1NFDF

An alpha-beta t cell receptor (tcr) heterodimer in complex with an anti-tcr fab fragment derived from a mitogenic antibody
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
222
structure length
222
Chain Sequence
b'EVYLVESGGDLVQPGSSLKVSCAASGFTFSDFWMYWVRQAPGKGLEWVGRIKNIPNNYATEYADSVRGRFTISRDDSRNSIYLQMNRLRVDDTAIYYCTRAGRFDHFDYWGQGTMVTVSSATTTAPSVYPLAPACDSTTSTTDTVTLGCLVKGYFPEPVTVSWNSGALTSGVHTFPSVLHSGLYSLSSSVTVPSSTWPKQPITCNVAHPASSTKVDKKIEPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N15 ALPHA-BETA T-CELL RECEPTOR
molecule tags Complex (immunoreceptor/immunoglobulin)
source organism Mus musculus
publication title Atomic structure of an alphabeta T cell receptor (TCR) heterodimer in complex with an anti-TCR fab fragment derived from a mitogenic antibody.
pubmed doi rcsb
total genus 34
structure length 222
sequence length 222
chains with identical sequence H
ec nomenclature
pdb deposition date 1997-08-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1nfdF02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1nfdF01
1Z0NA 4OCWH 3AB0C 3WFDL 1TQBB 3KJ6L 1RIHH 4HXBL 1C5DB 2XTJC 3T3PE 5HHME 3L9RB 4IMLA 1CI5A 3FB8B 3RHWF 1PFCA 2WBJB 1MY7A 4WW1B 1C5BH 1F3DH 4PLOB 3R0NA 4PRHE 3VFTB 4OSUH 1HSAB 3AS3A 4YK4C 1Z9SA 5GHWL 3SEPA 4Z77B 4U1LA 3RWGB 5ICZB 3MV8D 4PJDF 4XP1L 1L4IA 1SM3H 3HR5A 2DWEA 2W60A 5DJDA 5DHXB 2EDNA 4LARL 3FOLB 2XZZA 2XNAB 2OI9C 1L0YA 3IDMA 1PDKA 4D94A 5MENE 3VD4A 1RHFA 4OCMC 3BYYA 5IROC 4ZAKC 5IEHA 3VXSB 3K3QA 1MJ8L 3CFEA 3ZDYF 1OD7A 3WFBL 2DD8L 5BVJA 5KANI 3OAZH 4JY4A 2VE6A 4ELMF 3PGDA 1VFUA 2DMBA 5LGKA 5EO1B 2WW8A 4QHNB 1FZMB 2XG4A 1FBIL 1QTYT 5KN5A 1NCAL 1IEHA 4KTDL 4P2QA 1JGEB 5I73C 1KN4L 3U36A 4Z8FL 2JF1A 2A73A 4N0FB 5E6IA 1G7MA 2ZG1A 1BMGA 5C8JB 4WHTB 1DN0A 4IJ3B 3UYRH 4OV5B 4GT7A 3DBXA 4NKIH 1DQJB 1OM3H 3NMEA 5CSZA 4K71C 5A3ID 4BYHA 4U1NB 5T3XL 2EIZA 5CEZD 3UJTL 1CQYA 3FQUB 1I4FA 2ZUVA 4Z0XA 2I9LB 2AGJL 3TLRA 4NWTH 1OLLA 4LLQB 2L7JA 4UDTB 3JWDH 1KCRH 3QFJD 4H1LG 3RNKA 4L8BB 2XWBB 1HI6B 3C6SA 1OSPH 5F7UA 5KOVC 1DLHA 2YD9A 4RBPK 3FT4A 3HFMH 2MQ3A 1UCBL 4MA3B 3M1BB 3AC0A 6FABH 5IR1A 1QD0A 1Q9KA 1NLBH 1JHKL 4GKSA 3UTOA 4KDTA 4OF6A 4PV8A 1GZPA 3OB0K 1KSRA 3BYTA 1CG9A 3VXRB 4LFHD 5DDHA 2VABB 4MB4A 2FATL 3U48A 4CJ1A 5JDSB 1JGDA 1IGIL 3MLTA 4MLIA 2VNCA 1IFHH 2A74B 3O81A 1A47A 4M7ZB 2DQGH 3GIZH 1G0YR 1HINH 4I0PC 5T33H 1UB6B 3QWRD 2XTLA 5GGRY 2DLFH 4WHYG 1PQZA 1BJMA 3K80A 2FJFB 3IF1B 5ALBH 3FFCE 3PGCB 3RKDC 1GC1H 4MA1B 3MNZA 4HIEA 4MSWB 2HFEA 3DETC 3V7MA 4H20H 4ZG1A 1JL8A 1P4BH 3U4BL 5D9SB 1KN2H 4XNMB 2XN9B 3LZFH 2ZPKL 3I02B 5HGBA 3ARDC 4CADB 5FO9B 2R4SL 1KJ2A 1B4JH 1ZLWK 1A9EB 2AKRB 1TJIH 1MCIA 3RX7A 4DKEL 3KPMA 3RDTA 1U3YA 1XZ0A 1MIML 4JO2H 2OYPA 1Q94B 1W72B 1EH9A 4Q58C 3OQ3B 1WTGT 5E99L 4ONHB 4ZQKB 3VRJA 5FCUH 5AAMA 2NY2B 3VG9B 5C0BA 4F33B 1MCCA 5IFAL 1AFVL 2A9ML 5E03A 4WY7L 1U58B 2I5YH 4HV8B 2D7TL 4XRCB 4PRBA 4AG4H 3HPLA 5C0JB 4Q9BA 5IB5B 1AGEB 4JPKL 3UTZA 2P8MA 4OCXH 2R23B 1CQKA 1HQRA 2IALB 3QDAA 4P49A 3MRIA 3EJJX 1AHWB 2NY1C 4AQOA 1AGDA 4XBGA 4ZD3H 3OR6B 2W0FB 3EFFA 4QTIH 3BDXA 2BC4A 2FJGB 4ODWB 4Y2DD 5D7IA 5IOPB 1A0QH 1D5XA 3X13A 2VDOH 4U1GB 3IDJA 1FZJB 4ODHL 5HDBE 3O8XB 3UZEA 1NL0H 1QFOA 4NWTL 5ESQA 4LCWB 5AYUH 3SQOH 1T89A 5B39B 5CMAB 2BXYA 5TJWK 4MJ6B 2AEWA 2VUOA 3V5HA 2YC1B 3KPRE 3QJFA 4NQDE 3BAEH 1MRFH 4PLJD 4JFYB 4KRPC 3RNQA 3CK0H 5K59F 3TWCL 5I0ZA 3PWVA 3WS6C 3C2AH 4Z7NE 3SE9L 4RISL 3UROR 5GS1C 4UV7L 4HWBA 3B5GA 4OKVB 4XPBH 3DI3B 5IHUH 5BZDB 5KVGH 3SO3C 2YPKA 3IU3A 5F3HA 1MFNA 1KB5L 2YPLD 4QHUB 2AXGB 3VA6A 3P4MB 5BW7C 3B8SA 4QF1B 3WHE1 5JPMA 4WGVB 1CLOH 2L0DA 3D6GA 3W2DL 5HVHB 1RMFH 1R5IA 3T0XA 3ZKMC 4WNQB 1U3HC 3IB4A 2C3VB 3K8LA 3BKMH 3QIUD 5ICZA 1CLZL 2V2TB 1MUJA 2NY2C 3VG9C 2H2PC 5CP7B 1S9YB 3NA9H 1CE1H 1IAII 2A6KA 2DQCL 3NAAH 2XNAA 5L2KE 3UJJH 5GRVL 4RMTA 1RIHL 2FX9L 4HXBH 4NCC2 1T21A 3OZ9H 1QSEB 3O6FD 2K3TA 3AXLA 4JFOB 4APQA 4HWBH 1OAUL 3GSNA 2HP4A 4NQVA 1N7MH 2PUQT 4BKLA 2BDNL 3T08A 4X9GA 1IAKB 4JZOA 15C8L 2ZSWA 4PRDA 2PCPB 3L3HA 3JWOH 3OGCA 4XWGH 2OP4L 3P9MA 2ITDB 1BX2A 4WO4C 1FV1A 4R0LA 3C5JB 4HH8A 2WIIA 5IJVA 3QQ9C 3JTTB 4I13B 4JM4H 3HE6A 2WM0A 2ATKA 4WUUA 5IMKA 2BNQB 3VFPB 3IFOB 4PJ5D 3G6DL 5HHVL 1JI2A 3QCTH 5IJKC 1DQJA 3IU4H 4HK3N 4IDJH 1EXUB 5E1HB 1BQHG 3LAFA 1T1ZB 2X4RB 4P3DB 1OAKL 5HXMA 5D6CA 3FQUA 4Y4FB 1I4FB 4N1CA 1BQHB 3QZWB 4X7SH 3TJEH 5IQ7L 3D3VD 4KUCD 5JNYB 2P8LB 4M6NL 1J8HE 1FJ1B 3ARBB 2DI8A 3UC0H 3KHOA 3E2HB 5E6ID 3VFGH 4K8RH 4QTHA 2DMKA 1XH3A 5HVGB 1T83A 2MMXA 4I2XB 3RAJL 5DO2D 4Z78B 2EKJA 1EFXB 3IDGB 4KTDH 3TZVC 1A14H 2HJLA 1WV7T 4IRSB 5C70A 1MCNA 1JNHB 2QSCH 1GGIH 2NY4D 1TJGL 3EOYG 4X4XA 1MJJA 1RUQL 2E6JA 5D2LF 4MXQD 3ZMRA 5CGYD 4HMEA 4U0RB 1KUMA 1LO0L 1MPAL 4P5KB 1MCHA 2F8VA 4GAFB 4XCYB 5JZ7C 1JGLH 4HBQA 4Z0BL 3BKCL 2GY5A 4CNIA 1C7SA 1CFBA 4YO0A 5T1KA 5B3JF 1RHHA 3GHEL 2X42A 4KRPB 1KEMH 1ERNA 3SY0A 3LN4B 4ODUB 2PYFB 1M6OA 4ZUSA 1BM3L 4BH8A 2BVOA 5DSCB 5JXED 1S7UA 4JPIA 4YBQC 4MNQD 1Z5LB 3CSYA 4FQXC 2WUBL 3PJSB 5DC0A 1GGCH 4JKWA 2OK0H 4FQ1H 4XCCH 4M61A 1QSFE 4QGTA 6CGTA 4ZSOE 3L6FB 4NC1C 1CDUA 3FO1B 1DQDL 5H94A 2VAJA 5ESAA 1X3DA 3V6FB 1NAKL 1MRDH 2V7NB 3E8UH 3WHXA 2ZZUT 2HT3C 3NFNA 1RZ8B 1J05A 3MR9A 4MD4A 3CFBA 3KYNB 4Y5VB 3ARED 3QQ3A 4IOIB 3FRUA 4PJIB 5TGBA 1OGAE 2EYSA 1NMAH 3C6LB 4W4OA 5T5NG 3TO4C 3VJ6B 3BMVA 4OCRH 2J3SA 2C4FT 2PNDA 1GC1L 3SKOA 4GMSH 3WFEH 1V3KA 4UUJA 4UT9H 4WW2A 4AH2B 3Q3GA 1ZA6B 1GAFL 4D8PA 3IYLW 3TYFA 5DJAA 3EOAB 4LP4A 5JIHA 4P59L 3RHWK 4N0CD 5B38G 5FDWA 2NX5E 4QCIA 3MRLB 4KKNA 4HGWA 4I5BB 3OR7A 1NGYA 2WWKO 1KCUH 1KYOJ 3DX7B 4KKCD 4H5SB 1LE9B 4YDJA 5I9QC 5I76A 3W81A 5BCAA 3D0VB 4KTEH 4I0PD 4YPJA 2XI9A 4M03A 3PABA 3IGAA 3T3PF 1U36A 1ZVSA 5DUBA 3GMQB 3DURB 1Q0YL 4M5ZH 2X6MA 4XMLL 2HKFH 5B39A 5GSVB 3G6AA 1LDPL 3C5SB 4GUPA 4ZTPH 4KJPD 4MQXC 3IKCA 2A9NL 3LMJL 5KVEH 1MF2L 4YR6B 3U9UB 3DX6B 1HH9A 4XPHH 3UEZA 5TDOB 4MWFA 4E0RA 1F4XL 4LBEA 5F72S 4JY5L 2EKSB 2ZG2A 1T89C 3MA9H 2AJ3A 4TNVF 2ERJC 5AUMA 5IIEA 5JW4R 2VH5L 3MUZ1 3KWWB 3O6FA 1CICB 1LK2A 1AO7B 4CN1A 1B0RB 3RWHB 5EU3B 2H8PA 5F9DC 2ZNXA 1JZ2A 3QEHB 4M48L 3NPZB 3SDXE 4Y7MA 1X6LA 3UTPE 4HEPG 4OLWL 1YPZF 2Z8RA 4FQ2H 4U1IA 3DVGB 3KPTA 3TBYA 3RVUD 5FXCH 5ISZD 3C8DA 4R4BB 3PGFL 3BQUC 1IEAA 4WO4D 4L3CB 3W0WB 3KG5A 3BEVB 1YPZE 4Z76A 3CH1A 1QOKA 4X0KA 5IBLC 3VXOA 3K4AA 4F8TA 4Q0XH 1DP0A 1ZHBA 4MMXC 3LV3A 5AZEH 5E2TL 5I1IH 2AV1B 4J1UA 3LHPH 4F3FB 3TBSA 1V7NL 1MI5E 5FEBA 5D70H 3VWKB 5DMKB 3HC4L 5EOCJ 2F19H 1JV5B 1YMHA 4DN4H 1A7OL 5SWSB 5IK3A 3AXLB 2XFXB 2VZ3A 4X4YB 4OLUL 3D0LB 2HLAA 3QNYA 3B2VL 2BERA 3WNLA 5DRWB 3HB3C 1TNMA 5DF0A 3VG0H 3S35X 3HZYB 3DPBA 5KN5B 4NFCA 5CWSA 5DMJB 3MSPA 1JBJA 5HPMB 2BNQD 1VGEL 4JHWL 1G7MB 1NAMH 1TETL 5C09B 4NWUL 1IEBA 4WO4A 2W38A 4PJXA 3GDBA 1VGKB 4OUOA 3GIVB 1KJ2H 4ONGL 2Y07L 3WXVH 1M4KA 1PKQB 4XP4H 4JFEE 1F58L 4LLDA 4HHAA 1W0VB 5GS0L 4M5YH 3ZL4L 2VLME 4K3GA 4XC3L 2XZAH 5CBAB 5FOJA 1FP5A 3BVNA 4ELKA 2FBJH 3Q6FA 4JGUA 3RWFB 1G7PA 1MHHA 4IRSA 2JCCE 5KSUB 1FL6A 4S1SH 5T1MB 4L4VD 2M1KA 2YRLA 1B6UA 3IU4L 1LK3H 4IDJL 3VFUB 1D9KC 3BH8A 3S37X 4NPYB 1G9EA 4I4WB 3DLQR 1GYAA 2VXVH 3GJFA 1JNNL 4Y2DC 2JCCF 5ACZB 2AABL 5CJOH 3RVTC 1AR1D 5D7KD 2H32B 2R0LH 3VGAC 1KPRA 4S1QL 4IRJD 4WFHE 1JWUA 3ZLQC 2MKLC 1OAXL 3WO4C 2HAZA 5HI3D 1PEWA 2CUHA 3MUGA 3BH9B 3QNXB 4MDJA 3RTQD 3SE4A 2P7TA 4XAKD 5BV7C 4KROC 3BE1L 2ZCLH 4JFEA 3VXSD 4AIOA 1MELA 1CD0A 1KPVA 1INQA 4UV4H 1FO0A 1FVCB 1UYWL 5IW6B 3N06B 4G8IA 4U49A 2ZUUA 4XPTH 3OHXB 2QR0B 1I9EA 3EYVB 3VXQB 4PGBB 3AREB 1DEEA 1OVZA 4P4KC 2ZUQB 2JIXD 1U8HB 2OM5A 2BJML 3QUMA 4KKBC 5BS0E 2G60H 1T0MB 4ONHA 4XX1E 1CR9L 4JM2A 3KVQA 1EEYB 1J87A 3STLB 5E9DD 5KS9A 2FBOJ 3OKEA 4NBZB 5T1LB 5J6HA 1QBML 3SN6N 1PX4A 4PTUA 3P3YA 5ALCH 5FYKD 5IB5A 4GLRH 5GGVL 2P8MB 5T5FH 5I1CL 5HI3C 3IDXH 1EHXA 4JPVH 4NM4L 5SWZB 1D5ZB 3D69B 3Q6GL 5ISZB 4MD0B 4GG8B 4HUVB 4U6HB 3ROLA 1P53A 1G0DA 5HDQH 1UC6A 5IT2L 1L6ZA 1I7ZB 4LLYB 2Y5EA 3RGVC 4ZTOL 2W92A 3KXFE 1R3KA 4ERSH 4PUBH 3IFNL 4UIMA 3D0VA 4JHBA 5GGSY 3UYPA 2FNBA 4LF3A 1T0NB 4ODSL 2Q6WA 5ITBH 5CINH 4G7YH 3SDCD 2GIYA 1SQ2N 2LVCA 4P2QB 4FXGB 5GGSA 2B1HL 4AYFA 2IPKA 5MEPA 1CF8L 3C5SA 4GUPB 1A3RH 2DM2A 3PWLB 2WBJA 4WW1A 4X9IA 2F5AL 1NC2B 2B4CL 4NRYB 1N5AA 3NVQA 3W11C 2WSKA 3OKOA 1JHLH 4NQCE 3C5ZA 4Z7OF 4GRMA 4JR9L 3GMPB 4YHIB 5C08E 2R2EB 3WYRA 4Z7UB 4UTAL 3AGVA 5HGDA 3PG2A 4LLQA 4KVNL 1HZHL 3MV8B 1D5IH 1AI1L 1N0XL 4V1DE 4X4ME 3RWHA 1G7IA 5GRJH 3HNTL 3CD4A 1JRHI 4Q6IB 4PRHA 1A7QH 5DFTA 5FYJE 3GJEB 2CK0H 3BN9C 2ZP0T 1PEZA 3FO2B 1UWGL 4UILL 4R96B 3WDIA 5EZIL 5D4QA 2P46B 4KVCH 4XVJH 5F7EH 2X7LA 2EDDA 3VD7A 5IHZA 3P0VH 2W91A 3B4NA 3NCJH 5I1EL 5T3ZE 4KGJA 2BNUB 3IAQA 3V95A 4I3RL 1C12B 3HI6L 4QHNA 5EIIB 3JWNC 4RGNB 4P9ML 3P4NA 2NLJB 5EUOA 1QKZH 3THMH 3PXJA 2HT4C 2LV4A 3IETA 2CJUL 4G7VL 2C26A 3BQUA 5CJQL 3WJJC 3X3GH 2BOBB 2B8OT 1OSZA 3PQYE 4B7IA 4KFZC 1R24A 4MNHA 1XF3A 1EO7A 4LHUA 3UPCA 4MAYA 2YD1A 4WFEE 1U8NB 2P5EB 2PCPA 3VXUA 2OQJA 4CVZB 3MX0A 4MVBD 1ACYL 1B6DA 4GRWE 4FFYH 5KSAB 4XTRC 1HDMB 1WVZA 4M6AA 4OLEA 2VDOL 5F6HJ 4POZC 3KNBA 4JDTH 1M71B 1UZ6F 4GRWB 2BMKA 1GZPB 3G9VA 2I07A 1F8TL 2J6EA 4M7LT 4OIIH 4M6OH 4N8PA 3IT8D 1DANU 4G9FD 4FZEH 3I2CH 4PJ8A 5D7LB 5JOFB 2P5EE 1MCRA 3ARFB 1KENH 3MBXL 1QHPA 2H41A 4S2SA 1WLHA 4GKZB 5IROA 1WBZB 4ZTOH 2YUWA 1A7RL 2NXZB 4K3EL 5FM5M 2EXYD 2VC2L 3LEYH 1HQRB 1Z3GL 3AS2A 1IBGH 4DZBA 1FH5L 4TVPL 1QA9A 1U3JA 1EPFA 2OL3B 3B9KC 1PG7H 1K8IB 2IAND 2CK2A 1T20B 3RWJA 1JNHA 3KPPA 4NQUA 4P46A 1INDL 5EBMB 5EZJB 4UINH 1D5BB 3HZKB 3BIKB 1PLGH 4Q9CA 1MWAA 4I4WA 1MAKA 2X9XA 4CADA 3A6CL 1N8ZB 4MAUH 2ZG3A 3PP4H 1TPXC 3WIHL 1J12A 3QXAA 1XF1A 4AM0A 2Y7QB 1I7UA 5IGXL 3EJZD 4XT1C 4G8GA 2D2OA 4L8SB 3GNML 2XYCA 1RJZB 4WV1A 4RGNC 3BZEA 3SDXA 2Q86B 4Y2DA 1S9KC 4I77L 2X4OA 3MODL 2C7UB 5C0EA 1SEQH 5DUPH 1S7WA 4XP1H 3GM8A 3BO8B 5MEQB 4PRBB 2C5DC 4PJGF 3QPQD 5H94B 3V4VH 4PB9H 1QFUL 2KDGA 3L95B 2R23A 3HHRB 2VJXA 5LGJB 4OKVA 2LVEA 1KIQA 5F7MC 1ETZB 3EDJA 1B9ZA 1WZ1H 3FRUB 4HK3J 1MFCL 4CMHC 3VWKD 4KMLB 4JO4L 5FGBA 3QUYD 3SDAA 2AEIT 3QEGL 4CU6A 1YEKL 4O5LL 3CXHK 2UWEE 2DBLL 4OQTA 1JTPA 1N5YH 5GISL 4AH2A 1NGXA 2ZKHL 3KXFB 4MDIB 1A6PA 3G5VA 3BD5A 4LSQL 4OM0H 4HDIB 1VFBA 5EOTB 1SJHB 1NGWB 4NBYB 5TDNB 2Q8AL 4XWOD 4PRIE 4HUVA 5IVZA 3T2NH 5IEHB 2OR7A 2YD4A 5L88H 4ONFH 4F7MA 1UVQB 4HJGA 3QJFB 4EI5C 4Y1AE 5JXAH 2MPAH 3VGEA 4KQ3H 2VISB 5CJ8A 1D6EA 1DLFH 1ROWA 1EV2E 2Z8SA 3M17B 1W2KT 4TSCH 1H8OA 2UUDK 2A6IA 2CH8A 2BFVL 3MOQA 4HCRH 2EZ0C 5IMKB 3MRKB 4YLQT 1QR1A 5I8OH 5DQ9B 3HMXA 4F37K 3DYMA 3DBXB 3NIFF 1A3LH 3OKDB 4NFDA 2BSSB 2DM7A 4NRXB 2GUOA 1IT9H 1CT8A 4Y4FA 4KWUA 1R5IB 2RBLA 4K7PL 2FJHA 3TH2T 2EH7H 1XF4B 3OBAA 1J10A 4JFED 5BW7A 3BPCA 2LQRA 4NQDA 1CDGA 4Y4KA 4KKLC 4NSKB 1CGWA 5C0GA 3K8KA 2MCPL 4G6MH 3BFOA 4NC2B 3TV3L 1PG7X 3GSXA 1T1WB 5E8EA 1AGBA 3ROOB 1QACA 1FE8L 5F1KC 3FHQA 3MLRL 3RVTD 2AXFA 3FKUS 1YY8B 1NBZB 4YXKL 2IPUK 1RUKH 3MLTB 2X9WA 1BX2B 1RJLA 4HX1B 3WIIL 5J11C 4KZDH 4U3HA 1YNLL 4R7NB 4WUUB 3PWPE 1YUHA 3SO5A 4JDVA 4JPVL 5F89A 4D9QD 3Q1SL 4ZODA 4Y8AA 4WFGE 4U33A 2D7OA 1HHGB 3DXAD 1A6UL 2OZ4H 1Z2KA 3NCFB 1T2QL 5F1NA 2ATPB 4MNGE 3GSUB 4ZAKA 3U0PA 4DGYL 2KH2B 4ZUTA 1NCBH 4HG4J 1YEKH 1MLCA 3H3PH 1KLFA 3ZZ1A 1QFWI 3AFLA 5HHQA 2VR9A 2NTFB 3L3DA 4ZFGL 3BMWA 2YHGA 5TQ0L 5F1IA 3LEXB 4DZ8A 3GMMA 1DLFL 2EYSB 4PGEA 5IG7A 2NY5L 2QTEA 5JOPD 2CLZB 5TQ2L 1U2HA 3V8CA 4LL9A 3LRHA 1G84A 5DC4B 4XCNB 3HCVB 2AAVA 2EDJA 3ORJA 4LIQH 2VLRB 4TRPH 5FYKU 2PO6A 5LGHL 3QUML 4PR5B 1AY1L 2C1PB 4C83B 3G5YB 4NN7C 5L0QC 2HJKB 5I8CA 2FH6A 4FZ8H 4OZGA 4YWGL 5L2KA 1MFDH 4KPHL 4L4JA 3MRMB 3PHOB 4WTWA 1A9BB 4XBGB 3NGBB 4FXLA 4ONOA 2XKUA 3MNZB 4MSWA 1ZLUH 2VDQL 4PREA 3UTQB 1OY3B 2B5IB 3D3VE 4JDTL 2HYMA 5I76B 4RGNE 2AI0H 4PJIF 5L2JA 5BXFA 4WI2A 2ARWA 4IHOA 2G9HA 3T1FA 3GMQA 4O2EA 2VL4A 4PJCE 3U46B 3BQUD 3D2UD 4KQ4H 2D7QA 2DYPB 5IQ9A 4Z5RB 4FQXA 1Y6NR 4TSAH 4M1DL 4XBPA 4S1RL 1ZANL 2NY5C 2XA8L 4PJGA 1ONQB 1IM9B 4YUEH 4OBSA 1KBGL 5DRNB 3LCYA 5E2TH 1O7SA 2JJVA 3VFTA 1XMWA 4J8RB 4NNXA 2QQLL 2QQKH 3SKOB 4WV1C 3G5XB 2DQUH 3MV8E 3O45A 4OTXH 2BY0A 2VERN 5DHYB 3O6FB 1DQML 1KELH 1FE8H 1BGXL 3FQWA 2IALA 2NY3C 4JVUA 4Y4HB 3PDDA 3C8KB 3QCUL 1S7SB 3QRGL 3QUYB 1HEZA 4PBVC 4JHAL 2K7PA 2YEZB 3CFEB 1MOEA 3EDEA 1RK0A 4RRPA 1NAML 4P2QE 3ARDD 1U8PA 5DR5H 3FZUD 1NBVL 4ODTL 4DN3H 4NRZB 1GOFA 4DJMA 5D96C 2HRPH 4PJAB 1CD1B 3GK8L 3WIHA 4JRXD 4PJ5E 3DMMD 2D7TH 3SDDC 1QSFD 1CDCA 5GRUL 4TUKH 4ISVB 1XR8B 2IANA 2A73B 5EN2A 1D6VL 2ESVA 4K3EH 5C07E 3VWKA 3JVGA 2ESVE 5CSZB 4YE4H 4YGVB 3SDAD 4JFOA 1KTLA 4GO6B 3MXWH 3GSOB 3NABH 1TZGL 4RA3A 2YKLH 3EJZC 3HN3A 1WZLA 3DETD 4GAJH 4UDTA 1SYSA 1NPUA 3CUPB 2A6IB 4LSUL 1MCOL 4H8WL 1BIHA 1OGAB 4UOW0 3ULUC 4L3ED 3HZMA 4XH2A 1R3JA 1DLHB 5IWLA 5JO5B 1FN4B 4HWNA 3MLYH 5KTEH 1ADQH 4F7TB 1OGTA 1ZT4B 2AABH 4PJFF 4X6EB 4YPGA 3X3FL 4P48A 3Q6GH 5T1DH 3R4DA 5F96H 3P4MA 5CSGA 8FABB 5E08H 1KULA 4WFFD 2NZ9D 3U7YL 5DDHB 4NQSB 4M62L 4OZ4A 2VABA 3K81A 3P11H 3IS0X 3RZWA 4ODBD 3QWQB 4JJ5B 3MV8A 4PJFE 1W72H 2F54B 1Y0LB 4TSAL 5F21B 2AJXH 1JGVH 4EN3C 5I74B 2VH5H 5I19H 2YS4A 3GO1L 1V8HA 4QHMB 5SX5H 3GMLB 3LKNB 4AT6B 1JF1B 2EXWC 3QQ9D 5K59E 1YEIH 4DK6A 2WZPD 4R96A 4A6YA 3LEVH 1NDGB 1EDQA 4BFIA 2HJLB 2ZJSH 2KUTA 1VPOH 3H3BC 1VCAA 5IK3B 2LTQB 4K7PX 5IHZB 2PYED 5FUCC 3H2WA 2IEPA 1OOAA 3MXVH 4JZOB 2VDRL 3RIAK 4BH7A 3QEQA 3T0DA 1EBPA 3H9SE 3LKPB 4QRQA 1EEUA 4FA8A 1CFSB 1YYLL 4R0LB 3GJFB 1XGTA 2IFFL 4YZFE 3PWNA 5EO9A 5CD5C 3D3VA 3F58L 4UAOC 4BFEA 2DQUL 4RWYH 5C0FB 2VXUL 3CSPA 4X98A 4JREC 3SGDI 3T77B 4M02A 5I18L 3G04B 5FECB 1RIUH 4JDVB 3MUGB 4KUZH 1VGKA 5A1AA 5IESL 1REIA 1XF3B 2PO6C 4UT9L 1JFQL 1BQHA 3GK8H 2DQGL 3SPVB 1U8NA 1IC7L 1FJ1A 3T0WA 1R3HA 3NIGE 5LXGL 4CMHB 1YEDA 4KRPD 4AEHL 3JWOL 1MLCB 4FFZH 3WFCH 1PJ9A 1X9QA 2UY6A 1VB9A 4FABL 4WRLA 2PYEA 1EO8L 1JNLL 2CGRH 3WIIH 1N64H 3OXRA 4Y5VA 1F6FB 2EC8A 4LEXH 1MCQA 3OJVC 1HHJA 5FUOL 3PL6D 3PWUB 2OXHA 5C2UB 3OL2A 1KCVL 4X4XB 2VDPL 1EEYA 3VXUD 4P4KA 4Y5YA 3VE0A 1XCQB 1KT2A 2X5PA 5BJTA 4X7SL 3QDGD 4HUKB 3LRGA 4IRSC 2IQAB 4O58L 1FZJA 1WBZA 4LIQE 1FAKT 1KPRB 5IM7A 4PRIB 4OGYH 2NY2D 5DD5L 3EOAA 2E9IA 3QIUC 5FHAH 2GK2A 2IQ9H 1BLNA 4JCMA 3AM8C 4FP8H 4NKQB 4U2ZA 3U30B 3QIWB 3V5HB 4OF7A 2GW5A 4N90D 4Z7VF 5GRXG 4Z7QE 3WS3A 2EH8H 3QI9D 4XZUA 3LQAH 2V7HA 1AP2A 3GO1H 1RZ7H 3CU1A 1K8DB 1J1XH 3CXDH 4EBQL 4ODVL 2BVUA 1KOAA 3M8OL 2J8UE 3V52L 5C0AD 4IMLB 2G5BB 3X14A 3LY6A 1T3FB 4FQJH 2XG5A 4XBPB 4QRUA 1Q9WA 1T4KA 5DTFA 3TJHD 4F9PA 4UQ2A 2NXZC 3O6KH 4NRYA 2J12B 4NZJA 1P9MC 2WK2A 3E6HB 5FO8B 1IGFL 1AO7E 1G9NC 4YHIA 2IFFH 5J6HB 3R06B 5AZEL 5I1IL 4EUPB 3BZFA 4PP2A 2EE9A 2GSGB 3D48R 4R8WL 1ZLWH 4G42A 5DHVB 4HKBA 3C8KA 2R1YA 1CL7H 4IRZL 1F02I 1D5MA 3GJEA 3CVHH 3VCLB 3QDJE 4MD0A 5ITFA 4K9EH 3ARGB 3BDYH 4OZIB 4OD1H 4CDHA 5FUCE 4LPVA 3VGAB 4LLWA 1NCNA 3GSNB 4YQXH 3PV7A 1IAIM 4JLRA 3ZTNH 4YDJB 2O5ZH 2NY0B 1UM6L 5EO1A 1X5ZA 1G6RH 1IC4H 5GRVK 1RULH 4G5ZH 4B41A 3FN9A 3SE4C 5IJVB 4ZFOA 1DBJH 1PSKL 3ETBF 3DROB 3SKJL 1KCRL 1RMFL 3MRFB 5LBSH 2P5WD 4YR6A 3FO9A 2NZ9C 2AJYH 2E9BA 1UVQA 3EHBD 3B9KD 1VADB 2ARJQ 4XPFH 3D0LA 1RUPH 1XEDA 4MAYB 5I15L 3WXVL 1J1OH 4PJXF 1EGJH 3C5ZB 3VH8B 1DFBH 4OCYH 5D7LE 1ACZA 4HSQA 5FUOH 3ZL4H 1AO7A 4GBXB 4NO2A 4JFZH 2W59A 2B4CC 3K4DA 2IWGA 2XKNB 4YDIL 1EZVX 4H8WC 3D85A 5HYQA 4NN5B 1HHHB 3VGDA 4MA3A 4ZDHB 3EFDL 3K2MC 1KB5B 5FO7A 1KCLA 4ZO8A 4Z18A 3SJVA 1FIGL 3HI5H 2JELH 3UTSE 4YUEL 3E3QE 2YMXH 2VZVA 2QHLA 5DD0L 4K3DL 5IKCB 1NSNL 3S4SB 4AL8H 1F4XH 1P7QD 4XHQA 1G6VK 1T0PB 3P40A 5C2BL 2MJWA 5ETUB 5DJXA 3ULUE 3IFLL 1RZFH 4L4VE 1AJ7H 4XMPH 1RIVH 3MBEC 5JW3H 5JW5B 3WD5L 1FGVH 5H35B 1OSZB 1A4KB 4LCCA 1W8OA 3MLYL 1FZKB 4HJJH 1GXEA 3TCLB 2P5ED 3K46A 2BSTB 5DEGA 3WBDA 1HIMH 5ID0A 5CBEA 4MJ2A 2V5RA 1Y18B 4HKJB 3HC0A 5C6TH 2AK1L 3FO1A 5FGCE 5LG1A 3RPKA 1WAAA 2AJZB 2WBJC 2WV3A 5AWNH 2WLYA 3HI1B 4WWKB 4NGHL 2EE6A 5KSAA 2DQFA 5HYEA 4PJ9D 4F8QA 4ZFZA 2DLIA 3NTCH 5FF6B 2EC9T 2J5LB 3CFJA 4PS4H 4TULH 1J0IA 3I6GA 2PR4L 4I2XE 5E70A 4DTGH 1NBYB 5C0BB 3VJ6A 3CCHA 1L7TL 5C08B 4QOKE 2WBWB 1J8HB 4XRCA 2PXYD 4GKNB 4U6XA 1K5NB 1P6FA 5LCVH 2X4QA 4RMUA 1I7RA 3QT2A 1VENA 1QFWL 3DTXB 5GIRA 2EDRA 1C16A 1RV6X 2C4XA 3BN3B 4D8PB 3BUTA 1YNKH 3ESVF 5BV7L 4FQQA 1QG3A 5C0CB 5I0DA 4TSCL 5FDWB 2BOCB 5C0DB 2B1AH 1HHIB 2BHUA 4N0YH 4O2FB 5DZOA 1X5HA 7FABL 5DJ2B 5EBMA 1CLYL 2AK4A 3EFFB 1V7ML 1V3MA 5JR1H 2VKXA 3VGBA 3WUZA 4LCYB 1VEMA 1ZVHA 4XGZB 1CFTA 4NO5B 4V2BA 3GHBH 3KPOA 4YHML 3CPLA 4R90L 3IGAB 1XCQA 2FO4A 4I18C 4KDTC 4O51B 2AGJH 1J5OL 4GAGH 5CGTA 1S9XB 1DE4A 2PO6B 2M26A 4KY1L 4HGKC 1JIBA 2LU4A 3SDAC 2FIKB 4NJ9H 4MAYC 5I19L 1C08A 3WFHA 4ZFGH 2IMNA 1K3IA 1YQ2A 4M1CC 3U83A 3QNXA 1U3HB 4MDJB 4Y2DB 3QO1A 1F5WA 4UTAH 4L9DA 3TH4T 4PPTA 5JUEH 1HWHB 3RL1A 2CUMA 2UWEA 1F6AA 3M17A 3S35H 4GRWH 3QISA 5FV1L 2F5BL 4LAQL 5BS0B 1FYTD 4I1NB 4J3XA 2QR0A 1IGJB 4X8XA 4ZFOL 4GH7B 3D1MC 5EC1B 1N59B 3STZB 3L3KB 3QUMB 2XXCB 2J8UA 4KV5E 3F6IA 4F9LA 1AIFA 2FHCA 4UBDC 4WFED 4PRAA 4JM2B 1GRWA 3GB7B 2FX9H 2XWTA 5IFJA 4YHPB 2F8XC 2BY1A 5HGDB 2A6JA 5DUPL 3NGBC 4HJJL 1JTTA 3FB5A 2A83B 4PP2B 3EYQC 2FZ3A 4NQDB 1YECH 4HDIA 1RFDL 2ZSVB 4UB0H 4AIZB 2JJTA 3H7LA 4FQIH 4BZ1H 1QLRB 3QUYA 2VDNH 4RDQG 1D5MB 3ILQC 3C6LD 1V3LA 3UO1H 4P9HH 1IQWL 1HILB 2VOTA 4LCWE 1AGBB 3ROOA 4G80A 4L5FH 1CTNA 1A1OA 2DDQH 5F7NC 1FYTA 1WBXA 4U6YA 2VSCA 1JZ7A 3FOMA 3PF2A 4R4ND 4JRYD 2PR4H 1G9NH 2CUIA 1U8KA 1YEFL 5DJCB 1N5YL 5BRZA 3KYMB 1PVHA 3B8YA 3MYJB 2VXQH 3DRQA 1QRNB 4OZIE 4JKKA 2DICA 3UJIH 4G9FE 4LEOB 3EGSA 3ET9F 1F97A 2PYEE 3BPLB 3O6LL 1OL0A 3GZKA 1K6QH 2P47B 5L6YL 4M7JL 3HE7B 3BGMB 4QRTB 1N5AB 3BIBX 3GHBL 4WUKL 4Y5XB 4YHYB 1A6WL 5DRZA 1P4IL 3VXRD 1YEJH 2VTFA 1YNTB 3MNVA 3DSFH 3KLAB 3O0RL 4YDKH 3P73A 5CEZL 1LO2L 1WT5A 5C0IA 4PJAF 2UUDH 5I1GL 1WCQA 3BPCB 1MCDA 2NYYD 3X12A 1JUFA 2WINB 4HMDA 2A6DA 5C09E 1IARB 1MHEB 1EFXA 1GGBL 3I85A 5C0GB 3FAXA 4O2CA 1RQ5A 3E6FA 4ZO7A 4YXLH 2BVEA 1KPUA 2IG2L 1U8OA 3SGEH 4LGPB 2W9DL 4DZ8B 4RCAA 5E8EB 3IVKA 43CAB 3ZE0E 4U1JA 2APFA 1F4WH 4PJ8B 3PP4L 4PIRF 3GRWA 4LAQH 1JHLL 4S2SB 3N85L 4MAYD 1BF8A 3LN5B 5GZNC 3HMWH 4U1SB 2A77H 2I60L 4ETQB 2BX5A 3IETB 5FYLH 4V2CB 3G5YA 1MCOH 1E28A 1P1ZA 4H8WH 4HUMB 5KVDH 1OP3K 1ZKAA 4OZGE 1YN6B 4M93B 3VWJC 2Y23A 3FQNB 4JFFA 2VLLB 4OFKA 3UBXA 3NZHL 2CLVB 4EOWL 1BQSA 1HSBA 1OLZA 2EIDA 1Y18A 2K9UA 2EC9U 3BZDA 1SBSL 3SKNB 2DQTL 4NT6B 2V6HA 5IW1B 4B0MM 3TIDA 4S1DD 3SO3B 1IAIL 1BOYA 3PWNB 3ZT6A 3HI1A 4EI6A 1I8LC 1URLA 2W1NA 3O9WA 3VXRE 4BK4A 2YPLA 3TGXA 1QQDB 3WNMA 3SDXB 1M71A 1IQDA 4BUGA 4KTYA 3U6RA 4WWID 5KSAC 5GISH 5D1XA 1G9NL 2D3VA 4FTVA 1R5VA 5MEOA 3LKRB 3OKEB 3P0GB 5C08A 1IQWH 1UZ6E 5D72L 1BBDH 4QRPA 2V2WB 4K71B 2ORBL 5GQBA 1BFOA 3MCLH 4E41E 3D85D 2DKSA 1CK0L 2W07A 3C2SA 1P84J 4NQTA 4DOHE 3PHQA 4G9FB 1KJVA 4HJ0C 2HJFB 4KZEL 4M5ZL 1T03L 1CD9B 1P4IH 2QQNL 4DGIH 2Z9TA 4P3CL 4XNXL 1HCFX 1PZ5B 5EZJA 2X4PB 2HWZH 3MRJB 5K9OB 5GGUA 4F58H 3T0EE 1GVIA 2UYLB 4HW6A 2Z4QB 5CD5D 5D7JB 2LU7A 2Q6WB 3OAYK 4F15B 2FGWL 4JZJB 4G8EB 2VL5B 1KIPA 2Z92A 1RVFL 3MACL 5D1XD 4EVNA 3VXSE 1RJZA 3B2UD 5ICYA 1IM9A 1M7DA 3OG6B 3GJFK 2X44D 5HSFA 1FNGA 5GRZA 4TUJA 3GSVA 1MY5A 2CGRL 4LSPL 4N0CC 3HNSH 2OX5A 1ZAGA 2EKSA 3RPIB 4G6AD 1E4JA 4PRPE 1KJMB 3LQMA 2F54E 3JUYA 3RZCA 4GG6F 3F12A 4JRXE 4NKDB 4OLXH 5E9DA 2DIAA 2DS4A 1H5BB 3FQWB 2PTUA 1I1CA 4QY8A 3U1SH 4Q6IA 2FB4L 5JO5A 4KJYA 1R3IL 2JIXA 4J4PC 4XI5D 3RWDB 1ITBB 1JCKA 4BQBA 4OGYL 3WL9A 3VMNA 4JQIH 4IIQC 4JY6B 1NFDF 2CIKA 3BISA 3NTCL 1NCTA 5HHMB 1LHZA 5LAXB 3TBWB 3BZ4B 2UVFA 1QSFB 1ORSB 4IOFD 4JRXB 3MV9A 1C12A 2P24A 1P4BL 4MYWB 2UZXB 4LU5L 5FKPA 3HMXL 4CAGA 1I9IH 2GQHA 4EOWH 3D39D 3FQXA 4PJEA 2ESVB 3CDCA 1YQVH 1FNHA 5TE6L 5IVZB 3OKKA 1DBAH 1HK6A 2OZ4L 1U8MB 4LLWB 2JJSC 3MV7B 1GJIA 2AXHA 2VE6B 4JN2B 5DVLA 2BSRA 3HNTH 5EB9A 5ICXA 3RL2B 3IDNA 3JVGC 2QLVB 1TCRB 1GIGL 4XC3H 1MWAL 1SY6A 2Y4SA 4GMSL 1NBVH 4ODTH 5DJCA 1E0OB 2JCCA 4AG4L 3WXWL 5BRZB 4LP5A 1ES0A 3U36B 4LMQI 1R3JB 4XNZC 3TCXA 4ZAKD 5CS7A 3OX8B 4KY1H 5BRZD 5E8NB 3LVEA 4N5EC 3DUSA 4LCIH 2H6PA 1S7XA 4IRZH 1HQ4A 2BMKB 2CDGB 3ME0A 3HC3H 3O11B 5EU4B 4OZ4B 4MNGA 3F7QA 1TFHA 3QPXH 4ZPTB 5IMOA 3Q0HA 5E8OB 4OFIA 2YRZA 3KLHC 1VFAA 2APTA 4ZNCD 2QSTA 3FT3B 1WTLA 1HHHA 4OZFB 1IGTB 4ODVH 2HKHH 3OXRB 4LRIA 1BZ7A 3G6JB 2CIIA 4U1HB 3RWFA 1DBJL 4FFWD 3H42H 1UJ3B 4RGOL 1WT5C 3O9WD 5FA4B 4DW2L 3RTQA 1J1PL 3U0WH 4WDIB 2NPLX 4XXCA 1UGNA 3NFSL 4FQCH 2QSVA 3VMPA 2P4AB 4P4KB 1L0XA 3IJSA 1HH6A 3LN5A 5JPNB 1VDGA 3NCCB 3A67L 3ALXA 4PJDA 4OZGB 4OI8A 1N2RA 4NQXA 3SDYH 3LSOB 3S5LG 3T77A 5H8DA 3G04A 1QR4A 5FECA 5JHDD 1X5JA 4NCDA 4R8WH 4ZNEA 3U9PH 3UO1L 4HAGA 4HS6A 5IBTH 3TNNA 3QDGA 2XXMB 2D03L 1A7RH 4OGXH 3P9LA 4OGAC 1CLOL 3MLRH 3ZHDA 2X4UA 5ILTH 5HGAA 4PJ8D 5C7XL 4OSUL 4DCQA 3MJ9A 2MQCA 3O2DA 1FNSL 3E0GA 1LEIA 2K7QA 2YA1A 1T6VN 1T2JA 5DXWA 1Q9WB 1T4KB 5F1IB 5ECJE 5GGVH 3MROB 3T0AA 3S88H 2IPUG 4IOFC 1UKQA 2HVKA 3PWUA 5IVXA 4ZPVA 1UXWA 4HWZB 2OL3H 2DQEH 3E6HA 5FO8A 4KUZL 4MHHG 3GRWL 4K23L 4P2YA 1ZWIA 1MFEL 3OZ9L 4N9OB 1LD9B 1BFOB 3AU1B 4U0QB 3MRGA 3MMEA 4KHXL 3H7BA 3QHTC 4PJ9A 1FNEA 2BDNH 1IC7H 3ZDXF 5IB2A 1S78D 2D0GA 1K4CA 4NM8H 3K4ZA 4HKBB 2R1YB 1YMMD 4POYA 2EYRA 2F74B 2YEZA 5HDLA 4U7KA 3T0EC 2JKXA 3PWPB 1QRNE 4UAOB 4WUUE 3BUYA 4XVSH 3GBNH 2AQ3A 4Q6IC 3QFDB 4YXHH 3VXPA 1OAYH 4D9LH 2Z4QA 2AV7B 3FT2A 4BSWB 1QBBA 2XA3A 5IV2B 1DE4B 3HE7C 2H45A 1JPGB 3VFWB 3FAWA 2VDLH 4KV5F 3BSZH 1VSCA 1BAFL 3MRKA 2LAGB 5C6WH 2N7AA 5HI4D 4H1LH 4PRID 2Z31A 2ED8A 3NZ8B 1FPTL 4PGZA 5EUKA 5DVMA 1UZ8A 1JRHH 4X6CB 2IPTH 2P1YA 4FOMA 3ZSSA 4F9PC 3U2SA 3HAEB 3WNPA 1GGIL 1KJMA 1CGXA 1W0WB 4EUPA 1K2DA 1PAMA 2EDQA 3CFDA 3TC9A 4LFHG 2KQNA 4ZXBA 4KJYB 3BI9X 1BZ9A 2HMIC 5AWNL 2P49B 1NFDA 1OP9A 1BM3H 3NIDF 1ZEAL 1KTRL 1VFMA 5C3LD 3ECBA 4QNPE 2QV2A 3D25B 5D93C 3T09A 3REWB 2IBZX 3P0YL 1J8HD 2RFXA 2EICA 3FFCB 4W4OC 1MJ7L 1BVKA 4HS8H 3D39A 4G6FB 4Z7OE 1WUNT 1Q72L 4KH2A 3W11D 1JYVA 2E9JA 3VXSA 3QI9C 4FFYL 3TBVB 2SEBB 1NEUA 3QXVA 4DWHA 1VADA 1MIEL 3QIBC 4PJBA 3VFMB 3PGDB 1CGVA 1G9MC 4DVBB 1IAKA 2BSED 1BFVL 3CDFA 3JV0A 3O6MH 5M7QA 1IBGL 1NGZA 5KS9E 2P5WA 3VFSB 3WFEL 2F19L 2XY1A 4M3KB 5IB3B 5F7FA 3MJ8B 1CXEA 3ZYOA 5DUML 4NKMB 1J5OH 4MB5A 4LPCA 1TTGA 4PJBF 4MCZB 1S7XB 1UQSA 4GAYA 2FX7L 2FWOA 5T3ZH 3TVMA 5I30L 1OP5H 1YQVL 5T1KD 4JG0L 1FH5H 4TVPH 3EAKA 4NHCH 1UT9A 3QZWA 2UZIL 1MNUL 2DQJL 3VWKC 3LKQB 1UWEL 3MLWH 4UDUA 4Y19B 2CDFB 3F8UB 1CXKA 5C0BE 4OFVA 1I8IA 4EJ1C 5J8OA 4PB0L 1XH3B 2ICWA 2OCFD 1EUUA 4ZUVA 4OCWL 5CKAA 3VWJB 3N1MC 3QHFH 3VI4E 4O2FA 1MCPH 3VMOA 1KIRA 3ZE1F 4HJ0D 2BZDA 3KHQA 2P8PB 1YZZA 3WN5B 5IWLC 1II4E 3HB3D 4WENB 5EZOH 3NCMA 3RQ3A 5I75B 4JRWA 4OAWB 4D0CA 4LRIC 1RU9H 4UI2A 5ERWA 2FO4B 4XPHL 1JRHL 2ICEB 3ILPB 2A1WH 3SE8H 2WQRA 3O2WL 1U92B 2KZ1B 1CLZH 1E28B 3T8XA 1FLRL 2ID5A 4NQXB 3A6OA 4MQ7A 3MGOA 4PLNC 3O2VH 4L4VB 2HFEB 4UZGA 3W5NA 5KVMC 2DQHH 1DQQA 4FG6D 5INCA 4K07A 5IHUL 1BVLB 4KVCL 1KB5H 2V7HB 5A43C 1MSPA 4U1MB 1KCUL 2DJSA 4HWEL 4U6XB 3RZCD 2EXWD 3GI9L 4JRYE 5J13B 1ZEAH 4I3RH 2X4NB 4IRSD 4OB5L 2RCSL 5DLMH 3N85H 4BJLA 3DVIA 3KPLA 2OTUB 5AD0B 2Y72A 3LH2H 4LSQH 2FDBP 4HC1L 5E6YA 1XR9B 2VR5A 2ICWI 2XWJA 5L2KD 5HHVH 3FHAA 3B3IB 1A22B 5ALBL 1B0WA 2YRPA 1DN2A 3LKRA 3MO1A 4JQVA 1CYGA 3KXFA 1E4XH 4PJAA 2Z91B 5C0JA 2F53D 4LCCC 1WQVT 1ZA6A 2CSPA 2HT3D 4HZLA 2PTVA 1NCWH 2ARJA 15C8H 2W60B 3LS5L 3V4UL 5C7XH 3RWEA 1TNNA 2DIBA 3VG0L 5M94B 3GSRB 4K8RL 3HFML 2W9LA 4OZIA 5J13C 1HILA 4PJ5B 3E3QC 5DWUL 1B4RA 3G08B 4KKAD 4PJAE 2BC4B 3H42L 4RGOH 1WWWX 2FJGA 4XNYH 1I3GL 1FYTB 1YEHL 1YPZA 4TQEL 1T7VA 1KCVH 4Y5VC 1YY9C 1BQUA 3VXNB 1ZA3A 3MUY1 4FFVC 2Y07H 4YHMH 5IB1A 4QRUB 1OB1B 5DTFB 5LQBL 4P5TD 1DN0B 4F7TA 4JDZB 2FCBA 1UEMA 5DR5L 3QDJB 5ACLA 1FFNB 4YNYB 3OPZH 2AJUH 3HE7A 1HINL 4TTDD 3VXMD 2GUOB 4JRYA 2JLLA 3GSWB 1RU9L 2MCPH 1T1YA 2X05A 5AUMB 5A2JH 1UACH 2GFBB 2WWMD 2QSCL 1AJ7L 4FRWA 5SX5K 3TA3A 3FB5B 4OLUH 1R0AH 3LB6D 5DD1H 4QY8B 4IOSD 1BBJB 4QHMA 3X12B 1VKXB 4JO1L 4S1DC 5D7JC 2R4SH 2DJ4A 4U0RC 1IAIH 4KKAC 2XZCH 2CRYA 4HKXA 4N8CH 4M6MH 1P6AB 4R97C 3W9DB 1QYGL 4YX2L 3V0WL 3MLSH 4PJCB 4HBCH 4EEEA 4R4BA 3EOTL 3PWPD 1ORSA 4K94C 4I77H 2Q3AA 4OIBA 1FORH 1A6VH 2VMFA 2HVJA 2A0LD 3N9GL 5CZXD 4U1SA 4UV4L 3MLUL 3GI8H 1FDLH 1QRNA 4XP5L 5F9JA 3V6OE 2XPGB 3QUKA 4KROB 5E6IB 3RY5A 3W39A 5C8JA 1UWXH 4X6CF 3ARDB 3PGCA 3VD3A 3H3PL 2E5EA 2VLRE 2GK0A 4Q9RH 1JPST 2XFXA 2YOCA 4KJPC 4QT5B 2FYYB 1A6ZB 5DRZB 3CNKA 5D7KE 4G6KL 4NNYA 1DCLA 1UB5B 3U0PB 2IGFL 1YEIL 1NGZB 5FYLE 2P5WB 3ARVA 4EI6B 2XKNA 1BFSA 2NTFA 3UTTE 1JZ3A 5B39G 3LRSB 1KB5A 5FO7B 5C09A 1DTUA 2Y1VA 4MQSB 3E6FB 3AROA 2YUVA 1NL0L 1H15A 5EPMB 3TPKA 1EXUA 4AMKL 4MJID 2OR9L 4RA0C 3DUUA 1DUYB 1DBAL 1H0DA 1L7IH 1N3NB 2OI9B 4MNGB 4YHLL 1UXSB 4F2MA 4HGMA 2NY6D 3OWEA 5MHSD 1FAIL 4M7KH 4N90E 5JA9A 4XCNA 4PY8I 1IGYB 1YEJL 3IFNH 4YBLC 4OCYL 1RZGA 2JJSA 3QIBB 4KTEL 3FT3A 2X09A 3F5WB 3WEXB 4I2XA 2ICCA 4W6WB 1KJVB 3SE9H 3MRMA 3WFDH 1ZLUK 4JO3L 2HLFD 1VEPA 3CFIC 4X6BA 5DUMH 1FZKA 5IBUB 4PREB 1N0LA 4X9FA 1WAAE 1A3LL 3VFUA 2WUCL 3L3GA 5ESVA 4LKCA 3H9SB 2R0ZH 3T2QA 1YEGL 4NC0B 4XHJC 2FR4B 1X5XA 2FHFA 5C2BH 4HK0B 3QO0A 3FN3A 3PL6B 4XAWL 5EO0B 5JTWA 2C1OA 1WISA 3QB7C 3T65B 1RJYA 2CKBA 3WJLA 3F7RA 4FXKA 2VIRA 4D3CL 2ZCKL 3I6GB 1PW3A 1Q0XH 4KK5C 1UENA 3EUUA 1PKQE 4FQ2L 3VI3F 2CO6B 1P84K 3V2AR 3L6FA 4JCLA 4NP4H 5E9DB 5J7CC 1KCSH 3QIWD 3QH3B 4YXKH 3ULVH 1NGQL 4R4FL 1X4ZA 3FONA 3QR2A 4FQQB 3PHQB 4H20L 1CZ8H 3MRIB 5EOQL 2C9AA 2BHZA 3MV11 1S8DA 5J3HD 2IH3A 1ZTXH 3GB7A 4IMKA 1JTOA 2WBJD 2VZUA 3S97C 3UDWC 5IOPA 1ADQA 1XT5A 4NYLA 2C3VA 1HWGB 3KJ4B 1A21A 1FNEB 5C92A 4H25A 1U91A 2NX5A 2A6KB 3ISWA 3QXDA 4M5YL 1MI5B 2XT1B 3DXAA 1MREH 2R8SH 3OKYA 4JN1H 1UCBH 5L9DL 4HC1H 2DAVA 5J12B 2Y5TB 1BJ1H 2DYPD 3KXFD 3VH8A 5KAQF 4J2XA 2XICA 2XZQL 3QULA 3LPGA 2ZUXA 3B9KA 3H9ZA 3P9MB 4YHOL 2HRLA 3P0VL 2Q8AH 1HKLL 4NCC1 4XH2B 4OLYL 5AZ2H 4HC1A 2BNRB 3RZCC 4ELMB 1B0GA 3RVUC 4X6EA 5DJZA 2OJZH 2YPKB 1EGJA 4AEEA 4QHUA 3QDHA 4QNPF 4X7CC 2C3WA 3TBWA 1F4YH 3LEVL 3QJHB 5BO1L 3KLAA 4GRMB 4YHPA 4R7DB 5AEAA 5A40E 2JB5L 1W0WA 2I60H 3QDGE 5E2VL 5ETUA 4UINL 3FO0H 3TESA 4U7SA 1BWMA 4U1KA 1D3CA 4WEBL 1G7IB 4CN4A 1HI6A 3C6SB 5HHXH 3GMLA 5DJDB 2NY1D 1H3GA 3WN5C 1JUFB 1IGML 5SWQB 3M1BA 4JANA 2DI7A 3IDGA 2EYTA 3LIZL 1OWWA 3VDAA 4F57H 2BRRL 4ZTPL 1N6QL 3DMMB 5GXBB 1EVTC 5ICXB 3QEQB 4P2RA 3IDNB 1EAJA 3O4LD 3TA3D 1UM5H 1V05A 3MCKA 3L5IA 1RUMH 3CH1B 4JGJA 4M6OL 4WCYH 3CLEH 2R2CA 5GHWH 3PV6B 3DARA 2X2YA 3JTTA 3GUTA 1A5FH 3ARGD 1BGXH 5ALCL 4YFLF 1NCWL 2H2SD 3OX8A 5BQ7A 5FYKE 3V4UH 1OQOA 1BZQK 3UZVB 3SGJC 4U1NA 5C0NC 5ENWA 3BKYH 3HG1E 3QAZB 4KRMB 4KMTL 3O8XC 3RKDD 2CLVA 3OAZK 4QT5A 1JHTA 1YNTA 1ZE3C 2NY3B 3IFLH 1AGFA 5KBNC 3MRBB 2DDQL 5DRWA 1INDH 2YD8A 2ZWLT 5ESAB 1YEDB 4MA8L 5KVFH 3VI4F 1QBMH 5J3HC 2VQ1A 3V5KA 1RZ8A 4MD4B 4OZFA 3ZE1E 4Z78A 4K2UL 5D1QC 5JORB 4JFXA 3X11B 4PJIA 5TGBB 2YPLE 3HRZB 5C0AB 5J11B 2DWDA 4A6YL 1NGPL 2WBKA 5GZOD 3KPOB 2DOCA 3OAYH 5FIEA 2IQAA 1Y6KR 3RVWC 2R2BA 4W68A 1S9XA 4KDVA 1P7QB 1W0VA 3D9AL 4GRLD 3QIBA 2IJ0C 4X6DB 2F53A 4D9RE 2WQ8A 2OMNA 1N0XH 3BJLA 3HS0B 4ELKB 5M95B 2OL3A 2MQ0A 5HVFB 3IAPA 4BH8B 5D5MA 5KSUA 2N7BA 3K74B 3FJTA 3WS3B 5T1DL 2X70A 3PJSA 1WZKA 5ADOL 5ESVB 4OZGF 3U1SL 1SEBB 3SKNA 1ZVSB 4FZ8L 1JK8A 3P11L 5DI8B 2ICEA 3T4AA 1CFQA 4JEGB 3OG4B 2VXSL 3RU8H 5T3ZD 4MGXA 3DYPA 1ZGLP 1LEIB 1CBVL 2HLFC 5EO0A 1S7TA 5DD3H 4HKZB 1W72A 3ARBC 1UG9A 5ABDE 3CFKB 3DIFA 4C56E 3U7WH 1K85A 5HYIA 5IVXB 5IVXF 4LBEB 3UJJL 4I9WD 4RDQF 3OV6A 5E00A 1RUML 3S96B 4NN7B 5L0QB 5GRYA 3IXAA 4Z7UE 4K9EL 4WFGD 4BQ6A 3K1KC 2ZNWA 4NQCB 5GGTH 3R06A 5JIKA 4WW2B 3ARPA 2J6EH 1WIOA 2AJSH 3DECA 4M00A 4H1LB 4C54A 4JKPH 3DOSA 2ZSVA 1D9KB 3GGWB 5FA3A 3VXQA 2GJZA 1WICA 2WANA 4Z7UF 1QSED 3D5OF 1EO5A 2EYRB 4I48B 4LPTA 1XR9A 3MRLA 3BT2H 5IEKA 3UYOD 3QEQD 1KEGL 1A1OB 4M43H 2UYLA 1YN7A 2XKSA 1CN4A 3RY6C 2ZCHH 3G5VB 4K23H 4ALAL 5D72H 4RFOH 3MA7A 5E5MB 3BX7C 3MRRB 1Q9LB 3UDWA 5IBLD 5E8DL 4L9LB 2H2PD 5D7IF 2B7DT 2CRIA 4TNWF 3GSRA 1RY7B 3MJ9H 3O2DH 4TSBL 9CGTA 1HHKA 2ADGB 2GEEA 2FBJL 3QG6B 5TDOA 3S3SA 3V5DB 5FM5O 3ZKMD 3ZKXB 1NFIB 4QXGL 5CEZE 3TV3H 1N4XL 2DN7A 5DA4A 4WI8A 4D0BA 2DB8A 1TCRA 2G5RA 4JJHA 4OIIL 2R15A 1FV1B 2NW3A 3UAJC 1FFOA 2B20A 2EDLA 3H9YA 1ES0B 4L8CB 3WSQL 4O58H 1JVKA 5CJXC 4GKOA 3OSKA 4P23D 4KHTH 1FZOA 1VERA 2HT4D 2A1WL 2H6PB 2IBBA 1U8IA 1UQSB 2AXGA 2R29L 3ARUA 3VGHA 1FCGA 3PIQA 2C3GA 3DRTB 2PW1B 3O11A 5EU4A 4GXUN 5JW3L 1CT8B 1ZLSL 1O0VA 4P4RB 3O8XD 1IEAB 4R7DA 4ZPTA 1O7VA 3A67H 5I2IA 1KG0A 3L3OA 3VXOB 2CXGA 4X6CE 3TVMC 1A6UH 2V17H 3QUZD 2AI0L 5CBAA 4GG6E 2JJUA 1I85A 4JANB 4CVUA 1A1MA 4JM2F 4MS8D 4NHUB 1H3WM 1G7PB 1MHHB 5TH2B 2ILLA 5F9OL 3VGFA 5A2KH 1DQLL 5FA4A 2X7LB 2X1XR 4G43A 5CEZH 5SV4A 4QXUH 3WN5A 5ID1B 4BKLB 1U93B 4HEME 5ILTL 1KBGH 2AJSL 2Q1EA 4L3EA 4ZFFB 2YN3A 3T0VA 3W2DH 5EBWA 3FTGA 3TIDB 2QKIA 1WC7A 3RBSA 5K9JH 2LE9A 2QQKL 1Y6MR 3L3JB 5F9JB 1CIUA 5DD1L 3KPMB 1MAMH 1YUHB 5E8NA 3LN4A 4ODUA 1GHFH 4R9HA 4UMGA 2OL3L 3FFCD 4WO4B 4JPWH 2GJ6B 4WW2C 2AW2A 2CDGA 2O5YH 3P30L 1PX3A 3N0PB 4N8CL 5HYJA 1TTFA 4Z7VA 2FD6H 3P9LB 2HH0L 2JJTC 1OTUC 4M61B 4QXWA 5CEYA 1E4WL 5I6XB 2XN9D 3V6FA 5E56A 1DBKH 1IC4L 3QUXD 4FMKA 3HE7D 1WWBX 2VDKL 3CFBB 5AD0A 3NH7L 4QXTB 4LPXA 5EWIL 3A6BL 4FQXD 2XWJB 1ND0B 3C6LA 5I8OL 3H9SD 1T0MA 4PYGA 3WNNA 1YMMA 2YZ1A 3MRJA 1I9RH 5K9OA 1T80A 3SDXF 3NFPA 1IL1A 4L29A 3MO1B 4LNVA 2F5AH 4JKLA 5I1DA 5T1LA 3CPLB 3CVIH 5D2NB 3MMEB 5TE4H 4YHZL 1NMCC 1BOGB 1KIPB 2Z92B 5MP6H 1LEGA 4C83A 3RWEB 3ELAT 5CSBA 3EDDA 2VUYA 5CD3B 4JQVC 3DVFA 4K8RD 2CMRL 3PWPA 1H3XA 2VLKA 4CVWA 4G6ML 3ULVF 1H3TA 4F57L 1TZHB 2G75B 3NPSC 4TN9A 3UAJD 4Z7WB 3C60C 3MRDB 5EG6C 4DFHA 3RZCB 1HE7A 3QUXC 4OBRA 4IHOB 1L6XA 4KI5F 5HGAB 4R4NC 5GGVY 1MPAH 4AM0B 2YXMA 5JOEA 4XXDB 5FYJU 4GQ9L 3G6AB 2N1KA 3KPLB 1A14L 4LK4A 2HRPL 1TQCC 3D9AH 5A16A 1S7TB 3QXWA 4BZ2L 4KJWD 3S5LB 4GW5B 1TJGH 5C71A 4YC2B 3TPUB 1FFNA 4YNYA 1NC2A 1YECL 1CU4H 1I3UA 5C0EB 5FAAA 1AD9B 4V1DB 1P69B 4X6DF 1QZ1A 1LK2B 2VDRH 2Z91A 4DKFH 3MCG1 4RAVA 3KR3H 3F62A 3D87B 3KLSA 5HHPA 1MQ8A 5IB2B 4DEPC 3C87A 3QEHA 3TYFB 4E5XA 1D5ZA 4ZOBA 5J1AA 1KIQB 3ES6B 1YEFH 1K9TA 2Q20A 1CD8A 1QSEA 3BGFC 4PJCA 4Z6AT 3CX5J 5FHBH 1XGPB 5TDPA 5I66B 3O9WC 3FRPA 1NFKA 1RUAH 4QGYA 3PWJB 5IUSA 4NRZA 2AV7A 4OCRL 3AAZA 4G6JL 4NYLB 4MB3A 5B8CC 1MFEH 3C5JA 3MV7E 1F42A 1GGUA 5CIPH 3WHE0 5HI5C 3BDYL 2G60L 1BQLH 2WNGA 2NX5B 3V4VL 5I1LA 3ZO0A 3JTSB 2YD5A 3O41A 1W72L 1A7BA 3DV6B 1BVKB 4LDOB 3ULVL 3TYGH 4FG6C 1K4DB 5HD8D 1TVBB 1CZ8L 2SEBA 1DJSA 3I6LD 5SWZE 4KPHH 5F70A 2OTPA 3DHJA 5IW3A 1KTLB 2VSDA 3CVIL 4LHUB 2DRUA 4WHYH 1QLFA 2I9LA 1SM3L 3FQTB 5C0ND 3QIWC 1YYML 3EO0B 5SWSD 4X6FA 5BS0D 4RBPH 1GZQA 1PY9A 3NPSB 5KJRH 4PJIE 4EQ2A 2X10A 4PRHB 1BIIB 5E2UL 4LVEA 2DQIH 5I1JH 2X4SA 4IS6B 4M1DH 3WIHH 3GNMH 4PUBL 1X5IA 5B8CB 1JPTL 4UNTA 4U1JB 1NMCB 1XGRA 35C8H 4OIAA 4UTBH 4MMZC 3VRIA 3BP7A 3ARFA 1KLGB 1CGTA 4Y4FD 2DM3A 3HUJE 4F9LC 1OAZH 4PP1D 3RI5K 3HG1A 2HVJB 3U4EB 1RZ7L 1YEEH 3N1QC 4DVRH 1NDMA 2J2ZA 4WVRA 2Z35A 2BOBA 1H3VA 2EXYC 4X7DC 1CVRA 4P57B 4PB9L 3EYQD 5T5NF 4LSTL 4OLYH 5AZ2L 1ZVYA 4JB9H 5SWSA 1TMCB 1IM9D 2V9QA 4P46B 4HS6B 3BKML 3HUJA 5ID1A 1JZ6A 2BCKB 4HWEH 4NN5C 1AXTH 3BH8B 1FGNL 1HSBB 4P2RE 5D6DC 4Z7NF 4CMMA 3EO1B 1WFNA 3D2UB 4Y16A 3QG7L 2QEJA 1NCDL 1MCFA 5HY9A 3T0EB 3OGOE 5DJ6B 1JYNA 1UH2A 1A7PL 2GITA 4HFUH 5E2VH 1GGTA 2F15A 3TO2B 3MNWB 1BBDL 4JAMA 1P7HL 5E2JA 3KYNA 2GJ6D 1UA6H 4P2CG 1RJCA 4A2MA 3QQ3B 2CKBB 5CP3A 2Q86A 3IDXL 4DOHB 3U6RB 1IGIH 4MXQC 1RUAL 4RGND 4OZFH 4ZQKA 1DQQB 3LQZA 4P9HL 5D7LA 4WEUD 4ORZC 3BPOB 5F1NB 2ATPA 3LKQA 4J3UA 2R56H 4S0TD 3WJLC 3O4LE 1AGEA 3UTZB 4PS4L 3K2UH 1VA9A 3WEXA 5J9PA 2GY7B 3C08H 4DZBB 2BNQE 4YHOH 5DJAB 4LHUG 4UU9B 3H3KA 3TJEL 1RURL 3QUXA 4JVPA 3LZFL 1T20A 3RWJB 3HRZA 5C0AA 5FKAB 2W65B 4QOKD 4I0PA 2HMID 3WS6A 5T1MA 3SDDA 5FYJD 1B4JL 1Z9MA 1LP9B 5B22A 3VXMB 4CBPA 3MREA 5F7KC 5F44A 3U79A 1TJIL 3RWIA 2VAAB 1BD2D 4AZ8A 4WI3A 4NHCL 4QYOA 4YHLH 1FG9C 4HZLB 3DURA 4J23A 1J1OL 2ZUYA 2UV3A 3HPJA 4RWHA 1F58H 5L2KB 4GG8A 5I1HH 5JW4Q 3T65A 3JV4A 5FV2A 3INUL 4GG6A 3NZ8A 4P23B 4HH9B 5DFVD 3DX6A 4OZHE 2VZSA 2V5TA 1EEZB 2J88L 4XB8A 5F8RC 1NAMB 2M2DA 5F9OH 4Z7WA 4UIKL 1R0AL 4HZAA 4FQHA 4OD1L 4NM8L 1U95A 1WBYA 1XF5B 3W0WE 3WV0A 1JK8B 3QXTA 5DI8A 2J7LA 4C4KO 3RA7H 4POUB 4OZHF 2C4FU 3S36H 4X8JA 1F13A 1OP3H 1QBAA 3UPRB 3EYSH 1A0QL 4S1SL 5GZOC 2BSSA 3T1WA 3SDAB 1EFQA 1T1YB 1AD9A 4V1DA 2DQDH 3QJHA 1VPOL 3LQAC 1XGYL 3QRFM 5GJTL 4DGVL 3KPRB 3RIAF 2W0KA 3VFRA 3V8OA 2RFXB 4F37F 4IMKC 4DQOH 4WIQA 4F3FA 3O4OB 4L8DA 2X41A 3QXDB 3WFCL 5KW9H 5C6PB 4MA8H 4HKXB 4LQFL 1CE6B 4GMTH 3ARTA 2HT2C 2A9MH 2NW2A 4G6KH 4HJGB 4BZ2H 5HDBF 4PJBB 4L8SC 5IF0A 3HNVL 4HULB 1W8NA 2IGFH 3RL2A 1NBZA 1RI8A 4XPAL 4NUJB 5J89A 3P4NB 1RJLB 1ZHKA 2LAAA 32C2A 4K8RC 1I3VA 4J3WA 5INDA 4M1GL 4L5FL 3VFPA 1A2YB 4I18B 4NKMA 5I75C 1A6TB 1TZIB 3MRFA 3UC0L 1OSPL 3IRZA 4QTIL 3JBG7 4P3DA 3GIVA 1NH6A 4CVXA 1C5CL 4PJHE 5JLZB 1AQDB 2I9TB 3EYFA 5KSVA 2AJVH 2Q8BH 1V7NH 1B88A 1I3GH 2NW3B 1S3KH 3U7AA 1WCBA 3BKJL 3P4LA 1IZKA 3O3DB 2BVQB 2ICWB 1U8JA 5I1AB 1R3LA 3L7EB 3V0VA 1U8LB 4FN0A 4JG1H 4EDXA 4KQ3L 1MHCB 3UTTA 3GIZL 4U31A 5E0QA 3FB7A 4Z0BH 1AH1A 1AD0B 2CLZA 4O4YL 5LWYL 1G7LA 3SJVD 2AXFB 1QEWA 4MNQE 2XN9E 3N1GC 5DJ0A 2E27H 4ZSOB 5FUZL 3MRCA 2MHAB 3QHZL 3MCKB 5GGRA 1A6AB 5I2IB 4IIQA 3O3EA 1T1XB 1DSFH 1P7QA 1NUGA 4MQXD 5I8EA 5D7LD 4RFNC 4YO0B 5T1KB 3DX9B 1IT9L 1SY6L 4J3VA 3HS0A 4Z7WF 4LSRL 4WW2F 1FL5A 2P42B 1CL7L 3C60D 1BD2E 3TIEA 5D71H 4OUUB 4ZS6C 1I9JL 4M6ML 3TNNB 4BSJA 4F7EB 2KKQA 3MLSL 3L3GB 3VW3H 3O3AB 2WMPA 3MRBA 7FABH 2EDWA 5BXFB 4OD3H 5I1EH 5JR1L 1L9NA 4X5XB 5HY9B 4G8IB 2X40A 2NY7L 2DQDL 3WHXB 5HHQB 3MNWA 2ZKHH 1HYSC 4WV1B 1QFPA 4FFVD 3BZEB 4PJGB 3KNBB 1LK3L 4HPYH 5E6ZA 2NR6D 1FRGL 5EULV 4RFOL 3DYOA 4ORGB 1CGYA 4ZPVB 1XCTB 2L7UA 1GPOL 3STLA 3WLBA 4GW4A 1IKNC 3IXAB 4F2MB 3G5XA 5TFSL 3O45B 4UUJB 3SOBL 4QOKB 4OF8A 4MCYB 4PGDB 1U6AL 2IFGA 4WI7A 3S34L 4JM2D 1S7QB 2YK1H 4LDEB 4PR5A 4GXVL 2COQA 2YWYA 3SDCC 4BA8A 3HTLX 1CVSC 2GJZB 1FG2B 1QA9B 4CRPA 4PP1C 4QXTA 4AEIL 1UCTA 1RPQA 5HYJD 3B83A 3I9GL 2Q8BL 4ACPA 3G5ZA 2D7MA 1F8TH 2FIRT 2X70B 5GSRB 5GS0H 3HG1D 3UCRA 3BKJH 4GW1A 2J8UF 2WP3O 3RWIB 4JHZA 3QUZA 2FR4A 1SVZA 1RUPL 5FM8A 3GMNB 1FAIH 1JPGA 2YBRB 3SGJA 2B2XL 3KDMA 4FXGA 3QQ4B 5LXGH 4YDKL 4R26L 4CKVX 5MENB 4HUXB 1M7IA 3CX2A 3TVMD 3OF6A 5D2LA 4XMPL 3K2UL 4PD4K 2VIRB 3QWRA 2QADD 2Y25A 4UOW1 5BO1H 1FGVL 1OPGH 2AS5M 2FEEI 3DWTA 1KGCD 2BVPB 3FL7A 3S96A 5MI0C 3FO0L 4U6VL 4H26A 4S1QH 5EU5A 3LS5H 3D18B 2O5XL 5E6IC 2JELL 3QULB 1F6AB 2RQ8A 4P2OD 2YMXL 1WIUA 3PQYD 1SYSB 1Z3GH 4YEEA 3E1F1 3TA3B 1Q38A 4NZRH 1UH3A 5EU3A 5DMIL 1NSNH 4AL8L 5BS0A 1KB9K 3L9RA 5LGJA 2NY4C 3ZT7A 4ELMA 4G3YH 3SE3A 3ZDZE 5JQ6L 4AENB 3L3KA 3NBNA 3PDOB 5F7DA 4MJ4A 5FHAL 1C7TA 3J7HA 4PRAB 4QWWC 3G6JF 4HS8L 1JPFA 3Q5YA 4RFNB 1Q0XL 2BNUA 2J1KA 4JJ5A 4X0KB 1NMBL 2NLJA 2B5IC 4H25B 3BW9B 4KUCF 3LKNA 1VFBB 5T3XE 5EOTA 3VW3L 3LS4L 5T3XD 4E5XB 3ULVD 4L8DB 4JGMA 4MZ2A 1MRCL 2NNAA 1UKSA 2YSSB 1OGAD 2QQLH 1NDGA 2MSPA 2R4RH 3CLFH 4JR9H 1F6LL 5EU6B 1OF2B 4P2OA 5AAWA 4KI5D 1A4JA 4KVNH 3KYKL 4Q6YA 5DJYA 1MFCH 3GSOA 3S34H 4FQLH 3FQRA 4YXLL 2FSEB 4U6YB 4ESKA 3TZVB 1DL7L 1OW0A 3SKUD 1BF2A 3QHFL 3SKMB 5INDB 2O93L 4WHTA 2DMCA 2VLKD 3WE6B 1KXTB 2BY2A 4P9HC 4ODSH 3DRTA 3MUJA 4P9MH 1QLFB 1N3NA 3C09C 4TUOA 3TT1H 1JHTB 1XIWD 3OKNA 1X5YA 1MH5A 3EO0A 4F58L 2E6PA 3DO7A 4R26H 1N4XH 3RNKB 4O9HL 4TOYL 4PRNA 4LCIL 1I8IB 1JJUA 2VQ1B 4G8FB 3V5KB 1XGUA 3CH8A 1B2WH 2R2HB 2YA0A 1CICC 3Q6FB 1H8NA 4FQJL 1KPUB 2R0LL 4M1GH 2FO1A 1V3JA 3TYGL 1EFXD 4HT1H 2NR6C 4N8VA 3DNKA 1D5IL 1AD0A 1FLRH 1WF5A 4OF5A 3GHEH 4U3CA 3UPAA 5E2WH 1ACYH 4L1HA 1QVOA 4L9LC 1JMZA 2XQBH 3HNSL 4L3EB 4OAWA 3SDDD 4LKCB 5DMIH 4YFDB 3BXNA 4JQXC 5JUEL 1CGSH 5EO9B 5KZCB 4DK3A 5HYSB 1P2CA 4ZNEE 5MERB 1MCLA 1DQMH 2IAMD 1RUQH 1FVDB 2EE2A 3PHOA 4G9DB 5DVKA 5C09D 2X4OB 5GGTL 4HCRA 2XTJB 1BVLA 5KANG 1CFNA 1FFRA 5CAYB 3O3AA 4ZYKA 4HKJA 1KJ3L 1KXVC 3MGTB 3LHPL 1DBBH 2W9EH 5DJ6A 3BP6B 3R8QA 4Z5RA 2AEQH 1A9EA 2ZJSL 1MHPL 4GRLC 1DEEB 3REVB 1TLKA 3C60A 5A16B 3ZKND 1Z9OA 5EH1A 1Q94A 4BZYA 4W81A 4WJ5B 4FQLL 5F7WC 4ZO6A 3DIFB 1R5WA 1S5HA 4YH6A 2B39A 4F33A 5JHLL 1EJOH 5LBSL 1T22A 1FQ9C 1J8HA 1NC4D 3T2OA 1MJ8H 5DHYA 4NUGL 4C59B 4GSDH 4PGCA 4MD5A 4XCFL 1I1YB 4H1LA 1XF2B 2CR3A 2VYRE 1DDHA 1ZHLB 5FOBA 3MPCA 2EDKA 5C0CA 1S3KL 1XAUA 3TBTB 4K9EC 5CUSH 2HJFA 5ITFB 2H32H 3GSQA 1QRND 2VWEE 1XFPA 4G8GD 3DXAB 4WGWB 3BRFA 3PP3K 4Z95H 1OWRM 3UTQA 4ZUWA 5E2UH 3VXMA 2VDML 2Y5TA 1YA5A 1MF2H 1WSST 1YN7B 2VISA 3JV6B 4NO3B 4O9HH 1OAKH 5DK0A 4JQIL 4CUCA 1K8DA 4HMCA 4PG2A 3VXME 4ZO9A 4P59H 1CGUA 2DYPA 5IQ9B 3EOBB 3QXUA 5CHNA 3UTPD 2G5BA 1Q9LA 1F11B 1KYOK 1HZHH 2GHWB 5IVOA 4LVHB 2OZ4A 3HMWL 1ONQA 1KACB 4W6XB 3WO3B 3JV4B 5GRJL 5DJZB 5D93B 4N1EA 4PTTB 3TN0D 4PJEE 4TUJB 5KVDL 3AS1A 5DK2A 5EC2B 3GSWA 1DUZA 3CSBA 4CU8A 2BVPA 3K7UA 2K1MA 4PJFB 5CJOL 1U95B 1WBYB 1XF5A 2GAZA 4FQCL 4NDMB 1AY1H 4RAVB 1VEOA 1MI5D 4X7EC 1LO0H 4ZUUA 2EDTA 3AVEA 4ZDHA 4Q0XL 5K9QI 1J86A 3PDOA 2RIKA 4MJIE 1EBAA 1FNAA 1RK0B 5JHDE 3C9NA 4NN6B 5GGQL 4EXPX 4HS3A 1A02N 1HSAA 5C9JB 1F00I 4RMWA 2GT9A 2FEDC 5IKCA 3U7WL 4PJ7F 2DQHL 4P2RB 4UV7H 3VFOA 2P24B 4Z77A 1MHPH 2VXTH 3PV6A 3DVNA 4R7NA 5I1LB 5EN2B 2XPGA 1PG7W 3KLHD 1A1MB 4M3JA 4NHUA 4BFIB 5JA8B 1G1YA 4HFWA 3MLXL 4TPRL 3B5TA 3ARFD 3RWCB 1A4JB 4PFEA 4RMQA 2P5EA 5T5FL 2J4WH 3OGCB 3CMOH 1S7RB 4U05A 1SJXA 1E4XL 2I5YL 2W0PA 4YK4B 2DQFB 2ATKB 2KL6A 2ORBH 3N1FC 1TJHH 1XGQB 5KSAD 1T5WB 4OCSL 3RY6A 3NCYP 4UB0L 2ED7A 4Y4KD 3SJVB 4JFXB 4OFYD 3X11A 3LEYL 2XZAL 3P9WB 4PGEB 5IG7B 8CGTA 3HA0A 3VXUE 5JLZA 4NJAH 2P48B 2Z8VC 4QRPE 3QNZA 3GBNL 3TEUA 4GKZA 5DJXB 3DO7B 3JWOC 2VLRA 4AT6A 3F7PC 4OGXL 2AJYL 2ZPKH 1C16B 2BVQA 2EDOA 3PQYA 2WINA 5EFIB 1IMHC 4A6YB 5I15H 4P57A 4BQ8A 5IQ7H 4JFQB 2F5BH 5E4EC 3K0WA 3FZUC 1ND0A 3VXRA 4G43B 4JZJC 5D8JH 1C5BL 3KPQB 2F8OA 1G7LB 3HZKA 3TCLA 3NFPB 2XRAH 4XB7A 5C3TA 3U7YH 3QUYC 1A1NA 3D2UA 1ZLVH 4Y19D 1JNJA 1X5KA 2VR4A 3KJ6H 5E99H 1ZLSH 5GGRB 1KXQE 3WUWB 35C8L 1I7TA 4O2EB 3U46A 1RAMA 1QUNA 3D3VB 4MLSA 2FL5A 2KQMA 3TN0C 5HGHB 4CDGC 4G8GB 3OXSA 4HIIB 3IJHB 3L5XH 1WEJL 2YR3A 5I1GH 3MGAA 1T7ZA 4M8QA 1DEDA 4HIHA 4M62H 3WIFB 1ZSDA 1MRCH 3MBXH 2IAMA 4JG1L 1NBYA 2A2QT 2VWEC 4XNMA 1F90L 3AMKA 1T04A 1FHGA 4NQCA 1HXMA 5A2FA 3HZVB 3QCVL 5E24E 3RVXD 3L95A 3HKFA 5GIRB 1OHQA 2WWMC 5FGRA 5IB4A 2D31B 5HBBA 1FLTX 2P43B 4DAGL 3NIGF 4RX4A 3TPUA 2D4FA 4RGMB 4LSVH 1HNGA 1G1CA 1AXSB 1HHJB 2NY6C 3F7VA 5FKAA 1AIFB 3BEWB 3RGHA 3BN9D 4P2RD 4WU7B 4DGYH 5K9KA 1LWRA 1T6WA 2XQYG 4KI1A 1FSKB 1JF5A 2V2WA 2EDYA 3M07A 3HPLB 4LCWD 3AU1A 3AMLA 3B6SB 4PJHA 2GTWA 1SYVA 1LEGB 3DX8B 5BOZG 4HIJB 3ZTJG 1QLRA 2DTSA 3IDMB 1NGWA 5LKNA 5EA0H 2GCYA 3ARGA 4YDIH 4K7FA 3I2CL 5GGTA 6FABL 2EECA 5C08D 1TZHA 3BWAB 4XZUB 1D6EB 4H88H 4JFDE 4NO3A 3PWJA 4IRJC 3MLVL 2NY0D 3FT2B 4YIQA 5ACMA 1IGMH 4G8EA 2RB8A 5DYOB 3ZYIA 4GXUM 2ENSA 1CK0H 4Y0GA 4M6NH 1NFDE 4R2GB 4NO0D 2D9QB 1SMAA 3MOBL 4TVPE 4YGAB 3S5LA 3UPRA 4NOFA 3LN9A 4R3SB 1G7QB 1HOCA 3NACL 3CSGA 1AE6L 4Y8DC 4QRRB 2ZUWA 1KC5L 2FEEL 4E41A 1I8LA 3I3DA 4Z0XB 4YHKL 4P4RA 4KQ4L 4MAUL 2VRAA 1YEEL 1S78C 4URTB 4DW2H 4FTVE 2FHBA 4S1RH 1JWSA 4LLVB 2X1QA 2A9NH 1WCBB 2WIMA 5D7SL 3WMSA 2E7HA 1X5GA 3T0ED 4Y4KB 1SBSH 4WU5A 2P44B 1BIIA 4XWGL 3MA9L 3BKYL 3ES6A 3V0VB 1QNZH 3H9HA 1G7JA 4OI9A 4GKSB 3GSXB 4EUPG 1YY9D 1ZT7B 4X99B 3JV5A 3TN0B 2GT9B 1QEWB 2FX7H 4L3CA 3W0WA 3PDGA 1RSFA 4K55A 2OSLB 3KYOB 5E4IA 3MFGB 3BE1H 5EBWB 5I16A 5FKPB 1X7QB 2V2TA 1UWGH 4P5TC 3I6KA 2OJEB 1UM4H 2ERJB 1M05A 3W5MA 5C0FA 1RZKL 4HBCL 1IRAY 3IF1A 5F6HI 5F89B 4PLJC 3DHMA 4HXAH 3OJDB 3EBAA 1HXYA 5JW4M 4OLVL 1FL3B 2ZOLA 5TQ0H 3ARBD 3FQTA 5CBEB 1AQDA 4UT7L 2I9TA 3PUCA 4OM0L 3I02A 4G7VH 1NMAL 3ABZA 3ZYJA 3QDMB 3VDBA 4X6FB 4JFHE 4X5XA 4P5MB 5JIPA 4PY8J 3CVHL 3Q5TA 2JB6A 3T4YA 3TO2A 3MJ8A 4FFWC 4ZFZB 2VZ1A 1F4HA 4CGTA 2ADIB 4O2CB 4EUPH 1X4XA 3DUSB 4OKDA 1TZGH 2Y06L 1ITCA 5B8CA 4GAYB 2YKLL 3FB7B 1X5AA 4OD2A 1T66D 3AB0B 2MFNA 4WTZA 3BOVA 1XGRB 3CCHB 2BRQA 4GW4B 5F7HA 4KZDL 4KU1A 1NQBA 4RZCB 4XPFL 2A0LC 3QNZB 2N4IA 4QOKA 2AQ2A 5AYUL 2R2BB 3SQOL 1YEHH 4TQEH 2RAMA 4M7JH 4D9LL 1U3HD 2GI7A 4JM2C 1P1ZB 1WJ3A 2R2HA 4LOUC 1A6WH 4UU9A 3G6JA 1LMKA 1HHIA 2ICWJ 5I17A 2HFFB 3OR6A 2IBGA 5I73B 4PJDE 1TVHA 1U0QA 1JZ8A 5DEGB 5FM4A 2BJMH 5HHOA 3KGRA 1AP2B 3C2AL 4MXVE 4Y16B 2W0LA 1UACL 4JFPA 4J6RL 3ZDYE 4MX7B 2GITB 4MJIA 5DQDH 3VI3E 4NQEB 1XZ0B 1KELL 3HUJF 2PYFA 1I9IL 4ZUSB 1FNGB 5CZVH 1EEZA 5DZNA 1S7UB 4JPIB 1YYLH 3NCEB 1XCTA 4TRPL 3JUZA 4LMQE 5CKGA 1U58A 4YHNB 4KXZI 1QYGH 1UM4L 3D18A 5CILH 1DANT 1IZJA 3NCJL 1HIML 3SCMD 3TP4A 4HIXL 4X80L 1OAXH 1ZGLA 5E8DH 3OJMB 3OMZA 1D9KA 3GGWA 5DRXA 4X8JB 3VCLA 4ETYA 5KS9F 1KLUA 3R1GL 2KPNA 1F2QA 4X5WB 3STZA 2BOCA 5C0DA 1C8PA 5DURD 5DT1H 4I0PB 5HTSA 2IMMA 3ALPA 2X9YA 5I66A 1AQKH 3S3JA 4GW1B 4Y1AD 3MV9B 2VLJE 3AAZB 4LNRA 4DKEH 5HVWA 1CD1A 4QHKJ 4OLVH 4GLRI 5KSBB 3HR5B 4E42A 4KHTL 3V6ZA 5HI4C 1DDHB 1ZHLA 1CR9H 1QLEL 3ZE2E 3LB6C 5FCUL 1M7IB 3V0AC 2AEQL 4EIGB 1M7DB 3GSQB 2OMBA 1B3JA 5JZ7D 5IMMA 1CE6A 4XX1G 4P23A 1FC2D 5EU6A 1OF2A 4P2OB 5BVJB 2AJVL 4TVSa 1E6JH 4CJ0A 2B0SH 4N0UB 4UILH 3V4PL 3FQRB 2LFGA 1WBXB 5F1SA 3MV9E 3F12B 2EE3A 1M7XA 3L3HB 5E5UB 3BP4B 3GBML 2AK4E 4LVOB 1FFOB 3TO4B 1OGAA 4EDWL 1MNUH 2AP2A 2DQJH 4R2GD 3WDJA 4MZ3A 5GZND 5L9DH 2IPKB 5MEPB 3IFOA 2AJXL 1ULVA 2ZUSA 1QRKA 1V7MH 1CGSL 3QDJA 3PIQB 5CUSL 4P5TA 1KEML 1FFPA 5TF1H 1JN6A 4G5ZL 4TUOB 2XWTB 5TE7H 4YFLI 5GRUH 3NA4A 5F9AC 3UTTD 2PO6D 3BP7B 5JNYA 4N5UA 2Q3ZA 1F3JA 2WUCH