3IE9A

Structure of oxidized m98l mutant of amicyanin
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
105
structure length
105
Chain Sequence
DKATIPSESPFAAAEVADGAIVVDIAKMKYETPELHVKVGDTVTWINREAMPHNVHFVAGVLGEAALKGPMMKKEQAYSLTFTEAGTYDYHCTPHPFLRGKVVVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Defining the role of the axial ligand of the type 1 copper site in amicyanin by replacement of methionine with leucine.
pubmed doi rcsb
source organism Paracoccus denitrificans
molecule tags Electron transport
molecule keywords Amicyanin
total genus 24
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2009-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3ie9A00
2AFNA 1ID2A 3CG8A 3SBQA 2N0MA 1RCYA 2BP8B 2CAKA 2YAHA 5F7AA 5A7EA 3FU8A 3S8GB 1NPNA 4CSZA 2CALA 1DZ0A 2QDWA 2PPCA 1ZDSA 1W6WA 3SBPA 2YAEA 5B1BB 2BHFA 5TK2A 1NICA 1AS7A 3G5WA 2VM3A 1SHXA 2PCFA 3JTBA 2GB2A 1ILUA 4A2HA 4A2EA 1KDJA 1GYCA 2ZWNA 1BYOA 3IN2A 4W1TA 1KCWA 3MX0B 3KW8A 3UACA 4ZK8A 4F2EA 1QHQA 1CUOA 3H4HA 2YARA 1AIZA 4BXSV 5FC9A 4BWUA 1A65A 2NRDA 1NIFA 1PNDA 4G70B 4L0PB 3H4FA 1JZJA 1IC0A 2CCWA 5B7FA 3WNJA 1OF0A 2TSAA 3ZBMA 1BYPA 3NSCA 7PCYA 4YSOA 4BXVA 2HLEB 1IBZA 5PCYA 3X1NA 2WO3B 5ANHA 1DYZA 1AS8A 1AZUA 3CDZB 3S3BB 3NSFA 2DV6A 1OV8A 3OQRA 1SFDA 2FQEA 3TASA 4E9QA 3PLYA 3V9CA 4E9VA 3PPSA 1HAWA 4HCIA 2XUWA 2XXFA 4X4KA 3GXUB 4YSTA 4HHGA 3GYRA 2Y1AA 4DP9X 2GI0A 2PP9A 3NJLA 3SQRA 3WIAA 1E5ZA 1ET8A 4K9JA 3AW5A 4N8UA 1AZBA 4YSEA 1IUZA 2YAMA 3N2JA 2W8CA 2MTAA 1HAUA 2VSKB 3IE9A 5D4HA 5LDUA 2IDQA 1J9TA 2DYRB 3BVDB 2GIMA 4HCFA 4WTQA 4NERA 1JZEA 2AVFA 2XLLA 2OCCB 2P80D 3PAUA 5AZUA 1WA0X 3L45A 1ADWA 3FYEB 2H47C 4FAAB 2PCYA 3QJVB 2A3TA 1M9WA 1ET7A 4NB7A 2IDSA 1ASPA 3IBOA 1AACA 1M57B 3NYKA 2GSMB 1L9TA 1E5YA 2XXGA 3ASNB 4P5RA 2IH8A 1QNIA 3FU7B 3OMIB 1J9SA 4TXVB 3T9WA 1V54B 2AZUA 5EHFA 3WKPA 2YAFA 2BWIA 1OCCB 2XV2A 1M56B 3PCYA 2FNWA 1JZIA 1ET5A 2BWDA 1PF3A 2PPDA 3QJTB 1OCOB 2JKWA 3X1EA 4E9YA 2XV3A 3QQXA 1GS6X 3FQ2A 1MG2C 2HX9A 3JT2A 4YSDA 2B08A 4YSQA 2JXMA 8PAZA 3ASOB 2BZCA 2EIJB 2IH9A 1EHKB 2J55A 1R1CA 2FQDA 3NJFA 2PP8A 1GY2A 3OMAB 4DPAX 2MRYA 1V10A 3NJHA 1WAEA 1J5CA 2VN3A 3TBCA 2AANA 1J9RA 4GP5B 3ERXA 4A68A 2B3IA 3D12B 3FSVA 2WSDA 3DIVA 3N55A 4RH4A 4GY4A 5B1KA 4AKPA 2X88A 4ENZA 1SFHA 2AZAA 4P5SA 4YVUA 2H5UA 1W8EA 3S8FB 3FPXA 1A4AA 1OCZB 3NJMA 2QDVA 5I5IA 7PAZA 4Q89A 2IWFA 3SBRA 4AX3A 4JKNA 1OCRB 2YXWA 3HB3B 4F2FA 1A3ZA 1FA4A 5B1JC 3GDCA 1GW0A 3AG4B 1TEGA 3UAAA 4BDVA 2IWEA 2CBPA 4QLWA 1AZRA 1AS6A 2QPEB 1EZLA 4HIPA 4BWTA 3WG7B 1ZV2A 1PY0A 1MG3C 3EF4A 4PAZA 4DPBX 1X9UA 3FSAA 2PLTA 3EHBB 3ZDWA 2BZ7A 1SDDB 4DP1X 1NWPA 4UAHA 1CYXA 1OE1A 1F56A 1UATA 3AY2A 4DP0X 1BXAA 2XU9A 1XB8A 4QKTA 1GR7A 3DKHA 3FPYA 4KOBA 1QLEB 2HX8A 1GY1A 2ZXWB 1BAWA 1FFTB 1CURA 5B1AB 3ABGA 2JFCA 3HEIB 2CUAA 2W88A 1JVOA 4YSSA 2PPEA 3WI9A 2VMJA 2UXFA 3NSYA 3T6VA 1MZYA 2CJ3A 2H3XC 3QJSB 1RZQA 4WKXA 1A4CA 4DP6X 6PAZA 2BW5A 3X1FA 2FT8A 4M4RB 4BDVB 2PP7A 2I7SA 1NIDA 2VM4A 5I6NA 1KDIA 5I26A 4JHVA 2DY2A 1JZFA 2PPFA 2YAQA 1XMEB 3PAVA 3NJIA 1AZNA 1E67A 2FT7A 1PLBA 3AG3B 4A2DA 3NP4A 2FJSA 1AR1B 4A67A 1JVLA 2LLNA 1IBYA 3AG2B 1SDDA 3ABKB 2TSBA 1NINA 1HFUA 1BQKA 1JZHA 1KCBA 1SHWA 4G7SB 4KO6A 2DWSA 1KBVA 3OD3A 4N4YB 1KV7A 4GYBA 1PCSA 1AAJA 3FU7A 3NP3A 5D4IA 3WNIA 1VLXA 2I85A 4HZ1A 4BWWA 4YSPA 1GS7A 5I28A 3QPKA 4YSUA 5B7MA 2VSMB 2RACA 3IEAA 1AANA 3ABLB 4UF7C 4PCYA 4Q8BA 1CC3A 4AI7A 2YXVA 1CYWA 2FWLB 2HRGA 1J9QA 5B1JA 3H56A 4YVNA 4GP8B 1WA1X 2DWTA 2IAAC 4KO7A 2UX6A 5I6PA 1SNRA 3T6ZA 4G7RB 5AKRA 1JXFA 4DP7X 1B3IA 2YAPA 3C75A 3EH5B 1BXUA 3RYMA 4KNSA 3CZUB 3UAEA 2J56A 3QJUB 1J5DA 1XB6A 1KGYE 2OV0A 1W6LA 1ZPUA 1A4BA 1WS7A 2EIKB 4E9TA 2Q5BA 3NSDA 3ABMB 1OOWA 2HX7A 4HAKA 1BQRA 2FT6A 4M3HA 3WKQA 1ETJA 2HRHA 1URIA 3TU6A 2GC4C 1NIEA 1L9RA 3FYIB 1PAZA 1PMYA 4YSAA 1GSKA 3BQVA 4E9WA 1PNCA 5TK4A 5F7BA 2UX7A 1PZBA 2QPDB 4AKQA 1T5KA 2XV0A 2OJ1A 2R7EB 4AKOA 5I6KA 3FSZA 1NWOA 3FQ1A 2DYSB 1XB3A 3UGEA 3X1BA 1OE2A 1NZRA 5PAZA 2ZOOA 4HCGA 3FSWA 3OM3B 4E9SA 5I6LA 1WS8A 3FQYA 1L9OA 5I6MA 2Y69B 2UXVA 3PXLA 4G7QB 2GBAA 3T71A 1ILSA 5I5MA 5IY5B 1PZCA 2J57A 2YAOA 3CVBA 3NT0A 1PLAA 4KNTA 9PCYA 3X2QB 2FQFA 1JXDA 4G71B 1AZCA 4G72B 1ASQA 1JERA 1X9RA 4HHWA 1E65A 1TKWA 6PCYA 2J5WA 2BO0A 2XWZA 2FQGA 1NTDA 1WA2X 1RZPA 1TEFA 2UXGA 4NAJA 2XYBA 1BEXA 1AQ8A 1A8ZA 1ZDQA 1BXVA 2BP0A 4A2GA 1ZIAA 4DP4X 3FU9A 3FT0A 3CVCA 5I6OA 4KO9A 1SF3A 5AFAA 2XVBA 1BQ5A 1ZIBA 1JOIA 3UABA 3T6XA 1L9SA 3T6WA 1E30A 1N68A 3ZX1A 2EIMB 4YSRA 2X87A 2VW4A 2PPAA 1AG6A 3UADA 4BK5C 2BP8A 4DPCX 3NJKA 4DP8X 1PLCA 3TA4D 1NPJA 4FA7B 4A2FA 3NJJA 3S3CB 4DP5X 1OE3A 4JHUA 1N70A 5B3SB 1PZAA 4W9ZA 2XX1A 2HZHA 2BP0B 2XX0A 4A66A 2E86A 4UANA 1TU2A 3X1GA 3EH4B 2WO2B 1KYAA 3IN0A 1KBWA 3FS9A 4YL4A 5D4JA 3DTUB 3PAZA 1V55B 3QJRB 2HXAA 3CDZA 5B7EA 2EINB 2BW4A 4GXFA 4AZUA 2Q9OA 3EH3B 2GHZA 2ZONA 3MBWB 1L9QA 3NJGA 5E9NA 4DP2X 1MZZA 4CSPA 3NJNA 3ZIYA 1ASOA 2UXTA 1AOZA 2R7EA 1YLBB 3KW7A 4F7KA 4EF3A 4MFHA 3S3DB 1I53A 2IDFA 2QT6A 3TBBA 1AG0A 4YSCA 2VW7A 1L9PA 4GP4B 1JXGA 3U25A 1SJMA 1GS8A 2GC7C 4E9RA 1IKOP 2P80A 3OMNB 4E9XA 3AZUA 1MDAA 1FWXA 4KOCA 5I5JA 2YQBA 2IDUA 2VW6A 1NIBA 2FTAA 3QJQB 3V9EA 1NDTA 1SF5A 1NIAA 3AG1B 4HALA 4KO5A 3CVDA 2IWKA 1RKRA 2EILB 2I7OA 4KNUA 2IDTA 1JZGA
chains in the Genus database with same CATH superfamily
4RSYA 5I16B 3N1FC 2B7DT 1P2CA 4JZOA 3NA9L 1FFNB 4OLZH 4YC2B 1CFVL 3WS3A 3HG1E 2CDEB 4LNRA 4XHQA 3LZRA 1HZHL 4GO6B 5AENA 3I75B 4LHQB 4F8OA 2JI1A 5T1DH 1BQUA 3DDFA 4XCYB 4PJGA 5AQ0A 1OP5H 4A2EA 1FC2D 2Q8BH 4GRLB 1UXWA 1KMGA 2WTOA 3QEQE 1V7MH 4GKNA 4H5SA 2YUVA 5E1HB 5AZ2H 2OJEB 1AE6L 3K91A 5F9OL 1PIGA 5I0VA 1R5VB 1PKQB 4GFTB 1T03H 2Z93A 2FB4L 1Z6JT 2CCWA 3ULVE 2OSYA 3W0WB 1COBA 4XXDA 3IMBA 2FH8A 2EE0A 3FF8A 1WWCA 4BXVA 5CLTA 4K7PY 4Y5YA 2WO3B 2YRLA 4AGNA 1NBVL 1XO8A 3E0GA 3MLVH 3WMPA 3O0LA 4CAGA 3EO1B 3NSFA 5GGRB 2CG9X 3HG1A 1LEKA 1CDBA 2AXFA 4K15A 5TPWH 4IBQA 5D7JD 3BUDA 4KITB 1JTPA 5GISH 3TURA 4E0RB 3WEXB 1Z9PA 2R56H 5EZOH 5CKGA 3LY6A 25C8L 2GJZB 2XXFA 4HIXH 3E3QE 4HHGA 4JJOA 4QPEA 4P5KA 3HI5H 4DP9X 1TPXB 5E2WL 1AFVH 4C56E 1N0XL 4AK2A 2FWOB 5KSAA 3W2DL 4NRXB 2BY2A 3QUZD 4WW1A 1L0YA 3O6FB 3QEUA 4FE9A 3BVDB 1BBDH 3PABB 1E9OA 2OSXA 2ARWA 1ERNA 3DX0A 2E27H 4QT5A 2Y07L 3MRCA 3B1TA 3GSXA 5DJAA 1WA0X 3QXVA 5ANMB 1L6ZA 2H47C 2ZWZA 4PJXB 5E6IB 4K9EL 1M9WA 5DTFB 1WAPA 5ADPH 2WXMA 3HFML 4DK3A 3OKOA 3WXWH 5FDWA 2ARJQ 2KZBA 1TVDA 4Y9FA 3EJYC 1THCA 4WRLA 4L4TD 5LGHH 3CNKA 3HVNA 5I1IH 1I1AC 2BSBA 2AZUA 5TJWK 3SO3B 4M8UA 3ZGIA 3F85A 5KG9B 5DHVH 1EBAA 1JZIA 3QORC 4R8WH 4PS8A 5AZEH 3ZQWA 4N68A 1VPOH 2B1HH 3AS1A 3T1WA 4JE0A 4CADB 1WFOA 2Z6FA 1ZHNA 3UZQB 3BAJA 1KIRB 4L3EB 2ICEB 5FOBB 1CD8A 3MRMA 1TITA 2BOLA 4WTXA 2K8QA 2D3LA 3GMRA 3N3EA 5G55A 2AXJA 2MKWA 3H9HA 1G7IA 4H8QA 3D12B 3WDJA 1NKRA 4CU7A 3N41B 3N85H 5D2NE 4CC1A 3TT1H 1R4XA 4HCRL 4UOW1 1KWKA 1OQXA 3IGAB 2R0LH 2XTJB 1WD9A 3R1GL 1OCZB 3QUXC 1AFVL 3O4LA 1AGEB 3LPPA 3ZRCC 3AGVA 1XL4A 2VXQH 4GKLA 4Q89A 4AQOA 2XWJA 3ZRSA 4O02H 4WHDA 1MQ8A 5BV7H 3ULVF 2BY0A 1DQVA 3QRLA 4CVXA 4AX3A 2R56L 2YD1A 2X1QA 3HB3B 4I2XE 1D5RA 1YY8A 5BPPA 1GW0A 1JPFB 2WVUA 4HISA 4O4YH 1A4KB 2NXYC 4YDJB 3F7VA 1NSNL 3TIEB 5B8CA 1AZRA 3OLGA 4YPJA 3WE6B 4PG2C 2NNAA 4KI5C 4P5TB 2EYRA 3RG1C 2OZ4H 4M1CD 4JPIA 2ARJA 3CVIL 3UTZA 2O6EA 4UB0H 1CFTA 4RX4D 2NQ3A 4X7SH 4LT7A 3EHBB 1BLNA 1DZBA 5DVNA 3D25B 3VSVA 1CYXA 3K3QA 2NR6D 2YFNA 4PJCE 4RGNC 3ZTNL 4M1DH 3D69B 5CD3B 3K6DA 3ZKND 3J27A 2N3JA 1QSZA 3IMSA 1Q0YL 3WXVL 2VLMD 4WO4D 5F7UA 5JW4Q 5C8JB 1J5HA 3P4OB 2QGCA 4H8VA 3F62A 3V5DA 2GEQA 3GSRB 3L81A 2BLFA 1XF5A 2E9BA 1TT6A 4NAQA 5TF1L 5AAMC 2GYSA 2XZAL 3AUWB 3VRJA 2WLLA 2OMUA 2UXFA 1IAIH 5DZ9A 1MZYA 1MFDH 1F1GA 1D5IL 5GS2D 4KK6C 2DRUA 2XC8A 4BDVB 4M5ZH 2OXHA 3GUTA 2VLKE 4DETA 2VM4A 3HA0A 2Y36L 4TPRL 1H15B 2WLJA 3FCBA 3S8WA 4XCNA 1K8IA 3RWJB 1GPOL 5IGXL 4JCWA 1MCJA 3H6AA 4P2QB 3D4CA 5HYFA 1HX0A 3V10A 1QA9A 4QF1A 1BFTA 4IOSA 3D51A 2H41A 4HX1A 5ETUA 1D5BB 1CGVA 3DV4A 4Z7WE 1NINA 5D1QA 2VXUH 3OAYK 1DSWA 2OW6A 1UD3A 4OKDA 4P23A 3VXSE 4AK1A 5E08L 3B1UA 1NA8A 3J7HA 1PY9A 1EHXA 3QDJE 1QKZL 3K6SB 5JDSB 2W1NA 3J8F7 2E9GA 3RILA 1XR8A 4L37A 3SO5A 4UYPA 4XMLL 5KW9H 1AKPA 3QPKA 3HC0B 5T5FL 3EOYG 3MACL 2DLHA 1TJIH 1SYSA 3IDGA 4JJHA 5HGBB 1I8MB 1FG2A 4N2DA 1C8QA 15C8H 3ROLB 4CKVX 1IL1A 4YVNA 3SOBH 1JWUB 3KDMB 3AT8A 4TL5A 4UM8B 3K2UL 2XKNA 3TONA 3FB5A 3EAKA 2FYVA 1J9CT 5FECB 1VCAA 4UYQA 4AIOA 3JQOB 4LCYA 4W4OA 3MBED 5DS2A 1P5UB 3GB7B 2Q3ZA 4ZW8A 3I02A 3RKDC 3RYMA 1ZTXE 4KNSA 4AJYV 3Q6GH 2EICA 2A73B 1TETL 3RWDB 4F1ZA 4RLDA 3CU7A 4U0QB 2ZXEB 1MCOH 3UO1L 3D18A 1VENA 1BZQK 2FT6A 3I3EA 4OB5H 3U30C 2B1AH 4EVNA 3WFEH 4FXKB 4ICXA 1G4MA 2BNQB 1S7UB 3BPNC 3GKZA 5F3BA 1Z9NA 1G9MH 2Y0SA 3GXFA 2XCMC 1KBGL 2FJFB 4DN3L 3TS8A 4FMVA 3KCPB 3Q8BA 1PNCA 5F88B 1WZ1L 2DQEH 4FQXB 1CZ8H 3RY4A 2YXMA 3QRFM 1M71B 4PWJA 4W81A 3GI9L 5G4MA 4LCUA 3BUTA 3K5RA 5K33A 2OTWA 2VKWA 4LPCA 3FSZA 1N7MH 2SEBB 3FQ1A 3QZBA 1F4HA 3JT0A 2XA8H 3V4PL 2BOBB 4N25A 4E9SA 3H0TA 2Q3AA 4KRNA 1OP3H 2VDOL 4ZG1A 1FYTD 3NZHH 1T04A 4M6NH 4XNZB 3ARBA 4TVPL 4B9KC 3RUGB 4DK5A 1IAOA 2FX7H 4LARL 1JK9A 4G8IA 4RVBA 3X2QB 4BSVB 5IKCB 2AXGA 3TVMB 1ID5I 4LE8A 1INDL 1MCHA 1IGJB 4PJ9B 4KVNH 2ZP8A 4N0UB 1TKWA 4U1IB 4U6XB 4UQDA 2EEFA 4YHOL 4I7ZC 5HVHB 3NABH 1QNZH 3CDFA 3WE1A 1A6ZB 1UA6H 4LGPB 3WUWB 3BIKA 4JFOA 3VXTB 3HRZC 3EGSB 3FFCA 3MLUH 5CJQL 2NNFA 3KNBA 5ACMA 1A6WH 1FL5B 1GZHA 1SBSH 4H0HB 4F33B 4MDJA 5JDJA 3GSUA 4ODTL 1OGPA 3TEWA 1E30A 5D72H 1N68A 2AQNA 2GSIA 3UPAA 4XB3A 1F2QA 3KPRA 1GZHC 3KYOA 3MBEA 3VD3A 2X7LB 3ML8A 3RVXC 4A37A 2CO4A 4JN1L 3VRIB 2OMYA 4N6RB 2MKLC 4ZPVA 5BZZA 4D8OA 4GAFB 4ZOEA 4CVZB 7FABL 1N70A 4HGWB 3WFCH 2OSWA 1TQTA 4KDWA 2E86A 3MXVL 1HH6B 4YGAB 2WO2B 2ZWKA 2VUKA 4HUNB 4LKCB 4NP4H 3QCTH 4I3SH 1C5CL 4GXUM 2P7TB 1QTPA 4GKZA 5IROC 3T2QA 4R84A 5FDYA 4PHZA 3WHE1 3WN5B 4AQAA 3IYLW 4LP4A 2QGDA 3OG6B 4XCFL 2YN3A 1AO7B 3RU8L 1L9QA 5ICYA 3SSGA 2ZWLT 4LPWA 4XX1G 1SXCA 3G5VB 4M93B 4Z7VA 3EOAB 4P05A 5LJYH 1KNOB 4JY5H 5F89B 4ZW3A 1O6VA 2VDQB 3WN6A 3MRHA 2VSCA 5E00B 3SCMD 4BYHA 2WTPA 1YUKB 3DO3A 4H1LB 4OQTL 1P4UA 1RURL 2F5BL 3T0BA 4BCYA 3BX7C 5FB8A 3GMNA 1TJXA 3F65A 2ITCB 5T3ZH 2DL9A 3TBBA 2XG5A 4YSCA 5EH1A 4GP4B 3CZLA 4J28A 1X5HA 2IALB 3OZLA 4IDJH 3U25A 2EH7L 2FIRT 1FZOB 1GGBH 3DPDA 4DFIA 2P80A 3GKWL 3UEZA 1G9NL 1Q9WA 2YPLA 3AZUA 1MDAA 7CGTA 4ORGA 1I8LC 2ESVB 3GF8A 1TUPA 1AZVA 1NIBA 2FO4B 2P4AB 3SY0B 5INCB 1XSKA 1VGEL 1RVFH 3C2AH 5CFAA 1HH9A 3F6LA 1L6XA 5LGJB 1I4FA 4PCSA 2A6JB 3X14B 2EILB 2B8OT 1GW6A 3S4SA 4P9HC 3GFUA 2I7OA 1I9JL 2IDTA 3DHJA 4IBSA 4EZKA 2V2TB 2EO7A 1BFSA 5DO8A 4Z7OF 1GJWA 4PM1A 3SBQA 2BP8B 2C4XA 5F7AA 3HG4A 4HUVB 1NM4A 3B5GA 1T7YA 2GJ6B 1P9MA 3GJFB 2QZQA 5FGCE 1H3PH 5B1BB 1WFIA 3HS0B 1CN4A 1FBIL 3LSOA 4KI5F 4MAZA 4YX2H 2X4TA 3NCJH 5ICUA 3RGVA 4H8WC 1QPKA 2IQAA 3V4LA 3ARQA 1NCJA 1KG0A 5C7XL 5HYQA 4ZO8A 3VXRB 3SOBL 2OR9H 1QSFA 3BZ4A 3SKUD 3UACA 4M7JL 5EUKB 4N9GB 1KLFB 4OI7A 2PYEA 3MXVH 1CUOA 2XQBL 1EUUA 1I8KA 3VE0A 3PJLA 1OSPH 2BSSA 2GBUA 5J11B 3T65A 1FIGL 4LLQA 5FC9A 3SQBA 5CEZD 2NRDA 3O2DH 4X5WA 4ETQA 4I88A 4MD4B 3FQXA 3HNSH 1AHWB 3UPRA 3HIZA 1KGJA 4MVBC 1MY5A 4U3CA 1UADC 2W92A 2FO8A 2WD0A 3MYJB 3U46B 2DS4A 2O61A 4QNPE 3FQTA 4F37K 4WVRA 3BFWA 3QYCA 1XV8A 4ERSL 2WKOA 1BMZA 4KQ3H 4PQXA 1P2CB 1XX9C 4E9VA 1EGJL 5IJCC 2RHEA 3JV6B 1OK0A 2F1EA 2EP6A 1NPUA 4WK0B 4YQXH 1JBJA 3NFNA 3CN1A 3VI3F 3P11L 3UZEA 2CKBH 3MNWB 2CO6B 3T0ED 3C5SA 1F4YH 5AAPA 3CHOA 4YSEA 3KLSA 2N7SA 2YAMA 2F53D 3B56A 1SXNA 2MTAA 1KYDA 2NNRA 5LDUA 2XKSA 3CFJB 4HCFA 2ATPB 2ICWA 4N22A 3OWRA 4DEPC 2OCCB 3FH5A 4Y2DA 4Y7MA 3ZT7A 2Z7WA 2ZUYA 2CKBA 1PKQA 3L4YA 4XVUD 2MNJB 5K9OB 4XODA 1N3NA 3IU3B 5DA4A 3VTAA 2NPLX 5BRZB 4LGRB 5ESQA 5DFAA 4JO1L 3MNZA 3ZN6A 3MGAA 3VMNA 5DJDA 1BEYL 2WXJA 1TXKA 2KL6A 3V6OC 5B38G 2YPKB 4OCLC 3MMEA 4N2CA 1S7SB 3HAEA 2G2NA 5TE7H 5D7HA 4JRXE 4S1RL 2XA3A 5AOKA 1KGCE 1QEWB 2AXFB 1FH5H 3MRIA 3U0WL 4HWZA 2VDLB 3VCLB 4E0RA 4HLZH 1K5NB 4HUMB 1ICTA 2JELH 2IQ9H 3BQUA 2JXMA 2NW2B 5KSBE 3CHXA 4JFEA 4O2FB 2VAAA 3VDBA 4PJ7F 1RUKL 2J55A 1NDMB 1U41A 4WW1B 1QSFD 2DQIH 3O6FA 4HS6B 1PKQE 4GBXD 3JUYA 2X2UA 2PYED 1R24A 2LTQC 3QR1A 3CDGA 3MOBH 3CLEH 4JO2L 1U93A 1S46A 2WIMA 5CMAA 5E6IA 1KB5L 4F8LA 2WGNB 1NCCL 1MCCA 5KVFL 1Z3RA 3KPOB 4BH8B 1MJUL 3MVSA 2HMID 4X0NA 3MV9E 3ULUL 3D0LA 2H32B 3FUNA 3BJLA 3OKOB 2OQJA 3NK3A 4FHBD 3BGFB 1AY1H 3GRGA 3M07A 4DVBA 3TJEL 3O6MH 3ECQA 3MGTB 3DIFB 3AG4B 1SYVA 2G4GA 4QNPF 3K71B 2E7BA 3OQ3B 4B9ZA 2WKOF 4MJIA 2GITB 2NT1A 4KZCA 1Q1PA 3S96B 3LKRB 1GOHA 3BP5B 2OK0L 3W37A 5L4FA 3VFUB 4KMTL 4DGIH 1YN6B 4I18A 3IFOB 5DZLA 1JRHL 1RLWA 1KIPB 2ZKMX 1HINH 1F3DH 1MAML 2H2SD 3CFIC 3AT0A 4PYGA 4YGVB 1RAMA 3H2QA 1T5XB 1NC4B 2ZUUA 2DWEA 4JFYA 3T2NL 4YHLL 4B9PA 1JV2A 1OAYL 1UWEL 2HRPL 4BD4A 3CQPA 4XPAH 1N9PA 3BWAB 3VWKC 3HEIB 1NGPL 3OAZH 4EN3C 2PXYB 2EIEA 3H7BA 4XC3H 1KB5B 3QJOA 4DEWA 35C8L 4NQQA 1Y7VA 3LDBC 5AW5B 2A9CA 2IVFC 1UQSB 1F1DA 4HKJA 2DMHA 3B6SB 1G6RL 4HA1A 2HUEA 4JM2C 4NM8L 2G30A 1RZKL 3VWKA 1WQVT 2XXMB 1XIWC 4FEMA 1OSEA 4PV9A 2RIKA 4ZTEA 1JTOA 5K9QI 4X7TB 1JV5A 4KKRA 3BQUD 1CIDA 3GMMA 1LE9A 2CU9A 1FNFA 3I9IA 5DZOA 1BV8A 4D3CH 1OXYA 3RDJA 1JVLA 1IM9B 2OTPA 4NQDE 2ZKXA 4M48L 4WUKH 5C0BE 3THML 1IBYA 3O6FD 1SVCP 3D25A 2H6UA 3FTZA 3FUFA 5DSCB 1P7BA 2LGNA 4QKXB 1DVFB 1SHWA 4P46A 1QP1A 2H9GA 5HI5D 3ZHNA 1G4RA 2DZEA 2XBTA 3P0GB 3IDXL 4PJGE 4KKCD 5DHYA 4AWJC 1GYVA 4HZ1A 3L3GB 4PY8J 2CHNA 2YGQA 3IM1A 5C0ND 5I28A 4WNQB 4ZFGL 1Q0YH 5GRWA 4CNIB 1I1YB 1IEBB 4NT6B 3SJVB 4A55A 1BWMA 4PCYA 3ZKSD 5H37G 3SKNB 1S5HB 3EJCA 3BRFA 2OZ4A 4Y19A 3NAAL 2UWEA 4G6MH 5CNHA 4BCXA 1H3WM 4G43B 1EJ8A 3GSOA 1OO2A 5JXAH 4YHMH 1E27B 1GGYA 5SX4H 5LAXB 4J7RA 1EEZA 4IBTA 1OB1B 3HLKA 2X10A 1KPUA 2W5PA 4ONGH 3K46A 2BFGA 3BVUA 3GK8H 2VDPL 1H15A 4RAHA 3JTTB 2VL4A 1UH3A 1YMMB 2BFVH 3QJUB 1OD7A 2XPZA 2Q2LA 2BOCA 5IMKA 3RDTD 2HVBA 4I13B 1C16B 1ZHKB 5HDLA 2K6WA 2NSQA 2Q7AA 4TNWF 1DBML 1TJGL 2PO6A 3EBAA 3KS0H 2PCPA 5FAAA 2WIIB 4WI6A 3JWDL 4HOXA 4QHMA 5MHSE 1XD0A 3MUZ1 5IOPB 4JQXA 3H55A 4W9DC 4FC3E 1WFJA 3V0HA 4NNYB 1IKFH 4FQIH 1D9KB 4G6JL 3TO4D 5JIPA 3UJIL 2E9IA 2FL5A 2QFPA 3OPZH 2PO6C 1ZSHA 5AZEL 1UM5H 1VRSA 4NYLB 3RVWC 3GS4A 1LHZA 3EYFB 3HCVA 1B0RB 2EEXA 5CEZL 4Z8FH 4IIZA 2VLJA 4HBCH 4U31A 2VISA 4POYA 3P0VL 3C08L 1I1AA 5JPNB 4LSSH 1KZYA 1A22B 2BHZA 5SWZB 3FB5B 3OM3B 1CO1A 4LL1A 1L9OA 1BPLB 2Y69B 4OCWH 5GIRB 3VDAA 1HS6A 2R0ZH 2XT1B 4XO4A 1NFIB 3F7RA 5EZLB 1U36A 2NX5A 3MREA 1PLAA 5JQ6H 4X42A 2H2PD 2FQFA 4DO6A 2V17L 5FGRA 3PIQA 3GJEA 1MIML 2E0PA 1XWVA 2JKXA 1CBJA 2JJSA 4IU2B 4QHKJ 4R4NC 3IKCA 3OXRA 4B5EA 4KXBA 1BBDL 3CH1B 3M45A 4AJ0A 5HDOA 3TEXA 1YCSA 2CCLA 2NY4B 4FFVC 1X5XA 4FYTA 1WA2X 1RZPA 2H3KA 1CICC 4LRIA 3QRGL 2YMTA 1AQ8A 5JOEA 1QLEH 2NY5C 5I17B 4WGVB 1A7QH 1ZDQA 1C5DB 5GGRY 1O7SA 4RIRA 1QASA 2FSEB 2GFBB 2JB6B 3SGJA 2BFVL 3DVNA 1A1MA 3FT0A 5I30L 3S3SA 2GCYA 3EYSL 4LVOB 1SBBA 3CVHL 4D8PB 1FNEA 3NPSB 3TA3C 1M71A 3DOHA 3KYAA 3RP1A 3UTOA 2P48B 2IBBA 2M83A 4A6YB 3II3A 1OSPL 3DRTB 1MJUH 1QSFE 1KWGA 4X98B 2H26B 5C6TH 2YUZA 3ARDA 1FZJB 2E76C 1RK0A 3TN0A 2XXCB 3CFKB 2OCJA 5T1LA 1F6AA 3QDME 1DE4B 1I3RB 5HYJE 4KZEL 5DT1L 4HPOH 1RULH 4PP1D 5EN2A 1CLOH 1ZOXA 3T4YB 4BV1A 5B3SB 5DK3A 1IAKA 4M6NL 2EYSB 1U8IB 5HYSA 4YHYB 5GGVL 1KLGA 3BH9A 2QVMA 2V33A 4P07A 5F2FA 4G8FB 4AUJA 4QHPA 3DTXA 1S8DB 2C7UB 3C9NA 5JZ7D 1Q8MA 4HCRA 2PWDA 5DT1H 4JRFA 3RPBA 3WJMA 3PUUA 4R7NB 3ARFB 3L4XA 3VXTA 5I5RA 1G6VK 1NC4D 5E4EC 1YMME 3D9AH 2V4LA 1FL5A 5F9OH 1M6UA 3VGAB 5D7IB 5ESVB 1AXTL 3VFRA 2FJGB 3BVTA 3GZKA 3H9ZA 5BVPL 5FYLD 2DAVA 4YMPA 4NZRH 2G3MA 1OAZL 1U58A 2UXTA 1AOZA 3SKJH 1Q94A 4NX0A 5HI3C 4HULB 4YIQA 3C5ZB 4G5ZH 1OT4A 1M1XB 4G42B 2R8SH 4XNQB 3TIDA 3UBXI 4OSUL 3KPRB 1I53A 3KYOB 3ZIMA 2VXVL 1NUFA 1PG7L 5FCSH 4I4WA 3BT2H 3OKLA 2DQTL 3HC4H 4X5PA 3V4VA 3X11A 1FRGH 2ROXA 5F9WB 2XZQH 3OB8A 2VE6B 3HJEA 1GS8A 1OW0A 1QBBA 4KZEH 5F97E 2RQEA 2NY5H 3CFMA 4U6TA 4B6ZA 2P5EE 3QDGE 4GRWB 2NLJB 4NM4L 4NQEB 3TFKD 2IV9A 2W65A 2OMTB 1U3HB 2OI9C 5JHDD 4ZQKB 3HHRB 4PJXE 1WGVA 2EE3A 4RFNB 1DUYA 3VFPA 1S5IH 15C8L 4JCMA 3GIZL 1XGRB 2Z35B 2BDNH 3KLQA 3PRZA 5C0CA 1SZNA 1UKQA 3CFTA 5CR8A 3WXWL 3T4AB 1RZ8B 2HH0L 4UDUB 3FB6B 4LDOB 4UU9A 4LAJH 2EDYA 2EE9A 1INEH 2P5EB 5SX5H 2N0MA 1DJYA 4JHAH 4KQ0A 4DERA 5F8RC 2OMBA 4G7VH 2KI6A 3FF7A 4U1LA 5JIKA 4PS7A 4Z7VB 1XF1A 4GUQA 2QDWA 3BI9X 4Z7UE 4S1SL 1NKGA 3MUGA 4XWOD 1XCTA 1FYTE 4YDLC 3FOLA 2JKSA 43C9B 3HLAA 1FJ1A 3EFOA 2GT9B 4PJ8D 3S88H 2ATKB 2CLRA 3IN2A 2GQHA 2ZG3A 3V6FB 1B2WL 2OSLA 5KAQF 3KW8A 1T2QL 4PRBB 1WHOA 1WTGT 1AMYA 3U4KA 4P23C 4ZQTA 5SWSD 1CFSA 2F54E 2XBZA 1GOFA 1NIFA 4O5LL 1Y1DA 1Q9OB 4AV5A 1FSKC 5AAWC 1AD0B 2ZX6A 3FZUC 4Y4FB 3V6ZB 3P9MA 2AQTA 2YEQA 1HHIB 4AT6A 3U1PA 1TJGH 3OHXA 3I2CH 5B3JE 3GK8L 4RNRA 5L88H 1FE8H 3IU4L 1CIUA 1WFMA 2EH7H 3SGDI 1PQZB 4QXUH 4TQIA 2J43A 1BFOB 3MLXL 1NGWB 4G6JH 4QRSB 2WUCL 2LAAA 2AEQL 4YZFF 4PJBE 1ZJAA 3WIAA 4MMZB 4NQSB 4DESA 3FL7A 3LOWA 5BOZG 1FL6B 3PWPE 3BPLC 4PJ7E 4H88L 2ZF8A 1EA9C 3PXHA 1CD9B 4MQ7A 4J1UB 4BA0A 4F7MB 1PTZA 5D4HA 1TCRA 4JFZH 4X7SL 1SJXA 4WTQA 3BQUC 3RRQA 3RVVD 5IJDC 1DJIA 2KC0A 3FQUA 2BNRD 1RZGA 3HAEH 3WJLA 2D2CC 3H3PL 2LQRA 2X4PA 5CSZA 2K3HA 2BVTA 4ZYKA 1P53A 4JS7A 2WZ5A 2BXYA 3GMQA 4EPSA 3MOAH 3FQWA 2V6HA 3NYKA 3HZKA 3K6NA 5DK2A 4F7EB 1FGNL 4F20A 4PJDA 5IQMA 4X4MA 2Y6SD 3MFFA 3QZWG 3PWNB 5GHWL 5LBGA 1VHPA 4EI6A 5KYWA 1KULA 1YEEH 5FW6A 4JPWH 1A6UL 4G1MA 1V3KA 4WU7B 3WD5L 2CK0H 3BRDA 4R0LC 3X1EA 3CHRA 2ZOLA 2W95A 4PW4A 1A7QL 4JFVA 3U36B 1KTLA 5JO5A 4XC1H 1G1OA 2ZNWA 2DKSA 4HU2A 1XMWA 8PAZA 4I0PD 1GSMA 4PRNB 2F6AA 3C5SB 3K2IA 1DCEA 1U4FA 1MCEA 2QADD 4HEPA 2DJUA 4HWEH 5I1HH 1F45A 1A6VH 5A16B 4O5LH 3CFJA 5KBNC 1UKSA 1GGTA 4KAQH 2SODB 3D39E 3HNSL 2EJ1A 5D96B 1YEGL 1MJJB 1IB5A 2PTVA 3N06B 4AEIL 5EEZA 5F0JB 3AQDA 3WGUB 4ELMA 2JI2A 5T3XD 2CKBB 5HY9A 3ZMRA 4HV8B 4L29B 1HC1A 3BUPA 2QKIC 1RK1B 3IT8D 4ENEC 4ERSH 3BIBX 3DVGB 2M26A 1HOCB 1IFGA 1IBGH 3QXWA 1MFDL 4LCWA 4ANWA 1UD2A 2F7RA 3QA3B 3GLZA 1MNUL 4ZS7H 4UT6H 2EYTB 4OBSA 2X3BA 5DHMC 2QFRA 2ADFL 1OCRB 1MFEH 4Y2OA 3ZYOA 4Y16B 3KBHE 3W1ZA 1QEWA 3MLUL 5AVVB 1XBRA 1BGXH 5F6IB 2APSA 4N90E 3JVGA 4I1RA 4LLVB 4WI0A 5MP6L 1S7QA 1OLLA 2CO7B 5LBSA 3ZUNC 4KI5D 3QC6X 5J12C 3QWRD 3TCTA 5J1AA 1QR1B 4H26A 2X4OA 1VACB 2P52A 4HLZG 3VI4A 4XWGL 4FJ6A 1BZ7B 1SDYA 2Z91A 1R24B 2IWGA 4BE6A 2JB5H 2CCVA 1I1FA 2OTUB 3HE7B 3A5VA 4KJWD 2YUXA 2WMPB 4OGXL 2QHRH 3MJGX 4U1JB 1XF2B 4ZUWB 2EDHA 3QEQA 5ESAB 5IFHH 5I18L 2CO3A 2X0WA 3CLEL 3MAWA 4TV3A 1HNGA 3GMPA 4NRYA 4X2UA 1BP3B 3KPOA 4BH8A 2ORBL 5JW5B 3BUIA 4M7LT 1Z0NA 4OTXH 4G5ZL 2H32A 3U9UB 5C6PB 2P9RA 5BO0D 1ETB1 1AO7E 3CFDB 1V3JA 3ULUH 4X6EB 3AS0A 3GMOA 4YDNA 1KBKA 4B7IA 3MODH 3A6BH 3HZYB 1H9VA 2WN3A 5CU9A 4RZCA 3ECVA 3CLFL 3OHMB 4X4XB 1UENA 5GSVB 1GAFH 5KN5B 2PP7A 2B2XL 5J57B 3NCMA 4LB8A 3QFJE 4HFUH 4Y2LA 1N2RB 1YDPB 3MLWH 1C12A 5LAPA 3QGVA 2EXYC 3ESVF 4ESKA 3CVIH 1XMEB 5E1AB 2IEPA 4NPKA 3NP4A 3BLBA 2HJLB 5FGSA 5BUPA 4IQHA 2JH2A 2R23A 1ZLVK 3O2VH 3HBQA 5C3TA 1MI5E 2YJQA 1U42A 2FEJA 1R34A 3L1GA 4P2RE 1H5BB 1WCBB 2DD8L 2BS8A 2DBJA 4KK8C 4L8SB 4MA8H 4ODWA 3WFDH 2JB5L 4FEIA 1JZ5A 5HJ3B 2I85A 5C09B 4UT7L 3EO0B 1ZVSB 2VN6A 4OGXH 5SWSB 4RA0C 1EUTA 4OCRH 5E23A 1U8HB 5B7MA 1JNNL 1HXKA 2ADJB 5EOCH 3O4LD 2H3NA 2J5LB 4H8WL 2RFXB 2YXFA 3H7BB 1S9WB 4NC0B 4RMVA 1HDMB 4G7YH 4M1CC 4NQCE 3PWJA 4OAWB 5EU3B 2ZSVA 4HJ0D 2DI8A 4K94L 2ZUQC 4DUWA 2QV4A 2X5PA 5IHWA 1DLHA 1XR9B 4M7ZB 4ODTH 3TPKA 3QZWB 4ZMYA 1ZLEA 5T3ZD 1ZLSH 1FCGA 2O5XL 1CTNA 2HTKD 3EH5B 4FLHA 4JFHD 1OAYH 2HRPH 4PGDB 3QNFA 5BO1L 1II4E 2TRHA 3CZUB 5H8DA 4Q74A 5BUAA 5BRQA 4GT0A 1OPOA 4HUUB 3RVUD 1ZPUA 4C47A 2P5WB 4GQ9L 4XGZA 1MPAL 5T5FA 5ABDE 4Q2ZB 4Z0XA 1Q9LA 2AABL 3WKQA 3KH3A 1T0OA 3QDGB 5FUZL 4P46B 2X0VA 3S2CA 2PW2B 4ZOCA 2YC1A 1Q72L 5EWIL 2CDEA 4LNRB 5FO8B 3N04A 4WO4A 1A7BA 4PBWD 2EC9U 2YO3A 4R83A 1L9MA 2FECI 4RMUA 5JQIB 2ZYSA 5TK4A 2AI0H 3CZJA 2BK8A 1IC7H 4GMTL 5IW1B 1MN4A 2Y7SA 2VXQA 4AYSA 4HSAC 3U6RA 2P8PA 2MMXA 4V1DE 3SBWC 4H5SB 5AYUL 2IPKA 2OJEA 3GHEH 2ADGB 5CN2A 1R0AL 2PTTB 5A6IA 4YWGL 3ZYJA 5I6LA 1F18A 1DBAH 3DIDA 4IBZA 3M88A 4UOW0 1OZTG 3PV6A 4Q9RL 5HHPA 1U8CB 2QLYA 3BAEH 1R3JB 1QPPA 3LQMA 5F1KC 2E7DA 3GSQB 2VB5A 2PR9A 4Y5YB 5I75C 2YAOA 4ODUB 4JL2A 4IOSD 4UQBA 3HG1B 5GRUH 1G0DA 1FGNH 5EF2A 3G5ZA 1BZEA 3QQ4A 1XF3A 1KXTB 5IG7B 4RGMC 2PCPB 5C0DB 2WIIA 3SDCD 5I1AA 5CEZE 5LQBL 3M1OA 4P23D 5CLYA 4R2GB 3DECA 4EAEA 1UD5A 2QMKA 2D31B 3QC5X 2MCG1 3DV6B 1TZHB 4ISVB 5ALCH 1MCLA 1FNAA 2FWOA 2VDPH 4EDWH 4PJIB 1RIVL 1ZLWH 3QXDA 4YEFA 3O3DB 1G9ML 3ABZA 5B1CA 1I9JH 1CZ8L 3OSVA 2H0EA 5AFAA 5J56B 2NT0A 2VN4A 4WU5A 4OZIB 4Y4KD 3BSHA 5E2VL 2X87A 3INUH 1IC1A 3GGWA 1KCSH 4PS3A 3KE0A 3AACA 3K74B 4QHLA 5ILTL 4BK5C 3RTQB 4UIMA 3CHQA 4U1NA 4CRPA 5KVEE 4FTVB 1JTTA 2D9CA 3KVQA 2XQYG 3HPJB 4OLWH 5IV2B 3W38A 3O8XC 1N6UA 1OE3A 3DBXA 4HGMA 1EQWA 5FW7A 1ZANL 3GM0A 2XX1A 3H7LA 3VXQB 4CN1A 5E0FA 2X9XA 3K6IA 4H8HA 4AYBA 5HSFA 3DSFL 3H54A 3T0XA 2CJUL 4ZAKD 4RBPH 4PW9A 4M7KH 2P24B 1BZ9B 3IDMA 3BPOC 4KMQA 3TZVC 4CADA 2AEPL 3E6FB 1KIRA 3WHXB 5L9DL 5DVOA 4Z77B 2WCGA 2Q9OA 1N0LA 1S78C 3C2SA 3PQYD 5H4YA 4L2LA 4IGBB 2OP4L 4JRXB 1DQIA 1RD6A 2VTFA 3JSSA 4NENB 4WWPA 5IJBC 3FU3A 5KANI 5F96L 4L1SA 3VSTA 4UQEA 1UZ6F 1MZZA 4MCYA 4DPRA 4Z7QE 3NJNA 5JW3H 4DUVA 1LO2L 1BVKA 3DXAD 4RFEB 4WNSA 4PV8B 5DMGC 5E4AA 3VAEA 5SV3A 2Y5QA 5MI0C 2X4QB 4GW5B 3VG9B 5IMMA 4V2CB 1FZJA 1QTYT 2QT6A 4Q7DA 1WC7B 1G7MA 2PN5A 1P7HL 1M05B 4KKBC 5EDXA 4JKPL 4ZSOA 3ETTA 3KZ8A 5CKAA 2ZSWA 3QFDB 4XP6L 2YGPA 2V7HA 4AW7A 2HLFC 5I8EB 3RZCC 5ACZA 4Z7IA 2E27L 3E7JA 2VW6A 3TT3H 1LO4L 2YEZA 4XR8C 3ULAB 1QRNB 5FYKD 1QABA 3FQNB 2HAZA 4V1DB 1SEQH 3DC0A 2FTAA 3TEYA 3U7WL 3V9EA 3DTXB 2QGBA 5DD3L 3ZHKA 2IJ0C 3GPSA 1CFMA 2ARJB 3HW7A 3IFNH 4XX1E 2X6CA 3BEVA 3CZGA 3WEOA 4ZD3H 1MJ7H 3WTTA 5I0DA 4JFDB 2P8MA 2YZ1A 3OAUL 4N0FB 3QEHB 4IRZH 2ICES 2D7TH 3OL2A 4JRWA 3M1BA 4CSZA 3Q3GB 3E8VA 2CALA 3QULB 2FJGA 2J1XA 1ML0A 4JKMA 1M7XA 2PPCA 1IC4L 3HZMA 1J0IA 4W68A 1XAKA 2VZSA 3L2MA 1AXTH 5IBTL 3VXOA 4UM9B 4AQ8C 3WNNA 1OT1A 3ELQA 1SHXA 2WLHA 4A7QA 1GMIA 3MRNB 2WAQA 3O3AA 3JWDH 3T6QC 3NSXA 4AYDC 4GO8A 5ERWA 2GTWA 1FG9C 4UUJB 4HEMA 2OXGB 1F3RB 5LGYA 3S35L 1SVZA 1RZIA 2W65B 2VM9A 2FYYA 4QRQA 1A9BB 4M9OA 2WOYA 1CGUA 1PL3A 3QDAA 4XPGH 1Y0LA 2JIXA 4O2CB 1I7TB 5DURD 4GEJA 4QHKI 3O9WB 5E1IA 4P2QA 1ZLUK 1KPRB 1AS8A 2VABA 4IRSA 5DS8B 3SPVA 5HVWA 1BCIA 2HJKA 3DSNB 3EOBA 3BP4A 4GUCA 1D6EB 4OZHF 3SYAA 1GC1L 3VWJB 4HCRH 1IVLA 2VXSL 3GI8H 4G5AA 3CUPB 4YLCA 4X8JA 1OGAE 3SCMA 3C5JB 1PZ3A 3SY6A 4PGBA 2DQCH 2EABA 4OB5L 3Q9PA 1OP5K 5AOJA 1Z32X 2C34A 3MV9B 3NZ8A 4F9LA 4N2AA 5D1ZD 3N44F 2CLRB 4GAYA 2IDQA 1ZTMA 5C0AA 3IDGB 3FRPA 1I8MA 1Q1JL 2FZ3B 1SY6L 5I1CH 2BS9A 2N1KA 2FE0A 2NY1C 2P80D 1F4AA 1ADWA 4MX7A 1QLEL 5F6HJ 2XHNA 5IB2A 1INQB 2XKNB 1IU1A 2A3TA 4LHUD 4WUUE 1E7UA 2EEDA 3QORA 1WT5C 3VFVB 3CCHA 3MRQA 5I74B 3NH7L 1UUSA 4KRPB 2AV1B 4Y5VA 1ZA3A 3T8MA 1E2WA 3RWHA 1F86A 1MHEB 3S4SG 4DGYL 4EZJA 1T4KA 3BWUC 2MJWA 2OR7A 1XXFC 3VSUA 5LN8A 3ZE2B 4JZNB 5D7LB 2PYFB 3UJJL 2YAFA 4G7VL 1E3XA 4ODBD 4QXWA 1IARB 2DLGA 3JV4A 3NCYP 3HFMH 2DIBA 1DTUA 1CI5A 2BCKB 1EXGA 3QO0A 3QQ3A 4I0KA 3BZEA 1S7UA 4B60A 4JBSA 3WLBB 2BZCA 3MRFA 4MTMA 9CGTA 2ENYA 3RJQB 2DQ6A 3KVDD 1UOVA 2CBQA 2AANA 3JYBA 4J1UA 5GRVL 4Y2NA 4F7MA 2X38A 4H8WH 4MNHB 3X17A 4ZMLA 3K72B 2XWEA 4GG8B 3DETD 5HVFB 1ADQH 3CSBA 5D7SH 5DJ0A 5JIHA 1M3JA 3IJ9A 3NVQA 4LRIC 2AQ3A 3BSZH 4OD2B 4PB9H 5I1JL 5KVEL 5L4JA 5I8OH 1DHKA 4GY4A 4A7TA 5C08A 1HVXA 5DZNA 5I24A 2NCMA 3B2DC 1U3HD 2WXQA 2MH4A 3BZFA 3LQZA 3O3EA 3U1SH 4G8EA 1XT5A 2C3GA 5T5NF 5L8JB 4PGZA 3QARA 3REWB 7PAZA 1T1YA 3KBPA 4K5MA 5A40E 1WV7T 2IWFA 5DK0A 5MENE 4MDIA 4M6OL 5IT2L 3PHQB 1W0VB 4Z7WB 4QOKE 3W39B 4OI8A 1ZTXH 4M5YL 3TH4T 6FABH 4PI0A 3U2JA 4N3TA 4LNVA 2O26U 5D1XA 3LD8B 1HWWA 4GW1B 5C92A 2BMKA 1C1EL 1WIUA 4PBXA 4XNXL 2CBPA 1PYWA 3BKYH 1U95B 3MSPA 4E41E 1KEML 2G3ZA 4ZDHB 3US0A 4HWBH 5C0IA 4U6XA 5BS0E 2V5SA 4OZHA 3IMRA 3THMH 2H45A 1H3XA 4L4TB 5CBEB 5H4ZA 4MYPA 4WDIA 1WBXA 4X8XA 4AW4A 5CGYC 5F96H 3S3JA 1NGQL 1JWMA 2F53A 2F18A 3V0AC 4GMSH 5I1LB 2BZ7A 3PAYA 1C1EH 1XH3A 4XNXH 4UIKL 4ZMAT 2ZG1A 3AY2A 5C0AD 3BVXA 1MCOL 4F33A 5EIQA 3DPBA 4KTEH 3VI3B 1RULL 5HTSA 1DBJH 2ZQKA 3HC2A 3BT0A 1R0AH 4N2NA 5FPIA 3QORD 4OZGB 3FT2A 3SODB 4QOKA 3WTSA 3MNVA 3ABGA 1RK1A 3IRCA 1VGKB 3BMVA 2IGFH 3O6KL 2WN2A 3TM6A 4URKA 1WK0A 5FHAH 4RISH 4UDTB 1OTTD 3OWEA 1XF4A 2IGLA 3FTWA 5F7FA 1RZFH 4XBGA 2VR7A 2XWTA 1MHPL 3O4OC 3SYQA 5L4MA 1X6LA 1OGTA 3QSKB 3UOAB 32C2B 3QCVL 2DDQH 1F8TL 4HIJA 4GEIA 3F05A 3TNNA 3DO7B 3GNML 2Z8VC 4X6DA 2DQGL 2PPFA 3BFQG 4IHBA 4L9DA 4NHUA 5CSBA 3GSNA 2D7PA 2FJSA 4YE4L 1NAMA 4KH9A 1FO0A 2Y5TB 3QUZB 4UAOC 2W94A 2HMIC 2X3AA 2Z1PA 2B59B 1LE5B 4XO5A 3TV8A 2G9HA 4AH2A 4GH7B 5JQ6L 4G7SB 5D7LE 2NYZA 2YD8A 5DVKA 3D6GA 3LB6D 1AAJA 2CIIA 3JWNH 4PMEA 1DQML 5HYJA 3ATFA 1NCUA 1I75A 2G5BA 3CX5J 4J4PD 4YSUA 5IR1B 1ZS8B 3IEAA 4P2CG 3RIAF 2IPTH 2D4DA 4G6AC 4KXCA 4GQPH 3U9UA 5AVRB 2XQYK 1QBLL 2AK1H 4PWHA 2NZ1A 1F0LA 3RPKA 3SKOB 4J3UA 5I16A 5DYOB 4PRPA 4F2MA 1MFVA 3IJSB 4YHIB 4NHCL 1CGTA 4QTHA 3T6ZA 5F72S 2GSGB 3O11A 1L4IA 3N43B 3WSQL 1NCWH 1OGSA 1CU4H 4NPYB 3VFMB 3ZZQA 2HVKB 3JV5A 1GPOH 3BUYA 1P7KB 3H3BC 4OCXH 3ZQ9A 4C4KT 1B90A 3DX4A 3ESPA 1S9VA 3OSKA 5IEHB 4ZFFB 4PD4J 2R23B 2YIHA 1T0MB 4JFEE 3EJRA 3KWXA 1OANA 4PJBA 1V7NL 3JUZA 2JJUA 4NRZB 4HC1A 4P59H 4HKZA 3DX9B 1U8NA 3PP4L 5GJTH 5I1DA 4NCDA 2W9EH 2XTJE 5AVSB 3ETBF 5DVMA 1PAZA 5E8NB 2DPKA 3CZNA 4IU3B 3CFBB 4P2QE 2WBJA 4PJFB 3WKYA 4YPGB 3QDMB 2JV6A 1OGAD 1DUZA 2H3NB 2YGOA 1Z5HA 2QPDB 3WIFB 3RX7A 5EUKA 4G80B 4LCVA 5D5MF 4JB9H 1CDGA 3X12A 3FCSA 4JFFD 3CSYB 3WKMH 1TTAA 4UMSA 1F8TH 2J21A 5HDWA 3SE4A 4M8VA 4BZYA 4F7PB 4GIPD 4XVUC 2CDGB 3AS2A 4XP1H 4XMTA 3S36L 1FVDA 2DQEL 3MLXH 5CP7B 4MJ6B 1ACYH 5HGDA 1DQMH 4P5KB 3V52L 4AZ8B 4B97A 2J1ZA 4GI8A 1JPGA 5I5MA 4OQ1A 4ZFOL 3DYMA 2VDQH 3KPSB 4YK4C 5AVXB 3Q5OA 3KD4A 5E6IC 1A9VA 3QZMA 5DZJA 2YN5A 3VXMB 5FM8A 2CGYA 1DQDH 5MERA 4AGQA 1PZDA 3OLDA 1D5MA 3QEUB 4G71B 5A2JH 3ARRA 3LZFL 1X9RA 3QXUA 2FK9A 3LIUA 2A74B 2J12B 2BIQA 1SVBA 7TAAA 1C08B 2VLRE 4OQTH 4TM9A 5IQ9A 1XGZA 2BRQA 1NGZA 4UT6A 3SO3C 3RWIA 2XYBA 1BEXA 5IFAH 3MV7B 2YMOA 2I24N 2GABA 3MNWA 4QI3A 1RZ7H 2G0LA 2BP0A 2G2RA 3SYCA 5DQDH 2L0DA 2WZPD 2AQRA 4TOYH 5HHOB 4YZFE 1I31A 5C7ZA 4BKLA 1NJ9A 1YNLH 4H13C 3GMLA 4PJHB 4G9DA 5CIPB 3KXFB 1IFHH 3SB3A 2XZCH 4I0PB 5M94B 1SEBA 3EG9B 3OX8A 4JDEB 4GSUA 3F58L 5EEYA 1FGVH 4LMQI 3HFFA 2PTTA 5G5DA 4XNAA 5B4MD 4BFIB 3UADA 5DEGB 1MFCL 4JRYA 2AJSH 3IPBA 5L7XL 4S2SA 4MKMA 1J8RA 2CRIA 4W9JC 4U3SB 4ZXBD 4NN5B 2BSRA 4K2UH 4DP5X 5EPMB 3OBAA 4QHNB 2LABA 3LQAC 4NJAH 3ARPA 3KYKH 4W9ZA 2O6DA 4O2EB 3EGDA 5GGSA 2PO6D 4NKMA 3KS0J 3VGGA 4AL8H 2YA2A 3QQ4B 4J3VA 5B3JF 5IG7A 2PKDA 5C0DA 1S9XB 2CWRA 4UTBA 2EUXA 3VD1A 4GKOA 5GRVK 2GJJA 2ZUTA 5ALBH 1F6LL 5ISZA 2NY1D 3VXRE 1J5OH 4L8CA 1XBDA 2JXMB 2V2XB 4Y16D 1KEMH 3IGAA 3ARGA 1BX2A 2VO8A 3O81A 4H8UA 2WBJD 3P54A 2XQBH 3AU1A 4OCNC 1QQDB 1AGEA 2UZYA 3KPPA 1WZLA 1KFAH 4WTZA 3UZVB 2UVEA 3K4ZA 3LXCA 4NO0D 2GTZB 2HP4A 2ZD0A 1CR9H 3AFLA 1JDAA 3SCMC 3QQNA 1A4KA 2D0HA 3LMJH 1SOQA 2VT0A 4TSCL 5FEBA 3VU2A 3DI3B 1UCBH 2APWA 1UM5L 3PGDA 4FYSA 4PWEA 3AMKA 1B6UA 4R97C 2G2PA 1JPSH 3LNIA 3FT4B 1PG7W 1AGBA 3ZE0B 4E9LA 5AW1B 3RWEA 4FTVA 2BSTA 3HUJA 5J5EA 3R0NA 4E9RA 4U2ZA 4DVBB 3MCKA 3FTUA 7FABH 4GAGH 4AEHH 3UDWC 1T6BX 1BLNB 3ZT5A 1KOAA 4JAMA 1DCLA 1UG9A 2R2EA 2QV2A 3BKCL 5DUML 1AQDA 5CS7A 5AEAA 4KY1L 1T0PB 4HMCA 4TQEL 1CLCA 2EO9A 3VFSB 2GITA 3B2VL 1GGBL 2MSPA 4F8PA 1AI1H 1JNHA 3INOA 4KQ4L 3MRRB 3RX8A 2WQVA 2A6KA 1YY9D 3L6FA 3LNEA 4WKZB 4ZMNA 2ZF9A 3ZHDA 2I60H 4Z3GA 1M9SA 3GSRA 3P4LA 5E03A 2WQ8A 2YAHA 2VO5A 1NPNA 3VRJB 2ZYRA 4JQIH 1DQQA 4H8PA 1LGVA 1AR1D 2YAEA 3AVEA 4DGWC 3AXLA 4MCZB 5EUOA 1JV2B 1N67A 1OAUL 3ARDD 5FYLE 3IAQA 4ANXA 1NOAA 5FUOL 1V05A 4UTBH 3ZYIA 4S11A 1LO5B 3MX0B 3QWNA 5T1LD 1G7MB 3FFDA 1UXMA 3AADB 1U2YA 3KEHA 1KB5A 2DH2A 2AEOA 4R7XA 1A9EA 4M7LL 1XSIA 3FO1A 1MFBH 2Z31B 3CZFB 1A25A 4FQCH 5I8EA 1D5BA 4W9LC 4MHHG 1O7VA 5D1QB 5EU6D 5HGAB 3QNYB 1UWGH 4G11A 1VEPA 5FV1L 1SM3L 3ZBMA 4I1PA 2IANA 4UQ2B 4PG9B 2XNAB 5FKPB 3OKKB 4XNBA 5JR1H 2AMUA 5ID1B 2O5NA 4HZLB 4WO4C 5DD1H 4APQB 4W9GC 1O0VA 2C3WA 2GAZB 4JCLA 1S7WA 2VQTA 3V9CA 4G9FA 3D39B 3GBEA 4HAFA 1K4CB 4JGUA 5LCVL 3UAJD 4ABQA 5J0BA 3QULA 1E7VA 2VN7A 1FLRH 1T6VN 1F1AA 2P5WD 4K71B 3RUGF 3TO4C 4ELKA 3BH4A 5CJ5A 2E7MA 2O5ZL 5FECA 4X7CC 5F9DC 2XTSA 4S1SH 1OAXL 2L3BA 3PHOA 2UZPA 2ZT9C 2AHIA 3MRNA 3ZTDC 4OZGF 2IPUG 1TNNA 5F7YC 2B15A 2QGEA 5IQ7H 3U2IA 3DROA 3UYRL 2D8KA 5ERWB 5T1JA 1QSVA 3V5KA 4JFPA 1J1PL 2XOTA 2WXKA 2JI3A 3WGVB 4Y19B 4ZNEA 1YECH 3CXDL 4S0SD 1RZIB 4OIIL 1IZKA 3PNRB 3N91A 5HYSG 1AACA 2G60L 1NH6A 2N56A 5H37H 5E8DH 5AUMA 2KLRA 5IBTH 3PGCB 1E5YA 3NOIA 1U21A 2BP3A 3MLSL 2DBLH 1R3LB 1UOKA 2WO4A 1S9YB 5IB1A 3T2LA 1QNIA 3WKPA 1J8HE 4HS8H 4P48A 3NGBC 3VXUD 3ARDC 3SPVB 5BRZD 2AQQA 2WXIA 1AGCA 4WHTA 1SXSA 3NIFB 3V6OE 3QPXH 3B5TA 2DQIL 1UWXH 3NSJA 2W80C 3UTPE 5JHBA 1T7WA 2ZWSA 5TPWL 1P9MC 1U91B 3WY1A 3V0VB 3EUDA 2R1WA 5FOJA 4OM0H 4HW6A 5E9DD 4NQCA 1R1CA 4DW2H 3HBGA 4PJ8A 2MRYA 4IRJB 3MLYH 4RRPA 3GINA 4Y9CA 5KVFH 1L5GA 4MVBD 3FB7A 1HILB 3ARBB 3IMTA 4CVWA 5IBLD 3NPZB 3V55A 3VFNA 5E8PA 4FKEA 3BP7A 1BIIB 3KLKA 2B3IA 3O45B 4KX7A 4ZMZA 1FQ9C 2VISB 2IV8A 5JPNA 5JHLL 5KUMA 5DLLA 4LKXB 3T0EB 4ENZA 5C0JB 5EU6A 3T8XA 4N5UA 1J11A 1IGJA 2BM3A 4MA7L 3MRQB 4PJ9A 4U1GC 2O1AA 5E8OB 5FR3A 3UAJC 4NQDB 1C5BH 3MUY1 1ZK9A 2XV6B 3T0DA 1KTDB 1RIHL 4JN2A 4TUOB 3TF7C 3P4MA 2VR9A 1JS4A 2G5RA 3MRKA 3QUKB 1R5WB 2VLLA 3CZSA 1H0DB 4NZJA 4G9FD 4XOEA 4N6QA 2WP3T 4OSUH 1J0YA 3BAWA 3ECUA 3UAJA 5L6YL 4BWTA 4YHML 4NUJB 1A6UH 2GKIA 2XPGA 5IVXA 4XN2A 5I9QC 3KJ6H 4Q9QH 1PS3A 3EF4A 3QWQB 1C8PA 1IGFL 4GS7B 1THAA 3FSAA 5A3ID 4LZKA 4KHXL 5DJZB 2X4UA 4ADGA 4LK4A 1FLTX 5J1SC 3S5LA 3EYOA 1EMTL 3GXDA 3HMWH 5FYKH 2UY6A 1D7CA 2R2CA 4GG8A 1QFWH 2JWYA 3FPYA 2XY2A 4IGBD 2YBGA 4OIAA 5C08B 4CGTA 4N0UE 4HUXB 4PLJD 3WIHL 1B88A 4G8EB 2HFFA 4I77L 5EN3A 2CUAA 1IQWL 4W6XB 3TXAA 3FRUB 3QQ9D 3WI9A 4QHUB 3WEMA 4POZD 2H3XC 4WKXA 2D4FA 3U9PL 4LSPH 2A83A 3SE4C 1U8IA 3X1FA 5KSUA 2PXYD 2APTA 4LFHG 3UERA 1N6QL 2I7SA 5BVJB 1FIEA 4PJAE 4HIIA 2MWCA 3OKMA 4K8RC 3IDXH 3LEXA 3CLWA 1QUPA 1QW8A 1L3WA 1E9QA 3IDNA 4RAUB 3VW3H 1AR1B 2NUPB 4R7NA 4J5VA 4WI7A 4Z8FL 4WFED 1FFOA 2J71A 3KWVA 2ITCA 2XG5B 4PGEA 1XH3B 1L6PA 4JO4L 4KROD 3RA7L 5ITBL 1FV1A 1VZGA 3E2HC 3F5WB 2W07A 1QLFB 3NACL 1RHHA 3BESR 4H25B 2YD6A 3QCUL 1K4DB 1TVBA 2XVLA 4JZJC 4TULL 4TVPD 5F0MB 1QW9A 4YIQB 5DJCB 3DMMB 4QRTA 3L5XL 4XH2A 3UTTA 4LOEA 5JIMA 2RACA 5EO9A 4MS8D 3PNWA 3L3OC 4MD0A 2V17H 4Q8BA 3V4VB 2JJWA 2Q86A 3KVPA 1NDGB 3ME0B 5DD6B 2XICA 3PS6A 5LDSA 4HT1H 1BF5A 4NDMA 4L23A 1CLYH 4I48A 3FNKA 2UX6A 3EYUL 2Q76B 2I27N 3SJVD 2ZCZA 1F3JA 5K1NA 32C2A 2KDYA 3ZLQC 3TCLA 2EIBA 4HIJB 4ZQKA 3QWRA 4X9HA 3BKML 4F37F 1VESA 3VFPB 3WIIL 1KGYE 4UQAA 2ZAIA 2Z64C 2HG5B 2WWKO 4IOIB 2PMZA 3CAFA 2MQCA 1G1KA 1DP0A 1G87A 1OOAA 3VXRA 5IMOA 1QSFB 2Q7YA 1JDDA 2ZWYA 1W8OA 5T1KA 5ELIA 4WWID 2Q8BL 4DO4A 3Q06A 5J89A 4MQXC 1ETJA 4F7TB 2J8HA 3INUL 4HMEA 4W6WB 43CAA 1Z5LA 4LL4A 1RP8A 3OR6A 1NIEA 4EBQH 3IB4A 1VFBA 4ONOA 4MD4A 1RUAL 3EZJB 4P2RD 4BQ6A 3WBDA 2QEJA 1MJ8L 3GRWA 5CN1A 4IIQA 4R0LA 4XBPB 1TSRA 1ZS8A 4XPGL 4JM4L 4DAGH 3MYJA 1SQ2N 2XZCL 5JZ7C 4DUXA 4MD5B 5A1AA 5I8KL 1IGCL 2W60B 4NKDA 4Z76A 3UG5A 4XVTL 3P2BA 4LCWE 1TTGA 4F2MB 3CXHJ 1OGAB 1CXHA 3FSWA 5D4QA 4C83B 2XZZA 4GINA 5DUMH 3TFBA 1MRCL 4Z7NF 1MCNA 3K1DA 4BZ2A 1E4HA 3ATDA 1VFAA 3NFPA 1TZ8A 4DEPB 4OGYL 2A6IA 2FBJL 1LNUA 2HFGL 2AGJH 4NJAL 2VIRB 4UMGA 2H6PA 3UDWA 4NNPL 4PLKC 5IEHA 3STZA 4ZFFA 3QAZB 2VDKB 1JGVL 2CUMA 4U3XA 1T0MA 4KRMB 4N0CC 1H3UA 3G9AB 2Y07H 4PR5A 1CDCA 4MZ3A 4PYHA 4HJGB 4U1KA 1U2CA 1UHVA 5HI4C 2X4RB 3RL1A 1ES0B 1IO4C 4ZFQA 3ZL2A 5J6HA 2VDPB 4LPUA 1BXVA 4P2OB 4WHYG 1KJMA 3LCYA 3CBKB 3CQFA 4YPGA 4F58L 4XMVA 4FQQB 5L2KB 4WO0A 3TT3L 1EXHA 2RTTA 2YWZA 4BINA 2ZCKL 2VERN 2EE6A 3RWFB 2B1OA 3OAYH 2CPUA 1IGYB 4ABWA 1KCRL 4FP8L 4JMXA 4YXLH 3OC5A 5D1XC 4YAQA 4F7PA 5HHOD 3SDDA 3D09A 4BUHA 1FVDB 3NCWA 4XVSL 1RSYA 2YK1H 1PKOA 2ITDA 3V4PH 4FA7B 4CC4A 1YNTA 3O3UN 4K3JL 4O02B 4XXDB 1MCIA 1KUMA 4GRWH 2A4EA 5GPRA 4PJDB 5CZRA 4ZUVB 2DLIA 2XX0A 3GXNA 5D7IE 4B27A 3VXMA 3C6LB 4NUGL 4ZSOE 2VQ1B 3X1GA 3NESA 3EH4B 4ODVH 1V5JA 1YEDA 2C1OA 1GL4B 3HS8A 3FMGH 3FUHA 5AW9B 5GJSH 1C08A 1OTUC 5D8JL 4AM0A 3L4TA 4OF6A 1BVOA 1ZSDA 1JGIA 1WZKA 1YO4A 3AREA 2CIKB 1YNKL 2ED6A 1A3RH 1TMQA 3ROOA 1Z3GL 3T3ME 3FTYA 4FTDA 1I8IA 4NRXA 1R3KB 3SDAB 4G9DB 5CIPA 5I18H 4HOZA 1H3PL 3ILQC 2OMXA 4N8VB 3W9DA 1KCKA 2MPVA 3B2PA 3EGXA 2ZXDA 3L3IA 5A2CA 1XZ0B 4X9YA 1A14H 4JRYB 3WCYA 1KB3A 3HMXH 2R1XA 4C4UA 4EN3D 1KIQA 1JXGA 1KCSL 3A6BL 5C86A 5DXWA 4AYEC 2V5MA 3WAKA 4ZTPL 1CD1A 2P8LB 1Z9SA 4QGTA 4WFGD 2ODHA 2ZPKL 1YN6A 3CX2A 4HFUL 2AKRB 3VNYA 4ALAL 1KIPA 3SDCA 2XTJD 5T5FH 2PXYC 4GO9A 1YJDC 4DWHA 3SGEI 4TNFA 1WZMA 3MODL 4AV4A 3AG1B 2X6BA 4KO5A 3PGFL 3P3SA 1MI5D 1EXUA 1VACA 5D2NA 4PFEA 2YA1A 1MWOA 4MYWB 1QQDA 2UZYB 3KPPB 1EHLL 2A0LC 1A3RL 2DQFA 2O6FA 3ILDA 4W9FC 2VRAA 5J6GB 5IWLA 1W91A 2BNRB 1E9PA 1BAFL 2DQDL 2OTUA 4IS6B 4K7PH 1YEHH 5CJOL 5E99H 5DMIL 3OZ9L 1JXKA 4PJDF 4S1QH 4AG4L 3FMGL 2Q7NA 3GZOA 1UYWH 3CK0L 1QYGL 3KPNA 1HSBA 3BHBB 5D8JH 4A2HA 5BRPA 1CE1L 1CYGA 4M5ZL 3PGDB 4JHAL 3OGCA 1DVFC 3EJSA 1AGBB 2NY6C 4XN1A 4K23H 5FK9B 3V4PB 3RWEB 3VM5A 1OTSC 3AAZB 2A9NH 3LV3A 4J3OF 1RV6X 3CFDA 5KTEL 5IP4A 3MXWL 4U3HA 4B9IA 1UM4H 4JAMB 1GC1C 2DIJA 4P9MH 1TJMA 2B14A 3ISWA 3VSQA 3IDYB 3L95B 1ZMYA 4MA3B 5B7FA 5IM7B 1A6TA 1IIIA 1JPFA 2YOCA 3B43A 3WNJA 4YDJA 3SBWA 3DRQA 4DGUA 4LF3B 3PWPB 1NOFA 5C0EB 3I75A 2IOMA 2XSKA 1UT1A 4BIKA 2HLEB 1CLZL 4X6CF 2ZXGA 5KZCB 3S37H 5IQOA 4XCYA 3TTSA 4K07A 5D7SL 1I1YA 2J8UF 3FBQA 3IJEA 1ZTXL 3QIWB 4ENED 4GKNB 4DQOL 2F8OA 1S5HA 3LMJL 4AEEA 5C0RL 5EUOE 1WCBA 4L8SA 5GGTH 3IF1A 3VTTA 3DX8A 4RMTA 4DKFL 1W0YT 5HJ3A 2VLKD 4ANVA 1OLZA 4N8UA 1PGRB 3HR5B 4L0YA 3P30L 4OFVA 4LOUC 4GQQA 4EUPB 1KY7A 4PRAB 2N7AA 5C8JA 4B9YA 4P3DB 4KV5F 3ZJAA 3RVVC 1J12A 3NCYS 1CF8L 4QJ3B 5TQ0L 1JZEA 3PWJB 3N1GC 1HL5A 3NABL 1LO2H 4ZUSA 2V5RA 1GGIH 5F1NA 5IW6B 4MAYC 3MN8A 4XHJC 4FFZL 3II1A 3W9EB 1PZSA 3KL0A 4X83A 2LVCA 5KS9F 3CSGA 3LS5L 3IXTB 5IOPA 4KC3B 4FA6A 3VXPA 4XAWL 4QRAA 3IXAA 3QUYD 1FNGB 2IH8A 2XQYA 1G94A 1I3VA 1UD8A 2EDLA 4FQHB 4E5XA 3LPOA 2IGFL 3ZDXB 1SM3H 2DI7A 2L04A 4APQA 3QHFH 3K0WA 4QF1B 3MO1B 1GA2A 2JKWA 2NY6D 5BZDB 4NI6A 3DYOA 4JM0A 3QDGA 4EDXB 4NWUL 4O00A 4F1SA 4WHCA 1AKJD 3DUHA 3KL3A 5E94B 1CG9A 3LYRA 1X4XA 3MNDA 2NTFB 3PDOA 2DQCL 5DTFA 4FG6D 4XPHH 4Q97A 5JYLA 3MLWL 1WAEA 1PX3A 3FZUD 4LMQE 3ZDZB 3W81A 4J39A 4Q0XL 5EOQL 3ARZA 3ERXA 4ZS6D 3RWCB 5I73B 1FNSH 3B8YA 4KXZI 4YLQT 5TDOA 4YS4A 2FX7L 5HHQB 5A43C 3KYMB 5FUCE 3AXIA 3VX1A 3GJEB 3BXNB 1IGIH 3P77B 5FO7B 3CHSA 4DZ8B 4M8QA 3KM2A 3KDMA 3LZFH 2QQLL 4UQ9A 3L1FA 2H5UA 4YJZL 3L1OH 5ADPL 1FAIH 1FFPB 3NPSC 3MV8B 4LSVL 4XVOA 3PGCA 1QFPA 2B4CH 3OHXC 4QO1B 1WWAX 1MIEH 1XTMA 2R29L 5FOBA 1XGPB 5DS1A 4P2QD 3MRMB 1G7PB 4HKBA 3VG0L 1HJBC 4KJYB 5E5UB 1MF2L 1I7UA 2VZVA 5C0RH 2DW5A 3MLSH 4MDRA 4QRPA 3BAKA 3MRBA 1S7TB 2ERJC 3GTVA 3WJJA 4JFFE 1LEIB 3PQYE 4XP5L 4BFNA 4HK3N 4JO5A 1E2VA 1FYTB 2HJFB 2X6UA 4XMLH 5AKTA 2QHLA 3QG7L 3QI9B 1ZWIA 2MHAA 4K55A 1RSFA 1S7RA 4PJ5A 3ILEA 2ICCA 3PF2A 1YUHA 2AJZB 2PLTA 4NQCB 5D1ZA 4Z7AA 1EWHA 4J3OG 4MCYB 5DC0A 5TGBA 3CFEA 3TNMA 3RBSA 2XWBB 5GRYA 2X0UA 3VRLE 5HBBA 1NWPA 5GISL 4UAHA 3LXAA 4HIEA 4KJPC 2XWJB 1XGUB 3LIZH 4FNLH 1AVAA 1URZA 4JR9L 4LVEA 4ZODA 1HXYA 1R33A 4KOBA 4MKTA 4K5NA 4Y7OC 1KLGB 4M4PA 4WJ5A 1F5WA 1EO7A 1JGUL 1BOGB 4HEME 4FABH 3MRJA 4N2BA 4I2XA 5E8OA 2RCSH 4J8RA 1X9LA 3T3PE 2W88A 3L4CA 4KUZL 2EXWD 1LO4H 2AJUH 3A6CH 3LNDA 4P4RA 1TQBC 3DBXB 3FU6A 4DN4H 3VG0H 2VL5B 3VB9A 1KELH 1YEIH 4APQD 4UINH 4BRJA 2W59A 1ZLVH 1WT5A 1EFQA 1JGVH 4LCCB 1H6UA 3G6DL 4HFWB 4NC1C 5F1OB 4AGMA 2OMZB 1CVSC 2CGRH 1TTUA 5I6NA 2C8NA 3DUUA 3TVMA 3TC9A 5DDHB 4O4YL 4R7DB 4NUJA 5I26A 1AQHA 2FAUA 1QI4A 2R0WL 2CGZA 2V8MA 3GTTA 4G42A 1VDGA 4C58B 4M62H 5MEOB 1HTYA 4PJHF 4GUPA 5F3FA 1M6OB 3BIKB 4I4WB 4XE5B 5KVDH 4ZFGH 4BZ1A 2HKAA 5DWPA 4P4KB 1UA7A 5FA4A 3DJZA 1DQDL 1KBGH 2LU7A 3HBZA 3KGUA 3GJFH 3PDDA 5J7CC 1U8QB 5DRWA 4PJEB 3H2PA 4FADA 1CXKA 1U3HA 2B4CL 3W56A 5TF0A 4HWUA 2BVPA 2HTLC 2F1BA 2VDLH 4PTTB 4WWKC 1AANA 1CFBA 4FERA 4XCNB 4FQ1H 3RWJA 1NAML 3MRDA 4HBCL 3MBEB 3KBFA 4GOSA 5F3HB 1I3UA 4HJ0C 1EMTH 3FB6A 2KLSA 1KYOK 4PBDA 4QAMB 5FGBC 3L5IA 3QZLA 4PJCB 4ZMXA 4AJWA 4WV1B 4KTDL 4WWKA 1JXFA 4U6HB 4DP7X 3CMOH 1UKTA 3A67H 4NZ8A 4P23B 4BUQA 1AXSA 4F3FB 4JQIL 3LRLA 1RL1A 3UAEA 4JFUA 2CO1A 1J5DA 2X4NB 2J44A 3QJFB 1XB6A 2JCCE 3DX3A 1L0PA 3QIBA 5LBSL 3L5WB 3EFOB 4R3SB 1FSKB 3O6LL 3BDBA 4OGAC 3QDJA 1DBBL 2OSLB 2QADB 3H9SE 1ZANH 5DU7A 1UWEH 2Z0UA 4PPTA 4XMXA 5L88L 1RU9L 4FABL 1EJOL 2LE9A 1DANU 1KZQA 3CDYA 3FHQA 1Q9OA 2VDRB 3BPCA 4A63A 3KEDA 2MCAA 4CMMB 4DEUA 1EGJA 3P9MB 4KUCD 5DRXB 3ZQXA 1RUQH 4E9WA 4Z7NB 5T3ZL 4H1LA 5CLZA 4HOWA 4D3CL 4E2OA 3D48R 2BS71 4UINL 1CICA 3MROB 2A73A 3RWDA 2EADA 4MMZC 3QUYB 1MVFA 2OXGA 1ED3A 2EDKA 1ZHBA 3BPLB 3D3VD 3GT6A 3L4UA 4NBXB 4WSJA 4XCEA 2XG4B 5JUEL 1CF8H 4MS6A 5PAZA 5TQ0H 3RIFF 1ANUA 1PIFA 1CGYA 4ZJ9A 4XMUA 3PXLA 4FXKA 4M6MH 3T71A 1E3FA 3SY0A 2K0RA 2GG1A 3PL6D 4EI5B 4KXZH 3O9WA 3FQRB 5EC2B 1BQLL 1XGYH 3FH7A 3NT0A 5DMGD 1UM6L 3WHE0 5DS8A 4LLMB 5CAYB 4YBLB 4XMKH 4JGMA 2LW3A 5CFHA 2VLJE 1TQUA 5L2JA 2V2TA 2MCPL 1XCWA 2Q1EA 2GK0B 1LMKA 3Q13A 5E99L 1Q90A 2J1YA 1RJZA 2B9AA 3EDJA 5IIEB 3WO4B 2HUHA 4OIIH 4TF4A 4Y9EA 1IJ9A 4R0LB 1J8HB 3IJHA 3O2WH 1EDQA 1E8ZA 4XP6H 5CZXC 4O9HH 4YHKL 4F7EA 3OPZL 5EFIB 4PREA 1BQ5A 1USZA 3QUMB 3STLA 1HU8A 5E9DB 2FECL 5TE6H 1ZGLP 4G8IB 2R2BB 4QWWC 3BZDA 5EEXA 4BSVA 4IRJD 3LPFA 1INQA 2DWXA 3QFJB 5DFTA 1RU9H 1N10A 4AXWA 3NIFF 1TDQA 3BN3B 2Y06H 2YSSA 5I0YA 2DMBA 2X9YA 3FQXB 3N1MC 4BM7A 1CGXA 1RUAH 4KKAD 1NFDE 2NYKA 2BVEA 4PVLA 3QI9D 2Y7QB 4Q6IB 1QFHA 3FFCB 3ISYA 2ETWA 4PB0H 4DHLA 2Y22A 1PD0A 4J2XA 1NGYA 5AL0A 3ZKXC 5E5MB 1H3GA 4YC2C 3GSUB 2C9QA 1CFQA 1NGQH 2BVYA 5CLXA 3ZE1F 1QLRA 5JHAA 1HEZB 1UWGL 2PR4L 5I15H 3A4EA 5EBWA 1YEJL 4LSDA 3NFSH 5I6XC 4LBAA 3KBEA 4P2OA 4MHHI 1KJ2B 1KJMB 4XO8A 2VDKH 4XBMA 1JPST 1PG7X 4ZPVB 3SKMA 2BCMA 5E6RB 5AOZA 4IBWA 3E80A 4JFFA 2OR8A 1FZMA 1X5ZA 1T5WA 3F04A 4WFFE 5DEFB 3LQAL 3Q2LA 3VNZA 1MRFL 3HVDA 5TE4H 2KQNA 3UBHA 3VFTB 1X5AA 2OPCA 4LLVA 4WI0B 4BZ1H 4AE0A 4PI2A 2IDFA 1MWAH 3LS5H 2A7BA 5K9OA 4N2IA 5DURB 1L9PA 1NCBL 2ITDB 2NY2D 5TD4A 3MRPB 4GI6A 2X89D 3MNZB 3ZHFA 1OPGH 4MDIB 1JK8A 3IDIA 3WKML 2OK0H 1AD9B 4P5MA 5FCUL 1N18A 1O5PA 4MBRA 5EIIB 5EDSA 2BPBA 2E74C 1G7QA 2CBMA 3F7LA 2Q8AL 3VXNA 3L5JA 4Y1AA 3FQ4A 1MFNA 1YEDB 1HXMA 2C1OB 4HUWA 1G1YA 4XVJL 4RDBA 4ZDHA 2X1XR 4BZ2H 1XGQB 1QFWM 8CGTA 2IQ9L 3LNFA 4JY4B 2B39A 1GCYA 4OU3A 1IBDA 2B2XH 4L4TA 5CBEA 4O9HL 4P0DA 3K8KA 1J0KA 1YY9C 2D7QA 3KGRA 3H2WA 2Z1KA 4OUUB 2X2JA 5DJYA 2F54A 2UUDH 5AYTA 1DVXA 4JDVB 3AB0B 3FU8A 4S1RH 3DUSB 3P11H 1TZGH 4XN4A 1YEKL 4HS6A 1Q9WB 4YHPB 2K9UA 4ONFL 5E7BA 2J72A 1TO4A 5CINH 1NCTA 2V2WB 3PQYB 4DGYH 2PCFA 2BINA 1NAKH 2WLIA 4TSCH 3GWJA 3QPQD 4QCIA 4C54A 2WXFA 5JNYA 4K7FB 5LHDA 2W0KA 4Z18A 3ETSA 3PWLB 4QXGL 5AW7B 3RI5K 2N4IA 4L8SC 5E4IA 1T6WA 3C8HA 3A4AA 1MLBA 3JZ7A 1I9RH 1NCDH 3MOQA 4D0CA 2BY1A 3TJEH 3NIFE 4FJYA 4XNMB 1NBVH 3MLVL 1SJHA 4BXSV 1MFEL 3D85B 1JZJA 4H1LH 1IC0A 3ZXAC 1YMHB 4HF5H 2ZXBA 2WPGA 1OB0A 4H20H 3TZVA 1SYVB 3UBXA 5IVNA 4EI0A 1OARL 1KB5H 3QRBA 5C07D 3UG4A 3R18A 4KDVA 3GBNH 3LSOB 1RPKA 4KJWC 4BSJA 3HC3L 4W93A 4X6DB 1XGTA 4NHUB 1AE6H 3HI6H 4H0GA 2ZUQB 5CD5C 2UZIH 1A1OB 1K2DA 3TASA 5D2NB 2GIXA 4RRPM 5GS1B 3LS4H 4P2OD 4F9LC 1JZ8A 3GZQA 5ISZE 5JA8B 3EXLA 1N5YL 2OYLA 2RFXA 5IB4A 5TFSH 2PYEB 3QZOA 1LP9F 4OAWA 5EUOF 4PD4K 2MNUA 3ULUF 1LQBC 5D70L 1ZT4B 3NJLA 1AGDA 1E5ZA 3APNA 4PJAB 1A3LL 5JIDA 2G75B 4K9JA 1RZJH 4U6YA 5HYJB 4KX8A 3D3VB 3EADA 2XZQL 2BHUA 5D1ZC 5JOPE 4JFYB 3ZTJH 2NXYD 3QUXB 1DSFL 2WQRA 3D4GA 3U0PA 2BX5A 3QR0A 4Y5VC 1IGFH 4N26A 2NMSA 3U46A 1F6FB 2NR6A 2X89A 2FLBT 2AVFA 4K7PX 5CSGA 4IHOB 1E50A 5EIIG 3HRZA 4UM9D 4WSKA 5BXFA 1UT2A 4PRPB 2Z3FA 4UV4L 1RUPL 1YRKA 3HUJE 1FP5A 2XPYA 3SQOL 3L95A 2FB4H 4MAUH 3DJ9A 1OALA 2WXNA 4PY7A 3RY5A 1L9TA 1LWJA 1T0NB 4I0CC 4OF3A 5BJTB 3BUYB 5DRNA 4NO2A 2EDBA 4PRHE 1QFUL 3VGEA 1IQDB 5IQLA 4HQQH 5FFOA 3MTXA 5LQBH 2FR4A 2CLVA 4M61A 3NEXA 2QQNH 1OCOB 3IGUA 1EFXB 4E36A 3MLPA 2XN9B 4NSKB 1LVEA 4Y2DB 2B08A 4G2AA 4YUEH 5FX3A 1DVZA 3BISA 1U8NB 4ZMOA 4K73A 3AU0A 4JREB 5I8OL 4NN7B 5FO9A 3RDTB 1Q4NX 3PY9A 1JN6A 2Z92B 2AEQH 4V2BA 1J5CA 1PFCA 4EUPA 3NA9H 5D55A 5D9SB 3R1GH 1ZGLM 1R3JA 2E5EA 1VSCA 1J9RA 2JKNA 2PWGA 5DYFA 4NT6A 3FCSB 5D7KD 4E42A 2G3NA 2BNUA 3TBYA 1U3JA 2JKRM 5F1NB 5IW6A 2FD6H 4LEEA 2ITFA 3BH8A 3B34A 4P5SA 4WIQA 4YVUA 4OCMC 4AYMC 1BGXL 5BS0B 5I1AB 1E6JL 4POUB 3NJMA 2C7FA 2QDVA 3DVFA 5LAXA 1AMXA 4AZ8A 2FHFA 3SBRA 4JFEB 3F83A 2DBLL 4DNLA 2O6CA 2IPTL 5B1JC 3K2MC 3LVEA 2EECA 5I66B 3CFUA 1UCBL 4Q4EA 3UAAA 3V7MA 4AQ1C 4F58H 1AS6A 2QPEB 1VPOL 3MO1A 3WYRA 1DLFL 1D5ZA 2QQNL 4HIPA 4Y5XB 5JHLA 3LAFA 2H6OA 1ZV2A 5EF3A 1U93B 1MG3C 5KSAC 1TZIA 3ASWA 4Z95L 2EDXA </