3HRZB

Cobra venom factor (cvf) in complex with human factor b
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
233
structure length
233
Chain Sequence
b'DGFIADSDIISRSDFPKSWLWLTKDLTEEPNSQGISSKTMSFYLRDSITTWVVLAVSFTPTKGICVAEPYEIRVMKVFFIDLQMPYSVVKNEQVEIRAILHNYVNEDIYVRVELLYNPAFCSASTKGQRYRQQFPIKALSSRAVPFVIVPLEQGLHDVEIKASVQEALWSDGVRKKLKVVPEGVQKSIVTIVKLDPRAKGVGGTQLEVIKARKLDDRVPDTEIETKIIIQGDP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cobra venom factor
publication title Insights into complement convertase formation based on the structure of the factor B-cobra venom factor complex
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 28
structure length 233
sequence length 233
ec nomenclature
pdb deposition date 2009-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00207 A2M Alpha-2-macroglobulin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.130.20 Mainly Beta Single Sheet S-adenosyl-L-methionine-dependent methyltransferases S-adenosyl-L-methionine-dependent methyltransferases 3hrzB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3hrzB02
3GSOA 1T5WB 1QR4A 4ISVA 5GJTL 2YHGA 3QDMD 1AC6A 4N1EA 1L9NA 2HVKB 1RK1A 2WUCH 2ZUVA 1OM3H 5F6IC 32C2B 2B4CC 1DBAH 3MV11 3VXOA 5F9WB 4UZGA 1U3YA 1KV3A 4LQFL 4HUNB 4RQQA 1A1MA 3O6KH 3OG6B 5CFHA 4LF3B 2X4SA 4MX7B 2NXYB 2DS4A 4QTHB 3WHXB 3LN5A 1S7SA 2YEZB 5C0GA 5IMMB 4O51A 3PXHA 3ULUF 1HI6B 2XQBL 3C08H 4Y1AD 5TF1H 4Y2DC 3L3DA 4XNQB 3MRPA 1TZIB 3JBG7 4P4KC 1RJYA 1NUDA 2OL3H 1T5WA 3BWUC 1QFHA 3DGGA 3I50H 3O3BB 3NFSH 3WMSA 1FGNH 3EOAB 4OF3A 2HVKA 4GBXD 3VXMA 2Q20A 1T66C 2JCCF 3FFCE 4Y19D 2G60L 3HC4L 1S5HA 1QBLL 3U30C 2JB5L 4I18B 2Q8AH 4MX7A 4QTHA 3RPKA 4L3ED 3WHXA 5ILTL 5FUCE 2YEZA 1P84J 1W72H 5IMMA 3VXRE 2UWEB 1RFDL 1HI6A 3RZCA 3V52L 5GIRA 2JIXD 4J3OC 1Q0YL 4YDLC 1ZE3C 1HWGB 4M5YL 2OR7A 1HEZB 1XEDA 4WY7L 2RQ8A 5E8OB 1ZSDA 3KYNA 1NCWL 4XNQA 2NLJB 2Y5EA 4HIIB 4M7ZC 1Q9WB 4WTZA 4YIQB 1EDQA 1G6RH 3QDME 4HWEH 4G6KH 4XP4L 3Q1SH 4S1DD 1RIUL 3EOAA 4KY1H 3T09A 3OTTA 3RUGB 5EZJB 3MLPA 3RX7A 4XCEA 1Y6KR 4M43H 3HA0A 4O4YH 5IQ7L 5ETUA 5F71A 4I18A 5ICYA 1AGEB 5DQ9A 5E8NA 3V8CA 1H15B 4WWKA 3RGVD 1FAIL 4ZAKA 4LL9A 2F5AL 4XNXH 2IQ9L 3P0VL 4DN3H 2BXZA 3WIIH 3BXNA 4NM8H 4DUWA 2UWEA 3HC0B 1KPUB 3ARUA 1WFNA 5FM4A 3GBLA 3HE7B 3SGDI 4PJCB 4Y1AE 4KUZL 1HEZA 2MFNA 3SHSA 5E8OA 1OARH 1H3PL 2NLJA 4HIIA 4U1KB 1MRDH 3UJJH 3A6BH 2ZUTA 4BQ9A 4ZFZB 1Q9WA 4L29B 3OKEB 4KHTH 1I3GH 1UZ8B 1NCBH 4TNWK 3A67H 4YFDB 2GT9A 4ZO7A 2FX9H 3OJMB 1EHNA 4Y19E 1GPOL 4HZAA 4LCWA 2O5YL 3PIQB 4XPFL 2KZ1B 4N8CH 1QFWM 1SEQL 5GRJL 1TDQA 1SYSA 3FCTA 3TM6A 2AEPH 4L3EE 1MHEA 3ARDC 4MA7L 4YAQB 5IM7B 2FX8L 3U4BH 3HC0A 5DD1H 1KPUA 4Z95H 4HLZH 4YHOL 2DIJA 2X42A 3HE7A 4PJCA 1BBDL 4UDTB 4K23H 4WW2B 4U1KA 3H9SB 1YYMH 2GK0B 4ZFZA 4DK6A 1UZ8A 4Z7OF 3ARFD 2WBWB 1S78C 4PBVC 5JNYA 4FQPA 5ABDE 5GS0C 5E6ZA 2HH0H 1ZWIB 3LQMA 1MHCB 1E4WH 1ZT1B 5FIEA 5T5NG 2H41A 3MLTB 1JV5B 4OFKA 2LQRA 4HT1H 5T5FH 5ACLA 5DT1L 2WQ8A 3X13B 2N4IA 1J87A 4LLWB 1LE9A 1EAJA 2L7UA 2PTTB 3B2UD 4PB0L 4WRLA 4Y88A 1NMBH 2EDHA 4WTXA 4XNYL 3L3OB 1A14H 3AU1B 4ODVH 1EHLH 1KB5H 2BSED 2ZUSA 4RGOH 3K2UH 1IEHA 4UDTA 3PHSA 1ORSB 1A6ZB 1U8HB 4HKXB 1S7RB 1VGEL 5BS0E 2HMIC 4WW2A 1SJEB 3H9SA 2F58H 2GK0A 3T08A 4AIOA 5F7NC 1J0IA 4QHKI 4P57B 1SBSL 1WCQA 4LEXL 3CK0L 3AS0A 1KJ2H 1F4XL 1JNNL 1ULVA 1ZWIA 2MQ3A 1MHCA 1ZT1A 1KLGB 5J1TC 3G5XB 3T2NH 3HS0A 4FZEH 5JZ7D 1OCWL 3VFNB 1BHGA 3C5SB 2NTFA 5DVKA 5T3ZH 1RHHA 4LLWA 3CFDB 1FFNB 4AMKH 1C5BL 3QISA 4NQSB 2EEDA 2PTTA 4I4WB 5EIQA 3SJVA 3G6AA 1PJ9A 1MCSA 1RMFH 2EIZB 3AU1A 5BCAA 1ZTXH 3P11H 1ORSA 1U8HA 4K55A 1HIMH 5EOTB 5I8OH 4JY5H 2X89A 4RA0C 2X4PB 1RURL 4TSCL 5MEPB 4GG6F 2CIKB 1YEEL 4P46D 4HUMB 3W0WB 3U4AA 2FRGP 4P57A 3FQRB 3EYQD 5HHMB 3RJQB 3CVHB 3HG1A 4OFVA 2DLTA 4N0FB 1ZT4B 5KBNC 1QNZL 1KLGA 2C3WA 1EO8H 3G5XA 5D70H 3WN5C 2CRZA 3GI9L 5HYJD 4HV8B 4A6YL 3GJFK 1S3KL 2R2BB 2VLKD 3C5SA 2C4XA 3NCJL 2MMXA 3JV0A 1CDYA 3H7LA 1ZV5A 5IK3B 4NQSA 3B8YA 3QPXH 5BV7C 1KCVH 4P2OB 4XAWL 4KROB 3JWOC 4U7MA 1DBML 3O6FB 4M1DL 4JKKA 2R23B 5EOTA 4UV7L 2V2TB 5DD6A 4DVRL 15C8H 5MEPA 2BVQA 2CIKA 5IVNA 2DJUA 4OZGE 4CKVX 3FQRA 5IESH 4MYWB 1KTDB 1V7ML 3IFOB 1UZ6F 4UOW1 5A1AA 1T0MB 2DI7A 2YD3A 4AEHH 3DSNA 5GSRB 5HI5C 4KC3B 5AD0A 4HV8A 5DC4B 1KPVA 2R2BA 5IHUH 4GG8B 3QIBA 2X4OB 5IK3A 2FR4B 3QCUL 4WUUB 4P2OA 1OOAA 3WFCL 3VFOB 1ZGLM 1MCJA 2D7QA 2DQTL 2GSGA 1JGEA 3O6FA 5HTSA 1CLCA 2R23A 2BNRD 4BKLA 2V2TA 1BVZA 1F5WA 4QKXB 4NYLB 1RZKL 1QRKA 1EMTL 1X5HA 4R4NC 2CXKA 4JFYB 1KJ3H 1P9MA 3IFOA 3UTTB 1FRGH 3ARED 3HB3D 1KYOK 5JPMA 5GSRA 4Z7NF 4BK5A 3QFDA 5HYJE 4F7TB 4XCYB 3MFFB 2VLKE 4J12A 1LO4H 4GG8A 2I07A 2AKRB 2X4OA 1AHWC 4BSWB 1MRFH 1JZ4A 2FR4A 4JFFB 1CE1H 4WUUA 4RSVA 3F6LA 3VFOA 3FN0H 5E08H 1Q72L 5H8DA 3HRZA 4KTEH 2YRLA 3SBWA 2X7LB 1DQML 4HMDA 4DW2H 3HAEA 4OZIA 4FXGB 3VXPA 3GRWA 4M02A 2BVYA 4NYLA 4ODWA 3T3PE 1ZGLA 2YR3A 4R26L 1CI5A 4GRWB 3L5IA 3O4OB 4PRBB 4JFYA 2DWDB 5GRXG 1C5DB 2B1AH 3V4PL 3UBXI 3UTTA 3OL2A 1B90A 1CG9B 4XVTH 3VWJD 1BD2D 2V5RA 3SKJL 4F7TA 4R4FH 4LFHG 5EZOL 4OF5A 3VW3H 4HK0B 3OR6B 2AKRA 4K3GA 4HXBH 3MRLA 4K7FB 4BSWA 4M7KL 1NAKH 2AXGA 5D1QB 4YHLL 3LEVH 4UT9H 3NH7L 3P0GB 4JO3L 4CU8A 4FXGA 4N9GB 2BNRE 1MLCB 5IV2B 5MERB 5MEOA 4MJ4A 1PKQB 2CKBL 4X0KB 1UJ3A 1BOGB 1PG7L 2VL4A 3EFDH 2PN5A 5GGTH 4MQ7B 1AO7D 3GHEL 4PRBA 3RVUD 2FYYB 8FABB 4GAJL 1C5DA 1LO0H 4HXAL 5C0CD 1RZIB 1SEBB 1KN4L 4HS8H 1JGUH 2W91A 4KK9C 1YUHB 3KLHD 1RQ5A 4O58L 3U0TB 4PJBB 3UDWC 1TITA 2J8UE 2J6EH 1CK0H 4K7FA 1CLYL 3QIUD 4U1IB 3HE6C 4ODSH 3IJHB 1NC4D 3BH8B 3H8NA 5AWNH 1FLRH 3V5KB 2F54D 4P5TD 5FAAA 1W0WA 4R8WL 3WLWC 1R3LB 1NQBA 4NNYB 2NZ9C 4N9GA 1MLCA 5D1XB 5IV2A 3FFCA 4RRPA 1JZ5A 3O41B 4JKMA 2QQNL 1K8DB 1PKQA 1I4FB 2F5BL 4X0KA 1KYOJ 3S8WA 4K8RL 1A7PL 4XVJH 3TCLB 1JTTA 3PL6D 4MJ5B 2FYYA 5EU6B 8FABA 5F70A 2FATL 2P5ED 4H25B 4XP9L 3VWKB 3HPLB 3GMOB 4PJHB 4M7LT 1RZIA 1BD2E 1B88A 2UUDH 4MCZB 3U0TA 4PJBA 5KAQG 1ERNA 1CGUA 1ZANH 1NLBL 4U1IA 2P8PB 2X05A 3H42L 3SDYL 5CIPB 2FGZA 4OCXH 3IJHA 2VB5A 1CGSH 4MMZC 1IGCL 5J1AA 1F11A 4HSQA 3V5KA 3QDMA 4OIAA 3TZVD 4X5XA 5DMGD 4GBXB 4H0GA 3C09C 4NNYA 1RIHH 4Y4KC 5D1XA 5J12B 3ULVL 4NBYB 3O41A 1K8DA 4JQIH 5MHSD 1U41A 2ADGA 2F15A 1X6NA 4G7VH 3TCLA 4MJ5A 2CJUL 5EU6A 4NRZA 3WFZA 5FDWB 4LNRB 3VWKA 5C0CE 3VU2A 3NZ8B 2WP3T 3GMOA 3P4MB 4NO3B 4PJHA 5DFVD 2AK4D 3TVMB 1IKNC 2Z92B 1YJDL 2H3NB 3VRIA 4MCZA 3QI9D 5D6CA 3AUVA 2FB4H 5FB8A 2DLIA 4JO2L 2MKLC 1JVKA 3DXAB 3DX6B 3PNWA 3G6JE 2Q7NA 2P8PA 3DX8B 5FV1L 1O5DT 5CIPA 4K3JH 4FTVD 4LGSB 4CADA 4KKLD 5I8KL 4CL7A 4Q0XL 1EV2E 3MBEC 1G0YR 1T80A 4GBXA 3OF6D 4DUVA 1OAXH 1NLDL 1DP0A 3HNVH 2ARWA 5EIIA 5D8JH 1BLNB 2ADFL 5TPWH 1BQHB 4G6AD 1U91B 1UGNA 1DSFH 4L3EA 1UQSA 3QUXC 2R9HD 3IDNB 4P4RB 3NZ8A 4F3FA 3M1BB 3P4MA 2CIIB 4M8QB 2OZ4L 2CLVB 3TVMA 2Z92A 4JPKH 2A1WH 2H3NA 2EC9U 2JIXA 5KSUB 1OF2B 1IT9L 3DX6A 3DX8A 1JZ2A 1XR8B 2PO6B 4JQVC 5DVOA 2C26A 4LGRB 5MEND 1KLFA 1OQOA 2JELL 2R4RH 4JM2C 3FO0H 3GSQB 2ZSVB 5IHBA 2ZG1A 1Z0MA 2MCPH 1DUYB 1BLNA 3WDJA 5JW4N 5MHSE 1IL1B 3R4DA 1BQHA 1F97A 5L9DL 1FVEB 3QCVL 3TWCL 1C5CH 3AB0C 3RGVA 4S1RL 4JO4L 3IDNA 3BUTA 3M1BA 2CIIA 4M8QA 4M48H 2AK4E 2CLVA 2PW2B 3GNML 5C71A 1OF2A 4PPTA 3C60C 2EE2A 3S3PA 3DECA 4WHDA 3U1SH 4RMWA 1XR8A 3BP4B 2BHUA 2PO6A 2V7NB 1HXMB 4YXKL 1KB9K 3JVGA 4FTVE 1CLZH 4PRAB 1T7VA 2E8ZA 1Z3GH 5DZOA 5I16B 5DJYB 4FP8H 3GSQA 2ZSVA 3B2VL 5IBTL 5F8QC 1DUYA 3VG9C 2V2XB 4LHUB 3T0EB 1YEKH 1FVEA 5SWSB 4FNLL 1T1WA 1QLRA 3EDDA 2IAMC 3P9WB 5D96B 5E2VH 2RB8A 1MVFA 3MLWL 1YEFH 2YZ1A 3OKLB 1TFHA 2PW2A 2EE6A 2I27N 5IB5B 3NFNB 5C9JA 5GSVA 2CLZB 2P8LB 1FNFA 1YA5A 4PJXB 5FUOH 4DQOL 5F44A 2Y5TB 2V7NA 3LHPL 3FQUB 1HXMA 4ORGB 4TUOA 1CL7L 5J56B 3S34L 1JZ7A 3N06B 3ARFA 4PRAA 5EPMB 4KZDH 3GSNL 4TULL 1KCLA 1FG9C 5MENE 3CVIH 5I16A 3I75B 4UNVA 1CDHA 5DJYA 1A7QL 3SCMB 2NR6D 1HHJA 3BN9C 2PW1B 2V2XA 5EBLB 4LHUA 1G7MB 4JGJA 2Q1EA 3T0EA 1R3IL 2YK1H 5I8EA 3BH9B 5DTFA 2ESVB 1MREH 1FSKC 1MFCH 5GHWL 4YBHA 3OKLA 4KQ4L 4XBEL 5MI0C 3QZWG 4N0UB 5IB5A 2ARJB 3NFNA 1MCBA 1ZLWH 2NY1C 4A6YB 1TJGH 2P8LA 3MLZL 4AJ0A 4DKFH 1IARB 2Y5TA 3VMOA 1XIWD 4K3EH 3FQUA 4EN3D 1MWAL 4ORGA 2EXWD 2FIKB 1YN7A 5EPMA 1VSCA 4F7MA 3I75A 2BY3A 3ZKMD 5I2IB 1EUUA 4NQDD 3SCMA 4JDTH 4FQIH 3ZYOA 1SVCP 4K9EL 5EBLA 4N8VB 2WK2A 1G7MA 1A6AB 3N0PB 3UZQA 1GYAA 4FQHB 1JMZA 2GEEA 3RAJL 5IF0B 5FXCH 2I5YL 2ITCA 5D2LF 3RKDC 4OCWL 2ESVA 4XTRD 5DWUL 1T7XA 4CN6A 3DRQB 1KB9J 4MA1C 1FDLL 2EDYA 4HCRL 1ODAA 3IKCB 2IPTH 1Y6MR 4YO0B 3Q6GH 1UJTA 1AR1C 3MSPA 1E28A 1RY7B 5DJXA 4BSVB 4S11A 1CE6B 5F97E 2R2HB 4RAUB 3E3QC 4QCIB 5BQ7A 4I3SL 1UYWL 1A8JH 3K4ZA 5E6IC 3TEUA 1QSZA 3BQUC 4F7PA 1AKJD 5HYJA 1A6AA 5DK0B 3RI5K 4FQHA 5I1EH 4M1GH 4H26B 1QFOA 1KTLB 3QDAA 2OJZH 2P46B 2WLZA 3A6CL 3UTZA 5JOEA 5DO2D 4X7EC 1DQJB 3O6ML 5TFSH 3DRQA 4YFLF 5FHBH 5KVFH 1FL6B 2EEAA 2EDQA 1DBBL 1UM6L 5C2UB 2J88L 2FWOB 1GGUA 4YO0A 2P45B 2A9ML 1T5XA 2G9HB 5JHLH 1XGRB 4MZ2A 4BSVA 2PYED 1JRHI 4BH7B 4XPBH 1CE6A 3ZE1E 2R2HA 1V8HA 4D9QD 1MF2H 1JZ8A 5LQBL 1X5XA 3BIBX 4QCIA 3B3IB 3UYPA 2IFGA 4NQDE 1XCQB 3BX7C 1X44A 4WTZG 3TFKC 4S2SB 1MIEL 2AEQH 5C07D 2XZAL 1YNTB 1GOHA 4R97B 3FMGL 1KTLA 4J4PC 5HBBA 2VH5L 4FG6D 4GQPH 3ZLQC 3M45A 2D03L 2F19H 1DQJA 1LP9B 4Y16C 1WC7B 5F1IB 5H37H 3LB6C 2RCSH 2D3VA 2FWOA 4JN2A 5DUPL 3NGBB 4MQTB 3D2UD 4DGVL 5IWLA 3NCEB 3QUZD 1AD0B 3MV8B 2G9HA 2GJ6D 2Q7YB 2J8HA 3MXVL 4HC1A 1R3KA 3RL1A 5BVPH 4BH7A 5F7LB 2HTKD 2Z4QB 3OAZH 1PKOA 2DBJA 1DEEB 3AREA 3IU4H 4NZJA 4FN0A 1XCQA 4JR9L 4U2ZA 2Z8RA 1J88A 1NGPL 4NZRH 2E6QA 1D5MB 1UVQB 4S2SA 2WNGA 4AL8H 2CKBB 2J8UA 4UILH 1A7NH 4RFNC 5HYSG 5IBUG 3RIAF 3AY4C 1S7XA 4Q9QH 4WI5A 1LP9A 3K81A 4LVHC 3WKML 2MSPA 5F1IA 3GSUB 2XKSA 4HPOH 3WNMA 2GCYB 3MV01 4QWWC 5EORL 2AQ2A 5JQ6H 1SY6H 4GLRH 5C2BH 3S3SA 5L7XL 4YE4H 2PYEE 3PDOB 3WNLA 5CBEB 1I9JL 3ZTNL 2Z4QA 5CZXC 4NN6C 1AO7B 4D9QE 2DQJL 4QHUB 1DEEA 1J11A 2FJFB 2ADJB 4OCNC 1A64A 4OLVH 3VI3F 3VWJA 1P53A 2H6PB 1BD2A 2F53D 3V9FA 2XNAB 1JTPA 1UVQA 2FNBA 4I9WE 3VXQB 2CKBA 1J1XL 5C07E 3KDMB 4TSAH 5CEXB 4HWBL 1UG9A 2B0SH 4PJ9C 5FO8A 4MD5A 1NC4B 4NP4H 1FVCA 5TE4L 5A2LH 2DQEL 4XBGB 4KI5F 2F54B 3GSUA 3IRZA 3IJYB 4B41A 2Z8SA 3QDGD 3GSVA 5EC1A 3REWA 4NDMB 4JY6B 4HG4K 4LPVA 1C1EH 2HA1A 2GJ6E 2FJGA 3PDOA 5CBEA 4JVPA 3EO9H 1AO7A 3MJ9H 4P23C 3WXVH 1NCTA 2GYSA 4XMLH 3V4VH 2P5EB 2FJFA 3U0PA 2ADJA 4YGVB 4KDVA 5FECB 4GRLD 1QKZH 3SOBL 3UEZA 1MJUH 3VXQA 1MFAH 3PWPD 3CLEL 3QIUA 2G2RB 4XVUC 1DQTA 5CEXA 3G6JA 4JY4B 5ERWB 5JW4Q 4LBEB 1NC4A 1EEQA 4LSPH 2AERT 4K71C 3SDCB 4XBGA 5TGBB 2A9NL 2F54A 1WIPA 4P5TA 5IROA 2LVCA 3IJYA 3TZVB 4OF0A 4YWGH 3MLSL 3ULUD 3F8UB 3SEPA 4JY6A 4LEOA 4ZTPL 3TT3H 4P0DA 2AI0H 2ZCLL 3OKYA 5BRZE 3H2WA 4OGYL 4BFIB 4XMPL 3GSRB 3PL6A 4CMMB 2P5EA 3QDJD 2BK8A 1KJMB 3VD4A 3WIHH 4YGVA 3ZT7A 3TJHD 4ENED 3FT4B 2R2EB 5FUZL 5TE6L 2F53E 5FECA 5IB3B 5DXWA 3BD5A 3QI9B 4FFZL 2A0LC 2X10A 4JRYB 4JHAL 1JL8A 1KIRA 4U6VH 4KU1A 3T65B 2G2RA 4JY4A 5B4MD 2HFGL 3U79A 4LBEA 1MELA 1JWUB 4IRZH 1QUNA 3W9DB 5C0BD 4JPVH 5GRWA 2D7MA 5TGBA 3EOBB 3PQYD 5FM8A 4C4KT 1AY1H 3TZVA 3EW3B 3VXSB 2UY6A 3N1PC 4KXZI 3QDGE 4MXVF 4M1CC 4M6MH 4WI7A 1WT5C 2X6MA 5FCSH 4Q97A 1NGWA 3OR7A 3GJFB 4PB9L 3BKJL 3NCYP 5DJAA 5BZDA 5DJDB 4BFIA 2F74B 4X80H 3GSRA 1VPOH 4CMMA 4KJWD 5IGXH 5ISZD 4X4ME 3FT4A 2IMMA 2R2EA 1B2WL 1NH6A 5IB3A 3QI9A 4JRYA 4F8TA 2E9JA 3N9GH 3PWPE 2AABL 3T65A 4JN1L 4OFPA 3I3DA 5DUBB 3SGKA 2NY2D 1JWUA 2EH7H 3S6CA 4HG4J 2NW2B 1FORL 4EZMA 2IBZY 4P9MH 1MAML 3EOBA 5FO9B 3KGRA 1D5IH 1T2QH 4NUGL 1RZ8B 2N56A 2HT4D 1BJ1H 4Q2ZB 2DD8L 3ULUE 2OR9H 5FYJL 5HVWA 2XA8L 4KMTH 4GW4B 3MUY1 1NBVL 4I5BB 1U2CA 4WUKL 2QQLL 3GJFA 3B9KB 1X4ZA 1CFSB 1Y18B 3MREB 5DJDA 2DDQH 2F74A 1A47A 4K94L 2E6PA 3JXAA 3P30L 7FABL 1T6WA 3QDJE 3VMNA 3WO3B 1XH3A 5KSAB 4MNGE 3V6ZB 3DO3A 4PJ8B 2FHFA 3MBXL 2XT1B 3UTQB 1VERA 5DUBA 3GKWH 4HIJB 2WIIB 2EIBA 2NW2A 1I3VA 4PRHB 5C0BE 2GK2A 3PQYE 4D3CH 1ZLVK 4TOYH 1RZ8A 5FYKL 3ZDYF 1KULA 1QSEB 1PGRB 3T8XA 3S37L 3EIFA 1OSPL 3HI6L 4GW4A 1VKXB 4I5BA 2HJKB 3B9KA 4LCUB 1CFSA 1Y18A 4KGJA 3B9DA 4CBPA 2BRQA 3G08B 4PJ7E 3VD5A 1IJ9A 3LSOA 4OM1H 3D0VB 3HAEG 3PG2A 4LARL 3GSNB 5ISZE 1S9VB 4I18C 3G5ZA 3GJEB 3P0YL 5DJ6B 3QXTA 3HMWL 4C83B 3V6ZA 4PJ8A 2FD6H 5H94B 3UTQA 2OYPA 1V7NH 4HIJA 2XRAL 4P3CH 2W07A 1LVEA 1Z5LB 3R06B 2IF7A 2R1XA 3S7GA 5F7UA 4XNUH 3NIGE 1IC4L 2XTJB 2EDBA 2ZUYA 3QCTL 1AGFB 5CGYD 1WZLA 3V5DB 5TQ2L 4F80A 2HJKA 1MUJA 4LDOB 5CBAB 4Y7MA 1RZGB 3TT1H 3G08A 4LPUA 1ACZA 2VDPH 4EUPH 1J05B 2WBJB 1IAIL 3C6SB 4NGHH 1S9VA 2Z31D 4PJGB 3TYFB 3VFMB 1UB6B 3GJEA 2L4OA 4M00A 4WO4D 2HKFL 3ZL4H 5H94A 3V6FA 1G9MC 5C7XL 1LK3H 2VDRL 3HE7C 1Z5LA 3R06A 2DTML 5B3JE 2DMKA 1IC7L 1YMMD 3UJIH 2QL1A 1TVBB 1AGFA 4FQXB 3V5DA 1N64L 1PBYA 4U1LB 5CBAA 5L6YH 1MCKA 1RZGA 4KKCC 1IKFH 4IOFC 4EOWH 4PR5B 1J05A 2YA2A 4Z7OE 3C6SA 4FQJH 1MPAL 5I1JL 3WFBL 4RRPG 4XRCB 2ZSWA 3VFMA 3DI3B 5GS0H 2OTWA 4KQ3H 5DZNA 1CICD 4LSSH 1I7UB 3DVNB 4EN3A 5IB2B 3U9UB 2X2YA 4UT6H 1GIGH 5CJQH 1JPSL 1CU4H 1I1RA 4TVPL 1XCTB 2FDBP 3D39D 2QADB 3D87B 4NQDA 5D7JD 1FP5A 1ZLSH 1AKJB 3VGAB 4CU7A 1N5AA 4PR5A 3WNNA 3QH3B 3LKOA 5E2JA 1MAJA 4N5UA 1U8QB 4S1SL 5F1SA 2J1KA 3LMJH 3IAGC 4UB0L 3OHXB 2DWEB 4WCYH 4WVRA 4L4JA 5L8KB 4NM4H 5I74B 1NEZA 3DVNA 4OCYH 1W0YT 3TA3B 4F37F 2D4DA 4JKLA 2Q86B 4B0MM 1QSFB 1GOGA 4LKXB 1XF3B 2JLLA 4FQQA 3SY0B 3TH2T 3FJTA 2QSTA 1XCTA 3TBSB 1YMME 3STLB 4LPXA 1CDIA 1I9EA 2VL5B 4NWTH 3U7AA 2V17H 3FONA 4WU7A 3I50L 3WLBB 3ME0A 5BJTB 1FGNL 1AKJA 1F4YH 3LAFA 3PWUB 1L9MA 2A6JA 3OB0H 4R2GB 4GG6E 1U42A 3QH3A 2OTUB 1CQKA 1U8QA 3IETB 3KJ6L 2R8SH 2ZCKL 2VDQH 3PWLB 4JVWA 4YX2H 2B8OT 4BFBD 1RUPH 3D18A 1WQVT 3O4LB 1EVTC 1NJ9B 4OCMC 2VZ1A 3TA3A 2Q86A 3QAZB 1QSFA 4RAHA 5HHXL 1XF3A 2AJUH 2HTKC 3QIWD 2NX5B 1N6VA 5HDBF 5BV7H 3WYRA 3L7EB 3TBSA 1KF9B 5J6HA 1GJIA 3STLA 3IU3A 1T1YA 3D39E 5I66A 4FQ2L 1J0ZA 3MNWB 4XWGL 1BPVA 4Z76A 4BFGA 5JMOC 1IE5A 5BJTA 4JRXB 3Q1SL 1XGUA 4KY1L 5EIVA 5ANMB 1EHXA 1ZKAA 1B0WA 5C07A 3SDDD 3RDTD 4O4YL 3MMEB 3U9PL 4N0CD 5L88H 3PWLA 4NO2B 4X8JA 1A6VH 5HYFA 3BD3A 2EC9T 4JFPB 4GOSA 1B9ZA 2E7HA 4DN3L 4F2MA 3GM8A 4YZFF 1CZ8H 1RUQL 3LCYA 2VUYA 3TBTB 4KROC 1NUFA 2GJ6A 3AS2A 4KK6C 3QDHA 3O6FC 4E5XB 2NX5A 2UVFA 5E6YA 1KPRB 1R3JA 3H3PH 1H3WM 2Y6SC 4O2FB 2AXHA 3MNWA 4DAGH 1NCBL 3NTCL 2NCMA 4Y4FD 4C4KO 3O8XD 1LO2H 1Z9MA 1IBGH 4D9RD 2FX9L 1F8TH 5JHDD 5ANMA 5KANI 4P9HC 1AIFB 4ZTOL 3MMEA 4ZPVB 4N8CL 2M8XA 4GAGL 3LIZH 2UVEA 3IDIB 1YY8B 1W0VB 1YPZF 2NPLX 3KPPB 5FGSA 1AFVH 1G9NC 1CFNA 1Q1JH 2OTPA 3GIVA 4P99A 2XN9E 4JFPA 1WWCA 1RUMH 3QDGB 3EGSA 2NQCA 3GMQB 5DSCA 4BUHA 5DD1L 4QRQB 2H1PL 3TBTA 2VKWA 2C3VA 4JFQA 3MRKA 4U1NA 3RHWK 4E5XA 2CMRL 1KPRA 5AZEH 4K23L 3U7YH 4WI2A 1XGPB 5I75B 3MLVH 4O2FA 1UM4L 1N6QL 4LLMB 4APQD 5I30H 4X9HA 2F53A 2HT2D 4YXHL 1D7FA 1N7ML 1DLFL 3QHZL 1AIFA 4OZHE 4OKVB 3NOIA 4UIMB 4ZPVA 3SDAD 5J9PB 2CRYA 3IDIA 5ICXB 1W0VA 3R0MA 2NXZB 1ZAGA 3SGDH 3Q6FB 1FO0H 1EGJL 3RTQD 2UY7A 3KPRD 3QDGA 3GMQA 4G42A 4M6NH 4MZ3A 3WO4B 4Z7QF 1KB5L 3EOYG 4RISH 3K2UL 4HK3N 4HUWB 4YQXH 2IBZX 1T1ZB 3EJZD 1OAYL 1JFQL 2WWMC 1WEJL 3R8QA 4GSDH 4ZXBB 3I02A 4X4MA 4LLMA 3UCRA 3IB4A 3UBXG 1AJ7L 3P9LB 5AUMB 2GJJA 1OSZA 2APFA 3O4OC 4D9RE 3X17A 1NMAH 2BVPA 5JHDE 2JCCB 1A1NB 4OKVA 3T2NL 1LK2B 4UIMA 1RZJC 4GKNB 3MO1B 5J9PA 1X5JA 1OAQH 1OAZL 2Q76B 5SX5K 5T3ZL 5ICXA 2B1HH 2EDOA 5IJVB 3Q6FA 2DQIH 3LPWA 3VJ6B 5D1QC 4BFEA 4XC1H 3ARVA 1N0XH 3MODH 5F7FA 3P40A 4NZTH 2AJZB 4BH8B 3RGHA 3PDDA 1TENA 3P11L 4HUWA 2AW2A 3N1QC 4X6DF 3V0WL 1T1ZA 4MB3A 5EH1A 1CXHA 5LBSL 3ALPA 4HIHB 1EEZB 1ETZB 2AJSH 4FMKA 3UAJD 1S9XB 3X3GL 1NPUA 3P9LA 2O61B 3IVKB 2JCCA 5DFTA 3WUWB 5DJ8A 1EO8L 1OP3K 1LK2A 4EI5D 2XWJA 3HNSH 4GKNA 3MO1A 3QWQB 4RWHA 4EIZC 2Q76A 5FYJU 5C08B 4CVXA 1I85A 5C0BA 5ITBL 1TCRB 4YHIA 3VJ6A 4LLVB 4MMXC 2YRZA 3QJHB 4WI3A 2AJZA 4PJFB 1VADB 1XF5B 4XPGL 4XZUA 1LDPH 4EDWL 3FT2B 4MD4B 4U05A 1TZHB 1I9RH 1DBKH 1KG0B 5D1XC 2GQHA 2X5PA 4HIHA 1EEZA 3HMXA 3QUYD 1S9XA 3B6SB 3U7WH 2O61A 4RGNB 1VFUA 3TJEH 2IJ0C 4XCNA 2DJSA 4I0PB 1J0KA 5F6HJ 3CD4A 3WUWA 3VWKC 4AEHL 1G7PA 4AIZB 4QF1B 4JG1L 5FYKU 4XH2B 4X7CC 4O5LH 5J13B 4JQXA 1R0AL 3THML 3S9DB 1TCRA 2CK0L 2VMFA 1EEYB 5HD8C 2GHWB 4LLVA 3VD9A 4KK5D 3FOLB 3QJHA 5C0EB 4AT6B 3V7AE 1XF5A 4JGUA 1U6AH 2J4WH 1BP3B 2WUBL 4ODBD 1TZHA 1KG0A 2BVEA 3TN0B 1DVFB 5J12C 4NOFA 1MFDH 2MWCA 4HF5L 3OAYK 3B6SA 1WCBB 2UZYB 1RSFA 1N6UA 3KPQB 4Z77B 3UC0L 1HDMB 4I0PA 4XP1L 1U93B 3TBVA 1A3LL 3BPNB 1I1YB 1FRGL 4UTBH 1U0QA 4QYOB 2EXYD 2ZZUT 5DR5L 4AIZA 4HHAB 5CSZB 4QF1A 3TO4B 4BJLA 1MCWW 3MRMA 5KW9H 2NYYD 3TVMC 3FTGB 3CDGB 3FO1B 4RFOH 4EI6A 1EEYA 2JJTC 5E08L 5D71H 2HRPH 4KAQL 4MA8L 3FOLA 1OD7A 2OS7A 5C0EA 4KTDH 4E9LA 1RPQA 4AT6A 4PG2A 1JNLL 5JR1H 4UV4H 3V8OA 2A6IB 5GRVK 1CDCA 5TDOB 2DQUH 5BO1H 3TN0A 4PRID 1DVFA 1KCRL 4LKCB 2RFXA 4ESKA 3VXNB 2Z31B 1WCBA 3AMKA 2KUTA 1Z0NA 3OJDA 3KPQA 4Z77A 2B1AL 1HDMA 2M26A 3HZYA 1U93A 5KZCD 1I1YA 2NY4D 5SX4I 4QYOA 4QTIL 4HHAA 5CSZA 3FTGA 4JCMA 3ARZA 1JHLL 4XP6H 4FMFA 3I9GH 1L7IL 2EECA 3FO1A 4UINH 4X6EB 2D0GA 1VGKA 1UFUA 5FGRA 1UA6L 5EN2B 1CVSC 5ICZB 5CD5D 5KSBF 5FGBA 4EDXB 1FL5B 1FNSH 4AY0A 1KACB 2VITB 4N68A 2ZUXA 4GG6B 4GT7A 5K9QG 1NFDF 4Z7VF 4H0IA 3QRGH 1NGYB 1MCCA 3VXNA 1RJCA 4PGBA 2Z31A 4YFEA 1NFIB 1QHPA 4ELKA 1JGUL 4PJEB 3ZE0F 5E00A 5F1NA 4XMKH 4U0RB 3TIEB 5CJXA 1C08B 4X6EA 3RKPA 3G5YB 2W92A 5DJ0A 3VFVB 3BRFA 1GGCH 3GK8L 1YMMA 2ORBL 3STZA 1MEXH 1BZ7B 5F7DA 5AWNL 4PY8J 4AM0B 5ICZA 1NC2D 5CD3B 4EDXA 1X5GA 1FL5A 1TZGL 4EXPX 4J1UB 2VITA 3KXFD 1EIBA 4LSUH 1WF5A 3G6DL 4GG6A 2IMNA 1T2JA 1EJOH 4PRIE 1NGYA 4QNPE 4HIEB 3T0EC 1OTSD 3P4OB 1OLLA 4U1SA 2GJZB 5D96C 1IGIL 1NFIA 2AJYL 5EFIA 1IEBB 4IM8A 2Z91B 3LKPB 5J3HC 3KPOB 4BQ8A 1A6UL 2R1WB 4ZS7H 1WICA 4HX1B 1ORQB 1ZANL 3N50A 4HGWB 3DUUB 3VFVA 4DEPC 2O26U 3UO1H 4ZO9A 3GI8L 1BZ7A 1OL0A 4AM0A 2H2PD 5D7JA 3RU8L 1W72B 3JUYA 5CD3A 1CGTA 1PZUB 2XQYG 1FZJB 2ERJC 4LAQH 4Z78B 1D9KD 1J1PL 2VZUA 3SCMC 4ONHB 4JQIL 3I84A 1EPFA 5ALCL 1ZEAH 2Q3ZA 3NAAH 4UMGA 4HIEA 2VERN 3P4OA 3K4AA 5D9SB 2OL3A 2GJZA 2EYSA 3D1MC 4TRPL 1FC2D 1NAMH 1IEBA 3L3GA 3JTSB 3CMOH 1YECL 4KJQC 3KPOA 4HS6B 3FRUB 4PIRF 1OP5K 5T3XD 4YHMH 4HX1A 5D2LE 1ORQA 4X6BB 1D6VH 2WLYA 4GRMB 3RVWC 1OQXA 1MJJB 1MCNA 3DUUA 3VGBA 3PGCA 4HUUB 3REVA 1W72A 4J7RA 4IMKA 3U0WH 1FZJA 4JKWA 1RJZB 5D93B 3KXFE 2HRLA 3SDDC 2KL6A 4HEPG 4ONHA 3RDTB 2WSKA 3F12B 2ZKHL 3ZKNC 1S7QA 5T1DL 2I9TB 4N5EC 1AI1L 1G6RA 3QUKA 2NY3D 5F7WC 1LO3H 1JZ3A 2BOCB 3DV4B 5FFLA 1XGTB 4G8GD 3ARPA 3FRUA 4R96B 3GHBH 4X6BA 3ARWA 4KKBC 1A7OH 3QIWA 4GRMA 4PJ5B 5LCVL 1RJLA 1MJJA 4HEME 1I1AD 4MAUL 3O2DH 3MV7B 4HUUA 3RVVC 4Y4FB 3OPZH 4C56B 1RJZA 4PGDB 3LD8B 2XA3A 3PUCA 5E5MB 2VDOL 3RDTA 5KN5B 5HVGB 3F12A 4X83A 1RZFH 1I8IB 2E6JA 2W60B 2I9TA 4H1LG 1T83C 4DOHE 1RZKC 1NDMB 3A0OA 1JWMA 2WINB 2O5ZL 4G80B 1A7RL 3DV4A 1G7JB 4ZG1A 4NBXB 4BK4A 5JXEC 2IEPA 5T3XE 3CC5B 4MB4A 5E2TH 2YXMA 5DJCA 2WM0A 4GS7B 4LLAA 4PJ5A 1ROWA 4BZYA 3QNYB 1P1ZB 2JTDA 2E7BA 4Q58C 1YY9C 4NHUB 3SGJC 5LKNA 2BHYA 5JUEL 3D48R 4RWYL 5F7YC 1KENL 4Z7UB 1FBIL 4LLQB 4Y4FA 2DLGA 4C56A 1M71B 1B4JH 3QA3B 1HKFA 4PGDA 4R0LC 4NOBA 5JHDA 5E5MA 1KB5B 3FB8B 4RBPH 1ACYH 2DOCA 3DVGB 5KN5A 5GS3A 3GBMH 1I8IA 4MDJA 4OM0L 4JO1L 5K59E 3WJLA 1QBBA 4ERSL 4KRPB 4R97C 5TQ0L 4NQTA 2WINA 1INQB 3RFZC 3KPRB 4MXWH 4PLJD 1G7JA 4G8GE 5F9DC 5HXMA 4JM2F 4RZCB 1DBJL 4L3CA 1CL7I 4G6JH 4IBLT 3O3DB 3IAQA 1PQZB 1Q8MA 3QUMH 3I3EA 3HPJB 3NGBC 4XPAL 4G8EB 3QNYA 1P1ZA 4NHUA 1JNHA 3ES6B 1FPTL 4KZDL 4APQA 2BJML 4KVCL 2ICES 5BOPA 1M71A 3QA3A 3CXDH 1FIGL 4YFLI 1KB5A 3FB8A 5DLML 4PJIB 5A2KH 3DVGA 4GW1B 1YN6A 4JFOA 4ZS6D 3SDAA 5F88B 4L8CB 5GRVL 5E24E 1K2DB 3L5XL 2VSCA 1R3HB 2C3HA 1ZVHA 3UZEA 4LDLB 4NKOA 1RUAL 3OG4B 5GGVL 1INQA 1HHHB 5H2BB 3KPRA 1KJ2A 1U3HB 3KNBB 3RP1A 2VXQL 3BGFB 4OCLC 3MYJB 5HY9A 3RWHA 1EFXB 1PQZA 1TJGL 5C0IB 3BMWA 3DWTA 4RAVB 2P48B 2X1XR 1NBQA 4G8EA 4K3EL 3WD5L 5H35B 5JQHC 3BE1L 2V7HB 3ES6A 2H8PB 3TP4A 1RVFL 3BO8B 3MV9B 3SO3B 4HBCL 2PYFA 3H0TB 5I1KL 1UWEH 1TQBB 4PP1C 3WFEH 4GW1A 2YD7A 4EI5B 5F88A 5DD5L 5HYEA 4MNHB 4L8CA 4EQ2A 4TNVK 4XB8A 5DMIL 1FNHA 1K2DA 4PRNB 4YJZL 4N0YL 4OZGF 2DMBA 4M8VA 1WIOA 4E41D 4K8RC 5D7LD 5L0QB 1HHHA 5H2BA 4LOUC 5CMAB 3U2SB 1L0QA 5IROC 1QRNB 3MYJA 5B38G 4UBDC 3QULA 3ECBB 2GFBB 3HUJB 1CT8B 3MOAL 5IFHL 2L7JA 1I8KB 3RY6A 4RAVA 1KJVA 1B0RB 5H35A 2BVOA 1NEZG 5KVGL 3QUYC 3ZMRA 4G9DB 4JAMB 3BO8A 2LV4A 3MV9A 4HLJA 1TQCB 4XXCC 4YBQD 3H0TA 2CUMA 1MIMH 5C09B 1QR1B 4L9LA 4EI5A 1CBVL 3MUHL 1KT2A 4MNHA 3ULVC 3DPBA 4PRNA 4M1GL 1M05B 2QR0A 2VISB 1FVDA 5CEYA 1RHFA 4NN5C 4QRRE 5CMAA 5LJYH 5TFSL 4OGAC 4W4OA 1BAFH 2FX7L 5KVFL 1BGXH 3SDCC 2EC8A 4KZEL 1IC1A 1QRNA 1YNLH 2FJHB 3MYZA 1H3UA 3ECBA 5ADPL 2GFBA 1P4IL 1YJDC 3UPRB 1B0RA 1MFBL 3MLXH 4Y8AA 4OGXH 5HI4C 2RBLA 4G9DA 5F3HA 1A6WH 4JAMA 1MFEL 4GFTB 1N5YL 2HKHL 2APVA 4MXVE 3RVTD 1OTTC 3V6OE 5C09A 3BPCA 3O2WL 1QR1A 5EOCH 5JPNB 5E99L 5EUOF 1F4WH 4BZ2H 1MRCH 1E4KA 4OBSA 2AEQL 1YC7A 3V2AR 1M05A 5D1ZB 4DKEH 4E41E 2VISA 4Y4HB 5D7LE 4F57L 4OIIL 1WIUA 3SGKC 4NKMA 4ZPTA 2BP3A 2NY0B 5E8PB 1KCSH 1MJ7L 3TH3T 4LIQH 2I9LB 4WTWA 4WEUD 3PWVB 3UPRA 4HULB 12E8H 5I73B 5IEKA 3LEXB 3BESR 1G7IB 3KYKL 1T20B 5KS9B 3DYOA 5IG7B 2YS4A 4ZSOE 2KDGA 4NZUL 3IU4L 1D3CA 4H1LH 3MRIB 3KJ4B 3ARBD 4XBPB 2P5WB 4N90D 4NQED 3GEWB 2LE9A 4PRDA 3DETC 3O81A 4UIKH 5D1ZA 1ZMYA 3M07A 1YNKL 4XVSH 2EDWA 1IGML 4LLUB 4JPWL 4HPOL 3KPSD 2R69H 3QFJD 1JGLL 3Q5TA 4PRIA 3QP3A 1E6JL 4PTTB 4L8SB 3L3HA 4OLZL 5D6DC 3B9KC 1AR2A 2AJVL 2V9TA 3ZDYE 1G7IA 5CHNB 5KS9A 5T1MB 5DURD 5E8EB 1BFTA 1J8HD 5I1IH 4KVNL 4J6RL 5EOQL 2Q8BH 3S36L 2ATKB 2JF1A 2QQKL 1I7RB 2P5WA 2PKDA 5B22A 3TCXA 3RBSA 2R56L 2EO1A 1MI5D 5KSAC 4K7PL 1F6FB 4PJ8C 5DJ2B 2XI9A 4TSAL 4Z6AT 3P9MB 2FECL 5GGTA 2YPVL 5DQJB 5DD0L 4NP4L 1JHKH 2J5LB 5I0DA 5HHOE 4LLUA 4KK8D 5FYLL 4JZJB 1XT5A 1CFVH 4JJ5B 2YKLH 5JIPA 2IPUG 3ZKXB 1KEMH 4ELME 2J6EA 5D7IB 2A6KB 4NRXB 4PTTA 4L8SA 3RWEB 1P7KB 3K0WA 5T1MA 5E8EA 1IGYA 3RJDA 1NBZA 3C5ZB 4WW1B 1A6TA 1I7RA 4N90E 4NQEE 3B4NA 1MJUL 1M6OB 5D2LA 3CNKA 2P43B 2X4TB 3P9MA 1U8MB 4RNRA 4Z7WF 3R0NA 4EVNB 5DQJA 1INEH 5DRWB 3DMMC 2PR4H 4NHCH 1NC2A 2FBJH 4Q6IB 4JZJA 3KPSE 2DKUA 1RU9L 3QFJE 3PP4H 4YWGL 4JJ5A 5TF0A 3KXFA 3SE9H 1G9MH 2XTJC 4D9LH 4L4VD 5HVHB 3FB5B 2A6KA 4MS8D 2AI0L 4CMHB 3RWEA 1P7KA 3EAKA 2MPAH 3W9EB 3TNNA 1XF2B 3JUZA 1BIIB 2WBJC 3OKMB 5CWSB 1E4XL 2X1WL 4WW1A 4PG9B 4UU9B 1OW0A 2CPCA 1MI5E 4RIRA 3KHQA 4K9EC 5ESQB 43C9B 2HTLC 2X4TA 4NRYB 2AJXH 4OB5H 4DZ8B 4HJGB 1QO3A 1BF8A 1U8MA 2YUVA 1ND0A 5CAYB 4HJ0D 5DRWA 3PABB 1BQLH 4JREB 1CQYA 4Q9RL 4Q6IA 1JUFB 4X99B 4NWUL 2HVJB 1U8LB 4OLWH 1Q9LB 1D9KA 3OAUH 5J7CC 4FQXC 5MP6H 3BRDA 5TDNB 3WFDL 2EDLA 5J89A 5DRZA 3EO1B 5FGCE 4XHQA 4O9HH 3CSYB 5JW3H 3OKNB 1BIIA 1DE4B 5IW3A 1IGFL 3OKMA 4OIBA 4TVPD 5CWSA 4NQCB 5MEQA 2ED9A 4NO5B 2P4AB 4UU9A 2DBLH 1YEGH 5DRXB 3MRQB 2R0LL 4Y2DD 5L8JB 1NGQL 43C9A 5ESQA 4NRYA 1ONQB 1GXEA 3CFCH 3MRDB 4P4KD 1II4E 2KH2B 5JO5B 1OD9A 4GLRI 4JLRB 3PABA 3VFSA 2OJEB 3CDYA 1BVKB 3RWJB 1JF6A 3IDXH 5J1SC 2YPKB 1T2QL 4KJPC 2DQHL 5F1KC 2QADC 1T66D 4E42B 4YLQT 4L4VE 4BA8A 5TDNA 2O5XL 4JFXA 3FO2B 3VGAC 4IIQB 2A2QT 1N4XH 2ADIB 5HDOA 1J8KA 4LVNC 4OTXL 5IB4B 5EO1A 3OKNA 1F00I 1WBYA 1DE4A 2VAAB 4X8XA 1OWRM 3N1FC 4XI5C 4UUJB 2D0HA 5ALBL 1MCWM 4NQCA 4GAYB 4NO5A 5DRXA 1OB1B 1YQVH 3MRQA 3TYGH 4LU5L 5I74C 1ZLUH 1TLKA 4MD0A 4XCFL 1XMWA 4KXZH 4JFED 2BX5A 4YC2B 1I1AA 3RVXD 5JO5A 2VIRB 3TA3C 4ODHL 4TSBL 1WZ1H 3RWJA 1BVKA 4OCSL 4G6ML 3C8KB 1RULH 5TJWK 3MOBH 4E42A 2YPLD 5BVJB 2D9CA 4N0RA 3TIDB 2W0PA 4IIQA 4PJAF 1SM3H 2ADIA 2YN5A 1DDHB 4R2GC 1T7YA 2FEEL 5TE7H 2BCKA 4HJJH 4WI6A 2Y7QB 4TVPE 1IAMA 1PLGL 4GAYA 5K9JH 2APWA 3CVHH 1OAKL 2A6DA 3UTSD 4U2YA 2XV6B 4TPRH 3BP5B 4M62H 4OT1H 1U3JA 3CIQA 4YDIH 1MCHA 2VIRA 4OD1L 2B2XL 5EZIL 3QAZC 4ODTH 4XNUL 4U0QB 3SE8H 4YZFE 3HLAB 2EYTB 4QOKD 3C8KA 4GKSB 4U1JB 3RX5A 3PHQB 1E27B 3DX9B 4Y5VB 3ARSA 3EHBC 1IAII 1P6FA 2VXVH 4J23A 1JE6A 2W65B 3BSZL 5I19H 4HQQH 1DDHA 4NQVA 4FXKA 3P4NA 1A0QL 2EDNA 3ARDD 4MNQB 1SYVB 1T1XB 5I76A 2Y7QA 3RY5A 1NCDL 3IXTA 1HINL 2QSVA 2N7BA 4LLYB 4G9FD 5HGAA 3P4LA 2FGWL 4P9HH 4M4RA 2Y07H 3BP5A 3CFBB 3MRJA 4JFEE 2DM4A 3MJ8A 5LAXB 3FZUC 5FA3B 1ITCA 1G9NH 4JFZH 2J7LA 4GMSH 4Q74A 4MQXC 1S78D 1UKTA 3DGCR 4OLXL 1WWAX 3V6OC 2E9BA 5GS0D 1WAAE 2EYTA 1AXTL 4GKSA 4Q7DA 4U1JA 3PHQA 2XWTB 3U48A 1FH5H 3IGAB 2YPLE 1QFWL 3CU7A 1FV1B 3BP7B 5EULV 1MCEA 1I8LA 2F9BT 2W65A 4EOWL 1HYRC 1TETH 4DJMA 3QEUB 3S35L 1PAMA 5CS7A 1NCCL 4MNQA 1JPST 4IDLA 1SYVA 2VXSH 4FQJL 4UAOB 1T1XA 3NA9H 1A21A 2LU7A 1Q0XL 4JZNB 4KKNA 3DTXA 4LLYA 1NSNH 3QHFL 2AS5M 3CFBA 4G5ZH 5AYUH 3BPOC 2HMID 3F7YA 1X4YA 3RUGF 2DIAA 4ZFFB 1CGXA 4K2UH 4UT6L 5FA3A 3FAXA 1GIGL 1Q9OA 4YDKH 2IBBA 3I2CH 1AQKL 3FB6A 5E9DB 3T0AA 3X3FH 1RUKH 5D72H 4MJIB 3FT3B 4QOKE 5I75C 1IM3B 1YEHH 5DD3H 4Z0XB 2VDLL 2XWTA 3GMRB 3IGAA 4Z7QE 2K1MA 4X9GA 5LGKA 1ZGLP 1FV1A 3BP7A 1PSKH 5DQDL 2GTWA 1GGYA 4UT7L 3IFLH 4PD4K 4E41A 5D7LA 3ZE1F 4DTGL 1TVHB 3QXAA 1EBPA 4JZNA 4M61B 4FQLL 1MJ8H 2NXZC 2YD9A 4X7TB 2DMCA 4DCQA 4G9FE 1V05A 3KPMB 1IQWH 1M7IA 4N8PA 1KIPA 1QBMH 1P7QD 3VXTB 3MRNA 1RZJH 4XX1E 1IM9B 2IALA 4J3WA 5ADOH 2IANB 4R7DB 5FA4B 4ZFFA 1QYGH 4E0RB 5JIKA 3QO0A 3K8LA 3U4EA 4MJIA 3FT3A 3E2HB 1WUNT 3RIFK 1IM3A 4ZXBC 4Z0XA 5DA0B 3WFHA 2C1PB 4LSVL 5ESAB 4CUCA 4X6DE 1F4YL 2ZOLB 2Q6WB 1KBGL 4ZUWA 1EBAA 5I1CH 3HKFA 5E2WL 1TVHA 2Y06L 4M61A 2EIDA 5GZOC 1I85C 2DI8A 3N1GC 5GJTH 3KPMA 4OD2A 5JORB 1CFQB 4TVSa 1AGBB 2LAGB 2J3SA 1FIEA 1IM9A 3B5GA 2IANA 4OFIA 4R7DA 4YHNB 3EYUL 3J8F7 4E0RA 1FNGB 4XAKD 1NEUA 4DGIL 1JBJA 4F9LA 5LG1A 1HCFX 1I1CA 4M7JH 4X9BA 5HI5D 2C1PA 5ESAA 2DF3A 5TDPB 2PNDA 3RRQA 2QLVB 1J0JA 5IMLB 2XQBH 3OGCB 2W59A 2Q6WA 2B5IB 4QHKJ 2H32B 3MZGB 4FFYL 1ZA3B 4IRSB 1A6VL 4G6FD 4K94C 4MXQC 4JQXC 1A4JB 3DUSA 1FZKB 3OJVC 1CTNA 5FM5O 5JORA 1CFQA 1PEZA 4G7YL 1H5BC 4WV1A 1AGBA 1CZ8L 1EK3A 4PLKC 1ITBB 2XXMB 2D9QB 2G60H 3Q0HA 1HSAA 1YEDB 1BX2B 1QBLH 3RWIB 3LQZB 4R4ND 5A3IC 3EYVB 1T7ZA 5CIPH 1J8HB 3ROLA 5ILTH 1EXUA 5F89A 4PD4J 3RA7H 3RWFB 3VFTB 3ARBA 1SBBA 1SY6A 3DVIA 5J57B 3HNTL 4LK4A 4IJ3B 3OGCA 3V52H 4I0PC 1MI5B 1Q0YH 3GRWL 4M5YH 1WGOA 1KN2L 4WY7H 1ZA3A 1NCWH 4IRSA 4F7CB 4CW1B 1A4JA 3IFPB 3B83A 5HSFA 4ZUUA 1Q1JL 1FZKA 3WSQH 2DLFH 1LILA 3KPSA 4XP4H 1RIUH 1WFOA 4RFEB 2BNQB 2HWZH 2LTQB 2LFGA 3QZWB 2E5EA 1BX2A 3LN4A 2BY0A 4PG2C 3RWIA 5DF0A 5IQ7H 5AZEL 3QNZB 3EYVA 4XAKE 5IMOB 4M5ZL 1J8HA 1FAIH 1DVFC 3G9AB 3HR6A 5IFJB 4Y5XA 3BW9A 4Y5YB 2F5AH 3RWFA 2IQ9H 3P0VH 2VE6A 1KUMA 3T4YB 1AGCB 3ROOB 1M7DB 1YYLL 1MI5A 3BPNC 1CF8L 4U49A 1P84K 5EA0L 5CEZL 4KUZH 5IIEA 5K33A 3TO4C 2YD8A 1H3PH 4QXWA 4F7CA 4CW1A 3GSOB 2W9EL 3IFPA 4ISVB 1X5FA 1FO0L 3KHOA 5IVXE 4RFEA 4ONGL 2BNQA 2XOTA 4ZO8A 2VLJB 4L8BB 1MHPL 1GPOH 5LWYL 2O5YH 3MRRB 4RQQB 1O0VA 4XPFH 1GC1H 5AYQA 1SEQH 3QNZA 5IMOA 3F7VB 1OY3B 5IFJA 2BRRL 4MA7H 4Y5YA 4BUGA 1J12A 2HFEB 1A6PA 1SJXA 1CFTB 2XPGB 4HUXB 3QEQD 4KK9D 3T4YA 1AGCA 2FX8H 3ROOA 1B0GB 3BAEL 5BW7A 2AV7B 4YHOH 1AXIB 3L3DB 4Z7VE 1BBDH 4U6TA 4I13B 3MRPB 4KRLB 3HE6D 2YMXL 1RJYB 2B1HL 4S1QH 2DN7A 3DGGB 3MA7B 2ICWI 2J8OA 3WIHA 3WLWD 1A5FH 3VXMB 5GZNC 1L4IA 4XC1L 1SVZA 2NZ9D 3ZE0E 5EG6C 4P5MB 5ID1B 2VLJA 2YZ8A 1D6EB 1D5ZA 1S5HB 4L8BA 4EEEA 3MRRA 4OLUH 4V1DD 5IW6B 3RWGA 5D2NE 5DT1H 3F7VA 3SKNB 3NIDF 3V7AG 1HILB 3AROA 2R4SL 4PB0H 2HFEA 2GAZB 1CFTA 1I1FA 2XPGA 4HUXA 5CILL 4XNYH 3RZCB 5LGJB 5GIRB 1B0GA 2CGRH 2AV7A 1BJ8A 3HNSL 1ZSDB 3KYNB 4HPYL 2ICCA 1VGEH 3LV3B 3O11B 1HCVA 1CR9L 4U0RC 3MA7A 3F5WB 4JM4L 1SBSH 3CK0H 4PP2A 5DA4A 2WQRA 4Y4KD 1F4XH 1JNNH 4P5MA 4XCEB 2KKQA 5ID1A 1D6EA 1TTGA 3VE0A 5ETUB 6FABH 5ICYB 2YXFA 3IDYB 5DQ9B 5E8NB 5E5UB 5IW6A 1OCWH 4OFDA 4WWKB 3CFJB 4ZAKB 2XKNB 3SKNA 1OPGL 4XB7A 1JMXA 1HILA 1C5BH 2WZPD 2XACC 1YEJH 4FFVC 3BXNB 2GAZA 4QY8B 5LGJA 3QEQE 5CGTA 5FEBA 4YDLB 2DM7A 4Y2DA 2YD2A 3BHBB 1JHTB 1JK8B 1S8DB 4PJ7F 3HC3L 4MAYB 1X7QB 3MCKB 3RVXC 1YPZB 3LV3A 1RURH 3O11A 4P2RB 3MA9H 1YEEH 5F96L 5HYSB 3F5WA 2GT9B 4FZ8H 5IBUB 3U83A 2VDKH 1ZA6B 3MBED 4AQ1B 3KG5A 2X44D 3IXAB 4OZ4B 2DIBA 1NUGA 4LCWB 1QNZH 2QHLA 3QQ3B 4OUUA 4IMKC 4A6YH 4V1DE 1SYSB 3FCTB 3NCJH 3CFJA 4WEMB 2XKNA 1MHEB 3QUXD 3S88L 5T33L 4L1HA 3NIGF 4QY8A 3LRGA 1V3MA 3C9NB 5F3BB 25C8L 1CXKA 3T4AB 2NY6B 4IS6B 3UTSB 4NC1C 3BHBA 1JHTA 4M1DH 5BS0D 1JK8A 1S8DA 4YPJA 1JYXA 4MAYA 1X7QA 3MCKA 5KW9L 4UV7H 4PV8A 1YPZA 4C59B 4DVRH 4P2RA 5HYSA 1E6OL 1ZA6A 3WBDA 5JNYB 2CQVA 4LPWA 2WMPA 1DANU 3IXAA 4OZ4A 4JM2D 3VXUD 1V7MH 3RWDA 2BDNH 2YPLA 3QQ3A 4KTDL 4IOIB 1A7BA 1H3XA 5JR1L 1LE9B 2JJUA 5F9JB 1FE8H 5DDHB 5L2JB 3ARDB 5B3JF 1G1YA 3QCUH 4I2XB 3QO1B 1MQKL 4U6YA 2DQGL 2ZG2A 3C9NA 5F3BA 5C0AD 2ZOKB 1TNMA 1E0OB 3T4AA 3C60D 1X4XA 3UTSA 4IS6A 2DQTH 1Y6NR 3I3BA 1HYSC 4EUPA 3I9GL 4YUEL 3CX5J 1RZKH 2OK0L 1EMTH 1G1CA 4M3JA 4PS4L 4QOKA 4I48A 3L3IB 5KVDL 5AAMA 3HS0B 4AYFA 2IPKB 4IOIA 1YEIH 4XHJC 4X6DB 2WW8A 2NTFB 1RHHB 4DN4L 5F9JA 4Z5RA 1ZVYA 3LD8C 2IAMD 1U8NA 5DDHA 5L2JA 1WTGT 3ARDA 3SJVB 3G6AB 5C0RL 1U58B 4I2XA 1F3DH 2V5YA 3GSWB 3QO1A 2HFFB 4QO1A 5T1LD 3QXWA 1Q72H 2NY5L 2ZOKA 4G9FA 4MQSB 1DQMH 2V2WA 5F1OB 1RK0A 3FAWA 5E56A 3KR3L 1JF5A 1U95A 4QHMB 4CU6A 2Y1VA 4XMKL 2XQYK 2E7CA 1KIQA 4LPCA 3IDGB 4LSQL 1K6QL 1FG2B 3LZFL 4GS7C 4R26H 3HG1B 2CLRB 2A77H 3VXUE 3V4PH 4OV6F 3DHMA 3BN9D 3L3IA 5CJOL 2IPKA 4MHHI 3GFUA 4U1GB 4WGWB 4ZUTA 4X6DA 1T03H 1HHGB 3SKJH 4LSUL 5EZOH 4DGYH 5SX4H 3ESUF 4OLYL 5CZVL 4M7KH 1U58A 5EWIL 2CUHA 3GSWA 2HFFA 3WCYA 3AS1A 1N0LA 4YHLH 5IQ9B 3VFPA 4JDVB 4WJ5B 5C0AE 1J5OL 3NH7H 4KRPC 3O9WB 3T04D 2NY1D 1NL0L 5DD6B 2PETA 4JO3H 4QHMA 2BVQB 2E27L 4ZS7L 3IDGA 4XC3L 4NSKA 2CKBH 1MCPL 1FG2A 1PG7H 3D6GA 3BI9X 3GHEH 2CLRA 1JYVA 2X4QA 3U6RA 3K1DA 4GAJH 4HXAH 4WHCA 3WN5B 2DM3A 5AD0B 1EFQA 5GXBB 3TV3L 2GKIA 2YN3A 1KPVB 1KN4H 2XZCL 1AC0A 1HHGA 2EDKA 4YDVB 4O58H 2OP4L 3QIBB 4TTGA 4YXLL 1NMCB 3RKDD 3KLAA 3E8UH 1CLYH 4P2CG 3BKYL 4D0BB 1MHHA 2H9GB 1G84A 5IQ9A 4L4TE 4JDVA 2WWKT 4WJ5A 1AGDA 2GSGB 1JGEB 3O9WA 5HHPB 4C57C 4HWZB 5GGRY 5GJSL 4BKLB 4HKZA 5GRYA 1U3HC 1AR1D 4YHML 3BGFC 1TVDA 4X5LA 3FKUS 4K8RH 3HCVB 1A7PH 2PF6A 2VN4A 3EDKA 4NKIL 3INUH 1FC1A 1G0DA 2FATH 4XP9H 5E6ID 5JPMB 1L7TL 3WN5A 3BQUD 3HI5L 2AP2A 3QFDB 1NBYB 3SO3C 5IVOA 3L1OL 2I07B 4YDVA 3EUUA 1TQBC 4X6CE 3ZT5A 3L3JA 5CUSL 4D0BA 3ABZA 3SDYH 3H42H 3SE4A 2GY7B 3IF1A 4PJXF 2H9GA 3VFUB 3HRZB 5L2KB 3CFIC 1IGCH 1TJIL 1LO3L 5HHPA 3HAEB 3BDXA 4HWZA 4XCCH 5L0QC 4OZIB 1A3QA 2VDML 1F13A 1HKLL 3VXPB 5B8CC 4W4OC 4ODWB 5HHQB 3ULVH 4QXGH 4JFDB 1ZGLB 3JV4B 3HCVA 4KHXL 3ZE2F 2CJUH 3DSFH 3I6GB 3GGWA 5KSBB 4GO6B 1NBYA 3H9YA 4P2YA 3TFKD 1P5VA 3OPZL 3F7QA 5GPRA 1J10A 1R6VA 5EC2A 1TQCC 1YJDH 3MRLB 1NFDB 1AHWB 4Z7VB 3IT8D 3K2MC 4HC1L 2AXGB 3ARTA 4J4PD 4JO2H 3WNPA 4YHKL 3B9EA 3VFUA 5L2KA 4PUBL 2VN7A 4Y16D 5E8DL 1S7WB 3LB6D 3BIAX 5I8KH 1BEYL 4YH6A 5EUOE 4O00A 1U8OA 4OJFL 4WNQA 5MEOB 4KMLB 5CINL 3WJJC 4OAWB 1MCDA 1U8JB 2CDEB 4OZHF 5HHQA 1UJ3B 4JFDA 5KOVC 1H8SA 1VEPA 3JV4A 5D2NC 4OFYA 5IR1A 3VFWB 1KC5L 1JNJA 3E3QE 1QQDB 3LKSB 4ZUSA 2EDRA 1OGAD 1FO0B 2FH6A 4UTAL 2VQ1B 2QHRH 3I6GA 2EZ0C 5KSBA 4G8IA 4TQEL 3VA6A 1R5IB 3K74B 3HRPA 4F15C 2OZ4H 3W11C 5SWZD 1X5KA 1BQSA 3D85D 1NFDA 5GRUL 4ETYA 1AHWA 1NANI 4Z7VA 1GCFA 3MLRL 1IT9H 3GBML 4RX4D 1BQUA 4QRPD 4JANB 1W0WB 1QLEL 2D7PA 1S7WA 4Y4HC 2VLRE 4QWWD 3F7RA 5DVMA 2IFFL 2JELH 3FFCB 3C6LC 2NY0C 4OAWA 1U8JA 2CDEA 1K85A 1HE7A 5I71C 1DL7L 1IC5L 1AH1A 3BPLB 5CZXD 5HPMB 5I15L 5L9DH 3VFWA 3QCVH 5JIHA 3LKSA 1QQDA 3O2VL 5I73C 1FO0A 2VQ1A 3VXRB 4JO4H 1R5IA 3D9AL 5EO0A 4AZ8A 3S3JA 3ARGB 4P48A 3CXDL 1KGCD 1Z9LA 4HFWB 4AG4H 3PXJA 3IJSB 4LCIL 4PJ9D 1NUNB 3BRGC 3UYRL 3V5HA 1F11B 4YXKH 5J1AB 2E8YA 2ZPKL 5HPOA 4JANA 4CAGA 3QDMB 5KG9B 4JRWA 1NCUA 4PRPD 2ICEB 4X5XB 4KPHH 5AZ2L 1HK6A 3EDEA 3G9VA 3OQ3B 5EBMA 2ADGB 4ALAH 5IMKB 5HDQL 5DK2B 2Q87A 4LCYA 2CK2A 1XFPA 5HPMA 4P23D 4NRZB 1P2CB 4FNLH 3BZFB 1OGAE 1MLBB 3GIZL 3VXRA 4L8SC 4OD3H 3MLWH 4AENA 2I24N 1X5AA 4ZFGH 3QEQA 3VRIB 4I8DA 2FEDC 5SWZE 3ARGA 5D6CB 3FQXB 3UDWA 4Y1AB 5FB8B 4XPHL 3OZ9L 4M93B 3FL7A 1SQ2N 2VZ3A 3PNWB 4HFWA 4XVUD 3ILPB 3IJSA 4I3RL 4DQOH 3FN3A 3LHPH 4CADB 4QRPE 3T2QA 1CL7H 4ZNEE 5E2UL 3FB7B 3ZYZA 2D7TL 4CN4A 5KG9A 2ICEA 4WU5A 3GSNH 3LPGA 4TULH 4JE4B 3WNOA 3C09B 5EIIB 4Y19B 1A7QH 5IMKA 5DK2A 4JZJC 2CDGB 1FFOB 4Z7WE 4L3EB 1UQSB 3ZKXC 1P2CA 4X5WB 3BZFA 2OM5A 2QKIB 5IW1B 4POUB 1MLBA 3MXWL 4F3FB 4V2BA 2ID5A 2PUQT 3QQ4B 3G04B 5GHWH 3X11B 1VFAB 4IMLB 1H8OA 1P4BL 2VZOA 4KQ4H 4XBEH 3EFFA 2IWGA 1HZHL 2JIXB 3FQXA 4Y1AA 4FQ1L 2A0LD 3C8HA 1ZHNB 1KGCE 4PGCA 4TNWF 4RMRA 3ILPA 2QSCL 3MLZH 3C5ZC 2LAAA 3AAZB 4F33A 2YUXA 1A3RH 1TJHH 1MWAH 2XY1A 3FB7A 3CUPB 4TTDC 1WBZB 4PRPE 3D69A 5DEFA 3MACH 3C8DA 3Q5OA 4M1CD 4LRNL 4Y4KA 4Y19A 3K3QA 5T3XH 3MUGA 4HGMA 1JPFB 4S0SD 1QEWA 4Q6IC 3N85H 4P3DB 4K9EH 2CDGA 1HNGA 1FFOA 3V4UL 1NCAL 2GIYA 4O2CB 3RGVB 3MLXL 4X5WA 3RAJH 1Y0LB 2I5YH 2QKIA 5IW1A 1LDSA 1KXTB 5DRNB 4OCWH 1FFQA 5GGUA 5HI3C 3QQ4A 3G04A 3X11A 1VFAA 4ONFH 4IMLA 1IKNA 4PLNC 1JGDB 3MLYL 1JYWA 1ZHNA 5BMFL 4HCRH 3VA2C 5BS0B 2PXYC 5H37G 5J11C 3AAZA 3PE9A 5CP7B 5GGQL 5I18H 4NFCA 3H9ZA 4F9PC 1F58H 3CUPA 1WBZA 3VD7A 3MBEA 1D5XB 2VJXA 4JZOB 5IBLC 4JM2B 2CR3A 4HUVB 2X1OA 4I3SH 1JPFA 4XP5L 1T3FB 1F2QA 4PJDE 2YSSB 4P3DA 1T1WB 1QLRB 4O2CA 2RAMA 4O2EB 3ULVF 3AB0B 1Y0LA 4ZOAA 3QUXA 5FHAL 5A16B 4J3XA 5DRNA 4DVBB 3TBYA 2DI9A 3A6CH 2BNUA 5HYQA 2NXYD 1JGDA 3O6MH 1ZHKB 1KFAL 4HIXH 5C9JB 5GSVB 4WHTB 1UM6H 2J88H 5BS0A 2VC2L 4JQVA 4X4YB 4TUOB 1WWWX 5CP7A 5C1MB 2A9MH 3ARFB 3MR9B 2AJ3B 2IPUK 1Q38A 3JV6B 4XVSL 3CSGA 1D5XA 4JZOA 4JM2A 5LQBH 2ZP0T 4HUVA 1G7LB 1HHJB 1CIUA 4MVBC 1JGVL 1JRHL 1UB5B 3D3VD 1UACL 1T3FA 2YSSA 3NFPB 1PDKA 5I8EB 4O2EA 5HHVH 2IAMB 4HFUL 2BVUA 1MIEH 5DTFB 1UWXK 2P47B 5A16A 3FMGH 4DVBA 2K3TA 4Z8FL 4IIQC 2D03H 1QA9A 3NCCB 1ZHKA 3BEVB 3C60A 5CCKH 2Q8BL 4WHTA 4NKDA 4LIQE 5DUPH 3UBXB 2VO5A 4X4YA 4JKPL 2X41A 2AVGA 4PJAE 3LN9A 1YN7B 4OZGB 3QG7L 2JK5B 1AD9B 1S9WB 3MR9A 2AJ3A 4QNPF 1K5NB 3JV6A 4F7MB 4IRJC 4YC2C 2VTFA 4F58L 1G7LA 4KI5C 3NACH 5A2IH 5KSVB 4XPTL 5DVLA 1UB5A 1MCOL 5E4EB 4OI8A 4AH2A 3HFML 5F9OL 4JR9H 3NFPA 4HGKC 1NGPH 1CLOH 2ITCB 4PBXA 1TTFA 4IDJL 4RGMC 2IAMA 3AGVA 2VNCA 3KPLB 1FSKB 5MI0B 2BY2A 3AFLA 5T1LA 3WKMH 3BEVA 2RJMA 1NDGB 4N9OB 1ZHLB 2E9IA 2QTEA 3M17B 2MOVA 2AEWA 3UBXA 1LO5A 1E28B 4OZGA 3V0AC 5DJXB 4P46B 3HE7D 2JK5A 5L7XH 1AD9A 1S9WA 5CP3H 1QACA 1K5NA 3ZTNH 2UV3A 5BQ7B 2R0KL 1AQDA 1HN1A 4HKBB 2DQJH 5KSVA 1ES0A 4F7PB 5HYJB 3RQ3A 3D3VE 4DFHA 5D7SL 2ZNWA 2VLKB 3NPSB 4KKCD 3H7BB 4IOFD 2C1OA 3TPUB 1J1XH 2BSTA 4Y5VC 3UTZB 3KPLA 2AEIT 3LKNA 4HWBH 1EAPB 1U92B 1E4XI 2HLFC 1A2YB 5TE4H 2DQEH 2AQ3A 1NDGA 4H88L 3NN8A 4KRMB 1ZHLA 1ZVSB 1JPTL 3M17A 5A2JH 2UWEE 1T5XB 1YDPA 5FO7B 1G6VK 3P73B 1BVLB 4P46A 3BT2H 1UWGL 4FQCL 4OB5L 3KYOB 4BM7A 4NQXB 3OKDB 4QXTB 3H9SD 3SKUD 4HKBA 3BDYH 2RR3A 1BQLL 3SE3C 3QRFM 2VLKA 3GMLA 3H7BA 3SOBH 3RUGE 3TPUA 5MP6L 5FKPB 2DQFB 3CLEH 1JPGB 4NNPL 3VDBA 1EAPA 1Z9OA 4POZC 1U92A 5IHLB 5INCB 1A2YA 3TNMB 4D94A 2A9NH 3EDFA 4JN2B 4UAOC 1J1OL 5EUOA 3U46A 1ZVSA 2BNRB 2Y36H 3EO0B 4UOW0 2APBA 5GISL 5FO7A 3P73A 1BVLA 3C2AH 1R3KB 4ZTPH 1CXIA 3RL1B 1GGIL 1HHIA 3KYMB 2ZCLH 3KYOA 3QPQC 2IGFL 2XG4A 4NQXA 3OKDA 2X89D 3BUYB 4OGYH 4QXTA 3KS0H 4XMPH 3T0WA 3AREB 3QEHA 3LKRB 5E6IA 3NCMA 3BQUA 2BMKB 1XAUA 3HI1B 3OMZA 5FUZH 4PJGF 4I9WD 5TE6H 1BZ9A 2QJDA 2J8UB 4YBLC 2Z9TA 3RPIA 2DKSA 3T3ME 4LVEA 5FKPA 1DQDL 1S7XB 2DQFA 1JPGA 4MA3A 3KPTA 3RL2B 1CD1A 3JWDL 2HFGH 3O2DA 3NZHL 1SHMA 3R1GH 5INCA 3EYSL 2DQCH 3ZKQD 3TNMA 3LS5L 4CVZB 4U6XA 2W38A 2BNRA 3EO0A 4FFWC 4LP5A 2OR8A 4LGPB 3ZHLA 4HAGA 3KYMA 5K59F 2WANA 3BUYA 3H9SE 4L1DA 1DFBL 1CIDA 2G5BA 2R0ZL 3LKRA 1BZQK 3W0WD 3VWJB 2BMKA 1BD2B 1OTUC 3HI1A 5HHMD 5IT2L 3EOTL 1B2WH 3E2HC 3MCLL 3FQWB 5I1AB 1LQSR 1UH3A 1QBAA 4F9LC 1CDBA 2KPNA 1AE6L 4W81A 1DCLA 2AABH 4J4PA 4JN1H 3RL2A 2R29L 5FO8B 4MD5B 2DQDL 1FVCB 2BSSB 2JJWA 4Y16A 5TE7L 4CVZA 1MAMH 3GSVB 2WP3O 5EC1B 3REWB 4P2OD 4ODUA 2DD8H 3UROR 5IFAL 5FYJH 5K9JL 5K9KB 2XA8H 1IFHL 4KROD 2FJGB 4HMCA 1NBVH 4KK6D 2QQLH 3O6FD 5BRZD 1H3VA 1OHQA 2V6HA 1DANT 4CNIB 1T21B 1EEUA 1FCGA 1GGBL 2Y6SD 1OGAA 4JEGB 4HW6A 5C0CB 3U0PB 1JWSB 3ILQC 4QXUL 4JPIA 3TBWA 4EUPG 2OQJB 2FHBA 4LP4A 4Y0GA 2Y4SA 2D7NA 3SE8L 3WS3B 5SWZA 3FQWA 4ZMAT 1FFPB 5I1AA 3QIUB 4GMTL 5DUML 3G6JB 3QUMA 3CFKB 3MBXH 4PJ9B 5KOMC 1HH9B 2VXVL 4X7SL 1F3JA 2VQTA 4HQQL 4ZNEA 2BSSA 4P5TB 2B5IC 4BQBA 4WUUD 5F7EL 2P7TA 4S10A 5FYKH 2P49B 4IRSC 4LEOB 5K9KA 3S37H 4PGJA 1UKQA 1OSPH 3HI6H 5DK3A 3O45B 5F93C 4B7LA 1B4RA 2Y07L 3I85A 5AG8A 4Z7WA 3PL6B 4KKAC 4P23B 2GY5A 4CNIA 1T21A 5HGHA 4GQ9L 35C8H 5C0CA 4JG0H 2WV3A 3BOVA 1JWSA 4LARH 2VXTL 1CN4A 3W0WE 2OQJA 2XZZA 3OKOA 3VI4E 3NABL 5HHME 3WS3A 1FFPA 3SQOH 3HZKB 1WTLA 3HMWH 3UTTD 1KIRB 1FH5L 3CFKA 5F9AC 1WK0A 4GXVL 4PJ9A 1HH9A 4EBQL 5EU3A 2XRAH 4IJ3C 4K71B 1UXSA 3VFRB 1CD9B 4JFFD 1S7UB 5SV4A 1KLUA 1IC4H 1VDGA 3QCTH 1UCBL 1NGWB 4H20L 2J12B 3L95A 3OR7B 5DJAB 3O45A 2W0FA 3BEWA 4GXUM 3TGXA 2DLHA 5BZDB 4G5ZL 4MCYB 3PJSB 3W5MA 4P23A 3FHAA 4MWFB 2WWMD 1FN4A 3P77B 4K2UL 1BFVL 3QQ9C 2LTQC 1CWVA 4PBWD 4ZD3L 3I2CL 1IAIH 3QEGL 4ZOCA 1DLHB 2AK4B 2VUOA 3UXFA 5J06A 2CRMA 3BWAA 3ULUL 1FZMB 3F6IA 2GSIB 3HZKA 2HKFH 4CVUA 3DRTB 3LQAL 1FGVL 1S9YB 4FTVB 2VDRH 1PVHA 3PGDB 3VFRA 3V7MA 3OBAA 1WISA 2DTMH 4CRPA 1RIVH 4WUUE 1IC7H 1S7UA 2CD0A 5D1QD 3QNXA 4H8WL 1GAFL 2I60H 4Y8DC 1C16B 2RGSA 1HQ4B 1RZJL 3ULSB 4MCYA 3PJSA 5ADOL 4JB9H 1HSBB 4MWFA 2MKWA 3P77A 3FOMB 1IGTA 1MPAH 1DLHA 2AK4A 3LVEA 3NPZB 4ZOEA 3WFBH 5I1JH 3QT2A 1XH3B 1FZMA 1UXWA 2GSIA 3C2SA 3UTTE 2B4CH 4WGVB 1DJSA 4G8FB 3DRTA 1YZZA 3T2OA 1S9YA 4FTVA 1QFUL 4PJAB 3ZDZE 3NIDE 2IQAB 3MRCA 5I1CL 2VSDA 3HMXL 3PGDA 3DROB 1JPSH 4CVWA 5MENB 4TVPH 4JFFE 2WIMA 3ZSTA 3OF6A 3T8XB 3E6FB 3STBA 4H1LB 3IYLW 1WT5A 4JHWL 4JCLA 1C16A 2PCPB 1HQ4A 2BSRB 3PGFL 2H45A 3ULSA 1G9EA 3LSOB 1HSBA 5D1XD 2ZG3A 3FOMA 1HH6B 5F9WC 4LSTL 5CEZE 4S1SH 3G5ZB 2NXYC 4GRWE 4UB0H 2EH8L 3TC9A 5EU6D 1J9CT 4B5EA 3VWKD 1UM5L 3BKML 4M7JL 3J7HA 4G8FA 3LS4H 3RZCC 1LE5A 4PJAA 1URLA 2IQAA 3IFNH 2R1XB 3DROA 3LRHA 5HD8D 5MENA 2DICA 4I3GA 1WITA 3E6FA 5A43C 4H1LA 5EBGA 3ARRA 1MUJB 3D3VB 1P4LB 2PCPA 2BSRA 1IQDB 2COQA 4EJ1C 5GQBA 4XWOC 1GHFL 1HH6A 32C2A 5I0ZA 1PKQE 4XGZB 3KJ6H 2ZCKH 3IDYC 4WWKC 4OF6A 1XGYL 4LF3A 4ZAKC 5LXGL 3RA7L 4QLRA 5ESVB 3V6FB 2ITDB 3VGGA 3EJYC 4LSRL 3TVMD 4ELMF 3FO9B 4PJBE 3S4SB 5HHXH 3DXAD 4J3UA 1UEYA 3OXRB 4MAYC 2B39A 1TZIA 5IKCB 5FCUL 2W9LA 4FQ2H 4XWGH 2BFVL 3WSQL 2DLFL 3D3VA 3O3BA 2R0WL 1P4LA 1IQDA 5I6XB 1INDL 3NVQA 1IAKB 2HWZL 4XGZA 3U9PH 2ZSWB 4ZUVB 4ZNCD 4WEBL 3W2DL 2R15A 2OTWB 2VKXA 4PLOB 5EU6E 3V95A 1N2RB 1IILE 5ESVA 2XZQL 4PJHE 5CJ8A 1XIWB 5JA9A 2ITDA 1MNUH 3M8OH 4EN3B 1RUQH 3FO9A 2HT3C 5D5MF 2NY6C 4PJFF 3S4SA 2OBGA 3RI5F 3OXRA 2PO6D 1CD0A 4NQDB 4YIQA 1TPXB 2VZSA 5IKCA 3NTCH 1YMHB 1ZS8B 4TUKH 1N5AB 1PG7W 2FCBA 3L3KB 3RWCB 3RUGA 5EZJA 3LKOB 1IAKA 4FABH 1P69B 2OCFD 4ZTOH 5B38B 1GC1L 4GAGH 5GGRB 4ZUVA 1AGEA 3O3EB 3UJTH 1H15A 4LSDA 1NEZB 1N2RA 1KELL 5DMYA 1TNNA 5E94B 1ADQH 1XIWA 4OSUL 2PTUA 2HAZA 2H1PH 4FQQB 1SJVA 3LEYL 5I1GL 1AXSB 3DXAE 2CMRH 2X09A 4WW2C 4S1QL 4L29A 3FONB 1NCNA 3OKEA 4KJYB 4WU7B 1UM4H 1N6QH 3D5OF 1ZLVH 1YMHA 1A5FL 1F2XK 1ZS8A 3SN6N 2IG2H 3TPKA 1F3DJ 2JJVA 2WUCL 3EKCA 2A6JB 1OM3L 4YXHH 3L3KA 2OX5A 1DLFH 1N7MH 3RWCA 1DBAL 5IB1B 3QHZH 5SWQB 1PY4A 3O0RH 4LHUD 5B38A 3PIQA 3DUHA 3IS1X 3O6KL 4OLUL 4ZDHB 3T0ED 5GGRA 3O3EA 5SWSD 3D18B 1EGJH 4YAQA 4NKQB 4OQTH 5E94A 5J3HD 5IM7A 3C08L 5TF1L 2CGRL 3LDBB 3ARXA 2PYEB 4XT1C 1AXSA 5J6HB 3IU3B 1T1YB 1OAYH 2OL3L 5I66B 1JFQH 1WEJH 4Z76B 4KJYA 3NFSL 4P49A 1XGUB 1QFPA 1AJ7H 4MHHG 4NIKB 4KUCF 5C07B 2OI9B 2UZXB 3SCMD 5IB1A 1L6XA 5SWQA 1VESA 4LVOB 3MLTA 1JV5A 1QOKA 6FABL 4U1GC 4X8JB 2Q8AL 4ZDHA 2MQCA 1OAZH 3X13A 2XN9D 3B5HA 3UX9B 43CAB 5T1KD 1YEJL 1W72L 2ESVD 4F2MB 3L6FB 3D2UB 3L3OA 4M9PA 4KJQD 3QUZB 1IAOB 2GJ6B 1X5ZA 2PYEA 3O9WC 4UDUB 1R3JB 3RVWD 3V0WH 1A6ZA 4HKXA 1KCKA 1S7RA 1LEGB 5LBSH 1SJEA 1G6RL 1I9IH 3JWOH 3MA9L 4FZ8L 2VDNH 4G6KL 4HWEL 2VDKL 3MC0A 1EO5A 1T7WA 3MFGB 2ILLA 3X3GH 4QEGA 5JA8B 2JJSA 5I1HH 4M43L 1FYHB 4X7DC 3ZKND 1RZ7H 4N5ED 3T0EE 3VFNA 4PJEF 1CFNB 3QIBC 5SWSE 3CFDA 3GIVB 1NMCC 1FFNA 43CAA 4XNXL 5ITBH 3ZDXE 3WIIL 4I4WA 3K1KC 3L6FA 3EGSB 4NM8L 4P2OC 3SE4C 5DSCB 4M6OH 3PV6B 1DN2A 3D2UA 3F58H 3QUZA 1IAOA 2C3VB 2EIZA 3KLDA 5C9KA 4JFQB 3MRKB 4U1NB 4UDUA 4KKBD 2YA1A 4XPGH 5BRZB 1OARL 4J2XA 3UJJL 1MRDL 5AAWA 4EDWH 3A6BL 1B6DA 4PJXE 4D0CB 1LEGA 2X4PA 4KHTL 1I3GL 3RVVD 5C0ND 1Q9KB 3CXHK 3A67L 3X12B 3W0WA 2F53B 2OXHA 1P9MC 3CVHA 4N0FA 1ZT4A 4X9FA 1NKOA 2BDNL 3CDCA 2JE8A 4JG1H 3CU1A 1QVOB 2AEPL 3ZE2E 1R0AH 1EVUA 3THMH 1FE8L 2CK0H 2ESVE 3VRLE 4A2MA 4G42B 3U4BL 1WAAF 4Z95L 2EE9A 3PV6A 5JXED 3S5LG 3SBWC 2XG5A 3H3BC 4N0UE 3CX2A 2HJLB 5BRZA 1HWHB 2WUBH 4MB5A 4X9IA 1YYML 4D0CA 4Q6YA 1YY9D 5K93A 3I02B 3I6KB 1Q9KA 2P1YA 4HF5H 3X12A 3NCYS 1OSZB 1PG7X 3H9HB 1FZOB 2UUDK 2BVPB 1KTDA 2HH0L 4GRLB 1E4WL 3UC0H 3PWPB 4XP1H 1A3LH 1T0MA 4OZFG 4HT1L 1YEIL 5DR5H 5T5FL 2Z8VC 3U82B 1F6AB 1QVOA 2DAVA 1NMBL 3RX8A 4X7FC 1A14L 3D25B 4ODVL 4BZ1H 4KAQH 4MA8H 1U8PB 1EHLL 4RGOL 1FYTD 4PGEB 1E4JA 2HJLA 1JNLH 4WI9A 4QHLB 2EYRB 2F58L 2IC2A 5JDSB 3I6KA 3QDJB 1KCRH 5KJRH 1UJ3C 3MV8D 1UC6A 3H9HA 3HZMB 1FZOA 1KJ2L 4GRLA 2A77L 4MNGB 4ORZC 3PWPA 1HOCB 5DJ8B 3W5NA 2XWJB 4FZEL 4NCC1 4KDTA 4QTIH 5EU5B 1T03L 1O7VA 4CVXB 4XCYA 3MFFA 4LCCB 1F6AA 5C0BB 4AMKL 1JHLH 5IUSA 5JOFB 4DGYL 3PQYB 4YHIB 1L7IH 5DHVH 3SKMB 4RMSA 1T0PB 4JFFA 3D25A 2A38A 4ONOA 1RMFL 1UA6H 3DHJA 1U8PA 2O93L 3CXHJ 5B39B 1ZTXL 2X7LA 1FJ1B 4XZUB 4PGEA 1A02N 1HIML 4PJ7B 5I8OL 4JY5L 2KQMA 4QHLA 2EYRA 1U36A 2OLDA 5JDSA 4XNZB 5ISZB 3QDJA 1GRWA 2VOTA 2VLMD