3IE9A

Structure of oxidized m98l mutant of amicyanin
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
105
structure length
105
Chain Sequence
b'DKATIPSESPFAAAEVADGAIVVDIAKMKYETPELHVKVGDTVTWINREAMPHNVHFVAGVLGEAALKGPMMKKEQAYSLTFTEAGTYDYHCTPHPFLRGKVVVE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Amicyanin
publication title Defining the role of the axial ligand of the type 1 copper site in amicyanin by replacement of methionine with leucine.
pubmed doi rcsb
source organism Paracoccus denitrificans
molecule tags Electron transport
total genus 24
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2009-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3ie9A00
3MBWB 2FQEA 1IBYA 1BQKA 1I53A 1AS6A 1ASQA 1PF3A 1ZIAA 1ZIBA 2VN3A 3CDZA 3T6WA 3ZX1A 3NSYA 2XX1A 4FA7B 4YSRA 1GS6X 1NTDA 3D12B 4DP7X 2FT8A 3H4FA 4KO9A 2CUAA 4YL4A 2BZ7A 1WA2X 2FQDA 2VW6A 2YAPA 5B1BB 2VSKB 3FQYA 1TU2A 1ET8A 3EH5B 2FTAA 1ASOA 1XB6A 2OV0A 2XYBA 2YAEA 4YSSA 5I6KA 3ABGA 4Q8BA 3OQRA 2AZAA 2AANA 3QJSB 5D4HA 1PMYA 2IDUA 2R7EA 4F7KA 2BWIA 3RYMA 1E67A 4M4RB 4ZK8A 2W88A 1ZPUA 3NSDA 1W8EA 4DP4X 1F56A 1FWXA 1JZEA 4KO6A 4AZUA 1JZIA 1GS8A 3FPXA 2VM3A 2IH9A 2WSDA 3BQVA 2CJ3A 4QLWA 4KNUA 2BZCA 2OJ1A 2PP7A 1XB8A 1SFHA 1AG6A 3JTBA 5F7AA 4CSPA 1BAWA 2YAFA 4A67A 3TBBA 2GC7C 1SF5A 3FPYA 4BK5C 5A7EA 5I6OA 2GHZA 5TK4A 2EIJB 1SHXA 1VLXA 2YAQA 2BP8A 4AKQA 2DV6A 3TBCA 2IWFA 1J9SA 2XLLA 1XB3A 3ABMB 2HRGA 1ID2A 1M56B 1OV8A 3NJMA 4G70B 1AAJA 2FJSA 3KW8A 3SBPA 1L9TA 4BDVA 4Q89A 5ANHA 1V10A 1FFTB 1OOWA 2YXWA 5I5MA 1BYPA 2Q5BA 3S3BB 3PAVA 5B1KA 2DWTA 2HX8A 2B3IA 4UF7C 1RCYA 3GYRA 1NPNA 1WA1X 2BO0A 1AQ8A 2JKWA 1PZBA 3X1GA 1JZJA 4HCIA 5E9NA 3S8GB 2I85A 1GR7A 2DYRB 2X88A 3WG7B 3C75A 1BYOA 3GXUB 1NINA 6PCYA 2PPFA 5B7EA 3NT0A 4EF3A 2J55A 4G7QB 1NIFA 1PZCA 2IDQA 3EF4A 1JXDA 3AG2B 2I7OA 4DP8X 3BVDB 5EHFA 3MX0B 3NJHA 1IC0A 3CG8A 5AKRA 1V54B 1X9RA 2XWZA 1AZUA 3FT0A 3FSVA 3FU7A 1EHKB 4W1TA 2IAAC 4E9WA 2PPCA 3WI9A 2JFCA 1QNIA 3HB3B 2E86A 1RZPA 3EH4B 5I26A 1NIAA 3TU6A 2J57A 4NB7A 2J5WA 2VW4A 3FU8A 4A2DA 1L9RA 2PP9A 1TKWA 1E30A 1WS8A 3FS9A 4YSOA 2PPEA 2PCFA 8PAZA 1NIEA 2HXAA 3TASA 3ASOB 2QDWA 2FQFA 4MFHA 2AZUA 2HZHA 1E65A 2UX7A 3V9CA 1KGYE 1AZNA 1ET7A 2CCWA 1NWOA 3X1NA 2VMJA 2AVFA 3CVCA 1KCWA 3ZDWA 1GS7A 3S8FB 1JZFA 3WIAA 2DYSB 1AS8A 4BWUA 2CALA 2FNWA 2W8CA 5I5IA 1CUOA 2A3TA 2AFNA 1CYXA 1PLBA 3OMIB 1W6LA 2PPAA 3S3CB 4E9RA 4NAJA 1OF0A 4JHVA 1JZHA 2UX6A 1BEXA 1PLAA 3QJRB 4A68A 5AFAA 3WNJA 3CDZB 3NSFA 4YSTA 3TA4D 2BW4A 4AI7A 3PPSA 2FT7A 4K9JA 4E9SA 2GBAA 5B1JA 4KNTA 3QPKA 2XXGA 2EIKB 1NWPA 2BW5A 3PAZA 3FSZA 3UAAA 2N0MA 5FC9A 4JHUA 1A8ZA 1AZBA 1PNDA 1OCRB 3NJGA 4A2FA 2Y1AA 5B1JC 4YSAA 2H5UA 2R7EB 1NDTA 2BWDA 4DPAX 7PCYA 3NJKA 3UAEA 3OMAB 1BXAA 1BQ5A 4UAHA 1SDDA 3UACA 5F7BA 2XUWA 1HAUA 1TEFA 1M57B 1ILSA 4E9XA 4DP9X 3AY2A 1NPJA 2HLEB 4N8UA 1KYAA 1A3ZA 3HEIB 1YLBB 4M3HA 2XV2A 2P80A 4G72B 1A4CA 3G5WA 4WTQA 1JVOA 1N70A 2XX0A 3NJNA 2Q9OA 2BP8B 2VM4A 1T5KA 4F2EA 3DIVA 3AG3B 4CSZA 3NP3A 1URIA 4BDVB 3UGEA 2B08A 2UXTA 1GSKA 3JT2A 3KW7A 4N4YB 4KNSA 4GY4A 5D4JA 3AW5A 3CVDA 3NP4A 4YSEA 2ZONA 4KOCA 2HX9A 1HAWA 1NIDA 3FSAA 3IN0A 3QJUB 1SNRA 3AG4B 3U25A 4DP1X 1AG0A 1J9QA 3QJVB 4HHWA 1ASPA 4G71B 3DKHA 1XMEB 3PXLA 4ENZA 4AX3A 1RKRA 1AZRA 2VSMB 6PAZA 3EHBB 4E9QA 1JXFA 1WS7A 5I6NA 2QPEB 3UADA 1JERA 4E9VA 1J5CA 3QJTB 3FU7B 1IBZA 1EZLA 2YARA 1OE2A 2EINB 2HX7A 2NRDA 2EILB 1GYCA 5TK2A 4L0PB 1PZAA 1OE1A 4A2HA 3X1BA 4YVUA 1BQRA 2JXMA 3DTUB 4HHGA 2EIMB 7PAZA 4RH4A 2DY2A 1B3IA 1PAZA 5I6LA 2LLNA 2CBPA 5I6PA 3NJFA 3V9EA 2BP0A 1JVLA 1SHWA 1W6WA 1KBVA 3ASNB 1KDJA 1ZDQA 3OD3A 5B3SB 3SQRA 3AG1B 2DWSA 2CAKA 3FQ2A 1PLCA 2QPDB 4DP2X 5I5JA 4BXVA 2X87A 3AZUA 3UABA 5IY5B 1N68A 1GY2A 3L45A 2FQGA 2XV3A 2H3XC 1BXUA 1JXGA 3ABLB 1J9TA 4A66A 4HCGA 3H4HA 3NYKA 2P80D 2XXFA 2PPDA 2ZXWB 4KOBA 4TXVB 3GDCA 4KO7A 4NERA 3PLYA 2YAMA 3S3DB 5B7FA 4YSQA 3ZBMA 4DPBX 1ET5A 1NIBA 4DP0X 3WNIA 2PP8A 5LDUA 3PCYA 1MZYA 1AACA 1J5DA 1OCCB 1AOZA 1L9QA 2XU9A 3H56A 4UANA 4FAAB 2VW7A 3N2JA 1SF3A 1KBWA 2UXFA 1HFUA 2HRHA 3T9WA 1A65A 1J9RA 3QJQB 5I6MA 2ZWNA 2XVBA 4DP6X 3WKQA 1ZDSA 2I7SA 2GI0A 4P5RA 3T6XA 1AIZA 4YSDA 2H47C 3NSCA 3T6VA 1DZ0A 3T71A 3IBOA 4GP5B 2RACA 1KDIA 2GB2A 2TSBA 2YAHA 1JOIA 1L9SA 1IKOP 2UXGA 2MTAA 4GP4B 2IWKA 1CYWA 1SDDB 4A2GA 1MZZA 1RZQA 3FU9A 1QLEB 3IEAA 2OCCB 3X1FA 2XV0A 4YSCA 3NJIA 4G7SB 1KCBA 3EH3B 1OCZB 1MG2C 2PLTA 1A4AA 1L9PA 1MG3C 2Y69B 5B7MA 1X9UA 1PY0A 4HCFA 2TSAA 4QKTA 1R1CA 1A4BA 1DYZA 3NJLA 3PAUA 1E5YA 3OMNB 4HZ1A 4BXSV 4GXFA 1L9OA 1PNCA 2IDTA 1NZRA 2IDSA 3SBQA 9PCYA 5PAZA 1BXVA 2FT6A 2IWEA 3FQ1A 4YSPA 3FYIB 4E9TA 3N55A 2FWLB 4W9ZA 3X1EA 1CURA 3ZIYA 4DPCX 3NJJA 1AZCA 5PCYA 1M9WA 1AS7A 2BHFA 4KO5A 5B1AB 4HAKA 2GSMB 2UXVA 4AKOA 4P5SA 1AR1B 2ZOOA 1UATA 1FA4A 1E5ZA 2PCYA 1GY1A 1SFDA 3ERXA 4A2EA 2WO2B 4BWTA 1AANA 4JKNA 3OM3B 1ILUA 2QT6A 1ZV2A 1ADWA 3T6ZA 3FYEB 3WKPA 3X2QB 4WKXA 1GW0A 1CC3A 3CVBA 5I28A 2GC4C 3FSWA 4GP8B 1PCSA 3IN2A 4YVNA 4HIPA 4GYBA 1KV7A 4X4KA 2WO3B 2GIMA 2IDFA 4HALA 4AKPA 3IE9A 3ABKB 4BWWA 1OCOB 2YAOA 1V55B 3CZUB 1QHQA 2QDVA 3SBRA 1IUZA 1NICA 1OE3A 1WAEA 2J56A 3QQXA 1SJMA 4PAZA 1MDAA 2BP0B 4DP5X 1JZGA 1ETJA 1TEGA 2MRYA 4E9YA 1WA0X 4YSUA 4G7RB 4F2FA 4PCYA 5D4IA 5AZUA 2YXVA 2YQBA 2IH8A
chains in the Genus database with same CATH superfamily
2GT9B 3L1OL 1TLMA 4QTIH 2FECL 4F8QA 5CS7A 2RCSH 4Q14A 5E94A 4OQTL 1B2WH 4CW1B 4AYFB 4PGZA 5T3XD 1NUNB 3EJJX 3V4UL 2OR9L 5I1EH 4HS3B 2BZ7A 1WA2X 1FI8C 2I5YL 1R33A 4ETQB 2AS5M 1AHMA 1MJ8H 2DZEA 4MJ4A 3BP7A 4B3VA 1I9EA 1ASOA 3FB5B 4G6FB 4IKIA 2JQAA 3CFMA 4KUZL 4W9FC 1D5BA 3Q2LA 4KC3B 2E7HA 4AQAB 1WBYA 3CX2A 1QFWH 1WUNT 3VX0A 5JHLA 2QQKH 1GVIA 4L3AA 1CZ8H 1L7TH 5ESVB 1A25A 1D9KC 2R29L 3PHOA 1W8EA 2ENQA 3P9LA 2H1PH 3FTYA 5CILL 4QOKD 4DEPC 1AQHA 1LXMA 2Q2EB 4GUPB 1JZEA 3ZTJH 1DQKA 4AQ1B 3CFBB 1YNTF 4FG6C 4RNRB 2CO3A 2SEBA 4NQCA 2VM3A 5EIIG 3T65A 2W0FB 4PJBA 5T1MA 1DVFC 3GS0A 1A5FL 2BZCA 4I0PC 4MJIA 3VJ6A 1IAIL 1I1FA 2IG2L 4YJZL 5JW5B 2NZ1A 4TPRH 5L4MA 5MENA 3QP3A 4DK6A 4UILL 1FAIL 1TMQA 4ZD3L 2WN3A 4JFZH 3QUZD 2PYEB 3KWWA 1J9SA 1VPOL 1JG9A 1L5GA 1SY6L 3MV8E 4X7FC 3AROA 3SYCA 2LVEA 1ID2A 5D6DC 3ZOAA 2BSTA 3QUXB 1OOWA 2YK1L 1KG0A 1MJ7H 4XE5B 5DS8A 5AG9A 5IVXA 2NT0A 2UYLA 5DJ2A 4EN3D 1XGYH 2X9WA 5DWPA 2XRAL 3WEMA 1OSPL 3CPUA 3CZLA 3NCCB 1YHPA 3R18A 5CLXA 5HVHC 1UD4A 3H9SB 2E7LA 4PRHB 5B1CA 4M5SA 3BCDA 1QP1A 1S7WA 1MFAH 2WMPB 3DX9B 3I9GH 3UTSA 1OY3B 3CSYA 4NBZB 2VLLA 5J9PA 2WINA 3Q1SH 5H37G 3QIUD 5LGJB 2Q86B 1UT2A 4P3CH 1FG2B 3IDGA 4FLRA 4GRMA 1YNLL 4FZ8L 2EEXA 3MQIA 4DP8X 5SWQB 2CLRA 3NIGB 4FLQA 3QHTC 2OP4H 4Z95H 3CHPA 3OKKA 3BT2L 3LKNA 1K6QL 1Y1DA 3FT0A 3TEWA 4D94A 3MFGB 4APQA 4MS6A 1TZHA 3P4MB 3IKCA 2Z8WC 1EAOA 4M9PA 4WEBL 2IAAC 4BFFA 1K85A 4KKZA 2EECA 4FXTA 3WI9A 3PFUA 1NCTA 1AKPA 5B39B 1SYSB 5EULV 1KXTA 4YHIB 2HUHA 4JO1L 5EBWB 4K3EH 4OLVL 3EHBC 1FC1A 4JPIB 5IROD 3I3EA 4TTDC 1XMWA 2X9XA 2PP9A 1TKWA 3RWFB 2QPSA 3QI9C 3MLTB 3RRQA 3P3SA 4AQEB 4E5XB 5E95B 4XHJD 1RFDL 1YAIA 5IEKA 1YUHA 3QW9A 4I7ZC 2KC0A 3NSJA 4PR5B 3IS1X 2WQRA 4JLRA 1Y18B 5IMLA 1DBKH 2ZOTA 4WJKB 5E2JA 1IFHH 1KCWA 1WHOA 2C9VA 4OH2A 4G1EA 1IM3D 1P84J 3ARWA 1NCJA 5D2NC 5CSBA 5SWZA 4B96A 1A6ZA 4P46A 1WT5A 2JTDA 4X9IA 4HWBH 5C09B 2H9GB 1CQYA 1IBHA 2C9QA 1T20A 3QEGH 1JF1A 1NCWH 1RI8A 5ICZB 5ABZA 2NSXA 3KM1A 4EE2A 5EZLA 4HC1A 3Q3GB 3QJRB 3EG9A 5GGRY 1U4FA 3BPLB 4U1MA 2LU3A 2XWRA 3MV8B 4K3JH 1VKXB 4A63A 4HS6A 4TVPE 1I3VA 1FNGA 3BSZH 2NY0C 2DQUL 3GLAA 5EO9B 4AY0A 4R5XA 2HKHH 3IMTA 4G80B 2WXPA 3HG1A 4XCCL 4CA4A 2Z93B 4PY7A 2ZKYA 5IW1A 2R51A 1N8ZA 1JMXA 5GJTL 3O6KL 3CMOH 1O7VA 1EJ8A 1MREL 2YXMA 4RRPG 3FT4A 4QNPF 4WHCA 2XPZA 1T4KA 1UC6A 4JRXA 1I7ZA 3MO1A 2OZNA 2XFGB 2F68X 4HC1L 4S1DD 5GRVL 4M6OH 3WXWL 4PU2A 4HFUH 2J1WA 1PKQA 2WGNB 5CEYB 3O2WL 2BFVL 2Y2WA 4KAQH 3NEOA 4KKBD 2ARJA 1B4TA 3EOBA 1L6ZA 3MAWA 1KGJA 2L4OA 2G2RB 2NXZD 3L3OB 4LSRL 4MRCA 4BH8B 1BQ5A 4Y16D 4L9DA 2VWEC 3V0AC 1YY9C 5I76B 3DV6A 1ZY9A 3DBXA 5HBBA 3AY2A 4FQXB 2CGRL 4HUVA 1KGWA 4LQFH 4PP2A 2VUYA 1EPFA 1KIPB 2P7TA 4E9LA 1K9TA 3HHRB 2AVGA 4QXGL 5HGHB 1RUAH 1R24B 3DRQA 3MRHB 5DT1L 3RNQA 5J1AB 1YDPA 2KPNA 4AXWB 4CN4A 4OVVA 2R8SL 3BFOA 5FO9A 4BDVB 3UGEA 2B08A 3JTSB 1IBGL 3M1BB 1HSAB 3U6RB 2EDHA 2LR4A 3P77B 1H15A 2EDWA 1QSFD 3KHOA 2HT4D 5LG6A 4Z78B 4F8LA 1PZ5B 4NFCA 3B9EA 1OARH 3N85L 3VGFA 3GBLA 1RULL 2EVGA 1SQMA 3V5DA 3WFBH 5LKNA 3KWTA 2A83A 1SGKA 3BJ91 3ZDZF 5A6LA 2WNKA 3OX8B 5EIVA 3WD5L 2NXZB 3V79C 1SJXA 4RETB 4OV5B 2DICA 2VDLL 3KVDD 1E5AA 1WH0A 3A47A 3UADA 5FDWB 1JERA 1L4IA 2EUVA 3BQUA 3TOPA 4YBHA 5DK0B 2Q76B 4OUUB 4Y5YC 4MGXA 2EINB 3QNXA 2CR3A 4YIQB 5DMJB 2Z35A 4M3JA 1WWCA 3FOLB 5LNEA 4O2CB 3UTTD 5C97A 1DLHB 5CZKA 1WFNA 4HGWA 5J11C 1HQRB 4NWUL 4DN3L 4YDKH 1Y1UA 2NR6C 3U4BL 1DLFL 4GXVL 5F2FA 4EKJA 1ZE3C 4L4VE 4WW1A 4KROB 1SBBA 2VZUA 3ILPA 1ACYL 2BX5A 5MERA 1UWXH 3KDMB 3K8KA 2GCYB 4YHMH 4JPVH 3NTCL 3BZFB 4X4XA 2BP0A 1UM6L 1MFUA 4YO0B 1IIIA 2R4RH 2QFPA 4KK6D 3D0LA 1XGUB 1QSFB 3LS5H 1MNUL 1EEZA 4JCWA 4KRMB 4TN9A 1UGKA 1GYVA 2G2NA 5F3FA 3FQ2A 2EYSA 5C08A 5ACZA 4PFEA 3PWNB 3FL7A 4WV1A 3T3ME 4PLJC 4KKRA 4M7LH 2J1ZA 4AYEC 1TG8A 5J5EA 2NNFA 5DVOA 5DU7A 1SVBA 5LGHL 4B9KC 5CEXB 2OMUA 3SDCB 4XMZA 3P73B 4DK5A 3OPUA 4G6AD 4DVRH 4NGHH 4HW6A 3U0TB 1MW0A 1MFBL 2XXFA 3WJMA 1R5WA 2J88H 4H1LG 3QJZA 4PJ8C 3EKCA 4H88H 3K6NA 5DQJA 4HIJA 1X5GA 2Z31A 3W0WA 3CZFA 1VAHA 3RGVD 2X12A 5CEZE 4HBQA 2X89D 3ULUF 1OL0A 5FGRA 1MZYA 3ULVD 1XL6A 1O6VA 4OKDA 5IFHL 5DHMC 1U91B 3L1OH 4JO4L 5HY9B 1KBWA 2ZUTA 3QIWA 3RU8L 4Z7QF 4GKLA 4XBEL 2WYIA 4IRZL 1UZ8A 4OQTH 4DZ8A 1E3ZA 2WZAA 1I3GH 3RZCC 2CDFB 1YN7A 3TH3T 1P6FA 2WTRA 3V4UH 2OR9H 3AXLA 1JGVL 1MCCA 5E4OA 3MNWB 2D3LA 2I5YH 2ED8A 1UKTA 2DKSA 1ZRUA 1A7BA 1A7PL 1PX8A 3TFBA 1FJ1B 2RR3A 2XV6B 4JDEA 3UERA 4Y5XA 4DF9A 1CYWA 4H13C 4KUZH 4X7DC 4XRCB 1ZS2A 4PJXB 1UEMA 1XCTB 3OKMB 4U2YA 4JHZA 3HG4A 3UROR 1QO3B 1HXYB 2V0AA 4LSUH 1PLGL 1UXSA 1H0DA 4FCAA 1M2OA 1RHHB 2R29H 3O8XB 4LP5A 4KTYA 5CILH 1Z9SA 2DWEA 5KN5A 1MG3C 3MLPA 4IW4C 2NZIA 3VFVA 1K72A 5JNYB 4QHPA 3QR0A 1DYZA 3BAJA 1U3YA 4APXA 1I85A 2M1KA 1YYML 4GQRA 2OSWA 1A5FH 2IDTA 4NOBA 5C2UB 1IAIH 2IG2H 2C1OA 4WDIB 4UILH 1FAIH 3FN0L 4UIKL 3RWIA 4ZJ9A 5KG9A 5L6YL 4ZD3H 1A7QL 1J0IA 1UOKA 2C1PB 1HL4A 4Z23A 5GGVL 2ITDB 3F7YB 3KG5A 4P9HL 5E2WL 4MQ7B 4L29B 1VPOH 1SY6H 4DPCX 5TDNA 4MJ5A 1FN4B 4CDHA 1KF9B 4QJ5B 4GRLA 3H9HA 5MHSE 3Q8BA 2YK1H 3P9WB 1JD9A 3DMMC 3L54A 2NCMA 3R0NA 3BFQG 4GINA 2M2DA 3QHZL 4M1CC 3MC0A 1OSPH 2BXYA 1BVNP 5AAMA 4ZFFB 4S1QH 2WO2B 3H0TB 4NQCE 2OJZL 4OJYA 4NN6B 4MJIE 4JPWL 4EUPA 5MENE 5IJVB 3WY3A 4C56B 1N19A 2KLRA 4W6YB 2HTLC 1P4LB 4JR9L 4L2YA 3HB3C 5I28A 4GSUA 5I0XA 2JKXA 1YNLH 4MCNA 4ABQA 4FZ8H 4AEIL 4NRYA 1WFIA 1H5BB 3G6DL 4UCFA 2WO3B 2VJ8A 4XNYL 4UQ9A 1K6QH 5E23A 4GSDH 3KBFA 2X2UA 2R0KL 1GOFA 4WEBH 3SKOB 5HYSG 5KTEL 3VTAA 5I1AB 3CDGB 5J13C 3W11D 5IVXE 1WAEA 5FGSA 1BJ8A 5AD0B 1SJMA 2Z4QA 4JO1H 1SEQL 4OLVH 3QDGA 1B0GA 4G8IB 5GS0L 1X5LA 4IDLA 4JFXA 3UTSE 1TYEB 2J1XA 5D7IB 5FUCE 4Y4FA 1RFDH 1CBJA 1FL6B 1XDTT 3BGFC 4R4BB 1ML0A 2K70A 3QFDB 4AE1A 4HMCA 3VGAC 3IGUA 4FX5A 3LN5B 3ZE0B 5I0ZA 3BCFA 5CNHA 1LEGA 3IJSB 3MUHL 3ULSA 1MCHA 1J12A 1R5VB 1ZE3H 1LL1A 2ED6A 1TPXB 5BZWB 3RDTA 3L1GA 3G6AA 3NIFB 4L8DB 4W93A 3M7OA 1F5WA 2K4AA 2IDUA 2YPLD 2R7EA 3E9UA 5F1OB 1LP9B 1ZEAL 2BVUA 5CJBA 4BFEA 4GQQA 3C5ZD 4I4WA 1AR1D 4L1LA 2UZPA 4B7IA 5IMKA 5DQ9A 4BK5A 3T3PB 1ESOA 5M94B 3QIWC 1HSBA 5KSUB 2DQUH 3TBWB 5BRZA 1BD2B 1LE5B 1YSOA 3LZFH 3DDFA 1PAMA 3TJHD 1XCQB 4XCCH 5GZNC 1INQB 1R6VA 2JJUA 3O6LL 2F0CA 3O6KH 4K07A 4MDIA 5GJTH 5I16A 4RGNC 3WAKA 1KN4L 5TK4A 2WCPA 2EIJB 4XN5A 5GSRB 3D25A 1DEEA 4K3DL 5SWZE 4D7BA 1RLWA 1QRND 2F74A 3IJEB 3TBCA 3T2PA 4ES8A 2IMMA 4HC1H 1NGYB 5EUKB 2HJFA 3WXWH 3I3DA 2C3WA 2IQ9L 1JIBA 3O2WH 2BFVH 5C3LD 3KYNB 2Y6TE 5HJGA 1V10A 3IVKB 4P9HC 2WJ5A 2VT0A 4LSRH 5E8OA 5BVJB 1RCYA 4G1MB 3KWWB 1XF3A 3GTNA 4NZ8A 4ZXBA 4L9LA 1Z9LA 5JW4M 1W72L 3LEYL 4JCMA 4C4KO 2RIKA 4EI0A 2NXYB 3EYOA 3BN9C 5HI4C 2CGRH 1EEYB 3F5WA 2BDNL 1NPUA 3Q6GH 3Q9PA 4AZ8B 4K73A 3HG1E 2J55A 4U6VL 2YPLB 5DJ2B 3KWVA 2PYFB 2ESVB 1DO6A 3VD0A 5DT1H 4C59B 3SKNA 4JRXE 5AB1A 3NJHA 3B2UC 3UTSB 4EZMA 4NKMB 5LXGL 2R8SH 1AZUA 1PKQE 1F2XK 1YQVL 4JEGB 1FPTL 4UB0L 4M61A 5D7LA 3GJEA 1IBGH 2Q20A 4FS0A 4QPEA 4E9WA 4U6YA 3MA7B 3OB0H 4MMXA 3L4UA 4PJAF 4LEBA 3QORA 4M7ZC 3P2TA 1F0LA 4OZFB 3X11A 4CVWA 2J57A 3D3VA 4KKPA 2J5WA 2VW4A 3JUZA 4APQB 2XQBL 3MRNA 3N85H 5BZXA 1UD6A 2H3NA 3IKCB 4NT6B 5L2KB 1RULH 1XR8A 4LCCC 3FULA 1KNOB 2J8UA 2K3TA 4UU9A 2VQ4A 4AC2A 4KI5E 3WIHA 1CICB 3D87B 5LNDA 1H3XA 2J25A 5GS0C 3S7GA 3QEHA 3IMWA 5SX5H 1ET7A 4HOXA 2VDLH 4I3RL 3VXRA 4YN3A 3NN8B 5DQDL 3S8FB 2IF7A 1JZFA 2B3RA 4CC4C 5I1LB 4ERSH 4ZODA 2H45A 4AM0B 1NFDF 3N43B 2A9MH 3L4VA 4XNZB 1JHTA 2B1HL 1CYXA 1PLBA 2XIIA 4NWUH 4DN3H 3U4BH 2BRRL 3OKYA 1DLFH 4M1DL 2QVMA 4MB1A 1JGIA 1EV2E 4WWNA 2EH8L 4E9RA 5F7HA 5C0DB 2VR7A 4Y2OA 1ACYH 2EXWC 2IH1B 1AYRA 3APFA 3UYOD 3RIAF 3NTCH 1CE1H 4P5TB 3EGDB 1UM6H 4KDTA 2NX5A 1I9RL 3FHAA 1YEHL 4OLZL 3TVMC 4KXCA 1MNUH 2YFNA 4NQEB 1RUML 4O2EA 4WU5A 1GTNA 5LAXB 1MF2L 3EG9B 3SBWA 3WIFA 4DIXA 1OGTA 5I73B 2W92A 4ZUWA 4WUKL 4LAQL 1ROWA 4LVOB 2N1TE 2B0SL 5DJAB 1MFBH 4S1RL 1JGEB 2VSDA 1G9HA 2C3HA 2HFFA 2NUTB 2RA1A 3QUKA 4JY4B 4Z7IA 3SDAD 3FB6B 4X80L 4HGMA 3BSHA 5GZOC 2AQTA 4MS8C 2IH3B 1DDHB 2WXQA 2Y9RT 4HOMA 1HHJA 5DYOB 1FFQA 3T0ED 3TA3B 1RL1A 5IFHH 5I0DA 1HOCA 1KACB 2IBBA 4JO4H 4U1HB 2VL5B 5C08E 2AERT 3RU8H 3ARYA 3O3DB 1N67A 4XBEH 4IRZH 4FTVB 4PJDB 1I7TB 4UM8B 1N70A 2E56A 4OJDH 3UH8A 4ZI8A 5F6IB 1S8DA 3B2XA 3HOGA 2GJPA 5ALCL 2Y3NA 4PBVC 4TYUA 5JW4Q 4LHQB 1JGVH 1FFNB 3LOWA 5A16A 4CSZA 4X4ZA 4RFNC 3EBGA 3CFKB 1A7PH 4BUHA 1T1ZA 2WQSA 3A23A 5CFAA 3WTUA 5TGBB 1MVUA 1U42A 2AEPL 2ZNXA 4POUB 1E7UA 3W0WE 4B95C 4PJEB 3D39B 5E5UB 1QBBA 2E7MA 3B3IB 3FQWA 3TL5A 5EDSA 4EEEA 2HX9A 2QEJA 4IM8A 4MBOA 2O5XL 1S9KC 3UC0L 1PLGH 2A38A 2C9RA 2I32A 4Q2ZA 4Y19A 3BOVA 1S9YB 1U8NA 1U8OB 1AG0A 1G7PA 1BZ8A 4KJWC 3K6IA 1JDAA 3GQFA 3T08A 4P2QD 1Q94A 1YYMH 2J2ZA 4M4PA 5DEZA 5TH2B 4Z7WE 4HQQL 1G4MA 5F97E 4Z7OB 1O9VA 4HLZH 4H2CA 4Z7NB 1T4WA 4OCLC 3CFQA 3FH7A 3FN0H 4UIKH 3N91A 5L6YH 1A7QH 4MAYC 4FNQA 1JV5A 5CD3B 1X5XA 5GGVH 3ARFC 3EO0B 3MXVL 4P9HH 4B9CA 5K59E 4MYWB 2YD6A 1FNEB 4GEJA 2OQJB 5E2WH 3HS8A 1ERNA 3QORC 1R3LB 1IL1B 4GSXA 1AP2A 2VE6A 2BH0A 4LCWD 1TETL 1KJMB 5FR3A 4UQ3B 3QHZH 2D31B 3MDJA 4X6EA 4QF1B 1DANT 4N2OA 2ID5A 4W9LC 3V9EA 2AV7A 2YRLA 2OJZH 1KBVA 4F33B 4A39A 4BZ2A 2FGZA 3MLZL 4BKTC 2CJSA 4JPWH 4XNMA 2OW7A 3MI6A 3AG1B 3QJFB 2I9LB 3HMXA 2XTJC 4ATWA 3UPCA 2W07A 1B3JA 5I5JA 3IGFA 2FBRA 1R0AL 4ODXA 2PR4L 4IEFA 3DJTA 4AEIH 3G6DH 1C5CL 1J9TA 3DA0A 5DRNA 3WEXB 3FCBA 1EEZB 3QIBB 5E03A 1U95A 3E1F1 2R0KH 4P2QB 4TVSa 2XWBB 3KJ4C 5KTEH 4IHOA 1SZNA 3HS0B 4NNYA 1J0HA 3ZBMA 1PGRB 1SLXA 4RAHA 3BLBA 4ZDHB 1SEQH 3GHPA 1G84A 3HMXL 1G7LB 3LZLA 4YBQC 5EO1B 3V4PB 2CGZA 1KYUA 3S96A 1L6PA 1HNYA 4Z76B 5GS0H 2OMYA 4LHUA 1L9QA 3L48A 4M5YL 4MXVE 5IB3A 1JF5A 3VXUD 1CFNA 4MA1B 4U6HA 2JTYA 2MNWA 2I7SA 4FXKB 2MHAA 4NN5C 1PD0A 3KPOB 3PWLA 3WNPA 3NSCA 2J5LC 4KTEL 5IWLC 1TQTA 4RZKA 3KPMA 4C47A 1RUPL 3QH3A 1MIEL 2G5BB 3KWXA 5E9DB 1L9SA 3QXVA 2HG5A 3SE8L 3BAIA 1P1VA 1G7QB 4Z7WB 4JZJA 3FU9A 4UQIM 5E7FA 1QLEB 4TQPA 5EOQL 2DMCA 2YZ8A 3OKNA 3QDGE 4FFWC 4H25B 1ZEAH 3CAFA 4L8CB 2D3VA 1D2PA 2FJGA 3APNA 4JDVA 1A4AA 4HSAC 4XNUL 1DBJL 2AXGB 1CI3M 4ZW5A 5DSCA 1BPVA 4X7TA 2I60L 3EJTA 1J8KA 4PIRF 3G5ZA 1N3NB 2WXNA 4YE4H 4F9LA 1IAMA 3NVQA 3WSQL 3B9AA 2OTWB 3FF8A 4PJGB 2BNRA 3I3BA 3JTTB 3O6LH 4AL8L 3V5KA 3VFOB 3MRLB 4QCIB 2XVKA 4GT7A 1KN4H 3O4LD 4KMQA 1XHHA 3UBGA 4K3DH 4KK5C 4EIGB 2YQGA 4RBPH 5HYFA 2MOQA 5BUAA 2IQ9H 2BHFA 3ARGA 1RAMA 3BVUA 3VQLA 4X6BB 3MJ9A 3QJXA 2MQ3A 5HHNA 1CXKA 2JH2A 2BC4A 1W9XA 4CJ1A 5C9JA 2DBJA 1D5ZA 4XPTL 5F9JB 1FA4A 1W72H 1NC2D 3LEYH 5AOIA 3RB5A 5FM5M 5GRYA 4WWPA 5EA0L 2DKMA 4JDTL 4JQXA 4OFYD 2VERA 5C6PB 4Y1AA 2X1PA 3SD2A 3CH1B 4TNEA 2FEEI 4U6VH 2NDFA 3WKPA 2Q1EA 4NPYB 1EH9A 5ADPL 2EE6A 1TJMA 3NABL 3PWVA 3CVBA 4HD5A 5CIPA 1HEHC 4CSTA 2GJZA 3CQPA 1GSMA 4QRQA 4ETYA 1GC1L 5LXGH 5C0IA 2DI8A 3P4NB 1YQVH 2UZYA 3RG1C 1FPTH 1G43A 1ZSDB 1OAQH 3N0PB 3OBAA 3PRZA 4UB0H 4BH7A 4HEMA 4D0CA 1U9KA 1NDMA 5C0BA 4NRYB 3UTOA 3ZDYB 4R6UA 4FF9A 4PJFB 1QWHA 2DD8L 3IKKA 4LOUC 1WGVA 1PEWA 1K8DA 3DOSB 2XKNB 2XQBH 3KL3A 5CHNB 4JPSA 1KLFA 1ZA3A 2Z8SA 1W0WB 3TYFA 1NQBA 3NIGF 5KYNA 4LRNL 4Y2DD 4LU5L 1DQDL 2XETA 2WD0A 4AITA 3ZX1A 1PF3A 5KANI 5HDWA 1CFBA 5EBLB 3JV6B 3QDGB 5A2LH 5HHMB 4FI6A 1F6LL 3NCXA 5AB2A 1J05A 4I3RH 4ODHL 2MOVA 5DQDH 2H26B 1O5DT 2K1MA 1E0OB 4IS6B 4UZSA 2WZ6A 4MNHB 3QAZC 5D7LE 4Y4FB 3O3BA 2F8OA 2E74C 3KPRD 1DJZA 3C6LA 3SIKA 2JKIS 5D5MB 3P3TA 3QBTB 2B1HH 4NRXA 3ZYIA 4Z77A 2BRRH 3D2UB 4M1DH 3RVWD 1TQWA 3D3VE 5IG7A 2XG4B 1C1EL 2BY0A 3HPLA 1OTTC 2BP3A 2EH8H 1GGIH 3IU4L 5K33A 3VD9A 4AVJA 8CGTA 3BH8A 2J8UE 5D1ZA 2ITCB 4RLDA 4L23A 2E9WA 1X44A 1U8CB 2A77L 3BMWA 5HGAB 1GS8A 1ZS8A 3QUGA 3Q8FA 5JA9A 2WSDA 1I9RH 1IV8A 1YEHH 2VTFA 4L1HA 2VXSL 3LS4L 4OLZH 5CLZA 5I8KH 4PVBA 3BISA 3GSVA 1KCUH 1RUMH 3PWUB 5KSBF 2OJ1A 3JV4B 3VXRE 4DGYL 5E51A 4AIZB 1AR2A 1MF2H 4LZKA 1AHKA 1BOGB 5H2BB 3QO0B 2A6IB 2HA1A 3HBZA 2WZPD 4WUKH 2P24A 3EAKA 3O0RL 4LAQH 5D9SB 3C9NA 2XLLA 2B0SH 4HSQA 4AL8C 3QDJA 3VWJD 1OAXL 5EG6C 1OV8A 3NPSC 2GUOA 4S1RH 5B38A 2X7LA 4KJQD 1RH8A 2OSYA 2YKLL 5ERWB 4ZMZA 1BX2A 5SV4A 4KV5F 2YD4A 1XTLA 4GQZA 3RDJA 5I0VA 1LGVA 4X80H 5FECA 5IB2B 1PDKA 3DPBB 1NCBL 1DANU 4KX8A 3B9KB 3FRPG 4S2SA 2JKWA 5JXAL 4WGKA 5EO0A 3ZRSA 3F7VA 1JGLL 1MCBA 2NX5E 2FZ3A 3PG2A 2NW2B 2HJKB 3QEQB 3U4KA 5BUGA 4HZLA 2EYTB 5FWQA 4F9LC 1ZGLB 1KPVA 3VMPA 4K7PL 1X7SA 4G7QB 3BP6B 2Y2TA 3QXDB 1XF3B 4LBEA 4LKCA 4QO1B 3CMGA 2BERA 4MLIA 5ALCH 1E5CA 4J3OC 4JFEA 1FFPB 2YD7A 2RAMA 4FQQA 4KGJA 1QKZL 2ZXAA 2CO7A 2MQ0A 2BRQA 2GTQA 1HHKA 3L8QA 2XTLA 1DL7L 5F0PB 3DUUB 1SXCA 5DUML 5LWYL 4XMVA 3GXPA 4I1PA 1BQSA 2HFGL 1K5WA 2X6BA 1GC1C 4QWWD 9CGTA 1SJEB 4PMEA 1XVSA 4QRTA 2HAZA 4TL4A 4U1KB 2O5XH 3UC0H 4A2DA 5FLUA 3VXSA 4PRPB 1DN2A 4YUEL 3GJEB 1HZKA 3QEUA 2RQEA 2PXYA 3NFNB 4NXSA 1WZ1L 4OF8A 4RDQG 5CGYD 4NHUA 1EDHA 3ASOB 4N2LA 4EI5C 2V5SA 5E6IA 1CD1A 3P02A 4UTAL 2EO9A 3NA4A 4FMVA 1T1YA 2UX7A 4HQQH 2Q7NA 3P40A 4JGMA 2WKOA 2H3NB 2HT3C 1XR8B 3X1NA 3WLBA 3VWKD 1IBBA 3CVCA 4XWOC 1GS7A 3OR6A 2CGYA 3DXAD 1BJ1H 1UA3A 3MXVH 1QI3A 1ITCA 3UTQA 5JXED 1KZYA 3FQXB 5DHVH 4NHCL 4TLSA 3SKMB 3QNYB 2AV1A 2FHBA 3Q8AA 4ANVA 2JJTA 3MJ7B 3V6OA 5CJ8A 4NUPA 4Y19E 1CDIA 3SODB 2HUEA 4LLMA 4PWEA 5L7XL 3UCRA 2NY1C 4JJ5B 3P2BA 3NRQA 4CADB 1G7MA 5FV1L 5K5YA 2I69A 2YBRB 2EICA 3MLZH 1BZ7B 4RFEA 1BVKA 1AQKH 3QPKA 1JWUA 2WANA 1JYVA 4NYLA 3MLXL 1G7HB 2WCGA 3FT9A 3RPIB 5D1XD 1OLZA 4JHUA 3OJMB 2V9TA 1R0AH 4NN7C 4YHZL 1JN6A 2PR4H 3SDDA 2ZAHA 1C08B 2VN7A 4ZUTB 1C5CH 4NWTL 1FP5A 3LH8A 1AGDA 2R9HC 4Y9CA 5I1KL 5JMOC 1KCVL 4EZJA 3X12B 2LGNA 5DJXA 3CHOA 3RJDA 4M8QB 1QBLL 1GZHC 2YD5A 3MGOA 3EDDA 4UAHA 3TO2B 5IBLD 2YHGA 3HMXH 4OAWA 5AW5B 5DMGC 2ZAIA 1OANA 4ZW3A 1OTUD 5TPWH 1RK1B 1T04A 1HZLA 1QVOB 2EZ0C 4ZO7A 4M5YH 1U93B 2HFEB 3MYJA 3UZVB 1XF2A 4M8VA 3RP1A 2LTQB 3W2DL 1WE5A 3WN5C 1NBZB 2ZXQA 3ZKSD 3CN2A 2XX0A 4YPGB 2BP8B 2NYKA 3I6LD 2YD9A 3LKQB 3O9WB 4HF5L 4NQXB 3Q06A 2C7UB 4KTEH 4P4RB 1M3JA 4UMGA 3DIVA 2XBDA 1UXMA 1ND0B 2JV6A 3PL6C 4PJCB 2ADJA 3MNMA 3TCLA 1RUPH 1MIEH 4WWOA 5JPMA 3VD3A 3SE8H 1WZMA 4M03A 4JFFD 5D4JA 4J4PA 3B37A 1HWGB 4RISL 5EOQH 2ICCA 4KOCA 3KS0H 4A7GA 1HAWA 2JLLA 32C2A 4P2RA 3PAYA 5I1DA 4N6RA 3HZYA 1LVEA 3GMNB 5L0QC 1NAMB 1NM4A 5ISZA 4YGVB 3J8F7 1HILB 3TESA 1WZAA 4XNUH 4TNGA 2V5TA 3NEEA 1DBJH 1FIGL 5DC9B 3DX4A 3FQWB 3WXVL 2I60H 1KFAL 4KUCD 1FORL 1ZA6B 1E6JL 3U7WL 2Y24A 3WSQH 5JOEA 1ID5I 3D69B 3B8SA 3O3UN 3QG7L 5I6NA 4AL8H 2BOCA 1CDBA 3QDMB 4J8RA 1SLVA 4DKAA 2QL1A 2R59A 4O00A 4BM7A 5JO5B 4MZ3A 3VXOA 1PY9A 1XIWC 5FA4A 4U4IA 3MOAL 4X6DF 1LLAA 1WO2A 4R5TA 4JM2A 4UQ2B 1I8MB 5DA0B 3SPGA 2O5NA 2JXMA 3DTUB 1NC4D 3BE1L 5TDPA 3QFJB 1SOSA 3F12A 4XPTH 2FEDD 5I6LA 4D9RD 2WSPA 4NO0D 1P53A 4XGZA 3ULVF 3FTSA 1LK2A 4W6WB 5HPMA 3AQYA 3MRPA 1IE5A 4JFFB 3ZTCC 3CVHA 5E6IC 2HN7A 3A0OA 4JDTH 5EA0H 4F8NA 4U1JA 3Q0HA 4J3OH 1ZDQA 2QR0A 3W9DA 2OMNA 5HVWA 3D30A 4PJ5D 3EYQC 3NFPA 5ADPH 1DP0A 3BSGA 4ZFQA 3NABH 3G6JA 3I75A 2V33A 1IVTA 1UFUA 2A9BA 3FCSA 2XV3A 1GC1H 5JPNC 2VLJB 2WAHA 1QABA 4XE0A 4WCYL 1U8LB 2IAMD 2JJTC 2PO6D 4KOBA 4U0QB 3WEOA 4R2GC 4BQ9A 3SCMD 3CVHL 2FJFA 3M7FB 4GG6B 1WK0A 1XO8A 4P23A 4ZUUB 1DJSA 4W9JC 2H2PD 4KK9C 3REWB 4HHAB 4DP0X 4LLYA 2DD8H 5DRNB 3TNNA 3CIQA 2AJZB 3GHBH 3RIKA 1ZMYA 4UNTA 2ZSVA 1VFUA 4FQIL 3W37A 3BPNB 1SJHB 2ZOLA 4Y1AE 3VXQB 4G42B 4GW5A 1WZKA 4LRNH 3FH5A 2FYYB 4LU5H 3N2JA 4FAAB 1SF3A 5B8CB 1DQDH 3MBEB 4U6TA 1A65A 2ZWNA 3DVNA 1VHPA 2MPAL 3ARDA 2CK2A 3FQUB 1S7QA 1HU8A 1CXHA 2QKIB 4ODHH 1S46A 5G2NA 2MKLC 4S0HA 3BEVA 4F7TA 4XC1L 4X6CB 4FABL 1NUFA 2RACA 3LZRA 4NO5B 4HU2A 2YRPA 2X38A 3JWDL 4HEME 4KKAD 2XPYA 5LXVA 4HIHB 1D7CA 4L37B 1TEYA 2CHDA 3E6HA 3K6OA 4QHKJ 2EAEA 1RZQA 4OLEA 5D7IF 2GAZB 4TNWF 3UZQB 1NGXB 2XV0A 4DTGL 5JHDA 4YSCA 3NJIA 4JQIA 4U3SB 3IU4H 2VZTA 5E00B 2QTEA 2JI3A 2FO4B 4UOW0 2PWHA 5L4FA 4I8DA 3ZE0F 2A77H 3VH8B 4CNIA 2TSAA 3S98A 4QKTA 1R1CA 4LLWB 3T1FB 1V3JA 1BLNB 4W9CC 4DKEL 3RIAK 3HCVA 2VXSH 3LS4H 3WEBA 2A5UA 2BCKB 5HJBA 1IE4A 5DJYA 1ZPLA 1BFVL 3GFUA 5FB8B 1XGTB 3VAEA 4DGYH 3GRBA 5E8PA 3NIFF 1IQWL 2H32H 5HI3C 4IRJA 3WFCL 4JDVB 1PVHA 1TSRA 1EJOL 1N6UA 3N55A 5JW4N 1AGCB 2KL6A 3WIIL 2HVBA 2FWLB 1LP9F 2ZWZA 4JQIL 4K5PA 3O0RH 3MV7A 4KKLC 1YC7A 3O6FA 4XO5A 2X09A 1I8IA 5C0JB 3OG4B 1OAXH 4A37A 4P3DA 1IEHA 2K6YA 3BUPA 3T3PF 4KO5A 2Q3AA 3QAQA 1JBJA 1KCLA 1HHHA 4NQQA 1NCBH 4J3XA 3HI1A 4X0KB 1FYHB 1P4IL 1LD9B 4XXWA 1QZ1A 5K1JA 2DYPD 2ZOOA 4GKOA 4N90E 3I02A 5JXAH 3QQ4A 2LAAA 1CDUA 2PCYA 5KBDA 5IW3A 5EF0A 1PS3A 3EYFB 3OM3B 1UD2A 2J6EA 3MODL 5ICYA 4K7PH 5C8JA 2NZ9D 5FGCB 5BOZG 1Q4NX 1I1AD 4B5EA 2DLTA 1CN4A 1MIML 3I9IA 1S78C 2C34A 2W95A 3K2MC 1QKZH 1D7BA 2GW5A 2IANA 1HH6A 3LZNA 4XN9A 3QDJE 5A6MA 2E5EA 1KPRB 1ECYA 1UQSA 3I6KB 3TBVA 2ATKB 3KLHC 1PJWA 4UNIA 3O41B 1DL7H 4KGLA 5BPPA 5LWYH 2HFGH 1O75A 3VG9C 5HSFA 3FT1A 1KYOK 1BFSA 2XY1A 3LKSA 3NPZB 3QQXA 5EUOA 4JGJA 2JKNA 3VI4A 4F7PB 3ULAB 3L3JA 3WKNA 1BZ9B 3V4VB 2BNQD 2DBLH 4YUEH 5C2BL 5IKCA 5GRJL 4XCFL 4DETA 3AQDA 5IZ7A 3D4CA 1WZ1H 5AW7B 3MBWB 1N18A 1OPGL 3T4AC 3QJOA 1VFMA 5FFGA 1ZIAA 3LH9A 1TTGA 4UTAH 3GHEL 3HG5A 4JFEE 5DUBB 5DC0A 1ZA3B 3L5IA 4NM8L 4QGYA 1QASA 4LF3B 3MKKA 1MELA 5KBNC 1D5RA 5DA4A 3RFZB 4BYHA 4UMSA 2J43A 3MCKA 2A74B 3EUDA 4TVUA 3HZMA 1A3RL 4CRPA 4P23C 4L1TA 1MFDL 4IYKA 1D5IL 2X1XR 4JFDA 4PBXA 3IMBA 4Q8BA 2OXHA 2NY4C 3VXMA 2VCOA 4OLWL 3SO3C 3T6QC 3JWDC 3QJSB 4YNYA 1YMHA 4ZSOA 5ES4B 2ICWI 4F7KA 3VXSE 4RGMC 3L9RA 5L7XH 4XP6L 3D05A 1IM9A 3IDJB 4GAFB 1SN5A 2YSSB 4XCNB 2CIIB 1E42A 4WSGA 2VISB 4ZX5A 2ICEC 5IHUL 3QWRD 2Q7YB 2FSEA 1J5OL 4KNUA 3MLXH 3WJLA 5LBGA 2YD8A 3GMPA 3N43F 3D85B 2DLEA 3BWUF 3RVXC 1QSEB 4QRFA 4NUQA 4YHZH 2ZJSL 1JK9B 2YMXL 1RZIA 5A7EA 5IOPB 4YOKA 2FBOJ 1J8HA 1BHGA 1UUNA 2DKUA 2R1WA 3EJUA 3PQYB 2K8MA 4FD0A 4NWTH 4BFIA 1FYTB 1N9PA 3N44B 3ABMB 5I1KH 1KCVH 3RWGB 1VGKA 4J1UA 3TN0C 3V6OE 2F53A 5DWUL 1FFTB 4NKOA 4MNQA 4W68A 1QBLH 5MI0B 2Z7UA 5B1KA 5K9QI 1X6NA 4I9XA 2OYMA 2BO0A 4GW4A 2N7BA 3QDJB 1Z5LB 2ODHA 4Q6KA 2X9YA 3DIFA 3IXTA 5DRXA 4D8OA 2V2TB 4RAUA 1BX2B 2PPFA 4L3FA 3VA6A 3B7YA 1TSHA 3AXIA 3W2DH 3BWAB 1JP5A 1JXDA 4PCKA 4TLUA 3PIQA 3EO1A 3NG5A 3E80A 4MQTB 4YHOL 5B4MD 3HAEH 4QRSB 5JTWA 4HF5H 1RZGB 4G9FB 2P5WA 3I2CL 3IJ7A 4POZC 5EEVA 5T3XL 1EHKB 3CU1A 4RMVA 3CN1A 2NNCA 4B9ZA 3MLSL 1FZJB 4WU7B 3WS3B 1H6UA 4FQQB 3MRBA 4RISH 3TT3L 4AENB 4WNSA 4RESB 5I26A 4R7NA 3S0PA 4K5MA 4PJDF 2CWRA 2PETA 2DIAA 4QHUB 1D9KD 2NY6B 3DJZA 1WZLA 2AAVA 3FMGL 1P7BA 5KVGE 1FIGH 3P0YL 1U92B 4R0LA 1DQQB 4FG6D 5EMYA 3WXVH 5I15L 1KFAH 4EUPG 2P45B 2HVKA 4LLVB 2DOCA 4QTFA 1F86A 1FORH 1I3RB 3EYSL 4I0PD 3U7WH 2ZSWA 3MGTA 3VFRB 4ZBJA 5I6XB 2AVFA 1G0DA 2F54B 2K6WA 3QZPA 1NCCL 4L3CA 2APXA 2CLZB 1NKRA 2YSTA 3FN3A 4LOVA 4WO0A 2E0PA 3TXAA 2DF3A 4DGUA 2RFXB 4AYID 2X44D 5F7KC 3DLQR 3MOAH 3K0YA 3BD5A 3PY9A 1RZ8A 4MVBC 5F3BB 2KS0A 4PEEA 5BZDB 5FKPB 2JKSA 2Q8BL 5F70A 4P2RE 3RY4A 3BKCL 4L4VD 2W65A 1UZ6F 3UBXA 1T3FA 3BE1H 2WNGA 3O2VL 3DHJA 3G5YB 3OXSA 4Z7OF 5ISZE 1WAAF 1HN1A 1Y07A 3O3EA 4BSWB 1THAA 3RTQA 1KTDA 3ZRCC 3NSFA 4YSTA 4JY5L 2FRGP 5IB1B 4GG8A 2CJTA 2GG1A 3ZDXF 5B1JA 1QWUA 4UINL 3HUJA 1QW9A 1I82A 4LLMB 5D1QC 1U8HB 5KSVA 3L9BA 4PV9A 1LE9B 2BNUB 1TU2B 5DZVA 4FFTA 3VQ2C 2EUZA 4DEPB 2Z8RA 3ES6A 3WNMA 3SJVD 4JB9L 4NYLB 2X2YA 2BSRB 5C07A 5JHMA 4XO8A 4IBSA 4TUJB 4BFNA 1DVFB 1MH5A 2BWDA 2XWTA 4RMBA 2DM4A 3CVHH 4RAVB 3CPLA 3RVVD 3SYOA 3B3BA 3K46A 2WLKA 2XA8L 5DJ6B 1MHCA 4YQXL 4XTRD 1DJHA 4R90L 2BOBA 1TEFA 5TQ0L 1EHLL 3VD1A 4FQIH 3IPFA 2WZ0A 2H6PA 3TIDB 4NQSB 3QI9D 3ZGHA 1YLBB 4JHBA 5DJXB 3UC2A 5CKAA 5EU4B 1FZMA 2Z64C 1QYGL 3G6JE 2MPAH 3Q8CA 4ECNA 4M8UA 4ZUVB 3S5LB 3A4AA 3JVFC 5HVHB 1QHOA 1MXDA 2B9AA 4JRFA 4XC1H 4Y5VC 4XX1E 4FABH 1XF2B 4G8EB 2I07A 3TZVC 3BJLA 1BIIB 2GJJA 3JWDH 3H1ZA 3OKDB 4NO3B 3SGEI 4TUUA 4KNSA 1Q0XH 3GT6A 3II2A 4O2FA 3AW5A 2FEEL 5H35A 5IEHB 3MRMA 5DDHB 3MRQB 4WEEA 4DTGH 1PSKL 2K9UA 3QZWA 3QQDB 5HYJB 1T89C 3EGXB 3M8OL 4PTTA 1KCKA 2ZF9A 3V9FA 4GO9A 4N85A 4KI1A 3J7HA 1OGPA 2OA9A 4G71B 3RQ3A 4F8TA 2VR8A 3DKHA 2IPTL 1ZHLA 4PRNB 4YXHL 4IBZA 1K4DA 4P2RB 4AX3A 3QWQB 5IVOA 1RY7B 1BFVH 4AGNA 1K3ZA 1I1RA 3EHBB 1S2EA 1IQWH 1F6AA 3WFCH 3FO9A 1EJOH 1HCVA 5JIPA 2A9NH 1UH4A 2CBMA 2GI7A 4O5LL 3L5HA 4R8WL 3WIIH 4E41D 3H3BC 3BKML 1RJZB 4J3UA 4PGBB 3ARXA 3VVVA 4OCWL 2OR8A 4YHKL 3LRSB 1KJVA 4JREC 4LVNC 1EHNA 1JUFB 2FATL 1OO2A 1P4BL 3EOAA 3SD5A 3EIFA 5JHDE 4A2HA 3X1BA 5BMFL 1HDMB 2Y7OA 4G8GB 2EC9U 1P4IH 2EIMB 3RX7A 1E50A 3U4AA 5D2NB 4R0LC 1YY9D 3CC5B 4HWZB 1D5XA 1TZ8A 4NQCD 5ANMB 4JKMA 2G3MA 1KDJA 4DUVA 4MJID 2XVLA 5ID0A 5MEND 4RMWA 1YUKB 3MODH 1VRSA 2NNXA 1E43A 5EOCH 1A4KB 1PLCA 2QPDB 1A7NL 1QLRA 1YEWA 3M86A 4G8FB 5DGQA 4EN3C 1LK2B 4XI5C 2ZCLL 1MIMH 3UABA 3HA0A 1ACZA 1BFTA 2ZX5A 3MV7E 3ABLB 1IQDB 2H3XC 4FXGC 4F9PA 4A66A 4HCGA 2NY0B 1MCJA 2OMZB 2WQXA 4P2OA 3W9EA 2GJ6B 2X05A 1YA5A 4GUCA 4NERA 4OW6A 5AW6B 3U9PL 5B7FA 2E4FA 3GUTB 1MNNA 3UXFA 2PP8A 3P4LA 2Z34A 5KYWA 1QATA 4TM9A 1JFQL 3IDNA 1T6WA 4U3CA 1JPFB 3VSVA 5C2BH 4XCFH 1R3HA 4FC3E 4UM9A 4TOYL 4HEPA 1AOZA 3VFWA 3H56A 4Z3FA 1OPGH 2VW7A 2HG0A 4AJVA 2W9EL 4Z5RA 8FABA 3GHEH 3RWCB 1T1WA 3S4SB 3KPNB 3C6EA 1G1KA 5DS2A 2H47C 4NM8H 5IROC 2IANE 4JG9A 1YG9A 2DTSA 5E1IA 4GAJL 2VN6A 3IU3A 3ZDYF 1N8OE 2FIKA 1GZPA 2GB2A 5SX4I 5BOJA 3A4FA 4PRDB 1A66A 1K5NB 1A3RH 2MTAA 1MFDH 5F88A 1D5IH 1TQUA 1KPUA 1SDDB 4BA0A 5EUOE 4LIQE 5DRWA 2NR6D 4OLWH 3QS2A 3WHE0 3UL4A 3DO4A 4FNRA 1B9ZA 2JCCA 3D4GA 5FO7A 1FL5B 1ZV5A 1WHPA 5LBSA 1NUDA 4PHXA 3QWOB 4XP6H 3TF4A 4UTBA 3JZ7A 2C3VA 4HH9B 5L4IA 3B56A 1ACXA 1T7ZA 2NYYC 3EOTL 2OW6A 2VDML 1E5YA 4J3BA 5DI8A 4ZPTA 5IHUH 3RGBA 2C5DC 4A2MA 1KIRB 2IDSA 5D5MF 1I4FA 4YMPA 1FZOA 3KPPA 3KYMA 3IFNL 4P5MB 2LT9A 4CC0A 4PLJD 1JYWA 1TTCA 2ZJSH 4ENEC 2YMXH 4ZMTA 5SWZD 4KKQA 1FE8L 2E9BA 4P46D 3K71A 4JFDE 5INDA 1NSNL 2P8PA 5J7CC 3ARUA 4KU1A 3FN9A 5LBSL 3VXME 1AS7A 3LQAL 4ZSOE 5J1SC 4AK1A 5DWUH 3L2LA 4BHUI 4D0BA 3GRWA 1Q9OB 3BXNB 4YWGL 4JFOA 1OLLA 3RVTD 1I8IB 4Y5YB 1GIGL 5FGBC 1XFPA 1GKOA 5T5FA 4AC4A 2H41A 3IGAA 3DI2B 3L5WB 1SLUA 4BWTA 5H94A 5J11B 4FEIA 3GMMB 3K0WA 4X5XA 1CFVL 3HG1D 4XAKE 1KIQA 4KKBC 3VFMB 1JTTA 2QV2A 2WVVA 1PIGA 1R9FA 2X1WL 2GTWA 1AXSB 3UTZB 4Y16C 4MXWL 3FSWA 3RZCD 3MJ6A 4YHOH 5JORB 1BMZA 4JRXD 1J8HE 4GKSA 5D7KE 3GRWL 3I2CH 2IDFA 25C8L 5KVFE 1Q8MA 3IGKA 3U1QA 5T3XH 4PBWD 1R3KA 4OJEH 4TQHA 3WO4B 2F53E 5D96C 1YNTA 1N26A 4MNQE 1OGAB 2A0LD 3MLSH 3S36L 3TT3H 4L8BA 4F2MA 4BEIA 2Z92B 1ETJA 4AEFA 2MRYA 4E9YA 1WA0X 4N2BA 2AQ1A 2FGWL 4U33A 3FMGH 1MOEA 4GQ9L 2YQBA 4K5NA 5IV2B 4XMXA 3MRGB 1T1XA 1RIUL 3P0YH 3O45B 4FMFA 4KI5D 4BFOA 4PJ8B 5I15H 3VVWA 3AS3A 5JDSB 5JQIB 3EYSH 1YJDL 2RJMA 4GKZA 1NTDA 2HT4C 4HIEA 2DLHA 3MV9B 1NEPA 5KOMC 1U8QA 5CJQL 1VEMA 2C9AA 2P5WE 1NCCH 3UO8B 4QTHB 1AGFB 5B1BB 5JA8B 1JPTL 2MNJB 3SSGA 4DZBA 2CM5A 2KPWA 1OSZB 4P4KA 4W81A 4JANB 3U9UB 3DVGA 3BAEL 2VC2B 2OL3A 5D7JA 1XF4A 4QAMB 1PPIA 4F7CB 2MJWA 2Q8BH 2E3VA 1F6FB 5EC1A 3O2VH 2QSTA 2WAQA 4WK4B 2WBJA 4L8SA 3GC3A 3NSXA 2BVPA 1C7SA 3OPZL 3WE1A 2VITA 4JY5H 1GJUA 2ZD0A 4LHUG 1CB4A 2N59A 3KJ6L 1T0MB 4WI6A 4UINH 4X99A 5DHXB 3VGHA 2R69L 2OL3L 2BSDA 4C8XA 3BQUD 1WCBB 2HTLD 5DJ0A 4YAQB 2X2HA 1SF5A 2GHZA 4OM1L 4NDMA 1QQDB 3V52L 5DO8A 2DV6A 1FO0L 4LLQB 4JB9H 2FSEB 1T6VN 5E8EA 1V27A 1VGEH 4EAEA 1F90L 3Q43A 4QLRA 1ZVSB 4KK6C 2FBJL 3T04D 5TQ2H 1KELL 4JO2L 5ANHA 1XZWA 1ZLVH 5AOKA 4KH2A 4OJFL 4H40A 3RNKA 2XA8H 4YQXH 4TUOB 2R1WB 3ME0A 1P5UA 5TQ0H 1JNHA 3LQAC 3DGGB 5TD4A 4XNDA 2B77A 2VDLB 1DQLH 4G6AC 2KBGA 5CCHE 1N2RA 3P54A 3RL1A 3HUJE 1HVXA 2FDBP 5B7EA 5EBMA 2WLLB 5C08D 4IRSA 4GBXA 1BFOA 4NZUL 5HGBA 2WHVA 5J89A 3DMMB 1QYGH 2ODIA 1FHGA 2UWEB 3C60A 4LOFA 3QNZB 3KVQA 3CUPA 3RGVC 4IBLT 5T1LA 4ZFOA 4PYGA 2L7JA 1VENA 5HHPB 2WIMA 4FFYA 1G7IB 5K9KA 5C07E 1MFVA 3FU7A 3LIZA 4L3ED 4IOSA 1JS4A 2HWZL 1KGIA 2VKWA 2C3XA 2Z31D 3MUUA 2A1WL 3W0WD 4PV1C 5TFSL 2O6EA 3B2DC 3HB3B 1UYWL 5I74C 1KB9K 4PGCA 5IHBA 1PSKH 2VXTL 4HJ0C 4LLDB 2H0FA 43CAA 3M8OH 2TAAA 4IBQA 5DZJA 4TNWK 1U3NA 3IJ8A 4PJ9A 5LN4A 3DUSA 4FFYL 3UIZA 3QIWD 2R15A 4M6AA 3X3GH 4X4YB 4PJCF 5J13B 2IPTH 4QGTA 1HHGA 3TBSA 4YXHH 3FTUA 4F5CA 2ADFL 5ETUB 3EGSB 4K7FB 4PD4J 3GSUB 1TF4A 4Q6IC 3ZQ9A 4FG0A 3WY2A 1SMOA 4O5LH 4R8WH 4UWQB 1YJDC 4XOCA 2COQA 3BKMH 1P5VB 3DTXA 4WK2B 3BFWA 4OCWH 3UG3A 4RMRA 4YHKH 2ATPB 2A3TA 2L8AA 4ONFH 2FATH 2R2BB 2ZSWB 3BGFB 2EDBA 4AQ8A 4XXDB 4BRVA 1D2OA 2EYRA 1YMMB 1M7IB 2WO4A 1FRGL 1A1MB 3FSOA 4J28A 5GSVB 1U58A 3VGAB 1BVNT 4ZMPA 3RUGF 5ACLA 5HP5A 2HJLB 5BXFB 3UPAA 1KT2B 4S0TD 3WLWC 5IJCC 1JL8A 4K8RD 3WFHB 4DO5A 5T8IA 1UM4L 2DB8A 4N0FA 4ZZKA 1JVKA 4O4YL 1JJUA 1GGBL 2XWJB 2XXGA 2FYVA 3UBXB 2IALA 4JKPL 3TBTA 3VG0L 4QYOA 3VYOA 1RPQA 4NP4L 1EDYA 1G9NL 1BVLB 2ZE0A 4MJ2A 1JMZA 3RWHA 2GPZA 5FC9A 3RTQB 4WENB 4PG9B 4KMTL 2ZCLH 5EWIL 4Y4KA 4CU7A 3PGCA 4P4KC 4R7VA 2K0RA 3FRUA 5I8EA 4QHKI 3EDEA 2E6QA 2V5RA 4NUJB 4U4BA 3S88L 4PB0L 1COBA 2YPVH 3ETTA 4NEHB 4GRLD 5KSVB 2Y7NA 3L7FB 4MB3A 3PWPA 5HGDB 3NJKA 3U9PH 4B0MB 2WBJC 3UAEA 4JM4L 4AE0A 2MCMA 4PREB 4RGNB 4EI6B 4EBQL 1JFQH 3ZE1F 4LT7A 5K39A 1NMCC 3T2QA 4A6YA 2EVIA 2IFGA 4GLRI 4ZTPH 1WEJH 4BSVB 1FQ9C 2DMKA 3HZKB 3OJVC 3BIBX 2VL4A 3BEWA 2QPUA 2G2PA 4N25A 1SOXA 3CX5K 4KUCF 1W80A 3ZYOA 3VSTA 3K1DA 2I25N 4PJ6A 4OQ1A 4GG6F 1UACL 3D0VA 5E24E 4KNQA 4LDCA 3TCTA 4GAJH 1ZT4A 2G75B 1IKFL 1TCRB 2D73A 1C5BL 1AHWA 1L3NA 4ES9A 5JMRA 5D71L 3JT2A 4HUXB 1A3LL 4N2EA 4P5KB 5B38G 3BP5A 1YY8A 1TVHB 1P5UC 5HDBE 4FQHA 3IF1B 4IKJA 1D5MB 1SNRA 2L7QA 1QR4A 4RFOH 4CJ0A 4MCZA 2QZ5A 4JFPA 2Y5QA 4I48A 3A6CL 4Z7VE 5EU6B 3Q6FB 3C08L 3DV4A 4GBXC 4X6CF 3LQZA 5KYXB 3H9ZA 3EOTH 3PJSA 3HTLX 3VRIA 3TVMD 1XMEB 1CVRA 3C60C 2J1KA 4MRBA 4ENZA 1HHIB 4M7ZB 3RKDC 2Q87A 5HHOA 1QFOA 4HUWB 2EKSB 1J88A 2WIIB 2NDGA 3IFNH 3PABB 1AO7B 3DNKA 5CP3A 4LCCB 2BXZA 3C5ZC 3GPSA 1AR1C 4DGIL 1EZLA 2YARA 1FE8H 1IEAA 3LHAA 3RHWF 2O5ZL 3RDTD 5IB5A 3BIKB 4E68A 1NSNH 3P9MB 3MRDB 3IDIA 5LBSH 2ICWA 4KZCA 3LQAH 2R2HA 5ILTL 4GW1A 3TJHC 1UB6B 5ICXA 3KLAB 5DGRA 3ZY7A 2JCCE 1I1YA 3LKRA 4MB5A 2ZXBA 1BBJA 3KL5A 4GT0A 2PCFB 4WQOA 3GBML 4L5FL 4ZOCA 4YWGH 2MCAA 1GIGH 3LKPA 1ROCA 1BG9A 5I6PA 5AW2B 4UQDA 5BRZD 2Z9TA 2LU4A 4XBMA 5LAPA 3VD4A 5IBUG 1CFVH 4LDOB 2QTVA 4JZOA 2P49B 1PFOA 5A1AA 2CAKA 2Y1YA 1S9VA 1JGDB 2YGNA 2X87A 4MXWH 2BY1A 2W9LA 4DVBB 1HX0A 3VI3B 4EQ3A 2A6DB 3IJYB 4MQXD 3W39A 4F57L 2JJWA 3GRWH 1H8NA 1WIOA 2KDYA 1G9NC 2YN5A 25C8H 1Q9LA 3OQ3B 3L6FA 4N1HB 1RJLB 3LPFA 4GB9A 3ROLA 4PN6A 3AADB 3OGOE 4J23A 4OD2B 3S36H 1M42A 1FNAA 1UCBL 4ZXBD 2FJHA 1QFUL 4J6IA 2APSA 1HH9A 2D7PA 2EIZA 5CJXC 4HWNA 4YFLF 3VXPB 2FGWH 3VM5A 4RDBA 3CFNA 4GQ9H 1LK3L 4OGXL 1IGML 3FT3B 3EBAA 1RIUH 1YO4A 4JZNA 4KJWD 4AQZA 1HNGA 3LCYA 3LEXB 2OX5A 3QYNA 1J9RA 1ED3B 1EXUB 4HJGB 5HDBB 4PVNA 3OG6B 1YJDH 4P5RA 5CMAA 2OTUA 4Y4KC 4HUUA 3T6XA 4DJMA 1KB3A 4UM9B 5CJQH 2M8XA 2WY3B 1QLFA 3TO4A 3KEDA 4QRRD 4Z7VB 5D7LD 1BF8A 1KMGA 3IK2A 1JPTH 3BGMB 5F93C 1MHEA 1P7KB 1MQKL 2UUDK 3HBQA 4ANKA 4OV6F 4BINA 3ZN6A 1W72B 3BAEH 4GP4B 2Q7AA 3OAZH 3B6SB 3QORD 4AH2B 4WJ5A 2V6HA 2ZUXA 4W70A 3S2CA 4L4TA 4WTZA 5DZPA 3D3VD 3VFPA 2OJEA 3FAXA 2FIKB 5JQHC 3VFUB 4S0SD 4EDXB 2CHZA 2VJ0A 3DVFA 3GXNA 3BRDA 1A64A 1EHAA 3FFCA 5IMMB 4RFNB 4Y9GA 3G7TA 1NOFA 5EEXA 1KYFA 1UG9A 3MBXL 2BVQA 1WTGT 3HLAB 1KPUB 2KZ1B 3VYNA 4R7DA 5FF6A 2C26A 1WBXA 2OYKA 3KJ6H 5I8CB 3RFRA 3PAUA 3ARBA 1UB5B 1KB5L 4WW2C 3GSOB 3OMNB 4BXSV 4NXKA 1JWSB 2OSLB 2R69H 4XCYB 2IEPA 2OL3H 5PAZA 3EH2A 3SPCA 3VXRD 3KZ8A 1UGNA 4HG4K 1R19A 4JPKL 4PPTA 1VACB 3BPCA 4CBPA 1P2CB 2B2XL 2OI9C 3FQNA 2R0WL 3FQTA 1MCRA 4OM1H 2VDPL 3HE6A 3L5JA 2GQHA 4YGAB 3MREA 5FO2A 3V52H 2L04A 4JY6B 1FO0H 5GGUA 1EFXA 1MCEA 3X1EA 4CVUA 3NJJA 1F90H 4WFHE 1QBML 3DX3A 5FYJE 3QS3A 2FBJH 3HHSB 4C4UA 1FZOB 1LTXA 4NLAA 4KRLB 1KELH 4JO2H 5FYLE 3RPKA 3UAJA 2IGFH 3LJ3A 4OJFH 3RWEB 4YC2C 5H4ZA 1ANUA 4MAYB 2KZWA 4PJ7B 1PQZA 3DROB 3IFPA 3M17A 2JK5B 4FN0A 4HCRL 4ISVB 4Q6YA 4OFVA 4QHNB 3ARFB 4YBQD 3FCTA 3ZUNC 3OAWA 2NX5D 1ZCRA 5SWSB 1U3HA 2XN2A 1L0YA 3PP3H 5C92A 3W56A 1X5FA 1T5WB 4JO8A 3KLQA 4NZUH 3N44F 1P7QB 3SDAC 4YDVB 4JFOB 4LK4A 4XN4A 4FG2A 4Z3HA 1CC3A 1B0IA 3NCWA 3G5XB 2GTZB 2MIZA 2V2XB 2YLHA 3TNMA 4F58L 1T22A 3D18B 3TJPA 1F41A 1XQ4A 1RZJL 1U8MA 3PV6A 5CLYA 3T0EC 5IP4A 2VLMD 5EOTA 4H20L 5JIHA 3V0EA 1ORQA 2HWZH 4UUJA 5J1TC 3BVXA 2XTJB 4JRYE 5TFSH 4FFZL 3GXIA 5LQBL 1UYWH 3VSUA 3NK3A 4I2XA 2CR6A 2VXTH 1AQDB 4WKZB 5DZOA 1A6TA 4YXLL 5T1KA 1M2VA 2CKBB 2GK0A 4PCYA 4F7MA 3KLLA 2DMGA 3O2DL 5AZUA 4JGNA 3KJ4B 4FFYH 1ADQL 5FCSH 3ZSSA 5BW7A 5DHYA 2VIRA 2ZPKL 5JHAA 1I53A 2O6PA 3FO2A 1N7ML 2ADFH 4YSRA 5JOPE 1KTRL 1TZIB 4U1IA 4J3WA 1ONQB 3C8KB 1M6UA 2P5EA 4LHJB 3U36A 4XVJL 4OZ4B 3V0VA 4FKKA 2OZ4A 2NNRA 3DHMA 4F3FB 4WY7L 2F6AA 4I9WE 4XX1G 2YWZA 2VR9A 4HKXB 2YAEA 2N4IA 2DJMA 5T3ZE 3KGSA 4O02A 4FKEA 4NN5B 4QXWA 2AHIA 1FRGH 4AWJC 2J5LB 3ZLQC 4Y19D 2FX8H 3CFDA 1ZOXA 4ZOEA 3RYMA 4LVHC 4QNPE 4B53A 1TVDA 3V2AR 1GPOL 3BKYL 1ZAGA 4WSJA 2DAVA 4JJOA 1VA9A 4BCZA 2V3DA 1OP5H 1FWXA 1R34A 2YR3A 3R8BB 1UM4H 2ADYA 1OP3H 3FPXA 1HI6B 5IFJB 3MJGX 5I23A 1F18A 4ZAKA 4O4YH 5KYUA 1GGBH 3T4YB 4F5CE 2NTSP 2WGXA 5FX3A 4JKPH 3VG0H 3Q5YA 2K7QA 4NP4H 1SBSL 5DD6A 5J6GA 1CG9B 1G9NH 1HWWA 4HKZA 4PJAA 4XNQB 3TO4C 2CU9A 4OLUL 2VLRA 4O02L 3F7PC 1C8QA 4KMTH 4F7EB 5EWIH 3QYCA 1A02N 2R4SL 4EXPX 3RJOA 1MUJA 4IGBA 3S88H 4PB0H 4I87A 2MQCA 5LCVA 4EVNB 4G70B 3SKJL 1R3IL 2EXTA 2FJSA 4X83A 1L9TA 1YYLH 2PWGA 2X41A 1UTDA 4ZFZB 5GRXG 4B6ZA 1SJVA 4RQQB 4JM4H 4XH2B 2RBLA 3F64A 1AQ8A 1AKJB 4EBQH 5J0BA 5JIKA 1LJMA 2OMTA 4HIXL 4WWKA 1S9XA 1HE7A 2AQQA 1PD1A 6PCYA 3FU3A 4JRYB 1IC1A 3RNKB 2CBOA 4OLXL 4HIIA 1VEOA 1JZDC 5KSAB 3SE3A 4EN2A 5DHVB 4WEUD 5I9QB 1I7UA 1UACH 2I7OA 3CLEL 2PABA 5E2VL 4LPCA 4QD2E 3ZKND 1IKFH 1E27B 1MWAA 1X9RA 1G5GA 4B5ZA 4J12A 1C5BH 5DJ8A 5IUSA 2OS7A 3ZDZE 3PWPE 3H7BA 5D71H 4MZRA 3US0A 1A3LH 2W1NA 5CP7B 5C0CA 5D6CB 1XGQA 2P26A 1ZANL 3VNYA 2XPGA 4YDIH 3D5OF 3VFTA 2E8YA 4M93B 4MA8L 3KVPA 1GZQB 4HD9A 3WDIA 5IIEA 4LHUD 3Q8EA 2VH5L 3ECBB 1E30A 3ZVVA 3HN8A 4KJYA 3A6CH 5BJTB 1UT1A 3C08H 3I84A 1YVLA 2NSMA 3IJHB 3OHMB 3EFOA 2FQFA 1Z9NA 5TTRA 1D3CA 1RUQL 2BVEA 4NS0A 4BK8A 3TBYB 5H37H 3N50A 4JRWA 5KVEE 3ZDWA 3QWNA 3LNHA 3B2MA 4DGIH 2O26U 2VZOA 2VLKB 4OF7A 2C3GA 2O5ZH 1HESA 3HE7B 4M7JL 3UP6A 4S10A 4MXQD 4LCYB 3R7RA 3RTLA 5FEBA 5ILTH 2X4PB 5KAQF 3QUMA 1OSEA 4KTGA 5FKAB 3SGJA 1XT5A 1XR9B 3WMPA 2ZCKL 3GBMH 1ES0A 4L5FH 4PRBA 3IAPA 4G83A 4N0UB 2ALWA 2VDQB 2ZUYA 4ZMOA 3FHQA 4G43B 2KKQA 1A9BB 3WY1A 3ZT7A 2DQIL 2X2JA 1NGZA 5HHOE 5JW4R 1OK0A 2BNRD 2P5PA 4DK3A 2N0MA 1JE6A 3CCHA 1AZBA 3OWRA 2CRIA 3ULUE 3CC1A 5HDQL 4PRAB 4LARL 5DD0L 4WHTA 1S7XB 4F57H 3MMEA 3U9WA 3U83A 1IAKA 3ARGD 5DVMA 4BHUA 1G9ML 4BFKA 4Z7QE 2H5UA 2OCJA 4YH6A 3LKOB 7PCYA 2AJ3A 4OKVB 5GGSB 3GMOA 5H8DA 4F8PA 3R06A 3A6OA 1UCBH 4FQJL 3TS8A 5MEQA 1QFUH 4FHBD 5IJKA 1BA9A 3WUWA 2EDTA 2ZXCA 3EFFA 3B1TA 4Y1AD 2AJXL 1LK3H 3QB7C 4KZEL 4OGXH 1A6WH 5CU5A 1PCXA 2K7PA 3HZVB 4EPSA 2P80A 5FK9B 1JVOA 2PTUA 4UQAA 4EI5D 1FNSL 4H5SA 1S9WB 1MRDL 5ESQA 2R39A 5M95B 4MCYA 2Y06L 5CBAB 1IILE 1BLIA 1ZT1B 4WI4A 1FFOA 4XWOD 4FJYA 4XBGA 3BRFA 5E1HB 3PDOB 3NP3A 3HNVH 1MQKH 2CDEA 4OGQC 2CQVA 4Y2DC 5C0BD 1F11B 3KW7A 4UT9A 3S97C 2QJDA 1EX0A 1P7HL 1BAFL 1Y6KR 3MSPA 2E8ZA 3ILDA 5EU7E 3MCG1 3BLKA 4CVZA 1XH3A 3C6SA 4JVUA 4W4OC 2ZYRA 1ZLWH 4ILDA 1XSOA 3FB7B 5I8OL 2NY1D 4NC1E 2GABA 2H8PA 3MBXH 1CO1A 5C9KA 2KHAA 2A9CA 3MNDA 4PJBF 1ASPA 1A7OL 3AGWA 1KB5H 4JW3A 5E5MA 4YDJA 3ZRFC 4WGWB 1RKRA 3RVWC 2VSMB 3A3YB 4IK6A 3PGDA 4HUCA 1MCSA 2CLVA 3LZPA 1G6RH 1S3RA 2CO6A 5IVZA 4JPKH 1NEZA 4N9GB 4IOIB 1V7MH 1E90A 2B2XH 2R0WH 4PHZA 2DMBA 5J6HA 2VDPH 4FLOA 4CMHC 1J1XL 1RZ7L 4I5BB 4IKKA 2VUOA 3KPLB 3QCUL 1QBMH 4L4TE 4MZIA 4YHNB 1JZ8A 1WG3A 3CFEA 5DK2B 3OL2A 4IKLA 1EBPA 2FSDA 4PJHB 3GLZA 1EHXA 1NCOA 3FFCE 5D1ZD 3OLEA 3WNKA 4N90D 4CN6A 4HCRH 1QR1A 3F62A 4AIEA 3NIDB 4KQ3L 3CXFA 2X4NA 1XD1A 2V7NB 5ICXB 1PZDA 4KJQC 2HRLA 4U3HA 4MJ6A 1IGCL 2ORBL 2GIYA 5DURD 3TPUA 5B3SB 3QQ3A 5GGQL 3N1GC 1NM9A 3WO3B 1KXQE 3U46B 2GT9A 2DL9A 4U1SB 3AZUA 4F58H 1OZUA 1T0NB 4ZOAA 4CW1A 1AD0B 3EFDL 4AYFA 3SQOL 1DTUA 4ABVA 1BGXL 4JZOB 4TQ8A 3IJ9A 4H20H 4HS3A 1IT9L 1S9VB 4KK8C 4ETQA 4A2LA 2EDDA 4QHLB 3RBGA 1JNLL 4FFZH 5J12C 3FB5A 3T77B 3QUYB 4NN7B 1N64L 2VMCA 3SKUD 1G9MC 3NRFA 5JLZB 4GRWH 4YXLH 3AT9A 4MD5B 4Q0XL 4AQAA 4P2YA 5DFWH 5A40E 2H32B 3SYQA 5A2JH 3O2DH 4AYMC 5ESVA 4KQ4L 1ADQH 4WUUB 1HFUA 2VZVA 2ZPKH 1XH1A 4GUPA 4QWWC 3Q48A 1N7MH 4N9OB 1WP6A 2AEWA 1ZDSA 3CFBA 4JFED 4RNRA 2YRBA 4AQ1A 4KVPA 2W0FA 1OK8A 1AJ7L 3QZNA 1DZ0A 5JW3L 4K71C 4OD1L 1MRFH 4LSVL 4OIBA 4XVJH 5JW5A 3BUYB 4DKTA 5FUZL 5DURB 4WY7H 1NBYB 2QQNL 1LEIB 2PYEA 4A2GA 1TJIL 4QKXB 4I2XE 3Q05A 3PV7A 3K6DA 1QUPA 3JT0A 3VXSD 3VWKC 4NENA 1WBZB 3QUXA 5DEGB 2PXYD 3PL6B 1J18A 1GPOH 2W0PA 3BKYH 5HHVL 1FBIL 1M1XB 4AEEA 5JXEC 3SGEH 5E6ID 1C5DB 5DUPL 5CCKH 6TAAA 3VFPB 3H9SA 2Z3FA 5GS2D 4PRHA 2A6JB 1URZA 3B9DA 5F9WC 1ZLDA 1SBSH 2WMPA 3DX9A 4IOFC 4N2NA 3FFCB 4M1GH 4MMYB 3BC9A 4OLUH 4ZQKB 2P5EE 1TQCC 3OR7B 4X6FB 2VJXA 5L0QB 1VFAB 5LGJA 2Q86A 1FG2A 1HXKA 3OAYH 5KS9B 1UXLA 3FUMA 2R4SH 3AUWB 3IMUA 4W9ZA 5SWQA 4CMMA 3WFDL 1M9WA 3FOMB 3SKJH 1B4LA 4R2GD 1AGEB 3RURA 1R3IH 4HAKA 3GBNL 3P4MA 1O7DE 3WENA 3FQTB 2PW1B 1M05B 1ZLSL 2B14A 3NCFB 1RU9L 3W5MA 3QZWG 5B39A 5A2IH 2VXUL 1SYSA 2TRYA 3RVUD 4XPGL 4YHIA 2Z0BA 4N2IA 5EBWA 1XIWB 4AOFA 5I1HL 4HIXH 3T8XB 5L2JB 3GMLB 5KANG 1H8SA 3GJFK 1A1OB 4G9DB 2CO4A 4KI5F 1ZV2A 2XQYA 5HVFB 3RWFA 4W4NA 3E8UL 1JZ4A 3P69A 3O3AB 3MLTA 4PJAE 4Z18A 4OLXH 4RWHA 5FDYA 4AQEA 3KL0A 2VLRE 2W60B 2WVSA 5AL8A 5AVXB 3UO1L 4G7VH 3SDDD 4E5XA 3FCTB 5IBLC 3CLEH 5A7BA 5E2VH 4C57C 4X4YA 1OTUC 1OW0C 1P6WA 1USZA 1Y18A 2AEQL 5IQ9B 2ZUWA 3VE0B 4FHKA 1F02I 4HYTB 3WN6A 3GSNB 5GIRB 4BCXA 3JSSA 3AM8A 5LNGA 4B3EA 1ZANH 3TNMB 1D6EB 3NZHL 3QIUA 2ARWA 1ZJBA 4MA8H 2H9GA 1EGJH 2V7HB 5C09A 1ZLUH 3ISWA 2ROYA 2UWEF 1UHVA 5JPNB 3BP4B 2VH5H 1BJMA 2ZCHL 3HNSH 5ICZA 1EDQA 1MI5B 2WXHA 4IU3B 3Q3GA 2P1YA 5EC2B 1T83A 2ARJQ 3C8HA 3LN4B 2VZSA 1OB1B 3ROOB 1VKXA 1RUQH 3AAZA 1XXDC 4HJ1A 3L5XL 3N1QC 3TT1L 5EO9A 1J48A 1XF1A 4ZX6A 4G80A 2B39A 5HI3D 1OWRM 2AGJL 4YL4A 2Z93A 4IMLB 3FQYA 4FI7A 1A6AA 1OHZA 1ETZA 3FO2B 1BP3B 3UG5A 3MRKB 5C0CE 3HHMA 2OV0A 2XYBA 4BBWA 1YEGL 1CXEA 3D1MC 3RHWK 4AGLA 1FVEA 4DESA 2P5EB 5CEYA 5ITFB 4ELKB 3OKOB 2ZCKH 3AC0A 2G2RA 5HD8D 1CFMA 5SX4H 3L3OA 4BH8A 1XAKA 1HXMB 1M71B 3HAEB 1UJ3C 3CJJA 3C5SB 4HEPG 5C0AB 5I76A 3ZE2B 4AQ1C 1CD0A 3BQVA 3F2LA 1M6OB 2DQIH 4FQXA 5F7EL 2IOIA 2JIXB 1VZHA 2YO3A 2CMRL 1G87A 4MAUL 1AG6A 5F7AA 2YC1B 2LW3A 4X2UA 2APTA 5HDQH 1KLUB 2E9GA 2FEDC 1I9JL 5DD0H 5FYKE 4CU6A 1Q1JL 4N8VB 1R24A 3MRHA 1CI5A 5J1AA 4JM2D 4AXWA 43C9B 3L4XA 1G9MH 2DQTL 4HKZB 5DF0A 4ZX4A 1GXEA 4KH9A 4JMXA 4Q89A 1Y7VA 4BDVA 3M1BA 1WC7B 3HKZA 1HSAA 3PAVA 2NOYA 4Y4HB 4FQJH 4OCYL 2B3IA 4UF7C 3U6RA 3QK0A 4HCIA 1AH1A 1CTNA 4UOJA 5E9NA 3MNZB 1MVFA 4Z78A 3WG7B 5D55A 1PZ5A 4RA3A 3C75A 3IXAB 1OP9A 4KZEH 2IAMC 2PO6C 1FLRL 4R83A 1WSST 3SCMC 2L0DA 3NT0A 2G3ZA 2X0WA 3H6AA 4YR6B 5EFIB 1FNSH 5ACMA 3WL9B 2H2PC 1MRDH 2F18A 3C5JB 2QGBA 2XFXB 1T66C 2Y06H 3OX8A 1IGFH 5EHFA 1WPCA 3T0VA 3QRBA 4OV5A 1I8AA 4NI6A 1ZVHA 2LVCA 4HXBL 4HVBA 4N1CA 5FDWA 1BWMA 1NFDB 3FSVA 4XT1C 1W91A 2F1EA 1SRDA 5DK0A 2Q76A 4OIFA 5AYUL 4P23D 4OUUA 4XN7A 2EABA 3EBHA 5I18L 1BAFH 1TYJA 1AC0A 3GTTA 3OKLB 3EZ8A 1QNIA 2ZYHA 4J2QA 2ZKWA 3V95A 3FOLA 4O2CA 4A38A 3GZKA 1OAJA 1HQRA 4WK0B 3HR6A 2DMHA 2AQSA 4GPVA 1LO2L 5I8OH 4IIQB 1Z1WA 1YEKL 1J0YA 1WS8A 2BK8A 4LL1A 1T80A 4K3HA 3PUUA 1XGQB 3KDMA 2GCYA 1A7OH 3TC9A 4PY8J 3BZFA 3ARDD 1ZVYA 4JE0A 2EDKA 4YO0A 3BKJL 1V05A 4TVPL 5G5DB 4GAYB 2VDNB 4A7VA 1QSFA 5B3JF 2UY7B 4J2XA 4EXKA 3QQ9D 5BS0B 3TEZA 2BM3A 2PTVA 1E9PB 3N9GL 3PWNA 2DYSB 3ZUCA 3EFOB 1FNFA 3D48R 3T4AB 1J1XH 1KTKE 1RZ7H 3GINA 3L3KB 5AUMB 5GGRB 4BRJA 3QCUH 5CEXA 3SDCA 2X6UA 2ZTBA 3P73A 3U0TA 3QG6B 5JHDD 3ATBA 2XN9B 4W9KC 3S3CB 1HQ4B 4JHVA 2D8KA 3BVNB 3EUUA 1U36A 1LDSA 1JF6A 4DUXA 4KQ3H 3CDZB 1T83C 4LCUB