3IE9A

Structure of oxidized m98l mutant of amicyanin
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
105
structure length
105
Chain Sequence
DKATIPSESPFAAAEVADGAIVVDIAKMKYETPELHVKVGDTVTWINREAMPHNVHFVAGVLGEAALKGPMMKKEQAYSLTFTEAGTYDYHCTPHPFLRGKVVVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Defining the role of the axial ligand of the type 1 copper site in amicyanin by replacement of methionine with leucine.
pubmed doi rcsb
source organism Paracoccus denitrificans
molecule tags Electron transport
molecule keywords Amicyanin
total genus 24
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2009-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3ie9A00
1AAJA 1OE2A 4KO6A 4ENZA 4DP6X 3WKPA 1W6WA 3AG2B 1JXFA 1ASPA 4Q89A 3H4HA 4CSPA 1RKRA 1AZUA 1EHKB 3DIVA 3OMIB 2XLLA 3PAVA 3NP3A 2J57A 4KNTA 3EH4B 4NB7A 3FSAA 1J9QA 4N8UA 3OM3B 3ZBMA 1PLBA 2B08A 3U25A 1ZV2A 3ASOB 2HX7A 3NSDA 4UF7C 1FFTB 3HB3B 4E9SA 3NJIA 3X1GA 4UAHA 3QJRB 1WA2X 1SF5A 2PP9A 1L9PA 2QPDB 2XV0A 3WG7B 1AS7A 3NJNA 2GI0A 2IWFA 1WA1X 4GXFA 2FQFA 1EZLA 3TBBA 2YXWA 3MBWB 4FAAB 5ANHA 1JZFA 1R1CA 1PF3A 3IEAA 2XX0A 3FPXA 1CC3A 1MZZA 2B3IA 1PY0A 3FQ2A 1KCBA 3PCYA 1BYPA 1XB6A 3WNJA 2A3TA 3FPYA 1JXGA 2HRGA 2PCYA 5I6LA 4F7KA 1XMEB 3S3BB 1ID2A 3NJFA 4HALA 4DP8X 3C75A 1NICA 3TA4D 3AG1B 3UABA 1AR1B 4HZ1A 1BQ5A 1ZDSA 1ASQA 4YSPA 4BXVA 1FWXA 2DYSB 1JVLA 4RH4A 2AZUA 1NIFA 3OD3A 3AG4B 3PLYA 3X1EA 1RZQA 2CALA 2QPEB 2BHFA 3DKHA 5D4IA 2YAHA 4JHVA 3V9CA 3CVDA 1OCRB 2UX7A 5I5JA 1XB8A 4DP4X 2RACA 1JZEA 2GIMA 1IKOP 4YVUA 4F2EA 1NIEA 4E9RA 4KNUA 3TASA 2ZXWB 1RCYA 3S3DB 2GB2A 2VW6A 1TEGA 3ABKB 4HCGA 2X87A 1ETJA 4Q8BA 1GS7A 3FT0A 3WKQA 1F56A 4AKPA 3WI9A 4KO5A 2TSBA 1JVOA 1KYAA 1XB3A 5PAZA 3NJGA 4YSSA 1IBZA 4E9XA 1MG3C 1L9SA 3V9EA 3X1FA 2ZOOA 1FA4A 2PCFA 1A8ZA 2W88A 1BAWA 2JXMA 1TEFA 1SFDA 4KO7A 1URIA 4A2HA 3GYRA 4GP5B 2JKWA 1AZCA 1OCZB 2YXVA 5I6MA 2FT7A 3AG3B 4BXSV 1WS7A 2YAEA 1OE1A 1KGYE 4G70B 1PCSA 2QDVA 3IN0A 2PPEA 2YAMA 2BO0A 4A66A 4FA7B 4HIPA 3DTUB 4A2FA 1JZGA 1NIBA 2J55A 2QDWA 4A2GA 3EH5B 2CBPA 2VN3A 1PMYA 2BWIA 1NPJA 2HRHA 2IH8A 2WO3B 3ABLB 1OCCB 5TK4A 2BZCA 4PAZA 3JTBA 3S8FB 2FNWA 2XX1A 2BP8B 2XUWA 4HCFA 4GYBA 3QQXA 3T6WA 4AI7A 4DP2X 2XV2A 2HXAA 1PZAA 3QJQB 4A2EA 1NIAA 4GP4B 5D4JA 3ZX1A 3CG8A 3CDZB 9PCYA 3ZIYA 4QLWA 2IDQA 1NWOA 2PPFA 3FU7B 1DYZA 1AQ8A 1CYXA 2IH9A 2VW4A 5FC9A 3X2QB 2XXGA 3FYEB 3AZUA 2GSMB 2FJSA 3CVCA 2I85A 5B1BB 4AX3A 3N55A 1E67A 1W8EA 3N2JA 3NJJA 1WS8A 3CZUB 2PPDA 4N4YB 4G7RB 2XV3A 2VM4A 1J5DA 1L9TA 1AZBA 2IDSA 5AZUA 3FU8A 4GP8B 2BZ7A 1AS6A 3SQRA 2BP0B 2FQDA 2XWZA 3H56A 1E30A 1JZHA 1PNDA 3RYMA 4CSZA 1V54B 4EF3A 4WKXA 1L9RA 3S8GB 2AZAA 2IDTA 4NERA 1NZRA 5IY5B 2GBAA 5A7EA 3NJLA 2E86A 1WAEA 4YSEA 1KCWA 1AACA 3AY2A 1NDTA 5AKRA 3IBOA 4YSQA 5TK2A 1HFUA 1ADWA 2CAKA 2EINB 2OV0A 1A65A 3WNIA 4BWTA 4DP0X 5B1KA 4NAJA 4YSAA 4E9QA 2IWKA 3X1NA 1AIZA 1JOIA 1JXDA 3IE9A 1ET5A 3GDCA 2YAFA 4AZUA 1CUOA 5B1JC 1AOZA 1JZIA 2VSMB 4KO9A 2YAQA 4DP9X 3T6VA 1GY2A 1ET7A 2BP8A 1OF0A 1TU2A 1MG2C 4A68A 5B3SB 2PP8A 2J5WA 2IDFA 3NJMA 2DV6A 4YSCA 2UXFA 1JERA 1OCOB 2LLNA 2BW5A 3ZDWA 5I28A 5D4HA 2XXFA 2FT6A 4DPBX 4WTQA 1M9WA 2R7EA 2OCCB 1NWPA 1AZRA 3QJUB 1OV8A 2XVBA 3GXUB 4HHWA 1GS6X 3H4FA 2X88A 1NINA 3FSZA 1PZBA 2I7SA 1AANA 3NSFA 1BXVA 4KOCA 2QT6A 3NSYA 2HX8A 3NSCA 1WA0X 4KOBA 2AVFA 3ABGA 4G7QB 2DYRB 8PAZA 3KW7A 1SJMA 1BYOA 4P5SA 2AFNA 1E5YA 1TKWA 4HCIA 2R7EB 5AFAA 2XYBA 4YL4A 3SBPA 6PAZA 3D12B 4JHUA 1ZDQA 3TU6A 4KNSA 2IWEA 3EH3B 4UANA 5E9NA 2JFCA 1NTDA 1GSKA 2EIKB 2AANA 2OJ1A 1M56B 4X4KA 1AZNA 4K9JA 1RZPA 2P80D 4PCYA 5I6OA 1CURA 4DPAX 3SBRA 1IC0A 4BDVA 2FQEA 2NRDA 1ZIAA 4L0PB 2VW7A 1ZPUA 2HX9A 1PLAA 2UX6A 1QNIA 3UACA 1PLCA 1KDIA 4BDVB 1J5CA 4YSTA 1I53A 1ILUA 3FSWA 4G72B 1OE3A 5B7EA 1GS8A 2UXTA 1W6LA 3ERXA 1BQRA 4JKNA 4E9TA 1V10A 3NYKA 2BP0A 2HLEB 3OMNB 3T6ZA 3L45A 2YQBA 2FQGA 3OQRA 2EILB 3QPKA 4W1TA 4M4RB 3UADA 1HAUA 1N70A 1GY1A 3FSVA 2BWDA 3HEIB 1B3IA 1UATA 3UGEA 2I7OA 1AS8A 4HHGA 2EIJB 1ET8A 3PXLA 5B7FA 4TXVB 4DPCX 3KW8A 4YSOA 4E9WA 3FU9A 1AG6A 4M3HA 2XU9A 1GR7A 2CJ3A 2PP7A 1SF3A 1CYWA 1OOWA 3UAAA 5I26A 1E5ZA 1ASOA 2EIMB 4BWUA 1A4BA 1PZCA 4E9VA 4DP5X 1NPNA 1GW0A 3X1BA 1JZJA 5EHFA 1L9QA 2DY2A 3WIAA 1A4CA 2W8CA 2VMJA 2Y1AA 5B7MA 2WO2B 4AKOA 5LDUA 1KV7A 3OMAB 1HAWA 5B1JA 1J9RA 3FU7A 4YVNA 4BWWA 1QLEB 1NIDA 3CVBA 3G5WA 3MX0B 5PCYA 3QJVB 2FTAA 4MFHA 4ZK8A 4E9YA 2GC4C 1BXAA 1L9OA 2FT8A 4GY4A 4DP7X 3FYIB 2MRYA 4P5RA 1MDAA 2CCWA 6PCYA 1SFHA 2DWTA 5I6PA 4A2DA 3IN2A 5F7BA 3EHBB 3NJKA 1GYCA 4AKQA 2P80A 1KBWA 2VSKB 1N68A 2IAAC 2Y69B 1DZ0A 1KDJA 1X9RA 1VLXA 3QJSB 3T71A 2PLTA 3EF4A 1T5KA 2MTAA 1QHQA 1PNCA 1A3ZA 3S3CB 5I5MA 1SHXA 4BK5C 2TSAA 3ABMB 2N0MA 4YSRA 1BQKA 4YSDA 3CDZA 3JT2A 1YLBB 2FWLB 3QJTB 1ILSA 3T9WA 3AW5A 1SDDA 1X9UA 1SHWA 2BW4A 1IBYA 1SDDB 2GC7C 3NT0A 1AG0A 2DWSA 1IUZA 7PAZA 5I5IA 5B1AB 2IDUA 2YAOA 3FQ1A 3NP4A 1MZYA 3PAUA 5I6KA 1J9TA 3PAZA 2WSDA 4HAKA 4G7SB 2VM3A 5F7AA 2YARA 2Q5BA 2ZWNA 4A67A 4F2FA 2Q9OA 2ZONA 3BQVA 2YAPA 4QKTA 2UXVA 1PAZA 2HZHA 2GHZA 7PCYA 4W9ZA 3TBCA 3PPSA 2UXGA 4YSUA 3FQYA 1SNRA 4DP1X 5I6NA 1A4AA 2PPAA 2CUAA 1KBVA 2H5UA 4G71B 1BXUA 3ASNB 3T6XA 2PPCA 3NJHA 2J56A 2H47C 1BEXA 1J9SA 1V55B 3SBQA 3UAEA 2H3XC 1M57B 3BVDB 1E65A 1ZIBA 3FS9A
chains in the Genus database with same CATH superfamily
1L4IA 1NCAL 3WN6A 3OKKA 4KV5E 3ARPA 1V7NH 3SDCA 1FSKC 4JKPH 1KBKA 3H4HA 5FUOH 1BIIB 1EDQA 1NC4D 4CU6A 1XWVA 5DQDL 4A7TA 3VFNB 3MFFA 1LO4H 2FJHB 2VZTA 4G42B 1M9SA 1OP3K 5IB1B 5DYFA 3BUDA 3DX4A 4HC1L 2YKLL 3W2DL 4UYQA 3T09A 1NOLA 3C60D 2FX9L 1K9TA 3VMOA 5EOCJ 1FH2A 3L13A 4HOMA 1HQ4A 1BVOA 4NM8L 4ZQTA 1DJSA 2X4UA 3Q2LA 3LSOB 3Q13A 1KEGL 2GJPA 1J8HE 3MKGA 1CT8B 4NPYA 1Z9NA 3IAPA 5DCCA 3VWJD 1B0IA 2Q10A 4JDTH 1YEGH 3LKRB 4WJ5B 1XX9C 4HSAC 4TLSA 4X80H 4JBSA 2WXGA 4P0DA 4WI0A 1FGVL 3IGUA 1PSKL 2CO4A 3VDCA 3UJJH 3E7JA 1F4XH 4G6KL 5D7KD 1KN2H 4RMQA 2A74A 4PJFA 4NGHL 4OFPA 4OV6F 4HIXH 3UTPE 3HB3D 3FHQA 4JDEB 2X1OA 4WHTB 1IGCH 4NNYA 3FU5A 4CAGA 4OI9A 4M8UA 3RNQB 1PZUB 3T4YA 4PQXA 5C08A 1PDKB 1DBAH 2DDQH 3MRMB 4DP8X 1BV8A 1OVZA 1YA5A 2QZ5A 5CZKA 1JG9A 4DVBA 1NLBH 1J05A 1BQHG 1HKLH 3FQNB 1I9JH 4XBGB 1T1XA 1OHZA 3KYOA 5TDNB 1FE8H 3RTQB 4YHNB 2X4NB 4U6YB 4YDKL 3SYPA 1G7QA 3ELQA 1BBJA 4F15C 4LPCA 2N01B 4CGUB 2WXJA 2X12A 3MRJB 4MAUH 4B9PA 2VLRB 1FAIL 4RFEA 3L5WB 5I1DB 2X1XR 1TJIH 2OTUA 4TSBL 3R1GL 3ZZQA 2FE0A 3A67L 2WBKA 1DVZA 1BZEA 2ZCLH 2KQMA 1JHKH 1QBBA 2QSVA 5HPMA 1RUMH 1R5WA 2WLIB 2P1YA 2DLGA 1EGJL 2IG2L 4Y9BA 4AQEA 4RFOL 6FABL 1F56A 4AVJA 1LEGA 2VDMB 3RIFK 4C59B 2B7DT 3RPIB 3NIDF 4KZEH 4IIZA 4IOSA 3VD7A 1XB3A 1U2YA 2ZCHH 5FWQA 2JTYA 3CU1A 3F04A 1ZJBA 2JB5H 4HS6A 4LSUL 1P7KA 4PJ8C 3UZQA 4GUPA 1KV3A 1KJ3H 1OTTC 2YGVA 1NUDA 2QSCL 3A6BL 5MEOA 2YWYA 5C6TL 3KWTA 3S48A 1MFCL 1IQWL 1UFUA 3EBHA 3L3DB 3SDAD 1NCJA 1GZPA 3DJRA 1RIVH 4PRNA 2W0FA 4ZFOL 4FQJH 3EUUA 3QORA 3WNKA 2YA2A 4YZFF 1LO4L 3TVMC 5CGYC 2HT2C 1DQLH 1E4WL 2YAMA 3MRPA 4D9QE 3WSQL 3LHPH 4POZD 2YRLA 2FECI 3UGXA 5CJQH 2WYZA 1SZNA 4A2FA 5AOJA 3SE4A 3QBTB 3MREA 1NPJA 4WI5A 5JPMB 3V6BR 3MLWH 3BAEH 5J9PB 4BHUA 5E5UB 1RIUL 2WUBH 1I75A 1BREA 4R97B 2Z93A 5IREA 1QUNB 2E47A 1BQHB 2W95A 3OSVA 3QQ4A 2CBTA 4PTTA 5D55A 5CJXA 1W91A 3K2UL 3P0VL 4NZFA 3ZX1A 2R83A 1RQ5A 4ZT1A 5TF0A 2NNAA 5JDSB 2BNUA 4I0PB 3F85A 1YY9D 4XR8C 3X2QB 4U6HA 4ATTA 2VQ1A 1SLVA 4OGQC 1NMAH 3ARXA 5KJ7E 5C0AB 1QA9B 2VGLM 2O5NA 2E5EA 4IOIB 1TR7A 3RFZC 4E36A 5HDQH 1S5IH 2XV3A 4QJ3B 4GT0A 5J12B 5K9OA 1MF2H 5GGRY 5HI4D 5D6DA 2ZWSA 3SN6N 1T4KA 3NRFA 3CBRA 1D5IH 3T4AA 3SQRA 5D7LB 5IHUL 3REVA 3B8SA 3W39B 4N2AA 4CILA 3GSNB 2JELH 3IGKA 5CD3A 2OXGA 2J88L 1KC5H 2HFFA 3DC0A 2FSEA 2OCFD 4XPHH 3U4BL 3D39E 1XF3A 2IAMD 2E4TA 1NGPH 5DQ9B 5KTEH 4IS6A 3NAAH 4BUQA 2BVUA 3SYAA 2CIIA 4X8JB 4N5EC 1OP5H 2XNAA 3VUAA 5FPIA 1RK7A 1VF5C 3ZYJA 5E9DD 3OAZH 1BGXH 3QUMB 3V0WH 1ZT1A 2H6PA 1G4MA 3L3KA 4M4PA 4FN0A 1TU2B 1DHKA 1PY9A 3D2TA 4ANWA 4DEWA 3V2AR 4K5LA 5JHLA 1DP0A 1F4YH 3W56A 2HWZL 4P05A 4BFKA 1G5GA 2FLRT 5HGHB 4YK4C 3OC8A 4P46B 4N3TA 4R0LC 3MJ6A 2V17L 2UXFA 1MHPL 4HHAB 1P7BA 1XAKA 2NXZD 4FNLL 1KN4H 2E59A 2V9UA 3UPCA 5C7XH 2D7NA 5IQNA 2WLJA 2DL9A 1FFOB 4WTQA 4YE4L 2OCCB 1OGPA 1X5AA 3HE7B 2YR3A 1UASA 1NFIB 1HL5A 2Y7SA 2QQQA 1ID5I 5DRXA 2CRYA 2DL2A 4ZUUA 5CGBA 4JCMA 3RIAK 2LU4A 3QI9B 4IKKA 4L3FA 4A63A 3DO4A 3JV0A 4HHWA 5AVUB 4UAOB 3HE7A 3RNKA 4F7TA 3FSZA 3IB4A 4ISVA 4X5XB 3P3UA 3ZTCC 3AXIA 2X2IA 3G5YA 3L3HB 4AUJA 4HLJA 1RJLB 3PQYA 1L7IL 3H3PL 1BD2A 4G7QB 4L4TB 4MAZA 4P2OD 3L54A 4OZIE 2CXGA 4Y4HA 2A1WL 4KKRA 3GWJA 4JFYA 2C7FA 1JF1A 3NZHL 5C08B 3ZGHA 5JO5B 2FGWL 2JI2A 1A7PH 4PRAB 2A9NH 4WU7B 1QSFB 3NH7H 3L4WA 1AC6A 2MCPH 4X4XA 1MPAH 1UQSB 3D07A 2ZOUA 4FGMA 4NN7B 2WBJD 5IUSA 3K81A 4BFFA 4H8WH 4LAJH 4PS4L 2DQGH 5E2WH 4YFLI 1KUMA 1KLUB 1NEUA 1ZMYA 3CX2A 4ISVB 3WTVA 1D7FA 3VGBA 3QI9A 4WQOA 3D4CA 2X9WA 4GG6F 2PWDA 2MFNA 2G9KA 2WQWA 1F00I 1F5WA 2DBJA 1D5BB 3MACL 1Y1DA 2C9XA 2R23B 5B7EA 4RDQG 2HJLB 4UV7H 3QIBA 3I3EA 2J88H 1RZKH 1KC5L 3FFCA 5SV4A 2IALB 3VQMA 5DWUL 4XCFL 4E5XG 4XPHL 3U4BH 5KN5A 4W4NA 1V10A 3GUFA 4RESB 4HMCA 3UDWA 5DMJB 3VH8G 1NGPL 5DJYB 5KTEL 1AE6H 2FQGA 3NGBC 1ZEAL 1M2OA 2EILB 1HAUA 2BNRA 3PGFH 4JGJA 3QNZB 1BFTA 5DEGB 1TVBB 1U8IA 1E8WA 5LN8A 1FFQA 3BP4B 3PXLA 4RX4A 1K2DA 3TC9A 3VRIA 3ARVA 4IBVA 3I02B 4FF9A 3OKOA 3PABA 3G6AA 3PWPD 2I9TB 3JBG7 2FYVA 2BVOB 5DZAA 3WNPA 2ODIA 4UQCA 1WZAA 1QZNA 1S9VA 5GRUL 3T1FB 2OX5B 1J48A 3DMMA 4C56E 3QZWA 4OV5A 1KULA 5F9WB 3KJ4C 4ZUVB 4KDTC 1A6TB 1CG9B 1TTAA 5EEVA 5GZNC 1KN4L 3E8UL 2YD4A 3VXOA 1MLCB 3FO1B 3OLDA 4K94H 4LF3B 2XTSA 3BSZH 4LDOB 5BUAA 4W6WB 3J7HA 3MREB 3BD3A 4OGYH 3L4ZA 4PLOB 3K3QA 4U4IA 3G6DH 4HWBL 4UQ3A 4LP4A 2QADC 1ZVYA 4JAMB 4RMWA 3T8VA 3OKEA 3P9WB 4UT7L 4Y7MA 5E2VL 1U33A 1ESOA 3VXOB 1TQCC 1WTLA 35C8H 3SBWA 1J0JA 5PCYA 5KSVB 2Z1KA 5AB9A 5IG7A 4ZX6A 2EUWA 2CSPA 3IJYA 3ARBB 3QH3A 4BQCA 2J3SA 1YNTA 2FT8A 2VB5A 3IDIA 2MTPA 1MCNA 5L6YL 1S9VB 4KKQA 4KQ3H 2NPLX 3ESPA 5KW9L 1DL7L 3LIZH 4ONGH 3MJ7B 2VQ1B 2WZAA 2V8LA 1N68A 3FU0A 4M6OL 4TNGA 3KCPB 1OD9A 1P1ZB 4QXWA 5AWNL 5F8RC 2WCGA 4MRBA 2XVGA 1S78C 5A2FA 4QRPD 3TNNB 5KYYB 1A6AA 5C0JB 3QG7H 5M94B 1PNCA 2G9HB 1CGUA 1BQHA 2AQSA 2YRPA 3HC4L 4QHLA 4WU5A 3ABMB 5CSBA 4NQVA 5A2JH 4HJJL 4MZIA 3TN0B 3VFUB 3CMOH 4G3YL 1ILSA 4H8WL 2YSSB 3DO7A 2DQ6A 2YEQA 4PJCF 2Y5TB 1M71B 2LFGA 1CGXA 1JF6A 3L5IA 3NT0A 4JM4L 5DHYA 5DUML 5F0MB 1SHSA 1R5VB 1IUZA 2DWSA 1HC1A 5HYJD 3MRKB 2HCZX 4HCRL 2AEPH 4I5BB 1Y07A 4RFEB 1KCKA 4WV1B 4HU2A 1JK8B 1PTZA 2DQJL 1KCLA 3UBXI 5HGDA 1SM3H 4ZMNA 3BQVA 1RZ8A 5A2BA 4P59L 2R0KH 5H35A 3LEXA 3O3EA 1WFOA 2R0LL 2W65B 2YGPA 5DS8A 1J5IA 4OCWL 3MA9H 1ZEAH 1Y18B 1RY7B 1ZT7B 3RWHB 3ME0A 4YDJA 3JWOL 3N85H 4PRAA 5DDHB 2O5ZL 3FAXA 5H35B 2XY2A 4U1LB 2VJ8A 1Y0LB 3NJVA 4H44C 4JFYB 2QV2A 3S97C 5KYWA 3UBXB 2ZX9A 5EEZA 2H5UA 3N0PB 1SGKA 4TUOB 2Z35A 4M1DL 4QRRE 3TGXA 5L2KE 2R39A 3C6EA 2H47C 1BEXA 3CUPB 5CN2A 3V4PB 1T7VA 3QC6X 3UAEA 3HI6L 4GLRH 5BCAA 3FS9A 4BINA 4RAUA 5IZ7A 5BOPA 3A5VA 3KBHE 1F3JA 3LV3B 1GPOL 4Q89A 3L9RA 4CSPA 3MV9D 4PJ8A 4DUWA 4P57A 2NXYC 2E9WA 1KB9J 1G0YR 2N1KA 3VFMA 5JIMA 5AW6B 2D73A 1JGIA 4LSDA 2ZTBA 4LL1A 1HHGB 4I0PC 4ZXBC 3BSZL 5E8PA 1RPKA 4PJ7A 5MERB 1ZE3H 1VFUA 4PGDA 5EU3A 4E5XB 5LXGH 4X6EB 2J7LA 4FQ2H 5E08H 4U3SA 5GS0L 1NSNH 1EGJA 35C8L 2WN2A 5D2NC 3MLRH 1M7IB 2JWYA 4FQXC 4HPOL 1D9KA 3S96B 3GMNA 3FT1A 2FH6A 1RVFL 4MAYA 4QXVA 4WI6A 3FUJA 4ELKB 2WYTA 3MODH 4V11A 2NZ9C 3M86A 3NJNA 1AZVA 4ZI8A 4LARL 1MI5E 2EVGA 4FABH 1PVHA 4NZUH 1S7SA 3HR5A 4PWGA 2LAGB 3H9SA 4LLWB 1EJ8A 4L3EA 4NFDA 1KGWA 4P3CH 1AXTL 1R1CA 2X6UA 3IEAA 4D8OA 4PP2A 1VZHA 2A74B 3Q8BA 1A1OA 3Q9QA 3QDMD 4WFGD 2V3EA 2BIMA 2AK4D 3D09A 2ADYA 3QCVH 5I1EH 4JVWA 4MCYB 1LP9A 4HKBB 2NLJA 3PHOA 3QXDA 2A77H 1XB6A 3JWDH 4MMXA 3CFJB 1CD0A 5JLZA 4MAYD 4LCYA 2EABA 4PJCE 4KGJA 1EWHA 3G7TA 1ROCA 5SWSB 2XT1B 4PS7A 1BD2E 3X14B 3WTWA 3NTCH 2UVEA 1JS4A 1ACXA 4K71C 1TTRA 4Z95L 4L0YA 1M3IA 2GUOA 1CR9H 3FUFA 5C0NC 1FNGA 4JFVA 3B9KA 4HJTA 5SWSE 3L6FA 3LVTA 1BG1A 3CZFB 2EECA 4YNYA 2DQEL 1OP9A 1I8IA 3U48A 5FYLL 2B0SH 4PW4A 2X89D 1G9HA 3EJJX 5BQ7B 5E8PB 3IMBA 2VDMH 3QIWA 3IE4A 1RCYA 1MREL 3S3DB 4X6FB 5FK9B 3JWOH 1EQWA 1LE5A 4C8XA 4Y5YA 3FT0A 3NFSH 4Y5VB 1A7OH 1C5DA 2ZXBA 4L1LA 1LK3H 2EIBA 4J1UB 4ZAKC 1L9NA 5FV2A 3Q5TA 2CHNA 4MQXC 2DTML 4L18A 5IT2L 4UAOC 4OZHE 2ZOOA 1UUSA 4M8VA 1ZT4B 2PCFA 3VWKA 1HXMB 5IB2B 3EG9A 1OB0A 4EN3B 1KLUA 2C26A 2DPKA 3BMWA 4UQAA 4PGBB 3KXFE 4PVMA 3FTXA 4PJ5D 2YXVA 5D5MA 3X17A 2NZ9D 1CK0H 2YAEA 1SQ2N 4HWUA 1GHFL 4WSKA 1N0LA 2WXNA 3QORB 5ILTL 2BO0A 5I1CL 2PO6C 3QQ9C 4DETA 4MRCA 4AQ8A 3DTUB 2G3XA 3BIAX 1KTDA 2QDWA 2ZYHA 3OX8B 3P4NA 3P4MA 4J4PC 4KRNA 4QRQB 3N5AA 1WC7B 2BWIA 3FULA 4R4ND 3LPFA 5ID1B 3QEGL 4JZNA 4TNEA 4O5LL 2FNWA 2DLIA 1AFVL 3JV5A 2J20A 4HCFA 5BRPA 1TXKA 1RZKC 1FFNA 2R2HB 5KG9A 4WEBL 5EU3B 4E5XA 4F7MB 5CLXA 2CGZA 2CBMA 2O4EA 2NY2D 4XHQA 3ZHFA 2DZEA 4IBZA 1AXTH 1QBMH 4E2OA 3JV4B 4LQ1A 2FBOJ 1AQMA 4DAGL 4OCXH 4IGBD 2VE6B 3F7VB 1NFIA 1TIUA 5EU7E 1J1PH 3DV6A 3BT2L 1AJ7L 3BSGA 4H40A 1TQVA 4JGUA 1XHHA 4HULB 5E2UH 4TTDC 4Z3FA 2BS71 3ESNA 4N0CD 3QZOA 1EEQA 4JQVC 3L7FB 3OKNB 3AXLB 2EDOA 2NYYD 2OMUB 3HG1A 4M6AA 2Z8SA 1P4BH 4U1JA 1WG3A 2IDSA 4FTVE 1ZGLA 2DIJA 3WCYA 3U83A 2OZ4L 2XWZA 1WAPA 2ZSWB 3FRPA 4ELDA 2WQ8A 3GTVA 2DMGA 5IK3A 1KXTA 3ULUH 1DVUA 1IGTA 1NZRA 4YBQD 2DQEH 5GJTH 5CLZA 5JHLH 1ACYL 3NJLA 4S2SB 5CN1A 5IV2A 3OL2A 3KJ4B 1BLNB 5KAQF 2ZE0A 1NDTA 3AU1B 5TK2A 1D6VL 2MJWA 3D5OF 3O8XA 3QRGH 4JB9H 5TTRA 1MREH 3SGDI 1WCBB 4JHZA 3N1FC 5C2UB 3G5VB 5HVFB 3FUEA 5DF0A 2XZAL 3WTYA 2ARWA 1JXDA 1OTSD 1T7ZA 3A47A 1FG9C 1YUHB 5HD8D 3M07A 3V5KA 2YWZA 3KDPB 3OKDA 5J6HA 4X6DA 1KYOJ 3L4TA 5A6MA 5T8IA 1WEJL 3QEHA 4CC4C 4Z18A 2C9VA 3MI6A 3IPEA 4U1HB 3E3QC 1N0XL 4OKVA 5EIIB 4F33B 5ERWA 5C70A 5JW4R 2EO9A 4J4PD 5FDWA 3LSOA 4YSCA 3KS0H 5AG9A 1GGUA 3CN4A 5EZIL 1RP9A 1W8NA 1NA8A 5IESH 1RFDL 4IRZH 4MJIB 3LOWA 1CK0L 2IH3A 5E99L 2BHYA 5FDWB 2CK0H 3B3IA 3TNMB 3Q9PA 1HKFA 2QVIA 4JFZL 4JM0A 3CXDH 1L6PA 2X4OB 4WO4C 2Y2YA 5GGSA 3FN9A 2HG5B 5SWQB 3TONA 3MGTA 1MAMH 3U0PB 1YNTB 4YXHH 3TN0C 1EV2E 1A25A 5LG6A 1LNUA 3AS1A 1ZHBB 5CJ5A 2N56A 2GAZB 1XF4B 2VLJE 3HVNA 4FDWA 1XGUB 3ZQXA 5CEXB 4KKBC 4Q74A 2NYYC 4XC1L 1ZHKA 2V9QA 5FF6A 3MCG1 1CE6B 1QQDB 2HVJB 3GMPA 3FB8B 3AT8A 1AI1H 1IU1A 1MJ8H 1RMFL 1XV8A 2XQ0A 1E4XI 3P69A 1QLFA 2IWEA 3ECWA 1O9VA 3ZKQD 2VABB 4X9HA 1BM7A 2B2XL 4DKFH 1E3FA 3D48R 5LVEA 2GITA 5E2UL 1ZLUK 4AEFA 3U0WH 3KYMA 2P80D 1HHJA 2NX5B 4BD4A 3IKCB 3INUL 2AQPA 2ZXGA 1E6OH 5TE4H 3GXTA 4ZW5A 1A6VL 3UBGA 3HZMA 4ODUA 1SEQH 4BFRA 1MRFH 3LXUX 2D31A 1IO4C 3VRIB 3AREB 3T2OA 1IIIA 1R19A 1L9MA 2HMIC 4DVRL 1IBFA 1B6DA 3TH3T 5JW4M 3VI4E 3VXSB 2ISDA 3ULUL 2UXTA 3FQXB 5ESQB 3ERXA 1JFQH 3WFDL 5L0QB 1QWUA 4NBYB 1I9EA 1BQRA 3CIQA 3CSGA 4L05A 2WXQA 3OMNB 3U1SH 3LQZA 5DJ2A 2YQBA 4DH2A 3QRGL 1BZ9A 4Z3IA 3GJEB 3OG6B 2BWDA 3F7VA 3LXCA 1JTPA 1YMMB 2ZXDA 2DQUH 3ZDZF 4MA8L 3LTVA 1H3GA 2G60L 1BMZA 1BFOA 4KTEL 1K4DA 4S0SD 4M62L 4YSOA 2VMFA 3CDGA 1XF5A 2X40A 3NCEB 4XB8A 3MUZ1 3FB5B 1F4AA 2NY1D 3DX8B 1CFQB 3NMEA 1ORQA 3VD5A 4BFIA 3DRQA 3HN5A 1DJWA 1CYWA 1VADA 1AMYA 1WZ1H 1F0LA 1GYVA 4BRJA 2I26N 4MZRA 4MMZC 4KUCD 2WNWA 5ADPL 1HI6B 3D4ZA 1JGDA 3LEXB 1X6NA 3ARFC 5JHAA 2O5XH 2X41A 4QRSB 1SOQA 3QDJB 3CSYB 4K94C 3T4YB 5BS0D 1J8HD 3TJEL 4C47A 3DVIA 4X8CA 2CUIA 2VMJA 2C4XA 4GEIA 4U1NA 3V10A 2B5IC 4W9EC 2K7QA 2P9RA 2ESVA 3AY4A 4UTBH 1VA9A 3HLKA 1DQIA 5C0BB 1MHCB 1QSED 4Q0XH 2MMXA 2AQ1A 2W0LA 3L1EA 3VTTA 2WC7A 4EN3A 1IFGA 5BV7B 3EOYG 4AIOA 2FX8L 4F7TB 2YSSA 3AS0A 2DJUA 2H3NB 2QVFB 5A6IA 2P5EB 4UT6H 3WJMB 4JS7A 3VXQA 3WFBH 3LRKA 3L95B 2AEOA 3HMXH 5F7DB 1VERA 4QPEA 5DHEA 4LP5A 3BMVA 2IDCA 1U30A 2I60H 1QSEA 4LPVA 2A9ML 4P5TC 3KCPA 4MD0B 5INCB 4YAQB 4QJ5B 5INDA 1NKGA 4K3GA 4KROB 4BYHA 3HLAA 4HIXL 4HIJA 5FW8A 1QHQA 4IIQC 2HVBA 5L4JA 3IAGC 4IHOA 3CQQA 3L4UA 1XIWC 3RWJA 1PZDA 1MUJA 2N0MA 3RU8L 4XP9H 4YSDA 4RISH 2CLZA 2Y36H 4LOVA 4WNQB 4DGYH 5JA9A 2HSIA 3B56A 1SHWA 2NY4D 4N0YL 2NNRA 3SEPA 3L9YA 4Z0BH 4NKDA 2AK1H 4ZAKB 5BZWA 1AOHA 4OZHB 1MZYA 3JV6A 2LAAA 4DVRH 4PRPE 3N1QC 2XNAB 4D9LH 5GGRA 4PRHA 3BVUA 5AL8A 1DDHB 4MWFA 3PDOA 2CK2A 3QCUH 4ZUTB 1ZWIB 1ZXKA 2OP4H 5I75B 1YEIH 4JG0L 4D7PA 1MWAA 2ROXA 1O6SA 2V7NB 2A6KB 3MDJA 3ZW3A 4FQIH 5DS1A 5IFAL 5D72H 4UUJA 3PPSA 4HKXA 3RIAF 1OXYA 1V3KA 2XTJC 3RDTB 2WINB 4TL5A 1M2VA 1CLZL 1CFNA 4LBEA 4H88L 4O9HH 4PJCA 1ONQA 4MA8H 4N87A 1XH1A 3QORC 4NZDA 2PO6B 4HIHB 4M62H 4QY8A 5KVEH 4J2XA 3QISA 5DC9B 1WGOA 1WZMA 2C4FT 2X10A 2J56A 1IGIL 2VXQA 3MBEA 3MV8A 4LRNL 3K72A 3E6FB 4XO5A 5C07E 4TKWA 4FMFA 4OLYH 1B4TA 1M4KA 4U1IB 4MBOA 3AWFA 4AMWA 3MR9A 5EU6E 1JXFA 3CDCA 3KWUA 4L48A 2GT9A 1MSPA 2BCKA 3BP7B 2VAAA 2X3CA 5LUMA 4CN1A 5DJCA 5J1TC 2QVMA 3GSOA 4X6DB 4R9HA 2VC2H 5E0QA 3GKWL 3OZKA 4GAJH 5CLYA 4N8UA 3WSQH 1MCOH 3STBA 5EZJA 5GSVB 1MHEA 4F2MB 1WCQA 3ASWA 2R29A 4JFFE 3SDDC 3WFZA 1LEIA 4UAHA 5J6GA 2GSIA 4FG6D 3D0LA 2AMGA 3D0AA 4AYFB 3FO0H 1THCA 3T8XA 4UIKH 1G7QB 2VN4A 3BFWA 5FA3B 4MS6A 5DUPL 3ZTDC 3NCMA 2PETA 1TJHH 1EZLA 3UH8A 3QQNA 2H0FA 4TVUA 1NCIA 2QQKH 2ZXEB 3VD4A 1HN1A 1NKRA 4JO2L 3SE3C 3QDGD 5AALA 2LABA 4YE0A 3FQ2A 2VH5H 5IMKA 3DSNA 5BO1L 1F97A 4XP9L 3VGEA 4RISL 3ZMRA 1ANUA 3O11B 4OB5L 4PM1A 3QUYD 5DVPA 4NWTL 3CJJA 1KG0B 3RBGA 4L3AA 4KJWD 1A1NA 3DROA 5A16B 4AYFA 4OY9A 2H32B 3RUGE 3B9EA 3HS9A 2VDKH 3ECBB 5AOLA 2JELL 5TFSL 1NCDL 2VLKE 3EAKA 1F45A 3MGTB 4RDBA 3CSPA 3IVKB 1AGFA 3DURA 4UT9H 4F58H 3D85B 1AZZC 1YEIL 3RA7H 4P46D 1XB8A 1AMXA 3MFFB 5D72L 1KCUL 4M1GH 2JNZA 5LGKA 3AVEA 1SYSB 2GYSA 1A9EA 3L17A 4WEMB 2RAMA 3MRRB 3ZZSA 4ZFOA 3KXFA 4FQXA 4O9HL 4YGVB 4WEUD 3CVHA 5GGVH 3GRWH 3MXWL 3S5LG 1DEEA 1QFWI 2VDRL 3L7EB 4Q14A 3QI9D 5KVFL 1HX0A 5CEYB 4DQOH 2WWOA 3OKEB 2NNFA 3RDTA 1SN0A 3UC0H 4A2HA 5JXEC 3ARBA 4HGWA 2QFRA 2E7LA 3VXNA 2JIXA 2QELA 1B2YA 3RL2B 3WHXA 2A6DB 4XO9A 5F7EL 1EFXA 3LS5L 3WUWA 2XWBB 1SJEB 1QLRA 2E46A 5F71A 3RZCA 3GS0A 4GAJL 1U95A 4EE2A 1FLRL 3RKPA 1MLCA 1A02N 1IE5A 4P2OA 1JDDA 3BEVA 2J55A 3BE1H 3FTGB 4IDLA 4NN5C 3TBSB 1LNUB 2WO3B 3ABLB 5AYQA 4PAZA 1EFQA 4Y16B 4ADJA 1LILA 3ATAA 1NM9A 3VG0H 4FQPA 1H19A 1YEGL 3PP4L 1UXLA 3KLHD 2YBGA 1TJHL 1OZTG 3QUYC 4R5TA 2DQMA 1PSKH 1NH6A 2IH3B 1AGEB 2UZXB 3GIVA 4N2GA 5BV7L 1OK8A 4FCHA 1RJZB 2KDYA 1A7PL 3FYEB 1WWCA 4X9IA 2AJVH 3S2AA 4JFPB 4G82A 1E67A 3BN3B 1W8EA 1IVTA 1AD0A 1D3CA 4OIIH 1TCRB 5DC2A 1AD9A 4QTIH 5J4MA 3GSOB 4FQQB 3TZVC 4NENB 4ZUSB 2DWYA 2DQGL 3MRGA 5E2WL 1FN4B 1PS3A 4DK6A 3HZ3A 3LZNA 4OLZH 3EOTH 2IADB 2F5BL 3BW9A 2WKOA 1OARH 2FQDA 2VDKL 1RUQL 3F7QA 3HAEA 3GXPA 3IS1X 4M9OA 4MS8D 1PNDA 1ZXQA 1NAMH 5GSRB 4PP1D 1O7DC 3EDFA 2IDTA 3MRFA 5MENE 5EUKA 2EUXA 4CNIA 2NOYA 1AVAA 3L3GA 4AUYA 3VWJC 5A7EA 4D0DB 2NQ3A 1DQJB 4F58L 4JY4A 2QVTA 2XPGA 4ADIA 2BFGA 3TLRA 4RMBA 3L1OH 3MX0A 2VDPB 3HA0A 5DUBB 1XZ0B 3LDBC 2K4WA 3G5YB 2B5IB 4Y19A 3MXWH 1MJJB 4ACTA 3GK8L 1N5YH 1F18A 2XDHA 2YXFA 4H8VA 2ZCHL 3IDMA 2V4LA 4EIGB 3EYSL 2XZCH 5F3FA 3U46A 3VA2C 4L1DA 5FM4A 2IGTA 1H0DA 2CD0A 5KSAB 1Q94B 4KJPC 4AQEB 2BP8A 4JFWA 5CSGA 4WNJA 1MG2C 4DO6A 1L0XA 3GF8A 4A68A 4E41D 1KJ2H 4OF8A 3C6SA 1DVQA 1JL8A 3UZEA 3UOAB 2GABA 4ABQA 4AYGA 4DFHA 5D4HA 2J25A 2XXFA 4YHMH 4ZD3L 1MEXH 3CNKA 4PREB 3RUGB 3AB0C 4F57H 1CJYA 1YC8A 4Y4HC 1QRNA 1KBPA 1U3ZA 5CGYD 4QRPB 2FUTA 1MAKA 3MV8B 4NJ9L 1HOCA 5CJQL 4ZMZA 5K93A 3BE1L 5D7IF 1QSZA 3QE5A 4LOUD 4LCUB 1OAUH 2I32A 3BAEL 4PU2A 3VU1A 2VO8A 3RBSA 3PGCB 3EOBB 1IL1B 2Y7QA 4BQBA 2Z31C 4LEBA 2HUHA 5HGDB 2H2SC 3ZDXF 3QSKB 4X5LA 4ZFZA 1ETA1 2ZUXA 4CSSA 5CEZD 4B41A 5EUKB 8PAZA 4E0RA 1C16B 5EU6B 3JWDC 1E5YA 3HAEH 5SWZA 1S3KL 4ES9A 3WKMH 3IJ9A 5AVYB 5ISZB 4LVHB 4F8TA 4WTXA 3TU6A 1FO0L 3FH8A 2V9RA 4YHPA 4UANA 3LZLA 4UM8B 3S37X 3PV6A 3NIFE 5KZCB 2AJVL 1I8KA 2AANA 4HFUH 4OIIL 1DDTA 4MXQD 1HEJC 5D1QA 1E2WA 3PIQA 2UWEE 5DLML 1CFMA 2B59A 4OLZL 3LZRA 5AVSB 4PSPA 4L2LA 3DMMB 1TQBB 3LKSB 3AUWB 1LO0H 3SGEI 2O61A 4ELME 2UYLB 1KELL 1OD7A 5SX5H 5C0AA 1E9OB 4NCC1 2JKJA 5KS9A 5DD1L 2BOBB 2FGZA 3F5WA 2E3VA 5I19L 2R56H 2ZPKH 2ADIA 1W6LA 4Z7UF 3EJCA 4ZNCD 2C1PA 1UZ8B 3LQAL 4JKNA 2J21A 3QR2A 2IAMC 5FV1L 3MOBL 3L45A 1F02I 1QRNB 2IPTH 1ZGLP 4AK1A 2D7MA 3S35L 3H9HB 1KFGA 1UATA 2J8OA 3UGEA 5KN5B 5ALCH 3CAFA 1DBMH 5T5NG 1G6RL 3ARTA 3RJQB 3EKCA 3KW8A 4OD2A 2HG0A 2ROYA 1G7HB 5DC4B 2AEQL 2OA9A 3TIDB 2XU9A 3E9TA 5AVXB 1DQVA 4C58B 3QYCA 4OTXH 3CFJA 2YUXA 2MPVA 3W57A 3UDWC 1DQQA 5F9DC 4PJBB 1B2WL 1YNLH 4MXWH 5D1ZA 4XOBA 2HLAA 1QFUL 4PJGF 1K4CB 3UTTB 1CGVA 4GQPH 3K74B 1JGDB 4XTRC 5CEYA 2DY2A 3AU0A 5BRZE 4QO1A 1EEUA 1Z3GL 4PWIA 5G55A 4DKEL 2AW2A 3O0LA 3KPNB 3MLYH 2AABH 4G6ML 5F9JB 1TVBA 1NSNL 1U8IB 4OZFG 4A55A 4W9LC 4KI1A 4RA0C 2BDNL 1DFBL 3UP6A 5C3IA 2YD5A 4GG8A 4HUMB 1FCCA 2ZKHH 4C57C 2CZNA 5FYLE 2VDNL 4J3OG 3RUGA 5DD6B 3N50A 5JW3L 3NN8A 3BWAA 1OM3L 3SPVA 4UTAL 2B4CC 2DB8A 4L29A 4NO3A 4LSRH 4M5SA 4QRPA 2WM0A 4U3CA 5I23A 3FTSA 2J1YA 3QR0A 4PJDE 5DT1H 3A6OA 2VSKB 5DRWB 2A1WH 4RMSA 2FWUA 3MA7B 3SYCA 2DKUA 5DYOB 2QLYA 1ZE3C 4ELMF 2GPZA 4KNQA 4AMKL 4HFUL 5IVOA 1ZPLA 1DSFL 3PWPE 4MDIA 1TYRA 1ZTXH 2YQGA 2EC9U 4OF6A 3BVNA 4X7SL 2FHBA 3SDXF 4HLZH 1CDUA 2OR7A 3BPOB 2K7PA 2OMXA 2UVFA 5HHMB 1EDYA 1UGNA 2MPAL 4BFNA 1IBYA 2EDBA 2FLMA 3B83A 2EZ0C 4FJYA 3RLSA 2GJ6E 3L3GB 1JUFB 3UG4A 3MNWA 4TQIA 3FQWB 5DMGD 2IF7A 4UYPA 1YC7A 2DRUA 4OZGF 1OPOA 3FW6A 3PQYB 4XCFH 2ZONA 1CF1A 3ISWA 3WTXA 3SSGA 3RIFF 3M8OH 4R2GC 2UXVA 1T0NB 3T0AA 5I6XB 2F54E 3MV01 4H0HB 1HNGA 1QBLL 5F1IA 1SNRA 1MCPH 2VRKA 4J3OH 4NC2B 2EEBA 5I6NA 3FO2B 2MKLC 4J3OF 5GGQL 3RRQA 1QVOA 2OL3B 2VJ0A 5DEJA 2QPUA 4M5YL 1G7MA 1LEKB 4OUOA 1FL3B 3R06B 2F19H 5DXWA 4MNQA 5ITFA 5KYXA 3T0ED 1IJ9A 1E5CA 3DO7B 1CDIA 3DECA 4X0KA 4AEEA 1G7PB 5AVVB 1AKJA 2WLLB 3UAJD 2A9DA 3SOBL 5E6SB 3B3IB 3TNMA 3WJLA 2X4TB 3WUWG 5C97A 4G8GE 1OE2A 4HSQA 1UXMA 5E70A 3TPUB 1T7YA 3IDGA 4MXWL 4KK9D 1J11A 3MRRA 1A1MB 2JJSC 4PJHE 2NY2B 2Y3NA 3MNVB 2ADIB 2OTWA 4U6VH 3ILDA 3MQIA 4XNDA 5ACLA 2WOYA 1EJFA 3G6DL 4HWBH 3VFNA 2V7HA 2OXHB 5A3ID 5IMOB 3KG5A 4QRUA 3SCMA 4QNPE 4CVZA 4OCRL 3B8YA 4GUCA 3WS6C 1AHWC 1RLBA 3RX8A 1SF5A 2W07B 4KAQL 4G1MB 4QTHB 1XZWA 4PSRA 2HVKB 3N1PC 4LSTL 5HHXH 4WEBH 3O2VL 1I8LA 2AV1A 4BH8A 3PHOB 3HE6A 3G6JA 4HBCH 3ZDYE 5BW7C 4PW3A 5AVQB 3FCBA 1UWXK 4RMVA 4X4XB 1ICTA 4HJGA 5IMKB 3KPOA 2CKBL 1JZ6A 2WLKA 1E5BA 4UIMB 4XNQB 1ZANH 2DLEA 5BXFB 1U3NA 3GLAA 2ZXCA 4XVTH 4KUZH 4J2QA 5HGAB 1UT2A 3EW3B 4LCCB 1D9KB 3S96A 3MBEC 1LK2A 4KVPA 4W9CC 1IC7H 1WWWX 1GKEA 3H7BA 3BZEB 4L5FE 3IK2A 1BZDA 2AZUA 3ZHDA 2CMRL 4N2OA 2Q8BL 1AXIB 3BGMA 5EF1A 1FO0B 5KSAC 2EP6A 1QMUA 1PQZA 1ACYH 3MNMA 5GS2D 2R0KL 1IT9L 1IAKA 4YN3A 1OPGL 4KKCC 5D6CB 2Y23A 3CPUA 5IQ9B 2C34A 1FIGH 4WSJA 4NUMA 4OBSA 1B4JH 1I7UB 1U36A 1U8PA 3KGUA 5AAWC 1CFBA 5JXAH 3ZKMD 2IANE 1OANA 4H0LC 4HK0A 4UOQA 3WI9A 3E9UA 4AIEA 1TKWB 3CSFA 3DX3A 3UYPB 4AENB 3CVIL 1Y6MR 5ETUB 3APFA 3QNXA 3TIEA 5IHBA 2ZAIA 3LPPA 3PP3K 2XN9A 1UT1A 1B90A 3LH2H 1IIKA 1I8MA 1HYSC 1A7NL 1U8LA 3RX5A 4IMKA 4WENB 1VADB 1AGBB 3M46A 5DVKA 5FA3A 5DRZA 3APMA 4JVPA 4PLKC 2QHRH 1BM3L 4O02H 4X8JA 4BXSV 3WAKA 1CYGA 4XX5A 4A2MA 1KT2B 4U6VL 2WVVA 5CUSL 3RTQC 3KLQA 1UZ6E 4XNXH 2QKIA 3CXDL 2BPBA 1H9DA 4I2XE 2KZWA 4M7LT 5AW4B 5MEPA 2NUPA 3Q43A 4PRHB 2CNYA 4K5PA 2DYPA 2X9YA 5AOZA 5KYUA 1SN5A 1R34A 1YO4A 1EHNA 4KKNA 5DTFA 4B9IA 1R3HA 2BP8B 3OJDB 3MODL 1A3RH 1JPSH 4ODVH 4QHUB 4F5CA 4XBPA 2QGCA 5LWYH 2WOBA 4MJJA 4NZUL 3CFEB 3ZDYF 3VRJA 4M61A 1IGJB 1FZMA 2R51A 5KYYA 4P3CL 3BAYA 3JWNE 2H1PL 1D6EA 1FFOA 2Y6SD 3LKNA 2PPFA 1BBJB 3JWNC 3V6FB 1AQ8A 2YRZA 3FBQA 3CVCA 4U7MA 4XVSH 2VERA 1TMQA 1RUKH 2IAMB 3U36B 1YEFH 2R0WH 2R8SH 5E6IB 1RLWA 3OKLB 5CCKL 4MAYC 3SD2A 4G7VH 5T5FA 2P24A 4QHMA 1TTCA 4R90H 5I30H 1LL1A 2WZ5A 1TZGH 4JPSA 5FHBL 2DBLL 2PTUA 4D9RD 1F1GA 2GI7A 4Z95H 4L4JA 5E9DB 2ORBL 1QFWH 2XA8L 5IBTH 2A6KA 1J8KA 4IRZA 3L16A 4U7SA 1ONQB 3GBEA 4ZNEA 4XZ4A 4ESKA 4CDHA 4L8SA 4A2LA 3WO4C 5AUMB 5KOMC 2BP3A 5A2IH 1ZHKB 5IY5B 4BH7B 2P46B 1Q1PA 4BHUI 1QR4A 5ACZA 3JV6B 2G0LA 1OPGH 5JPMC 1UXSA 3VXPA 1KJ2A 1K8IA 1NBVH 4N2HA 3WHE0 3MCKB 2CAKA 5B38A 1FIGL 2BRRL 2UY7A 4PRNB 2F7IA 4R97C 1UJ3C 3DJ9A 1AY1H 4OLUH 3DUSA 1A2YA 1H3VA 5GGSB 2FYYA 2H2PD 4HSCX 4TUJA 1KB5A 4L8CA 5AAMC 1BVNT 3T3ME 4ZODA 1XT5A 1JZIA 3E3QE 1AXSA 1BMWA 1QSEB 4WW2A 3VNYA 2ITDB 4NUGL 4HS6B 4XPAH 3ULVH 2XWJB 1Q9WB 4X9BA 4EDXB 5T1MB 1MCWM 3IDXH 3NJMA 4WNSA 4WUKH 2V37A 1J8SA 1OT1A 1LYQA 2P5ED 5INDB 3OHXA 3I3DA 5CD5D 4ZPVB 3IPFA 5J12C 2LLNA 4DN3H 4YHZL 1PD1A 4XMWA 4O02L 2HKAA 1I3RB 3PYCA 5JDSA 2CRIA 1S5HB 4N25A 4FNUA 4Z7WF 3V0FA 3AABA 5C08D 1DJIA 2A6IA 4LP8A 2ZP0T 3WJMA 5D2LF 3V4PA 1OV8A 1MJ7H 3L08A 4ADGA 3L3IB 1Q0XL 3GBNL 1GS6X 3Q6GL 5LAPA 4XWGL 3OPZL 1N5AB 1CCZA 3QEGH 1XIWA 2A4CA 3QEUA 1G94A 1A9BA 2D9QB 1AFVH 1BVZA 3CFBB 3SY0A 1WA0X 4JPKH 5D70H 4HUCA 1OY3B 1ZVHA 2V0AA 2G75A 5JIPA 3WFBL 1SJMA 4MQXD 1BF5A 3VFOA 3MRMA 3NCCB 1HOEA 4JQIH 1HHJB 2YEZB 1JWUA 2NX5A 5HYIA 2H0PA 3C8DA 4A6YL 5D7HA 1I1FB 3PWJB 4AV5A 3NCBB 3BSHA 4Z7UA 2PNDA 2VZVA 3SIKA 1NTDA 4HWZA 1GSKA 1AJ7H 1INEL 4CRPA 1BFOB 2B1HL 2ZOWA 3QQDB 5HPOA 2HTKC 5I6XC 4N0CC 1YMMA 1IC0A 3NA4A 4KVNH 4JHBA 3UTQB 4MJ5A 1Z32X 4BDVA 4HKJA 2UZPA 1AP2B 1XGTA 1YEDB 2CPCA 5ESVB 1FORH 1TTBA 3QFJA 5DJDA 3SBWC 3T2LA 1FN4A 4DOHB 5LBGA 3W82A 4ETQB 1PLCA 1QFWL 5IBTL 2AQ3A 4GG6A 2Y72A 3EBIA 3QDME 1T03L 1DQKA 4JPIA 5JNYB 1UD8A 3KD4A 4CN6A 3STLA 5D8JH 4FXKC 4XMPL 4Q6IB 4H1LG 5I1JL 2A9BA 4YJZL 4BM7A 4FFYA 4XC3H 3CX5J 4IK7A 4NQDA 3OGCB 3ARFA 4ZX3A 2G3ZA 1CDYA 3ARUA 3SPHA 3UADA 4N6RA 3TESA 5IGXH 3QNFA 1DE4A 4KY1L 1E7VA 3BWSA 4FXTA 4TNWF 1G9NC 3RVUD 1ETB1 2EDDA 2XACC 3O41A 5DO2C 1AHWB 1NANH 3SKMA 2R29H 4LSQL 4KJQC 4PGJA 4AWJC 2CJ3A 3O8XD 3IGAA 4XPAL 4OAWA 4EKJA 3QUXC 3OLIA 3POHA 2HP4A 3DVGB 3BDBA 4XCCH 3DGGA 2WBJA 3FAWA 4Z7OE 1M3JA 1KYFA 1V7NL 3J8F7 4QXGH 1R3LA 1IX2A 5GISH 5KVEE 2OYPA 1ZWIA 2CLVA 3EBGA 3OSKA 4IRZL 43CAB 5IW6B 2CIKB 2LU5A 3CHRA 2CK0L 4OSUL 4IBWA 3KPSD 2YPKB 3AXHA 5I1HL 3A4EA 3QCTH 4RMRA 3Q2WA 4JFZH 4U6XA 2FO8A 5CD3B 3VFSB 3FU7A 4CC4A 1MJ7L 1CXKA 5E4EB 5IMLB 1BX2A 4HG4K 1NCWL 3V5DB 2G2RA 1DE4B 4DP7X 5CBAB 3PL6D 5EU5A 1MDAA 4LCCC 2A2QT 2NY6D 5DA4A 3BT0A 3IDGB 4PIBA 3IN2A 2XTLA 1I3GH 1BX2B 1RZJL 4IGBA 3HLAB 4HIJB 4AKQA 1AO7D 1ETZB 2W94A 2APBA 3VTMA 5C09D 1N2RA 1DZ0A 2XICA 5FGBA 4D8PB 4G6KH 4PHXA 3GLEA 2E27L 3NIDE 1RIHL 2GIYA 1MFAL 2IALA 4QLRA 5LJYH 2R23A 3D85D 4G5ZH 4QYOA 2OS7A 1MFNA 2O5YL 4MVBD 2B1HH 4W4OA 4HIEB 4F37K 5CFAA 4PV8A 5DJZA 5I5MA 4JFEA 1IEAA 3DSFH 3GFUA 4JHAL 3ML8A 3P3TA 4KVNL 4PJ9B 5BO1H 1UADC 5D1QB 4Z7VF 1OAQL 4G59C 4NWTH 2MH4A 3I6SA 5D71L 1JV2A 5GGRB 4H13C 4Q58C 5D1ZD 2C9QA 1S8DA 2LOEA 2Z34A 3PNWA 1NFDB 3PAZA 2HMID 2XN9E 4OD1L 2WSDA 4Z3HA 2ED9A 4BZ2L 4IEFB 4M02A 2VXQL 5D8JL 3F7KA 1ZOXA 2YC1A 4R7DB 3VXTA 4UT9L 5I1JH 5IB3A 1TZ8A 1TZOA 5DO2D 2P24B 4QHMB 4QYAA 2MEJB 1W0WB 3L5XL 4AE1A 3ARBC 1RZGA 4W9ZA 1ZA3B 4JE0A 3QHZL 1C7TA 4Z7VE 5E51A 3FQYA 1EGJH 4NQCB 4ENEC 2V2WA 1E6JL 1FHGA 3R0MA 2J8UE 3LKNB 2FSDA 3B5HA 4PGDB 3X3FH 4KTEH 3K0YA 1IVLA 4K7FB 2EXWD 1NAMA 3ROOA 2ZWKA 4GPVA 5JORB 2Q8AH 4Q2ZB 2RFXA 3MUUA 4J23A 4K23L 4LSQH 3HOGA 1A7QH 1V55B 4ZUUB 4N2KA 4OFQA 1S7UA 3EH1A 3QIWD 1X5KA 1JF5A 4XCEA 2E8ZA 2PWHA 1NAMB 3QWNA 3ROOB 1S9YB 5E7BA 1AAJA 3KPQB 4YR6B 3O45A 1JRHI 3MO1B 3WFHA 4O2FA 5HYSG 1WFTA 3LXAA 1RH8A 3BWAB 1AZUA 2J6WA 1T3FA 2KS0A 3EYFB 4OZGB 1E9PA 4XNYL 3S2CA 2Q7YA 2B1AH 4PJ5E 3RGHA 1ZA3A 3G9VA 4K7PL 1E4WH 4F9LA 2P8LB 3OM3B 3UBXA 1R24B 2ATKB 3S9DB 3B2XA 3UMTA 1TDQA 2VT0A 3T3MB 3T0BA 5DZPA 3RP1A 4Q0XL 4TVPL 2KZ1B 2MOVA 4FFYL 1NCBL 2G75B 2ILLA 3WTUA 1VZIA 1FP5A 3GMMB 3CBJB 3NIGB 3QWRA 3TBWB 3D33A 2VIRB 3CFDA 1UGKA 2G4EA 5BPPA 4WLCA 5C9JB 2F8OA 4LLDB 5GGTL 2AI0L 5F7UA 1YY8A 4GT7A 4L4VD 5DJAA 4G83A 1PX3A 3BUTA 1NBZA 3HMXL 2VO5A 2DTSA 1PZ3A 3JUYA 1IKFL 1MFEH 1UD5A 1YEKL 3QPQD 4EO5A 1SBSH 1MZZA 3D52A 3KYNB 3H7LA 3C09C 4AW7A 4WVRA 3LNIA 1JPEA 3MO1A 1KCBA 3P0GB 1J5HA 2J2ZB 4N9GB 1WFUA 4FP8H 1YDPA 5GZOA 5FKPB 3MTRA 3F00A 4DGWC 4WF7A 4MD5B 1DVYA 1UJ3B 2A99A 4W9DC 3WMPA 3C75A 1NICA 3TA4D 3AG1B 4UT6A 1I1CA 1XDTT 5JORA 1BQ5A 3MJ8A 4KK8C 1X5JA 1MNUH 1KEML 2APFA 3KWWB 1SLWA 3EJZD 3MZTA 5F72S 1Z0MA 4Y1AB 3CK0L 1HILA 5TQ0L 3PLYA 4PJ8D 3D4YA 1OSZA 4RGMC 1DJYA 1HTYA 3F7YB 3MRBB 5BQ7A 3V9CA 4BQ8A 1M05A 1QBAA 1OCRB 4E41B 4LPTA 2HN7B 2WBXA 4DP4X 4XCYA 2UWEA 4TVSa 3MRNB 2OR9L 5FHAH 3DX6A 3LN5B 4U6TA 3QH3B 3V52L 4Z9KB 2GSGA 1HEHC 3TBSA 2ZG2A 5K9JH 1TPXC 1VGEL 1E6JH 1DR9A 3ZE1B 3N04A 1NGWB 4Q8BA 1U4FA 4GB9A 5KBDA 32C2A 1MCQA 3FT3B 3V0WL 3TVMD 4Q9CA 1JVOA 1ZHLA 2WQUA 1HCVA 5CJ8A 5JPMA 2EVHA 3DVGA 2E9IA 3T3MF 2NW2A 5HYEA 4FG0A 2YPLE 4Y7OC 1VGKA 2YUWA 5JYMA 3G5ZB 2W80C 1IC5H 3OGOE 1BMGA 1WV7T 5DHVB 1WO2A 3RL2A 1I8LC 3UJIH 1F4YL 4M93C 3Q7JA 4NQDE 4H20H 5IJCC 4I9WE 1ZGLM 2JKWA 2W07A 2X4PA 2BNRE 3WEMA 1RZ7H 2W60B 5EUOA 2EADA 4DKDC 4Z5RB 4ELKA 2DIBA 5EU6D 2KPNA 3PGCA 4K71B 2Y0SA 1ZS2A 1OE1A 4JJ5B 2AAAA 5FECB 5ISZD 2KBGA 4K7PH 4Z7NB 4L37A 4OQ1A 4ZYKA 4ZDHA 3KBFA 2BIIA 2CWRA 4PJBE 2HH0L 4NQXB 4JCLA 3MLXL 4PMEA 5KZCD 4XBEL 4RFNC 4JRXE 4ZFOB 4PG2C 1JXJA 2JKNA 1JNHB 4HXBH 1OT4A 2HRHA 2KYIA 3RX9A 3OV6A 1NCOA 2GTQA 1N64L 3ENEA 3OGCA 2PTTA 3T0XA 3D18B 2CGRH 1FNEB 2EXTA 4QWWD 4AYID 4UINH 2OSXA 1U92A 4S1RL 2SODB 3DETD 3BP6B 4RRPM 3T6WA 3WHE1 1CICA 2VL5B 2NZ1A 1U6AH 1P0SE 4GRWE 2YJQA 4A2EA 2ENYA 2YN3A 5EO1B 4ZOBA 4LMQI 1XGPA 5ICXB 2AEIT 4QLWA 4Y5XA 3WXVH 3UJJL 3FO2A 1K6QL 3P4OA 4FTVD 1SBSL 2FGWH 5FC9A 4P3DB 4NGHH 4AITA 2Q76B 3F62A 1WUZA 4G6FB 2X6VA 2AERT 2R2EA 3ZZ1A 2APVA 4QHNB 5I16A 3HI5L 1E8YA 2FH8A 3D39A 4NRYA 2EYRA 2RGSA 4OT1L 2SEBB 2ARJB 4TSCH 5C0CA 4LLMA 4I3GA 3BPNB 4ODUB 4HQQH 5C0FB 1C1EL 1EO5A 3FU8A 5IJDC 3W0WE 1AS6A 1OWWA 2B20A 4ODTL 1A9VA 3APDA 3RNQA 1MRDL 4EF3A 4WWKA 3ME0B 4YDJB 4FHKA 2AZAA 4I13B 1YQVH 1FAIH 1I31A 3ARGC 4AVKA 1CLOH 2VLME 5DWUH 3PWPA 1DLHB 3MLZL 3HAEB 3KPSE 3K71A 2LLLA 4ZTPL 2B14A 5FGCE 4PCTA 2CO3A 2IPTL 2EINB 2QKIC 4JREC 4KU1A 5IQ9A 1EAPA 3L9EA 1T20B 5JMRA 4LLUB 1IZKA 5F9OH 5G4MA 5HI3D 5GQBA 1KBGL 1AD9B 3Q1SH 2OJZH 4UB0L 1ET5A 1OL0A 1UH3A 2O6PA 2VDRH 4MMYB 5ISZE 5T33H 1A7BA 3KXFD 1PBYA 4MNQD 3QJHA 1CVSC 1JN6B 4GKNA 5EUOF 1XCTB 3L3OB 2IQ9H 4EKXA 4H8UA 3A6BH 3UTSE 5L7XL 4F7PA 3OF6A 1S7VB 4AZ8B 3FQ4A 5CJBA 1V3LA 4KX7A 4FEIA 4EDXA 1RZ7L 1D7CA 1JERA 1KGJA 4ZMXA 2BW5A 4F8PA 3SKOB 5HHOA 5F7EH 1F2QA 1UB5B 3IGLA 5DJYA 4QY8B 1WWAX 2FJUB 3MLYL 2AABL 2BSCA 2XN0A 4L8CB 4OCLC 1AQKL 5CINH 4S1QL 3FCGA 5DR5H 4YWGH 1HSAB 2ZSVB 3WXWH 2QQLL 4YIQB 3IGFA 2NX5D 3BPCB 3EO1A 3FL7A 5D1QC 3NSFA 3FHEA 3LZFH 3IF1B 2LT9A 3DNKA 2PYED 2IH1B 3O6FC 3WN5B 4NKIL 2P5WA 2ZWYA 4M48L 3O3BB 1J1OH 3ULUD 4MMXB 4QEGA 1DL7H 3QZWB 3MRQB 3ZYZA 1OALA 1S7WB 4RGNB 3RWDB 3F8UB 5AUMA 1ORSB 3CVHL 4ODXB 1RZIA 5AWNH 1LDPH 1M7DA 4HWEL 4Q6YA 3PQYD 4K2UH 2F7OA 2X5PA 1KXTB 1MW1A 3D08A 4TUKL 2E6JA 4FLHA 4EIBA 2OSLB 1TENA 4YHYC 2COVD 2NY0C 1JF1B 3BQUA 3SBRA 2B4CH 1JWMA 2NRDA 4XN8A 3MV7E 3SJVB 3LVEA 2XXCB 1T04A 2EAEA 3VDBA 4LDCA 4M6ML 3G6AB 2I9TA 4B27A 3IFNL 4N2IA 1WBXB 2LGNA 3MNZA 3ULVF 5JPNC 1QWNA 5HI3C 2DWEA 3ZKXB 1FLTX 5CM1A 4MNGE 2CJTA 3BEWA 3LY6A 1CI5A 1FNFA 1YYML 1FQ9C 5L4FA 3OQRA 3NAAL 2MHAB 1THAA 1O7VA 3VI4B 1F8TL 5T3XL 4M6NL 1QBLH 3VXSE 1XF2A 1AP2A 3DWTA 1J8HB 1N8ZB 4OF3A 1AGBA 2P8MA 3TXAA 1DBJL 3F58H 1AS8A 2NR6D 3TS8A 1VFBB 4MHHG 1YJDC 1LVEA 2ZG1A 3WV0A 4QXTA 5C6PB 1LMKA 1S7SB 5C0BD 3V0GA 2J71A 4BZYA 2AQRA 2Z9TA 3CN3A 5I26A 1N0LB 5D93C 4ZO8A 4AGQA 3BGFC 5DVNA 2IAMA 4PJ6A 3U36A 2EIMB 2WKLA 5F7YC 1UOWA 2F8XC 4PLJD 4H25A 1MHPH 1CXIA 1USZA 1JJUA 1U58B 2CNZA 2L7EA 2WUCL 5ABAA 1RZ8B 1OSPH 4MS8C 4WUUE 2MNJB 1P7KB 1TVHA 3WIAA 3TA3B 4UT9A 2YOAA 4DCQA 1ZLVK 1FZMB 1BAFH 3AREC 2WB7A 1KXQA 2R15A 2Y2TA 4FI7A 3QJZA 4NN6B 5AEAA 3S3SA 3WNMA 1CDJA 5LDUA 3WJJA 4L1HA 4HEME 5D1XE 1R5VA 2V5TA 1DQTA 2BVTA 3QRLA 1NIDA 3MLRL 3V7MA 5FO9A 4L8BB 4E42B 2JCCE 4KAQH 1RVFH 1SPDA 2AV7A 4LNRA 4YHIB 4Q97A 1HHKB 1I3UA 2XBDA 4XCEB 1T89A 3UZEC 2IOIA 1D9KD 4P5KA 4LU5H 4NYLB 4NZJA 2R0ZH 3BD5A 3FFOA 4KRMB 3TEZA 4N8VA 1WHOA 3EFOA 3JQOB 4HBCL 4N90D 4B9JA 3V95A 1JGVL 2Y69B 4MTMA 4BFJA 4N68A 3T3PE 4AQ1A 3BIBX 3T71A 1CTNA 2ARJQ 2YUVA 1A7RH 3QO0B 5DDHA 2GTWB 5A2AA 4JFOB 3UTSB 4HWEH 4JMXA 4OVVA 4HHAA 4AEHL 3E38A 4AQAA 4R4BB 3TV3L 1Y18A 4EI0A 4TUKH 4FMKA 4JLRB 1A3ZA 2ZCKL 4Y1TA 1X5GA 5DJ0B 3DGCR 2YLHA 5FA4B 4AW4A 3GUTA 2DM4A 3VI4F 3RWDA 2PW2A 2X09A 3LNFA 3MCKA 3HKFA 4WWID 4JDVA 4C4KO 3EGXA 1PKQB 4RGOL 1UB6B 5IBUB 2VISA 3SPGA 4LK4A 1TVDA 4Y2NA 4X5WA 4HAKA 1I7UA 2VM3A 5BS0A 2ODHA 1I3VA 2ITFA 5L9DH 3B6SB 5FX3A 2QHLA 2R56L 3OLEA 3WIFB 3LX9A 3ZDZB 4TQHA 3LQAH 2X6BA 1ZV9A 4FADA 2V7HB 5IMOA 3MUY1 2BVPA 5AD0B 3ALWA 4GNKB 2IO5A 5ANMB 2Z8VC 7PCYA 1XCQB 2OTWB 4M3JA 2LU3A 3FNKA 4ZFZB 1FRGH 2WXPA 3BUYA 5I8CA 5IM7B 1RUAL 2J6EH 4XB7A 2FEEL 4BBWA 5FUZH 1MXDA 3ZL1A 3CCHB 1LK3L 4PJIB 2CUAA 5IB1A 2GK0A 4YXLL 5EU4B 1INDH 5HYFA 4LCCA 3GJFA 1DTUA 4GUPB 2KC0A 1PGRB 1IFHH 1MQ8A 2YMXL 4P5TB 3O3UN 3DHUA 3THMH 3V0IA 1N12A 4GQRA 3WENA 2D4DA 1D6EB 3BQUB 3QNZA 1ZIBA 3LKSA 4OF0A 2V2XB 3FOLB 4AJVA 3O2DL 1NL0L 2OI9B 1OWRM 2UV3A 3PNRB 3ZE2E 1A6UH 1TZAA 2OTPA 3E8UH 2LVEA 2QHRL 3IDYC 2XLLA 1AGCB 1DJHA 4NC1E 1T22B 1EJOL 3RI5F 12E8H 4ZUWA 1QTPA 4XNXL 3LKPB 4U49A 3NSDA 4UT7H 4LVNB 3PWPB 1JGUH 2ESVB 3NJIA 3B2VH 4D0BB 3ZE0F 4ZSOB 5F1IB 3U7YL 4JDVB 1HZKA 3B4NA 2WTRB 4C55A 1TVHB 4P9MH 3II3A 4QAWA 4KQ4H 3U79A 2RQEA 3WG7B 1FZJB 5FFOA 4CVZB 5L6YH 4WAFA 4LU5L 4B96A 4PJEE 3VFRA 2YXWA 2XTJB 3RDTC 5DT1L 3NABH 4NZTL 2QGBA 1PF3A 1Q0EA 3FPXA 4NQCE 2OKMA 4HUVA 3RGVD 4WJG3 5KVGE 1PY0A 3MUGB 5FYKU 2D3NA 1CGTA 2MQCA 4XVSL 2VDPL 4QOKA 1T0PB 1BYPA 3WNJA 2A3TA 2UZYB 5CCKH 1OGAB 3ZMEA 1ID2A 3NSXA 4HALA 3TFKC 4O2CA 1KFAL 4HIIA 1JZ3A 3HBQA 3KM1A 4GSXA 1DJXA 1Q1JH 2H6OA 2ZZUT 3I9GL 1FL3A 4MKMA 2MPAH 3H53A 4UTBA 1AR1B 4XNAA 4BXVA 4X8GA 1HXYB 1IBHA 1PQZB 2EDEA 4POUB 4J8RA 4Q2ZA 2GBVA 2NUTB 5MP6L 2VDKB 3B2UD 5CZXD 3MROB 4K7FA 3DKHA 1O9ZA 3NK4A 2C3WA 2IXQB 3CC1A 3DIDA 2CBQA 2CRZA 4HUVB 1Q9OB 3O6LH 3NN8B 1BLIA 2BFVH 1MCLA 3OF6D 4F27A 4GIPD 1NBVL 4JG9A 5I74C 2WXRA 5CKGA 2FO4A 1WC7A 2GFBB 2M26A 3WY1A 4DVBB 5I1GL 3VXUB 4PJHB 1KYOK 4GXUM 2PUQT 5FUZL 1SQMA 1D5ZA 1JCKA 2FJFB 1HWGB 1KZQA 1UM5L 4YHLH 3RTQA 2C9UA 4APQC 1KXVC 4M5YH 4YO0A 3N1MC 5DZOA 3AQZA 3KBEA 1NBYB 4XI5C 2AITA 3BVVA 5BOJA 3BH4A 1N0XH 1A4JA 2CRMA 3FTUA 3WN5C 2J4WH 3GYRA 1BQLH 2MHAA 4R7VA 1IILE 3P30L 5KUKA 2COQA 5I0DA 3FT9A 1MNNA 2EZ0D 3VG9C 2ZNXA 4KHXL 2MSPA 5C8JB 3GM8A 5GRWA 3AG3B 4M43H 3CFKB 5AYUL 1DCEA 3KYKL 2OX5A 1F6AA 2F18A 1DQML 2NY7H 2VUOA 1DJGA 4R0LA 2ZSVA 5T3XE 4YDIH 5E08L 4D8PA 3OZ9L 1JGUL 4OCRH 3SPVB 4R7LA 3RGVC 5KJ4A 2R9HC 3D18A 5AVRB 4X4MA 3IDNA 2X2YA 1SOSA 5TK4A 4EVNA 3WMSA 1IFRA 2K0RA 3DHPA 3ILEA 4PYGA 1GGCL 2Z6FA 3SKNB 4CKVX 3C8KA 4JPKL 1I4FB 3BI9X 1NEZG 3SE9L 3Q6FA 4OKDA 3GJFB 3MCLH 4YNYB 3LD8B 1NMBL 5JPNB 2ZKXA 5TDOA 5CZVL 3ECUA 4Y4KC 2VN7A 3FFDB 5AG8A 1AKJB 4GAGH 1I85A 4I9XA 1GOHA 4HH9A 4L8SC 4QOKD 3WLBA 1NWOA 1I1AC 1GL4B 1WH0A 2NNAB 2VW4A 3QCVL 1U95B 2RR3A 1E4KC 5I1EL 4K55A 3FOMB 3ZDXB 4PBWD 5D4QA 5DI8A 1JPFB 3JWDL 3M1CA 4AT6B 4UM9B 1ZANL 1FV1A 2YQ3A 3Q2NA 5TF1L 2P49B 3AT0A 2P5WB 3II1A 3UBHA 1CLYH 5DJ6B 2WVTA 4U4BA 1L9TA 1AZBA 5HI4C 2NY5H 2OULB 1DO5A 1MQKH 3MBED 3QXAB 1BXXA 5KANI 4UU9B 1LP9B 2P28B 2B9AA 1OTSC 1T03H 5HD8C 1UVQB 3QULA 3QDHA 4PRDB 4WU7A 2X9ZA 3NDYE 5E9DA 1U8MA 1DEEB 3IDJB 3L7EA 1NMCC 5D5MF 3UIYA 2BX5A 3RWCB 3V4PH 3AGWA 5KSAD 4LCWA 2ATKA 2YHGA 1XGRA 4PVBA 2VQUA 3KLDA 2JK5A 4R7NB 5KVDH 1M05B 5IVXA 1QA9A 2WBJC 5DD5L 3ECQA 3DX2A 2OMXB 3ZO9A 2ID5A 1T80A 4ABVA 5I1GH 4WIQA 5C0CB 1N6QL 2JLPA 1IBGH 4E9QA 2IWKA 4NQSA 3APCA 2OZ4A 3TX4A 4IQHA 4NQUA 1JOIA 4AQ1B 3IFLH 2R4SL 5FR3A 4P4KC 4YHLL 5F7DA 4R84A 4KI5F 2CJUL 2O6EA 3OXRA 3U6RB 1CIUA 4JO5A 1H0DB 4I4WA 4F2MA 3KEHA 2G3MA 1J1XL 1U41A 1ET7A 3VD3A 2W0KA 3FH5A 3FC8A 3F2LA 1OF0A 4P2RE 1P6WA 1HEZA 3TBTA 4OBRA 2E6PA 1PYWB 3LNGA 3W81A 2CDEA 1VAHA 4KVCL 5ADPH 4TSAL 2A4ZA 4PB0H 3VFWA 2JV6A 4GRLB 3V4UH 2WB1A 1AO7B 5MI0B 5JOPE 1RK1B 4M43L 1BWMA 4TUOA 3GZPA 2Q6WA 2NY7L 1N3NA 2UY6A 2XQBL 3DTXB 3I2CL 1PPIA 4LLDA 4ZZKA 1MCEA 4UTBL 1BCIA 4IOFD 2F6AA 4KK6C 3HMXA 5A2LH 2QVKA 4ZS7L 1KBBA 3VFRB 1BXVA 4N8CL 4L3ED 1GGCH 4L4VA 4IMKC 4ODVL 1VZGA 5LWYL 1ORQB 3BW9B 3D0VB 5EO0B 2BWQA 4PJBA 5D1ZB 4HKXB 4TS6A 5EN3A 5GZND 4DGUA 5IEHA 2AK4A 1XR8B 5CZVH 1TKWA 1Y1UA 5DS2A 4JPQA 3FH7A 2AJSH 2DM2A 4WGWB 5C0GB 3IYLW 2FO1A 3GJFH 4L0ZA 1KYUA 1DBBH 1M7XA 1ZDQA 4K9EH 1G1YA 3EH3B 3NZUA 1UEYA 4TYUA 4ES8A 3IRPX 2YOCA 2PCPA 1HHHB 2O5YH 3ZTJG 3ZYOA 1HYSD 3BN9D 4ALAC 3BKJH 1VIWA 1HL8A 4AVIA 2ESVE 1FBIL 5L2KB 1IM9B 1T1ZA 4JHAH 3QS2A 3DX9A 2BY2A 5FGRA 4DESA 3K2MC 4V33A 3VAEA 3UTZB 1Z9LA 4U1IA 3ZIMA 1E50A 1N4XL 3WOVA 4JX0A 3HPJA 3VXSA 3SJVA 2UX6A 2VKXA 4ORGA 4HK3J 3O4OC 2WWKO 3GHBL 5KJRL 1QSVA 5EU5B 1WBZA 2HT3C 5C6WH 4LLVB 3MMEB 2AC0A 4EVNB 3VJ6A 2DM3A 2JVUA 4ZYKB 1TZHB 3ZZLA 1MCKA 5I0XA 3E6HB 2NY1C 3FN0H 3AT9A 4M3KB 3RDJA 5KS9B 1EZUA 3BAIA 3JTTA 4M7LL 1MCIA 5IJKC 1NLDH 4B9FA 2GUOB 4D0DA 5K5YA 1RURH 4PN6A 4FQIL 5I0YA 5IFAH 1D6VH 2H7WA 2EH7H 4LQFH 4P5MB 5DD0H 2ZT9C 5GS3A 5K69A 2EKJA 4PMFA 2AQNA 1HIMH 1IBGL 1QLFB 1A0QH 5BMFH 5DU7A 4JG1H 2WXHA 4E41E 2OK0H 2R4SH 1OK0A 4A38A 1LD9B 3VFTA 3B6SA 4R26H 5JW5B 4IKIA 3CN1A 4V1DD 5E5LA 1CGSL 4P07A 3EDKA 4LRNH 4NUGH 4Z3GA 1P9MA 1KJVA 1ECZA 1QPKA 4KK6D 1UCBH 1MHHA 3SQBA 4BWUA 5B21A 3ULVD 4WSGA 2WCPA 2YPLB 4YFDB 3MOAL 3V6OE 3X1BA 4ANUA 5CJOH 3SO3B 3QGVA 4DT2A 3V6OC 4AUUA 3ILQC 3GM0A 4OGZA 5E99H 2W8CA 3RB7A 1UM4L 2L3BA 2O30A 3C5JB 3J07A 4XH2A 4NRZA 5F3HA 5FGBC 4DTGH 3BP4A 5CGMA 4JNXA 2XQBH 1BOYA 3CLEL 3VGFA 2ERJC 1DQDL 2QTEA 1INQA 3HZYB 1Q0XH 3GBNH 3Q6GH 5BRZB 3RVWD 1FNSH 4FFYH 2WTOA 3DJZA 4M61B 1GW6A 5IJVA 2AJ3A 4FYSA 4P5KB 4GRMB 3BN9C 3TBYB 1VEMA 4JDTL 4JZOA 3HNVH 1HHKA 3ES6B 4L1TA 5IVNA 1H15B 2P52A 4X80L 4ONFH 2E9GA 4GSDL 2P80A 3FFCE 4CMHC 2AAVA 4ZXBD 4HG4J 5TH2A 1CWVA 4A39A 1XBDA 4X83A 2L7JA 2DMBA 3MGOA 3VI3A 1D2OA 1HH6B 1NC4A 2X70A 4DF9A 1INEH 3H0TB 2HT4C 1IGCL 3U0WL 2ZAHA 1DVSA 5IEHB 5D1ZI 1XGYH 1FBIH 3CSYA 5I1IH 3CZEA 2HTKD 2ZUTA 3ZVVA 1WFMA 3L81A 3G6JE 1BZQK 1UQSA 3OB8A 4XHJD 5DK2B 2OBGA 1DLFL 4OM1H 4X4YA 4S1SL 2FEJA 2WXFA 4HEPG 2JLLA 4TRPL 1CPUA 3MNWB 2KMWA 3BJ91 3DRQB 5I5IA 2IOMA 5CN3A 5J13C 4OCMC 4UV4H 2UY6B 3DTXA 3C60A 3VRLE 3LNEA 1PZSA 2XWEA 3BLBA 3QA3A 4U1JB 4FXGB 3PNWB 3TEYA 4J3XA 4PWHA 1CE6A 2GHZA 3T65B 3JSSA 2EH7L 1SOXA 3W0WA 2G3NA 3K6DA 3D0LB 2BNRD 2B77A 1A6ZA 1DVFA 4NQDD 4DUVA 2L0DA 4J8RB 5BZDB 1CT8A 4J12A 2VXVH 4NPYB 2CO7B 4W6XB 1BZ7B 3GRWL 4A7GF 2OK0L 1WPCA 4RX4D 5D7LE 1KBVA 1ZTMA 4QJ4B 1Q9WA 1XF1A 1Z5LB 1A1NB 4XMXA 3LRSA 3SDDD 3QIBD 4HWNA 3DX0A 4DQOL 1NFDE 1F13A 1LWJA 1MCDA 3WY4A 2GT9B 3D05A 4HOWA 4ZO9A 5EFIA 4H7VA 4GO8A 4OD3H 1J0HA 1MFCH 4KO6A 5F97E 4TUJB 4ENZA 2GKIA 2TAAA 4Z8FH 4QXGL 3PWLB 4NZRL 2FX7L 2O5XL 3RTLA 2XN1A 1RKRA 5CJOL 1R5IA 2VNCA 1EHKB 1QR1B 3BPOC 4TNVF 4Q9QL 4Y16A 5DVOA 1MIEH 4WDIB 2GVYA 3O0RL 1UM4H 2ZUYA 1YMMD 4UUJB 1I1AB 4NB7A 3IMWA 4FTVB 3ZL2A 4F33A 3PREA 4WFHE 3I6LD 1MWAB 2OMNA 2YO3A 4F7EA 5I8EB 4WTZG 1WVZA 3NIDB 4HS8H 1FFTB 2D9CA 2RTTA 5ACZB 4G6FD 3QDGA 2EIDA 1S7WA 3FQUB 4OJFH 1IBBA 4HXBL 3TEUA 3N42F 1XH0A 3CH1B 4PRBB 4RLDA 5LQBL 5AQ0A 4R5XA 1JD9A 1R47A 2CGRL 5F8QC 4OZHA 4AM0B 1KIUB 4KZCA 5IB4B 4KITB 4FYQA 1I82A 1NCGA 3CXHK 1VACB 4ERSL 4UT6L 4ZMVA 4ONFL 3CH1A 4J3UA 2WNGA 4PRBA 1ZSDB 3P0VH 3QEQD 4MQSB 5FW7A 4Z7QB 3JTSB 5E6ZA 4HUXA 5JW4N 5E2JA 3UP1A 1LTXA 3UXFA 3QQ9D 2DQIL 1U3JA 3OKOB 4FQCL 3ET9F 4Z7QE 2GSGB 5IF0A 4P06A 4YC2B 1E4XH 4MQTB 2ED8A 1EBAA 2WZPA 5GS1A 4KFMA 4NC1C 4DGYL 5L8JB 1EAJA 1ZGLB 4OM1L 4HQQL 4JGNA 1JZ5A 4UQDA 5K9QG 1XGQB 4ODTH 1WICA 2GK0B 4Z0BL 2AK1L 2D0FA 4LLQA 2F53B 2EVJA 2WXMA 5FEBA 3BKCL 4MNQB 1SY6A 3ZT5A 3VGAC 3TTSA 2APWA 4AYMC 1ZSDA 2Z7YA 1IGYA 5I15H 2P5EA 3PL6C 2L8AA 4NXSA 2XQYK 4ZTPH 1JWSB 3RWIB 1AIFB 5JXED 3N1GC 2OMVB 3K8MA 3TL5A 2LR4A 5IB5B 2WGNB 3QFDA 4QHPA 5FS5A 5MI0C 4PGZA 1WZLA 4WKZB 1MW3A 2VW6A 4PJXA 3T8MA 1CLZH 2KL6A 3RVVD 4ZQKA 2ZCZA 2BNQA 5FM5M 5F6HJ 4QNPF 4JM2A 2FJGB 1RJYA 1JTOA 1OP5K 5EZLA 3SGEH 5KVEL 3US1A 5JO5A 3C6LC 4PRHD 3X1FA 3NCYP 5C9JA 2HUEA 5ETUA 4KFZC 5KWYC 2Y7LA 3V0HA 3RX7A 3BVTA 4JM2B 2NY3D 4JLRA 5B8CA 1D5XB 3GMLB 4JN2A 4IW4C 3HRZB 4GRLA 4WY7H 2UZIL 2B16A 1F58H 2J8HA 2X3BA 2I27N 2CJSA 3R0NA 4PJDF 1UOVA 4PWEA 4Y2LA 1K5NB 3CPLB 4R4FH 2NW3A 4F57L 5IOPB 3JVGC 1HHGA 4L1BA 2P8PA 4FRWA 4LPUA 2JTDA 1VCBC 4PJAB 2GEQA 4HS8L 4M1CC 2RA1A 2V2TB 4APXA 2PN5A 3GBDA 3IJ7A 2VN3A 4J28A 5DRWA 2CO6B 1Q9LA 3FO0L 5AW0B 3T65A 5LQBH 3SJVD 4UIKL 1F90H 2CDFB 3FQTA 4N0UA 3FTYA 1QABA 2V2WB 4DP2X 3P11H 1J1OL 2QTVA 2XV2A 3D9AL 1PZAA 3ISYA 3QJQB 2VQTA 4KI5C 1FL6B 5A40E 4U1NB 3BSZA 2L04A 1WITA 4H1LA 2UWEF 3BP5A 4PR5B 3B2PA 2IDQA 1IKFH 3X12A 4BSJA 1NCHA 3QIWC 1I8IB 4LNVA 3F84A 4IRJC 2XXGA 3GRGA 2ZOKB 3JT0A 4ZOCA 5AW9B 2VH5L 3KPOB 4I87A 4KXCA 3L3KB 43C9B 4X4YB 4X7TB 1JGEB 4DFIA 15C8H 3VFPA 1MKFA 3CSTA 3PJNA 4FXLA 3EDEA 4ZFGL 2VLLB 3JTSA 1OSEA 2GJZA 5FAAA 5IQ7H 4KKZA 4L4TE 3MRFB 3MNDA 4IEFA 1MNUL 2BP0B 5DVLA 1Z5HA 5DHVA 5SX5K 3UX9B 3WN5A 3EJZC 3NVQA 4OLXH 2I9LA 5DD1H 1L9RA 1IMHC 4MAUL 4P2RB 1R75A 3LCYA 2VLKD 3H2PA 4PY7B 1GIGL 1TJIL 4TSBH 4R8WH 3BFOA 3UPRB 5E8EA 4TNWK 2W92A 4IYKA 3MJ9A 5BUPA 2ZCLL 2BZDA 5F7FA 1J5OH 2OR9H 5FHAL 4LSSL </