3IE9A

Structure of oxidized m98l mutant of amicyanin
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
105
structure length
105
Chain Sequence
DKATIPSESPFAAAEVADGAIVVDIAKMKYETPELHVKVGDTVTWINREAMPHNVHFVAGVLGEAALKGPMMKKEQAYSLTFTEAGTYDYHCTPHPFLRGKVVVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords Amicyanin
publication title Defining the role of the axial ligand of the type 1 copper site in amicyanin by replacement of methionine with leucine.
pubmed doi rcsb
source organism Paracoccus denitrificans
total genus 24
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2009-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3ie9A00
2DYSB 1NIFA 2UXTA 3CZUB 5E9NA 4A2GA 2PP9A 4AKQA 1AR1B 4AKOA 1OV8A 3MBWB 1NIAA 1NDTA 2VSKB 4A2DA 2CALA 3NJHA 4HIPA 1J5DA 4NB7A 3QQXA 2DYRB 3BVDB 4NAJA 1KYAA 4A2HA 1OF0A 1AS7A 5I28A 3ABMB 1WS8A 4DPAX 4JHVA 2HRHA 2P80A 3FS9A 5EHFA 3TBCA 1NTDA 1JZHA 1OE2A 1IBZA 3NJIA 1L9PA 2XV2A 2JKWA 2BHFA 1E5ZA 1MG3C 4UAHA 3PCYA 2FWLB 1AZCA 3DKHA 1MZZA 1XB6A 2GSMB 4DPBX 1IBYA 3FSZA 1OCZB 2J5WA 1NIEA 4YSRA 2XVBA 2IDTA 4GP4B 4PCYA 3FQYA 4UF7C 4DP2X 3S3DB 1OCOB 3PAZA 3NJMA 4A67A 4F2FA 3PAUA 1AAJA 2QDVA 1BXUA 3CG8A 1ET8A 4YSSA 4KO5A 1M57B 3T6ZA 2H47C 3PLYA 4BXSV 1L9SA 4AX3A 4Q89A 1A65A 3FSAA 4G7SB 1B3IA 2X87A 4GXFA 2IDFA 1V54B 1JOIA 1NWPA 1GW0A 2A3TA 5ANHA 2VMJA 4P5RA 4A2FA 5I6KA 2JXMA 5PAZA 2I7SA 1GR7A 4BXVA 3FU9A 1JERA 4HZ1A 2GBAA 3JTBA 3ZIYA 4HHGA 1L9QA 2FQGA 1HAWA 3QJSB 2R7EB 1AOZA 2E86A 1BYOA 4HCIA 4BWTA 4ENZA 4DP5X 1FWXA 3ASOB 4YSQA 4UANA 2Q9OA 1A4BA 2QPDB 2RACA 1SDDA 2YAQA 3EH5B 1PY0A 3FT0A 4G72B 1NIDA 3FPXA 2GHZA 3JT2A 1ASOA 4DP8X 2B08A 1PLAA 1JXFA 1GY1A 1SHXA 1R1CA 1GS7A 2BP0A 1AQ8A 2BZ7A 3KW7A 4YSUA 3CDZB 1URIA 1NWOA 2YQBA 1JVLA 1SNRA 1FFTB 3X1BA 1RCYA 3PXLA 4EF3A 4YSOA 1GYCA 1QNIA 4QLWA 2AANA 2IWKA 1WA2X 5B1JA 1JZEA 5D4HA 4JHUA 5I5IA 1J9TA 2XXGA 2YAEA 3SBQA 3HEIB 3ZBMA 3TASA 2YXWA 3NJKA 5F7AA 4F2EA 1DZ0A 2N0MA 1HAUA 2XV3A 4M4RB 1A4CA 1KCWA 3EH4B 4E9YA 3WNIA 2XUWA 3DTUB 3IN0A 2FT6A 2TSBA 4QKTA 3H56A 3X2QB 4CSZA 2HX9A 1J9RA 1ZV2A 4YVUA 3QJQB 3TBBA 4YSCA 3UGEA 2BW5A 1ADWA 3QJTB 2WO3B 1SF3A 3MX0B 4FA7B 6PCYA 1IKOP 1E5YA 3FSVA 2YAHA 5I6NA 3NJGA 5B1AB 3UACA 1SHWA 3AG3B 4W1TA 1ZIBA 2HLEB 1E67A 1W6WA 2XU9A 1GS6X 1RZPA 3WNJA 2TSAA 2BW4A 2IDQA 1MZYA 2PCFA 2UXVA 4HHWA 3NJLA 1WA1X 2YXVA 4DP4X 5AKRA 3UADA 2AFNA 1KGYE 1NINA 1GS8A 2BWDA 4MFHA 3WI9A 3ASNB 3PAVA 5LDUA 2ZWNA 2Y1AA 3EF4A 1AZNA 1BXAA 2R7EA 1ETJA 1PLCA 1QHQA 2CAKA 1QLEB 3L45A 3U25A 4M3HA 4G7QB 1X9UA 1AS6A 1ZIAA 4YSDA 1NICA 4YSPA 2YAMA 3NP3A 4BDVB 3X1GA 4DP0X 4E9WA 3UABA 1JZIA 1M9WA 2VN3A 5PCYA 1KV7A 4N4YB 3NJJA 1CYXA 2DV6A 1AZBA 1GSKA 3OMIB 2HX7A 3OM3B 3CDZA 3FYEB 2DY2A 4DP7X 5I6LA 1XB8A 4WKXA 4G70B 4GP5B 1AS8A 3H4HA 2I85A 2PPCA 2GC7C 3FQ2A 4P5SA 4E9VA 1EHKB 2ZONA 1JZJA 3SBPA 2WO2B 4TXVB 1AANA 2XYBA 5IY5B 4GYBA 1BXVA 3S3CB 3TU6A 2XX1A 3QJUB 2ZXWB 4YSAA 1JVOA 1AZRA 7PCYA 4BK5C 1AG0A 4YVNA 5I5JA 1TEFA 2IDSA 1ILSA 1BQRA 4KNSA 3SQRA 1CURA 1NZRA 1ZDSA 3FU7B 4K9JA 3NSCA 1PNCA 1AACA 2VW6A 4KO6A 5D4JA 1NPJA 2FJSA 2Q5BA 3C75A 1RZQA 1MG2C 2CJ3A 1TKWA 4Q8BA 2IWFA 2VM4A 1AG6A 3X1NA 1NIBA 1SJMA 2BWIA 3SBRA 2EINB 5I6MA 2MTAA 3NSFA 1FA4A 2PP7A 1XB3A 2IAAC 3FQ1A 1J5CA 2YAPA 3V9EA 1JZFA 4A68A 2UXFA 3ABKB 4YSEA 4W9ZA 1CUOA 1N68A 2FTAA 3H4FA 1YLBB 2GIMA 2ZOOA 2AVFA 2EIMB 2VW4A 1KBWA 3NJFA 2DWTA 4RH4A 4A2EA 2VW7A 5B3SB 1PNDA 2VM3A 4YSTA 1W8EA 4L0PB 3WKPA 3HB3B 2IH8A 2H5UA 3ABLB 1PMYA 3AG4B 1ILUA 1PAZA 4HCGA 2WSDA 4AI7A 5TK4A 4DP6X 1M56B 3ABGA 4JKNA 5B1BB 1SFHA 1ASQA 3T71A 5I6OA 4BWWA 3AZUA 3IEAA 1E65A 7PAZA 1OOWA 3PPSA 2HZHA 1JXGA 1A8ZA 3X1EA 3QJRB 3OMNB 3FSWA 1ZDQA 3T6XA 2PPDA 2OV0A 2BP0B 2JFCA 3EH3B 3N2JA 1OCCB 1CYWA 2CBPA 2NRDA 2B3IA 3GXUB 2IDUA 2PCYA 1X9RA 3IE9A 4PAZA 4AKPA 2W8CA 3OD3A 1PZAA 4HALA 3OMAB 1W6LA 3NJNA 4KNTA 2PPEA 1PZCA 3ZX1A 4E9XA 2FT8A 3IN2A 3N55A 2PPAA 2FNWA 4GY4A 4KOBA 1SF5A 1HFUA 3S8FB 1L9RA 1PCSA 2FQFA 2QPEB 3QJVB 3AG1B 1L9OA 1AIZA 1AZUA 4KNUA 3X1FA 2FQEA 4AZUA 1SFDA 1PLBA 4KO7A 3AG2B 1OE1A 3ERXA 4GP8B 2YAOA 2BP8B 4CSPA 1XMEB 3UAEA 1VLXA 2LLNA 2EIJB 4HCFA 3NSYA 3T6VA 4E9TA 3OQRA 5I26A 3WG7B 1ID2A 3BQVA 3WIAA 4F7KA 2J57A 1RKRA 3UAAA 1N70A 1BYPA 1NPNA 2GB2A 1PZBA 1JXDA 1KCBA 3FU7A 2PLTA 2UX7A 1KDJA 3RYMA 3V9CA 4DP1X 1KBVA 4DPCX 4X4KA 5AFAA 1IC0A 1E30A 2PPFA 2AZAA 4E9RA 4E9QA 4HAKA 1BQKA 3NT0A 2EILB 1ASPA 2CCWA 2QDWA 5I6PA 1ET7A 3D12B 2P80D 4A66A 3FYIB 3IBOA 5B1JC 2DWSA 2GC4C 2HXAA 5TK2A 3AW5A 1J9QA 3EHBB 4WTQA 4N8UA 1WS7A 2XXFA 3DIVA 4KOCA 1A3ZA 2OCCB 1ET5A 2UXGA 2Y69B 1ZPUA 1BEXA 4E9SA 2CUAA 2HRGA 5F7BA 2AZUA 2MRYA 3ZDWA 5B7FA 2XWZA 4YL4A 5I5MA 1JZGA 4BWUA 9PCYA 2IWEA 5FC9A 1DYZA 1WAEA 3CVCA 3NP4A 3QPKA 2FT7A 1I53A 2BO0A 2BZCA 4KO9A 2PP8A 3KW8A 3WKQA 2J56A 2GI0A 1MDAA 3GDCA 1WA0X 1T5KA 4G71B 8PAZA 2FQDA 3TA4D 2YARA 1TU2A 2XX0A 3NYKA 4DP9X 3S3BB 2YAFA 3S8GB 3FU8A 1EZLA 1KDIA 1GY2A 1TEGA 3T6WA 1V55B 2VSMB 3NSDA 4ZK8A 1J9SA 3CVBA 3FPYA 3G5WA 2HX8A 3AY2A 6PAZA 1BQ5A 1OCRB 1PF3A 1SDDB 2QT6A 2X88A 4G7RB 5AZUA 5B7EA 5A7EA 1V10A 1BAWA 2EIKB 2OJ1A 2XV0A 3GYRA 2W88A 2IH9A 1UATA 2BP8A 1IUZA 2J55A 3CVDA 2XLLA 5B1KA 2I7OA 4FAAB 5D4IA 4NERA 3T9WA 1OE3A 5B7MA 1L9TA 1CC3A 1A4AA 1F56A 4BDVA 2UX6A 2H3XC
chains in the Genus database with same CATH superfamily
3BPOC 3KYMB 3KXFE 1NIFA 3GO1L 1ORSA 1Z5LB 2G30A 3QZWB 3U6XS 3ULVH 2XZCH 1N5AB 1UCBH 3HPLB 4YHKH 1NDTA 1EIBA 2ZNXA 1X5HA 2O5YH 4XVTH 1RULH 5EWIL 1QSED 3H9HA 5GIRA 1DBJL 1MN4A 3QDJD 4MXWH 5MERB 1QKZH 5MEQB 4ZUTB 4OCRL 4PJXF 5I1JH 5F7FA 2PWEA 3UYOD 2NW2B 4JZJA 2C3VA 3VDBA 2C9RA 2JQMA 3MJWA 4PGCB 3B2PA 5TE7H 5F88A 3CN3A 5IP4A 3MRFA 1CT8B 4M3KB 1U30A 4BFJA 1CLVA 3NCBB 1MG3C 3TVMB 4L37A 1G87A 2Q3AA 4JDVB 5KSBB 2FWLB 2QTVA 1ORQA 2BIOA 1G0XA 1I1AC 2VN4A 4PMEA 1PPIA 3HPJA 5ACMA 3T65B 4PJEF 4AIZB 2E47A 5IFAH 5DCCA 2XVBA 3V0EA 2EVGA 2W0FA 5KVGH 2NNCA 1WFIA 2O6DA 3ETSA 1B4JL 1W72L 1PZSA 2ZCHH 3NGBB 5DQJA 2MOVA 1EHLL 3MUZ1 4JFED 4XC3L 2VLKA 4XZUB 4HJSA 3FFCB 4N20A 4UAOC 4OZ4B 1PD6A 3KJ4C 3MYJB 4G8FA 5IHHA 4EXKA 4XPAL 3TL5A 1KENH 1X7QA 2XTJD 5FWRA 1DUYA 2X87A 4Z76A 5IQ7L 4X6CA 5GZOA 5JTWA 4TUOA 1TT6A 3V4PL 2WBJB 3ETBF 3CNKA 5DUML 4A2FA 3BPCA 1Y6KR 4NZJA 2Z1PA 4JLRB 4PGEA 2ED7A 2Y5EA 1XR8B 2J88H 2W59A 3ZIYA 4M93C 1L9QA 3TP4A 4PWEA 1CLZL 3GNMH 3U7AA 3ZRSA 5BJTA 4PB0L 3NIGF 3VFWA 3BP4A 2VQ1B 2HT3C 3NG5A 3A24A 3P2DA 1FDLL 4LDEB 1MFEH 2VDRH 4HHAA 4I77L 4R5TA 5HGHB 5LLIC 4FP8H 1VZIA 1HE7A 2VDPB 2VXSL 2WVTA 4JFQA 1X44A 3QUYD 4U6HA 1MEXL 1CLCA 2E0PA 4ZAKB 3UH8A 4KFMA 3QA3B 3VA6A 5ID0B 1FIEA 1HTYA 4HS6A 2J6EH 4DQOL 3QQ4B 2HLAA 2VDOB 5J8OA 2E46A 1SHXA 2ADIA 4G1MA 4KKCD 1WYJA 2BZ7A 3KJ6H 4JY5H 4QAMB 2VLJE 3D2UD 1CBJA 2YQBA 4N0FB 4QRTB 1OHZA 4ODSL 3QHZH 4JFHE 1SNRA 2KLRA 2BINA 1LP9F 2IGLA 4PB9L 3V0WH 4I0PA 4OZHF 3ZDXF 4LE8A 4MA8L 1J48A 5KSUB 3ZUCA 2MQ3A 1IFHL 3NRFA 5GRXG 4CSSA 4GUQA 4FFVD 1BSIA 2G3MA 4WUKL 1LEKA 4P46B 3L2LA 1IKFH 1X5AA 4JPWL 4KZDL 2ZSWA 4ZUSB 4PVLA 1KELH 4IBZA 5FDYA 4PJDF 5DD6A 2AQTA 5JHDD 5D2LA 5F7DB 1CGYA 3T8MA 4R4BA 3UYPB 2QKIA 4W6YB 3CSBA 1KF9B 3EH4B 3EH2A 5LCVL 3VI3E 4OLYL 1F58L 3BAIA 5F1NA 2JI1A 4UM8B 1D5IH 3V52H 5H4YA 1PG7L 3G5VA 4CSZA 2BVYA 3EGSB 4EN3C 4ZD3H 2HX9A 5D7LD 5EUKB 4WV1B 5HY9B 2R4RH 1T1ZA 1KIRB 1MIEL 4ZMXA 5BRZB 3KGUA 1SYSB 3O45A 4QHNA 4KQ0A 1IKOP 4ODVL 3MGOA 4Y4FC 4JN1H 3LMJL 1I1FB 1RK0B 2HH0L 3S4SG 4UDTA 3LNGA 4JG1H 4JY4B 1GGBL 3K46A 1N19A 4NHCH 2VDRB 4KNQA 3G08B 2EKSB 5FGBA 4XN7A 2GTZB 3WIHH 4FFYA 5T1DL 1D9KC 4HH8A 4L4TA 4LFHD 4H26A 2YQ2A 4PHXA 5C3IA 5JXAL 2I9TB 4OD1H 3N43B 2X4SB 4NZTL 3MRQA 3VFTA 1A9EA 4JO3L 3DYMA 3VXTB 3T3PE 2CK0L 4CKQA 4GRMB 2D4FA 5HI3C 3GT6A 4W9HC 3ECQA 2HN7B 2V8LA 3HUJF 3I6SA 1ZHKA 1FFRA 5E4EC 3G9AB 3SGDH 3QB7C 3VWKD 3HI6L 4Z7WF 1VFAA 1YCSA 3L5XH 2UUDK 5FYJE 3PHAA 1OL0A 4B97A 2VN3A 1KTDB 4ABVA 4BGDA 1ZLWH 3IXTB 4MASA 3FQWA 2R39A 1EXHA 5DD3H 2WYIA 5FKAB 4DCQA 2DLIA 3MUGA 3NPZB 3SJVE 3HG1E 2ZP8A 2Y2YA 2NYYC 1QFWI 3EBHA 5AOZA 1UACH 2IGFH 2J73A 2BOCA 2HJKB 4K3EL 4OLUH 1L9MA 1XO8A 4U05A 3TCTA 3S36L 1I9RL 1DQJA 2LW3A 3BX7C 3BWUF 4JO4H 5ESVA 5IM7B 3OPZL 4YHOL 1N5YH 4WZ9A 2A73B 5BVPL 5I17B 2F9BT 2Q2LA 3L8QA 1TLKA 1S9YA 2DQHH 1D2OA 2UY7B 1U8KA 2ATKB 3G04B 2ZXWB 3O2WH 4L1SA 2KT6A 4HULB 2PR4H 3AT9A 3LTVA 4ZS7L 4W4NA 5T5FH 4NQQA 3D7PA 1KJ3L 1CXEA 3AREC 3RILA 3K4AA 2XVKA 4XNZC 3WKML 3L3KB 4C4UA 2IAMC 4QRAA 4PJ7F 1E4KC 1HIML 5BUGA 4GQ9L 1JFQH 2RIKA 1OAUL 5I1CH 2Y24A 4P2OB 4YOKA 3VO0A 1YEEH 2GJRA 3EOTL 3CLFL 3MX0A 4IKKA 2IO5A 2VLKD 4A68A 3P3SA 3IGKA 4TUJA 1G9MC 2OXHB 4F7PA 2XZQL 5HP5A 3BWUC 4H8QA 3LH9A 5K59F 3MRHA 1QRNA 1FLRL 4JJ5B 1VGKA 1HXKA 1KBWA 3NFPA 5GZOD 3DPBA 1JDAA 2OZ4L 3PPEA 1S9WA 1AXSB 1QSFD 1JFHA 4KZEL 4K71C 5ANMA 2O6EA 2IG2H 4XPHH 1MCSA 3QZOA 1IKNC 4DN4L 4EDWL 5HYJB 4GQRA 4HEPG 2VABB 4MCZB 1OP5H 3U46A 3MACH 1CD1B 4NNPL 1OOWA 4EI5B 3WFDH 5K1JA 1F3JA 2JJSA 2KZ1B 3U6RA 3OLEA 4FN0A 4RMQA 1FO0A 2QPUA 3VJ6B 3UP6A 4C47A 1JHTB 2OV0A 2FL5A 2OFQA 5J89A 1LL1A 1T7XA 1NGQL 1E27A 3D85D 2YBRA 4Y88A 3ZJAA 4WFEE 1CE1H 1X9RA 1Z3RA 2WJ5A 3MLZL 1OWRM 1MFBL 3L3HA 1AHKA 3VYPA 3DHPA 3KS0H 3DI3B 3KLSA 4UDUA 3IMSA 1W6LA 3RGVD 1NMCC 1XGTB 2D7NA 2FBOJ 2ZE0A 4I0PD 3PXHA 4X0NA 3JWNE 2AV1A 3AQXA 4NO0B 4KOBA 1SF5A 1QBLH 5DZVA 5BMFH 4YZFF 4PRNB 3UAJC 1OP4A 3QNYA 3O0RH 5J3HD 3IPBA 1BAFH 3A23A 4LLWA 1OE1A 3UTTA 3UC0H 4MJJA 4Z3JA 3OJVC 2UVFA 5KBKA 4LSQL 2K4AA 4LCUA 4K5OA 1NGXB 4FL4C 3C08H 2VDKL 3NSYA 3T6VA 5FGRA 3DRQA 2IVFC 4XMLH 1RPQA 3B5GA 4MS6A 2HVKB 3RA7H 3SGEH 5ICXA 1MCWW 3MXWL 5F9JB 3B9KD 3NEXA 3BQUB 3W39B 2WZPD 5IW6A 4OCYH 3PF2A 4Y9FA 5FIEA 2WLMA 3OR6A 3FFOA 1XF1A 2N01B 1BJ1H 3R7RA 3QJOA 2HFGL 1L7TL 3T0DA 4LO9A 3MGAA 3HNVL 4J4PA 4AV5A 1IGFL 1QASA 2E3VA 4TVSa 3ZT5A 1KGXA 4V1DE 2A99A 4ES8A 5EBWB 2B7DT 1LNUB 2IQAA 3WLBA 1V3MA 1JUFA 4OBRA 1XV8A 1TVHA 3MN8A 4UT7L 1DQTA 1TTRA 5DA0B 1R0AH 2FH8A 2B4CC 3LZFH 4FLHA 3VXSD 5EN2A 4FNRA 5GRZA 3ZDYE 4WTWA 1J9QA 1KC5H 5E03A 4PP2B 1CFQB 1T6WA 5E8EB 3VFPA 3B7RL 5L2JA 4M1CC 4L3AA 3D07A 6CGTA 2CLRA 5HYEA 3MJ9H 2EO9A 4A6YH 1TQCC 1RJLB 3Q2CA 1FG2B 1ET5A 3C8KA 5FO2A 4URKA 4ENEC 1Y0LB 4OJYA 4BE5A 4I1PA 4P2RB 2X9WA 4G8EB 3MLUH 3SDCD 1XZWA 3BPOB 4PJHF 1JYWA 2ZG1A 1NDGB 5KANG 1M3JA 2JVUA 2ZTBA 3FO1B 3D0LA 4NUMA 4AH2A 4P49A 2FWOB 1KXQE 4YQXL 3CVCA 4P9MH 1BWWA 3VSVA 3OAUH 4L8DA 3WEXA 3VCLA 3FT2A 2AK4E 1T5KA 2Z8SA 1H9DA 4L3CB 4X4YB 1HT6A 3ARDC 4LASH 2PYEA 1G6RB 4MQTB 1S7WB 4HWEL 2DQJH 2GT9B 3V7AG 3CFDA 3D39D 4I1NB 2CKBA 4NC1E 2Q7YA 4Z7VF 3ZY7A 3NACL 4NHUA 2RD0A 3FQTB 3NN8B 3OC5A 1OAXH 5MP6L 3MRDB 1OW0A 3UZVB 3APNA 5E2VH 5AZEL 5M94B 3EDKA 4NT6A 2JV6A 3WNKA 4X42A 1I1AB 2FYVA 5LXGH 5AZUA 1SDDB 4B27A 1FGVL 1IGJA 2ZUXA 1H8OA 4IS6A 4ADGA 4AJYV 5DEFB 3CLEL 5IZ7A 1QI3A 1CJYA 3KGRA 3KPLB 3R19A 3BKML 1SEQH 4L8BB 3MLTB 3EG9B 2X70B 1CDJA 5D4IA 2DBLL 1JXKA 1M6OB 3B37A 1E43A 1I8KB 1P9MA 4RAVB 4UZUA 1BAGA 4B9CA 1N64H 4EIBA 4UAOB 3RX5A 2JK5B 3KJ4B 3L3OB 1JWUB 4K3JL 3C60A 3QUXD 2WIIA 5DMYA 4PJXB 4JDTH 5L6YH 5LGHL 1A6WL 2PP9A 1AHWA 1R47A 3A67L 2D7OA 4XO8A 4Z7QF 1DCEA 2F15A 3BZFB 2O61A 4A2DA 3NJHA 1WFUA 4F7CB 1MJUL 1TTCA 4UUJB 1E4HA 3BVDB 3PGDB 1FP5A 1YEFH 3BKCH 4OGYH 4YK4C 4M93B 2VL4A 4JFOA 2YKLH 4PRIB 5C2BL 1QRND 1WWWX 3BSHA 4JMXA 4JB9L 4JHVA 1MAJA 2HRHA 4PJEB 5E9DE 5KOMC 5I66A 1UENA 2QELA 3IWVA 4N2EA 4GKNB 3LXUX 2NZ9C 2NNAA 5EMYA 3GI8H 2IADA 4P2CG 5IK3B 4A55A 1ACZA 2BVPA 4GW4B 3FJTA 5DMKB 1U92A 4LKXB 2ZZUT 2WLKA 1XAUA 1W16A 2EE3A 4UF7C 5IHZB 2DM3A 4ZRGA 5GRVL 4BFBD 2VR7A 3HLAB 4GRWF 5KVGE 2W95A 3MDJA 5CLTA 1A1NB 1CD0A 2EDDA 3VXMB 3HC4L 4WK2B 4B7IA 4GAGL 5A2AA 1YC7A 3BAWA 4J8RB 2RCSL 4EVNA 2W65B 5HGBA 4C4KO 2KS0A 1R5WB 4NN5C 3F3HA 5IROA 2BNRE 1SY6A 4TNWK 5EUOA 3RIFK 1H6EA 1MCQA 4A7VA 5H2BB 4L3FA 1NCCL 1CU4L 2VMJA 3LPOA 4R8WL 1A0QL 1GZPB 1ZVYA 4P5RA 5E00B 2FR4A 3RPBA 4N5UA 3HE7A 4Y0GA 2SEBA 5A1AA 2XBDA 5DJ0B 3BP6B 1DN0B 1JERA 4E41A 5GZNC 3BD3A 3QJSB 3EO9H 3L4VA 4PJCF 1J0YA 3WDHA 4E36A 1RURL 1G9EA 4FJYA 2E9JA 3UTTD 4O4YL 2LGNA 3QORC 3DX9B 5IQOA 2XPGB 3CDGB 1PY0A 4PVNA 1LP9B 2Q3XA 4NQDE 4OZHB 3ZDXB 3D25B 3RNKB 4N26A 4FXLA 2BIMA 2AKRA 3DGGB 3G6JA 4Y4FB 1U6AH 1NCAH 2Z7YA 2IANE 3BXNA 3HZVA 3H9SA 1XAKA 1I8MA 1EJOH 2EAEA 3CFCH 1E28A 1TVBA 5DVNA 1J10A 5HBBA 5C0RL 4IJTA 4XH2A 1CQKA 4PWIA 3VXOB 5HYSA 2JIXB 1UZ6E 3HS8A 1D9KB 2ZXCA 1CCZA 4WI4A 1VADB 4DGVH 5IJKA 3VGAC 1Q9OA 2F7RA 2X41A 3QSKB 4NM4L 2I60H 2AANA 5FO8A 1OALA 4NKDB 3DXAE 4H8HA 1IRAY 5DEGB 4J4PD 1JZEA 1SXSA 1GC1L 1X5IA 4KAQL 5DK0A 5CBEB 3LAFA 3SPGA 2ZXGA 2YAEA 4A37A 3HS0C 3PHQB 3M8OH 2DRUA 1AMYA 4N22A 4UQAA 4XHQA 4YPGA 5ICZA 4QXUL 1WGOA 3KPOB 3FT1A 1ZMYA 3LPWA 5HVGB 3TN0C 3CFNA 1BX2A 1FVCB 5EC1B 4PWGA 2WZ5A 2XV3A 1E7VA 3QS3A 1H3XA 2F54A 4YXKL 5I0DA 5E4EB 1TOXA 4TNFA 3QUZD 4MNQD 1T1XA 3SDXA 2Q20A 1JZ8A 4B53A 5FLUA 4WF7A 5ITBH 5EOCH 3X2QB 3NIDE 2FECI 4MMZA 2XG5B 3REVB 3QG7L 3GIZH 4JL2A 3RDTC 1G0DA 2HUEA 2NOYA 2Z8VC 2Q8BH 4MQ7B 1JN6A 5DD5L 3FUEA 2W92A 5FUZH 4ZFGL 1DP0A 2H1PH 2K45A 2WLIB 4NZRH 4Z77B 4ZX4A 4NUGH 4FLRA 2Y5TB 1X5MA 5EA0H 3P0YH 4XPTL 3SGJC 4G6MH 1AKJA 3V6OA 1RZPA 3A5VA 2L7JA 1KY7A 3CDYA 5FGCB 5D71L 4XN2A 5FA4A 1ND0B 4IRJA 3NEOA 3GKWH 4P0DA 1HHHB 5TE6L 4IIQA 5E2UH 4JPVH 5HTSA 3ZYIA 3DK2A 4BFOA 3SO5A 4W81A 5DUBA 4Z7WB 2R0WH 1CPUA 3QUKB 3ASNB 4NJAH 3PWPA 4XCNB 4HFUH 2L7QA 1SRDA 3KPNA 1HXYB 4NKIH 2WLJA 3I6LE 4I13B 4Q74A 4EZKA 4XNZB 3T77A 3EF4A 4WWKD 5A16A 1TZIA 1BXAA 3GHBL 2IAMB 4PHZA 3F64A 2E4TA 2XVGA 3B3IA 2XG4A 2NY1B 5DDHB 4M3HA 4G7QB 4UIMB 4TNVF 2MCPH 2IOMA 4LIQE 4ZW5A 1BD2B 1MCFA 3LN4A 4E5XG 1S8DB 3MBED 4TTDC 2EXYC 5KUKA 5D70L 3O6KH 1E2WA 2R1WB 2CKNA 1KBGH 5EEVA 1E9OA 4XP5L 1SXCA 3D5OF 4LSSH 4N90D 3BAJA 4L05A 2OMBA 2HX7A 3DECA 4N6RA 2ZQKA 3BN9D 5F8RC 4Z7UB 3QDAA 2VQTA 1A21A 1ZPLA 5C0DA 2OW7A 1QSEE 2EEBA 3NCXA 4K71B 3EUUA 3MNDA 3QDJE 3ECWA 2JJWA 3AUWB 2VITB 4XP4H 4ZTPL 2GUOA 1E9PB 2DOCA 2CDGB 5KBMA 3DOSA 1D5XB 1JRHH 2WQ8A 3S3CB 2NUPB 3VWJB 3QJUB 1A64A 4Z5RB 2PETA 4PJ7B 3BAEH 4NO2A 2JKNA 4RQQA 2ZYIA 4RSYA 3AU0A 1P2CA 1H15A 4XVUD 1ZVHA 3M1BB 3KLKA 4HS8L 3RWDB 4NQCB 4NOBA 1BZ7A 2Y23A 1CK0H 1JWSA 4MDIB 1MLBA 3Q6FB 1H3VA 1L6XA 4UOQA 4H25A 2OKMA 5L7XH 4LRIA 3HZKA 2R9HC 1ZSHA 4MQSB 3SCMC 3BMWA 5BS0E 1Y18A 1AO7D 3FOMB 3CHRA 2MOGA 3QZWA 4NDMB 1NMCB 4UNTA 4W70A 4JFEE 3OKDA 1JPSH 1MY5A 4IOSA 5LGJB 3E0GA 5CJXC 2YAPA 4J3BA 2UZIH 5J12C 1TYRA 1E42A 3QP3A 2VKXA 5F6HI 5E08H 4Y5XC 3TNMB 1B3JA 3BH9B 3DOIA 3LN5A 3P3RA 1YEDA 1YEHL 2HJFA 2Y3NA 4Q4IA 3MRJB 2VW4A 2WOYA 3CAFA 4RH4A 4M5TA 3GRWL 5B3SB 1RY7B 2A6DA 4AW4A 1OAZL 4P05A 4YSTA 1TQTA 4IU2B 3B7SA 3HE7D 1CT8A 4FL4B 4KJPD 4PJAE 4WCYL 1PAZA 4GXUN 3WKNA 1N2RB 1M56B 3EJQA 4A7GF 3ZSSA 3JV0A 4X50A 2AEPL 1AD9B 2QHRH 1M71B 1XGPB 2DD8L 2DJ4A 4JDVA 5KSBA 3J2PA 3VFSA 1OGAD 2A4CA 1E0OB 1EV2E 3HCVB 3L16A 1A4KB 2D3NA 1HKLL 1YMMA 4FZEH 1PAMA 3C6LC 3QK0A 4DH2A 1VESA 4CGUB 1TEYA 2ZKYA 4UYQA 4OGXH 4YLCA 3HR5B 4F7TB 1XSKA 1MUJA 4QRQB 4QRSB 1C5DB 5C0EB 1PX4A 3K4ZA 5KN5B 3FFCA 4PAZA 4OZ4A 1WCQA 3ZKSD 2FZ3B 1O75A 4ZXBC 5T33H 4ELME 3N3EA 4XNMB 3TTYA 1HZHH 2CNZA 4KJYA 1SPDA 3FCGA 3ZE0B 4DO4A 5AVVB 1RV6X 1ZT4B 4RDQG 4QIRA 4MXVF 5KANI 2QQKL 3GMMB 5F9OH 2NY3D 1CDYA 2PXYD 3QFDB 2Z7WA 4PS8A 4XCYB 4A7UA 3ARGC 4JO2L 1DQVA 1TQCB 4MBRA 4EOWH 5KW9H 1Y1DA 3JWDL 1G1CA 3WTSA 4FFZH 1WFNA 4CSPA 1J8SA 2VO8A 3DVGA 2D7TL 3EFFB 3F7YA 3UAEA 1DL7H 2PABA 5HVHC 3RI5K 3EDJA 2EYRA 4E9TA 5KG9B 1X3DA 1WHOA 4JY6B 4H88H 3O9WC 2F54D 5JHMA 2DM4A 3FH7A 4S10A 5IVOA 5ID0A 1FI8C 1RP9A 4F7KA 4R83A 3QQ4A 5FV1L 3RVVD 3FU7A 2EVJA 3ARDB 3HRZA 5CIPA 3S4SB 2ZOLB 4P5TC 7TAAA 1UQSB 2E27H 3NSJA 4MXQD 1RVFH 4LLYA 2DPKA 3P2TA 1N26A 2O5XL 1JK9B 1H9VA 3MGTB 1TZHB 1XL6A 3AABA 5H94B 5KSUA 4NN7B 3MRGB 4N1EA 3IDGA 1CBVH 3UYRL 2YZ8A 3A0OA 4KUZL 3IMWA 1A1MA 1MCPH 4XMUA 3ZYOA 5DVKA 1RK1A 3WN5C 4D9LL 5B39G 2FIKB 1ET7A 1HI6B 2VXTL 1AKJD 1NBVH 3GMLB 1IAOA 1MHHA 2R69H 2KUTA 2NTFA 3ZVVA 2APBA 1MRDH 3TYFA 2HAZA 3GZOA 4MCYB 4K7PX 4WTQA 1YN7A 3QDHA 1WTGT 1FSKC 2LQRA 3D2TA 4F5CE 3V10A 3DIVA 5AYQA 4ZDHB 1NC4A 4RMVA 4X6DF 5G4MA 1T2JA 3KCPB 2IBGA 4NIYE 2CIIB 4S1DC 5E0QA 2EDRA 3MV8B 2HRGA 4FERA 5F7BA 1A02N 1ZTMA 2AZUA 3NAAH 5CJBA 5EUKA 4WV1A 5HY9A 3S5YA 1R9FA 3F85A 2ZKXA 2Q2EB 4NQTA 1OAQH 5B38G 5BRZA 4C59B 4Y7OC 1KZQA 1SQMA 1U2CA 3E9UA 3IK2A 3MQIA 1MDAA 2BM3A 1I1FA 5C0IA 5DZJA 2FQDA 5IMOA 3W82A 2QJDA 5LAXB 4YK4B 4QHUB 1DVUA 2MKWA 4RZKA 5D7SL 2GTZA 2D3VA 2J8HA 1D2PA 2ZXBA 3P4OA 1HHIB 4YHPA 5IGXL 4K8RC 5D1XC 5GSVB 5LQBH 4M6NL 1IBDA 4K3HA 1ES0A 1KZYA 5I1AB 1P0SE 1RJCA 3BZ4B 3H9YA 3QRGH 1IJNA 1ZA3B 4RETB 5B7EA 2ITCA 1XSJA 3FQUA 1U95A 1QSZA 2OJ1A 3G5XB 4G1EB 3S35H 5IMKA 2QFPA 1UGKA 1JHLH 2L0DA 3LVTA 5FHBH 3RWCB 4N2MA 4YWGL 1IUZA 1IC7L 4Z7QB 3IYLW 5LAPA 1CDBA 2CH8A 4FYTA 1XCTB 2BVOB 4ELDA 1ZSDA 2ADGA 4PSPA 5IMLB 2Z1KA 1HJCA 1RUAL 1CFVH 1KTDA 3LDBC 4MLIA 4UTBA 4NWUL 3O3DB 4M9PA 4F37F 4OF0A 1T0MA 1MF2H 4H0GA 2VSKB 4LOEA 3GLAA 5FKAA 4BKLB 1TJIH 3Q5OA 3CK0H 4IOSD 3BESR 4HUNB 4OZFA 5I73C 3OC8A 1GMEA 1MJJA 2GIYA 2HJKA 2MNUA 4PS7A 4KY1L 1AZZC 2DBJA 3WHE0 3KM1A 2MPAH 3LHPH 3CU7A 4X6CE 5I17A 4L1BA 3NCEB 1TTFA 1LD9B 1HYSC 4OVUA 3NJIA 1YJDC 3LRGA 1A7QL 1IGYA 2JKWA 2A9DA 5BZWA 4I3SH 1D7CA 2CO2A 1OT1A 2DF3A 4XWGL 4DKFL 1KFAH 4H2AA 4LDCA 1OCZB 4ODXB 3O3AA 2LAAA 3LPFA 2YD6A 3SKNB 4N3TA 3AXHA 2HTLC 1WEJL 2DLHA 4FZ8L 1FAIH 1M57B 4CADB 2ZUSA 1CFSA 5HHPB 1RIHH 4QF1A 3KNBA 4P2OA 4R6UA 3VGAB 3L1OH 1T4WA 3EYUL 3OAYH 4PRAA 3RZCC 3W9DA 3RJDA 1A65A 3PGFL 2WB7A 3FFCD 1AR1C 4PJCB 4MA7L 3HS0B 3TJPA 2LR4A 4U1HA 3K7UA 4UYPA 1JV5B 2VLRB 2X53A 1K8DB 1DUZB 1HEJC 1U41A 3TC9A 1GXEA 2BOLA 5I8KL 1HS6A 2WBJD 5FO7B 1JYNA 5JW4M 4JNXA 3ZTJG 4TULH 1HAWA 3UPRA 3WJLC 5BW7A 4RDQF 5CINL 5L4IA 1XSIA 2VABA 4MCZA 5FXCH 3D06A 4I88A 3I6GB 1EQWA 3F04A 1F18A 1CD1A 1LO3H 1PD1A 4LPXA 2FE0A 3ESMA 5D2LE 1U8IB 3RDTB 1F4YL 2F6AA 1GGYA 3TIEB 1BP3B 2EUWA 1HEZB 3TM6A 2GHZA 1H3UA 4G7YL 4ODTH 4UU9B 4ZAKD 1DO6A 3KPTA 3U36A 3V9FA 3VJ6A 4DP8X 4AQAB 1JHTA 3OAZH 2AMGA 1NGWA 4FFTA 3FRUB 3V4VB 3WS6C 5I15L 3L3DA 1CYGA 4HJ0D 2ICEA 4ZMQA 1HCFX 3ZL1A 4YZWA 5IW1A 5EEWA 5AW0B 1RJYB 2QVIA 1DJIA 1SHSA 2WZ0A 5DRNA 4U1SB 4YBQC 4M1DH 3T5WA 3U82B 4NO0A 3F83A 3V6ZB 1E50A 4MVBC 4PRNA 2DL9A 3P40A 4FEMA 2OSLA 1H3WM 3TCLB 1D7BA 1RMFL 4A2MA 1UM5H 4RGOL 1HILB 3FL7A 4L4TE 4X5RA 4Z6AT 4PWFA 3J7HA 5EOTA 4KTGA 2PR9A 3COOA 1MW1A 2HKFH 3MV7A 4LLAA 5KSVB 3DTUB 3IN0A 2TSBA 5FHAL 4HKJA 1KCUL 4MNHA 3NA9L 5G4OA 2ZP9A 4OH2A 1WRFA 2HVKA 3S9DB 3N91A 3RTQA 4PV9A 2UWEF 5IF0B 4DKDC 1EZVY 4O58H 3FT9A 1AJ7L 2XIIA 1ADWA 3BQUA 1PLGH 1AQKH 4W4OC 2BRRL 3ZTNL 4OJAA 5T5NG 5BRZD 4ODWB 4LF3A 1E4WL 2ZYHA 1BVLB 4ZX5A 4UB0L 5IVNA 1MFAH 1OQOA 3AS3A 2DLTA 1ZIBA 4UT6A 1KB5L 4APQC 1W6WA 3QEQB 4J5VA 4YHIA 4WEEA 2TSAA 3BE1L 4YDVB 1V5JA 2RB8A 4KKQA 4HU2A 5DQDH 4DP4X 4QY8B 1LDPL 5I6XC 4WFGD 2JB6B 2NQCA 2AEWA 5AUMB 1SLUA 3UJIH 3IJ9A 4B96A 3DIDA 1ZEAH 3R1GH 4PD4J 1FG2A 1K2DB 3G5ZA 2A83B 3P11H 4AE1A 4KKPA 5CGYD 2R7EA 4OCNC 3E6FA 4Y5YC 1H3PL 5ILTH 5BVJA 4P2QA 4JUSA 3DVIA 2LU7A 4W9IC 4G8EA 4Y9EA 4QRRA 2W9EH 4DZ8B 2N7BA 5DJYB 4KXZH 1NDGA 1KPVB 2VZSA 3KHQA 1CFTB 4BZ2A 4U33A 1IVTA 3RU8L 1KG0A 4M6ML 5J12B 4L5FH 4NC0B 4HKBA 2EEAA 3HMXL 1G9NH 4NKOA 1RUML 3DO3A 3U7WL 1CICA 3U4AA 2J8UF 2E8ZA 1LK3H 3DHJA 4H5SB 4X4YA 1NGZA 1G6RA 1XGQB 1Z3GH 5GJTH 3ZRCC 4F24A 4LVHB 2VH5L 3GPEA 4NNXB 4TSBH 4TL5A 3GLDA 1FL6B 5I1EH 1DFBL 5BV7L 3FRPG 4YXHH 3QXWA 3FQTA 1TCMA 2DQFB 3U79A 3MRDA 4XAWL 3CQPA 4WGVB 3ZR5A 1QRNE 4L9LB 2XYBA 1EHXA 1WIUA 2FEEL 4ANKA 1KIQA 5IG7A 1ZLWK 2E56A 3DX8A 4J2XA 3K0YA 2X4PB 5DEFA 3BI9X 3KS0J 3FTVA 4ISVA 1NANH 5ANME 1SMOA 3C6LB 4PTUB 2AGJH 2WXNA 1TEFA 4L8BA 3MLTA 1J86A 2FJGB 2OYLA 1PNCA 4P9HH 2X3BA 1I8KA 1CWVA 3QQ3B 2YRZA 3SKOB 3K2MC 3MLVH 2JK5A 5L8JB 1NIBA 3PGCA 1HDMB 1MPAL 4O2EB 3ZL4H 2V6HA 3T6QC 5T1MB 3U1SH 2OJEB 1EZSA 2MTAA 1MCCA 4U2ZA 4ZODA 3B2UD 4DF9A 1XB3A 1GH7A 4GUOA 3C5JB 5SWZB 3MODL 4P2OD 4RRPM 5CLXA 5C6WH 1X5LA 3PGDA 2FGZA 1CUOA 4R7LA 3PV6A 2X3CA 4WKZB 3ARGB 1DZBA 2AVFA 4YHLL 4AUJA 3NJFA 3F7RA 2X4RB 2J1KA 4FEIA 1BFSA 3BSZA 4LLMA 2C9SA 3ZUNC 4AQ1B 5FYJL 2A9NL 3ME0B 4O02L 2NTSP 1W8EA 2IH8A 1UD2A 4J3OH 5HVHB 4LCCC 2VZOA 3PFUA 4JKNA 5LWYH 1FFOA 2NSXA 3JVGC 1BJ1J 3E8UH 4PD4K 4Q0XL 3LKOB 3QAZC 3MLYH 4RAHA 1OF2B 4KRNA 5C0NC 5HYJD 3SD2A 4LMQI 2BDNH 4YC2C 3TNNA 2APVA 3UTTE 2DI7A 4UNVA 4NLHA 5J6SA 3VTTA 2ZNWA 2YRLA 1UA6L 1SXNA 3VM7A 3WMPA 4ERSL 1MQKH 5K9OA 4EI5D 3B1UA 4G9FB 1QLRA 4P5TB 4KJWD 3IMRA 2PPDA 2DQTL 4OSUH 5T3ZH 2W0KA 1A1NA 5JW4Q 4XX1G 1SGKA 3SDYL 4J8RA 2VERN 4M8QA 3OHXC 3MCG1 3RAJH 3OD3A 3ECBA 4GKSB 1NAMB 5EV7A 1OP5K 3W0WB 3WN5B 3K1KC 1Y1UA 1E3XA 4OJEH 4H7VA 2EH7H 2UVEA 2WSKA 5H2BA 1M7UA 1D6VL 1J87A 2HCZX 1IAII 1U3JA 1GZPA 4U7KA 2AJYL 3DV4A 2F19H 3T8XB 1BEYL 3TWYA 1AIZA 3SE9H 4ADIA 5DJ0A 4NO0D 1J1OL 4AZUA 2YS4A 4HC1A 1Y6MR 3FAXA 1I4FB 5CCKL 4XI5C 1SM3H 5DK3A 1RFDH 1JL8A 1RZIB 5TJWK 3IAGC 4XNYH 1AP2A 4EN3A 3A21A 4NFDA 1ZCRA 2JCCF 2QLYA 3A47A 4N2KA 5DVPA 1CFNA 5AVUB 1LP9A 1KJ2H 4OZHA 5DRXB 3D25A 2M26A 2APWA 3WIAA 1U8QA 4OGZA 3P4MB 4Y4FA 2WNGA 1KCBA 1JGUL 5C3TA 3U83A 3MTRA 2A74C 3BQUD 2FX9H 2PYFB 3P0GB 5EZPA 4DVRL 3QEHB 4KXAA 1KBVA 3VXOA 2JIXA 2M83A 4TQHA 3S88L 3LKSB 5DJCA 1VADA 4PJDA 3O41B 4OUUA 3VVVA 3L4UA 3NEEA 4I5BB 4BE6A 1NCJA 4E9QA 4BH7B 4AITA 4HD9A 4M7KL 4MYPA 5CJQL 5T5NF 1QD0A 2CCWA 4X6DB 2DQUL 3UPAA 2DB8A 2B59B 4Z0BL 2PYEE 5J6GA 2OK0L 4FQ2L 2P44B 1UT2A 1KCRL 4LHQB 4X7SL 4U31A 2JJVA 3KPOA 3TBVB 4EIZC 5HDWA 4P3CL 1N4XL 1A3ZA 1N59B 3E1F1 3GXIA 3FTGB 1MAKA 1M2VB 3MBXH 3MROA 4LP4A 2CUAA 4UTCA 4PJ5A 1UD5A 3V8CA 2UZXB 4E5XB 3CDFA 4K7PL 1W0VA 3LDBB 1U8CA 5D7KE 3WENA 2VL5A 4P2RD 3VG0H 5I19H 3NFSL 1DYZA 1WAEA 2JSFA 2BO0A 1I53A 1F2QA 3PWJA 3F5WA 5D55A 3GIVA 2DQGH 3NCMA 4GBXC 1IGIH 4HWBL 4U6VL 4WGKA 2GQHA 1M1XB 5I73B 4N90E 4UTBH 1S7UA 1W0WA 1YECL 4GW5A 1P4BL 3EO1A 3Q5TA 1RHFA 2HPTA 3PXJA 3CX2A 1A3LL 5C6TH 1JMZA 1KJ2B 2OYKA 1MHCA 5GGRA 3FN0L 4O9HH 2OMVB 1ZWIB 1HHHA 4GAJL 5ACLA 1W15A 3HUJA 4KGLA 1MCHA 1V7ML 2EDEA 4N8PA 1YQ2A 2BNQA 3IKCA 4Z7WA 3QUKA 1SBBA 2FEJA 6PAZA 3W37A 4JQIA 3VVWA 2WYTA 3I75A 1HXYA 3GYRA 3AREA 4Q14A 1I1AD 4QT5B 5DR5H 4H20H 3WY2A 3MMEB 1OHQA 1FZOA 1IBFA 3O8XA 4OCSL 5B1KA 1E4KA 4HCRH 4BFKA 1KTRL 3X13B 2Z31C 1EMTH 3KDPB 2IF7A 4HJJL 5IR1B 1BD2A 1CL7L 4AW7A 3NQIA 2FO8A 1RUQH 2H3XC 2JQZA 1MRFH 1J12A 3ATDA 4W6XB 5HGAA 2DYSB 1DSYA 2UXTA 3M6DA 1I75A 1AR1B 5CEYA 1AXIB 4GH7B 3ZGHA 2CLZA 4K0OA 5EU7C 3Q1EA 4XB8A 2VXQH 4LEXL 1M2OA 1OP3H 3RWFA 4N1HB 1KMGA 2R29A 3CFEB 4NRYA 2Q3ZA 1QUNA 4TN9A 4M7JH 4L8SC 4PWKA 4J8QA 5FUOL 1MJ8L 2HT2C 4FABL 2FUQA 4U1NB 4WFHE 3T4AB 3KPQA 3VRJA 4X4XA 2VITA 1IKNA 2RH0A 3KR3H 5EUOE 5F6IC 4KKAC 3ARVA 5AWNL 2P80A 5EU3A 1R5IA 2XXCB 3VA2C 1NUDA 2CDGA 3IFNL 4FXKB 3VNZA 1D5XA 3B83A 2GBVA 1I7ZA 2AI0L 3U2SB 3TFKC 3LRSB 2XV2A 2HT3D 4PJ7A 5CEZH 4I9WE 1E4XI 4UAHA 4QGYA 1UM6H 1NMBL 4WI0B 1AZCA 3SSGA 4E41E 1EAJA 3FONB 4NQCA 2E59A 1DQIA 4RBPH 3FSZA 3RX9A 4ZG1A 3SOBH 1UYWL 4Q97A 2AK1H 3Q6FA 4DGIL 2JE8A 1FL5A 3OGOE 2YMOA 3S3DB 3WL9B 2VMDA 1OAYL 1B0RB 1BVKB 4YE0A 1ZHNA 3X3GL 1S9VB 4YHZL 1BXUA 2D03H 4K4KA 2BJML 1F11B 1HSBA 3CSPA 3FOMA 1N7ML 2XRAH 5C09B 1C8PA 1Z66A 3ELQA 4KXDA 1QWNA 3G6JE 3DUSA 3EFOB 2WANA 2QQLH 4OI9A 1M9SA 3TEWA 3H9SE 3WIIH 5HSFA 4P57A 3DBSA 3VD4A 1V54B 3BH9A 5EOCJ 4DK3A 3MRJA 4UOJA 2DEWX 4NPYB 3EXJA 1QR4A 2X6VA 5JUEH 5FYLH 4B5ZA 4D9RE 4NQXB 2A9AA 3ZKMC 4H0HB 4FQJL 3VFMB 1G7LB 1J05A 3NMEA 3NPSC 1ITCA 1WZLA 2KI6A 1FYHB 2F61A 1VKXB 5KYXA 1M71A 1TDQA 4MAUL 4UANA 1HL8A 2IBBA 2IFFL 5EIIG 1TMCB 2WLLB 2YEQA 1DR9A 1OGTA 1A4KA 4EN3D 3FUFA 4WO0A 1MWAH 3S96A 1ZANL 1WD9A 2F54E 1JNNH 3W11D 1IM9A 1ZA6B 3SDXE 1KXTA 3D0VA 1R1CA 4TL4A 4ZFOA 2EVFA 4YSUA 4G83A 5KS9B 4QRQA 4Y4FD 1C5DA 2JKXA 4OZGF 3TH2T 5KN5A 3CXDH 1V3JA 1VGEL 1J5OH 5KOVC 2MFNA 2FGWL 4OD2B 2FZ3A 4X8XA 1FZMA 4W9LC 4XNMA 4ZFZB 5EU5B 15C8L 3CFTA 5I0YA 3BEWA 3FU5A 3VD5A 2JIXD 5B39B 1D9KD 4WUUB 4KC3B 5I5IA 5F7EL 25C8H 1R24A 4N87A 2YXWA 2JKSA 3O2DL 1NCDL 2AAVA 2E6PA 3ARSA 3V6OE 1J8HB 4X98B 3L54A 3GUFA 3N40P 5AOLA 2B2XL 3X12A 1HAUA 3H0TB 5AYUL 3K6SA 2VZVA 3EFFA 4Y5YB 3IETB 3BPNC 4Q9RL 1Z9SB 1I8AA 2ERJC 1HN1A 4X9YA 5HI3D 2FT6A 5JO5B 5DO2C 2YD0A 4JY6A 5KG9A 1IQDB 3CSYB 3PWPE 4FI7A 1DBKH 3WFEL 5K69A 4N0YH 3HMWH 4WY7H 5B38B 3QJQB 3K8KA 1WWCA 1MFDL 1RP8A 1B6UA 3QNFA 4JREC 2BW5A 4WO4B 5KYUA 1LHZA 3IFOB 4FXGB 2I07B 2X12A 3ARDA 2ZOLA 4U1KA 2A9ML 5JHLH 5EORL 3DX6A 4DN3H 2Q76A 2VN6A 1JK9A 1NGPH 2AQQA 4R0LB 4TNGA 3ZKNC 1Z6JT 5H94A 1XBRA 1RQ5A 4Q9QH 4LOUC 3MRGA 2GI7A 2NYYD 1YY9C 4JE0A 2XU9A 1GS6X 3ARTA 4XNDA 1B2YA 2TAAA 1N3NA 4WW1B 2FIKA 2RALA 4GFTB 1WA1X 4XNQA 1MCBA 4U6TA 1G0YR 1U8HB 5EC2A 5J06A 1OSPH 3HC3L 4XBPB 4ZNEA 4PJHA 2P47B 1N6QH 3HNTH 1DBML 4UTAH 4J3TA 4ZDHA 3NIFF 1SJEA 3KCPA 4MS8C 2CIIA 4ODUB 3NABL 2X1WL 1J1XL 4LT7A 1GAFH 2J8UB 5T3XH 3B8SA 2FATH 2ZX5A 3WFCL 2IAMD 3TA3C 4FQCL 4AENA 3ZTJH 4BUQA 3DTXB 2AP2A 2NY1D 4E9WA 4Z7VA 1OAKL 1QATA 4ZMVA 1BD2D 4XOAA 5IVXB 4KU1A 1SZNA 4FQXB 5ALCL 3CFJB 2VWEE 2WXKA 2VDLB 4UBDC 4V2CB 5DHXB 5LAXA 1QWHA 1CGVA 5HD8C 2HLFC 3O4LB 2BC4A 3A4DA 4O2FA 2YEZB 4U6XB 1HHIA 2ZP0T 2X9ZA 4LCCB 5IB1B 1ADQH 3EJSA 1TJMA 1CLYH 2Z64C 2ZOKA 3FQ2A 4KTYA 4NC2B 5GSVA 3FO0H 4HIIA 4HPYL 3DRTB 2XKNB 3QAZB 4QNPE 4B9GA 4CW1B 5ESAB 2BCKB 1CE6A 3GO1H 3VWJD 3FXIC 1TSHA 5M95B 2FB4L 4IRSC 1S5HA 2GABA 2BSBA 3CMOL 4UZSA 4N6QA 5EWIH 4NM8L 4K9JA 2ZSVB 4NQCD 1DBJH 2O6PA 3CZEA 4BA8A 1FPTL 2C3WA 1GVIA 5F0MB 4NQEA 4OCRH 5IMLA 2H8PA 3B2MA 2IFGA 1YMME 3OX8A 2GVYA 3KLQA 3WJMA 3SY0B 1P84J 2F8VA 4CJ1A 4AWJC 3P9WB 1J1PH 1ZK5A 5JOFA 1BVZA 1TITA 4TOYL 2P5EA 1UA7A 2Y06L 3C09C 3RJOA 1K3ZA 3H4FA 3FFCE 1J0ZA 5I5RA 1TETL 2ZOOA 1NOFA 2YQ3A 4KUCD 5GZNA 4LIQL 2DWTA 3UAJD 1JI1A 2NY0C 1QO3A 3V0JA 4Q52A 3GMQA 5D6DC 3OXRA 4WJ5A 1LD9A 1B4JH 1W72H 2GG1A 3OBAA 4HG4K 2EXTA 1T89A 2BSTB 3EGXA 5C0FB 1ZGLM 4KHTL 3GS7A 3QORA 1EHLH 4E42B 4J6RL 4XC3H 1FN4B 5CCGE 3GUTA 2YA0A 2VO5A 4XPAH 4EIUA 3QCUL 4GLRH 3V0VA 5A3IC 4XCCL 4N0UB 3FO2A 4ODXA 1MAML 2ICWI 2WLYA 5KVFE 5C7ZA 3T1FA 3U2JA 5AW8B 2OL3B 4BFGA 2EDFA 5IQ7H 4GMSL 4C58B 1WBZB 3V4PH 2A74B 1XIWB 5DUMH 3VAEA 1AI1L 1SMDA 4J6IA 1IM3B 5GS2D 4R2GC 2YPVA 4E9LA 5T3ZE 5A2JH 2PCYA 2JF1A 4FCHA 3SDDC 1TU2B 3EJZC 5L9DL 3HI1B 5LBGA 4PLNC 1CLZH 2W8CA 5F0JB 3OKOB 4PB0H 3U4EB 1KNOB 2YUVA 2V9QA 3OMAB 1FDLH 4PJCA 3NJNA 3HS0A 4I77H 1WAPA 3BVUA 2OSWA 4BELD 3SKJL 1KGWA 2VXSH 2R83A 2UY6A 1MEXH 1JV5A 2VLRA 1WGVA 3PJNA 3UG5A 1XDTT 1PCSA 4KDTC 3TN0A 4ODBD 3GEWB 3O6FC 2J2ZB 3WS3A 3PG2A 3OSKA 3ULSB 1SVBA 1KJVB 4DQOH 3GTTA 1XGYL 4ELKB 3P54A 2MOQA 1PL3A 1NDMA 2Z93B 5AKSA 5LBSL 4ODSH 2BXZA 3L2MA 3NDZE 4ENED 2Z8WC 3I6GA 4PB9H 4JO8A 4K9EC 4MA8H 3T2LA 3ZE2B 1IFHH 1BG9A 4NIKB 5I26A 3WYRA 4UU9A 1OOAA 1RKRA 3LV3B 2CXKA 2QVMA 2VDML 3EOYG 4NZUL 2GSIB 4GBXB 4WUKH 1FVDA 1ZLUK 5CFAA 4MNGB 3PWNB 1MLCB 4Q6IB 3V4VA 3KYNB 4JPWH 4QXTB 2QR0B 5L4JA 1DVQA 4KZDH 2XXMB 3RYMA 3N9GL 1P84K 4LDOB 5GGSY 2A4EA 3SGJA 3ARDD 3Q06A 5BRZE 1JF1B 4HOZA 5EO1B 4F80A 4I7ZC 3LNDA 4HJUA 2NCMA 5LCVH 4OLYH 3HA0A 4APXA 1F58H 1MFNA 2G9HB 4HAKA 1D5BB 3KVQA 2EDLA 2Z0UA 3BKYL 2FAUA 3UX9B 5IBTL 4QHLA 1PG7H 3FYIB 5HYQA 4XGZA 1ZOXA 4S1RL 1MVYA 1O9ZA 2ZX6A 1PYWB 3AW5A 2AV7B 3V4UL 3MAWA 2KYIA 1MIEH 4Z3TA 5BUPA 4IYKA 1KBKA 1HNFA 1OK8A 4XRCA 3QXAB 4ODVH 3KBFA 3HC2A 4NENB 2EC9T 3AXIA 2Z31B 3LMJH 5KSVA 2HH0H 1GYAA 1S9KC 3ECVA 2EXSA 2G9KA 3L6FB 1GGBH 3GI9L 1XGUB 5GGUB 1ZXQA 2IBZX 4GAFB 1UH2A 1UKSA 3JTSA 4OQTL 3MV8D 2W07B 3EDDA 1RPKA 3L9EA 5T1DH 1AGBA 1CD9B 1KIPB 5F7KC 4BKTC 3REWB 5JXAH 3BIKB 4PJ6A 2BZCA 3KYOA 1B0IA 3KW8A 4F58L 4ODWA 3GDCA 1F3RB 3A3YB 4NZTH 1EDQA 3ASWA 5DRWB 4Z7AA 3V0IA 1INEL 4KK5C 4X5PA 4F15B 4L8SB 3SKMA 4OD3L 1Q9WB 2VJ8A 5JIPA 4N2LA 2JNZA 3OR7A 5F6IB 3BO8B 1U4EA 3FRPB 3CC5A 3MNVA 4KROC 4OFPA 2XTJC 3LD8C 3GSNL 4NSKB 5EBMB 1TEGA 2B9AA 4RGNB 4XOBA 3HI6H 4X6BB 2CIKB 5EIVA 3V6BR 5F3BA 5F2FA 2IH3B 1HCYA 2HX8A 2NZ9D 2YSTA 5BCAA 4J1UA 2Y7LA 4QRPB 4RA0C 8PAZA 3N44F 2E7LA 3EHBC 5CN3A 2W88A 2A83A 3NESA 1FE8L 1L6ZA 2ZXEB 3VXPB 5SWQB 1GMIA 4YLQT 4TNEA 3DA0A 3SCMA 3MFFB 3FCTA 4AEHL 3IJYA 3T9WA 5HYFA 3NOIA 1CC3A 1F56A 4XO3A 4K3EH 5DJYA 5CAYB 2HJLA 3S36H 1Q94B 1I9RH 2E7DA 3OPZH 2K78A 4YHOH 5BVPH 5CJXA 3CZUB 2IALA 3IU3A 4JDZA 1U8MB 3ZHKA 4WHYH 1UXWB 4H8WC 5TD4A 4QXWA 4Y5XA 1K5WA 2P5PA 4UWQB 4H5SA 3MRKB 2CALA 2YQGA 4WNQB 5EEZA 5DYOB 4OAWB 4ZS7H 5E8PB 2YOAA 2DYRB 2X5PA 2HYMA 4HT1H 1FZKB 1IEAA 3SB3A 1YNTB 2J25A 5EDXA 1KJ3H 5I28A 3WKMH 2FK9A 4FDWA 3FS9A 3PY9A 5GZND 2D31B 4FD0A 4EUPA 5CHNB 3PWLA 3GRBA 5CGBA 4CN4A 5GHWL 1ZE3C 1HIMH 4HETA 1VDGA 4M7ZC 3QJFA 1OAUH 3LIZA 4WDIA 5CEZE 3EOTH 1WWBX 1BFVL 3CLFH 4PTUA 1XB6A 3TWCL 1U3NA 4ZMWA 1LE9B 3W81A 1IGTA 3WUWG 1A7PL 2XZQH 2FJGA 4HX1A 4XXWC 2F8OA 5IB2B 3FQYA 3FDWA 5H37H 3QQ3A 3RUGB 4JPIB 1FLRH 3NJMA 4XE5B 4B3VA 1HH9A 2OX5B 1HWHB 4HWUA 5IESL 4XWOC 2OZ4H 3MA7A 1DQQA 4N8VA 4TQIA 4PRHE 4TPRL 3SPVA 4ZXBA 1BVOA 4O2EA 4KZEH 3B5HA 3PDDA 2Z0BA 3MLWL 3N1QC 4EDWH 4DN4H 1NUGA 3DVFA 4D8PB 1TQBB 3TPKA 1KCVL 4GG6F 3I6KA 2NY2C 3MJGX 1KLUA 4A7GA 3S7GA 4WKZA 4NNPH 1H5BC 3MREB 3AQYA 3ZHFA 2Z35B 4ZYKB 2VLRD 5LB1A 3ME0A 2EDTA 4NWTL 3TN0D 5FYLE 1TTBA 2ERJB 4ACPA 1NGQH 3BUQA 4OKVB 3ZW3A 1U21A 3O9WA 2FX7L 5C0AB 2TRHA 4P3DB 3BP5B 5EEXA 3OAYK 1GOGA 3MLZH 5I74C 1MFBH 1OF2A 1RPUA 3GJFH 4OZGB 4JREB 4TVPD 3BPLB 2YJQA 3CBJB 2AXWA 4M7LT 4YHML 1EAPB 3UTQA 3RDTD 1UXSB 3DJ9A 3MV7E 4G9FA 1HL9A 4M61A 2CJSA 4P5TA 2KQMA 3HHSA 4LSDA 3HG2A 2NQ3A 4W9DC 1T1YB 3CDZB 2NXYC 4A2LA 3OLGA 1D6EA 1Z32X 1AYOA 2BMKB 1WFMA 3CHQA 2GTWB 4OVVA 1NAMA 3PXLA 4LSQH 2COVD 3X11B 1OPGL 1PIGA 5AAMC 2ICWB 5DYFA 2VDKH 4DVBA 1O9WA 4JHUA 1GZHA 1KJMB 3RL1B 3LKQB 2XICA 4GEIA 3T8XA 5D5MF 1IAMA 3ILPB 1EHNA 3MXWH 4H0IA 1EO5A 1SBSL 3OAZK 5HHOA 2JMRA 3CPLA 2CJUL 2HMIC 2D9QB 1U8PA 4JW3A 4GUPA 3GMRB 3K6OA 5CUSL 3VFUB 5LG6A 5D7JC 3RWEA 2H6OA 2GJZB 4I87A 2HFGH 3CFQA 1L7TH 2Y6SC 3MNZB 3TA3B 1KTBA 3DUUA 3ZOAA 3HNVH 1NEZG 5BO1H 1IGFH 1T5WB 1MOEA 3SYPA 3KBHE 1U0QA 2H2SC 4YSCA 3LCYA 4GKZB 3DOHA 4KRPC 2KPNA 5C0BB 3UGEA 1UJTA 1UXLA 4TTDD 2EXYD 1MIML 3QJTB 2WO3B 1XHHA 5BQ7B 4UT7H 5L2KA 4P2QE 3QHFL 2EDYA 1T6VN 1F4HA 4QRRE 4UOW1 1UT1A 4HV8A 4TQEL 4N2GA 4UQDA 3TS8A 2HWZL 1SHWA 5CMAB 3B56A 3D3VA 1ACXA 3LKSA 1AGCA 1U33A 3ZE1E 5D1XA 5JPMB 4BH7A 3GJFB 4HSQA 1SOSA 1KLGA 4X6DA 2C9AA 2X40A 5CXPA 4XB7A 3QEQD 2OBGA 5AKRA 2H6PA 4PW3A 2Y7NA 3JTTB 1DJHA 1GS8A 4FXTA 3BRDA 4U6YB 3TH4T 4BFIB 4YQXH 2NNRA 4CC0A 3DJZA 4YIQA 5ADOL 1FV1A 4F3FB 5JOEA 1BJMA 1IMHC 4AMXA 5MEPB 3QH3B 3FTGA 3H85A 4JKMA 4W9EC 1M2VA 1AE6L 5IHLB 3QO0B 4HMCA 1QHQA 2VGLM 5SWSB 4JK0D 5DJ2A 4HWEH 5IHUL 1AS6A 2VDKB 4PV8B 3A4AA 4YSDA 2R9HD 2I9LB 1QZNA 4JFDB 5CU5A 1F2XK 3C5SB 3NACH 1DJXA 2JLLA 4DP0X 1I8LC 2HFTA 4FFYL 2V5TA 4HAFA 4PV1C 3CDCA 1I1YB 5MP6H 3ZQWA 5SX5H 3C09B 2VXUL 5AZEH 2KPWA 2ZKWA 5JLZA 3OMIB 4MDJB 2WCGA 3OM3B 4GRLB 1FGVH 4FQQA 3ISRA 3RWGA 3CGTA 3CLEH 1XB8A 2NY0B 1F42A 5GSRB 4DOHB 3AJ7A 2LT9A 3KEDA 3JT0A 5LN4A 2DBLH 3L4TA 1HHJB 3RBGA 5IFHL 3U0TB 3HJ0A 3QIWB 1T0OA 4K3JH 1AZRA 4G42A 5LGHH 1A6WH 4N2BA 3L13A 2BVQA 3RP1A 4ZFFA 4M03A 1RZJC 4Z95L 1T7YA 5D1ZB 2ZWKA 3NFNB 4JRYB 4QJ3B 3JWDC 5IUSA 4L18A 3C6LD 4R2GB 2NDFA 1NPJA 3W5NA 2Q5BA 3VXUE 5IR1A 1MG2C 5C2BH 5GS0L 3X1NA 3RZCA 3QWRD 1ZT1A 2YD8A 1PU0A 2IH1A 4KKRA 4GNKB 4MWFB 2GY7B 4ZXBD 5I24A 3HRPA 1XF3B 4QO1A 1SDYA 3ABKB 1QWUA 2K6WA 2YGOA 2OMZB 4E2OA 1N68A 2FTAA 1Z0NA 2H26B 2OW6A 5SWZD 4ALAL 3LKRB 2EIMB 3WTUA 3WJLA 1TQSA 3ARGD 3NIGE 4X7TA 3WNMA 3ULUF 5D93C 4X7DC 3VSTA 2R0KL 3SPJA 1I3RB 3U2SA 3WN6A 3LRSA 4AI7A 1KGUA 1DANU 3FCUB 3HC4H 2X0VA 4GAGH 3RJQB 3BZEA 5EIIB 2RCSH 5JQ6L 4NQVA 5D9SA 2WBWB 3SE4A 3POHA 5IQ9B 1MFMA 2G2PA 4XPFL 3BIBX 1I7RA 3MKKA 1JK8B 3MZTA 3WJJC 3QCTL 2HZHA 4Y19E 4QXVA 2B39A 1NCCH 4ZUVA 2E5EA 2F53B 1CU4H 4R8WH 3WS6A 1NOLA 3M45A 3EH3B 1S9VA 4G9FD 3SDCC 4P5TD 1BZ9B 4OZHE 3ZDXE 3L4CA 1SYVA 3DJSA 2P8MA 2B3RA 5FM8A 3W56A 2DWXA 4OFDA 1RURH 1QEWB 1BLIA 4O4YH 3ULUC 1M7IB 1NSNL 3T4YA 4IGBC 3W0WD 3CZLA 5D2NC 4ANUA 4HIXL 2EUXA 1GZQB 1QOKA 2WAHA 4PJDE 3ZR6A 1QBML 4KNUA 2FQEA 2DQCL 3QXDB 1OP9A 3AG2B 2CHZA 2WCPA 3QNZB 2D9CA 5C0RH 3GBLA 2O72A 5DMJB 4S1DD 3N1GC 2RGSA 3V0GA 1G6VK 5IW3A 3OKNA 5DJDB 5SV4A 4YO0A 3WE1A 1I1CA 3ILEA 2WLLA 4IDJL 4NM4H 5AVZB 3WG7B 4PG2C 5E94B 1WCBA 1GC1H 4KAQH 4UM9B 4I48B 1A4JB 4AQOA 3ETTA 1INQB 4AYFB 4ONFL 4PJ5E 2LVEA 5E6UB 2DMKA 5K5YA 2YFNA 4QXUH 4APQA 1G84A 2LOEA 2GY5A 1A7RL 3B6SB 5LG1A 4RWYL 4OD2A 5CJOL 4KROB 1WAAF 3QUXC 2X10A 3LD8B 4YXKH 5B39A 3NZ8B 1SOKA 4OFIA 4K8RD 1RZKL 1RAMA 1JXJA 3QG7H 2P42B 1HZLA 2BIPA 2DWSA 5MENB 3VD1A 2ROYA 3EHBB 4C56B 1J8HA 1LO4L 2OA9A 2A38A 2UWEA 4WRLA 5CBAA 5DD5H 3T0XA 2XV6B 3HAEG 1IT9L 4Y5YA 1CGXA 4LOVA 3VFNB 4FRWA 3IETA 4ZFGH 3G6AA 4H1LG 3N41B 3HUJE 3VU1A 3D05A 5D1QA 2BNQE 5CM1A 2XKUA 4NKQB 4Z7WE 2ICCA 1AD0A 2Y72A 1BBJA 3ZYJA 4ZUUB 3C8DA 4XPTH 5JYMA 1U9KA 4BKSC 5B38A 2AJVL 1ETZA 2M8XA 3IFOA 2V8MA 3A22A 2I07A 5D71H 2ATAA 2IWEA 5I1IL 5TE6H 2VR9A 3WELA 4EDXA 3CTTA 1BD2E 2FH6A 2XWTA 3MV9A 4LZKA 4PSRA 4RFOL 2IMNA 1DEEB 1HJBC 1RIUL 5FF6B 2XBZA 3QAQA 1YEJL 3RY6C 2VSDA 3LKNA 3FTUA 2J1WA 2AS5M 2XN0A 4X4MA 3GHBH 2ZG2A 1EZLA 3OJ2C 2HG5A 3TIDA 1WTLA 3F7QA 3ILDA 3O81A 5C71A 2FYYB 5I2IA 1HYSD 3KPRA 1J9SA 2F7IA 5GRWA 3O3EB 1DJGA 2EEDA 1A2YA 1AQMA 1TZGL 3D50A 5I8CB 5F1IA 2ZX7A 4XBPA 5ISZB 5D70H 4XZ4A 1BQ5A 2QT6A 3L9RB 4G7VL 3QIUB 2EIKB 2OLDA 1NFAA 4XP5H 3FC8A 4JFYB 5DHEA 3MJ7B 1WISA 1N8OE 1JNHB 2KH2B 1PY9A 2YO3A 3PP4L 2J8UA 4PJ7E 4TYUA 3FQXB 1XX9C 3K3QA 4N2HA 4PJ9C 1BOGB 2CGZA 4X5WB 4ZTPH 1RUKL 5HJ3A 2CKBL 5IIEB 4ABUA 1YDPB 2NY2B 5K1NA 4G82A 5DEJA 5K59E 2P46B 2BSSB 4H44C 1AR1D 1EXUB 2K7QA 4PJIB 3D18A 1N8ZB 4HJIA 4HS8H 1MQ8A 2WXMA 1MCNA 4ZMZA 3L81A 2BFGA 4U7SA 5JIDA 3JXAA 2VUYA 4U6XA 5I18L 4XCEA 4LCCA 1CTMA 2YPLA 5BOPA 5EHFA 1CGUA 3JVGA 3DRTA 4HKXA 5HDBB 1L5GB 5I74B 4WW2F 1Q0YL 5IB3B 1J7VR 1QR1A 1ZS8B 4ZPVA 5ESAA 3RKDD 4F9PC 1E5ZA 3WTTA 4UOW0 3FQNB 4JN2B 1KYDA 1FNSL 3JUYA 1TZAA 3LEXB 2X6AA 4LLVA 4C83A 5IT2L 1OGSA 5L8KB 3Q2LA 1OP3K 2XZAL 3L1FA 2ZSVA 2DEXX 1OY3B 1NUNB 2NXYB 3QUZC 5GS3A 1XVSA 1YEHH 5K39A 3OHXA 4K5PA 4PJBF 3GRWH 1OZUA 3IS1X 3JWNG 3VGEA 3VRIB 1OAZH 3SY0A 1Q9LB 4PREB 2C1PB 1JNJA 1YNKL 4WCYH 4GG8B 4K7PY 5C09D 4XCFL 4DKEL 4AZ8A 4NRZA 4C4BA 3WHXB 2AEPH 3IFPB 3OKYA 4GXFA 4YBQD 2IDFA 1Q0XL 5KBDA 2A6IB 3EYOB 4JS7A 4RBPK 4TLSA 3S97C 1T5XB 2MQ0A 4WW2C 2H9GA 2XN2A 1HKLH 1WICA 3I9GL 2AW2A 1WZ1L 2ED9A 3QDMB 4PG9B 5EBLA 3F7PC 5DUPL 2GBAA 3ZT7A 5C0FA 5D7JB 1I7TB 1CDHA 3GSOA 3PAYA 4HCIA 3ASOB 3CH1A 3CUPB 3O2VL 2HFEB 4WEBL 4Z0XB 4YSQA 3HJEA 3APFA 3BD5A 1OM3L 3H2PA 4KRPB 4XO9A 4N0UA 5INCA 1VHPA 1FNGA 1LK2B 3K6NA 4LU5L 5EBGA 2X4TA 3FT3B 3WSQL 4L4JA 4YUEL 3M88A 1P1VA 2J1YA 3I84A 4WWKC 4WSJA 1SY6L 4I4WB 2F74B 4O02A 2QQKH 5GGSB 1GS7A 1OB1A 1JSYA 5DT1L 3KW7A 4AL8L 4F1SA 4Y1TA 2ADFL 5A2BA 3NCYP 4PBWD 2WSPA 3O0LA 4JO2H 5D5MB 3M1CA 4N2FA 2X2HA 4K94L 3JWDH 3HC0B 2OULB 4TSCL 4NJ9L 3MNMA 3RQ3A 4X5LA 1UJ3C 3MLPA 2D7TH 1IJ9A 1RCYA 3IDUA 1KNOA 4GQPH 3ZTEA 3ESUF 1HL4A 1R3HB 3RX7A 4ZQTA 1XCXA 4HK0A 4OZIF 1EXGA 1LO0L 5C0JA 3Q9QA 3V4PB 1ETB1 3PABB 1RZ8A 2JCCA 4WUUD 5BZXA 2XWEA 4MA1C 1USQA 4JQVC 3QNXA 5E1QA 1UUSA 4ELKA 1UVQA 1YEWA 2BP5M 4AJVA 3C9NB 4YHNA 1J8HD 1JV2B 2GITB 5DC9B 3SYOA 3RE0A 2O5XH 2W60A 1CVSC 2V5MA 5EZLB 1BZEA 3WD5L 5DJXA 3NTCL 1A3RL 4ZNEE 4PJHE 1FHGA 4M5YL 4J39A 4LGSB 2GEEA 2W5PA 1JYXA 4KUZH 4XBGB 5AVWB 1GHFL 2GJJA 3BHBB 4D9LH 3UEQA 1NCNA 2Z92A 2VXTH 1VFBB 1OXYA 1L7IL 1WC7A 2VAAA 3EGDA 4XOCA 3T0AA 2YR3A 1UGNA 4WO4D 3KYNA 3BWAA 2YC1A 3I9IA 4QXTA 2QR0A 1J0HA 3VTMA 4G6KL 4Y1AB 1FYTA 3RB5A 1JF1A 1HH6B 4D8OA 2AHIA 4Z7VE 5E70A 5CZRA 3BUDA 3DVNA 4IBYA 5LBVA 4RRPG 5AOKA 1FJ1A 4HEME 2PWGA 3LQAL 1D5BA 1NFIB 2QBWA 2X89A 3CZFB 4Y4KC 1NC2B 3DX7B 3VE0A 4JAMA 3DHMA 1YUHB 5K9KB 2PKDA 3MLSL 4K3DL 2CPUA 4PGBB 2AFNA 3FU6A 4LHUG 3KPRD 3V0HA 1YO4A 3QXAA 4NKMB 4PCSA 2Z31A 4L0YA 1AC6A 4KJPC 3N1PC 4XNXL 1X6LA 5GGUA 3FFDA 1K4CA 4WI9A 2EIBA 3U30C 3TGXA 1ZIAA 5CFHA 4YSPA 1OARL 3FMGL 5IGXH 3RFZC 2F8XC 5C2UB 2QZQA 1FFNB 2GK0B 1SN5A 3BIKA 3QEUA 2YWYA 4K73A 4M6NH 3KWVA 4NQEE 2OMUB 2G60L 1TFHA 2V17L 4FQXD 4MD4B 1IGCL 2EDXA 4G70B 5E1AA 1YQVL 3GZQA 2B20A 2E9GA 3FRPA 1JGVL 2XC8A 4YWGH 4HUXB 5K9JL 1IC7H 2V2WB 3O4LD 2I85A 5TE4H 2G2RA 2P5EE 5EBMA 2ADYA 3LEYL 1ANUA 3HZYB 3DIFA 3RPIA 1XCQB 3WKYA 1EHKB 3K8LA 2VE6A 5D96C 4MX7B 4ZMNA 2EE0A 2YMXL 5E8NB 1A6ZB 1RUAH 5F7LB 1XF2B 1WBYB 3KWTA 1S7TB 1T83C 5C0ND 1JZ5A 4YVNA 1BMZA 4F8NA 3WUWB 4RFEB 5GISL 1BQRA 2OMTB 1S7XB 3QVAA 1NZRA 4GRWE 4NZFA 5I0VA 5DJAB 1AACA 3HS9A 1GOHA 4RZCB 3STZB 4BEIA 1Q8MA 3D8MA 5DJZB 3TTSA 4KY1H 4BZ1A 3K71B 5AW7B 4D3CH 2V7NB 2PO6C 4R90L 2YUXA 1CO1A 2FCBA 5LHDA 4P3WA 4IGBB 3U9PL 4CVWA 2AABL 4CJ0A 1A7QH 3HFML 3Q43A 4WNQA 5C0CB 3RI5F 2V2TB 4JZOB 4OAWA 1XBDA 4LSVL 3DETC 4PYHA 5LXVA 4G6FB 3D48R 2IGTA 1G4RA 3KPMA 4XWGH 3VACA 4DKFH 4AVJA 1U3HC 3P02A 2JLPA 4PJFE 2SODB 1DBBL 5TDPB 3KPPB 1KYOJ 4OLXL 4PJCE 2QSTA 3WKPA 2B15A 5CHNA 4Y89A 2NPLX 2VLRE 1WEJH 1AHMA 4FZ8H 1I7UB 3CHPA 3WTYA 1ZT7A 4HFWB 4BK5A 3BSGA 4NO5A 2DIJA 4N9OB 4P23A 3IEAA 4G9DB 3S34L 3F7VB 4GI9A 3PGFH 3SDAC 4M8VA 4ZOBA 5KVMC 4MA7H 2XA3A 3SKUD 4EKJA 3UBXI 3DMMB 1TUPA 3HVDA 4PCKA 2ZYRA 3BAXA 4FLQA 3VMNA 4PY7B 3BDBA 3ZTCC 4LARL 4TLUA 5T1LA 4PJGF 4QI3A 1XIWD 1O6SB 5I8KH 3I85A 4R4NC 2DWEB 3JWNC 2WTRA 1IM3D 1EEYB 3PIQA 5CINH 3MA9H 5ETUA 1JWMA 3SE3A 4KI5E 2ADJB 1PZCA 2CRMA 1EH9A 5DGRA 1JPTL 3N55A 2Y25A 1F4YH 2NNFA 3MREA 2Z35A 3H6JA 3MO1B 2WNWA 3F01A 4G7YH 3EFDL 3P1VA 1Q9KB 2A9CA 3T2QA 2V3FA 3EXLA 5DC4B 4O5LL 4OKVA 5ABZA 2VDNB 3FF8A 2I25N 5C0AA 5I15H 4PY8J 1JZ6A 5B8CB 1NEZB 2JH2A 1YN6B 4LLQB 4KKNA 2LLLA 4MMXC 1ZLSL 4OZGA 2XWBB 3FQ4A 4KTEL 4RX4A 4E0RB 1SEBB 4G11A 3P9LB 5AALA 4JANA 3ZL2A 4QOKA 1NPNA 1YVLA 3CFKB 3ROOB 3WIFA 3GXDA 3I2CL 3AITA 3P73B 5GGTA 2CBMA 1RJZB 1H8LA 1RMFH 4GBXD 3D34A 4PMFA 5KYWB 2X1OA 1F8TL 2GTWA 4LSPL 5IV2B 5B3JF 2VISA 4FTVA 3X11A 1FNLA 1S7VB 3TO4A 2LU3A 4PR5B 2ICWA 4KVPA 5FHAH 5KVFL 4YDKL 2YA1A 1KCUH 1YEIL 3NA9H 4MZ3A 3V7AE 1YYML 2VDPL 3T0EA 3IBOA 2YIHA 1C16B 4XVTL 5HHNB 4FQ1L 3LVEA 1T3FB 3OV6A 1AJ7H 1KPUB 1IC5L 1K8IA 1BFOA 3IDIB 1TCRB 2BRRH 2X4OB 2A0LD 3ZTNH 4JFXB 4RSVA 5I1JL 3GMRA 2VDOL 4KGJA 5GRYA 1D5MB 4MQXC 3GWJA 4GO8A 1E4WH 3TV3L 4L3EA 2GJZA 5DURB 3TT1L 4UB0H 3MNZA 1WJ3A 2WWKT 4PJ9B 3L17A 2MIZA 1KB5H 2Z31D 3D09A 3GLZA 4LCWA 5KEZA 4HUVB 1B0GA 3CBRA 1AGFA 3O2DA 2BS8A 2XWZA 3F12B 2BNUA 3BE1H 4HP5A 3TVMC 1I3GL 3VFRB 1XT5A 4IW4C 1FVEB 2V2XA 1LDPH 3MUHL 3QZBA 4NC1C 1J11A 5EF2A 4F57L 3ULVF 4G2AA 4OW6A 4WU7B 1PBYA 4ZNCD 2O93L 1NKOA 4N2DA 4TMPA 1B9KA 1WE5A 1SUHA 3NGBC 3QJHA 4BH8A 2HT2D 2NLJA 3WY1A 2MHAA 4DUXA 2Q0ZX 4X5XB 1H3PH 3MLRL 4YNYB 3DROB 1QQDA 2DWYA 4KKAD 5D7IA 3NSDA 4WNSA 4P2AA 2W38A 3UMNA 3CVBA 5ICUA 3TFKD 4AQ8C 1XF4A 5AW4B 4IRSA 1WDAA 4J3SA 4LCYA 4J3WA 3RU8H 4BFIA 4M6MH 5E5LA 4F3FA 1BLNB 2WBJC 3W5MA 3HMXH 2QGBA 3VFVB 1RUMH 4HS3B 3U7WH 1CFMA 2IH9A 3QH3A 3JSSA 3KWWA 4QRPD 2BP8A 5SV3A 2J55A 2E7HA 5FYKD 5I23A 2VH5H 5SWSA 3MOBL 3HIZA 1XD1A 4JRWA 1QFHA 4JFDA 5KYYA 3ULVC 2WBXA 4YBHA 1DFBH 5BV7H 4G8GA 5LKNA 4EBQL 1I1YA 4JVWA 4DKTA 4XAWH 2PTTB 4FMKA 1T4KA 2EDWA 3DSNB 2R59A 4L2LA 4MDJA 4MAZA 1KTKE 4U1LB 2GBTA 4HIPA 3K72B 2R2HA 3PUCA 1IAKB 3TO2B 4KHXL 1MSPA 4HJ0C 4F33B 3KWXA 5DWPA 1PDKA 4NAMA 1U91B 5D6DA 1KB5B 2CBTA 4LPUA 3W9EB 3MUY1 3F65A 3ZKMD 5FM5O 1XF5A 1ZLDA 4I1RA 3UTZB 3U0TA 3CX5K 4IOIB 3U0PB 3K80A 1X4ZA 2YD5A 3UTSA 4NN6C 1MPAH 2J21A 3TEYA 3HZMB 3IRZA 2FSDA 1E9QB 1KUMA 4P46C 5L0QC 1KCKA 4HXAL 4FKHA 5HPMB 2NW3B 3MODH 4JRYA 4ORGA 2PW2B 3PAZA 3VXNA 4XOEA 4YHLH 3SDDA 1U8NB 2QDVA 3ZK0A 3N43F 1UJ3B 2XTLA 2ISDA 5FYJH 3T6ZA 4H1LH 2A9NH 4AIXA 4O02H 2H47C 5T1LD 4G9FE 1DVFA 5CNHA 1EZUA 1UZ6F 3AS0A 1L9SA 2VNCA 1FFPB 4KKBC 5HJGA 1XF3A 4JRXA 4AQEA 4MXVE 1M05A 2VQ4A 4PP1C 4KDTA 4Q0XH 1OTUC 2KDYA 3FT4B 3WFBL 4ZMYA 4HKZA 3O6FA 1G7QB 5HVFB 4GMTL 3LKRA 5F44A 5E6IC 4EPSA 1G5AA 5FKPB 4CN1A 4Z7NF 4OTXL 3ESOA 1UA6H 3WEOA 4ERSH 5A43C 3FU9A 1F5WA 1VEOA 1DLHA 1LO5B 3CCHB 4QRUA 5K1VA 1ERNA 4N2IA 2R2EA 1I3RA 2DQTH 4CMMB 1AOZA 2E86A 4QR7A 1QFWM 3SDYH 1YMHB 7CGTA 1P7QB 1JBJA 1UD6A 5DO2D 4HUUA 2QVFB 5HHOE 3CVIL 1KYUA 5C0AD 3VD7A 1DDHB 4UMSA 5CSZB 5EFIB 3PHOA 2EE6A 4KDWA 1PCXA 3CSTA 1BQLL 1D6VH 4HLZH 2EXWD 3LEVL 5MHSE 4RX4D 4P04A 2WINA 1VCBC 1BEYH 4XPBH 4X83A 3BP7B 1A9BB 1URIA 3WNNA 3QXVA 3VB8A 1ZHLB 4IK6A 3VH8A 1J1OH 5DHVH 5EDSA 2IV8A 3ZKND 5CCKH 1C08A 3BVVA 3INUL 3X1BA 3L5XL 3H2QA 4LOUD 4EF3A 5L2KE 2MJWA 4UT9A 4Y4KB 5IFJA 1MI5B 1QEWA 3A6BL 3S6CA 1KB9K 5A2FA 4IJ3B 4MTMA 5D4HA 3T3PB 1J9TA 1TQWA 1KXHA 4ZO8A 4F2MA 3IDXL 3RPKA 3D3VE 4MA3A 3GB7B 3NJKA 3QG6A 4XVSL 4AXWB 4ONHA 2OR7A 5D1XE 2OAAA 1P4UA 4QTFA 3IGFA 2DLGA 5AOIA 1HQRB 2Q7NA 3ZLQC 4X6DE 3HAEB 2LE9A 4R3SB 3GM8A 5G55A 2HKHL 4CNIA 5I1KL 1LEGB 1JGUH 1GTFA 4H1LB 2NT0A 2DYPB 1WT5C 2YA2A 2KZKA 4MS8D 5JIQA 3WNIA 1E7UA 3U30B 4F92B 3S88H 1TENA 3RFZB 5IUCA 1OK0A 3E9TA 4IBQA 4JMNA 3TA3D 1BG1A 5DFVC 3SJVB 2HA1A 3HG1B 1ZV2A 5E94A 4M7KH 5CJQH 1I85A 2DQUH 1A4JA 5DFWH 2B0SL 4Z0BH 1IZJA 1HWWA 2OK0H 6PCYA 4FQ2H 4NPJA 5C0BD 1KCRH 4X7SH 1RU9L 2CA4A 1AGEB 4ZFQA 5LBSA 5KVDE 5B1AB 2E76C 3H7BB 3UACA 3BMVA 1U8JB 3FUKA 1KOAA 5HD8D 2AMUA 4ATWA 4QJ5B 2ZYSA 4P3CH 5HXMA 2HLFD 1I3VA 1N4XH 3FUNA 4AGMA 4OBSA 43CAB 2L4OA 3IGAB 4WAFA 3JVFC 4PGDA 5D96B 3JWNH 3S3SA 1PD0A 3DSFL