3IE9A

Structure of oxidized m98l mutant of amicyanin
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
105
structure length
105
Chain Sequence
DKATIPSESPFAAAEVADGAIVVDIAKMKYETPELHVKVGDTVTWINREAMPHNVHFVAGVLGEAALKGPMMKKEQAYSLTFTEAGTYDYHCTPHPFLRGKVVVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Amicyanin
publication title Defining the role of the axial ligand of the type 1 copper site in amicyanin by replacement of methionine with leucine.
pubmed doi rcsb
source organism Paracoccus denitrificans
molecule tags Electron transport
total genus 24
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2009-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3ie9A00
4PAZA 4YSQA 4G7QB 4F7KA 3OMIB 1MG2C 1BQ5A 2BWIA 3N55A 1OV8A 2PPFA 4K9JA 1AZUA 1J9RA 5I6LA 4BXSV 1ID2A 3S8GB 4G7RB 3MX0B 2DWSA 4JHUA 5I6OA 2BP8B 3QJSB 1E5ZA 1IC0A 3RYMA 1MDAA 3NT0A 2EIKB 2XX0A 3WKQA 2JKWA 1IUZA 4CSPA 4A67A 5I5MA 2XV0A 2FQEA 4HHGA 4YSOA 1I53A 4M4RB 4DP9X 1CURA 5FC9A 4HAKA 5F7BA 4HALA 4HHWA 5I28A 1PLCA 2TSAA 4HCFA 1VLXA 3FQYA 4ENZA 3FSWA 4EF3A 3N2JA 1UATA 1EHKB 5PCYA 1NDTA 2BW4A 1GYCA 3CDZB 4QKTA 1OE2A 3X1BA 5AZUA 5D4HA 1NTDA 3NJNA 2IDQA 2ZOOA 5I6NA 1TEFA 2XUWA 3NSFA 1GY1A 2EILB 3FU9A 2VW4A 2OV0A 3EF4A 1MZYA 1PNDA 3QJVB 1AACA 3FPXA 3UABA 2HXAA 4Q8BA 2XYBA 1E65A 2YXVA 3T9WA 1QHQA 3EH3B 4DPAX 5D4JA 3IN0A 1KDJA 4G7SB 4DP4X 1PCSA 4BXVA 5AKRA 3D12B 1WA0X 3TBCA 2IDFA 2AZAA 1ZIAA 1SDDA 2IWFA 1J9TA 2Y1AA 2MTAA 3FSVA 4G72B 1AZCA 2GI0A 1SF3A 3NJKA 1JVLA 7PAZA 4AX3A 1BXUA 3AZUA 2WO3B 3ABKB 5B1JA 1B3IA 1A4CA 4YSRA 3T6WA 2UXGA 4KNUA 3FU8A 2B08A 2PPCA 1AOZA 1OE3A 4P5SA 1KGYE 5ANHA 5TK2A 3KW8A 4YL4A 5B7FA 1URIA 2YAFA 4CSZA 4E9SA 2AANA 3L45A 4YSUA 1W6LA 2OCCB 2E86A 3DTUB 3UGEA 2QDWA 3S3CB 2GHZA 2YXWA 4BWUA 4GXFA 4YSPA 1WA1X 4WTQA 1AANA 1L9PA 2FNWA 1OCCB 2P80A 1AG6A 2DV6A 6PCYA 1BXVA 2TSBA 9PCYA 3NJMA 1CYWA 4AKOA 1NWPA 3FQ2A 2JXMA 5I26A 2XV3A 2XX1A 4KO5A 1ETJA 2W8CA 1BXAA 3NJLA 8PAZA 1A3ZA 4E9QA 4DP1X 1DYZA 3PLYA 5B7MA 3FSZA 3WIAA 3ZX1A 1RZQA 4AKPA 1AS6A 4BWWA 5I5IA 1ASOA 2FT6A 3CG8A 3FYEB 3JTBA 4KNTA 4P5RA 2LLNA 3OMNB 5A7EA 2CJ3A 1JZEA 3AY2A 3H4HA 2QDVA 3X2QB 1XB8A 1A65A 1SJMA 2N0MA 1SFDA 3NP4A 2CUAA 2GB2A 1JXDA 3IN2A 1CYXA 2BZCA 3PXLA 2CBPA 3AG4B 4A2FA 3EH4B 1AQ8A 1QNIA 3OQRA 3ZIYA 1KYAA 4BWTA 1ASPA 3OMAB 1PLAA 1SFHA 4KO6A 3S3DB 1OE1A 1EZLA 2J5WA 3ZDWA 3ERXA 3T6ZA 3X1FA 2BWDA 3NYKA 1TU2A 4E9RA 2EINB 1N70A 4A66A 2FT8A 1SHWA 3QPKA 4DP7X 2YAOA 3FU7A 1CUOA 1PNCA 2PPDA 2FWLB 1JXGA 4YVNA 1WS8A 3T6XA 3QJQB 3UAAA 3X1NA 1OCRB 3TASA 1PF3A 1NIAA 1KDIA 4E9XA 3GDCA 3NP3A 1F56A 3FPYA 2AZUA 2VM3A 1GS8A 1SDDB 2IH9A 3HEIB 1WS7A 3ABLB 1HAWA 4A68A 1V55B 1IKOP 2CCWA 2HRHA 2UXTA 3ASNB 3CZUB 3NJGA 2FTAA 4JKNA 4AI7A 4X4KA 1NIBA 2OJ1A 1JZIA 2VMJA 1BAWA 1NICA 3NSYA 3FQ1A 4AZUA 2XVBA 2DWTA 2X87A 1L9TA 3WNJA 4A2DA 3S3BB 1ET7A 3SBQA 2HLEB 4TXVB 1BYOA 1JZGA 2J56A 2R7EA 3WNIA 5I5JA 4HZ1A 3ZBMA 5B1JC 4DP8X 1L9OA 1ET5A 2PP7A 5TK4A 4N4YB 1XB3A 1NIDA 1ZV2A 2ZXWB 1ZDQA 4PCYA 3OD3A 1QLEB 1ASQA 1ZIBA 1ILSA 4A2HA 3G5WA 4KOBA 4E9WA 2UX7A 2IWKA 2PCYA 2PPAA 1PLBA 2BZ7A 2I7OA 1PZBA 4W1TA 2YAHA 4QLWA 4BK5C 2YAEA 4E9VA 5IY5B 1KBVA 2HZHA 2YAMA 1J9QA 1GSKA 3CVDA 4UANA 1JZJA 4DP0X 2P80D 1KV7A 5E9NA 3ASOB 3BVDB 2YAQA 1X9RA 2MRYA 5B1AB 1MG3C 1NPNA 1GS7A 1ZDSA 1M57B 3QJTB 3EHBB 5D4IA 2DYSB 4KOCA 3NJFA 3AG3B 1JERA 2IWEA 2YQBA 3TA4D 3QQXA 2UX6A 1SNRA 1NIEA 1OF0A 2PCFA 2Q9OA 1AIZA 3UACA 1CC3A 2H3XC 4GYBA 2IDSA 4Q89A 3SQRA 3TU6A 1FFTB 4A2GA 1BQKA 1AG0A 1E5YA 2GIMA 3FU7B 1BEXA 4L0PB 2YARA 4HCGA 2FQDA 5B1BB 2GBAA 3H4FA 7PCYA 1TKWA 2I7SA 3ABGA 3FT0A 5F7AA 1FWXA 3OM3B 4F2FA 2DY2A 4FAAB 2J55A 1GY2A 2QPDB 1HFUA 4UAHA 2VN3A 1ZPUA 2XXGA 1JZFA 4WKXA 1OCZB 1NIFA 1ILUA 2NRDA 3PAUA 1AS7A 2Q5BA 1N68A 2H47C 2X88A 4YSAA 2VSMB 1WA2X 3U25A 1M9WA 1JOIA 2VW6A 3C75A 1RZPA 4HCIA 6PAZA 2FQFA 5B3SB 2HX7A 3FYIB 3GXUB 2IAAC 5PAZA 1L9SA 2EIJB 3ABMB 1DZ0A 4MFHA 3WI9A 2R7EB 4G70B 2PP8A 2RACA 1NINA 4YSEA 1A4BA 3TBBA 2IH8A 4DP2X 1PAZA 4GP5B 4YSCA 3PPSA 2DYRB 3CVBA 1YLBB 3BQVA 1AS8A 5I6KA 1GS6X 2B3IA 1ADWA 1HAUA 3QJUB 2CALA 2PP9A 2XU9A 1T5KA 2XXFA 2GC7C 1J9SA 4KO7A 1V10A 3JT2A 3NJIA 2CAKA 1J5DA 2H5UA 1AZNA 5LDUA 2BP8A 5B1KA 2XWZA 3DIVA 3UADA 1IBZA 3X1EA 2IDUA 1A8ZA 1GR7A 2QPEB 4E9TA 2UXVA 1NPJA 2BHFA 1TEGA 3NSDA 5B7EA 4AKQA 4GP8B 2EIMB 2FQGA 4KNSA 1E30A 1W6WA 1BYPA 2YAPA 5AFAA 2AFNA 1X9UA 4YVUA 3S8FB 1AAJA 2I85A 2HRGA 3NSCA 2HX8A 1KCBA 1JXFA 4E9YA 4RH4A 2GC4C 3DKHA 1RCYA 1AR1B 1PZAA 2VW7A 5I6MA 3AG1B 3WKPA 3EH5B 4A2EA 3IBOA 1ET8A 3AG2B 4YSSA 2IDTA 3NJHA 3IE9A 1PMYA 3CDZA 4N8UA 3QJRB 1SF5A 1M56B 4DPBX 4F2EA 3AW5A 1NZRA 3GYRA 3X1GA 2JFCA 1KCWA 3CVCA 4GP4B 4KO9A 2Y69B 2VSKB 4FA7B 5EHFA 3HB3B 4UF7C 3FS9A 4DPCX 1WAEA 3SBRA 1XB6A 3UAEA 1PZCA 3WG7B 3KW7A 1W8EA 2FT7A 4NB7A 4YSDA 2AVFA 2XV2A 1FA4A 1V54B 3V9CA 1GW0A 1L9RA 4BDVB 2BP0B 4DP5X 1E67A 2UXFA 1OOWA 1SHXA 2J57A 2HX9A 4DP6X 1NWOA 1BQRA 1KBWA 4NAJA 1MZZA 4NERA 1AZRA 4HIPA 3PCYA 2FJSA 2W88A 2WO2B 1J5CA 2A3TA 3T6VA 2VM4A 1R1CA 2BO0A 4ZK8A 3IEAA 1JVOA 2PPEA 1AZBA 1PY0A 2WSDA 2ZWNA 5I6PA 3T71A 3H56A 4YSTA 3MBWB 2GSMB 2ZONA 3FSAA 2XLLA 2QT6A 3PAZA 4W9ZA 2PLTA 1IBYA 3SBPA 3V9EA 2BW5A 1OCOB 3NJJA 1XMEB 3PAVA 4GY4A 1A4AA 4BDVA 2BP0A 4M3HA 4JHVA 4G71B 1L9QA 1JZHA 1RKRA
chains in the Genus database with same CATH superfamily
1A3LL 4G7QB 1U2HA 3OMIB 3QFDA 1SBSL 3DK2A 3L5XL 4PHXA 2IBZX 3P73A 3VSQA 2O5XH 3AGWA 5I6LA 3TIDA 2O26U 3K72A 4GAYB 5JW4M 5L2KA 4OLEA 3EFOB 4QY8A 3EJJX 4WU7A 3TFBA 5EU6E 1DCEA 2FCBA 1JGEB 5BZWA 4MZIA 1UZ8B 5D96C 1PJ9A 1SY6H 2R56L 4X7DC 1OY3B 4IJ3B 3MOBH 4Z7NE 4NI6A 5GS3A 4BINA 4JFDD 3D4ZA 4M8QB 4JG5A 4PJCA 1AXTH 4Z7OE 5DK3A 1QI4A 3EYOA 1U3HA 4JFOA 1I8LC 1U8PA 5DZOA 2JK5B 1KN2H 2XTLA 3UZEC 4IEFB 5PCYA 1CLZL 3V0HA 3U1QA 3IMWA 5BPPA 2AJYH 2CMRL 3U46A 3ZE0F 3BYTA 3E3QC 3GF8A 3FN9A 4YXLH 4WY7L 4KH9A 3RAJL 2DMHA 3RDTD 2Q10A 3ZE1E 2EXYC 4PJBB 2KMWA 3PGDA 3DMMB 3VX0A 4FQIH 1WV7T 4S2SB 4NUQA 4NQDD 4AK2A 3O11A 4GMSL 3C8KB 3JWOL 1AJ7H 1RUPL 1RQ5A 2WVVB 4P2QE 1DQTA 3K0WA 4QRPA 4DP4X 3W3BA 4P05A 5L0QB 1S6NA 3BCDA 4K71C 1V5JA 4X7SL 2Y3AA 1V05A 3FSVA 4P9HH 3TXAA 1X5KA 1R5VA 4XI5D 5ENWA 5GRXG 5EH1A 4N2KA 4L3EB 4X9HA 2WO3B 1MFVA 3B56A 2WQUA 4JZNB 2W59A 2K1MA 3CH1B 1BEYH 4KK9C 1JXKA 4BJLA 3SGEI 4WUUE 5HDRA 2HMIC 5EPMA 4MJIA 4W6XB 4YL4A 4P3DB 2YZ8A 1BZ7B 4FFYL 5EU4A 5C09D 4CSZA 2AK4B 1Q9LB 4K8RD 4D9QE 3EJQA 1TR7A 2BH0A 5FKAA 4HP5A 4NRYB 2OCCB 1CE6A 3I3BA 1Y6NR 4U2YA 1DO6A 2VLLB 2WANA 1I1FB 4WTQA 4MZ2A 5D1XE 1PEWA 1AE6H 2WOBA 4FYQA 1OCCB 1OTTC 1QFWH 4LLUA 1YSOA 4RBPK 5EBMB 3U4AA 5J1SC 4K07A 1BXVA 1WZMA 4PG9A 1MEXH 2EEAA 2XZAH 2ROYA 2HG5B 2FD6H 4XVOA 4AKOA 5D7EA 1NDMA 4LU5L 4RRPA 4GKZA 3OPUA 4E9QA 2IOIA 1S46A 4XVUC 2GBVA 2XXMB 3ZZSA 1OZUA 2DIEA 3WL9B 5I5IA 2E6QA 4F91B 5JA9A 2WLLA 2O5ZH 3BESR 4KNQA 2ZWYA 4V1DB 3C6SB 4L4TA 2CUAA 3RKDC 3C5XA 1ZHBB 2YS4A 4X5PA 5T1LD 1DQJA 5A2FA 4YQXH 4PJEA 3IN2A 3GBDA 2BZCA 3AG4B 3VD7A 4N87A 2UY6B 4TNVK 4KKZA 1NGYB 3EOTH 4XNXH 5E00A 5F3HB 2DMGA 4OGZA 4YH6A 2V3EA 5DRZB 5ID1A 4BQCA 2Z92A 3RX8A 5EN2B 2E7LA 1X5GA 1RK1B 3BVXA 3O2DA 1D5RA 4CILA 2X09A 2Q86B 3VMOA 1ZV9A 4IBVA 2FT8A 4J3OG 4GO8A 5IQ7L 2ZYSA 4M7JH 4XWGL 4N8VB 3U4EA 2H6UA 3HLAB 3GI8H 4JE4B 1CUOA 1KJ2A 3P4NB 3IJHB 2UZXB 1UEYA 3WNLA 4H0HB 1WS8A 4H20L 4GRLB 2ITFA 4IGBA 5F96H 5H94A 5FM5M 3T6XA 1YJDL 2WJ7A 4U3CA 4X8XA 3VXOA 3S34H 3TASA 3R18A 2YXMA 1KDIA 4FE9A 1T22A 4JCWA 3CXFA 1SLUA 4GLRI 2JWYA 3VRIB 3S37X 4PS3A 4AQ1B 3EXLA 1ITCA 1IC1A 1PIGA 3O6FB 1IKFL 5GS2D 3U9UA 4OZIA 1HAWA 5CSBA 2PR4L 2YLHA 1QLFB 2AEPL 5L2JA 2FYYB 4Z7WB 5E6IB 2H0JA 4J3BA 5K5YA 4GUCA 2GJPA 2OZ4A 4JKNA 7CGTA 3X12A 1F4WH 3HAEB 3QO0A 4XXCA 5KJ4A 1ETA1 3MUHL 1YN7B 5K9QG 4ELMA 5FUCE 2A4CA 2VMJA 2FGWL 3MOAH 2VXUH 2V8LA 3BKCL 3NFSH 4QCIB 2VZSA 4Y4HA 3U0PA 4NQEE 3RPIB 3QUMA 4DETA 2FO1A 3I6KB 1FL6B 3OVUB 2D7TL 2WXFA 5C0EB 3D18A 4GXVH 2FUQA 3ULUD 1TDQA 5CUSH 2BVTA 4TSBL 4ODSL 5LHDA 2NSMA 3QAZC 1BM3L 5KJRH 4E42B 5JIMA 3OD3A 4LCYA 2AGJH 5AZEL 1NCIA 4GBXD 3Q9QA 3IU4L 3TJPA 2EABA 3KVDD 3PGCA 3EYUL 1PS3A 5HI5D 2XT1B 1FZJB 4M43H 1MJ8L 5J1TC 4Y0GA 5EULV 1RMFH 3VFPA 2A1WH 1UB5A 2FIRT 3GIVB 4N2GA 2X0UA 4JFPA 1G6VK 4QIRA 1RP9A 1OT2A 1XDTT 4FYTA 2FJFA 4XCEA 1PG7X 2V9RA 4LFHG 4LLYA 3RL1A 4TSAL 4UT6A 3QJTB 2NW2A 3DO4A 1NBZB 2XQBL 4GKSB 2IG2H 2EADA 1OGTA 3Q13A 2YA2A 5AB2A 4PW3A 5CSGA 2DLTA 2BCKA 4ZYKB 3EGXA 4H1LH 5I8EA 3RWCA 3RY6A 3TEWA 1QEWB 4ZMTA 5EU6A 2K3TA 4UTAL 5I16B 3QEQA 1UYWL 3BZFA 4HWZA 3IMTA 1SXNA 1EJ6A 4CVXA 1JNLH 2W9EH 1FO0L 5HJBA 3VGGA 1OP5H 5D55A 5D72L 3HMWH 3PGFL 3CDYA 2H3XC 4PMEA 1X7QA 4JQIL 2RH0A 3SPCA 1BQKA 4R26L 5AAPA 1NCHA 1QBML 1WUNT 5GGSA 3FUFA 3FFCA 4MNHB 4YNYA 5D7JA 5E8DH 2YARA 4UQAA 1RJZB 2HVKB 3OF6A 2P5ED 4JFTA 5F1SA 5DVMA 3EAKA 2H26A 5F7AA 2BY1A 4A39A 3FOMB 4LRNH 2ZUXA 3WJJC 5I18L 3S4SA 3VI3B 4PRBB 4CRPA 4F57H 5EEVA 3JXAA 4E0RB 1W91A 5BZDA 1CYGA 4KKBD 3CZKA 4OVUA 1DLFH 2J6EL 4J6RL 4OJFL 5E6SB 3D34A 3CXDH 3QPQD 2AEQH 1OCZB 2A4EA 3QA3B 1JNHA 4JFXB 1I1AB 3FO1B 1X5HA 3K8LA 3VGAC 5A6IA 3LKQB 4NQXB 3U0TA 1OVZA 3MZGB 1LK3H 5IHHA 4GAGH 4LHUA 4EO5A 1HVXA 1KN4L 1KFAL 3FTUA 1G9HA 3RWFB 3GMOA 4P2QA 1ZANH 2GITB 3N43B 1FNLA 3OMZA 4PCKA 3NA4A 2PWDA 5IZ7A 4Y8AA 3BPOC 1BWMA 2E27L 3MLTA 3WXWH 4GRWH 1CXEA 4PG2C 1KG0A 3EZJB 3QFJB 1E3FA 4ZFOL 1UD8A 3GJFA 3BZEA 4H25A 3CH8A 1KLUA 4UINL 1PAZA 3GKZA 5IEKA 2VDOH 4PGZA 4WUUA 3DRTB 4N1CA 4NT6A 4RRPG 3RA7H 1YLBB 4QT5B 3S37L 3MREA 1JGLH 4RZCA 5GS1A 1GS6X 5GGUB 1HHIB 3ZY7A 1HAUA 4ZD3L 1AHMA 2XU9A 1BD2E 4P2CG 5F9JA 4EN3A 1DDHB 3GSWA 1JL8A 2NDFA 1NBQA 3F83A 4APQA 4AWJC 1SRDA 1AYOA 3N04A 4KKNA 1T0MB 1DFBH 4WV1A 3WUWG 4HG4J 1OW0A 2WAQA 5F70A 3BVNB 2GY5A 1EO8H 1W80A 5HHQA 4Y5VC 1EA9C 4MTMA 4TVPE 4LSUH 4UZUA 4H0GA 1DN0B 2F53A 4NZRL 2GJRA 3TFKD 1KSRA 4OD2A 1E30A 1XGUB 4HMDA 3RHWK 1XMWA 3BKML 4MLSA 2YAPA 4DGYH 2NQDA 4HK0A 3N1PC 2OMTA 4OLVH 5DD0H 2XPGA 4AMXA 5F7YC 2P52A 2IH1A 4JJHA 2EO9A 2GEEA 4N0FB 4XMTA 4LVHC 2ADYA 4QHLA 1TO5A 2ATPA 5KVGL 1WP6A 4L8SC 5LBSA 4DPBX 2XA8H 1RZJH 4XI5C 5DRWA 1LEKA 4LF3B 1YEHH 2CZNA 4IBYA 5BVPL 4UQ3A 2JCCA 1MF2H 4FFVD 2ZCKH 3HBGA 4K7PH 4WFEE 3HNVL 3HC2A 3LRSA 1PG7L 1IAIH 4HSCX 3MODL 4K5PA 4RMTA 3QAQA 2WPGA 4M93B 1P4LB 1W9XA 2X70A 4NNYA 4F8QA 3HS0A 2VN7A 5CZRA 3QNYA 3ESVF 5IT2L 3H1ZA 5FK9B 4OZHB 1NMCC 3IS1X 4FD0A 4JY6B 5CBEA 1AI1L 3P9MA 2J12B 3EBAA 1EGJL 3G04B 4BZ1A 2KPNA 1E9PA 1V54B 4S0TD 4DP5X 1TQUA 5F7FA 2IV9A 1SDAB 5AW7B 1BAGA 1FHGA 3SPGA 2B1AL 4JQXA 1R0AH 2A3TA 3IDGA 1INDL 1OAXL 1MFDL 4O2EB 4QXUL 1RJYA 1DE4A 2CCLA 2X4NA 3RILA 3OKEB 1THCA 5TGBB 4XCYB 2OMVB 3ZSTA 1MREL 5I6PA 1IBGL 5CIPA 3JVGC 3MBWB 3JV6A 3OKDA 2OP4H 3K46A 5BW7C 3G5XA 5KBDA 1ZLVH 2KQMA 3C60B 2GUYA 1N10A 3P40A 2HKFL 2LU3A 4W9ZA 3GZQA 1F4AA 2SEBA 3IF1B 4NQEA 2BW5A 4Z76A 3NJJA 5A43C 4BDVA 4L1TA 6CGTA 5DUBB 3SYAA 3WFDH 2YIHA 4X9IA 1WEJH 3MLRH 1AGCB 2ENQA 2BWIA 2W65A 3B5TA 5AL0A 3GI9H 3QJXA 3IDIA 3KLAB 5I71C 3TT1H 5D5MF 1HWWA 3FO9B 1CJYA 2ADGB 5AALA 1H3PL 1C5DB 3B6SA 3F01A 4P4RB 2EIKB 4FG4A 4PJ5A 4QYAA 2Z4TA 3GRWA 5CCKH 3QVAA 2X4TB 1P6WA 3W9EA 1MIML 2DF3A 4TMPA 4NKOA 2XV0A 2W0PA 4PRNB 3B2UD 5BVJB 3RGHA 1S7UB 2BSDA 3O9WD 4HHWA 4RMSA 1BVNP 2G5RA 1RK7A 3BRDA 5TF1H 1PLCA 5A2KH 4ZO7A 5C0BD 2FR4B 1SYVB 3V4VA 1NCCH 1EHKB 2WXPA 2DDQH 3CDZB 4RGOL 3CFQA 3FQNA 3MLWL 3X1BA 1FLRH 2Y1ZA 5AZUA 1EQWA 1RIUL 4LOVA 1ZSHA 3VQ2C 3S4SG 4H8HA 5I6NA 3DUUA 4AEEA 3T65A 1XSOA 1MCIA 1IQDA 1YECH 1DHKA 2K4AA 3BC9A 1YC7A 1U41A 3U9PH 3LH2L 3SGEH 5EZLB 4Q52A 3V6FB 3DX6A 4BZ2L 3MV8E 3GRBA 3GSNA 1NFAA 3H9SE 2BPBA 3KLSA 6FABH 3TURA 3V7MA 2UYLA 4LLDB 5HHOD 5JIQA 2ZOKA 4JG1H 2QQNL 5DS8B 2X6VA 5AVUB 1CLOL 1CGVA 2O5NA 4HC1A 4LHUG 5IFJA 5EIVA 2VM9A 1SVCP 2QSCL 4B5EA 3LZFH 3B9AA 5BXFA 4TPRL 5HVHC 4X98B 2FJUB 1U4EA 2FB4H 4WW1B 5HHME 4L0ZA 4NYLA 4Y2DD 4RMRA 1AC6A 3AZUA 4DJMA 1JPSH 3ABKB 1X5ZA 3MJWA 2XG5A 4TLSA 3EOAA 4JB9H 2V2TB 4ZUVA 2DMBA 3GIZH 5E1GA 1FVCA 4AM0A 1OE3A 3BEWA 3L3HB 3BP7B 4AYBA 3QDMA 1GVIA 2RQ8A 1CBVL 2YAFA 4UBDD 5E9DB 3C2AH 4PWIA 5ESQB 4F58H 2W95A 3FRUB 5EC1B 3PJNA 2WXJA 1VEMA 3UBXA 5E7FA 1T1WB 3BDYH 1SJEA 1VRSA 2P9RA 1ZTMA 3UZVB 1Z9SA 4FTDA 1I1CA 4F15C 4C56D 1E9OB 1U4FA 1V8HA 3QFDB 2G2NA 3P73B 3NPSC 1J10A 1C5BH 3DUHA 1L9MA 3TIDB 5FYJE 1L0YA 3CVHA 5KZCD 1RURH 3EO9L 3K72B 3LEYH 5L2KB 1E50A 5I23A 5DR5L 3V4UH 3UPCA 5GS0D 2JJWA 4QY8B 4WU7B 4E9LA 5BZWB 1AS6A 1EJFA 1QSEE 3LQMA 4YE4H 5I1HH 4O02A 3JTBA 3SGKA 1HI6A 5IM7A 1SEQH 2WBJA 3AB0B 5T1MB 1JZEA 1KGIA 1KGJA 1BD2A 1U8KA 2LGNA 4N9OB 3IAPA 1SM3H 3UP1A 1X44A 3TCXA 1AFVH 4KH2A 4PJCB 1RUAH 1JFHA 5HJ3A 3EYOB 3WE6A 5ABDE 2IBZY 2XPZA 1U3HB 3HPLA 4GLRH 1U8PB 4JFOB 4MB4A 2DEYX 2QVIA 3F6IA 4MX7A 1TITA 2DL2A 2NSXA 5CS7A 3U46B 3ZXAC 3RJDA 3X1FA 1IM9D 1OGSA 3ECBA 1EDQA 3WE1A 2HWZL 1PBYA 3US0A 1UWXH 4W6WB 4FLOA 4YDNA 3ZKND 1T5WA 4KKAD 4Q6YA 3MCLH 3NIFF 2YD2A 3CN2A 3H0TA 3PGDB 1RPKA 2OL3A 1E4KA 1RZKC 5AOZA 1DBKL 1I9EA 3GBML 1FE8L 3WEMA 1X5AA 2QTVA 1UJ3A 2ZCZA 3EDJA 1KT2A 2RHEA 4GW4A 4QRPB 3U1PA 3NP3A 1F56A 5C0CE 3H7BA 1EZVY 4QI3A 3WNNA 4M7LL 4AIZA 3H2PA 5HHNA 2AJSH 2P24A 1R5VB 2QKIC 2NY0B 2QPUA 3A6BH 3HC3L 2Z1KA 5E51A 5ENWB 1W72L 4KKCD 5T3XH 2VN5A 1LO3L 1UENA 2Y2TA 5HPMA 3GLEA 2X1PA 3BDXA 4BUQA 2A9DA 3OX8A 3CFTA 4Y5XA 4ZDHA 3U7YH 3DBXA 3NFPA 5EPMB 3NSYA 4MJIB 4W4OA 3W82A 5EU4B 3AFLA 4OCXH 3WNJA 1U42A 3NGBB 1DVUA 4C4UA 2W60A 1HL5A 5FKAB 1CE6B 5EZJA 1Z5LA 3IWUA 4IDJH 3NA9H 2R7EA 1L9NA 2W1NA 3DYPA 3RWHA 4A6YL 2G3NA 4YO0A 4XOAA 1MFAH 4LLUB 4JKKA 1XEUA 1Y18A 4ODVL 2X44D 2ZXWB 2VZUA 2ENJA 4MXWH 4PCYA 4PG9B 4QAWA 5DMKA 4KXDA 5CR1A 5EIIA 1HINL 3LPWA 3SDCD 1X5XA 2OR9H 1DLHA 1NDMB 3G5WA 4DW2L 4ODHH 2JI3A 1N64H 1WTGT 2CUMA 4GKZB 5GGVH 2NX5E 2WXLA 2PYED 1MAMH 2WGXA 4Z1PA 4ZZKA 4HOXA 3RY5A 3HE6A 4BZYA 2NUPA 3BUYA 4YAQA 2WLLB 4R5XA 3PU7A 5E9NA 4L4TB 3LKSA 3RUGF 2QGCA 3V5HA 1DQJB 3BO8A 4EVNB 1JGVH 2P5WE 4PJEB 5DU7A 3HNTH 2DYSB 4ZTPL 4NKMA 4ODXA 4CA4A 1GKEA 5E00B 1CD8A 5DUPH 3VRLE 1MJ7H 4DVRH 1NIEA 3QEGH 3SE6A 5ID1B 5EU7C 2EXWD 5IB4B 4HLZG 2Z92B 3MACH 5FW6A 5D5ME 4TM9A 3BGAA 4JJOA 5F7UA 4EN2A 2RBLA 5E7BA 2WLIA 3LKOA 4GYBA 4Q89A 3VAEA 1RXLA 4B9KC 3D09A 3U4EB 1JYVA 2G60L 1NCUA 3SDXF 3ZO0A 1JYXA 1KJ2B 1SUHA 3IXAA 3TGXA 4JFYA 3T2LA 2N1KA 5H94B 4AIZB 4IGBB 4PWKA 3AU1A 1HS6A 3OM3B 3VXOB 3D0AA 3NAAH 4LDEB 3KL5A 3VNZA 2Y7NA 5CCGE 1T22B 3FDWA 3LNEA 4N2LA 2FHFA 2ZT9C 3WY4A 4F1SA 3TBVA 1AZVA 2R1XA 4R9HA 5FUOH 1ZPUA 2KQNA 4LPVA 5ADPH 1H0DA 1UGKA 4ZX6A 3ZQXA 3U9UB 4OZIB 1J12A 2CDFA 3P11L 1NIFA 5F1NA 2VLME 3K2UH 1K8IA 5DEFA 1HE7A 3UGXA 5L2JB 2XA3A 3MV8A 2HAZA 3H9SA 3X12B 4UDTA 1Q4NX 2IAMD 1QFUL 3QO0B 4K3JL 4ELMB 1CIDA 2LE9A 4E41D 4OCRL 2LOEA 5E6ZA 4KQ3H 4Y4HB 3NH7H 5GGSY 1MIEH 1OZTG 3QUMB 3NQIA 5IW6A 2KPWA 3B9KA 5B3SB 2EDOA 4G6MH 2IAAC 4GQ9L 1NKGA 3D18B 2DI7A 5DJYA 3UBXG 4MFHA 3VGBA 4F5CE 4XN7A 1JWMA 3CHSA 4S1SL 4P07A 4TQ8A 3B7SA 1B2YA 3MNMA 3S96A 4LCYB 4XE5B 1LDSA 2E7MA 3B2UC 3PGCB 1IM3A 3POCA 4XVSL 3O9WC 5DQDH 1E4XI 1KIQA 1TIUA 3EF7A 3HI1A 1HYSD 4DAGH 1O9WA 1F3RB 5C6WH 4FQ2L 1KYDA 2NR6A 4XNBA 3VFPB 1UB5B 2RCSL 1A14H 3FTGA 3RG1C 1XBDA 2G30A 4HUXA 4KRPC 4JFPB 1XGYH 1QNZH 5E2UL 2UY7A 2FJFB 3JT2A 4XCEB 2QQLL 2CAKA 1MAKA 3MROB 5TDOA 4LLYB 1NUDA 3RL1B 1WFNA 2A9ML 4QJ5B 5AOMA 2NW2B 2XJLA 5BOPA 4JQVA 1GR7A 1MN4A 4G8GD 3CHXA 1OGTB 3MV7E 5I8EB 1XT5A 2BCKB 3RWCB 3EGXB 4JRXD 4GP8B 5EU6B 5LBGA 3NQKA 4PPTA 4F27A 3BZFB 4HWZB 1QSEA 2ZF9A 4CVXB 1T4KA 4UNUA 4UAOB 4DHLA 4NGHL 4BUGA 4Q4IA 4Z7NB 3IPEA 4B7LA 1X7QB 3DKHA 1UD6A 1S7TA 1K6QL 5GGSB 3CLEH 3FFCB 4YNYB 4Z7OB 4P2OD 5D7JB 4OLWH 2IDTA 4NO0D 1PMYA 3RIFF 1DSYA 2XBDA 3HG5A 4Y16D 2GI7A 2H26B 3MAWA 4LLQA 3S4SB 2FH8A 4GP4B 5BZDB 1AC0A 4ETYA 2K6WA 1NFKA 2ENSA 4ZS6D 4UF7C 1BFOA 1VA9A 3ASWA 1Q9WA 3L95A 3V5DA 4UBDC 1BBDL 2V3FA 1JNHB 2EYRA 3CU1A 1HESA 4PJ8A 1RFDH 4CC0A 3U0TB 4JFED 4LHUB 1L9RA 2WN2A 1RL1A 4XPBL 4IBUA 2YRBA 4RMBA 3GMOB 3GDBA 4P2QB 4PUBL 2F7QA 4BE6A 5KVDH 2DM4A 5C0CA 1EEQA 3H55A 1GH7A 3DJSA 4OD1H 3MLTB 1JVOA 4K3EL 3SY6A 5I1CL 3C9NA 4AQZA 4BA0A 1P1ZA 4AQAA 1KG0B 3U1SH 4G59C 1DBJL 4NIKB 3FL7A 3GXDA 5GS0C 3WNOA 3L9YA 4LE8A 3GJFB 3L08A 4X9BA 5EO9A 4JO2L 2D9CA 3K74B 1I7ZA 4H25B 4AJYV 3BZEB 1KLUB 5IEKB 5EIIG 4HMEA 2R4RL 2PTTA 4BH8A 4WUUB 1Q1JL 1QYGL 3LH8A 4ZNEE 1G9MC 4NT6B 3M8OL 1OCOB 2BNRA 1XMEB 4FNLL 3JWNC 4U6VL 4XAKD 4TSCL 3MREB 4RZCB 2H9GA 5GS1B 3WFCH 3FQ4A 1IEHA 1RZKH 4EN3B 5F9JB 4Q9QH 3GSWB 3O4OC 3QGVA 3FUEA 1Y1DA 3DSFL 3NOIA 3DOIA 4APQB 5BO1L 4TLKA 4OIFA 4WV1B 2WC7A 1QSFE 4M5YH 4NWUH 3K6FA 4ZQKA 5HBBA 1LHZA 5HHVL 1B3JA 3U82B 1GTFA 2NXZB 1IFGA 4KKAC 2JKWA 5HHQB 2F5BL 3O8XC 2DLFH 2NX5A 5JR1H 4OD2B 2X4PA 2Y5TA 2XOTA 1ANUA 5F7BA 4ZUUA 1J9CT 2O6PA 4HK0B 2OMTB 4WEBL 3SO5A 2XPGB 2B14A 3T0AA 5GRJL 5ACMA 5AOJA 3MLZH 4IRSC 4UT9H 1A64A 4LP8A 2L7JA 1KBGH 1ZAGA 4QHLB 4J3WA 1O7DE 2F5AH 2P5WA 3DX1A 2ATPB 1D9KA 1P9MC 4JG0H 2VDMB 4ZO6A 5DRWB 1LEKB 2QELA 3DYOA 3HRZC 4PBDA 4UQ3B 1MXDA 2JCCB 3RUGE 2ORBL 4DQAA 3HZKA 1U8NA 3KWWA 3LRSB 3QNZA 2AK1L 1CXIA 5C7XH 5D5MA 3BT0A 3VFWB 1BG9A 5AAWC 4QWWD 3IFNL 4NNYB 2X70B 3FT2A 5D7SL 3HS0B 5HPOA 3QNYB 3SHSA 1DTUA 5CBEB 3RVXD 3P9MB 4Q0XH 1U6AH 2DQEH 1DJGA 2NUTA 3SKUD 5IESL 1E9PB 1J0HA 4PSRA 7FABH 2KL6A 2VL4A 2MCPH 5JTWA 2Y22A 3SDXE 2F6AA 4P5TA 3ZTNH 4F1ZA 3IDGB 3NJKA 3QDJE 4LO9A 3ZHNA 1RJYB 1DE4B 2X4NB 3G6DL 2YK1L 3SDCC 1R47A 4DOHE 2W38A 4UV4L 3AS2A 3SQBA 4GSDH 4NEHB 5B1JA 4NFBA 3QUXD 3CQFA 2UXGA 5CIPB 3H9YA 2VN4A 2PPCA 3JV6B 1A6VL 1Z7JA 3OKDB 5DD3H 2NYZA 1YAIA 2BSSB 3G5XB 4K3GA 3FBKA 3F3HA 2X3BA 3HNSH 2P8PA 3JVFC 3KR3H 4UZSA 1KEML 1X7SA 4WHYH 1RY7B 3QUZD 2SEBB 3GPSA 3GMPA 4NWTL 4NQEB 3DX9A 4Z76B 4IMLA 2DM3A 1A5FH 2B16A 3LXCA 4U1HA 4U1IA 1SY6L 2FNWA 4F5CA 1B4RA 2W65B 4OZ4A 2JELL 2JXMA 3IDIB 3QDAA 1ZJAA 2EXWC 3L6FA 3RIAK 2VXSL 1HCFX 4RGND 4NM4L 4DKDC 3TNMA 1UM6L 2O5YH 3E3QE 4PJ5B 3II1A 2D3VA 3QHTC 4LDLB 4RGMB 5B4MD 1OT4A 1Q9OA 3W9EB 3BFQG 3MNZA 4NKOB 3ATDA 3H4HA 2C3VA 1SJMA 2FX9H 4HUCA 4N2EA 3BZDA 1T7ZA 2J88H 4RFOH 1JXDA 1ML0A 3LVEA 5TE6H 3H53A 1IGMH 4JZJC 2XZQL 4BCZA 1FZKB 1W0YT 2CG9X 3BPLB 5I75C 5CEZH 2C3WA 3V4VB 1YNLL 4ZOAA 4JFHE 3KLLA 1QBAA 3C5SA 1ZD6A 3OGOE 1TZ8A 4TULL 1VGKA 3FQNB 2CR3A 4OBSA 3MV7A 4CDGC 1MCWM 4WI8A 2GFBA 4N25A 4DN4H 4XO8A 1X5MA 3GHEH 1RD6A 1M71A 3D08A 5AL8A 2HPOA 3DUUB 3T65B 1OARL 2APTA 2BIOA 4V1DD 1IQDB 3SE3C 3DX6B 4FA6A 5FV1L 3EYSH 3VYOA 4F8TA 3GSNB 1SZNA 1UH4A 2Y36L 2BNUA 3GLZA 3ZSSA 2UYLB 4G8IB 3LV3A 3WMSA 2ZOKB 3N1FC 4Y1AD 1CG9A 4N3UA 1U8OA 5IFJB 4LDOB 1A6WH 1HZHH 1MFUA 2WKLA 4MRCA 3VFNA 3TPKA 3TH3T 5BXFB 1EJ8A 4ODTL 4GSUA 1BVZA 1WLHA 3CBJB 4HUMB 1MCNA 3OAWA 4HIHA 2H1LM 4S1DD 1HL4A 2ZKMX 5C0FA 2R1YA 2XN9E 4NYLB 5EWIL 2AJ3A 1JHLH 1L6ZA 3DPBA 3SKOA 3ZE0B 2XG5B 1AD0A 2AAVA 2DQUL 3EOAB 4R97B 4ZUVB 1X4XA 2V7NB 3OWEA 4HJJL 4NFDA 2K0RA 1FVCB 4RMVA 2V6HA 5LNEA 4IRJA 3VFMA 4AM0B 3BEWB 2Q8AH 5BQ7A 3QDMB 2DH2A 4GEJA 4X6FB 3W56A 4AJ0A 1GGYA 3FCUB 4Q56A 1CPUA 2ZUQB 3OBAA 1FDLH 2R69H 5EOCL 3UBXB 5HYEA 1KTRL 1TETH 5T5FH 1SJEB 4MMZC 2FJGA 5E6ID 1Z9SB 1NAMA 1YQVL 4EPSA 1L9OA 2EUVA 5DURB 1R3HA 3OXRA 5JHDD 3CLFH 4Z78A 2O5ZL 3BZ4A 1OP3K 1MKFA 3SKJH 4A2HA 1F3JA 3LOWA 4KOBA 2YJQA 3CVHB 3QWOA 1ZSDA 2CK0H 3TO4D 2PPAA 1PLBA 4OM1L 1ZLUH 4A7QA 3TZVA 4JRYD 4YEEA 3D1MC 4FNPA 3BP6A 4FNRA 3Q2LA 1OAUH 4O02B 1AGFA 5IM7B 4LSQL 3F12A 4P2OC 2WBJB 4R90H 3SBWA 2VL5A 5ICZA 4XO9A 1BD2B 1U8KB 5HJGA 3KH3A 3O3UN 4NQSA 4MKTA 4Y16C 4PBVC 1PD1A 2B9BA 3KPSE 2EH8H 1R75A 1S5IL 2PO6A 5HJ3B 3WE6B 3VGDA 2BINA 1HHHA 1T1ZA 1O75A 3O6LL 4KJWC 3HPLB 3EJYD 3ZUCA 2XN0A 3IMSA 1JERA 5C2BL 1QFHA 1QSFA 4MX7B 4JKPL 3MLVH 3LB6D 1MFEL 1MWAA 2OLDA 1AGBA 3ECBB 4ZW3A 2GIXA 1JI1A 3BAEL 3BP5A 3UACA 3OSKA 4S0SD 5DYOA 2X6BA 5BS0E 1JPST 2JIXA 2X1WL 1T5WB 5BRPA 4ZTEA 5T1DH 3BX7C 4XPFL 2OL3B 4PRIE 3E6HA 4WJ5A 4NZJA 2YC1A 3PP4H 1G9MH 4X0NA 3KYKH 1WC7A 3JWNH 1FWXA 1UJ3B 2BOLA 1G4RA 2PF6A 5FYLH 4KKRA 1I9RH 5LGJA 1KT2B 4GW4B 4HYTB 4EI5C 1MPAH 1QX1A 3LKPA 3BH9A 4H1LA 3RUGA 3H7BB 4QTHA 2QHRL 2BVQA 2H6OA 2XQYA 2XTJC 3HG4A 2BY0A 3R4RA 4KBPA 1VGEH 1WSST 3UG3A 1C08A 5HHNB 2YKLH 2P24B 1OTUD 1PL3A 1WWAX 1KYOK 3NCJH 4I0PD 4UDUA 2DQCH 5HSFA 4GKNA 1YMMA 5K33A 2ROXA 1E4XH 4JHAL 4G7VH 5HPMB 5IWLA 3OX8B 4XTRD 4ZDHB 2DS4A 2W81C 4R5TA 3DBXB 1RZPA 3NFPB 1VJSA 2EDMA 3S88H 4OIAA 2WK2A 4BFNA 1WAPA 2IOOA 1L9SA 3SDXA 2EIJB 5L7XH 2AQ3A 1DZ0A 2MNWA 1NL0H 4U1LA 4PGDA 4XMWA 5EZJB 1Z5LB 2OI9C 3BPNC 1I1AD 2R7EB 3GS0A 3RWHB 4J8RA 2APWA 4UMSA 4K7PX 4YO0B 2W5PA 3U6RA 4OW6A 4HIXL 4MRBA 1Y18B 2BS71 2E0PA 5DMKB 1J8HE 5EIIB 5B22A 4Z3EA 3ARDD 2J71A 5I9QB 4KMLB 1DLHB 2CWRA 3QUHA 2DH3A 3Q6GH 1A02N 1D6VL 2QADB 4RWYL 3UIYA 4DGVL 3RLSA 2B3IA 3DARA 1G7PA 5E56A 2KYIA 3BOVA 3QXAA 5DFWH 3HE6B 3RB5A 3D05A 2NUPB 2OJEA 3BUYB 1JSYA 4YAQB 4OLUL 2R9HD 2WZ6A 3OPZH 1HIML 2ZQKA 2RAMA 2E9BA 2CNYA 1OSEA 1DSFH 3ARQA 3UTTD 1P7BA 4F7PA 5LDUA 3LKSB 4EBQL 3BO8B 4KX8A 2F2HA 1I8LA 4JO8A 3UZEA 5I76A 3A0OA 2R29A 1OT1A 2IDUA 1I1YA 4NKMB 4ODXB 3WFBH 4GFXA 3SKMA 1KJ3L 1KWGA 5B7EA 2BDNH 4DN3L 4YHIA 3SJVE 1KY7A 4A2MA 5AFAA 4QAMB 4N0YL 4F57L 3RVXC 2OW7A 3NTCL 1KB5A 5JIIA 5AVRB 2WLIB 3LKOB 3N9GL 4DO6A 3CFDA 1WAAA 2ODHA 3HN5A 3EGSA 3I9PA 4YSSA 3IXAB 4JFYB 3QJRB 3N41F 3INUH 1OGPA 3AU1B 1T6WA 4OF0A 1JGIA 2FNBA 1PZ2A 4M5SA 5IHZA 1KCWA 4Q6IC 1HOCA 2OYLA 3LD8C 3QUXC 1XCXA 2R1XB 2X1QA 3N1MC 2V17H 1B2WH 1WBZA 4JX0A 1XF2A 1H0DB 1QABA 1KV3A 1UFUA 2WB1A 2DW5A 2CDFB 3KYAA 2EO7A 2XY2A 5F1NB 1INEH 3GXTA 5DEFB 1K8IB 1YEJH 5BQDA 3QUZC 3H8NA 2ICCA 5IJDC 2DWDA 3MV8B 2KLRA 5CSZB 3ZMRA 3H9SB 1FA4A 4UDTB 3I74A 5H2BA 3V9CA 4JFDE 3QK0A 1Z1WA 1SHXA 3EHBD 1PX3A 4LVNC 1EZSA 4Y89A 2YZ1A 4HIPA 3I3EA 4WI5A 1J5CA 2ED7A 5IW6B 3B9KB 4PY8I 3T6VA 5DC0A 4PY8J 3SDDD 1R1CA 3Q8EA 4XT1C 2DQGL 5DJYB 3MGAA 2PXYD 3OC8A 3UIZA 4RGNC 1JWMB 2ARJA 5HHMB 5I2IA 2XN9A 2VDQH 3T71A 5EF0A 1NDGA 5F6IC 1T7XA 5B4MC 1UCBH 1D5IL 1QHPA 1ZTXE 3LNIA 3S96B 3FZUD 3H2QA 5JPMC 1D7DA 1CS6A 5E99H 1IM3B 2YRPA 5CN2A 4OCWL 1KIQB 4NC1C 4FLSA 3HI1B 1E2WA 1JZHA 1FL3A 2C9AA 4NQDE 2FO8A 2GJ6A 3FTGB 3GK8H 5HI4D 1OAYH 2Q0ZX 4HUXB 4RISL 4YGVA 2YUZA 2ED9A 3TVMA 2UY7B 4MAUH 2A6KA 5TDOB 2XFXA 4DK6A 3OB0H 4CGUB 4NP4H 1YA5A 4G7RB 3QIWC 2IQAB 1NCDL 4OSUL 5DHYA 1E5ZA 4UB0L 2V5YA 3GZPA 4PH8A 2WBWB 4XPTL 2FAUA 2XWJA 3IJ7A 4HULB 3EYFA 3NT0A 1MLCA 1MRCH 1I82A 2Z8VC 1TTGA 2HUEA 5D70L 5DJ8A 3S0PA 2XA8L 3SDYL 5D2LE 3M86A 1QSEB 4DP9X 5HVGB 4K2UL 1CURA 1T4KB 4NN6B 1YEKH 4KUZL 3L7EA 5C09E 4XB8A 1S2EA 3JV5A 3BUBA 5A1AA 3FAXA 3C09B 4TF4A 4FI6A 2B4CL 2VMFA 4HPOL 3KPSA 4JPWH 2EE9A 2AJVL 1HEZA 1BAFL 5F89A 4LOFA 4HWBH 1DQML 1UWYA 3D69A 1S8DA 4FG2A 4S1DC 4DTGL 5EZIH 3O2DL 1IB5A 5LNDA 3UO1H 4LLQB 3VFGH 2E8YA 4NJAL 5E1HB 1GMIA 1KJ2L 4H1LG 4UIKH 3NABL 4HS3A 2RJMA 4UM9A 1A6AA 1P84K 5DD1L 3EOBA 1BFOB 3L95B 3V5DB 1Q9WB 5BS0A 4N26A 4OKVA 2V9TA 3EDEA 1TFHA 2EYRB 2EXTA 1NGZA 2XYBA 3Q5YA 4ES9A 2Q3XA 2HFFA 4N2HA 1MNUL 1OQXA 4PJ8B 4PRIA 3ZDYF 5A2JH 3WENA 3ZGIA 4B60A 5D4JA 1BOGA 2UUDK 3PWLA 4GAFB 3SDAD 1PCSA 1V7NH 4WAFA 3T0BA 2G9HA 2IDFA 4HEME 3HOGA 4G6JL 3UCRA 4LAQH 1A7PL 2WWKT 4P5MA 3NMEA 5C0CB 2OZ4L 5E1IA 4DEUA 2JLLA 4HZAA 2Y72A 3CQPA 3TO4C 3C9NB 1P1ZB 4AQAB 3FUKA 2R2EA 3OAZK 2MEJB 4TUKH 4K7FA 4PRPD 3UFIA 3DIFA 1KGYE 4XRCA 4PVMA 3NRPA 2WLKA 4B53A 3REWA 1I7ZB 2X38A 2MQ3A 4XOBA 1U21A 3Q1EA 2C4XA 3TT1L 2PTTB 4BH8B 3KL3A 3VE0A 3S3SA 3DYMA 1QOKA 4H0IA 4L4JA 1AZZC 15C8L 5CCHE 2H9GB 4RMWA 2FECI 4U1GC 4YHLL 5JDJA 3IAQA 3MRJA 5KBMA 3EJYC 3K1DA 4AL8H 3GTNA 1THAA 4F7MA 2CNZA 5DUJA 1MCWW 1JFQL 4UTBA 3LMJL 3TEYA 1BVOA 1Z6JT 3NJLA 3II2A 1J8HA 4HWEL 2QMJA 1KCSL 4I18C 4ZQKB 1AHWC 3DV4A 3LS5H 5JMOC 1DBBH 4OZFH 1O6SA 2EZ0D 1XXFC 3SIKA 4NSKA 5A7EA 1UWFA 2NX5B 3UC2A 2X4PB 2XWRA 4IK6A 4UT6L 2Y5TB 5FF6A 2J72A 3ISRA 1HXMA 3L3IA 4ZUUB 1NMAH 4HDIA 4BCYA 1YECL 3LZNA 3PXLA 1X4ZA 3PXJA 5DMIL 2L7UA 1B4TA 3ULUE 2JNZA 1GKOA 2C3XA 2P5WB 5KTEH 1D9KB 2V5SA 5IFAL 5FHAL 3MBED 1VIWA 3OKMA 3WJJA 3VXSA 3KLHD 1NGPH 2I24N 4I0PC 3OB0K 3GSVA 2WZPD 3HZKB 2ZWSA 1U8NB 3NIGF 4W4NA 4IKNA 3KWWB 1NCAH 3QNZB 3SJVA 2ZAHA 5D5MB 1A7NL 3QPKA 1TVBA 4XTRC 4YX2L 4ZW6A 1PNCA 2Z35A 5IK3A 4NQCA 1ED3A 2FB4L 5CLTA 3K6DA 1BZ8A 1F58H 3FT2B 5CZVL 2Z91A 1FYHB 1E4WH 4FJYA 5FAAA 3FONB 2NUTB 4PRHE 3FU6A 3F7QA 4UYQA 4NX0A 4HJIA 1IGIL 1KPUB 1FZOA 2N4IA 2Y5QA 4YGAB 4P5TB 2NY3B 4IRZH 4U6YA 4UM8A 1XGTB 4H8WC 3ARDC 4PG2A 5DHMC 3BDYL 3ATBA 2CJSA 3SQBB 2UXTA 4F9PC 3ZDZF 3IXTA 4IKJA 1QBBA 2J1ZA 4M3KB 1RULL 5ILTL 4QRPD 1LILA 3QRGL 1YPZF 1G87A 2VWEC 3HS8A 5F7NC 2ZSWA 4J4PD 2P8PB 4B95C 1QWNA 5CBAA 4Z0BL 1RURL 2R9HC 2EE3A 3GMPB 3X3FL 5F72S 5F93C 3DX9B 4IMLB 2HTKC 1LXMA 3TNNA 4PJGF 1RUQH 2P5EE 5B38A 1JZGA 3FO0H 2R1WA 2OS7A 3DTDA 4Y19A 4U1HB 2EDEA 4U1IB 3RJQB 3V4PL 1P2CA 1YEGL 3D0LA 3FCSA 4G5ZH 2WIIA 1PU0A 4GAJL 4S1RL 4FADA 3VXQA 5HYJA 2MJWA 4ERSH 1QLEH 2ADJA 4OZ4B 1T5XA 1MY5A 3CXHK 3QZNA 2J1WA 5IOKA 2JXMB 3L6FB 3PWPD 5A2AA 1WISA 3TNMB 3GMLA 4HS6A 4Y5VA 1KY6A 2E6PA 3WSQH 2AITA 5CGYD 3K2IA 2NXYD 5HGAA 5I8CA 2YAEA 2YFOA 1KBVA 1G7QA 1RAMA 1CTOA 1Q9OB 2NDGA 1G9NL 2XHNA 3MNZB 4H0LC 4HH9A 4J12A 4OGAD 1B9KA 3PS6A 4DH2A 2C3VB 2G2PA 1MFBH 3ZHLA 4LESA 5LAPA 2MRYA 5AVQB 3UCQA 1QTYT 4LOUC 4FQJH 1H3XA 4FQPA 3IDMA 2YD0A 3NJFA 4L8SA 3D87B 3L9EA 3PJSA 3QIBD 5DQ9A 3WOVA 1FNSL 3MA9L 1R46A 3C5SB 2X28A 2ZOLA 3OB8A 4DGWC 1VGKB 2ZYIA 2E75C 4LSRH 3BGFB 4X6BA 3MV7B 5AB1A 4UCFA 1SOQA 1U8HA 2GFBB 4QUOA 5TQ2L 1DQLH 4L5FH 1M71B 1G94A 4GMTL 5I24A 1GZPA 3SQRA 3I9IA 2DBJA 2F1BA 2VDML 5C09A 3ULVD 3EHBC 2QSQA 4HV8A 4KDWA 2BNUB 3LV3B 5T3XL 4HS8L 3KPTA 1U0QA 3SDDC 4KMQA 1CG9B 4TTDD 4FAAB 1TJIH 1U8OB 1Q1PA 1KB9K 5T3ZH 5CJQH 2H45A 3VFNB 3UOAB 2OAAA 3BUIA 2HKAA 3PL6D 1E3XA 4PN6A 1YAZA 1PSKH 4WFGD 2IFFL 3MRPA 4HIHB 4KXCA 1LVEA 3FZUC 4WEUD 4ZMAT 1YNKH 1MI5A 2R1YB 3ARGC 2DKSA 4BZ1L 4PS8A 5C0FB 5HVWA 4IDJL 2AJ3B 1BJ1J 2FYVA 3DPBB 3JVGA 1U36A 3SKOB 4YSAA 2OCJA 4IGBD 1AD0B 5BW7A 2J7LA 2QTEA 3EH2A 4C4KO 4LASL 3VFMB 4IRJB 3BUPA 3LIZH 3PAYA 5HI4C 5IMKA 3ZE2F 1KELH 2WQWA 1DVSA 1MCEA 2XSKA 3DURB 1LNUA 3A22A 3NIFB 5LGHL 4Z3HA 1GJUA 1COBA 1FAIH 5T1LA 4F7EA 2R0ZH 3ZDYE 1A6PA 2RTTA 2X6AA 1MAML 3DUSA 1X9QA 2FJGB 1UWEH 1NAMB 3ILQC 1TZGL 4G70B 1AXIB 5BV7H 1J5HA 3TBBA 1NC4D 3CJJA 1R3HB 3OXRB 4P99A 1IT9L 1SHMA 1Z3GH 4Z78B 4GP5B 4JO4L 4XR8C 7TAAA 3BZ4B 4ZQTA 2CSPA 1VFUA 3QZLA 4Y4HD 4J3TA 2WVTA 3ARTA 5IQNA 1F3JB 3MUY1 4QTIL 4ADGA 1K85A 3QWOB 5IEHA 1ZSDB 4XAWH 5GRWA 2Z7ZA 5MEPA 4ZRGA 5EU7E 1KENL 3JTTA 1QPXA 1B4JL 3NCWA 2Z8RA 3D07A 3TZVB 4DKTA 5ACZA 1ADWA 5DZLA 2NY6B 3L3OC 3BP6B 4WGWB 4YDKH 1T5KA 2OMNA 4KI5D 1AGFB 5TFSL 3F12B 3KGTA 4UT7H 2VL5B 5ICZB 1H19A 2DOCA 2WUCL 4M5ZL 4OB5L 1CU4H 3WIHH 1XSIA 4A7SA 4NQSB 2FEDD 2KLSA 3DJRA 3IMRA 1Q72H 2VR9A 3DIVA 2GSGA 2PO6B 4MNGE 1J5IA 1HHHB 1T1ZB 4GW5A 1HEJC 3ZHKA 4ZMQA 3T2PA 5BUPA 1FNAA 1GMEA 1NPJA 1QSFB 2WCPA 1ORSA 1HCYA 2P4AB 3N1QC 1MWAB 1AGBB 3A4FA 1X9UA 1Q90A 5EZPA 4X83A 3BP5B 1CL7H 1KCBA 5DYOB 3U0WH 3V4VL 3LAFA 2JIXB 2Q3AA 3SDAC 1DQDL 3HHRB 1P5UC 3ZTEA 3IBOA 3HZYA 3E6HB 1C1EH 2CRZA 2QLVB 4WJ5B 2I5YL 2YC1B 3K4ZA 4OCSH 4LZKA 1WC7B 2K7PA 4P06A 5IBLC 3QEQD 4G6KH 3TBWA 5LGJB 3WY1A 3ALWA 3LKPB 3BH9B 5F7LB 1WHOA 5KSVA 4H1LB 3RUGB 1MIEL 5I73C 3RX7A 3GSNL 5EHFA 4QTHB 2BVQB 2YD8A 3MHZA 4LEOA 4I87A 1AR1C 3AWFA 4YK4B 1C08B 3FFCD 4UDUB 3KW7A 2M2DA 4HC1L 3RNQA 4GKNB 1GAFL 1YMMB 4A1RA 4GG6E 1HTYA 4WO4D 3L4ZA 3D4GA 3TM6A 2ODIA 4PRHA 1NGQL 4PR5A 5C0BE 5IJVA 2AC0A 2NLJA 3SDXB 1BLIA 1LO4H 5EA0L 1BCIA 3BKYH 4U1LB 4PGDB 1U58A 2Q1EA 2Q8BL 3QDJB 1PY0A 5B38G 2DTMH 2Z34A 4UUJA 5L8JB 4DOHB 2CDEA 3U6RB 4UOZA 4ZSOA 1G0YR 1BQLH 1BFTA 3GKWL 2EZ0C 3NZHH 2XQ0A 3LHPL 1L4IA 3LNFA 1LQSR 2VDRH 3WXVH 1U3ZA 3OAYK 4D0DA 3HS9A 4GIPD 2VC2H 4ZO9A 2EIEA 5D96B 1TQTA 1RKRA 3L54A 5HHOE 2AS5M 1G7PB 4PAZA 3F7PC 4IOFD 5TDPA 3MRCA 3I2CL 2CLVA 3JWOC 3QXAB 3WHXA 2JKLA 4KDVA 3R7RA 3SE8H 4G43A 2OJEB 4IU3A 3ZYZA 1G6RH 2NSQA 4RAHA 3CVHL 2PW1A 3MBEC 1SXZA 2VUYA 2EC9U 2ZCHL 3KLHC 4K7PY 4G9DA 4F7PB 2NY5H 4KKPA 1XCTA 4JHUA 4PJGE 2Q3ZA 2X1XR 4WUUD 5EBLA 3VFVA 1DJXA 5I76B 1OWWA 2NPLX 2EUWA 1LE9A 4O02L 1I1YB 1MFNA 2WOYA 3SKMB 3GFUA 3TBYA 3QJHA 1MVUA 3S2AA 5HHXH 4EN3D 1MSPA 4TQPA 4YHIB 1S78D 3PDDA 4NI3A 5FC9A 4I9XA 2EDLA 4H4NA 1KB5B 4I88A 4JW3A 4ZZFA 5I8OL 2HRPH 4DKAA 4WKZA 3CFDB 2FBJL 2I60H 4DQOL 5J57B 2VDKB 1FIEA 3BDBA 2K9FB 3FTZA 1LP9F 4HVBA 1K8DA 3EGSB 1NC2A 3UTSD 5FECA 1TJXA 2RGSA 2YD9A 2CR0A 2P8MA 2F53D 2R0WH 3OKYA 4C56E 2ZXEB 3MLPA 5IHZB 4X6DF 1HOCB 4K71B 3DVNA 2EDKA 4UOW0 2EILB 3R19A 5DFTA 3O3DA 2QKIA 1WBZB 3C08L 3L4UA 3PP3H 1XF2B 3MTXA 3VXRA 2IPTH 1CQKA 1PKOA 1C8QA 4J4PC 4MCZA 3DWTA 4OAWA 1NCOA 1FAKT 1FV1A 2DQIL 4G6AD 1BLNA 4YWGL 2DWDB 2A5UA 4XVTL 4OQTL 1P7HL 4PWFA 2CO6A 4G8AC 4QYOA 5H2BB 4DPAX 1H6UA 5JYLA 1T2QL 1EDHA 1PW3A 4BXVA 3Q8BA 3JWNE 5GSRA 3VG9C 2J4WH 3CSBA 2Z31C 3G3LA 2R8SL 2YPVH 2AXFA 4KZCA 2HT3D 4A63A 5F97E 3MBXL 35C8L 2AAAA 4H8PA 3HLKA 2EYSA 4Q14A 2Z0UA 1N6QH 3LCYA 2ARJB 2XWCA 3NIDF 1A4CA 4YSRA 4FZEH 3KYOA 5I2IB 2XN9B 5D93C 4ZMVA 1YYLL 2B08A 4MLIA 3GMMA 4P5SA 1UM5L 1NDGB 2NXYC 1CICC 5F7KC 5FYKH 1ZA3A 1MRFH 3KJ6H 1UOKA 3QZPA 2HP4A 3B3IA 3S5ZA 4OGAC 2BVOA 2ZKXA 5H35A 1J7VR 3FC8A 5JQHC 5B8CC 2P46B 4BWUA 4YSPA 1JYWA 2F61A 1FL3B 4BSJA 2DLFL 2P80A 2YGOA 3QIBC 2DV6A 3ZE2E 4YGVB 4OUOA 4HPHA 4YN3A 3T2NH 2OSLA 3HB3D 3TVMB 1J1XL 3CBKB 4Q9CA 2A6KB 3VW3L 2XFXB 2M83A 1T21A 4LCCC 4GI6A 5DHYB 1T03H 2X9XA 1OQOA 3QCVL 3S6CA 1A3ZA 1F4YH 3MLZL 3F7VA 3UP6A 1KBGL 2XWJB 3MJ6A 3EYFB 3FSZA 1MLCB 1RZQA 2F5AL 2Y4SA 4Y7MA 4QHKJ 1KLGA 2VGLM 5DJ8B 5MENA 5ICXA 5CEXA 3DX2A 1XEDA 5AVYB 1TLMA 1UT9A 1XB8A 2Y3NA 5D1QD 3L7EB 3T0ED 1EHLL 3EJSA 3MDJA 4KKLC 3HR5A 5DT1H 3WO4C 1J0KA 3T4YA 3KPSB 3KJ4C 3PL6C 4PJ5D 4MNGA 3VH8A 1J0YA 1HEZB 3MGTA 5F89B 2CQVA 3D69B 1S8DB 2VITA 3IMUA 5L88L 3NYKA 5K1VA 4WUKL 1A6TA 1T6VN 2X12A 4A66A 3WTYA 1UA3A 4DWHA 1ECYA 4JDTH 4UOJA 4HS3B 4UM9B 3KEDA 1A6AB 2Z7UA 3EOBB 5BS0B 4UYPA 2PYEE 4MCMA 5I1EH 4OKVB 2CE6A 2X1OA 1IRAY 4QHUA 1JV5A 1NGZB 4JVPA 4W6YB 2HFFB 1FFNA 3JQOB 4PRIB 2ZSVA 4AENA 5L9DL 1LTXA 3L2LA 1I75A 4KVNL 1BOGB 3A4DA 3PWLB 1A6UH 3Q06A 3FQWA 1F3DJ 2GHWB 4GT0A 2VM3A 3PABA 2G9HB 5E5LA 1MUJA 2D7OA 2J8UF 1WS7A 1FLTX 3ILEA 4Y9CA 4UOW1 5G4NA 4P5MB 3C2SA 4Y1SA 2ZXBA 2VR3A 3QYCA 1A5FL 1CGTA 2FTAA 3QAZB 4ZFGH 2WXHA 3TN0C 1K5WA 1TT6A 4POUB 2R2EB 4K7FB 3FUJA 3DIFB 4F33A 5LXGH 3REWB 3FTVA 4WZ9A 1OPGL 3O9WA 4HWUA 3VE0B 3K71A 2OMBA 3S36L 4AY0A 4KVCH 2AF2A 1HDMA 2OKMA 1ET5A 3MRJB 1ZV2A 1IGCL 4F7MB 4LNRB 1ASQA 3SCMC 1OANA 3QDMD 1TQCC 1SBSH 1A7RL 4U1NA 3L5XH 3OAUL 4L8BA 4E9WA 2IEPA 3FF7A 1J8HB 1JN6A 1L0XA 4FNUA 1XQ4A 2K7QA 1D5XA 3DV4B 3L1GA 4HA1A 4WW2C 4YUEL 1O6SB 5D2NC 1FP5A 3BEVA 3P77A 1N5YL 4NSKB 1XGZA 4LQ1A 3VGFA 5HHOA 1KV7A 2R56H 4E41E 4U33A 5FF6B 2F54D 1YPZA 1HXMB 2JI1A 2WBXA 2YAQA 3L3IB 5T5FA 3QXTA 4HDIB 5B3NA 1C9SA 3ROOA 5FYJL 2ILLA 1QMUA 1Q0XL 3L8QA 3V52L 4O9HL 4X6EA 4QOKA 2PCPA 2WXRA 4KTYA 4PJGA 1FN4A 2Y6TE 1SNRA 3T77A 5IIEA 3OKMB 4JN2A 3VXSB 3V0IA 4DUXA 1CLZH 2ZJSL 3MJ9A 4J6IA 2H32H 1N59A 2WTPA 5IVZA 2CMRH 3GSVB 4ZOBA 2E6JA 3EJZD 4K5MA 3SJVB 5K93A 5I15L 1S7XA 4GXUN 4WY7H 4WO4C 2OTPA 3RAJH 3CSFA 2E4FA 1T66D 1TVBB 1BZDA 3V0GA 1NSNL 5IK3B 2Z35B 1ED3B 3VGAB 2GBAA 3AABA 3CZEA 3G5YA 2Z91B 2P7TA 1JAEA 1DBAL 2HTLD 3FT0A 4I9WD 4XHQA 2VJ8A 4TVPD 4KJQD 3BWSA 4WI2A 4GMSH 3JWOH 4C56A 1RUPH 3RX9A 5CEYA 2X0WA 1LP9E 2VN3A 2NNAA 3PFUA 1FZOB 4MA7L 4HISA 5DVPA 5I1KL 4YHZL 3UPAA 3BPOB 4G8GE 4U6YB 4UM8B 4X7SH 4GINA 4AITA 1UB6A 4B9PA 3VXMD 5GGVY 3W5NA 3KM1A 2ICWI 4JRXE 1AS7A 4X6DE 4U49A 3IGKA 3IXTB 1UA6L 2ICWJ 4PJDF 2VSMB 4RAUA 4ADJA 1WA2X 4JPSA 1YRKA 1OB1A 2JKNA 2Y9RT 4MCNA 3C75A 1S9KC 1FPTL 3ZK0A 1XXDC 4FJZA 5J8OA 3PPEA 3SKJL 2ZSWB 1RIHL 3S97C 3VMPA 3L1OL 4PWHA 5CBAB 4FFYH 1QQDA 5F9OL 3VD9A 4QJ4B 4EQ2A 3CFMA 3TNNB 3O2VL 4FULA 3Q5OA 5B38B 2A83A 2R1WB 4HOMA 4Y19B 2LQRA 3WDHA 1P2CB 3D0LB 3FCSB 2WIIB 2E74C 2AHIA 4HLEA 3VXQB 5HYJB 3IPBA 1NAKL 4LCWE 1IM9A 2ADJB 1T5XB 4JEGB 5KAQF 1S78C 5J56B 4P46C 4NCC2 2MCMA 3RDTB 4JY4A 3NIDE 3Q3GA 3GMLB 4HS6B 4LU5H 4Y5VB 4ETQA 3O8XA 1RZ7L 2JSFA 5DQJA 3WEBA 5I8CB 5HGAB 4IYKA 4P3CL 4G80A 1G7QB 4MCYA 2J8OA 4HH9B 4JFEE 1F41A 3Q2VA 4X4YA 1DANT 1LL1A 1LO0L 4IRSA 1ZPLA 1MHHB 2BP8A 5LKNA 1ZS8A 3X11A 2ZX6A 4LVHB 2D0GA 4N68A 4L37A 1Q0YL 1P9MA 2UZPA 1ZGLM 1JD7A 2UXVA 4L8SB 1M05A 5DQ9B 3PJSB 2BXZA 4EQ3A 2BMKA 3U7WL 3RB7A 4KROC 3PP4L 3VH8G 3HRZA 2DQTL 2ZOLB 3AT8A 3IGLA 5CP3H 3UYOD 3HE6D 3WHE0 3DJTA 3IE4A 2XTJE 1U8HB 5FYLL 4G6AC 3APFA 3NSCA 3DHJA 5GSVA 4WK2B 1FIGL 3ROLA 1GZPB 1HKLL 5AAWA 4NQUA 5JPNC 3SKNA 4XAKE 3GO1L 2DEXX 3AG1B 4N2DA 4X9GA 5C09B 2DM2A 2GTWA 1NMCB 4HV8B 5IQ7H 1BYNA 4XWGH 4XHJD 4OIBA 3BVTA 1M56B 4YS4A 1UOVA 3VWJD 3KCWA 2VAJA 4H20H 4YZWA 2OSYA 1YJDH 3FOLA 3VSTA 2YMXL 4LXFA 3BIBX 3TIEA 4EEEA 3HW7A 5I74C 3SDCA 5KSBF 2UZIL 2VZ3A 3MRPB 3BRGC 4O5LL 3KHOA 1IKFH 1WGVA 1MI5B 3ARVA 4OF7A 2GCYA 1H8LA 1QO3A 1A3QA 2PR4H 1G43A 4NS0A 2PYEA 2AEPH 2HT2D 2AVFA 1HCZA 4BUHA 3VFUA 1OOWA 3ZL1A 5IMKB 4E68A 2JB5L 4A7TA 2FGWH 4JHWL 5JQ6L 5FO8A 4NRXB 2BS8A 1LNUB 1BG1A 3HB3C 5T1LB 4F7EB 2X6CA 3EYQD 5D71L 3FUDA 1WBXA 3MRLA 3VB8A 1QRND 2PPEA 2D7TH 3DUSB 3HJEA 3KLKA 2XWTA 4UQ9A 4TSBH 4ODSH 3QDHA 3WJMA 2J8UE 1GZQA 2VDLH 2ZONA 1OK8A 5I71B 1BM3H 5JDSA 3UEZA 3QB7C 2RA1A 1J88A 5DO2C 5IEHB 5AZEH 3PAVA 3WDIA 2OMXA 2V2XA 3IU4H 4GSQA 4QO1A 5D1QC 5MEPB 1B90A 5TD4A 3JTTB 3EYUH 3T0EC 5DJ6A 5ACZB 1CFNA 4UQ2A 5E5MA 4Q97A 1MJ8H 1T6BX 1ZVNA 3S35L 5D1ZI 3L48A 3N55A 3ARXA 4LVOC 4BXSV 2AV7A 4JZJA 4N5ED 5HXMA 3RBGA 1U3NA 2Y7MA 3II3A 1F45A 4N2NA 3LJ3A 5F8RC 2GSGB 1IM3D 4TSAH 1MDAA 4GW5B 3UPRA 5DZVA 2EVFA 2A4ZA 3ML9A 2XQBH 4QTFA 4AEIL 1ORSB 1VPOL 3ESPA 2WY3B 2FQEA 3PWUA 4UTAH 1T0NA 2VXQL 3WS3A 1VKXB 3SE3A 3A4AA 4B7IA 1D3CA 5I28A 3PFQA 5INDA 4E41A 1B0WA 1FO0H 1BMZA 1J11A 3FQYA 3UYRL 5CD5C 5D72H 3PGFH 4XB7A 4JQIH 4LARL 3HZYB 3F05A 3ARZA 4R26H 2CXGA 1QBMH 2ALWA 1OE2A 2EDJA 3B9VA 4QRRD 1DJZA 3IMVA 2MFNA 3R1GL 3TBWB 4ZX3A 2Z1PA 1CT8B 3UTOA 1H3VA 5KSVB 4RGNE 1RIVL 4A37A 5IMMA 3V95A 1KGUA 3FPXA 3L1FA 1A3RL 4I13B 4J6RH 4OJFH 2VXTL 3ILDA 1E65A 1SXCA 3RNQB 5CLWA 5IVOA 5C07D 4AG4H 1KIRA 3VGEA 4XXWC 4IOIA 2UWEF 2WLYA 3GXPA 1UCBL 4UQIM 2AZAA 4NC1E 1KN4H 2IWFA 1BDYA 1KFAH 4PRHB 4G72B 1D2PA 4PR5B 5IJVB 3JWNG 2NLJB 1E6JL 2G3XA 4MMZA 4K5NA 1MRDL 1FBIL 3AADB 5AYTA 4AJWA 1U58B 4G8GA 3N41B 3CMGA 4UUJB 3D6GA 4PJ8D 2E27H 3ZJAA 2CDEB 1OAYL 4JRWA 4ZSOB 3VYPA 3JBG7 4JRXA 4X6DA 2F9BT 3NPSB 4V1DE 2ZUVA 2AXHA 2AANA 5AB0A 1NCTA 1T80A 3LH9A 4NQQA 4UINH 3GUTA 4QF1A 1NAML 4D0DB 1JJUA 3TTSA 1MRCL 3S37H 2ITCA 1GGIL 4P2OA 3A5VA 2MKWA 3MRCB 2CLVB 4Y1AE 3BT2H 3OZ9L 5TDPB 3WHXB 4OBRA 4ZD3H 1P69B 2D0FA 4G43B 4IU3B 4Y16A 2FHBA 2MH4A 2PW1B 5E6RB 4G9DB 2B9AA 4HAGA 3EUDA 1XCTB 4LCWA 4ABUA 5EBLB 3VFVB 1EEUA 3EJZC 1LE9B 2BNRD 4X7FC 3ZX1A 2NY7L 2D2OA 3VGHA 4KNTA 2LLNA 3TBYB 3QJHB 1MVUB 3AY4C 4MAYD 5D1ZC 3X14A 4LPXA 2N0MA 2HTLC 3NP4A 4JFEA 4HCRL 3J2PA 3BKMH 1IQWL 3P02A 2WM0A 4OR1A 4WKZB 4KJQC 4BKLA 1F3DH 1PCXA 2H2SC 2AQRA 4MB3A 1CCZA 1FC2D 1K8DB 3AM8C 1NC2B 1MWAL 4FZ8L 5FECB 3E2HC 4ORGA 2C1PA 4KHXL 5KVFE 5GJSL 5KVGH 2P8MB 3O6ML 2NX5D 4EI5A 5JHDE 4R5VA 3T6QC 3SQOL 5C0JA 4KAQL 4R6UA 4E9RA 3CCHA 4MB5A 5FIEA 3DVNB 3AXIA 4M48L 3MJ7A 3QC5X 3HNVH 4J7RA 2IOMA 3O3DB 4W9CC 2CRIA 2QKIB 2YAOA 1OOAA 4NBZB 2FK9A 2DEWX 1PG7H 4JRYE 2Q2EB 3VXRB 1IVTA 1KPVA 4XO3A 4OAWB 4MCZB 1BLNB 1EEYA 5IT2H 3DTXA 3CQQA 2CO6B 4NLHA 4QYOB 2DD8L 4PTUA 1AI1H 2Z9TA 4WWNA 1EGJH 2H2PD 3F04A 5GSRB 3OR7A 3P1VA 3FRPA 1J05A 4MNQD 1GS8A 1W0VA 3EDKA 2AXFB 5JA8B 3QUKB 3V0WL 5AVZB 2B1AH 5BUAA 1INDH 1OAXH 1MFDH 4TV3A 4QXUH 2JQAA 3ASNB 2EYSB 3HJ0A 4RNRA 1VESA 4AI7A 1JK8A 2AVGA 3KYOB 3RTQD 4FQQA 5I30L 3GMMB 1MREH 5ELIA 1LK2A 2JKRM 3ZN6A 1IBGH 1TXKA 1ZA3B 5KSBE 3B3IB 5C08A 2BVOB 5H35B 2NY3D 2HKFH 3L4VA 2WQSA 1MLBA 2VTFA 2A0LD 2OJZL 3C8DA 5I5JA 2FZ3A 2L4OA 2ZE0A 4WWKD 4PCSA 3ZDYB 2QQQA 3CPUA 1EEZA 5J13C 5TK4A 4IRZA 1QACA 2OSLB 5F88B 5CJ8A 1WZ1L 5DWUH 1T0OA 1GGBL 4Z7AA 4KHTL 4QRBA 2M8XA 5FM5O 4BFFA 2J8UA 1T21B 3GJEA 4HIJA 3QQ3A 4NUJA 2N7BA 4AZ8A 2E9WA 3F7VB 4HUUA 4ZMYA 2WWMD 4IMKC 2O72A 1H3PH 4ZPVB 4POZD 1KLGB 2AABL 5MENB 3OKNA 5ICXB 5CEXB 2XDHA 5ITBH 4NFCA 3APCA 4U1MA 4XHJC 1FVEA 1MIMH 3NSJA 4XX5A 4OD3H 5J6SA 2R29L 5KVEE 1EANA 1P7KA 4N3TA 1ZDSA 5HHPA 5IVNA 3VWJC 4KY2A 1QSZA 3HR5B 4FKKA 2X2UA 1F8TL 3RL2A 3T4YB 2NY4C 5FO7A 1F58L 5CWSA 2UX6A 4DGIL 4MNGB 4NUPA 5FHBL 3VH8B 3RU8H 3MGTB 1I7TA 4U0RC 1ZA6A 1CDHA 2VITB 1LLAA 2C34A 4Q6IA 4BFBD 1KB5L 4XNMA 3N40F 4XCCL 4RGOH 3QUXA 4JM4H 5FCSH 1CC3A 1A6TB 2VDKL 1RIUH 2HT2C 5E4EC 2OMWA 1PX4A 1ZLDA 5DVNA 4IQHA 1NQBA 4JJ5A 3LH2H 3QUZA 3THML 1EUTA 1ZGLB 1UWGL 2EDYA 3GHPA 3KBEA 3ABGA 3Q8AA 4QHUB 4BZ2H 2YWZA 1JV5B 5IF0A 1S7SA 2VWEE 4G1EA 1FFNB 4QMEA 3EYQC 2L04A 2ZSVB 4AENB 2N59A 2QQNH 3F00A 5FGCE 1BXXA 1CLOH 1GY2A 2E9IA 3FQWB 1UD3A 3UTTE 3W81A 1MVYA 1FH2A 1TG8A 3LEXA 3PABB 3CZFA 3AQZA 1MUJB 2QSCH 2WZ5A 2W9LA 2P1YA 4R7VA 3TYFA 3ESOA 1HQRA 1ESOA 2OK0L 4FCAA 4X8JA 4PJHF 1X5LA 2XG4A 2Y1VA 4XP9L 2BP3A 3NIGB 4HCIA 4F33B 5JPMA 4FF9A 5E5RB 2CUIA 3PWJA 2CKBA 3O9WB 3K71B 1CBVH 2BERA 3D4YA 4XCNA 1RZ8A 3P4OA 4GIOA 3Q0HA 3GEFA 1Z9OA 1DVYA 3MNDA 1BGXL 4N5EC 3NG5A 2IADB 5DC9B 4PU2A 2B39A 1HDMB 4KRPB 2UWEE 2OR7A 2XJKA 1OD7A 3SZKC 3I84A 1QBLL 2NY2D 1FNEA 3P0YL 3QIWA 1IAKA 1MHPL 3PPSA 2BVYA 5E70A 3NJVA 3EKCA 3JSSA 4U1NB 3B2VL 4FX5A 5TJWK 2GY7B 4L8BB 1G1OA 2XN1A 4HSQA 1HH6A 4S1QL 5DA4A 4ZJ9A 1AKJD 1VCAA 1HL8A 1JN6B 2N1TE 2TRHA 1PAMA 3EO9H 1D5XB 4TNWF 5DR5H 1MQ8A 3ZDZB 3BEVB 3P77B 4PJDA 5T1JA 3B1UA 1C5CH 5HHOB 3FB8A 4OTXL 2OSWA 5EV7A 4C47A 1JHKL 3RZCD 4Y1AA 1H5BC 4JMXA 3WKNA 4HJUA 1YPZB 4L5FL 4PLKC 4FXLA 3UJTL 5C70A 1IV8A 3ROOB 4PLJC 2WNGA 3AS3A 2XBZA 3PHOA 2V8MA 3BQUD 4X6EB 4ACPA 4ZUSA 1UZ6F 1WBYA 4QOKB 2PCPB 3FO2A 2BHFA 4OCMC 4PJGB 2ZWLT 3T3MF 5IIEB 4FTVA 3EO0A 4JN2B 5JHBA 4WSKA 1AIFA 4LSTL 1Y0LA 1N59B 5IVZB 4KK8D 4ECNA 3KDMA 3QC6X 2HRGA 5T3ZL 5K39A 4TRPL 1EO7A 1S7XB 3SYCA 2HWZH 1RJCA 2PO6D 2IALA 2HRLA 1KF9B 2HN7A 4ZUWA 1QRKA 4Z0XA 3G5YB 3WIHA 4EAEA 2IIJA 12E8L 5I1IL 2P7TB 5I5RA 1DBKH 3MNVA 1CGUA 2IC2A 1WO2A 3GBMH 1FE8H 3APMA 3L3GA 2ZUWA 4KO9A 5GHWL 4C56B 4MYWB 3LIZL 5CEYB 5JHDA 2F7RA 2NNAB 4MA8L 4EI0A 2ERJC 3K5RA 2FRGP 3L5JA 1S9WA 4OFQA 5KZCB 1Q8MA 1UB6B 4M7LH 3TO4A 2LVCA 4NO2A 2Y0SA 1X5JA 3HC3H 1A7BA 3BPCA 4JRYA 1WCBA 2BIMA 1W72H 4NB7A 4YSDA 4RAUB 4Q58C 1LO3H 3MRFA 1OB1B 4AH2A 2MKLC 3D06A 1NCNA 1ADQH 3RVTC 2X05A 3Q44A 4H88L 4H8UA 1W8NA 2B1OA 4X5LA 3DETD 1L0QA 2YSSA 1QQDB 2RR3A 4XAWL 3VD2A 4TVUA 3CDGA 2V9UA 4LL4A 1ZXQA 2EDRA 3F6LA 4QKXB 2KERA 2A83B 5CO1A 4HOZA 4MBRA 2WP3O 3C87A 1YMMD 3ENEA 3MYZA 3O4OB 4FXKC 5DZPA 2ITDA 4A6YH 5EIQA 1OALA 1KEGL 2LU4A 4EUPH 2QGEA 1CF8L 4Z5RA 4ODVH 1IM9B 5A6LA 4UV7H 4MAYC 4XZUA 2ARWA 2JV6A 4I18A 4ZXBC 5HDQL 5KSBA 1AHWA 1HINH 3UROR 2BRQA 4WWPA 4JY4B 3Q3GB 4DW2H 4ETQB 3O8XB 4MSWA 5DQJB 4ANVA 2E4TA 3ECVA 2FIKA 5JORA 1NCGA 4G80B 4MCYB 3TJHD 3KGSA 4XMKH 4UTBL 1FZMA 1MG2C 1TQWA 3WTWA 1OV8A 3WU1A 4HLJA 2VDNB 2YWYA 4JG9A 4K9JA 4NO3A 5DVLA 4X4YB 5AAMC 1HJBC 1ID2A 5FLUA 1HC1A 3ZE2B 4IRSB 1H6TA 2BP8B 3VWKC 4OF6A 1ZS8B 3X11B 3WEOA 4R4NC 3VXTA 1XCQA 4L37B 4AYMC 5K59E 2WNWA 3ALXA 1W16A 1KOAA 1M05B 4FI8A 1MNNA 4QRQA 2BMKB 4ZTPH 3GBLA 1RUKL 3HRZB 4I0PA 5CHNA 4PRPE 2DM7A 3M45A 1MCHA 3MUJA 1PVHA 4ISVA 3RWIA 1RLBA 2Z7YA 3ROLB 3QQDA 3DGCR 1M3JA 3SKNB 3V79C 1T83C 2H2PC 3CNKA 3ZR5A 1JTPA 5KJ7E 1G6RA 3KNBA 2GTWB 4AEFA 5LWYL 2G60H 4LPUA 1QW8A 4LHJB 4FC3E 4NZDA 4IKKA 2EVJA 5BUGA 3DJZA 3FOLB 2VW4A 3RTQC 2EXYD 5HY9A 1AGEA 5F7MC 1ONQA 3E80A 1PNDA 2CIIB 3MXVL 5F7WC 1OAZL 1JMXA 4WI0A 3SDCB 1AACA 3ARDA 4OLXL 1H9VA 2G5BA 3SGJC 4WW2F 4F9PA 4Q8BA 3W37A 2DMKA 1YY9C 2DMCA 2GCYB 1A4KA 1GPOH 4YZFE 1QO3B 4ZFFA 1FG2A 5ETUA 3CX2A 4L3FA 3U30C 2PYEB 3HBQA 5DMYA 2P47B 3EH3B 3MA7A 3VFUB 4BFKA 1IC4L 2H3NA 3VXUA 4HH8A 2OQJA 4WWKC 1QFUH 1A1NA 1NCJA 1SDDA 3EFDL 4K3JH 5D7LA 4QDGA 4OCRH 3OJ2C 2XKSA 4XX1E 3UTTA 4XC3H 4F37K 1DQKA 1ECZA 3QR0A 1UT1A 2ATKA 1WBXB 3MRLB 1G0DA 4J1UA 4GQ9H 43C9A 4BE5A 2MQ0A 1B3IA 3BWAA 2D8KA 3AUWB 2XWTB 2J1YA 5J0BA 2QGDA 4KK9D 2VOTA 5ANHA 2WWMC 3E6FA 5JMRA 4I3GA 1GZQB 4S1SH 1O7SA 1RZIA 2CGZA 1PD0A 3I9GL 4POZC 5JDSB 4WCYL 3TEXA 3KHQA 4NM8L 4UU9A 1KBPA 1OSPL 1TVDA 2E86A 2OMXB 2V2XB 4QO1B 2YA1A 4D0BA 3T04D 5DJ6B 4HBQA 1CFNB 4UQ2B 5E5MB 1UA7A 1AANA 1YEFL 2F19L 5I66A 3B7YA 1P7QD 2RCSH 2UWEA 5CU5A 3BUQA 5E2UH 1ZTXL 2AV7B 4JZJB 4FJ6A 2QQLH 5I75B 2HRPL 2WJ5A 2VDQB 3EJTA 1DYZA 2A9MH 4UNIA 4X8GA 4XVUD 4ZFZA 1QPPA 1ASOA 3TH4T 1LEIA 2AQPA 3MLSL 4GKLA 4NNPL 3BZ5A 2GJ6D 3PWUB 2AQNA 1ZHNA 2EC8A 3MLYL 4YHOL 4QRPE 2ZCLH 4U2ZA 4DFHA 4Y4KD 4JDVA 1T0NB 3TVMD 4M6OL 4ELDA 4Z8FL 3WS3B 5HDLA 1KC5L 3CMOL 4XNUL 3CPLA 1FNGA 4E41B 1AHKA 1J48A 5INDB 4NGHH 5KAQG 3Q1SL 1ZY9A 4JUSA 1J1OL 2P48B 2W91A 1RERA 2Y7SA 3O2WL 5F21B 3W2DL 1ZEAL 1I7UA 1PLAA 1K6QH 3SDDA 1M6OA 3FQTA 5IBTL 2B8OT 1TU2A 4N8CL 5AVVB 3AC0A 3OLDA 1IGJA 4QHNA 1TMCB 1UZ6E 5SX4I 5DJDA 4K8RL 3PWPE 4M1GH 3QORD 5IMMB 2PPDA 3FT9A 3T3ME 3ARGA 2BNQD 4YVNA 4CMMA 2A73A 5E8EA 2VR8A 4XBMA 1BBDH 4S10A 3X1NA 3D50A 4YL9A 1KIRB 2X7LA 4E9XA 4IOIB 4LGPB 1NANI 4R7NA 4XPBH 2NY2C 5E9AA 1A0QH 1XZ0B 2F18A 1LP9B 1CQYA 4MMZB 2IFGA 2DQMA 3Q48A 2HRHA 4FQCL 4HHAA 3CZUB 5ESVA 4G8GB 2DRUA 1A7OH 3HAEH 5AVXB 2OJ1A 3TV8A 1PZUB 5I1CH 1GW6A 5FGBC 4JRXB 4X6DB 4MJ2A 4ZI8A 1DBJH 4RVBA 4AT6A 5BO0D 5JZ7D 3MKKA 4JO2H 3AGVA 3ULVE 3RZCC 1M53A 2R4RH 5K9JH 4QF1B 3GUT