3BWUC 5JTWA 5IMKA 3QH3B 3WIIL 1NFIB 3P0GB 4OZIE 1OP3H 1ETZA 5I75C 4GKSA 3TFKD 2ATPA 5GGQL 1N0LA 1FL6B 2RGSA 5D72L 3P30L 4JEGB 3NBNA 2ATKA 3KPLA 4LF3B 3VI4E 1BOYA 3UJTL 2DLEA 4JAMB 1BOGA 1Q94A 4DZ8A 2A6IA 5BVPH 4CJ1A 5GS2H 2AJXH 1U8NB 4MXVE 4JRWA 4DGIL 4D0BA 3FONB 1FBIH 4O58L 1RZ7H 4M6NH 2OR9L 3KPMB 4YXKH 4OKVA 3HI6H 5J13C 1FN4B 4HHAA 4PRDA 1I3RA 4DCQB 3MZTA 2ARWA 3ZT6A 3ALPA 3RL2B 3S97C 2V17L 4Q9BA 1ZVSB 1C5BL 1E6OH 5AWNL 1WEJL 2P5WA 2X70A 1PDKA 1CVSC 2W60B 5DMYA 2ZUYA 3T1FA 4MA3A 4FZEL 5EU6A 3L5XH 1D9KA 4G6KL 1YNLL 1DQDH 5K9QI 4KAQL 2EDJA 3QZWB 3O8XD 2BFVH 1BLNB 5L7XH 4ZSOA 4LCYA 5LAXA 4XBPB 2GSGB 4HMDA 1C5DA 4JVUA 1IKFH 5EBMA 1N5AA 2C1OA 3HLAA 1QO3B 3GBNL 4NO3B 4WI6A 1EGJH 3ALXA 1VFAB 3N85H 1DQQA 3QRGH 4DKEH 4Y16D 3ZKXC 4HGMA 4PJDE 1G9NH 1IC4L 4GAJH 3F7YB 1JF1A 2DMKA 1YMMB 1EERB 2MJWA 4TYUA 3V95A 2XZAL 1G1CA 1HDMB 3ZHDA 4L4JA 2N56A 4UIKL 2I60H 5H35B 4PJBB 2LVCA 4WUKH 2MMXA 1D5BA 1MHEA 2C1PA 1VKXA 2J4WL 3DMMA 3V6ZA 4XAWH 4YEEA 5AZ2L 2H8PB 3KGRA 4M4PA 1ONQB 2AEIT 4MQSB 4WU5B 4XNXL 4F37F 1P4IH 2W9EL 3ROLB 4Z0BL 2YBRB 2YKLH 1RHHA 5D6DA 5HHOD 2F58H 5T1LA 4YDJB 1P6FA 2GJZB 5KSVA 4G80A 1F3JB 3DLQR 1YN7A 4X5WB 2GY7B 3FOMB 1BPVA 1FORH 4LHUA 3EDEA 3F58L 2NX5E 5C0GB 4HWBA 1NAKL 3TZVB 3RVXD 4TUJB 4JQXC 4YH6A 1MHCA 1U58B 1ORQA 4NM4L 4WTZA 1QSFB 2BOCA 3EYFA 1YNKH 4HUXA 4MQXC 3H7BA 2YA1A 4QRSA 1R0AH 3MV11 2ESVD 4E5XB 2JIXB 4Z78A 2E7LC 5DK0B 3NH7L 1B88A 2F54B 2AXJA 5HGDB 3LKPB 1BBDH 2P45B 1JNLH 3QFJB 4NN5B 1E4XL 1EDQA 4V2CB 4XVSL 2R0WH 4X83A 3NA9L 1FSKC 3HE7C 4OD1L 5JHLH 1INQA 4RZCB 3F6LA 3DV4A 3DVNA 4BH8B 1HH6A 1AC6A 3VCLB 5A2FA 1VGKA 2G5BB 1KBGH 3I85A 2I9TB 1LE9B 1GJIA 2P47B 1HCVA 2G75B 4BZ2L 3E2HB 1FZMB 5DGRA 2CDGA 4EBQH 3EYUL 2F5AH 2WBJC 2XTLA 3RNKB 2X40A 3B8YA 3HZKA 2OK0H 1T66C 3L5WB 4PS4H 4EVNA 1AI1H 1C16B 4B0MM 2J8UB 4HS3B 1JF6A 4HIHA 3MRHB 1A0QH 2FLRT 3U83A 4M4RA 3QEHA 1TIUA 3KS0J 3MQIA 3OSKA 4XH2B 4L3EB 4PREA 3BO8A 5TDOA 3P3YA 1NGPH 1KELH 2G60L 4GQ9H 4GAYB 1B0RA 1G9MH 4OB5L 2XKUA 2BRRH 2PO6C 3VI3E 3WD5L 3ZE0E 5DHVA 3O6LH 3BKMH 3O4OC 3IAQA 3GMRA 3TO2A 1ZHNA 3FJTA 1LO2L 1KCRH 4OIIL 4U6YA 3VD7A 1MCJA 4QRRA 2MSPA 1GHFH 2BVTA 1BFVH 3AB0B 1LO3L 1GGTA 2GK2A 2C9AA 4ELMA 5F7LB 5DFWH 4KVCL 2D31A 3RTQC 3MLTB 1OTSD 3GSNA 4MA1B 3FB5A 2DWDB 1A6AA 2W0KA 1LGVA 4N8VB 2BVPB 1DUYA 3RY5A 3TO4C 3VJ6A 3IJSA 4MDIA 4R0LC 4HEPG 5E9DE 3MRJA 4ELKB 3UROR 2A9MH 2NY2D 4Q2ZA 4NDMA 1GOHA 3MTRA 4NNPL 4YK4B 4F15B 2OX5A 2P44B 5D7IF 1GGIH 3P9LB 1RV6X 2EH7L 1BFOA 1IGCH 3EO1A 3L3JA 1VENA 1V7NH 2YOCA 3MRQB 5TJWK 3BP6B 4M6OH 3OR7B 4KHTL 5F7YC 5F1NB 3V0VA 1JPGA 3HE7A 4Z7UB 4C56B 3QEQA 4H26B 3FHAA 2ZG3A 1RZIB 4WW1A 5BS0A