5KVEL

Zika specific antibody, zv-48, bound to zika envelope diii
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
115
structure length
115
Chain Sequence
MDIVMSQSPSSLAVSVGEKITMSCKSSQSLLYSNNEKNYLAWYQQKPGQSPKLLIYWASARDSGVPDRFTGSGSGTDFTLTISSVKAEDLAVFYCQQYYSYPYTFGGGTKLEIKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein/immune system
molecule keywords ZIKA Envelope DIII
publication title Structural Basis of Zika Virus-Specific Antibody Protection.
pubmed doi rcsb
source organism Zika virus
total genus 28
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2016-07-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5kveL00
1AQDB 4OZFH 4JFZL 1QRNA 3VG0H 5E99L 4HC1A 4F7MA 4EBQL 3CVHH 4K8RC 3D2UB 3NTCL 1IEAB 2HVKB 3W0WA 5CZXD 5C8JB 3HE6D 3L6FA 4L4VA 4KKNA 1H15B 2X89A 4JFEB 4Y4KB 4K3GA 4APQA 1WGOA 1IGIH 4ODXA 5GGRB 5IW6A 1T03H 1AHWC 4CMHC 1FZMB 4OZHA 3NFPB 4NOBA 3GSNB 1K6QL 1RZJC 3IDMA 3VXTA 5HI3D 4GAGL 5IHBA 1DLHA 2C7UB 3MLUH 5KOMC 3OAUL 1DQJB 2FGWH 1II4E 1WZ1L 3BH9B 4PJIF 4D0BB 1D5XA 1T5WB 1U3ZA 2DQHH 3KPNA 1F3DJ 3CU1A 5GGUA 3P11H 2QR0A 3C60C 4PJIB 1DANT 5T1LA 4Y16D 1JWUA 4KV5E 2BK8A 2WWKT 4LMQI 4OCXL 3KPSB 5HD8D 3ELAT 3I9GH 4LNRB 4DGVL 2P8MA 4LRIA 1NC2B 4DEPB 4BZYA 3MSPA 1T0NB 3TT3L 4I3RL 3SDAC 1FVDB 4L9DA 2AEIT 3MFFB 2RAMA 1GYAA 2NY0C 4EOWL 4J6RL 1BBDL 4JCLA 2CSPA 2K9UA 1NBYB 5FYKU 5I1DB 5I1AB 4DGIH 3GHEL 3GRWA 5GHWL 3PWUA 4UOJA 1JN6B 3O0RH 4JDZA 4NUGL 1X5GA 2VDQL 1TIUA 3V79C 4MXQD 3TYGH 3Q5OA 1IM9B 5ESVA 1ZTXH 1IAMA 1U8MB 2FYYA 2JCCA 2XNAB 1CVSC 1AXSA 4HS8L 4XP1H 2WZPD 1B2WH 2J88L 1QHOA 1A5FL 4PTTA 3F7RA 5C92A 4JAMA 2VDKL 1YN7A 2PW2A 2BJMH 2G5RA 4ODTL 3QNZB 3V7AG 5DUPL 4QTHA 4R2GB 1DJSA 1RZ7H 4H0IA 3NIGE 4NKIL 3SQOL 1Z6JT 4X98B 3TWCL 1X5LA 4H0HB 3CDYA 1OTTD 3QUZB 2ADIA 5E8DH 1ONQB 1S78D 3OKKA 3VFSB 1LEIB 1A3QA 2K7PA 3S5LA 1U0QA 3FT3A 4AJ0A 4ZTPH 1INEH 5JHLH 2X1PA 3L5JA 4AIZA 3IDXL 4JKKA 5CGYC 5I1IL 2CUHA 3WFEL 2CUIA 4Y5YA 4HBCH 3TLRA 5MEQA 4PJCA 3VXRE 4JY4B 4KJYA 2ZUUA 2MOVA 1FPTL 1KIUA 4UINL 2CKBH 5C0AB 1UM4L 3UJTL 1DQMH 1CF8H 4XVSL 2GHWB 2J7LA 4JGMA 5BRZE 3JWDC 4M7ZB 5JA9A 2B4CH 2IANA 3C5ZD 3MJ6A 4PGBA 1A02N 4HJJL 3RNQB 1GCFA 4ZUSA 4Z7UB 1I7ZA 2KZWA 4M62L 3S96A 1KPRB 3FQNA 3S4SG 4UU9B 5DVKA 1NSNH 3CFCH 4N8CL 4GXUM 2CMRH 4PP2B 4XP9H 3I50L 3WS6A 3KPRB 2VXTH 3PV7A 1G0XA 5I74B 2R2HA 1AGFB 4PLOB 4KKBD 3RDTD 4WEUD 4KZEL 4I0KA 2UWEF 2VSDA 1OAXL 4WTXA 3VXMA 3VFRA 3UO1H 3L3IB 1MCPH 1I9IH 1CLZL 2UWEB 5BJTA 2IGFL 1LP9B 1ZHKB 3NCCB 3QDGA 4LLQA 4LLDA 4NO5B 3TBSA 4IIQC 4HCRH 1JK8B 1DEEB 3RPIA 4DUWA 1FN4B 4HIHB 3RWCA 3VI4F 4PYGA 4P57B 2OJZH 5JIKA 4C56B 1QG3A 1SYSA 1JP5A 1XGQA 2PR4L 4NQCB 5E56A 2G60L 3HZMB 5E1AB 2X7LB 4HKZA 4OV6F 4EJ1C 3QH3A 5D2NA 1IAKA 2V7NA 3ZYZA 4M5YL 4P2OC 4BH7A 2ED8A 1K2DA 1T1YA 2DWDB 2D7MA 4K71B 5KSVA 3WLBA 3WD5L 3UTTE 2D03L 2YMXL 4U6XB 4X7CC 4ZFOL 3IJSB 4LFHD 4ODVL 1UH2A 3PDOB 1A1NB 5F8RC 4JPIB 5EPMB 5SWSA 1KYOK 1P7QB 3QG6B 4TVPE 1KT2A 1J1XL 1E27B 3KR3L 4X7TA 1FYTE 2XWBB 5AZ2L 2FLBT 2W9LA 3FB7B 3GSNH 1MIEL 2VLJB 1EGJH 3T4AA 4UTAH 1KPUB 1G9NL 1Q0YH 3MJGX 1ZMYA 2EE9A 4XP5L 3T0VA 4FQXA 2VH5H 2YUXA 2AABL 3WIFB 3W5MA 5HBBA 4Q58C 4Z7NF 2Y36H 1KEGH 4EZMA 3LZFL 5JMOC 2WIMA 5CKGA 1DLFL 5F6HJ 3HPJB 4UOW1 1LO5B 1QNZH 2N1KA 3MRPB 1MHEB 1G1YA 3WFHA 1N7ML 1KTKE 5J8OA 3UTSD 5D7SH 4V2BA 1JCKA 4O5LL 1VGKB 5IBTL 5I18L 8FABA 1W0VB 5IFHL 4XT1C 3FO9B 1A3RH 3FB8B 3D25A 4PBVC 3W11D 3ZE0F 2NTFB 3RRQA 2DL2A 1KG0B 1N5AA 3OPZL 4IRJA 4G6KL 4PJAE 4M7JL 1TVDA 4HUVA 1I85A 3W5NA 1UCBL 3VGEA 3PQYA 2P5WD 5DC4B 4OD2A 4MAYD 4NN5B 4U7SA 4NBZB 2P8LA 3V52H 2EYSA 5FCUH 1MREH 3I6LE 5BVJA 5CJXA 1ZOXA 1I1RA 2FL5A 3K3QA 5F89A 5T5FL 5C07A 1CD0A 3OGCA 2EEBA 3BGAA 3P73B 3ARVA 3UEZA 1E4XL 2B2XH 5J89A 1A2YB 1EEUA 2F53E 2XKNA 2DI7A 2R29L 2YA2A 1S5HB 4ONGL 4P5TD 2PTTA 5D7JD 1JWSA 4BZ2L 2D0HA 4PJEA 3WNKA 4NQEE 3SKNA 2HFEB 5I0DA 4JRXA 5MHSE 1DQQA 1RVFH 1T1WA 1YEDA 2CR3A 1D5IL 3OKNB 3KJ4B 4LIQE 1OAKH 3WL9B 3WLWD 2JIXD 2Z8WC 1JZ4A 3R06B 7FABL 4OJFL 4TRPH 5LBSH 3HUJF 3EYQD 5E4EB 4TPRL 1UA6L 1U36A 1B0GB 3F6IA 3BIBX 3FB5A 4B5EA 3EYUH 3HUJB 3SJVB 3D18A 1DL7L 4Y2DD 4U1MA 4KRNA 3L3JB 3TZVA 1LDPL 4G8EA 4R4FH 1JGUH 1GOFA 3UYRL 1U58B 1CLCA 3ABZA 1IL1B 3TH4T 4EI5D 4LLVB 1U8IB 2DBLL 4MNGB 3QQ3B 4LP4A 2AXGB 5FK9B 2LU3A 3WNLA 4F8QA 1NMAH 3D39A 3ETBF 4V1DE 1ZT1B 1H3WM 2VR4A 3SDYH 1A6VH 3HNTL 4QRTB 3U4AA 1R5IB 3MRNB 2A6DB 4FTVE 1TTUA 3U4BL 1YEKL 1IC1A 4P9HH 2VDOL 1PG7H 1Q0XH 2O5ZH 2NNAB 1I8KB 4X7SH 1AXIB 3W39A 4NSKA 1VGEL 1BLNA 1KTDA 2R23B 1RK1A 3IDUA 3PHOB 4K3DL 3O4LB 2DLIA 3L7FA 4HAGA 4Y1AE 4ZSOB 4N0YH 2GUOA 4F9PC 2HP4A 2R2EB 3UXFA 2FATL 1QFUH 4Y5VB 2APTA 4U4BA 3QEUA 1CU4H 4U1IA 2BOCA 3MNWA 4M1GH 2ZUWA 2J4WH 1BJ1J 1H3GA 3T1FB 5DK2A 3OHXA 3QIUC 1IGJA 5K59E 1W0YT 4H26A 1TCMA 3EZJB 5B21A 1YY9C 1Y0LA 4WV1C 1PG7X 3V2AR 3SGEI 2Z31B 2CRMA 4NM8L 3IXTB 1EZVY 2W91A 2YC1A 1B6DA 1NCUA 4WTZG 4I0PA 2AEPL 1QTYT 2NY6B 3E2HB 3OL2A 2V2XA 3X3GL 3U4EB 2Z93B 2GCYB 1CICB 3KGRA 3GHBL 3RUGF 3UDWC 4G42B 4QXUL 1IGFL 5IV2A 4PY8I 3C8KB 2X4NA 3H3PL 5C6WH 2D7NA 3RUGB 3ZDZF 5EA0H 4TN9A 2FEEL 5E8OB 3MUZ1 4LVEA 5TPWH 3TBWA 3NMEA 3FOMA 2J8UE 1OPGL 4HS6B 2UY7A 4PRHB 2V17H 2IQAA 4XBPB 5D1XB 1A7RL 1NCCH 3Q6FB 1J88A 4FMKA 2VLRA 4NT6B 1J1OH 2XYCA 2J2ZA 2OR9H 4ZD3L 2DQDL 4X99A 1S7UB 4F3FA 4FQIH 1C5DA 3NIDF 3IKKA 3U9PL 2AGJH 5IWLC 1KYOJ 2VQ1A 4RFNB 3QUYC 2AEQL 3ARFC 4Z95L 3T0ED 2AI0L 3CZFA 4JM2F 2E6PA 1F4XL 2MCPL 1YN6B 4KJWC 4RIRB 1CFTB 3FQXB 5IK3A 1T7XA 2R56L 2MHAA 4JM2B 2ENYA 3GRWL 1RHHA 3ECBB 1H8SA 5LAXA 4OAWB 3NCFB 1NDMB 1S9XB 4DTGL 3RZCC 3MRCB 5MENB 4WHTA 3E3QE 1NJ9B 4CDHA 2P5ED 3B2VL 4IOIA 3I6KB 2OXGA 4PJXF 4CAGA 1Q1JH 5IVZB 1WWBX 3I02B 1FNSH 1IEHA 4PJXB 3GSQA 4JQIH 1XF5B 3OAZK 3QHZL 1B4RA 3P40A 3TPKA 4NQVA 3PGDA 2ARWA 1BQLL 4RAUB 3DROB 5F93C 4GLRI 5KVFL 3SCMC 3WBDA 5D2LF 2APVA 1MAJA 3N1QC 5EORL 3JWNC 4HJGA 5D2LB 5DRWA 1JGEA 5MI0B 1DE4B 1NMBL 5DWUH 1MWAB 2R15A 4YDJB 5GPRA 2NCMA 4FP8H 1KGCD 4UUJA 1KCSH 2DYPD 4NBXB 2ITCA 5TE6L 1HKFA 1OGAD 2AV1A 4LSVL 3EYOB 2I9TB 5IHZA 1LK3L 2AJYL 2CIIB 3RWEB 2YHGA 3O81A 1A7PL 3NACH 4HJ0D 4KK8D 5LGJA 4KMQA 1S7WB 2UYLA 4DKAA 1FP5A 2EKSB 3BYYA 3ULUF 2YD6A 2EC9T 3LH2H 2DQUL 4YE4H 2CK2A 4BFIB 5JPNA 1DFBH 4O2FA 5DK0A 3VXNB 3L3DA 3QIWB 3UAJD 1T04A 4GS7C 1LWRA 5D6DC 4KJQC 1ZK9A 5FUCC 1UM6L 2R2BB 1MFBL 3WO4C 4XPGH 4U1KA 2AJSL 4UQ3A 4XNXL 5KS9F 3CUPA 5C0IA 5EU6D 2HLFC 4S2SA 5DUMH 4KKCC 1Z5LB 5KS9B 1MHHB 1MH5A 4YHZL 1T5XB 1JUFA 1UWXH 2NQCA 3Q1SH 4YBLC 4NZDA 1CDJA 1HSAB 2QKIB 1I8IA 4JDTH 1E6JH 2XFXB 1NBVL 3INUH 3MV8B 5IESH 1VFMA 2XPGB 4XCFL 5L2JB 4Z18A 5GIRA 1D9KB 4R4NC 5I8EB 2YWZA 3I2CL 2B1AL 1ZHLB 5KN5B 4XH2B 2IF7A 2R0KH 1NFDF 4W6WB 1I7UB 4ISVB 1CDBA 4ODUA 4U1GB 1X7QA 4U1LB 4YQXH 4DKFL 1NFDB 5D72L 1JPTH 3MJ7B 4M5ZL 4AMKL 2N56A 3EJZD 3B2UD 4NQDD 1NUFA 3MROA 4YGAB 1VKXA 1AC0A 1ITCA 1DSFH 1WAAE 1RUQL 2PKDA 4L4VD 2ADJA 4XCEB 2OL3A 1FL3B 4L4TE 3O2DA 1JF1B 1BEYL 4ZAKB 2BOBB 2DLFH 4APQD 5GGTH 1X5IA 4O58H 1OP5H 5B39A 3RL2A 2NYYC 5GZND 1WC7A 1WBXB 3SKMA 3AMLA 3QUXC 5DZNA 3VRIA 3JTTA 1J0IA 1RJYA 2X4TB 5F7YC 3TBTA 4JFOB 2A6KB 5E8NB 4NO2A 3VE0A 3ARDA 4PLJC 5IG7B 4D94A 2YSSB 3LPWA 1VFAB 2VLKA 1PW3A 4OF6A 3AS1A 3SDXF 5IIEA 5ACZA 5IB2A 5GS3A 5GS2H 1IEBA 5T1LD 3MRLB 4O2EA 2UZYB 1YJDC 3SDXB 3IDYC 3D0LA 3HLAA 4MCYA 3GSUA 3AY4A 3SE8H 5JW4R 2X1XR 1WBYA 2DQFA 3RWJA 4XRCA 1J8HA 1YPZF 1R3IH 3HMXA 3IXAA 1P6FA 5J1AB 4WU5B 3X13A 3ARBB 1YPZB 1T2QH 2VXSH 3DRTA 2IH3B 5DHYA 3MLUL 5F21B 1DN2A 2FGWL 2X6MA 1H3TA 4KAQH 2XZAH 2IMNA 3QSKB 4QY8B 1D7FA 1HQ4A 4Z7VA 4YR6B 5L2KB 5BXFB 4KI5D 4F7CA 2FSEB 3HNSH 4FFWC 1SEQH 4AENB 4P3CH 4OZGE 3U1SH 3C60B 3GSVA 1BIHA 3ZLQC 4X4MA 2QL1A 3U7YH 1N4XH 5JQ6H 3LQAH 2CLZA 3VXPA 3U0WH 4KRPD 5EC2A 4W68A 4KQ4H 4Q74A 5IGXL 5JNYB 5E7BA 4HS3A 2Y7QB 1EUTA 4Y88A 3SDAB 4RNRB 4QXGH 3UTPD 1OGTB 1HWGB 2FHCA 4DGIL 4QXTA 3OF6A 1NCBH 2HLFD 3AXLA 2AKRB 4XGZB 3G9AB 3O0RL 1MRDL 1CXIA 4MDIB 5DD5L 3DBXA 1WQVT 2GI7A 3RKDC 3TYGL 5DRZA 1WZLA 1ZTXL 1ULVA 3QJHB 3PIQB 2OQJB 3LKOB 3QJFB 4XP1L 5K9QI 1T22A 2A1WH 4RMWA 4M6MH 4R96A 5FO9B 3LEVL 1MWAH 1ND0B 3BUTA 4R4ND 3QDHA 2Q76B 1EXUA 1R3JB 2YN5A 4JO2H 5DUBB 5F8QC 3RNKA 5HDQL 1J0KA 1G0DA 1RZ7L 4TQEH 3WJLA 1GGCH 1FNFA 3HMWH 4WW2F 1Y6NR 2WLZA 2X4PB 1TPXC 2P49B 2L7JA 4W4OA 2M8XA 4S1QH 3DGCR 1A6ZB 4WW2B 2IAND 2I60L 4WU7A 1CFQB 3UROR 2WWMD 4AG4H 3L1OH 1A4JB 1ZA3B 4MQTB 4ZTPL 2DTSA 4XI5C 3DXAB 4HF5L 5JA8B 1SBSH 3BRDA 2BVOB 4UAOC 4ZFZA 3QYCA 4MD4A 3ULUH 2LTQB 4YAQB 2B39A 1YY8A 1FDLL 5DRNB 2E5EA 4F7TB 2X5PA 5CWSB 2CKBL 2F19H 2G9HB 5L8JB 3VG9C 2NYYD 2AW2A 4U2YA 3Q5YA 1DQML 3KWWA 4HEPG 4JB9H 3VJ6A 3QDGD 3ZTNH 4JFQA 4LARH 3MV9A 5AYUH 4ESKA 2B4CL 4J4PC 4JY6B 1MNUH 4HUNB 4N8VA 2PYFA 5CEZH 2HMIC 4IJ3C 4RISH 3KHOA 3LEYH 5HI5C 5TFSL 5FGBA 2GJJA 3OTTA 1NSNL 4OLXH 4JFDB 5DTFB 1S7TB 4JZOA 3GIVB 4P59H 2VXTL 1QKZH 4K9EH 2OTWB 1EVUA 4Z0XB 1EHAA 3TN0B 3EO0B 3QPXH 4DOHB 1RUMH 5EIIA 4IEFB 4YC2C 2VQUA 3D85A 1ADQA 4FS0A 4O4YH 5I15L 1YNLL 4EUPB 3MV7D 3FCTA 4X5XB 1MF2H 5C0CD 4H88H 2XICA 4AH2A 1RIVH 2L0DA 2DQGL 1CFSB 5LQBL 2ESVA 4IIQB 3MJ9A 4HT1L 2OJZL 4NIKB 5FOBA 2L4OA 1FG2A 5DO2C 2XRAH 2F8VA 3V6FB 5E6ZA 1MUJA 3QT2A 4ZXBC 4LMQE 2QBWA 1S7VA 3BJ91 3HAEA 4PRNB 2XZQH 5JR1H 2W92A 1JWMA 4XXCA 1M71A 2D31B 3BW9B 3MACH 3PG2A 4IRSD 4JG1H 5GJTH 2CRYA 4P2OB 3VFMB 4OGYH 3MOAH 4OV5B 5HHVH 5IB1A 2XWTA 4JCMA 4U6VH 3WHE1 1CXEA 3CSGA 1ED3A 4CDGC 2C4FU 4PLKC 3RWIB 4G8FA 4PJDE 4K8RH 4ZS7H 5GS0H 3T0EE 4HIXH 3O3BB 2BHUA 1MJJB 3P9MB 4MLIA 1FVEB 1RJLA 3P9LA 5SWZA 3RY4A 3SGDI 3RP1A 2XZCH 5IUSA 3MRJB 2GSGA 3GSNL 4CVXA 4KUCF 3UTZA 4PJBE 1P5UA 3EOAB 4P23C 4UTAL 2JE8A 1RZJH 2OX5A 4J8RB 1YA5A 4LCIH 1RZFH 2Y23A 5J11B 5ICZB 3BXNB 1FV1A 2VH5L 2P5EE 5EIQA 1OTUD 1DBAH 5IQ7L 1NL0L 2M1KA 3KG5A 3QFDA 5GGRY 4KDTC 1OTSC 1WTGT 2Y36L 1ORQA 3VXUB 4F58L 3DYPA 3EJYD 3MOBL 1DDHA 2Z91B 2AK4A 1I8LC 4ELMA 5FB8A 3QRFM 2VL5A 4P5KB 2C3VB 1N6QL 3OSKA 5D7SL 3T0AA 1UXSB 2HVJA 1WWWX 3P0YL 4KC3B 1L6ZA 4UNTA 3IU3A 4KDVA 4JRYA 1ACZA 1A3RL 1Q94A 3KPMB 1DBBL 3FQUA 5DQJA 4Z7WE 4FG6C 4QHUB 1T83A 5DJ8A 1M1SA 1A7OL 2BSSA 1FIGH 2I26N 1SY6A 2VDRH 1C8PA 5FYJH 1RK0A 1KGCE 5HHMB 3ES6A 3LEXB 3PWPB 2HKHH 4KKAD 2DQJH 1E28A 1OGAE 2P46B 3WS3B 5CJBA 3CLEH 1KF9B 1BD2B 1DVFB 1ZS8B 4QT5A 4X6CA 1HHJB 3QEHA 1BVKB 1GGIH 4LK4A 4CW1A 3TZVD 1I1YB 2B2XL 3PWLA 4UDTA 3CDCA 1MCSA 1OD9A 3PP4H 2EIZB 3VCLA 3E3QC 2YPLA 3BJLA 3TVMC 1V7NH 5DFVC 1EO8L 1RZ8A 1IAII 3QQ4A 4OGZA 1OAKL 3OB0H 3SKOB 3V5DB 2CDFA 2BFVL 1X44A 4TRPL 4X9GA 3BH8A 4HIJB 5EU6E 3H0TB 35C8H 3BRGC 1AO7A 2DJUA 3DUUA 5E9DB 5ECJE 5FM4A 5D1QC 1CE1H 1HEZB 1V3LA 2Y1VA 5FUZH 4N0FB 5HYJB 1TZIB 1INQB 4RQQA 1JGUL 4HH9A 1QSEA 2DWEA 2IAMB 3O9WA 5ADOH 3REVB 3VFTA 4P4KD 3VFPB 3BGMB 3UBXA 2X1OA 1NMAL 5E00A 1NGXA 4KTYA 3L3GA 3U6RB 2H26B 4DAGL 3X3FH 1KXQE 1QYGH 2BMKB 1A6VL 3QDMD 4MXVE 4YIQA 4DN4L 2FIKB 4OM0H 4XCNB 5EUKA 1WWCA 1OSPH 3SDDC 4YXHL 1A4KA 1A1OB 4PLKD 4WCYL 3ZMRA 4DCQB 3HR5B 4G9FB 3O3EA 4BFGA 3MUJA 4IS6A 4NC1C 4NQDE 1PG7L 5JDSB 3KPOA 1QFWI 1Q0XL 4DZ8B 1AI1H 1YDPA 1JNHB 3BDYH 1IQWL 1HHHB 4OLYH 4L4VE 4X7SL 5FYKH 4EUPH 5C6TH 2ADFL 3MMEB 1IGCH 1Q9KA 1WT5A 4FABH 4XXDB 3JBG7 3B6SB 4LFHG 2VE6A 1W2KT 5T1KA 3ULVD 4OZHE 1QFUL 5F6IC 1ZLWH 4HV8A 4X6DE 3U79A 2J4WL 4RAVA 4Z78A 4HUKB 2OK0H 1G9MC 2VL4A 4H1LG 3H9SD 3KHQA 4OZ4B 3VW3H 5CJOH 4HUMB 4GRLA 3T09A 5FKPB 4ZUVB 4LDLB 1BWMA 1F6AA 3NCMA 1XR8A 3L9RA 4X4XB 1P4LA 2BNUA 2ARJA 1F2XK 3H9HA 1QP1A 5F1OB 3W2DH 4QWWC 4B53A 3JV4B 5DF0A 2ZUVA 5J13B 4WNQB 1PKOA 1RZKH 3HMXL 1EK3A 2VR9A 3C5JB 5GSVA 2IG2H 5ALBL 2APWA 2HWZH 3WMSA 2IPUG 4HKJA 2OI9C 1N0XH 3VH8G 4Y89A 3MNZA 3GB7A 4WO4D 1AR1D 1JTOA 4KI5E 4HFUL 2VB5A 3PABB 4DN3H 3IDGB 4YDLC 1NUDA 3LKNA 1U3HA 1NCCL 2W9EH 5JXEC 2NY3C 1QLFA 3B3IB 1IE5A 3QXVA 1ZEAL 1K4CA 4MQSB 3OR7A 4K3HA 5EZLA 4HKBA 4M8QB 3WN5C 4OFKA 3LB6C 4LOUD 4F7EA 5J6HA 1HINL 4LGPB 4LLYB 4GBXC 4ELKB 2R4SL 3A6BH 5TF1L 3HE7A 3BP5B 4BSVB 4B7IA 2AGJL 4G8GA 4S0SD 5ANMA 4G6MH 1G7MB 2MQ3A 5LGHL 4DFHA 3PGCA 3QUYB 2P24B 5KBNC 2ICEB 4XHJC 3ARFB 4XWOC 1IC5H 4XAKD 2OYPA 2YEZA 4JKLA 3HFMH 1DN0B 4KK9C 5CBAB 4LSDA 2HKFH 5F9OL 5DVNA 5D1QD 4OBSA 2D0FA 1NBZA 3UZQA 4JKPH 1FBIH 1CE6A 1R3HB 3FONA 5E5RB 4PJCE 1A6UH 2FJGB 5DS8A 2LQRA 4FN0A 4IDJL 2IC2A 4Y19D 1T66C 1F97A 4NQUA 4D8PA 4NYLA 3RTQA 1IAIL 2VLMD 4JQIL 5E2TL 4M7KL 2EDOA 2Q7NA 4ETYA 4E9LA 4YHPA 4P46D 2IANE 4P2QA 4Z8FH 3BD5A 3RWFB 4KMTH 1LK2A 5BZDB 4QO1A 3MBXH 3FO0L 3B5TA 1YQ2A 4ACPA 5L7XH 1W8OA 5DWUL 4H25A 3O41B 3T2NL 3MLVL 4NC0B 2CR6A 5K9KA 3TV3H 3H2WA 3SGKA 4RX4A 1E0OB 4LCUA 4AM0B 3DUSA 5B38A 2R0ZL 1CBVH 5I8KH 3QDGE 5FFLA 3T3PE 1N6UA 3NACL 3QFJA 5HGGS 3X11B 1CGVA 4O51A 3DTXA 3ARGC 4UQ2B 3LH2L 3F7YA 2HTKC 3NBNA 3RAJL 3FQWB 1DFBL 2Q3ZA 2DM4A 3SKJH 3EOYG 3GI9H 2NY1D 2N4IA 4XPGL 5IKCA 3C5SA 4GS7B 3CX2A 2EE2A 1NCAL 3MV7E 1BJ1H 3AAZB 3UBXI 3NIGF 4QRRD 4ZTOH 5C0CE 3TP4A 2QSTA 2WLYA 1OY3B 4PJ9B 3GEWB 4ODBD 5DUML 2AVGA 1PSKH 3MYZA 1KCVH 4LF3A 2ATPB 1H0DB 3FN0H 4Y0GA 4HUUB 4AYFA 3UPAA 3Q1SL 1OCWH 5C0JA 1H3PH 3Q0HA 1UG9A 3CPLB 1L7TL 1I1AB 5H35B 4YBLB 2YD4A 4UILH 1CTOA 4JDTL 1E6JL 5E94B 1A9EB 1I3RB 3BQUA 2EDBA 3MJ9L 5IESL 2FR4A 5SWSE 1IC7L 3OX8B 4NNXA 3FQRA 5C08A 1MJUL 5F9AC 1QQDB 5DA0B 2NY2C 2Y72A 4NKMB 5D7KD 2CDEB 3BN9D 3RGVA 3VXRB 1ZE3C 1YNKL 4HXBH 3SE9H 2PN5A 4P0DA 3QCVH 2Y6SC 5GS1A 4YQXL 4W6XB 1KN4H 3OXRB 3BEVB 2OLDA 2PO6B 3ARDD 3TGXA 1WZKA 2A73A 1G0YR 4R26L 1R24B 2VLKD 3ARSA 3IDJB 5BRZB 5CP3H 1OT2A 4QHMA 4K94H 4KK6D 2EE3A 1DSFL 4EN3C 3DUHA 3PL6B 3CFBA 5CD5C 1ZT4A 2DLFL 4LHUB 1E6OH 5GISH 4DKEL 5KVDL 5GGTL 1QSFD 3KXFA 3HI5H 4UNUA 5TJWK 1MFDH 1UVQB 4UDUB 3ZE2F 1J8HD 1KJ3L 2YD9A 1SM3H 5I66B 3VFWB 3BESR 3SDCA 4YBQC 4LDEB 4PJ8C 1E4KC 1PD6A 3QUXB 1RULH 3G5VB 5CLWA 4GKNA 3IGAA 1U8JA 3BAEH 4CJ1A 3ZKNC 2VAAB 4X6EA 1FYHB 4KUZL 2HJKB 1Z3GH 3GBML 1RIUL 1OW0C 3I75A 4Y5XA 4KTDH 2BRRH 5FCSH 2W07A 2RR3A 3CU7A 4ZODA 3GSRA 3L3OB 2OTUB 5I1HH 3QZWB 1KFAL 2G5BB 4ONOA 2E7LA 3IDYB 1MRCH 4HSQA 3RHWF 3O4OC 3U2SA 5IM7B 3S4SA 1HSBB 5I19H 1F4YH 5C07E 4ZQKA 3AGVA 1G9NC 3DVNA 2KL6A 5C2BH 1MLBB 3SN6N 3T0BA 2XXCB 1T2QL 1VPOL 2XKSA 1CDYA 1HXMB 3OKOB 3VFGH 4ZUTB 4LEXH 3PNWB 4X4ZA 4FQ1H 3F8UB 1OB1A 1T2JA 1I1FB 2BC4B 4KAQL 5TDOA 1EFXD 3BPNB 3HPLA 2CK0H 4JRXE 3B9KC 4LBEB 3OF6D 4IMLB 2VJXA 4R3SB 3UTTB 2HN7B 3HNSL 4WRLA 4OCRL 2XTJE 1SEQL 1D3CA 4P3CL 3TO4A 3U1SL 4Y4HA 4J3OC 3VGBA 4YHIB 1G7PB 5EZIL 4L3CB 5FKAA 5D1ZA 3GMMB 2PUQT 3U7YL 1AQKH 1N4XL 4L9LA 5GRXG 2B5IC 1Z9OA 3RL1A 1KJMA 3V8CA 5FYLD 4BH8B 3O3UN 5DSCB 4JQXA 3I3DA 1AGDB 3DSFH 3FO1A 4KQ3H 3OJMB 4LHQB 5CJQH 3T8XB 3KYOB 4RZCB 5ITBL 4D0CA 1XGTB 2DDQL 1N6VA 2V9QA 4LCWB 1OOAA 1NCBL 3ZKXC 4M7LH 4GW4B 1S7QB 4AQ1B 2Y5TA 4YHKL 4YFLI 2HT2C 4PY7A 3MZGB 5E8PB 3KJ6L 5IVOA 3O8XD 3MLTA 5IMKA 5TE7H 4KGLA 1OP3K 4MNQA 5CMAB 3BVNA 3PHQB 4GAJH 3P4MA 3WKMH 4GXVL 1IGYA 4HK0B 1T7VA 2ZZUT 3JUZA 4WJ5B 1KENH 3CMOL 2Z35B 3DV4B 3RY6C 2B1HH 4TQEL 4UMGA 3HMWL 1MI5D 5AG8A 4X5WB 3O2VL 4RFEB 3GSXB 1OARH 3QDME 1ACYH 4HWEL 2F54B 2RGSA 1KCRH 3CDFA 4Q9RH 4Q6YA 4AG4L 3ILQC 3DNKA 3DOSA 1M05A 4YHOL 3TF7C 4BA8A 1LEGB 3MUHL 4WI6A 2H6PB 1SEBA 3BHBA 5DEGA 4L1DA 5CD5D 2XOTA 2GJZA 1MCDA 4KU1A 3MCG1 4I2XE 3ARUA 2HT4D 4JVWA 2Q6WB 3RVWC 3ARRA 1RD6A 4XMPH 2F53B 2B0SH 4NO3A 3WNPA 3GSWA 3MBEC 4JB9L 2VAJA 1U95B 3ZTNL 1G7LA 5I1JH 2COQA 4LARL 1FGVL 4HZLA 4NQEB 1ZT7B 3DV6B 4JLRB 4P9MH 2KQNA 3NIFE 3ZKND 5KTEH 4MD0B 1HILA 2YUWA 1N3NA 1NGPH 4G8IA 2CIKB 3H9SE 3O6FA 3OWEA 3LSOA 1JHLL 4OLXL 1AD9A 3AREA 1V05A 3BI9X 4MNHA 5F88A 4F33B 4P59L 4K9EL 1QKZL 3QEQD 4MD5B 4Q0XL 1HKLH 3QPXL 4WWKD 1RUML 4O4YL 2PW1A 4JFFA 3MPCA 4LGSB 1MF2L 1VA9A 4H88L 5FF6B 4GW5B 1UM5H 2EEAA 1JYNA 5I17A 3QCUH 3MJ8A 4LLWA 5JOFB 2FO4A 4PJHE 1PZUB 5E5MA 3PV6B 3QXDB 3E6FB 2HFGL 5DJXA 4FQCH 4TUOA 1NCTA 5AYQA 5CFHA 1CLYL 2XRAL 3EOBB 3GMOA 1F45A 5KSUA 4FTVB 3HRPA 2JJTA 4S1SH 3PWJA 5CILH 2GTZB 5CJ8A 3W9DA 4JG1L 3MACL 2R69H 2HRPH 4POZC 3QCTL 4UT6L 2WBWB 5GJTL 3T08A 1BJMA 3G5XB 3HCVB 2WUBH 5HHVL 1NCDH 4Y1AB 2GEEA 5FDWB 2VSCA 4GRMB 4U6VL 1A1MB 2CPCA 1JYXA 1YUHA 5C71A 3CH1B 3T3ME 1VB9A 4ZS7L 5GS0L 4GOSA 2EXYC 1VADA 4HIXL 5K59F 3VWKD 2AK4D 3TA3B 2ZCLH 4PV9B 4HZAA 5C0DB 4TTDC 1A6TA 1X5JA 4XAKE 1QHPA 2AXFB 2XZCL 1DBMH 3H7BB 2ICWA 1REIA 4WUKL 3HE6B 1RZFL 2O61A 4P23B 4Q2ZB 4C54A 5K9OB 4HLZH 2WINA 4MX7A 1DBAL 1T2XA 5ABDE 1UCTA 2HLAA 3O3AA 5I1AA 4GG6A 2P42B 5C70A 3LDBC 4PUBH 4PGEB 2BRQA 5JXAH 5I16B 2YOCA 2E6JA 2VLME 2AEWA 4X4YB 5IJVA 1NAMB 5EIVA 3MREA 2EH7L 4QRUA 4M1CD 4LPYA 2J8UF 4HX1A 2FJFB 4P4RB 4JKMA 4B0MM 5ID0A 2ZUYA 1S7XA 5H8DA 3OAZH 3BP6A 4Y16B 2JJVA 1QBML 4X80H 3RU8H 2OP4H 3BZ4B 2JLLA 5T33H 2XA8L 1CWVA 1G7QA 1GAFH 2VDRL 5KVEH 5HPOA 2AV7B 4A6YA 4WTZA 1ZLUK 3WO3B 5FYJL 2J6EH 1J1PL 2PNDA 1FNGA 3D69B 1RAMA 5I73C 2HKHL 1LNUA 2DQJL 2ZCKL 2D4FA 5F1NB 1AO7D 1KJ2A 1FO0A 4L3ED 2DMCA 3KDMA 1JPSL 2JELH 3CNKA 6FABH 1A7BA 3AS0A 3D0VA 3Q2CA 4QRPB 1ETZB 4YHLH 4X7EC 4MA8H 4EDXA 3DMMC 3GZKA 4MJ2A 1NFIA 4ZPVA 5F7HA 3PP4L 1HH9B 4Y5YC 1V7NL 4GKSA 4NWTH 4OLUH 4S1RL 3LVEA 3BIKA 3KS0J 3TVMB 2UZIL 4AY0A 5KAQF 2Q8BL 1KCLA 1B0RA 3QZWG 2FX7L 3OG4B 1FL6A 3MV11 4QRRE 4Z7UA 2BY2A 4OCSH 1DR9A 2IPTH 3QA3A 4QHKI 3IFPA 2XT1B 2NR6D 3NCYS 3I6GB 1ZANH 3QIBA 1ZGLM 1CE1L 5FUZL 5TDNA 3IKCB 4PREB 1TTFA 3WJJA 4HLZG 4WFGD 5ITFA 1S9WA 4GXUN 3BX7C 1ES0A 5EZJA 1XCQB 1LP9A 3JZ7A 2EDXA 4KKLC 2E7BA 5D7KE 5T1KD 1YECL 4POYA 5FO8A 4OCMC 2DICA 3DX9B 1F3JB 3QI9A 5EOCH 4LIQH 4OM0L 1UJ3A 5T3XD 1TJIH 1TCRA 1OSPL 1KELL 4JFXA 4FFVD 1KIRA 2BVPA 2FJHA 2MPAH 1H3VA 2GK2A 4HUXA 3SDDB 4JANA 2VDMH 1UWEH 2VLKE 5C0BD 1T20B 4M1DH 5E1AA 2NY7L 1IQDB 5AD0B 1AI1L 5CSGA 1NGWA 3HR6A 5JQHC 5I30H 5FYKL 1QD0A 5ESQB 1IGCL 1H5BA 4XAWH 4ZOCA 5E4IA 1O7VA 2ATKB 1QSFE 4FABL 1EFQA 3EO1B 5DHVB 3DX7A 5IQ9A 5DMGD 1J8HE 1RUPH 2QADD 1CK0L 5T1DH 1YEHH 5ISZB 5D2NC 4OFDA 5ICXB 3LD8C 3ZYOA 4CMMA 5MEPA 5GRWA 5F6IB 1AGCA 2OK0L 1L9NA 2X9YA 4N68A 4N9OB 5EN2B 5CCKH 3NH7L 4NZRL 1S7SB 3G6JB 3NA9H 1G6RA 5EU7E 1H9VA 2PXYA 1SJXA 3QP3A 3VFNA 3AM8A 4D9QD 4HWZA 3JVGA 2FHFA 3C6LC 1C12A 1GOHA 1K9TA 1GZQA 4JGUA 4X4ME 2P47B 2DTMH 4IOFC 4NPYB 4X9BA 1QR4A 3U0PB 1GGTA 3MRKB 1RZKL 2X40A 2VRAA 2JJSA 5CEXA 5DJZA 4G8GD 1TNNA 1TZHB 3M07A 3H42H 4RCAA 5IEHA 2I9LA 3GJFA 4FQXC 1N0XL 3TIEA 1BOGB 4PY8J 1T89A 2OI9B 1AIFA 5HDOA 1FAIH 1DQLH 3RVUD 5JO5B 5IB5B 4HHAB 4DN3L 1FQ9C 3PWVA 4HWBH 4U33A 2W9EL 4DGYH 4YNYB 4YDLB 2J8HA 2Y07H 4KVCH 2AAVA 3QNYA 4L4TB 2GTWA 3DX8B 1S3KH 2FH6A 5FYLE 3GMPA 2ICWI 4XMKH 4NZTL 5EOTA 3HC3L 2Q1EA 4G9DA 1BQHB 4TNWK 4OCLC 2W9DH 5FEBA 2H1PH 4G6ML 4LPUA 1J05B 4J2XA 2Y25A 3P4NA 3C08L 3N06B 1C5CH 1CVRA 4PIRF 3LN5A 1NAMH 3BGFB 1KN2L 1VCAA 3H7LA 5I8CB 5D71H 1AD0A 3OKDB 4IRJC 3HG1A 4R7DA 3C6SA 4XC3H 4MCZB 5F7KC 1I85C 4P2QD 4JO1H 1A2YA 3B8SA 3ZO0A 1ZA6B 1F58L 1FBIL 3TNMA 43C9B 3QULA 2NW2A 3GMLA 1KXTB 1A6UL 4Y4FA 3IDIA 3OKNA 3UPRB 4L8CA 3S88L 3R06A 1P5VA 5D96B 2WBJB 1OAUL 3K46A 4U1HA 1MI5E 1GZPA 1U92B 1OLLA 5D93C 5D7LB 1FYTA 1UXWB 3S35X 4PD4K 1BFVL 4Z8FL 4OZGF 1MLCA 4MHHG 4KMTL 4P3WA 4KPHL 3DURB 3MBXL 2OZ4H 5C0NC 4MAYB 2ARJQ 4MNGA 5HHQB 4P2RB 1T21B 4XZUA 5IBLD 4L8DA 2V5TA 4S1DD 3IAGC 5C9JA 3L3HB 5EO1A 1JTPA 1HI6B 4KK5C 5D7JB 5CP7A 1H8OA 5I8KL 2EIEA 3CFDB 3IJHB 1P69B 4KHTH 5C0FB 2W65B 1TQCC 1TJHH 3CXDL 3TM6A 4DW2L 4BK4A 3HB3D 3ARGB 1LMKA 3C6LD 1XT5A 3SKJL 3QEQE 3SKUD 3MRHB 5C08D 4CN1A 1UZ6E 1CTNA 5IVXE 1VDGA 3U7WH 4Y2DB 4KGJA 1GL4B 2XY1A 4NHUA 3GMQB 4PJAA 3WXVH 1Z0NA 5KSAA 4TTGA 3RGVD 2VR5A 4UOW0 1MFAL 4X8XA 3G04A 1CD8A 4ZTOL 1KEMH 2OS7A 4EI5B 4HDIA 1PSKL 1VENA 2B4CC 1KCVL 3FN0L 4QHNA 4WI2A 5EC1A 5DD1L 1OCWL 5JIHA 2WP3T 2R0LH 1M7IA 3DX6A 5FA3B 3VXQA 1U91A 4LKXA 1YNTA 4PRIA 1R3LB 2ED7A 5EB9A 3VDAA 4BSJA 5BS0A 2D0GA 3BUYB 3K80A 5CSBA 4EI6A 1KB5A 2F74B 3HRZA 4NCC1 4Z76A 5DHVH 3MUGB 4PGJA 3DPBA 4WWID 5DJ2B 1MQKL 3SO3C 2F5AH 2A6IB 2NY2B 5DQDL 3SE9L 3GMNB 2WP3O 1AY1L 4FXLA 2NX5D 3MR9B 5IP4A 3P0VL 4HEME 1WIOA 3MRMA 1KN4L 1I7TB 2PTVA 3B43A 4I0PC 1G9MH 3SE4A 5C7XH 4K3JH 5FGSA 4IMKA 1RJZA 3MA9H 4QCIB 4NFCA 3EFDH 4K94L 4WEMB 3OKEA 3CDGA 2M26A 1CD1A 3K1KC 5F1IB 1KBGL 1A7QH 1R5WB 2AK4E 4KTEH 4ELME 1XIWC 1BP3B 1P6AB 1V3KA 1MFDL 1E4WH 5DJYB 5GSRB 4C59B 1SM3L 4HFWA 4HKXA 1K8IA 3GUTA 4JRYE 5B8CA 1RULL 1PDKA 2FEDC 3RX8A 4PJ8B 3V6ZB 1JVKA 1V7ML 2VITB 2YZ8A 1OM3L 4Z5RB 3UTOA 4YK4B 3TH2T 3PF2A 2DJSA 5K9JH 4KROD 3VFOA 5TH2B 1Z3GL 5E99H 1WICA 4KTDL 2XQYK 4ZFOB 3NTCH 4RMSA 3LPGA 1OAYH 2GYSA 2EZ0D 4EQ3A 4AEHL 1OSZA 1U8QB 1MJ8H 1NANH 1HHKB 5LCVH 4ZOEA 5EFIA 1TVBA 1LE5B 2GAZA 4X6CE 3FN3A 1F4YL 4Z7QE 5JHDB 4MAUL 1QA9A 4CADA 1K6QH 5BOZG 5CIPA 4ZPTB 1HCFX 2NXZD 3IETA 12E8L 2EDQA 5J6GB 4RGMB 2FBOJ 3VFGL 4K7FA 1DP0A 4LEXL 1BFTA 2OSLA 2NW3A 2YPLE 2AK1L 2HJLA 2CK0L 1WZ1H 2AQ3A 3AS3A 1FVCB 3D3VA 5EUOA 1PX4A 2GJ6A 1T3FA 5SWQB 3VWJD 3B9KB 3NAAH 4ORGB 4PJDF 4RAUA 5ID1B 4JQVA 4HIIB 3M1BA 1K8DB 4C57C 4P3DB 4WI3A 1AO7E 1X5KA 4L3EE 4DGVH 4M3JA 4PGDA 4DEPC 4MNQD 5IBUB 1KJ2L 1YEJH 5DMKA 4PJBF 5E6IA 3A6CL 5HHOD 2KZ1B 3BPCB 2BNRA 4RDQF 1FZOA 3DSFL 3GBLA 4I3RH 1URLA 1CT8A 4PJBB 4LCCA 4IHOA 1NCWH 4J6RH 3F5WA 5CJQL 1JNNH 3K2MC 5EBLA 3LRGA 1P84K 1B9ZA 3TFKC 4PG9B 2ZOLB 4FQHA 1X4ZA 3NPZB 1G7JA 2J8UA 5GHWH 1FFPB 1BF8A 2DOCA 4F8TA 1PKQA 1WTLA 2VDQH 4U1NB 5I1LA 4TUKL 1HYRC 4KJPD 5TE7L 1GSMA 1XF1A 4L29B 1W72A 3K0WA 5IFAL 4HS8H 4TSAH 4GAJL 1A5FH 3U0TA 1ZLSL 2IEPA 2FZ3A 3LKPB 5MP6L 1GGBH 4RGNE 5F44A 4QYOB 5DRXB 4M6OH 3DI2B 5ETUA 1KENL 3CFJA 4WFGE 4Z7WF 4C83B 1IT9L 1X5HA 1R3KB 5DUPH 5E8EA 2HJFB 3IF1A 5FA4A 3QUZC 3OJVC 4PD4J 4YHMH 1EBAA 1OARL 4I4WA 4L1HA 4B7LA 1ACYL 5T3XE 1KCRL 4Q9RL 1KB9K 3CSYB 4QLRA 1U42A 1F00I 2QLVB 2LVEA 2X4RB 3IDXH 4UIMB 5C0BE 2YZ1A 3QWOA 1OGAB 3RI5K 4I48A 5F9WC 2PYEB 3EIFA 4NDMA 2A83B 3TIDA 3QUMB 3REWA 1A6WL 1PYWA 2MNUA 2QEJA 1IM3A 4UINH 1Y18B 5KVGH 2Z4QB 4XMPL 5L9DH 5FECA 1UM4H 4AEFA 1AH1A 1BM3H 2RFXB 3QPQC 3T77A 5A3IC 2AERT 2BVQB 5MEOB 4HJJH 1FAKT 4MS8C 1XR9A 1HHGA 3V0VB 1MVUA 3RJDA 5F7UA 2G75A 5I74C 4N8CH 4Y4KD 2BOBA 3I50H 3GSOB 3IS0X 4ALAL 1HKLL 3WDIA 1G6RL 5D6CA 1JMXA 5CGTA 3GI8L 5DD3L 5D5MA 5FUOH 4F7PA 5CSZA 5ACMA 3G5ZB 1IKNA 3FAWA 2X2YA 4NRZB 2IGFH 1UM5L 3EW3B 4OZIE 3KYMB 4UB0H 1C16A 3QCUL 5HGDA 5JW5A 3GDBA 4MXVF 5D7IE 4G8GE 5ANME 4FQCL 5DJ6A 5CLTA 5IW1A 1KLUA 1XF3A 3DARA 3MLRH 4B41A 4XP4L 4PP1D 2X9XA 3QO0B 3BDXA 1R0AH 2PR4H 1F90L 2ZUSA 5LG1A 3WUZA 3KPSD 2X4SB 3IDNB 4S1SL 1XFPA 4GW1A 5CILL 3RDTA 5A16A 1QRNB 3THML 1IC4H 1NC2D 1AHWA 4F7MB 2R69L 5LXGL 4K71C 2HRPL 3HNVH 3W0WB 2ITDA 4L4VB 1PY4A 3L6FB 5GRUH 3WV0A 5A2LH 3LS4H 4APQB 5FHBH 4OZHF 3FT4A 1NCDL 4ODXB 1UYWL 5IW6B 2D03H 2YMXH 4GH7B 2MQ0A 1JZ2A 4OZHB 3VXOA 1S9VA 3IDMB 3VXTB 3Q5TA 3F7VA 3LN4A 1DLHB 2P44B 3ZKMD 4N8PA 1IM9D 5A43C 2WBKA 4MB4A 1J1XH 2BXZA 1DBML 1D5XB 1PEZA 5AZ2H 4P2QE 4PB0H 4JHZA 5GGUB 1CQKA 2QR0B 3F6LA 5T1LB 1G9NH 1WCQA 2JB6A 1JWUB 3N1GC 1NGZA 3UZEA 4XVUC 3SDAA 3FTGA 3VD4A 3ALPA 4R2GD 2P8MB 4EKXA 1F11A 4N0CC 5IHLB 3QUZD 4PUBL 4G43A 5JXAL 3KYAA 4OGAD 3LDBB 1WAAA 1KCUH 3LZFH 2D2OA 3QXWA 4EIGB 1NDGA 1X3DA 3WIHH 4H1LA 3WNNA 1N7MH 3N9GL 4KI5F 4TVPL 2VZUA 4H8WH 3CCHA 3CIQA 3QFJE 3S3PA 2IBGA 5HI4D 2IJ0C 3PWUB 3KYNA 5IBTH 5I18H 1ND0A 2X70A 4JDZB 1QSZA 3ARYA 5C0AD 2JCCF 3MRGA 5FHAH 3PJSA 1FFRA 4GSDH 5ESVB 4K23L 1GAFL 2FYYB 2JCCB 3QRGL 5I76A 1AXSB 2A74A 4OQ1A 1X5ZA 2WIIA 4G6KH 2J6EL 4M7JH 2WANA 4PTTB 1Z2KA 4JAMB 1YN7B 2FD6L 2PW2B 3O3DA 4QHLA 5I73B 4JE4B 4QTHB 2Q20A 3UTSA 2HH0H 4JJ5A 4UBDC 2JELL 6FABL 3KPRD 3VH8A 3U9UA 2ADIB 2EO9A 3LOWA 3MLWL 4YHLL 3LRHA 4MA8L 3STBA 1UWGL 1P84J 1BIIA 3OKKB 4ONGH 3S5LB 2R39A 1ZVHA 3FT3B 4PJCF 5C08E 1U8KA 4AIZB 1EAPB 3OR6B 4Y5YB 1MCEA 5MEQB 4G6FB 4PJCB 4KJYB 2ZCHH 1N0LA 3KPQA 2P5WA 3UCRA 3EHBC 4OCSL 4G3YL 4DUXA 4C56D 4YDKL 4OI8A 32C2A 4JFDA 4NQCD 2V2WA 1F2QA 3V7AE 1OQOA 4AEEA 5T3ZE 5EZOH 3FFCA 3QUMH 3V6BR 4PGBB 2IANB 3NFNB 3UYRH 2IBBA 4LAJH 2VIRA 4P5TA 4ZUSB 3IAQA 1I7ZB 4LSSH 2DBLH 3FQNB 3KXFE 2BVYA 5ADPL 1KB9J 2JIXA 2R2HB 4PJFA 5EU5A 3TJHD 3HNTH 5EOCL 2NX5E 4LIQL 3VFVA 3QNXA 1TJIL 1M7DB 3KNBA 3GM8A 4Q9BA 2MPAL 1AGBA 2WM0A 3VXMB 3VFRB 4L8SA 3T3PF 1YEKH 1UWEL 2RBLA 2PXYD 1UADC 3Q3GA 3QDGB 4LLDB 4LLQB 2VDOH 5T1MA 3BN3B 3TBSB 1OWRM 4Q7DA 5I30L 2DIJA 1P53A 1GVIA 1W0WA 4U1JA 4E5XA 4XAWL 1Z9LA 1SYSB 5MERA 1XGQB 3VRLE 3VFMA 1RUPL 3K7UA 2F5BL 1BZ9A 5F7MC 2FATH 5B3JF 4HKZB 4K07A 3UTQA 3QH3B 5D2NB 5HTSA 3EFFA 1IAKB 2V7NB 4LLUA 3LD8B 2X44D 4BH7B 3L5WA 3RFZC 4XPFH 3LQZA 1K2DB 1T1YB 3NA9L 5C09A 4ORZC 5KSVB 3WLBB 3SOBL 4TYUA 5HGAA 2Z31C 5C86A 4PBWD 3SEPA 3UMTA 5HYSG 4NM8H 4HC1H 1QR1A 1B3JA 4WW1A 2D9QB 4XP6H 2NY6C 3E2HC 5SWSB 1T0MA 4LPCA 3MYJA 1XGYH 1WBZB 4HW6A 1KT2B 5ELIA 4L5FL 4X7TB 4KXZI 1FJ1A 1JI1A 4RMTA 2FWOA 5IMOA 1IGFH 3H42L 2DN7A 3G08A 3T4AB 3H3PH 2APBA 1NUGA 2HAZA 5EBGA 4XPBH 4LSUL 4OUOA 4FQXB 4H5SA 4R90L 3M45A 1DQLL 1U2HA 3MCLH 3HG1D 3ROOA 3CC5A 3NGBC 4HPOL 3EYSL 5D1XC 4HWBL 1DBJH 3O6MH 4UBDD 1I75A 4J23A 4DGYL 1A7RH 2Y07L 4KVCL 3NVQA 3KPMA 1MJ7L 3QXAA 4MNQE 1S3KL 4XMKL 2DQDH 3WFHB 5HHOE 5FM5O 5SX5H 1NLDH 1X4YA 2P7TA 5E2UH 2J5LC 1RFDH 1C1EL 2CLRA 8FABB 2EDLA 3LCYA 1C5CL 4Z95H 4M6NL 2ZOKA 2AI0H 3D25B 3WKNA 3S35L 2YD3A 4JM2C 3SJVD 4XTRD 1NANI 4XC3L 3MNVA 4PBXA 1N5AB 4IRJB 3L95B 1FSKC 4RA3A 3GRWH 3OKLA 4F9LC 1I1CA 4HUVB 1UB5A 3PQYB 4JO1L 2H8PA 3GBNL 4OD2B 5E03A 4DTGH 5DFWH 4PTUA 3B2VH 2P8LB 2EYSB 2QJDA 4MA3A 2EYTA 3KPPA 3Q6GH 5BVJB 3KS0H 5DJCB 2FL5B 5F89B 5C07B 2CDGA 3OGCB 4V2CB 2DLGA 5L6YL 2YWYA 4PJDA 4PJEF 1OP3H 5LVEA 3BEWA 3QHZH 3T0EA 1CIUA 2PTTB 1JWSB 5DYOA 4BJLA 3MO1A 4PJEB 3C9NA 4WI7A 5D93B 3WE6A 3SKNB 1D5BA 4JRXB 1HEZA 1DQQB 1T1WB 1YEDB 3B9AA 1TZIA 4LLMA 2D7PA 2NY4D 4PV8A 2XTJB 5EORH 4CU7A 5MI0C 3REVA 4ODSL 2P5EA 3WHE0 5DZOA 1R5VA 3O6LL 2EC8A 3RKPA 3T2OA 5F7EH 5KSBE 1NMBH 1XGPA 3D18B 5J3HC 1SJEA 2H2PC 4U1MB 3TZVB 4G8EB 4UI2A 2P48B 1FFNA 4NGHL 5TE6H 4LSVH 1QBBA 4ZSOE 1PAMA 1LK3H 4KHTL 3D39B 4MSWA 1A7PH 1NC4B 1JNHA 1TJHL 2ADGA 3BZEA 3STLA 2ICCA 3DO3A 4PRID 1CXHA 1I3GH 5JIIA 1OVZA 5BS0D 5KW9L 4HWUA 4Z7WA 5EU3A 5C0EB 5F3BA 1G7HB 4LQ1A 3B6SA 1CR9H 4Q6IA 2DB8A 2NY6D 4OCWH 5HPMA 4JPWL 1MFBH 4F9PA 2YN3A 4XNXH 1CICD 4HH8A 3PGFH 5CZVL 2DYPA 1KEML 3IFNH 1WT5C 3W39B 4K2UL 2DJ4A 2HT3C 1BLNB 1KTDB 1RK1B 4OZ4A 3L7FB 2X4UA 3C09B 1MOEA 2APFA 4YHZH 1WLHA 2GUOB 3QIUA 2R0LL 2IALA 4JREC 4PRDA 4QGYA 3QQ9C 3QEUB 4U1IB 2BOCB 2BHZA 3MNWB 1YQVL 4PRHD 4AT6A 4G6JL 5F96L 4WV1A 2VWEC 4K9EC 5CKAA 5DK2B 3KPSE 3OHXB 4BFBD 4XCFH 3SGEH 3ET9F 4P49A 1IGJB 4GRLC 4UIKL 4UT9L 4ENEC 4H26B 1MCFA 1Y0LB 5EOQL 4U1GC 5ENWA 1CGUA 2X4OA 2GITA 5EU6A 4ZYKA 4JN2A 3UDWA 2YC1B 5KVMC 5C0RL 4UNVA 4AMKH 5C7XL 4K3JL 4I0PB 3OG6B 1U8HA 3MA9L 4GG6E 2V2XB 4RWHA 2FDBP 4JM2D 4ZAKC 1RUQH 3GJEA 1BWWA 4M48H 5IV2B 2X4NB 3V0AC 5MEND 4LL9A 1E4WL 3TBWB 3FOMB 3HC4L 4LLYA 1BZ7A 4HMDA 4Q9CA 3HHRB 4ETQA 4N9GA 5SV3A 1G7MA 3FFDA 2IQAB 2A9NH 5K9JL 5EULV 2VLRB 3D3VD 4JZNA 4NQDA 2IPKA 2GJ6D 1J9CT 4BUHA 4X99B 2H45A 4RMUA 5GS0C 1JJUA 1OAYL 4PS4H 4R97C 4F3FB 1P9MC 3RX7A 1C5DB 2VN4A 4OSUL 1MJ8L 2VQ1B 2Y4SA 4TNWF 5LCVL 3KLSA 1N8ZA 3CZFB 5HGBA 3RZCA 3ARBC 4DJMA 3FT2A 5E6ID 2BNQA 1EHXA 5IK3B 4X6DA 2BNRD 2MHAB 1GC1L 4E0RA 4FZEH 1RHHB 3W82A 5LAXB 3T0XA 1EEYA 1VACA 4WHTB 2CRZA 4W81A 3EYVA 3V4VL 2C1PA 2E7CA 2ZSVA 3NAAL 3T3MF 3S6CA 3RTQC 4MVBD 4Z7UE 1GHFL 3GSQB 1MCOL 3SCMA 1A9BA 4N1HB 4ONHA 4GLRH 4WHYH 3LKRA 5CEYA 1ZLUH 5JDJA 5JW4Q 1YEJL 3KPRE 3ULUD 2DLTA 3BPOB 3JUYA 3PGDB 1MCNA 3QIWD 4NQVB 4X8JA 2LABA 5IGXH 1TXKA 4YPGA 1NCWL 5DGRA 3MLYL 5DVLA 1JNNL 4I77H 1IFHL 1EMTL 2WWKO 5L8LB 5JORA 1LP9E 4HJGB 5DRWB 1JGEB 3LRSA 3V7MA 1HIMH 1MRDH 2VABA 5CEZD 3LKQA 5DD5H 2GKIA 4C56E 4UUJB 3F12A 3MV8D 3VI4E 4NQCE 2ITCB 2H2SD 4TSAL 1CGXA 2AV1B 1D9KD 5IHZB 3LEVH 1KPVA 3LHPH 1GGBL 3WEXA 3U30B 4M6OL 4O02L 5LGJB 2ZJSH 2UYLB 5D6DA 1KC5H 4OZFG 5HDQH 3F58L 4MQ7A 4GUPA 1FNHA 5JPNB 4YHML 1BBJA 2VKWA 1D5MA 4WW2C 4E42A 1FFOA 2ATPA 4O2FB 5DK0B 4BM7A 3QAZC 3L3DB 1T04B 2I60H 1KXVC 1PJ9A 2D7TH 1PLGH 4U1KB 4N90D 4UQ3B 2W0KA 2FHBA 1IVLA 3CUPB 4TNVK 4HF5H 5C0IB 2Z0BA 2LTQC 5DURB 1UACL 4ZAKD 3GMRA 5IB4A 1J0ZA 1MH5B 1QQDA 1FDLH 1JUFB 1WEJH 2DBJA 3BP7A 3E6HA 2VUYA 5F9WB 3U46A 5DMIH 5KVGL 3BQUC 1I8IB 3QXTA 5DDHA 1JPGA 1G6VK 4I8DA 5L9DL 3RWDA 4BSWA 1TLKA 1BM3L 2UUDH 5GIRB 2C4XA 3IDJA 2LAAA 1FZKA 2ZUXA 2NY1B 5LGKA 3FRPG 2VC2L 5J9PA 4FXKA 4D3CH 5TFSH 4K8RD 4ZG1A 5GS0D 3R1GH 4ODUB 5INCA 1X7QB 3TN0C 1F4AA 3FB6A 1YC8A 1JGLL 3O45A 5HHPA 5FUOL 4FMFA 3SO5A 3H8NA 3DETC 5FM5M 5I15H 3MROB 1YNLH 1F4WH 1VKXB 2VUOA 3ZE1F 2ADJB 2OL3B 5I8OL 1KV3A 4PRAA 1CN4A 5I1KH 4UB0L 4QRQA 4BQ6A 2DQGH 3SDCC 5B39B 5LQBH 5L2KD 1DQTA 3RL2B 2XWJA 5JPMA 3WSQL 1WC7B 3SKMB 2IFFL 4HT1H 3CSBA 4MA7L 3MLRL 5JW4M 4GG8A 3UJJL 3VRIB 1D6EA 3QDJB 5GGVH 4DK6A 1RJYB 1SYVA 3CAFA 1DUZA 3TBTB 1R0AL 3C60D 3QZWA 1WK0A 2XN9A 3VE0B 1VFUA 3NCBB 4NO2B 3ARDB 1XF2A 3HG1E 2J12B 2MSPA 4NCC2 3RWHA 1HYSC 1IC4L 2HTLC 2BSRA 1AGEA 5IB3A 5IIEB 3RWGA 5ACZB 5IB2B 3MV7A 4DK3A 3HNVL 1IEBB 5B4MC 5I9QC 4O2EB 4HUWA 1K3IA 5GRUL 5KG9B 5C0CA 4YJZL 1PZ5A 3D0LB 5JIPA 3HLAB 3C2AL 3LS4L 4MCYB 3GSUB 5FHBL 3SDAD 3VGGA 3ARWA 2NXYC 1RZKC 1WBYB 2DQFB 2NY0D 3RWJB 4XRCB 4CVUA 1J8HB 3IXAB 4X7DC 4E41A 3X13B 5DJAA 3DVFA 3DRTB 1X6NA 1G7PA 5DHYB 3W81A 1C5BH 4Z7VF 1J5OL 3LV3A 2MQCA 4PRBA 3SJVE 3KVQA 1HQ4B 3EDJA 4Z7VB 4PB0L 3TO4C 4F7CB 5J11C 4IRSA 4Y4HC 4B50A 3JXAA 4XB8A 3EYFA 2W59A 2V5RA 3G6AA 4ONFL 5F9JA 3GSVB 4L9LC 4MNGE 4BKLA 1B88A 4YO0A 3KYOA 4U0RC 3M17A 4LU5H 1NL0H 3QHFH 4RBPK 5IQ7H 2YXFA 2CLZB 4JQXC 2E8YA 3UPCA 5EC2B 3JTSA 3OAYK 2XXMB 1K5NA 1KCUL 4F58H 1TQBB 2F15A 4CL7A 4HS3B 3MOBH 3Q48A 25C8H 3ZKSD 2B8OT 5EU4A 3WIHL 2IQ9H 1XCTB 3JWOL 4H8WL 1N6QH 4X6FA 3ILPA 2GY7B 1JV5A 4QXTB 3AXLB 5A1AA 3P0YH 5CGYD 2Q86A 3W9EB 4HK0A 3LKSA 1Q9LB 3MLXL 4LP5A 5FHAL 1NH6A 3DBXB 4C55A 4RGOH 4GSDL 1DBBH 1L0YA 5DRZB 1AC6A 2F8XC 1A7OH 2P43B 3DGGA 2E27L 1MAML 4U3XA 1T22B 4R96B 2OBGA 2W38A 4N0UA 4K7PH 1HNFA 3ARZA 5C0GA 4HGWA 1EXUB 1DVFC 3RNKB 3SPVA 4JFDD 2HH0L 5DD0H 3R4DA 3H3BC 1WFNA 4MQXC 3FFCD 4X7FC 5IF0A 1CLOH 5AEAA 1OF2A 1QO3A 4PRIE 4TULL 4WU7B 5I1EH 5HY9A 5BS0E 3EKCA 3MA7B 2E9IA 4LPTA 5JOPD 1XH3A 4C4KT 4D9LH 1EO8H 1WF5A 2JK5A 3HZVA 4MD4B 3V5KA 3T4YA 1YY8B 2ZCHL 3RI5F 4G5ZH 2LU7A 2BFVH 3L7EA 4NRXA 2E9WA 1I3UA 4J4PA 4K7PX 1A7NL 4M61A 3QWRD 3KWWB 2CLVA 4LRNH 5EZOL 4AEIH 3VJ6B 4QHKJ 2IAMC 4JFQB 3QUML 2DM7A 3MV9B 1P7KA 1CI5A 4N8VB 2PYFB 1I9JL 3O6FC 1IBGL 1OQXA 4LSSL 4M93C 3AREC 5F70A 1MCKA 3PDGA 4FQ2H 3RA7H 4P2OD 4OB5L 2V5SA 3EDKA 4JZOB 4YX2H 1YEGH 4R4BA 4DAGH 4RMVA 4XBGA 4CNIA 4DN4H 4PGCA 5EIIB 4NM4L 3D85B 4EDWH 3LMJH 4YXHH 1IGML 3ISWA 5GGSY 3C87A 3FCTB 4WCYH 5C09D 2ERJB 4AH2B 2R4RL 4ZXBA 3WCYA 1IQWH 2HFTA 2ESVB 2GSIA 1M4KA 5FOBB 3MCKA 2ADFH 4P4KA 4XBEH 5FO7A 1FG2B 4NHCH 3EJJX 2OL3H 3V5HA 1JE6A 5MENE 3O2DH 1UZ6F 2JJTC 1MUJB 3V6OC 4DWHA 2GFBA 3PXHA 2UY6A 1S7VB 3EBAA 3PUCA 3QDMA 3HAEB 4LCYA 4XX1G 3RIAK 1GXEA 3FZUC 4Q9QL 1JWMB 1M71B 1SJVA 4JEGB 1I8MA 4PJXE 4RA0C 3VXUD 3WFDL 2QSQA 4XPFL 2YPKA 3VD7A 5I6XB 4PV9A 3D3VE 5EUOE 4K94C 2GJ6E 5FGCB 5IB1B 4H20L 5IR1A 1JMZA 2XWTB 5E24E 4I2XA 5DLMH 3KLHC 3DYMA 3NCJH 4HC1L 2Q8AL 1JZ5A 1ED3B 1ZHBA 4N1EA 3SGDH 4XP6L 3LPFA 4G8FB 1TDQA 5KANI 3QXUA 5J13C 3TCLA 1XGYL 4OTXL 1RJLB 3P9LB 5SWZB 2R1XA 2BNRE 1OHQA 3HMXH 4YEFA 2GSGB 4WFFD 4CVXB 4KDTA 3UTZB 3KAAA 4KZDH 1AP2A 3H9SA 5ALBH 5HHMD 3PWPD 2IBZY 5DC0A 4XPBL 1FV1B 4YXLL 5EDXA 3MCLL 1BD2D 1I8LA 2Y06H 1LO2L 4HFUH 3QFDB 5I75B 1DBJL 1PKQE 3NGBB 3O6ML 1ORQB 1H8NA 1UC6A 4ELMF 3OXSA 1FLRL 4GAYA 2BY3A 4YDVA 1DDHB 1ZEAH 4LASL 5H2BA 1MRFH 2AK4B 1EEZA 4ELMB 5FB8B 3ULUE 4NKDA 2VL5B 1HINH 1NLDL 4PJHA 2XQBL 1AFVH 5E2UL 2HVJB 2NY5H 2R4SH 5TF1H 1RFDL 3RHWK 1F4HA 2ICWJ 1UJTA 2E6QA 4JRYB 5LGHH 4KY1H 2J5LB 4JDVA 3HI1A 1Q94B 2I07A 3SQBA 5KZCB 4RWYH 3FQUB 5DQJB 4WO4A 5DJ8B 4EVNA 2BSSB 1PVHA 4PB9L 9CGTA 5F9OH 1LO3H 3PDDA 5CEZE 5HYJD 4X0KA 1RK0B 1FSKB 3ES6B 4KWUA 1MHPL 3MV8E 4TSCL 4X6CF 5GRJH 2BERA 1E28B 4Z7QF 5B39G 2RHEA 4LSTH 2H9GA 2BSTA 2Z8RA 4QT5B 3Q6GL 4X6CB 4I3GA 5FYLH 2H41A 3QEHB 4IDJH 4CW1B 3H6JA 1CL7I 3ULSA 3PWLB 1IAIH 5CS7A 1VSCA 4UDTB 5E2TH 4M7KH 2EECA 2QQQA 1NFDE 3VCLB 3ZSTA 5C9KA 3GK8H 2YPLB 5DEFA 3CFKB 1RZ8B 2I24N 3QQ4B 1T1XA 2YRZA 5D1QA 4N90E 4OQTA 2CDFB 1NAKH 1AKJA 3NZHL 3FO0H 3BH8B 3DWTA 2XQYG 4ZS6C 1JBJA 3QIBC 3DUUB 5L88H 1BVLA 5F7EL 3FRUA 1MCWW 4FOMA 3LIZH 4JN1H 4NZUL 4R9HA 3MLVH 4Y19A 5D5ME 3T2NH 2V7HA 4RQQB 4HH9B 4YZFE 1QSEB 2DWEB 4DVBA 5J06A 1QSVA 3O9WB 1RMFL 2FX8L 4F37K 2R0ZH 3FZUD 3VFTB 5A2KH 3UP1A 2DMBA 3UBXB 4P46A 5FIEA 5E00B 3QIUD 1NGXB 5I1GH 3L3GB 2DAVA 5AZEH 3QI9C 1UJ3C 4M7LT 3QBTB 4XNMA 4YIQB 1YY9D 3SDXE 1I3GL 5EUKB 3RAJH 5GGQH 1QFWH 1A4KB 2CD0A 4XCCL 43CAA 1CR9L 4XB7A 3JV0A 3O3EB 4OCWL 4IS6B 15C8H 3KPOB 1QFPA 1YDPB 1NCAH 4PJ9C 3PGFL 4OFVA 1YPZE 5F7DA 4RGNB 1ADQH 3IFNL 4PJ5A 3PWNA 1Q9KB 3G6JA 5JLZA 3LAFA 1I1AC 2VE6B 4HG4K 5T1KB 3VFUA 5L2KE 1U6AL 5HXMA 5DQ9A 1L7TH 3QWQB 4YFDB 3WXWL 3HN3A 1EDQA 5H94B 2OR8A 4HD9A 4HV8B 4JRWA 3X14A 4JREB 4RAVB 3MJ9H 1YZZA 5DJ0A 1IC7H 2CKNA 1FNEA 1PGRB 1QPPA 1MJUH 4JO3H 2CXGA 4FFYH 4GRLB 5CINL 3JVGC 2GT9A 3HAEH 1YNKH 4MHHI 1OP9A 1RQ5A 4NO0A 1F6AB 4N5EC 1XR8B 3L9RB 1P4LB 4MJIA 4QRRA 2PO6C 2BNUB 2ARJB 3H9HB 3VA6A 3R8QA 3QUYD 4R26H 3ARFD 4XVTL 2YKLL 3OKMA 1Q9WA 2EEDA 5I0ZA 2JJSC 3S97C 3PL6C 4HHAA 1OAQH 1CDCA 4KJWD 3MLZL 3ESVF 4M48L 5GSVB 4DKEH 5KVDH 4HKJB 1HXYA 3EDEA 3MNZB 1KJ3H 3RZCD 3GB7B 2VQTA 3WN5A 2DKUA 1FC2D 2BNQD 4ODWA 1M6OA 4NQXB 4GBXA 2A9NL 3LKNB 1U3HB 1QLFB 1JHTA 4L8BB 1K4CB 1ZWIA 5EZLB 4HKBB 4KUZH 2DD8L 3GBMH 5ESAA 1RIUH 2X4QA 4O2CB 4F7EB 4N8VG 5J6HB 4PS4L 5BQ7A 1N64H 2LAGB 3HE7B 4D0DA 4G8GB 4R97B 5ANMB 3HZYA 3QDAA 2EYRA 1KFAH 5I1CH 1QSFA 3SCMD 3K8LA 3PGCB 2EXWC 3UTSE 2FIRT 4U0QB 1P4BL 4AIOA 2QQKL 4OFYA 2YEZB 5F7NC 3B5HA 1VPOH 3HA0A 2SEBA 4ZUWA 4FZEL 3BPNC 1NBZB 1JHKL 1S9KC 3RVXC 1CE6B 1CL7L 3FONB 4KH2A 4Y4FC 5E5UB 4BQ8A 2CO7B 2C3XA 4QTIL 4ZUUA 1SY6H 5DS8B 4OCRH 2P5WE 4YFLF 3GKWH 1NPUA 4FFZH 5EZIH 4D8PB 3R0NA 4NYLB 3RTQB 2EH8L 5M95B 4JFDE 1EJ6A 5AWNL 4P2RA 3FFCE 4FQLL 4PG2A 4YHPB 5DXWA 4DOHE 1ROWA 4P2QB 2J3SA 1LK2B 1B0WA 4KJQD 5IOPA 5JOPE 4I77L 1G7IA 1EFXA 4PJ9D 3DVGA 5ITBH 1T4KA 2C5DC 2O26U 2DDQH 1TENA 1XGUB 3RQ3A 2QV2A 1EHNA 4XNZC 2VDLL 4PJFE 4KKCD 1VERA 1HIML 4H25B 1IGTA 4YHKH 1T0PB 4ZO8A 4U05A 3KJ6H 2HG5A 1K3ZA 5FV1L 5K9KB 4OUUA 5GXBB 3ZHKA 4LCUB 3I85A 2A0LC 3DUSB 5B38B 3MC0A 2XG4A 4XHQA 2V2TA 5ICYB 3LHPL 5AAMA 4GXVH 1VEPA 1ZGLA 3QFJB 3BP4A 2ZJSL 1KC5L 4O51B 3DTXB 3CMOH 4I18A 4R0LA 5HYQA 3F7YB 1AJ7H 2GK0A 3MRFA 4QF1A 3O2VH 5KSAC 1CXKA 2Z92A 1ZVSB 1MAKA 3FOLA 4HWEH 2QHRL 3QAZB 2P8PA 2D7TL 1PLGL 5IKCB 1EX0A 3C5SB 2ZKHH 3O8XA 2Y5EA 4YHOH 4JFPA 2O5XL 3HS0A 1HH6A 5C09E 5EH1A 4LF3B 1WEJL 4DZBA 1QLRA 1UZ8A 5C0JB 5DMIL 2W60A 2E7HA 2IMMA 3VDCA 1PEWA 5CBEA 5HVWA 5DJDA 3QUXD 3BQUB 2CQVA 1MI5A 3X12A 2FR4B 2JKXA 4NNXB 1LVEA 1J7VR 3FQRB 5C08B 5I2IA 1FGVH 5BV7B 5ERWA 4ZDHA 4PLJD 2MFNA 1QVOA 3BT2H 3RGVB 1KUMA 4D3CL 5T3XH 2FCBA 3B9VA 3MXVH 4XMLL 4CN4A 3MRBA 2AS5M 3S8WA 1JHLH 3R1GL 3SE4C 4EN3A 5IMMA 5GS1B 1TETL 1KIPA 2XN9D 4Z77A 4Q0XH 3NFSH 5DI8A 3PXJA 1RUAL 2A73B 5GSRA 4YLQT 4G7VH 3O2WH 2IH1A 4Z0BL 4UT7L 2HFFA 3IYLW 4QHMB 1F4WL 1KLGA 2AXJA 1F5WA 3CFBB 1E4KA 2R9HC 3SY0A 4HG4J 1ZT4B 5I1KL 5E0QA 1WV7T 3TJEH 2VZ3A 3KXFB 1A8JH 1ZHNA 3ULVL 5FDYA 1KJVA 2AJUL 5EOCJ 2O93L 4WFFE 3UTTD 2HFGH 3SDCB 4XNQA 4E41D 1OW0A 4P5MA 5HHME 3K1DA 5GGVL 1C08A 1CLYH 1TJGH 3PWPE 1U8QA 4FFWD 4GKNB 3QEQA 3IGAB 1U8JB 4YHYB 1VFBA 3U83A 4NJ9H 4WWKA 4NN6C 5IVXA 4CKVX 2OCFD 4X6EB 3NPSC 1NGQL 1I9RL 3TYFA 3RJQB 3I75B 4YWGH 3U7AA 2W1NA 1HHIA 2VMFA 2V6HA 1T6WA 1GRWA 2VNCA 4ZFFA 3DO7A 3QCTH 4LKCA 4UT6H 3VRLF 5GGVY 3GSRB 5DFTA 5I9QB 4PFEA 3UBXG 5IFJA 3MGOA 2G2RB 3U2SB 1A3LL 3S4SB 2NXYB 4LCWD 3DVNB 5TQ0H 2YBRA 3TA3C 1U8PA 1NLBL 5EBMA 1C5BL 4F2MA 3K81A 4W4NA 2BX5A 3QUKA 1OB1B 3RKDD 5TDOB 1LD9A 3HPLB 4PRPB 5EBWA 1ZSDA 5CZXC 3HE6C 5HYJE 4WUKH 1C7TA 4MJ4A 1SMAA 2R1WA 4JQVC 3TO4B 4Y4HB 2E9BA 1BPVA 1WFOA 1N2RA 2OMNA 5FKAB 5D1ZB 1UB6A 1LEKA 4LU5L 3QHFL 4L9LB 3N85L 1KJMB 1ERNA 5HI3C 3G6DL 4U0RB 4MXWH 1H3UA 3VXSB 1X5XA 2F54D 4LCCC 2NXZB 3IJYA 25C8L 4U1NA 3VWKA 4G80A 3FO1B 4UTBL 2EH7H 2IQ9L 5J1TC 4D0CB 4XI5D 2ENSA 1A6AB 2XA3A 3QQNA 4Y16C 3P9WB 3GNML 3B9DA 2WUCH 1RY7B 1EH9A 2Y5TB 3AS2A 5HD8C 1QBMH 2YPVH 4PY7B 5HDBE 1BAFL 4OQTL 4RGOL 1U3JA 4CGTA 5HYSA 3NABH 3MLTB 3WUWA 5IMKB 1DANU 2AJ3B 2XA8H 3PHSA 4MNQB 5B3NA 1BX2A 3BVNB 3P4MB 1J1PH 4K7PL 1IGYB 2IPUK 2FH8A 1CGSH 4J4PD 2ZCKH 3OBAA 2HMID 1AE6L 1UKTA 5HI5D 3I3BA 3KYKL 5DD0L 5TDPA 2PYEA 1JPSH 1CLOL 1FGNL 1PBYA 2GW5A 5I1EL 4MXQC 1UQSA 3RVVC 4PR5A 5GGSA 4GQ9H 3P4OA 1JNLL 2AJVH 4D9LL 4JPVL 1XF4A 4TNVF 4S1RH 1SEBB 3BHBB 5DEGB 2UZIH 3MBEA 2Q8BH 4G5ZL 2GJZB 3V4PL 3N0PB 2FX7H 4QEGA 1FORH 4L3EA 3ZDXE 1OTTC 4LRNL 4NO3B 5DO2D 3GSWB 4AEIL 4J3SA 1G7LB 1S78C 4HZLB 2Y9RT 3EAKA 3O11A 4ZXBD 5DD6A 4OLVL 1WIUA 3TBVA 4RRPG 5D8JH 3S9DB 1PQZA 1HILB 1JTTA 1N3NB 4G8IB 3SBWA 3O6FB 1DUYA 4FQ2L 3RA7L 4QOKB 1CDGA 3LSOB 4M93B 1AD9B 3AREB 4YX2L 4MNHB 5F88B 1YEGL 1YECH 2C4FT 1S8DA 4Y1AD 5BV7H 4NFBA 3ROLA 1BJ8A 1QACA 3FN9A 4EDWL 1JGDA 3S3JA 1ORSA 3LMJL 1IKNC 1KELH 3MGTA 4A2MA 2PW1B 4JFFB 4YGVA 1KIQA 2KBGA 2VXUH 4LEOA 1FH5L 2W0FA 2X4SA 3C5ZC 4YHNA 2NY7H 5I17B 3MJ8B 2LU4A 4LLWB 3CZJA 3QR2A 2FO4B 4JHWL 4WI8A 5E5MB 5T3ZH 1EO7A 5DJXB 4TUOB 4XBEL 3S37H 4NHCL 2X41A 2OL3L 4QXWA 2RQ8A 5INDA 3O2DL 3GMOB 4P23D 1MHCB 3KLAA 5KSUB 1CK0H 4KKBC 3RDTC 3PWJB 2J8OA 3EO9L 2BNQE 4XWGL 3SE3A 2IWGA 1OTSD 3W9DB 5B38G 4NNPH 3NH7H 4NZRH 3T0WA 4YUEH 5C0BA 3F65A 1U93A 1F02I 2DQIH 2MWCA 5DLML 3NCJL 2A6JA 1X4XA 3DRQA 1YUHB 5LJYH 4FQQA 1NEZA 3OJDA 3S37X 2BCKA 4MJ5A 1HQRA 3BZFA 1VADB 2AQ1A 1S9YA 1X5AA 4UV4L 1A6TB 2YUZA 1U9KA 4FG6D 3WFZA 1SQ2N 3ARTA 4D9RD 1MSPA 2VXVL 1G1CA 3CVIL 3TPUA 2QQLH 4OGXL 2ICWB 4KZDL 2H32A 1BFOB 4URTB 3P0GB 4J7RA 2O61B 3MRDA 4JZJA 4M4RA 4GG6F 1P2CA 1TTGA 1WZMA 2WINB 2Y06L 3GGWA 3K8KA 4MX7B 5GJSH 4EXKA 1L4IA 1KTLA 2HLAB 3O3AB 1ZKAA 4GG6B 2V5YA 4QRPD 2NLJA 2FBJH 4TSBL 1JZ3A 4NQSA 3TBYA 5IJVB 3BO8A 1MRFL 3RVVD 3MREB 4OZIA 4QRUB 4HX1B 3EGSA 4NZTH 2YA1A 3HC3H 1GC1C 2Q7YA 1AFVL 4OKVA 2NY5L 3TVMD 5D7IA 1XZ0A 5DFVD 5ID0B 1EA9C 3MQIA 1S7XB 2ED9A 3BGFC 4KY1L 5FUCE 1BF2A 1O7SA 2X9WA 3BP6B 3LN9A 3C08H 5FAAA 1I7RA 3UTPE 3BISA 4RWYL 1KN2H 4FQJL 3C8DA 3S3SA 3IU4H 2DQTL 3BE1L 5L8KB 1G7QB 3KLDA 5FM8A 3FQTA 4EUPG 4A6YB 5AUMA 1LO3L 4OFIA 2IADA 5F1SA 4HK3J 4LVHC 5EO0A 1FNGB 1AKJD 2VISA 1F58H 1LNUB 5GRJL 2H3NA 3AUVA 2N7AA 3DMMA 4LSTL 1KJ2B 1FO0B 1X9QA 1MCIA 1EAPA 3OR6A 5FYLL 1E4XI 4PJ7A 3KDMB 2LV4A 5D96C 2WBJC 3D0VB 3RBGA 3S88H 1CDHA 1OAUH 3W11C 4EDXB 3GKZA 1J87A 4ZPVB 1NFIB 5TF0A 3SDDD 1BHGA 3NZ8A 3GK8L 5J0BA 5C1MB 3DLQR 4MYWB 4GKSB 2VXQL 1BFVH 4U1SA 3BIKB 4Z7UF 4KV5F 1IRAY 1B0RB 1NAKL 3NFNA 4KPHH 4MAYC 4MGXA 1J10A 4S10A 3DIFA 1FL6B 3CGTA 2YXMA 2E7MA 1CGTA 3QA3B 3IFPB 5L88L 4NNYA 3QIBB 5HVHC 3LIZL 4JN1L 5ISZD 1U8NA 3EZ8A 3QISA 3KPLA 5TDNB 3ZSSA 3FMGL 4P5TC 5D7JC 3ZE2E 4MJ6A 1M7DA 1QLEH 4GKZA 4PJ5D 4XCYA 1LP9F 5ITFB 3X17A 1S9WB 1BOYA 1LE9A 1HOCA 1MEXH 1ES0B 1I4FA 5M7QA 3WLWC 4P2CG 5EZJB 5IJKC 5I1GL 5AZEL 5FO8B 3CXDH 3EYQC 4DW2H 3QI9B 5HGHA 3STZB 1RUKH 1P1ZA 1UJ3B 3AB0B 1TCRB 5GGQL 1QFWL 4CUCA 4JFXB 5TGBA 1KIRB 2BVPB 2FJHB 4L8SC 4HUXB 2DLHA 2XN9E 4LSPH 4Y2DC 4JANB 1KLFA 4S11A 1GPOH 4X9FA 3NN8A 2OJEA 4QWWD 3I84A 3FO2A 15C8L 1KNOA 3U36A 5IMLA 4NO0D 1MFAH 1NGWB 4EI5C 1ADQL 1RZIA 1SJHB 4MJID 3BWAB 4WDIA 4EEEA 4LVNB 2I5YL 1H5BB 2XACC 3DX7B 5DD1H 3TNNA 1I9EA 5IQ9B 4E41E 1JNJA 3P2TA 3RPKA 4CMMB 4UV7H 4OD1L 2C3HA 4IM8A 5MEPB 3RIAF 4CVZB 1AGCB 3HZKA 4LSRL 3C6LA 3MXWL 1RZGA 4L4TD 4JO3L 5JXED 2NY3D 1G6RB 4FFYL 1IARB 2PXYB 1MQKH 2R1YA 1WBZA 4NJAL 3VFNB 5DQDH 3ZDYE 3LB6D 1AY1H 3E8UL 4HWZB 3P0VH 4QRSA 1Q9OA 4J1UA 4GBXD 1C12B 3MOQA 4KDWA 1GZQB 5BZWA 3S36H 4JFYA 4OZFA 3ORJA 1RU9H 3HC0A 3IVKA 4LCWE 4XHJD 3CVHA 4XWOD 1OAQL 2AJZA 2NZ9C 4ZNCD 5CEXB 4FNLH 1O0VA 5DJZB 4XPHL 1KBGH 4KK9D 2FEEI 1QEWA 1HWHB 2PCPA 5IEHB 1TVHB 2I9LB 3GJFB 2C1OA 4WI4A 2ZSWA 3TIEB 1Q72H 3N1FC 1AIFB 1NGYA 2NX5A 4OFYD 4NKOA 4NUJA 5EO9A 4U6HA 4KRLB 4YK4C 3T65A 2VLLA 3PWVB 1OM3H 1V7MH 1I3VA 1T66D 2WBJD 4G6AC 5HJ3A 1CD9B 3QNYB 4U3HA 2GTWB 3P77A 3S36X 1JGVL 1ZLVK 3GMPB 5D7LD 3MRRA 5F3HA 5EOTB 3O6KH 2F54E 3L95A 4G9DB 1N64L 4N0UE 3TO2A 5DZLA 4AEHH 3OJ2C 2XV6B 5I1CL 3FRPA 3P4NB 5LWYH 1JFQH 4PJGA 4O9HL 4RBPH 1WCBA 3LN5B 3U82B 2UVFA 2YRLA 3BIAX 4CVWA 2JJWA 1JPFA 3N1PC 4P2RD 4TOYH 1AD0B 3HG1B 3OAYH 4MAUH 2PF6A 4R7DB 4RGMC 3JSSA 4BELD 3WFBH 3C6SB 5DJCA 4C58B 12E8H 4X6BA 1V3MA 1ZXQA 2AK1H 2KDGA 4J3TA 3TNMB 4OT1L 3AU1A 3QULB 2NW2B 3GMLB 3GM0A 4Y4FB 1SY6L 3IDIB 1S7RA 3D48R 5SX5K 4A6YH 1S5IH 4NRYA 3GKWL 4FFZL 3WHXA 3P4LA 1V8HA 4L8CB 3T0EC 3JWOC 4H8WC 2Z8VC 1U8LA 4U1HB 3ARGD 1GZPB 4R8WL 1QBLL 2HTKD 1KJ2H 1FO0H 1K4DA 1F8TH 3A6CH 1FYTB 4NN7B 4NC2B 2ZG1A 3AMKA 3RIFK 5BVPL 1BVZA 1MLCB 3PP3K 3V8OA 1TITA 1FZJA 4QGTA 2VZTA 4DVRL 4R7NA 2DQCH 3VWJA 1L6XA 2VO5A 4HWNA 1NC4A 4XZUB 4AK1A 4XNZB 1FL5A 4HIEA 4L8DB 3EOTH 4TUKH 5C9JB 5EO1B 5F72S 1T1ZA 3L3KA 5CP7B 5IFAH 3MRIA 5C0EA 1G7HA 4LPVA 5HHNA 5HHOA 4F37F 1ZLSH 4XC1L 5MP6H 2CKBA 2NY2D 1YMMA 2CO6B 2EDYA 2DF3A 2NY4B 1IT9H 1IAOA 5CHNA 5BO1H 2X1WL 1AJ7L 5BW7A 1F13A 3VMPA 2Y6SD 4Q6IC 4PJAF 2ID5A 1LQSR 5D70L 1D5ZA 4PJAB 1OT1A 4NHUB 5KSAB 1BGXL 2ZKHL 3MZTA 5EG6C 2MKLC 3VRJA 4TUJA 3G04B 1RPQA 2FB4H 4EN3D 3AC0A