3IE9A

Structure of oxidized m98l mutant of amicyanin
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
105
structure length
105
Chain Sequence
DKATIPSESPFAAAEVADGAIVVDIAKMKYETPELHVKVGDTVTWINREAMPHNVHFVAGVLGEAALKGPMMKKEQAYSLTFTEAGTYDYHCTPHPFLRGKVVVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Amicyanin
publication title Defining the role of the axial ligand of the type 1 copper site in amicyanin by replacement of methionine with leucine.
pubmed doi rcsb
source organism Paracoccus denitrificans
molecule tags Electron transport
total genus 24
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2009-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3ie9A00
3DTUB 1WAEA 2BP0A 3FSAA 4BXSV 2JXMA 2XV2A 3X1EA 4YSQA 5AZUA 4W1TA 2YARA 4YVUA 1MG3C 1AR1B 3UAEA 3OQRA 2FNWA 3JT2A 5I6LA 7PCYA 5D4IA 1JVLA 3FQ1A 3CG8A 3IN2A 3WIAA 3C75A 1ZV2A 2HX7A 2ZOOA 1J9QA 1QLEB 3NJIA 2IDQA 5ANHA 1JXFA 1URIA 2P80D 4YSTA 1MG2C 2B08A 2P80A 3NSDA 1TEFA 3EH4B 3NSFA 2BW4A 2GHZA 3ZIYA 1ILUA 4GXFA 4WKXA 4JKNA 2DYRB 2PLTA 1AZRA 2XWZA 2YAQA 5EHFA 1CYXA 2VW4A 2FQFA 3TBCA 4DPBX 1GYCA 2Q5BA 3UABA 1J9SA 2YAFA 2QPDB 1PLAA 2BO0A 3QQXA 2RACA 3PXLA 4G7QB 2Q9OA 1AZNA 1BEXA 1NPJA 1OF0A 2YAMA 4KOBA 1PZBA 1GSKA 1KDJA 1J9RA 1OCZB 1SF5A 2YXVA 4YSOA 5D4HA 3WG7B 2AZUA 1ASPA 5B1KA 2IWFA 2XXFA 3QJVB 3T6VA 1KDIA 3ABGA 3UAAA 4YSAA 1BQKA 1CURA 3QJUB 1FA4A 2PPFA 3WI9A 1BQRA 2YAEA 5I28A 4BWWA 3FYIB 1M57B 2XVBA 4N4YB 1X9UA 1E5ZA 3DIVA 2OCCB 3EHBB 3FYEB 2GB2A 2CAKA 1KV7A 1XB3A 4EF3A 3CZUB 2HX8A 4JHUA 2BP0B 1BYPA 1CC3A 4E9SA 1AS7A 1NTDA 2BZ7A 4KO7A 5B1JA 4DP6X 2DWSA 2FTAA 1AOZA 1IBZA 3AY2A 3ABKB 4Q89A 2UX7A 1I53A 3CDZA 3SQRA 2X88A 3CVBA 1RZPA 3T6WA 1AACA 4A66A 5I5JA 4BK5C 1AS6A 5FC9A 4KO9A 5AKRA 4A68A 3V9CA 1NIEA 3OMIB 1SHWA 1V55B 2VM4A 1BXVA 2HX9A 5LDUA 2W88A 1NWOA 2A3TA 2I7OA 2Y69B 1PMYA 4G71B 2FQGA 1ET8A 2WO2B 1SFHA 3TU6A 4UF7C 1HFUA 2QDVA 2JFCA 4PAZA 3FU8A 2AVFA 3ASOB 2J5WA 4G7SB 1ASOA 2TSBA 1J5DA 1ET5A 2AFNA 2PPEA 2IDSA 2GBAA 2EINB 4HAKA 1PNDA 4KOCA 4KNTA 5I26A 4UAHA 3FQYA 2CCWA 5I6PA 4RH4A 4BXVA 4YL4A 2UX6A 2FQDA 1OE1A 1OE3A 4A2DA 1L9QA 4GP4B 4AKQA 4F2EA 1J9TA 1F56A 3FSWA 4DP0X 2AANA 3SBRA 1AZCA 4HHGA 2ZONA 4AKPA 1HAUA 3OMNB 2GI0A 4A2HA 4DP5X 1DYZA 1PZAA 1MZYA 2XLLA 1KGYE 1SFDA 1GW0A 3IE9A 4AI7A 4P5SA 1PF3A 1HAWA 3TA4D 2PP8A 3PAUA 3T6ZA 1EHKB 1WS8A 1ZIAA 3NT0A 4DP1X 6PAZA 1SHXA 2EIJB 3T9WA 1KBWA 1CYWA 3FU9A 2FWLB 1XB6A 4PCYA 2PCYA 3CDZB 2WSDA 1BXAA 2XV3A 3T6XA 3X1FA 3H4FA 2R7EA 4L0PB 1M9WA 4HALA 2IWEA 1WA2X 2UXFA 1W8EA 4K9JA 3ZBMA 3N2JA 3T71A 1AS8A 3WKQA 1GR7A 1RKRA 3EH3B 3AG4B 2TSAA 1RCYA 5B7FA 5B7MA 3GDCA 1PCSA 2WO3B 4F7KA 1XB8A 5PCYA 2VSMB 3UGEA 1JVOA 3QJTB 4A2FA 2ZXWB 5D4JA 4DP2X 3S3DB 2XXGA 1ASQA 3FQ2A 4A2GA 4YSSA 4KO5A 1WS7A 1T5KA 1JZEA 3KW8A 3NJJA 1N70A 5B1JC 2HXAA 3CVDA 5B3SB 1SDDA 2CJ3A 2FQEA 1FWXA 1AIZA 3NSYA 2UXVA 1AG0A 2J55A 4YSCA 1GS7A 1IBYA 4HZ1A 1L9OA 4A67A 5I6NA 5I6MA 2IH8A 1ETJA 2VW7A 3NSCA 2XYBA 2LLNA 1OCOB 5B7EA 3IBOA 1BQ5A 3OD3A 1L9SA 2IDTA 4E9XA 1JZGA 1ZDQA 2FT8A 4DP4X 5A7EA 4E9QA 5I5IA 1A4AA 1GY2A 4KNSA 4KO6A 3X1NA 3NP3A 1PNCA 3V9EA 1KCBA 4AZUA 4E9VA 2BHFA 1J5CA 4CSZA 3BQVA 3QPKA 2AZAA 1M56B 2BP8A 2BZCA 1R1CA 4DP8X 1NDTA 1ILSA 3QJSB 1AG6A 2FT7A 4NERA 3PAVA 2H5UA 3CVCA 2YAOA 3GXUB 2BW5A 1OCCB 2QT6A 2UXTA 3FT0A 3HEIB 5E9NA 1EZLA 2MTAA 3TBBA 5I6KA 3IEAA 4HCIA 2R7EB 4FA7B 3WKPA 4BDVA 2PP7A 3X2QB 4AX3A 4QKTA 1OV8A 3X1GA 3AG1B 1NINA 3SBQA 3NJMA 1E5YA 2OJ1A 2DYSB 1GS8A 3N55A 3PCYA 1NICA 4MFHA 2CUAA 2Y1AA 1FFTB 1JXGA 4G72B 4BWTA 3WNIA 3S8FB 3OMAB 4G7RB 2XV0A 4G70B 2BWIA 1IKOP 1AZUA 4YSUA 3S3BB 6PCYA 2J56A 2EILB 2HRHA 3FS9A 1SDDB 2QPEB 4DPAX 1L9RA 2H3XC 1GY1A 1W6WA 3PLYA 1PAZA 3ZDWA 1TU2A 2EIMB 1NIFA 5B1AB 3KW7A 1UATA 3NP4A 4BWUA 4W9ZA 1IUZA 2EIKB 2VSKB 1JXDA 3H56A 1PY0A 1XMEB 2PPDA 2X87A 2YAHA 1NIAA 3AG3B 4HIPA 1NIDA 1RZQA 2HZHA 3GYRA 8PAZA 2IWKA 3ABMB 4GP8B 4WTQA 5PAZA 4YVNA 1PLBA 2H47C 3D12B 2FJSA 5I5MA 4Q8BA 1QNIA 3FU7A 2UXGA 1QHQA 2PP9A 1YLBB 4HCFA 1DZ0A 2BP8B 2PCFA 2QDWA 3FPYA 4HCGA 4KNUA 7PAZA 1A8ZA 1TKWA 3RYMA 4GP5B 1KBVA 2NRDA 3PPSA 1NWPA 1MDAA 2OV0A 1SF3A 3NJFA 5B1BB 4E9YA 3ERXA 1WA1X 3OM3B 1JOIA 3IN0A 1CUOA 3ASNB 1AZBA 3TASA 2CBPA 4DP7X 4BDVB 1GS6X 2W8CA 1NIBA 2PPCA 4YSPA 4M3HA 4E9WA 1NPNA 4CSPA 2IH9A 3AG2B 3U25A 4HHWA 2VMJA 1VLXA 1X9RA 2HLEB 2VW6A 3NJGA 1IC0A 4M4RB 1L9TA 2GSMB 1W6LA 4NAJA 4YSEA 5TK2A 1OE2A 1JERA 2IDFA 2YQBA 2XU9A 1JZIA 1AANA 2J57A 3AZUA 3PAZA 2I85A 1L9PA 4GYBA 1JZJA 4ZK8A 3JTBA 4P5RA 1B3IA 5F7AA 1A3ZA 1BYOA 1A4CA 2GIMA 2VM3A 5TK4A 3WNJA 3QJRB 3NJHA 2B3IA 2JKWA 3NJLA 1KYAA 2CALA 4E9TA 4ENZA 2XX1A 4UANA 5IY5B 1AAJA 2FT6A 1BAWA 4DP9X 5I6OA 2GC4C 4QLWA 1AQ8A 1SJMA 1ZPUA 1JZFA 3UACA 3AW5A 3MBWB 3NJNA 1E30A 3QJQB 1JZHA 1OOWA 4AKOA 3FU7B 2DV6A 1ZIBA 2YAPA 2I7SA 2GC7C 4JHVA 4YSRA 1A65A 2HRGA 3ZX1A 9PCYA 1E67A 1MZZA 1V54B 2YXWA 1TEGA 4YSDA 4N8UA 5AFAA 2DWTA 3MX0B 4GY4A 4TXVB 2VN3A 1SNRA 1PLCA 2PPAA 3S3CB 3SBPA 4A2EA 1N68A 3DKHA 4X4KA 3EF4A 4E9RA 3BVDB 3L45A 4FAAB 1ADWA 2BWDA 3ABLB 3EH5B 3G5WA 2MRYA 2ZWNA 5F7BA 2IAAC 4NB7A 4F2FA 3FSZA 2IDUA 1V10A 3FPXA 2N0MA 3UADA 1ZDSA 3X1BA 1NZRA 3HB3B 2XX0A 4DPCX 1KCWA 2XUWA 2E86A 2DY2A 1OCRB 3H4HA 3NYKA 3FSVA 1ET7A 1PZCA 3NJKA 3S8GB 1A4BA 1BXUA 1ID2A 1WA0X 1E65A
chains in the Genus database with same CATH superfamily
1AP2B 1F13A 2X4SB 4R6UA 2BP0A 5ACZB 2GIXA 3JWNC 1YNTA 1EZVX 2ICEB 4ANXA 2F7PA 5F7YC 3X3GL 3HRZB 5AG9A 5A6MA 3NVQA 1VGEL 2NUPA 4HHAA 3LH2H 2FX7L 1RPQA 2Z1KA 3ARYA 5HHXH 1AR1B 1C08A 5DQJA 5CEYA 3TYFB 3OHXB 4XVTH 1KLGB 1SJVA 4EI5B 5CZVL 5IV2A 4XMLL 1DEEB 3FQ1A 3VGDA 4YDKH 1HNYA 2FK9A 3S5YA 1MNNA 3CHQA 2OCFD 2PUQT 3D39A 4PS4L 4GQQA 3MV8D 2ZUQB 4LDCA 3FUNA 4PRID 2F2HA 1M2VB 5BUGA 4QXVA 2UZIL 3P77B 3DDGA 5HI4D 1BGXL 3DK0A 3PDDA 2E7CA 3EH4B 4KK8D 1V3JA 3UPAA 2GSIA 4XPTL 5BOZG 5J3HC 2YD3A 3OSKA 3ULAB 2Y23A 2BW4A 3ARUA 1BZ7B 4JM2A 1E9PB 2H2PD 1FYTD 3OKMA 3TNNB 4BE5A 1U36A 4Q97A 1XD1A 1S7VA 1IIKA 3D4CA 1A6UH 2AI0H 2C3WA 3DXAB 4PV9A 2JCWA 1TFPA 3HZMA 2YGPA 2PYFB 4IRJD 5D7JC 5GIRA 2Q5BA 1EAPA 3NIGF 3Q1EA 2VQUA 3SE6A 2R56H 3WIHA 3OWRA 5KVDL 4AJVA 4JZNA 2IFGA 4KQ0A 1S5HB 5CILL 4KKZA 1DQLH 5HHQB 4IRSA 2VB5A 3HR5A 1FVEA 4Y4KA 2YUXA 5DWUL 5I0YA 1BFOB 3DWTA 2WXPA 4UT7L 3VFWA 3ORJA 4NNPL 5DQDH 2Y24A 3OLEA 1IL1B 5HD8C 2OW7A 2PW2B 5ESVB 3UAAA 1CURA 1FA4A 3C87A 2XG5B 2X2UA 5EO0A 3S37H 3DX1A 4FLSA 4LLYB 3QQ9D 4NUJA 4K9EH 1VEOA 4GMSL 3WFCH 2AQRA 1FC1A 1E9OA 5LNDA 1E3XA 2J5LC 1PX3A 3VGAC 2OCCB 4GRLB 3ARRA 4LSUH 6TAAA 1JK8A 5I74B 2XJKA 2K8MA 1XAKA 3UTTE 4TNVK 4OV5A 3AUVA 1W72H 4Y19D 3AWGA 3NFPB 3V10A 4X9IA 1HQRB 1NTDA 4JFQA 1I8LC 1BP3B 2IPKB 4GEIA 5KTEL 5LGJB 3IMVA 5E6IA 4B97A 1KIPA 2M8XA 4WU5A 1JPSL 2MJWA 4XNQA 1BVLB 2FH8A 4KFMA 3RA7H 2FECL 3C5XA 4PTUA 2YA0A 4FFTA 4F7MA 1WGOA 5AALA 2P8MA 4OB5H 5DJ6B 4NQVB 2BVPB 3P1VA 4DN4L 3H3BC 2V2XA 2YOAA 4FFYA 4JPIA 1F97A 1IGIH 3V9CA 1KFAH 5EIIA 4ZMAT 2VM4A 2CO3A 5DT1L 4N8CL 4HJJH 2BRRH 4TQEH 3HE6D 2WXRA 3CCHA 1UM4H 5DO2D 5JOFB 1N6QL 5JW4M 1LO0H 3S9DB 3BH9B 3U46A 3DHUA 1F58H 2X6UA 4M00A 3ZYOA 3QDJB 3F7VB 1KELL 1T22B 5KSAC 2J5WA 2WBWB 4CBPA 4Q56A 2MIZA 5KYWA 1KXTA 2LE9A 1OO2A 2VLRA 2W81C 2EINB 4MJ5A 3BRFA 1G7HB 1PNDA 2OMWB 3DV6B 4OM1H 4JY4B 3RP1A 3U9PH 3V2AR 3NIFB 3VFOA 3OL2A 1RHHB 4Z6AT 1TLMA 3B2XA 2V3EA 2AMGA 2JJTC 3KYKL 3LEYH 1DQDH 4XO5A 5CBEB 4UT6L 3V7MA 1OCWH 1RJCA 2X5PA 5L4IA 1X5HA 1MWAB 3T0BA 2BNQA 3IKCB 3KL0A 1Q9OB 3MJ9H 2PW1B 2EZ0D 3WUWB 5MENE 1XH3A 2NLJA 1PVHA 1WD8A 2ZG2A 5E03A 1KCRL 1NDMB 4PRAB 1CLOL 2DQMA 2L7UA 2DQEH 3DOIA 4XCNA 3RDTC 3DRQA 4G5AA 3I3EA 5C0CD 5I71C 4TUOA 5JO5B 5DMGD 3X12B 1FNSL 1THAA 4HUWA 5BV7L 2X4OB 3WELA 5D7IE 3ULVC 1RZFL 2FZ3B 1PDKA 4HLZH 5DYOA 1O7SA 1EUUA 2Y5EA 4OJCA 5FA3A 3NFSH 3VRLE 4JO4L 3PWPB 1HCVA 3CFUA 1ZHKB 4NBXB 1NEUA 4N6RB 1X6LA 4OI8A 3WEXA 1RULL 4JM2D 4H20H 4ZXBC 2EDJA 3ZRSA 2OJZH 3FU5A 3B9KB 4F7CA 4QOKA 3WS3A 4OI9A 5F9WB 2CO2A 2QHLA 4NP4H 5IMKA 4A7VA 1S5IH 2VLLA 1N0LA 4YHNA 1P6WA 3KLLA 3IJEA 2B3RA 2HFGL 1EJ6A 4IRSD 5KVGE 3KWTA 5KN5A 1HYSC 3HLAB 1NBZB 3ZQWA 3LKSA 2XXGA 3BWAA 5K9OA 2PWDA 4K8RL 4LMQI 1IAIM 1JZEA 3KW8A 2DYPD 4N2KA 3RFRA 4Z7WF 1KLUB 4N9GA 1JK9A 3GSWA 5JUEL 1FIGL 4ENEC 4L1DA 3CQFA 3T08A 3CN0A 5F3FA 5CKAA 2VQTA 3RI5F 3KL5A 4AEEA 5JIHA 4QRPD 1U58A 1F6AB 3OQ3B 5L2JB 1QBMH 5AW5B 3QIWD 3FQUA 4L9LC 3EO0A 4KKLD 4OW6A 4PTTB 4LPVA 1A9BB 1BBDH 1GJUA 4XTRC 2TRHA 1O7DE 3SOBH 2BIHA 1E9QA 1TJIH 4QHKI 3FB6A 2V8MA 5E6ID 2EDNA 3U0TA 3VU1A 4XP9H 2WCGA 3BXNB 2FAUA 1UYWH 3WE6A 2ATPA 5F3BB 1ZDQA 3L4XA 1ZVHA 1K5NB 5I5IA 2XTJB 5KS9B 2EUZA 2X2HA 1KY7A 1MY5A 3X1NA 3ZMNA 3C60B 4OH2A 4P07A 2Y07L 3PGDB 3NSXA 2NZ1A 3DGCR 4AIOA 5HDQL 2OSLA 3EJRA 1UG9A 4OKDA 2K1MA 5HI5D 4S2SA 4HIHB 3U1SH 1YEKH 1RUAH 5SWZB 4Q4EA 1AXSB 4YX2H 2QT6A 3HEIB 1T1YA 5EOTA 4PJFA 1YECH 4XAKE 1VACB 4AG4H 2NSXA 2F54B 2E4FA 2AJSH 4E68A 4FXLA 4NLAA 3KPOB 4MQXD 3WXVH 4UTAL 5IB5A 4HIIB 3HMXH 4HS8H 1CFMA 3L4WA 2X4RB 3B2VL 3OGCB 1XGQB 2IQ9L 1E5YA 2OJ1A 4H13C 5CGMA 2DYSB 3V5KB 3AQYA 4Z1PA 1H3VA 1YEEL 3H7BA 2X28A 4NWTH 2F8OA 2Y1AA 4OGXL 4RMUA 2DEWX 3SYAA 2F8XC 1OAKH 5IBTH 1UVQB 4PJDE 1SOSA 3W9DB 1MRFH 1H8NA 2R0ZL 2H7WA 3LPOA 3KDMA 4X9FA 1HZHH 1MJUH 1OB1A 3MXWL 5KBKA 3RWJA 3D50A 4OGQC 1J10A 3MLYH 1BIIA 3EJTA 5EA0H 5L2KE 4I3SL 4FZEH 4BFOA 4YZFF 1NFDF 3MRQA 1JFHA 2WB1A 4MDJA 4S1QH 4RGNE 1S46A 3N1MC 3W2DH 5J0BA 5CP7B 3SY6A 1OTUC 3CFNA 1JYVA 2C9QA 3BDYL 5D1QA 1TJHH 1A1MB 1ZV5A 3E3QE 4KQ3L 1GJWA 3FTWA 2IWKA 4FMVA 5CJOL 1CTOA 4OZHB 1K2DB 1TNNA 1TZAA 5PAZA 3VXRA 2AERT 4QOKD 3JTTB 3H9HB 3U36B 1OIOA 1MEXH 2AEWA 4FLQA 3NIGB 5I1JH 4LVOB 2E8ZA 4WEEA 3V0DA 1YLBB 3EYFB 3CHSA 2FLRT 4BGLA 5L8KB 1FO0L 1ZVSA 1O6TA 5I9QC 3OJ2C 4QRUB 5IROA 4DN3L 4LNRB 5ID1B 2CRZA 4RGMC 1ZEAL 2FUQA 3QQNA 4LVHC 5B1BB 4L1BA 3QE5A 3VYOA 3S5ZA 3ZT5A 1BVNT 3IN0A 5EH1A 4I89A 4HGWB 2Z31C 3ASNB 4F37F 3PXHA 5AYUL 5A43C 2YEZA 1CG9A 4QRRB 3V6FB 4MYWB 5GGVH 3TA3D 3IGUA 2Q87A 1G9MC 5ISZA 3G5VA 3BD3A 5HDRA 2DIAA 1VENA 4AGNA 4F8QA 1KUMA 3KYNB 3L1FA 4JO3H 2VAJA 4WUKH 1NPNA 5E6YA 1UUNA 4JFZH 1YEIL 1X9RA 1XEUA 3K4AA 1CDBA 3VSUA 4Q6IB 5I82A 2IH3B 4M4RB 1IZJA 5DF0A 1R3KA 5MEQA 1LILA 2YQBA 1AO7E 1I8KB 1RIUL 1UD8A 1CMOA 4ZODA 1RXLA 5ELIA 2X6MA 4XRCB 4IU3B 3GHEH 2X4NA 2OL3L 3ARGA 3GXFA 1BF2A 3QIBA 3CVHH 4PJ9D 3FTXA 3SDYL 3U7YL 4C54A 3HS0B 1X3DA 5DD6A 1NAKL 1DVQA 2D7NA 4AMXA 4LHUG 5C9KA 5A2KH 4P5RA 1B3IA 1DBBH 4NM8H 4OZFH 5F7AA 4PW4A 2OTUB 2PYEA 3KLKA 3QJRB 1N5AA 4NDMB 4MNGE 1U8CB 5ILTH 5CSGA 4IGBB 3UBHA 1IU1A 1AAJA 2EVFA 5DGQA 4PJ7A 2CPCA 3KJ6H 2EIBA 2HVJA 1WFNA 4U1GB 2YSSB 1AQ8A 1KJVB 1QRNE 4PUBL 4M9OA 4WWOA 2ZJSH 3UACA 3AW5A 2APXA 1RFDL 1KN2H 3QG6B 4MA8H 1OOWA 1M53A 2VDPL 3DK2A 4MKMA 4P2CG 5C6PB 3VD4A 2DV6A 3HPJA 4HISA 4OZGF 3Q06A 2NR6A 3I3DA 4R7NA 1YQVL 3DYMA 5A3IC 1KB5A 2EADA 1JHKL 2X9XA 1N8ZB 1XBRA 4Y9BA 2YXWA 3IMRA 1P9MC 4Y1AB 3HHMA 4Z7VA 4OSUH 4TXVB 1IGYA 3LCYA 4NPKA 4K7PX 1PLCA 1BM7A 4A04A 2I5YH 3MBEB 5FYJH 2JJSC 3L45A 5FOBB 2MTPA 2ZWNA 4G3YL 3OJDA 2PETA 5DZ9A 2ROYA 5KYYA 4HD9A 3ILPA 2N0MA 2UWEB 4X4ZA 3VXUB 1U8OB 3G9VA 2HJKB 2AQNA 1NFAA 43C9B 4OKVB 1BFVH 4HIJB 3I6KA 3MRRB 2EACA 2NY1C 3RNQB 3S8GB 2DM3A 4YNYA 3VQ1C 3LEXA 1EHXA 1GIGL 4PJHB 1PJWA 2CDGA 4K3HA 5I30L 5CP3H 5L0QC 1SY6H 3FSAA 1O7DC 3MLUL 3QARA 4A7UA 1QQDB 3PHOA 1A3RH 3MN8A 2YMXH 3Q8EA 1NMBL 4O02H 5CGYC 5HGDA 3LS4L 2KDYA 3VXRD 2GSGA 4PY7B 4C83A 4N68A 3LKOA 1FNAA 4E42A 5BPPA 5D4IA 5HDWA 3I9GL 3C75A 5BQDA 3FQTA 1ZV2A 2HX7A 2R4RH 3QWRA 5IR1B 3NZ8A 4ODXB 4F7TA 5DMIH 3T77B 1FVCB 1IAOA 2A0LD 3NJIA 5MP6H 1OARH 4FQXC 4BFBD 5IROD 4Z95H 3I9IA 3RBSA 3IPFA 4ZUUB 5EO9B 4NKDA 1MG2C 4NZTH 3DO7B 1AGCB 2WLHA 3NSDA 1IEBA 1INEL 5E9DD 5F93C 2WXOA 5DJCA 3ZOAA 5MI0B 3OAZH 2GW5A 2X1OA 4JM0A 4XVUC 4XNZB 4P2OA 4D9RD 3FXIC 1F00I 3EFFA 2OMVB 2YEQA 1TSHA 3BPLC 1QLFB 1UM6H 3FOLB 4PD4J 4XXCA 4DK5A 3RIFK 2KHAA 1PLAA 2HT3D 4M61A 2B59A 3BISA 4QHMB 3EJYD 4KOBA 4CW1A 1IAIL 4WI7A 5IVZA 3ULSB 3SPCA 3ARGD 3I2CH 1RURH 1Z3GH 2DTSA 3KPRD 2XWCA 3WNKA 3DX3A 4ODHL 3O6LH 4OTXH 3U6XS 1NLDH 5BVJB 2R1WA 3QJVB 4I2XB 5DQ9A 3QR0A 4LU5H 4BWWA 3CFBB 5AB9A 4N90D 5C3TA 3EYUH 3CSPA 2WVUA 4X4MA 1UB6B 4IOIA 1EXUA 3CGTA 4R84A 5DK0B 4RGNC 3D25A 1RL1A 2NYKA 1EO5A 2NNFA 1CICA 1MQKH 1H19A 2YZ8A 4Y5YA 1XCXA 3VFSA 5IB4B 4OBSA 3E3QC 4FFVD 2W0PA 1BJ8A 3PG2A 4JFWA 3ARDD 2BSSA 3V5HA 3KG5A 4I4WA 1AJ7L 3R8BB 2NPLX 5CJQL 4JFDB 3II1A 1MI5E 3VG9C 1JMZA 2NR6D 3N5AA 5D4QA 2DF3A 4K94L 1UKQA 5DC2A 5DFWH 5J6HB 2ZOKA 3FUHA 1S8DA 4MRBA 4ZUWB 5JW4Q 4S0HA 4HSAC 4K9EC 4XVSH 4FTVB 3MCG1 2XFXB 3DIFB 1A3LH 2JKTM 3S5LG 1DVFA 3K6IA 3VXMA 4O5LL 4XMPL 1PQZA 3KCPB 5CD5D 1AGFA 4NRXB 2HSIA 2A3TA 4QAMB 4TSAL 1FNEB 5CEZH 2WO2B 1NQBA 4ZZFA 5LBVA 3PABB 4KKBD 1HHHA 5FYKE 3GNMH 3L6FA 2E74C 4Z77B 2OYPA 1SLUA 3GKWL 1ASOA 3VXNB 1ET5A 4Z7WE 2FATH 2ZAIA 4OVVA 4UNVA 1WAAA 3H85A 1AGBB 4PY8I 3SKJL 1W80A 2AEPH 2I60H 3B2DC 2P4AB 3O0LA 5FK9B 4MWFB 3EG9B 1M6OB 3DUUB 3LIZH 1NC2B 2FCBA 3FW6A 3L9BA 3VI3A 4DKFL 1RJYA 1OE1A 4MXWL 3R4DA 1G1OA 1ZLDA 5I1CH 3HAEA 4UB0L 1XR9B 2WLLB 2YLHA 4LBEA 3OXSB 5FYLL 5JNYB 5C0BE 1GGIH 3SJVE 4X8GA 1QUNB 3QWRD 1UURA 4B0MB 1KTJA 3VFUA 1DJXA 2Z35B 3P02A 2Y3AA 3NRQA 4GLRI 2KZKA 2DWEA 3GMRB 5FECB 1FZMA 3P0YH 1MELA 5AVYB 5F7UA 1R34A 4PLKC 1ZIAA 3CDGB 3GMOA 4QKXB 4Y5VC 5E8PA 1MFCH 3LVTA 5DZNA 4J8RA 4AV5A 2FWLB 5BZDA 2AXHA 3OAZK 1DJHA 1AE6L 2DQIL 5EBLB 3K71B 1JSYA 3LHAA 4P2OD 4LCUB 1NCBH 1W8NA 2JQAA 4MXVF 3H4FA 3S36L 1I4FA 1Z32X 5HGGS 3DX0A 5D5MF 5GGSB 5TH2B 3RNKB 3ZT7A 1ZKAA 4FLHA 3EJZD 3NZSA 4N0YL 1RKRA 4KVCL 4LAJH 1T20A 2A1WH 3MYJB 1RCYA 4CJ1A 1F45A 5GZOD 4F7KA 4NQSB 2HFFB 3RUGE 2ADIA 3JZ7A 4LLDB 3EYOB 3TVMB 4KVNL 3LQAH 2HLFC 1EX0A 1QBLL 4G8FA 4IS6A 4TQ8A 2CJSA 3FBQA 5B4MD 3ZY7A 4UTBL 3P30H 5T1LB 3K6NA 1EIBA 2AAAA 1QNZL 3RVTD 2EVGA 4I3GA 2J55A 3QUHA 3CX5K 1A2YB 1M2OA 3FTSA 4U0RB 3M1OA 1CICD 1I1FB 4WNSA 4LCWE 4YZFE 4U3SA 5DUBA 4CMMA 1OP3K 1COBA 3QUMH 2KT6A 2W0LA 3MRLA 4ZOAA 5DJ0B 4KZEH 3BZFA 4ZDHA 4NQDE 4FQ2L 2XWJA 1NDGA 4U1JA 5FYJE 3LDBB 1Z5LB 2ITFA 1OW0A 4PN6A 2FWOA 5D2NB 2V3DA 2O6FA 1T2QL 2V9RA 2WN2A 4NIKB 4Q0XL 5E1HB 4LSQL 5CN3A 3NP3A 1PNCA 4HQQL 2AK4A 2R2HA 3QUYB 5J11B 1M56B 2HFTA 1S9XA 2BZCA 5GHWH 4AY0A 5CCKL 1DVFD 4P3DB 4PWEA 1G7QB 4P2RE 3VXMD 1WFOA 3TZVB 3DSFL 1SPDA 4QRTA 1R24B 5F3HA 1R4XA 1R3IH 1KN4H 2UV3A 3A6BH 3IFOA 4Q6YA 1UWGL 2K45A 4HCRA 4KROB 2WMPB 5T3ZE 4NJ9H 4NZ8A 3L5HA 5F1IB 4AVHA 3KLDA 4R96A 5JHDE 2R7EB 3GXMA 1AC0A 3K1DA 2FJHA 4K3JH 4BDVA 2E47A 4DAGL 2QQNL 1QTYT 1N18A 5C0GA 1A47A 2IALB 4FFWC 4W9GC 2LQRA 5FGCE 1P1ZB 3FRPG 3T4AA 3N55A 1NICA 3O8XD 2ZUSA 3BT2H 4BV1A 3MRPA 3HN8A 2D9CA 3CZFA 1D2PA 1DL7L 1REIA 3FT4B 3G08B 1CF8L 1CGSL 1IKFL 1RK7A 1T7WA 1GMIA 4PY8J 4PLNC 2WYZA 3G6JA 5IJDC 5HJ3A 2ZXAA 4FI6A 3ZE2F 4FKEA 5HP5A 3GBEA 1PG7H 3RL2B 1CXFA 2DQCH 5DRNA 5TE7H 4GI8A 2RIKA 4L48A 2WBJB 2NNCA 1WICA 2A9NH 2CBTA 3ZRFC 3B3IA 3HPLB 1KGCE 1N7MH 3SGJA 1UB5B 5I19H 2EIMB 5F9JA 3VQLA 3CZJA 3NP4A 5E94B 1ID5I 4W9ZA 2WANA 2AJZB 1KT2A 5KSBA 3FO2A 3L3GB 3BEWB 1QR1B 3L1OL 2AQTA 3P4OA 1YEGL 3H3PH 4XZUA 5KSAD 3AAZA 4WDIB 1ORQA 1S78C 1SYSB 3Q6GH 4M9PA 3SQOH 1C7TA 3LKQB 3OKNA 3QXDA 3QA3A 4JY5L 4G8IB 3TN0B 5ITBH 2H47C 3UAJD 4WW2A 1MLCA 4AUJA 4Z3GA 3B9EA 3HCVB 4OZGE 2NY2D 1VFAB 2QADB 5EBMA 1J8HE 4U6YA 3D5OF 4FQCH 2APSA 2NXZB 3MX0A 3QZWG 1UZ6F 2B20A 4X6EA 2PTVA 3O45A 3BKCL 3CC5B 4JQVC 4K2UH 3DURB 5AG8A 1EAOA 2VDML 3V4VB 5ESQB 3JV0A 1UJ3B 4HC1L 3DX2A 3MUGA 4HLZG 5T1KA 4MCZB 1IAMA 1J88A 5AAMA 2ZF9A 3ENEA 2IADB 4UQCA 1V05A 1RK0A 3B9VA 4LF3B 3VH8G 3C9NB 2DMKA 2ATKB 1H15B 3GPSA 1NCDH 1UKSA 3A22A 1YMMB 2R39A 4G9FB 4B9GA 4XE0A 3MLWH 4EQ2A 3V0WL 3F5WA 1BIHA 1P5VA 3TT3L 4N0UA 4DQAA 5KVEH 1WFUA 3JV4A 2BP5M 4ZOEA 1AP2A 2X4SA 1RZGB 2ZOLB 4BQCA 5ACZA 2ICEA 3HRZA 3STBA 3AGWA 3MODL 1AMXA 5LAXB 3JTBA 3V52L 3EIFA 4HMDA 1NLBL 1GYVA 2MNUA 1Q0YL 3CJJA 3O6KL 3OHXA 4XBEL 1KLGA 3TYFA 4EI5A 3SBWC 4EZMA 1DEEA 3BD5A 2AK4D 5E24E 1T1ZB 5TK4A 4LL4A 3HLKA 1TTRA 3IDGB 2Y6SC 2GABA 1IGCL 35C8L 4L3AA 5I1HH 1ZV9A 1J7VR 3SEPA 3MZGB 4POZD 3WO4C 1M2VA 4MMXB 1VDGA 2KYIA 3KVPA 2R69A 5I6OA 3P77A 2FX9L 2IIJA 3DOSB 2C9XA 1PIFA 4Y7OC 1RUPH 5KYUB 3NABL 2QVMA 1BZ7A 1E9PA 2IANB 3TNNA 3FT9A 1U33A 2WXMA 1V3LA 1TSRA 3B2UD 2ZCKH 3HG1E 4X7EC 4YSRA 4GSQA 2HRGA 3DXAA 1TKWB 2ZYRA 3BVVA 2CO7B 3B9DA 2PYFA 3QVAA 2K6YA 5B39G 4ZO6A 4NRZB 4PBWD 2CO6B 4UZSA 1YEHL 3RTQD 4M1GH 3DJRA 4BZYA 1S5HA 1LL1A 3ZGHA 5HHQA 3WNMA 4Z7NB 2D2CC 1B90A 3QAZC 2OFQA 5LN8A 4YEEA 3IMWA 5EDSA 1BFOA 3EH5B 3ZMRA 2W80C 2NQDA 2X1PA 3FONB 5C97A 1DUZB 3QEGH 1UFGA 2W9EL 4NEHB 4OD2B 4ZS7L 4ZD3H 1IL1A 3DX8A 2PW2A 5ESVA 3Q6FB 3Q5YA 4GQ9H 5T5NG 2XX0A 3T3PF 2XG5A 4UIKL 4Y9GA 2ZKHL 2J8UF 5LHDA 1RIHH 2FBJL 4LLYA 3MLZL 2C9RA 4FNSA 2N7BA 4BEIA 3NYKA 1PZCA 3DGGB 3MA9L 2E27H 4GRLA 1FP5A 2MPAL 3FTYA 4N3TA 3A21A 4IKNA 2OLDA 5DI8B 5GS2D 3TFBA 3X1EA 3NFPA 1YYMH 1HQRA 2VMFA 2IPKA 1EDYA 5LGJA 5DS2A 2WUBH 5GGRB 1WZ1L 4AV0A 1QABA 3EBGA 1CQKA 1KGIA 4CA4A 3KLHC 3QXTA 1BVLA 2LU4A 4FNLL 1IC1A 2XYCA 3B1UA 3R19A 4YHPB 1NGWB 2JLPA 4KDTA 3D51A 3FFCB 2ZOOA 5DJ6A 1QLEB 1EJOL 4NQVA 2BVPA 2W0KA 1IBDA 3UTSB 5DD0L 3MTRA 4APQB 2CLRB 3LEVH 3WFBL 1MCJA 1G4RA 4OJFL 4NUMA 1WHPA 3BUIA 4U4IA 1JI1A 1VAHA 4WV1C 3DO4A 4BKSC 5JOFA 3ZIYA 5T1KD 5CR8A 5JHMA 3BH9A 2N1KA 4GXFA 4PJXF 1YNKL 5KVFL 4RX4A 3QDJA 2RB8A 3F7VA 3LNGA 3IFLL 5JOPD 1T22A 2YKKA 2PLTA 2O5ZH 2ZCZA 2MCPL 1MFVA 3KR3L 2G9KA 3QBTB 1DN2A 1G7HA 4LQFL 4QTIL 2OMWA 4FFYH 4H8WC 3DV6A 3Q1SH 3SO3B 1E4WL 4JY4A 5T3XE 5C0AD 2B1HH 1XO8A 5CJBA 4HAFA 5D1XE 3QPXH 2OSWA 3MLTB 1RHHA 4DESA 1KY6A 2DQ6A 5E2UL 2WUCH 1GSKA 5CBEA 4FI7A 4JO2H 1J8KA 2CR3A 4PJAF 2YWYA 3SQBB 1AR1D 1MWAA 3Q8BA 4PP1C 3G6DL 4EI5D 3IKCA 4ZFQA 4DTGH 1Q9OA 3MJ8B 2PW1A 3NZHH 2YAEA 3WUWA 3LJ3A 4H0LC 1MRCH 4JG9A 3ESVF 1NDMA 4PRAA 2A4CA 4WW1B 3L3HB 4FP8H 2F58H 1CK0L 2VSCA 4M6OL 1JGIA 5JO5A 3X12A 5AVTB 1OGTB 2VSDA 2X4OA 4H40A 3HG4A 2H2SD 5IESL 1OAUH 3BEVB 1YRKA 5TF0A 2FZ3A 4LVEA 2YPVA 3QG7L 4L4VE 3QRGL 4KJQD 4B9FA 3K1KC 2DQFB 3PWPA 1AOZA 1ZHKA 3EJJX 3IMTA 4N6RA 4U7SA 3AGVA 2YN5A 1NCOA 1F8TH 5ICZB 1G0XA 1JN6B 1AACA 5HHOE 3B9KA 3GDBA 4ZJ9A 1VHPA 4W9CC 3DXAD 2ZUYA 1LYQA 4M8QB 2EYSB 5FFOA 1RK1B 4FMKA 4OZFG 5TQ2L 4IKLA 1KB9K 4PRPE 3RVXC 5D5ME 1QI5A 3UGXA 3BUPA 2NQCA 1FFRA 2A99A 2X4QB 2A9BA 2KUTA 3OR6B 4W4NA 2A6IB 5EF0A 3GHPA 1WITA 2IAMD 1NBZA 2I7OA 3HLAA 1X5AA 3ARPA 2IV9A 3EH2A 3OG6B 4Y1TA 5EOQL 4YHML 1KEGL 1T66C 3RDTB 1XGPB 1OPOA 2J1YA 3QDHA 1KLUA 2AVFA 4W68A 5DHVH 1J86A 1SHMA 4OQTA 2HH0L 4JCLA 2LVCA 2XIIA 4E41E 3N85L 1J18A 1KC5L 2B4CC 3WJLA 1L3WA 1UD2A 1F6AA 4AJ0A 5L2JA 1UXWB 1DJGA 3GMPB 5BRQA 2YXMA 2UX6A 2CHZA 4KX9A 3UCRA 3GZOA 3CFQA 3DV4B 4PTTA 2ZWYA 4Z18A 4ZG1A 2PXYB 1LE9B 1A9BA 4Z0BL 3P11H 2HYMA 3C5ZC 3QDMD 3QT2A 3TS8A 5FYKU 5GPRA 4F2EA 2XN0A 1LP9E 1S2EA 1F56A 3BXNA 3C5JB 2HRPL 1HAUA 5F3BA 4X6DF 3CLFL 1K5NA 4A2HA 4ZFGL 5KS9A 3BE1L 1ZSHA 3EJSA 3WFHB 4DP5X 3C60A 2NYZA 4MKTA 4W9LC 3PGDA 5T5FA 2PP8A 3FAXA 3U48A 1SXAA 4HIHA 4PB9L 3W3BA 5SWZA 3JWOH 1AXSA 2P44B 3KH3A 1XB6A 2IXQB 5GGQH 2PCYA 3GUFA 1VACA 4MA1B 4PCSA 2W92A 1A66A 1JGLL 1AHWC 1UD3A 3T6XA 3RLSA 4OFYD 2F54A 4TNWF 1EK3A 1N19A 3KPOA 5IT2H 2L04A 1KPVB 4J3OC 1N8OE 4FXKC 4I9WE 4HIIA 4RFEB 3AC0A 1N4XL 2X4RA 3OGCA 4DKTA 1UA6L 3V5KA 4AGMA 1PCSA 5KOMC 1N59B 5SX5H 2CBQA 1UVQA 3H6AA 4LHUB 2EE3A 3W9DA 1C1EL 4A2FA 2ZXWB 4JS7A 4M1CC 2VDNH 4G7VL 1WFIA 1T7XA 4DVBB 2HB0A 2DI8A 3FO9B 4Y4HC 3EOTL 4PLJC 4GKSB 2VTFA 5K9JH 1N70A 1TJGH 1H8LA 3ZE2E 2DDQH 2VXSL 3MNVB 1HEZB 4K0OA 3QH3B 5F9OL 1VFOA 5AVQB 3AY4C 1IGMH 1WT5C 2FHBA 1IC4L 1CLVA 2IOIA 3FN9A 4X6FB 4B3EA 1GS7A 1NKOA 3O4LB 5IJKC 1NBQA 5CP7A 3CMOH 3NN8B 4K71C 1OAYL 4RGOL 1A1MA 4KPHH 5F7NC 1I85A 3PWPD 1OLZA 4PJGA 4JHBA 2EO1A 4MB1A 2OR9H 1K2DA 4OZHA 1GCYA 3B9KD 3BGMB 4WFHD 4YDLC 3BCFA 5IQMA 3JTTA 3H9HA 3U36A 2KDGA 4RFNB 4RMBA 3KE0A 1J5CA 4WCYL 4XXDB 1NM4A 3EYFA 4OD1L 1MF2L 1WC7B 3SCMC 3QCVH 3UZVB 1R6VA 3TT1L 4FE9A 2XN9B 4QRUA 2F1EA 5ABDE 4LNRA 5ID1A 3V6OE 1KCSL 4MJ4A 4K5MA 3P9MB 3L54A 4HGWA 3U2SA 4IIZA 1EZLA 3V7AG 3T3MF 3EJPA 4QRRA 1OM9A 2X42A 3V6FA 4NBYB 1UHVA 1UZ6E 1XL6A 4HCIA 3QQDB 4HPHA 3T3PB 3BX7C 4PVBA 4E0RB 2J8UB 3S98A 3NA9H 3B34A 3H54A 2N59A 4O2CB 1SUHA 2EEXA 1IM3B 3K91A 3FT1A 3KYNA 3MREB 4U7KA 4XN7A 5GQBA 3UTTB 1GOFA 4G6JL 1AD0B 5HVGB 3J2PA 4YFDB 1CLYH 3BUDA 1ZLSL 4Q6IA 2IH3A 4M4RA 1XVSA 2EXSA 2YGQA 3LH8A 1U30A 2P43B 1B6UA 1I8KA 5IQ9B 3CN1A 1CE1H 4RLDA 4DFIA 5DD1H 4XRCA 1IQDB 4IU3A 2GY7B 1VSCA 4BH8B 2DL2A 1SDDB 5ALBL 3HS0A 5I9QB 4NCDA 5I1EH 4JE4B 2QBWA 1FORH 2XTJD 4OLYL 2VXQH 3C60D 3PHQB 1KB5L 4GAYB 2OTUA 3UYRL 3L9YA 3QR2A 4QHUB 4NDMA 1U8CA 5DHXB 1RP9A 4LPXA 2ICWI 3F85A 4IGBA 2CM6A 1MW3A 2AS5M 4AMKL 5GZNC 3DBXB 4HIPA 1TQCC 5SWZD 4AEFA 2QHRH 1U93B 5JPNC 2YSSA 4M02A 1KJVA 3IFPB 5EU5B 3ZLQC 5ESAB 4GP8B 3K4ZA 5SWSD 1YDPB 2F54D 5K33A 1HHJB 2WXJA 1BOGB 3N43B 5HHPB 2QEJA 1KIQB 1TZGH 1QHQA 4Z3HA 1RQ5A 5C2BH 4NN6C 4YL9A 3FPYA 1VFBB 4I3RH 1N8ZA 4NOBA 5GS0C 4JR9L 3DX6B 2YUVA 2QVFB 4Y1AA 3EFOB 4ZQTA 4LASH 1I9IH 3TGXA 5MENB 3GS7A 3MBEA 5E00B 4J5VA 1YC7A 3IT8D 4UBDD 4YHYC 1F0LA 3X3GH 5FOBA 3CXFA 4Q9BA 4UQEA 1MPAL 1I1CA 3D08A 3ZZSA 2FX7H 2ORBL 2UWEA 3HB3D 3UZEC 3S2AA 3VXUA 1U8OA 4DKAA 2HJKA 5CZVH 4QLRA 4XMLH 3FH5A 3SE3A 43C9A 4OKVA 3R06B 4HIJA 2GCYB 2HRLA 3MRRA 4GRWH 4LPTA 3QUXC 1CL7L 4PS4H 1FPTL 1W6LA 4X7SL 3RNQA 4A7TA 4ZFFB 1FI8C 3REVB 4PJHA 2ZUVA 4OLVL 5DD3L 4CNIB 1HH9B 2QLYA 3MSPA 4AYMC 1QQDA 1QX1A 2YJLA 2UZIH 4X6CE 5IZ7A 1ECYA 3QEQB 4LDEB 4ZTPL 1BGXH 3RPBA 3S5LB 1GGYA 3MJWA 4XPTH 4C4UA 2IPUG 3E8VA 4PY7A 1LD9B 4JB9L 4ZAKD 1QWHA 5GSRB 3K46A 1U95B 4JG1L 5I0XA 2B3IA 2JKWA 5D7LB 1OAZL 3QNFA 3TNMB 4ODXA 4AL8L 3HC0B 3NCYP 3T77A 1SJXA 1FVCA 5IR1A 1XGTB 5ICXB 4JFFE 4I1NB 1WIOA 4ZUUA 5EO9A 1Y7VA 3DO7A 1KPUB 1AGCA 4QRRD 4OU3A 1JZFA 5EZPA 1NKRA 1UA7A 3AVEA 2YD7A 1ACXA 2HKHL 3LKNB 5DWUH 1E30A 2ZXCA 5F0LB 4UT7H 4NHUB 2NY1B 1RU9L 2ESVB 4NNPH 5T1DH 4LGRB 2X41A 5DJZB 4JHVA 4AZ8B 1PY4A 1JD7A 2OMVA 3AS2A 1TMCB 2BNRE 9PCYA 2X6CA 1QLFA 4F27A 2JQZA 3FOLA 1V54B 2VDLL 4GMSH 2Q86B 4C4KO 5EEWA 1LO3L 3BHBB 2WYTA 4HEME 4IEFB 1GC1H 4QHMA 3AS0A 3IBEA 3ULSA 4EIZC 3DUSB 2Z8SA 4QRFA 2XACC 3RVVC 3H9YA 5A6IA 5KTEH 5BVJA 3U7WH 4FQXB 5CEXB 4PJAE 2EKJA 4DWHA 1G0DA 3P73B 4I2XA 3ZO9A 3CFBA 4I77H 1DQML 2Y5QA 1QFPA 1TQUA 4KHTL 1Q9KB 1PL3A 1UB6A 2ITEA 4Y88A 5DK0A 5AVWB 3CZLA 4GBXC 4K7PL 1QHOA 5K1JA 4LSSL 3T1FB 3PUUA 5A2IH 5IMLB 5MEOB 4BXSV 5IB4A 2FEEI 4FFWD 1G1YA 4N8CH 1URLA 4PSRA 4Z7OF 5ES4B 1MG3C 2ZP0T 3BPLB 4I5BB 3JT2A 1N6QH 1JNJA 2B5IC 4JFDA 1TQBC 2HTKC 2KPNA 1CIDA 1MCPL 1KELH 1O5DT 5J6HA 3DVFA 4POUB 4ZUWA 4AE0A 4BFIB 4M7JL 4GEJA 4FTVA 2XFXA 3DIFA 2IDQA 4HVBA 1S7SB 1RZJC 4Y1AD 3SD5A 4OFQA 5HDLA 3V6OC 3ULUF 4NXKA 5CZXC 4JUTA 3GJFH 1CBVL 4YJZL 2Y6TE 3GSOB 1YZZA 4PWIA 5L2KB 4NRXA 3KYKH 5KWYC 5IREA 1XF1A 5J57B 1CXKA 1FNEA 1Y1DA 3GQFA 4UT6H 3PABA 5DJDB 4RGNB 4QHPA 2WINB 3VXUD 4Z77A 3H0TB 2YAQA 5CZRA 4YMPA 1UH2A 1DJZA 1ACZA 3VXNA 4LT7A 4M93C 1KCRH 1S78D 2GBTA 2ZG1A 1AGBA 1CLOH 2ICCA 2QPDB 1P7QD 3L08A 3TJHC 2JTYA 3FCUB 2J12B 2VLKB 4KU1A 3EG9A 4MWFA 5FK9A 1M6OA 4MZIA 2BXYA 3DUUA 1NC2A 1FNSH 1OF0A 4BCZA 2R8SL 3J07A 5BV7H 1CGVA 3IYLW 3K8KA 3VG9B 4MAZA 1SDYA 3DPBB 1ASPA 3MLRL 2IWFA 1XR9A 2WLLA 2PPFA 3OXSA 1RULH 4EOWL 5JNYA 3AXIA 1M57B 1C8PA 1FV1B 2WZ6A 3WFEH 2XVBA 1QUNA 1FGVL 1HDMB 1FSKC 4HWNA 5IKCB 4RZCB 2MCAA 3RWCB 1W72B 1KIUB 2Z35A 4PJBE 4P5MB 3GMRA 4JHUA 3CHRA 5FECA 3FH8A 4MNHB 3NRPA 4P23B 3T3MB 2JK5B 4NI6A 3CDGA 1IILE 2A73B 2V2WB 2XKNB 2HFGH 1UZGA 4F57H 1UT1A 5L88H 3W37A 3PP4L 3GD1C 2DWYA 4JPQA 5EBLA 2FSDA 4PJCE 2X88A 4GSRA 4LCUA 3K71A 1RZPA 3GJEB 3DNKA 1U3HB 4FZ8H 1SVCP 3KEDA 4W4OC 3ULVL 4WRLA 1I1RA 5GGSA 5C08B 5TH2A 3RNKA 1AO7B 1EO7A 5JUEH 2E7MA 1FIGH 4DEPB 4A68A 1L7TL 1SEQH 3MYJA 1JWSB 3C2SA 5GISH 1BF5A 2CGZA 5AKSA 1BZOA 5FIEA 1AC6A 3BSHA 4NQSA 2HFFA 4LLDA 3EYOA 3TVMA 4R7XA 3X3FL 4R90L 1PMYA 4X9HA 2DN7A 4ZTOL 5EC1B 2Y6SD 1DVSA 4G1MB 4MNGB 4XMZA 2JFCA 3RGVC 5F44A 2CBOA 5JDSB 5B3JE 5C9JB 3FU8A 4L18A 4G7SB 2D73A 1QSFE 5T1LA 2WJ7A 4N0CC 2XG4B 4N2GA 4Y5VB 3K2KA 3JV5A 1QRNB 3EJQA 1GA2A 2HP4A 2Y07H 3FL7A 1XGYL 1A2YA 4AUYA 1HE8A 1I1FA 1WCQA 3QPQD 4UMSA 2QQLL 4PG2A 4V1DE 5DJ0A 4P5TB 4HCRL 1ZXKA 4X42A 3BUBA 1J8SA 3AB0C 5IBLC 3HNSL 3BQUB 2P5WE 2RTTA 1Z5LA 4PW3A 4YK4B 5EU6E 4WI4A 4DEUA 1EDHA 4HHGA 3L9RB 3HNVL 5D2NA 3QZWB 2B1AL 4UTAH 4OZ4B 4JQXA 1KGYE 4FTVD 3QUYA 4WGKA 1F2QA 3B2VH 2IQ9H 3PAUA 3T6ZA 2ENSA 4NGHL 1EHKB 5L6YL 4P3DA 5IB1B 1G7QA 1YEEH 1T03L 1WTLA 3GJFK 4GRWE 3TZVA 1QW8A 4OGXH 1R24A 4C4KT 4NSKB 4U3XA 2WM0A 1ACCA 2R0ZH 5K69A 2WMPA 1ZS2A 3HBQA 3S4SG 5F1IA 2D3VA 4DERA 2R7EA 3WNOA 2EE6A 1BZ8A 2IWEA 3CX5J 3MXWH 3IDNB 2IALA 2IGFL 2J7LA 4N5EC 3WHE1 1P1ZA 2CK0L 2KLSA 4X7TB 2GYSA 1P6FA 2X4TB 4H8PA 4Y2NA 5B7FA 3KLQA 3V4PB 4FS0A 2DD8L 3UGEA 5LCVA 5IM7B 1LLAA 2D03L 2RQ8A 3FT4A 2APWA 3G08A 3T09A 4LLWB 5D9SB 3BDYH 5J12C 5A2FA 5KVDE 4YXHH 1E4XL 4A6YL 4BFEA 4KQ3H 1KCUL 3KXFD 3RL2A 3KZ8A 3BP5B 5B3SB 4CL7A 5CJOH 2WBJA 1FWXA 2DL9A 1CLCA 1DE4B 4FJZA 3MV9D 1G6VK 3HPLA 2HT2D 1BD2B 1N12A 1UB5A 3HI1B 3K6DA 3TEYA 2DM2A 1U8PB 3WEAA 4EKJA 4APXA 5E94A 2V5MA 4JFUA 4LSDA 2AJZA 2AITA 2QKIC 1FO0H 4XNAA 5IOPB 2GIYA 3L3GA 3BEWA 4DN3H 1QR1A 5B21A 3BMVA 1IB5A 4QRSB 1IV8A 1ETJA 4WDIA 5JDJA 1SYSA 1T7YA 1KCLA 1WRFA 3LKQA 4L3EB 4RWYL 1JG9A 2WQSA 1CTMA 5GRUL 5F6IB 1TTGA 2YKLL 4G8IA 3TN0A 4E9QA 5MHSD 1MJ7L 3V9EA 3CZNA 3NESA 3WAJA 4AZUA 5I75C 4P2AA 1EO8L 3BAEH 3HCVA 1YEIH 1VFAA 2XVKA 5C92A 2QZ5A 3CVCA 1LTXA 2P46B 5AENA 2EQDA 3CC5A 1HINL 3OLGA 1CI3M 3DURA 3IJSB 4GT7A 1RIUH 3V4VA 5ESQA 3VD1A 1UJ3A 3SPHA 1E4KA 1OVZA 1YJDC 2OW6A 2OL3H 1PJ9A 4MCZA 4F9PC 1IC5L 2HTLC 2IADA 4U1IB 3KPPB 5E2WH 3SDYH 3U7YH 5T1LD 4LF3A 1A7NL 2ENJA 3IJHB 3C9NA 1MIEH 3NJMA 4UOQA 1NGYB 4IBWA 2ATKA 1H15A 3KGUA 4OBRA 1DBKL 3WJJA 4XMWA 1YMMA 3ZO0A 1O75A 4BQ6A 1X7QB 4G9FA 5BS0B 2OAAA 3GRWA 2HT4C 3F58L 4Z7OB 1EZSA 4HD5A 1A1NB 3ARSA 4RFOL 2YRPA 1RZGA 1ADQL 2ZOLA 4AQ1C 3HBPA 4ZUSB 6PCYA 1JL8A 3MA7B 5EDXA 3X13B 5DD5L 3GGWB 3RVXD 5LAXA 4P9HH 1IKNC 2H1LM 4GSUA 2VDPH 1YVLA 2ZX9A 4WWKC 1T1ZA 3QUYD 3VD7A 3IDGA 2BZDA 3JWDC 5DJXB 1QPPA 3U0PB 5EZIL 3QULB 1YQVH 1H3TA 1JNHB 4BZ1A 3GXNA 1T89C 4TTGA 1JHKH 3IDXL 4JQIL 5BXFB 2E7LC 3HC3L 1HVXA 2O26U 3FQRB 3GRBA 4MSWB 4MMXA 2V2TB 1UXSB 4WO0A 5JA8B 2WWKO 4KROD 3DOSA 3RKDD 5D2LF 1CXLA 5KBDA 3GZQA 5E7BA 3RVUC 5F7DB 5KYUA 3CZGA 5J56B 4FLRA 5DFVC 3ZHLA 2IANA 2ZYHA 3QHZH 5JR1H 2GTQA 2XPYA 4G3YH 1UWYA 1WWAX 4XWOC 1DZ0A 5LXGL 3SDXB 3TBSB 4ACPA 3ZE0B 5L8JB 1TKWA 2CO7A 2IBGA 4DO5A 3B43A 4FI8A 1ZHBB 1BZQK 3H2QA 2CO6A 3ERXA 4PWJA 4EI6B 2E9IA 4U1KB 3GLZA 1CF1A 1GIGH 1GHFH 3H53A 5C0BB 3SJVB 1MVFA 5I30H 1BQHB 3MLUH 5JYLA 4Y5XC 2WYIA 1NMBH 4U1SB 2CA4A 3FONA 4L23A 1DUZA 3ZYZA 4OD2A 2WBJD 1E3ZA 3LS4H 4XN9A 3GO1L 3MOAL 3Q6FA 1UACL 4KJPD 2MQCA 4R4BB 5ENWB 5KVGL 5FO7B 1QFOA 4WFEE 5EF1A 4HG4J 2GJJA 5KOVC 3HFML 2EIZB 3I9GH 1OTSC 4B9CA 4GMTH 3CPLB 2Q7AA 1K5WA 3DGGA 4PRHD 4WHTB 4N1HB 3AJ7A 3CVHB 2XU9A 3HR6A 1HHGB 1QFWH 3VDCA 1L6XA 5DI8A 1SXNA 4AEIL 4AVJA 2I85A 4OLWL 2WXQA 1NCWH 4OZFB 1CDYA 1Q0XH 4OCWL 2DIEA 4N2NA 1INEH 1IZKA 5GGRA 3TN0D 2VRKA 3GINA 1CD1B 2WWMC 2WZAA 3Q5TA 1OT4A 2NY3C 4GS7B 4OZIE 4Y9FA 4YHPA 1Q8MA 3RGHA 3LXAA 4LDOB 5FO2A 4QRAA 5HGAB 1QPXA 1HC1A 1B88A 2XQYK 1L7IL 2KL6A 3QAZB 4NQCE 2QADD 3UTSA 4APQA 2CLRA 4X7DC 3KS0H 2NXZD 4AQEB 2H8PB 3QZNA 1DUYB 4YIQB 4PREB 3O3DB 4EIBA 4AC2A 2PNDA 3MBWB 1IAIH 4P59L 3V79C 3TP4A 1EA9C 2R59A 1J5IA 3QJQB 1MCKA 4ZX5A 2V5SA 3QUZC 3HUJF 4ODHH 1U8HB 4FDWA 3PL6C 4YWGL 4YDMA 3OJMB 2HMIC 3QC6X 3MROB 5ADOL 4MB4A 2O72A 2GHWB 5ICYB 2P5EE 4NQDB 5FGBA 2C9PA 2EXYC 3GPEA 4LPWA 5D1ZB 4FL4C 1JF1A 1U8LB 3QZLA 3MLTA 1RIVL 1XCQB 4RDQG 1ZLVH 4ZSOB 1N0XL 4OD3L 1YA5A 3U0WL 3WOVA 2Y36L 1JV5B 5IHHA 4GW1B 2BLFA 3SQBA 4M5YL 4B96A 1ITBB 3WJMB 3SCMD 4P2RB 5F7LB 1AJ7H 3L5WB 3MJ8A 3Q3GB 2VUYA 3RZWA 2LAGB 4WW1A 3L3HA 2FGWL 4WV1B 4JRYB 1NANH 4Q9QL 5L9DH 2FUTA 5JHDB 2N0KA 3X14B 1WAEA 1H5BB 1OGTA 1GYWA 2VXVH 2VWEE 3BEVA 4O5LH 4XMPH 3KBPA 5FGCB 4WWNA 2VR5A 4P46C 1T4KB 1KJMB 2DQFA 4IRZL 4J3UA 1UGKA 5DS1A 4G6KL 4MD0B 3L17A 5ICZA 4EXKA 1JN6A 5CM1A 1QSVA 2FL5B 2Q10A 4OIAA 3D85D 4NC2B 5FKAB 2NY5L 1J9QA 3MO1B 4X5XB 4M8QA 4P04A 2EYSA 3GKWH 1RK1A 4UQAA 4XBGB 4XO9A 3CVIL 4PH8A 5IFAL 1CFBA 5F7WC 2A74C 4LCYB 3SKJH 1NUNB 4HUXB 3QR1A 1LO2L 2X4QA 3TO4C 4BRVA 3OR6A 1Y1UA 2A6IA 3GS4A 4IYKA 1S9YA 1P5UC 1LMIA 3L3IB 15C8L 4FQ1L 4MXWH 4XVJL 3VM5A 2GHZA 4C59B 4PJIE 3RDTA 1XGPA 1DVXA 2QSQA 1I9JL 4FG6D 4JHAL 3KWVA 1I9EA 3TBCA 1MHHB 2NZ9D 4JL1A 4M5TA 5CN2A 3ZKMC 4PS3A 3U9UA 5DRXB 1LE5B 1UXWA 3GMPA 2E0PA 3IMBA 1TVBB 1PZBA 4HXBL 3DV4A 1BEYH 3MDJA 2PXYA 1LE9A 5D4HA 1I1YB 4URTB 3M17B 2WWKT 2F18A 1BZ9B 4YSAA 1X5XA 2DQIH 1AE6H 1J8HB 3WI9A 3C5JA 5AAPA 3FYIB 3F64A 4OF0A 3C2AL 2QV4A 3FFCD 3WFHA 4XOCA 3D4YA 3RE0A 2VM9A 2BHYA 4HWBA 3UJTL 4CVXB 4KVCH 3FHAA 4E9SA 5CJXC 5FHAH 2E9WA 2WHVA 5AKTA 1IFHL 3GFUA 5BV7C 4HUVB 2AXWA 3M45A 3AM8C 4KVNH 2IXQA 3HI6L 5D6DC 3QUXD 5KYXB 4BK5C 3UO1L 1KPVA 4WFGD 3RB7A 1E2VA 2DQHL 3WTTA 4RFEA 5JIMA 1OSZB 1JPTL 5K9OB 2ZX8A 2YK1L 1CXEA 4YO0B 5I8OH 1EVUA 1QNZH 2CR0A 1ETZB 1VPOH 1FFOB 1N59A 1CR9H 3C6EA 4LHUA 1ZLVK 1LO5B 1J1PH 3LZFH 1OAXL 4DVBA 3TU6A 4ODBD 3FO9A 4J4PA 4GKZB 1LWJA 1YYLL 4GKSA 4FQ2H 1DANT 1XL4A 4Y16C 4WIQA 4L8CB 3EZ8A 4K8RC 3MNVA 4XCFL 1HEZA 3T8MA 3QH3A 5L4JA 1T2QH 2NY6C 4Q0XH 2DKMA 3A67H 4KOCA 1HOEA 4D9QD 4FJYA 2O5YL 5I26A 4WUUE 4X6FA 3O4LA 3MLSL 3JXAA 4NOFA 2XXCB 3K2UL 3WIIL 5CCKH 1JZ7A 3MNZB 3NN8A 3RQ3A 1ZMYA 1WIUA 5I15L 5LGKA 4UOW1 1EZVY 1SHSA 1F4XL 1UWGH 4K07A 1J5HA 1EEZB 1MCOL 4S1DC 2K6ZA 4YEFA 1E27B 3BGMA 2CKBL 2P26A 2YD6A 4FQIL 4CU6A 4MA7H 1T21B 4UINH 4XXDA 4HBCL 4P5SA 5I23A 1PF3A 4HOXA 1HWHB 1WC7A 3NQIA 3QJZA 4FX5A 4OJAA 5AOKA 3UZVA 1EERB 3CPUA 2FYVA 5ECJE 3CNKA 3T0AA 3IU3B 1GYAA 1H6FA 4HT1L 2WBXA 4W9IC 4Z5RB 4P3WA 5KANI 3P9MA 4FF9A 3A4EA 3QFJE 1IGFH 3NCFB 4U1LB 1CF8H 1CGSH 1IKFH 1K4CB 4P99A 4E0RA 3QQDA 4PWHA 1AGDB 3DVGB 1QYGL 3OF6A 2J8UA 4LOFA 4L8BB 3IK2A 3QHFH 4O2CA 5C1MB 5IWLA 3MREA 1IM3A 4LGSB 3J27A 3N2JA 3RX7A 2R0KH 4K71B 2QGCA 3UTTA 6CGTA 3EGSB 5JW5B 1AD0A 4JX0A 1LGVA 2WO3B 1DDTA 3IGLA 3RWGB 1JVOA 1F6LL 4MX7B 5D4JA 2PXYD 3ARTA 3L1OH 5IQ9A 5C0FB 1XIWC 1D7BA 1T5KA 1B4LA 1IQDA 1VIWA 4NZRL 4BH8A 1QP1A 3UPRB 4KQ4H 3IE4A 3NH7L 1QO3B 1S3RA 1SDDA 1FQ9C 1Q0EA 2CU9A 3DOHA 3IS0X 4HF5L 1RLBA 2QSCH 4JY5H 3H9SE 3B6SB 1AZVA 3L9EA 4YAQB 1P69B 3MRFB 1AG0A 3QHTC 3PHQA 3QUMB 4GAYA 1UFUA 4QHUA 1KYUA 4KRPC 4UU9B 3PWLB 3LTVA 1E43A 2EIEA 3DBXA 2VWEC 2VDKL 1U93A 2VW7A 3BKYH 1AY1H 4TVPD 4UV7L 3SYCA 1UXLA 2VLME 2LLNA 3IFPA 5ESAA 5EU5A 4N1EA 2XQ0A 1YDPA 2VDMH 4LOUD 1AQDB 5EEZA 3BAWA 2XRAH 1HHJA 1I3UA 1BOGA 3SDDC 5IW1B 2PN5A 5D1XB 1KIQA 1R5IB 1WVZA 2YA2A 4MAYD 3PE9A 1VFBA 2FT7A 1UJTA 1U4EA 3PAVA 3DX6A 3ZL2A 2BW5A 4HJGB 2IBZX 3EFOA 3BVWA 4HKZB 3UAFA 3V0WH 1LWRA 3Q9QA 4CSSA 3TBBA 5MENA 5E00A 4ALAH 1DDHB 4J4PD 2JKIS 2V8LA 3ZKMD 4WO4B 4UQ9A 3ARZA 4FFZA 3MODH 3SZ6A 4X5LA 1WZLA 3AG1B 1NLBH 4OCRH 1Q0YH 1PD1A 3O6KH 4Y8AA 4XBEH 1TQCB 2Y7OA 4LESA 2GTWB 4EPSA 2MPVA 3D3VD 2AQ1A 4L4VB 5LG6A 3O4LD 3VRIB 1QSEB 2GCYA 3HJ0A 1IGCH 4X0KB 35C8H 2Y06L 1SQMA 4ZFFA 3H7LA 5DU7A 5AOIA 5FYKL 3REVA 4CN6A 4CNIA 3ZL1A 5JQ6L 1HH9A 4L8SC 1L9MA 4OF7A 3PFUA 4LXFA 2FX9H 1GMEA 2EICA 3QEQA 3VGBA 3S5LA 3GC3A 2VDQL 3RBGA 2DQUL 3AABA 4M7LT 3MLXL 2AGJL 3S37X 4YDNA 1LD9A 2X1QA 4XB8A 5HI3D 4EIGB 3NABH 3PLYA 5GSRA 4NT6B 1U95A 3PGCB 2BHUA 5FYLE 1F41A 5CINH 5JXEC 5D7LA 2GKIA 2YPLB 2C26A 3TNMA 3HC0A 2EIKB 1YY8B 3HFFA 2XN9D 4G6AD 1XGTA 3PY9A 5ICXA 2DMBA 4MQ7B 1CFVL 5GS3A 3D69B 1FUNA 1YEHH 1NCJA 1KPUA 2I69A 2XZAL 3N1GC 4MDRA 5K39B 3EYVB 2ILLA 3QDGE 4E41B 5BRZE 4CUCA 3LKNA 4JRXD 4JLRB 3OF6D 4MJIB 4TQPA 4Z78B 4JPWH 3EXLA 3T2NH 4NHUA 1GRWA 1IM3D 2ESVA 4M3JA 2W9EH 3AUWB 5DJZA 4ZS7H 4UDUB 2J8HA 4O9HL 4AZ8A 5I16B 5HYFA 1TQSA 1WGVA 2FBJH 2M2DA 2WQVA 4G82A 3MLZH 1I7RB 5E0FA 2K78A 5FWRA 2Q86A 2YO3A 3RZCB 3BHBA 3MA9H 2ATAA 4IEFA 2J6EA 3W81A 1VKXB 4GUPB 3U30B 3VWJB 5A40E 5BVPL 2RMNA 3DUSA 1U8MB 3FTVA 5I5RA 1NCTA 3E8UL 4FQXA 1WZ1H 5CEXA 1KB3A 3P73A 2VMJA 4K5OA 3AT8A 5IQLA 2YMOA 3MAWA 4FNLH 1YN6B 4MNQB 3NJGA 1A0QL 4UAOC 1MJ8L 2A6DB 4H88H 2BDNL 2F5AL 1Q9KA 5CGBA 1EJOH 1OL0A 1IGJB 5AB2A 1BECA 2JB5L 5DD0H 3T1FA 3HA0A 3I85A 5TDNB 4NQUA 3ILQC 3WFBH 4YS4A 5IMLA 5MEOA 2F61A 3SODB 4OJFH 3MV8E 3FO0L 2FO4B 3UG4A 4PJFF 5E1IA 5E8DL 2OP4L 1JYWA 4I5BA 3ZZLA 1WUNT 4X7CC 3HN5A 3CFEB 5KVFH 2GIMA 3ARFC 3MV7E 4GSDL 1I1AB 4D8PB 4M1DL 3NJHA 3P0VL 4FQJH 2J20A 1FYTE 2Z7YA 5AQ0A 2MCPH 1U2YA 4UANA 4BFIA 3KR3H 2Z4QB 2QVTA 1S7SA 3WFDL 4LQFH 4PSPA 4KXCA 4QTIH 1KXHA 4OAWB 4AOFA 1Y07A 1PY9A 3D4ZA 3GSOA 3GXTA 3WKML 5F70A 4R97C 1IFRA 5L2KA 4K15A 1ZS8B 2MFNA 5IBUG 2Z92B 5DJDA 2WINA 3ZX1A 3G6DH 1HL4A 4J3WA 3H0TA 2DI9A 4KK5D 3BPNB 3IETB 3V0IA 5T3ZL 4NZDA 3ZVVA 3EBHA 3GF8A 4YSDA 4Z7AA 2WQWA 1CK0H 4WI3A 2VLKA 4M6OH 1CZ8L 1WP6A 5TQ0L 3SGEH 2PPAA 4LRNL 4ZNCD 5I17B 5HPOA 1AKPA 4MASA 2HKFL 1TQBB 1FFPB 1ADWA 4MAUL 4AM0B 2BIPA 3IGAB 3QEQD 3DPBA 5EN2B 5BUPA 3QRGH 1MHCB 1H3UA 4G6ML 2EECA 4NI3A 3ZDZF 4DNLA 4H8WL 1T0OA 1EXGA 3RIAF 2PMZA 1FV1A 5E95B 2VDRL 2X9YA 3QCTL 5EG6C 2AEOA 5D7LD 1HDMA 2CWRA 3PJLA 1X44A 4RZCA 1A4BA 3RWCA 1W72A 4P4KD 3S4SB 1KIUA 3US0A 1Y6MR 1E65A 1TTFA 4P5MA 1F2XK 3TH3T 4X83A 2D0GA 2OTPA 1URZA 2F53B 4P23A 2JK5A 1AKJB 5EU4B 2A73A 5FFGA 3SKNB 5AZUA 3LN5B 1C5CH 2V2WA 1EHNA 2XKNA 3H9ZA 4OJYA 2DKUA 6FABL 5GGTL 2VJ8A 4K3DH 4JN2B 5I6LA 4CVWA 3VW3L 4YHMH 5EOQH 3N42B 4KXZI 4LZKA 4R9HA 3NTCL 3GJEA 4BUHA 2ESVD 1U3HA 3ZHFA 1R19A 3RGBA 5C08A 3UJJL 1AO7A 1WPCA 2HH0H 2BY0A 2FEJA 3CFMA 3N85H 4K94C 3W11C 1KC5H 1KENH 1JWSA 4IBVA 3OX8B 4IK6A 2Y2TA 3GKZA 1Z9PA 4ZBJA 1TT6A 4LKCB 3VD9A 3N40F 3VXQB 1PKOA 5I66B 5EC1A 4Z7UF 3TBYB 4G1MA 4MNGA 3SZKC 5JDSA 3S97C 3WMQA 3W5MA 5C9JA 3QORB 5AWNH 3E6FB 4YBQC 2FBRA 4KJWD 1UUSA 4Y4FB 1MFDL 4DPBX 2XG4A 3O9WB 2HRPH 4Y5VA 1J0YA 5F96L 3ZTJG 1QRNA 1S9WB 3BE1H 2F74B 3RB5A 4L3FA 2RACA 1ML0A 2WWOA 3UTQB 3GMNB 2VC2L 2YD0A 3VB8A 2YC1B 1DFBL 5C0CE 1KDJA 3TYGL 2YXVA 3I02B 4KK9D 2BVUA 3MJ9A 4P5TA 4PB9H 2MQ0A 2O5NA 2CHXA 3B7RL 1OOAA 3BQUA 3MRIB 3IDIB 1JGLH 1NMCB 2VUOA 3L9RA 2DLFH 3QZWA 5B8CB 4NO0B 2BSEA 1E42A 1IGTB 3D30A 4OZ4A 2PWHA 4ERSH 2D7OA 2SODB 1SLXA 2NXYB 5ETUB 3R4RA 1MFEL 1UA6H 4Z7VF 4WK0B 5IB1A 3RGVB 2WXNA 2P28B 5DK3A 2F15A 3O0RH 4NSKA 3P2TA 1H6EA 3BSZA 1YEWA 2ZE0A 3KBHE 1IBZA 1E90A 5TTRA 1F4YL 4G7VH 2IBBA 4NO2B 4QEGA 4JFHD 2V4LA 3IDUA 3EOTH 2VKXA 3ZKNC 1N5YL 1U6AL 3OKDB 4XO8A 1HYRC 4XCEB 3IDNA 4H1LH 1I8MB 2VXSH 1IIIA 1WZAA 3C08H 2GUOB 4R83A 1SHWA 4X6CB 4X7TA 5F9OH 4BBWA 2X4TA 2APBA 3IRZA 4LLMB 2VLKD 2HX9A 4L2LA 1IC4H 5EUOB 5F72S 3V4PA 3P3UA 3ZK0A 4HJ0D 4QRPE 4K7PY 4ONHB 5IM7A 1I31A 4IMLB 3BP7B 1OAYH 5DHVB 4LLWA 5D9SA 3MUZ1 4AK1A 4RGOH 4BZ2L 4RQQA 1XX9C 2V0AA 3WS3B 1YCSA 2R29L 3AMLA 3D1MC 4PCTA 3ASOB 2G3ZA 3BP5A 5TE6L 3TXAA 1OZUA 4B95C 1G1CA 1WFMA 1DE4A 4XP1L 2FRGP 1N0LB 4YHNB 3F04A 5D70L 2O5XL 1BD2A 2XDHA 3HI1A 4PJ8B 4WCYH 1U8PA 2VXTL 4YBLC 3W0WB 4YL4A 4FYRA 1MF2H 2BH0A 4P23D 3TF7C 4DFHA 4X5PA 5AW4B 3TT1H 5IOPA 2R0WL 2HMID 3PAYA 1KCSH 4QRSA 1D9KB 5KZCB 1E8YA 1NBVL 2WP3O 4AKQA 2BNRB 4XN8A 1SLWA 3LH9A 5FR3A 4D9LL 4L3EA 2WQAA 5HI4C 2PF6A 4DP0X 3SBRA 4IBSA 4KK8C 4DVRL 5LJYH 1U3HD 3GLAA 1PU0A 3KWXA 4X9BA 2GI0A 3IJ7A 3SDCD 2XKUA 2RBLA 2H2PC 5C08D 4TNEA 4KAQL 5JXAL 1DBAH 3ECBB 3IB4A 1KXVA 3Q2CA 3KEHA 5GRXG 5J12B 3QI9D 4NQTA 1ZLSH 4IRJC 3MRBB 4KK6D 4PI0A 3GSXB 1Z9MA 3BWUF 4B6ZA 3IJSA 2AQ2A 4NQEB 4EZKA 3EKCA 4DH2A 3L2MA 5EEVA 1TMQA 4HALA 2A4EA 3EDJA 3ARWA 4XNXL 1JHLL 3LPPA 2UXFA 3KPPA 4U1IA 1Z2KA 2APFA 2A6JB 5ALBH 1LEIB 3ZBMA 4UQBA 3IJHA 5KVFE 1NGYA 1JGVL 3RKPA 4OLYH 4NKMB 2MH4A 2VDNB 5KBMA 5B7MA 3UBFA 3UYRH 3U4EB 3MQIA 3QQ9C 1X7QA 5BS0A 2VSMB 1ONQB 3WEMA 1N10A 3MV11 4M8UA 2VN6A 3OAWA 5FKPB 1A1NA 4WSJA 4P5TD 4QT5B 4AMKH 4GG6F 3MRDB 3RVWD 1XHHA 4ZUSA 5CCJA 2VABB 3BQUD 1YEDB 3MA7A 3X13A 4AEHL 3GGWA 4K23L 4LSRL 4J3BA 5T3XL 5IF0B 4WI2A 2OZ4A 4HJTA 3F7YB 3MTXA 4RMSA 1U8JB 1JTTA 4UT9A 2BSED 5A6LA 1Z66A 3QO1B 4QOKE 7FABL 5IVNA 1G7LB 5DJXA 3U0PA 3PNRB 3QULA 3FK3A 1JNHA 2VZSA 3UFIA 1YEFL 1GH7A 3GRWH 4HZ1A 4L3CB 5BXFA 2VR8A 4JR9H 3FQRA 5I6MA 4MSWA 3LB6D 1NOLA 1CDIA 2V2TA 1UXSA 3AFLA 4KZCA 2BJMH 3ZYIA 4GNKB 5GSVB 4OJDH 3HE6C 5F7DA 3CAFA 2BVOB 5J6GB 1MY7A 5DO2C 2KQMA 3VB9A 4Q2ZB 4WTXA 1RD6A 1MPAH 2BOBB 3ZDYF 1ANUA 2ZAGA 2AZAA 3SDXA 1WAAF 3TBSA 2H3KA 4HFUL 2BS8A 1GPOL 1F42A 2GBVA 4G6FB 4Y8DC 1ZHBA 1N26A 4MXQD 3VI3F 4HYTB 4EI6A 4U1KA 1OCCB 5I1GH 1CL7H 1FPTH 4X7SH 5E9NA 2V6HA 1HT6A 1UT9A 5C0BA 3SJVA 3T2OA 4OLVH 3IEAA 5DD3H 3VG0L 2IGLA 1BQHA 2JH2A 5BOJA 1CD0A 2DICA 1ZJBA 2QTEA 4U1SA 3C6LB 1MCWM 3QK0A 4Z3IA 1KLFB 4F7PA 4R4BA 5ENWA 3MUHL 2G3NA 5FO7A 4RMWA 2EZ0C 1F11B 1BD2D 2KBGA 3I75B 4XB7A 4JG1H 2EIZA 3JWNH 4G72B 1DEDA 3CPLA 1OAZH 3PWJB 1R17A 1LXMA 4WHTA 5DJ2B 4BQ8A 5J13B 3CVHA 4EMZA 1HHGA 5DMGC 5H37H 3LD8C 1KGXA 2X0UA 1ICTA 2HFEB 2YR3A 4OZFA 4L3ED 5H2BB 4PJ6A 4ORZC 2HKHH 4NC1E 1NCIA 4L2YA 4UZGA 1CD1A 2AV1B 3EOBB 4JM2C 2FEDC 5LO7A 1RU9H 3WIFB 5HGAA 3SN6N 4OI7A 1UATA 5L4MA 4Y89A 1BQLL 3CXDL 1BFSA 4HIEB 1BQSA 2VDLH 1OKEA 5CBAB 2WD0A 4Y16D 5I1KL 5E4AA 1LO3H 4JHWL 4AQEA 2H8PA 2J72A 1DUYA 4Z7UB 4YIQA 4ZFOL 1QSFB 1OHZA 4LVNB 3O3DA 4PREA 1P84J 4NWUH 4IRSC 3MBWA 5BOPA 1QMUA 4K3GA 4Y4KC 3LPWA 5FX3A 1YMHB 1SGKA 3N3EA 5A2LH 1NAML 1U8HA 4U2ZA 5IHWA 1WLHA 3VM7A 2BP8B 3MROA 3CDYA 1VB9A 5ICYA 3KYOB 4PHXA 1MRDL 2NRDA 4DUVA 4NQDA 5BS0D 3DX4A 1SF3A 1DQMH 4XMUA 3L4YA 4C47A 4KHTH 5D1ZA 4S1DD 3BAIA 4ZO8A 4K7PH 1RZIB 1U8LA 3TASA 4LSSH 1QACA 1XCQA 3QIWC 1E40A 4ZSOA 5C09B 4AYBA 1J1XL 5AW0B 3BDXA 5AOZA 2W8CA 1JV5A 4KKLC 3RX8A 4QUOA 4GW1A 2L7EA 3H6JA 2WP3T 1IAII 2H0PA 2OXHB 4M3HA 4R5TA 3DTXB 3WJMA 4P2RA 1MQ8A 4GRWB 2ERJB 3Q3GA 3L5WA 3NEXA 5E6IC 3H2PA 1VLXA 5FLVA 3X17A 5E23A 4Z7VB 3ZDZE 2F7OA 3ULUD 1MCPH 8FABB 1SY6A 4WV1A 4JRYA 4FYQA 3TEWA 2IDFA 4BM7A 5JHDA 3SYOA 3X14A 3II3A 1H5BA 3AZUA 4AQ8A 1U8IB 2W38A 2WOBA 3PL6B 1T80A 3VDAA 1C12B 1D6VL 5HI5C 4IDJH 1BMWA 3AT9A 3OB0H 1T4KA 1KJMA 4DW2L 4QWWD 2X3BA 4MD0A 2GEEA 4P4RB 3NCEB 4I0PD 5E9DE 2XBDA 2CD0A 1IX2A 2WZPA 5JMOC 4HH9B 4IIQB 2GJPA 2FL5A 5FKAA 4MQXC 2DW5A 3MO1A 3UBXG 4X5XA 3QQ3A 1L6PA 1TVDA 3OLDA 4XBGA 3ZE1E 4W9HC 2C34A 1BAWA 1EGJL 4LCYA 1M7DB 4GQZA 4N0RA 4DP9X 3DMMB 4HUXA 3CFCH 1Z5HA 4ORGB 3L3IA 4MBOA 2OYMA 2R8SH 5HGBA 3G6JF 2J1ZA 3NJNA 3G7TA 4J8QA 3L4ZA 1D7FA 4XNUH 3NIDF 4IJ3B 1H3GA 3TLRA 1NGXB 1RZJL 3MLRH 5IQ7L 2IOOA 3MYZA 1A65A 3KPRE 3EW3B 4HV8B 2ZWLT 4XGZB 1SOQA 4WEUD 4EOWH 4ODUB 1MHHA 4HEPG 1J0HA 1V3KA 2NZIA 1MAKA 4R26L 4FNUA 2C9UA 1FGVH 3L5XL 5DRXA 2EAEA 4N90E 1LE5A 1D5ZB 1IEBB 4LIQH 5KSBF 4P49A 3SO5A 1TVBA 4M29A 1RZ7L 1SVBA 2YFOA 5I8EB 1KBGH 3ZQXA 3MLVL 4TVPL 2YRZA 4PJ7E 4Y0GA 3H42L 5BMFH 2MRYA 1I1YA 1EHLH 4TRPL 2VYRE 7CGTA 3IAGC 3M17A 3B37A 5DEGB 3TIEB 4ES9A 1M1SA 4FC3E 3PP4H 1J8HA 4G8GD 4W6YB 4WW2F 4H2CA 2XUWA 3VAEA 2C3HA 2OI9C 3BZDA 3ULVH 1P5UB 1Y18B 2EJ1A 4I8DA 1LQSR 3J7HA 3PHAA 1BA9A 1L7TH 4CVXA 4V2BA 5M95B 1A7PH 1UOVA 2IMNA 1H0DB 2YGVA 1BPLB 2R1WB 4FCHA 4HUVA 3X3FH 3Q13A 4R90H 2BY3A 4ZTOH 4F3FB 1LEGB 3CG8A 3TA3C 4F33B 5KYXA 4JRWA 4H26B 1OP5H 2B8OT 1G4MA 4D3CL 2CK2A 1OSZA 2P7TB 2BINA 3GJFB 3FJTA 4XP4L 1ZRUA 5E6RB 1BAGA 1B4TA 4YO0A 1K6QL 5FYJD 4F8PA 4HWBH 1FC2D 5D1ZD 4GG6B 1ETZA 3SE4C 2B08A 4AV4A 3MKKA 4Q52A 1FFOA 4WK4B 3BJ91 2R2BB 4V11A 1LO5A 25C8L 4Q9CA 2NOYA 1Z9OA 5ITFB 4OCXL 3O6FB 2X4PB 1SBSL 2ODHA 1JDDA 1ILUA 4GKZA 1RLWA 5C6TL 5IJBC 3HNSH 3BD4A 2XA8L 3KS0J 4UZUA 5FUOH 4DK3A 4L8CA 1Z9LA 4MS8D 2DOCA 4PJ9C 1PKQB 4FJ6A 4MJ6B 3LIZA 3HNVH 3SGDH 3UYPB 1JCKA 1BSIA 2XICA 2AXFB 5BV7B 4JRYD 4U31A 4BKLB 3CSBA 3GI8H 3T0ED 4G7QB 1ZTXL 5B3NA 3E2HC 3GEFA 4HXAL 2NW3B 5L6YH 3MNZA 1RZ8B 5FHBL 3WY3A 1QZ1A 4CC0A 4Y7MA 1PG7X 2FJUB 5FUZL 3FT2B 1EEZA 1U2HA 2VRQA 4NC1C 4HGKC 4B7IA 2WZPD 2JELH 2L8AA 3SKUD 1E27A 4U05A 5A2AA 4N4YB 4AIZB 3HE7B 1DQIA 4NN5C 1T21A 4JJ5B 2IGFH 5CUSL 3TV3L 3ZKXC 4EKXA 3SPJA 2WYHA 3EO1B 2CK0H 5LN4A 1CC3A 2X0VA 1DN0B 4XPFL 4QTFA 5D96C 3IU3A 4LEBA 2DD8H 3EXJA 4Z5RA 2DWXA 5D72L 4XN4A 4GAJH 2D03H 4HU2A 4Q89A 4U1LA 3V8CA 5JHLH 1K4CA 5CLXA 4ADJA 1AGDA 3DVGA 1UCTA 3QIUB 4U4BA 4A6YH 5KBNC 1KCUH 4L8BA 3KNBB 2WPGA 3BP4B 4NCC2 5C3IA 1RZKC 4HH8A 3EGSA 5E56A 5JW5A 2QSTA 3NPSB 4G9DB 1OQXA 5IVXF 4YFLI 3HRPA 3TH4T 2BXZA 3UTPD 4WLCA 5LWYL 2PWFA 3RWGA 4MX7A 3VXPB 4NN7C 3ZJAA 4ZS6D 4UF7C 1OTTD 5C0FA 2QDVA 3BAXA 4KKAD 4NQCB 3UPRA 3VTAA 1J8HD 4DETA 1QO3A 4RWYH 2YJQA 2JCCE 5GRUH 3AU0A 3B6SA 2XTLA 5DLLA 1IM9B 3MRFA 1INDH 1MJ7H 4K3EL 3Q05A 2OS7A 3QUMA 4JREC 4Z3JA 5HVHC 5I6PA 4RH4A 4D8OA 2IG2L 2YGOA 3ALPA 4UU9A 1TYRA 3PWLA 4F8TA 1EMTH 2DS4A 1PZUB 3KPLB 2A0LC 2G60L 3JUYA 5IROC 1U2CA 1JZ4A 4AYFB 1G7IB 3MGAA 4C56B 5IFHL 5DFAA 4RIRB 4LEOB 4M62L 3D33A 5LGHH 4FA6A 5M7QA 5KSVB 1HINH 2ZKYA 3FUEA 3O3AB 5DA4A 1AQDA 2K3TA 5I1IL 1U91B 1TTUA 2ZWSA 5IW1A 1CXIA 1CDCA 1OP5K 5D1XA 2FWSA 1LK3H 4YLCA 4PRDB 1R5IA 3UBXI 5DMKB 1A7NH 2XPZA 3ZXAC 2NMSA 3U6XA 3TCTA 3ZDYE 1XIWB 2A6KB 5LBSL 4DP1X 2V5TA 1WAAE 4WVRA 5CEZD 1FAIL 4DO6A 4NAMA 2J88L 5DRZB 1G9MH 2EE9A 4HJGA 4HKZA 2EDMA 2VO5A 3F58H 4OF5A 2HT3C 3CDZB 3F7LA 4FLOA 4O00A 3UJIL 3B8YA 4X80L 1DDHA 3EJYC 1ADQH 2GJ6B 4WO4A 3ARGC 5DD5H 2R2CA 1F90L 1S9XB 2EDDA 2HLAB 1H3PL 2XWTB 5EF2A 5GZNA 2TSAA 2ZNXA 3GSNL 2GTWA 1WWCA 3PJNA 5GJSL 4HIX