1NFDF

An alpha-beta t cell receptor (tcr) heterodimer in complex with an anti-tcr fab fragment derived from a mitogenic antibody
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
222
structure length
222
Chain Sequence
EVYLVESGGDLVQPGSSLKVSCAASGFTFSDFWMYWVRQAPGKGLEWVGRIKNIPNNYATEYADSVRGRFTISRDDSRNSIYLQMNRLRVDDTAIYYCTRAGRFDHFDYWGQGTMVTVSSATTTAPSVYPLAPACDSTTSTTDTVTLGCLVKGYFPEPVTVSWNSGALTSGVHTFPSVLHSGLYSLSSSVTVPSSTWPKQPITCNVAHPASSTKVDKKIEPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Atomic structure of an alphabeta T cell receptor (TCR) heterodimer in complex with an anti-TCR fab fragment derived from a mitogenic antibody.
pubmed doi rcsb
source organism Mus musculus
molecule tags Complex (immunoreceptor/immunoglobulin)
molecule keywords N15 ALPHA-BETA T-CELL RECEPTOR
total genus 34
structure length 222
sequence length 222
chains with identical sequence H
ec nomenclature
pdb deposition date 1997-08-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1nfdF02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1nfdF01
1JV5A 1O7VA 1UZ8A 2V9RA 3OKOB 1YA5A 1DQDH 5IUSA 3P0YL 2DQFA 5C3TA 1BZQK 1G9ML 4OZGF 2CLZA 3JWDH 5DS8A 4X6DB 1XGTB 1MHCB 3E6FA 2X4OB 2VIRA 3ZTNH 5E2UH 3E3QE 4I0KA 1KN4H 5F7DA 1WIUA 3H7BB 2AXFB 2BSTA 2MHAB 2N56A 4LIQL 3MBED 3CCHA 5F21B 4TUJB 4H8WH 1JGEA 1DQQA 2QV2A 3PHOB 5B21A 2HLAA 1A9BB 4H8WL 5D4QA 4APQB 3DYPA 3HMXA 5DMKA 2GIYA 3IKKA 4PY8I 4J7RA 4E9LA 3QIWB 4XI5D 3TO2A 5JHLH 2HVJA 1ZVSA 1DBBH 3MBXH 1DP0A 4YDKL 3VXNA 1MREL 4I2XE 3P73A 3B9KD 4Y16D 4R6UA 5EUOB 1T66C 5KTEL 1G7IA 3CVIH 4ODTH 4UBDC 1U36A 4PB0L 1DBMH 4X98B 4L3EE 2IPUK 4Z7VE 3T4AA 2FATL 4OTXH 5D2LA 3BH8B 4K7PY 4S0SD 3M1BB 4PB0H 4I4WB 2LAAA 1UEMA 3QULA 3MRDB 4OI9A 3DVNB 3WSQH 1ZWIA 3MV8E 3E6HA 1F42A 2EYTB 4EI5C 3VGAC 5INDA 5ADOL 2AJZB 1RK0A 4Z7WA 3D3VD 4NT6B 1I7TB 1HNFA 4JFED 3AUVA 5ENWB 5KN5B 2ITDB 4KI5E 4KDWA 1FZMB 5E56A 5IOPB 1MEXH 2V5SA 5HJ3B 4M7ZC 5FDWA 5IHZB 4FTVE 5I1KH 4PJCE 3TWCL 3GMPA 1T0MB 2FHCA 5J3HC 4ENEC 3FTGA 2VQTA 5CGYC 3QDGD 4FRWA 4ZFGH 1BIHA 3WJJA 2R2EA 1KJ2H 4HW6A 3FZUC 3WLBB 4UQ3B 3O9WA 1A14H 2X4PB 3T09A 4R90L 2FLBT 1IAMA 5CSGA 5E8DH 4WHYG 4AJ0A 4XP9L 4NKDB 2XTLA 2DIAA 3B5GA 1GRWA 3V5HA 2J8UF 3EYOB 4PTUB 5DD1L 4PGBB 4L3EA 5JXEA 1AGBB 3BJLA 4KJYA 3EO1A 3MLXH 3TA3C 5SX4I 4CL7A 4P5TD 4AQ1B 1ES0A 3D3VB 5A3ID 1GL4B 4LHQB 3JTTA 5IV2A 2VLRB 2AJ3B 1JHKL 3OAUH 4NQUA 1DVFC 5L6YL 3U6RA 3JV6B 3X14B 1DLFH 4HG4J 4AH2A 2NY7L 5TDNA 3CAFA 5T5FL 3CFBA 3FHQA 3PDOA 1L4IA 4WVRA 2NY0C 2X5PA 3OAUL 4ZXBC 3BP5B 4WTWA 4YGVB 5JDJA 4RNRA 4M6NL 4WEBL 3EJZC 4TNVK 5E99L 4D94A 3CK0L 6CGTA 4P4KD 2NY0B 3HFMH 5MI0B 4CN4A 5D2NE 1ACYL 2CJUL 3DUSA 4OD3H 1YYML 3BZ4B 4CVXA 3IAGC 3X11B 2JIXB 2Z4QA 3O41A 4LQ1A 5IVXB 4EUPG 2E8YA 4PREB 5DS8B 4FP8L 4XWGH 4QYOB 4Y16B 1W72L 4HKBB 3QIBD 4M7JH 4LBEA 4DGIL 2R0ZH 2X4TB 5TDNB 3H3PL 4RA3A 4NRZA 1FNEA 5IFHH 2DLIA 3SJVD 2BRRH 5EC1A 4C83A 5A16B 3ESUF 4BSVB 4WFFD 4JRXD 3QZWB 5E6ID 4EI5D 5TQ2H 5ID0B 1RUAH 1WQVT 5IFHL 4PJAE 3BW9B 3LKNB 1BBJB 2EXWC 5F9JB 1NDGA 1DE4A 4TVPL 5SWSD 4G7YL 4BQ9A 1U8IA 3T77B 5AD0B 2CDEB 3BW9A 4ZD3L 4DFIA 3H9ZA 1BJMA 3CVHH 3T8XA 3T1WA 1YN6B 4L1HA 3H0TB 1A47A 4QWWD 2JK5A 3WS6C 3RKDC 3EGSB 5FO9B 4P2QA 3LKSB 2EIDA 2OP4L 2LU4A 4QKXB 5CBAA 3WFCH 1TVBB 5KSUA 3DWTA 2EH8L 2VZTA 4PRDB 1MHPL 2OP4H 4H88H 3S34H 3MC0A 1ZWIB 4Z18A 1J0YA 2F54B 2VXQL 4LHUG 5FYLH 3LKRB 4IHOB 3HG1E 3LS4H 2OJEB 1RHHB 3TO4B 3GMRA 2W0LA 3LRSB 3VU2A 3LZFL 1CGYA 4XC3L 1IGYA 43C9A 1SJVA 3BP7B 4YE4H 3BQUC 2CUIA 3NA9H 3P30H 1EAJA 1XZ0A 3VG0H 2F74A 5F7HA 5TQ0H 3AS0A 2SEBB 3O2VH 1NEZA 5MEQB 4AH2B 3RL2B 1L0XA 1DVFD 4ODWB 1KBGL 3QUMA 2XKSA 1KLGA 1G7QB 2HH0H 4PRPD 1QRND 3CH1B 2ZCHL 3ARDD 3I6GB 1KJ2B 1GAFH 4P4RA 3F5WA 3O6FA 3T2QA 3BI9X 4O2CB 3T0VA 1WZLA 4MAUL 1HHIA 1PSKH 3NFPB 4JLRA 4L4VB 3BO8B 4QT5A 2J8OA 1NC4A 1DQJA 3GGWB 3JV0A 3N85H 2ZUYA 3QRGH 5CSZB 1OAYH 1CF8H 4XVTH 1CXIA 1K8IB 4FXGA 4YHYC 5ISZD 2V2TB 4HEPG 2XI9A 3DOSA 3QG6B 3QPXL 5CD3B 1C08A 4YHYB 3GKZA 2IG2H 4CN1A 4HGMA 4NWTH 3ZDXF 1CYGA 4LCIH 2FH6A 5C8JA 2WBJC 4G9DA 4O2FB 4LSTL 1CFBA 1SJHA 3TYGL 3L9RB 4Y19B 1RJZB 5D71L 3TGXA 2R4SH 3P0VL 1VGEH 1Q1JH 1TZIA 1TVHA 4GAYA 1M7IB 1JHTB 1EX0A 4I3GA 1XAUA 4WI6A 5EU5B 5HDQL 4U6YA 3MRRA 5L2KB 2R4SL 2UWEE 1OQOA 4K3EL 3RTQD 1QLEH 5B38G 1MJ8H 4NKDA 2ZKHL 7FABH 3QCVL 2JB6A 4HWZB 4JKWA 4YHOL 2YWZA 3JV5A 2R29L 3IFNL 3QIWD 4HIEB 1F45A 3M8OH 3JV4A 4KV5E 1FJ1A 2DQHL 4D9RD 4GT7A 1KYOJ 4R4BA 4QRRA 2VLKE 4QTIH 5DDHA 2F54A 1BOGB 1A1OB 3MRCA 1EEYA 1F4YH 2R1XB 4HS6B 2IANA 1H8OA 3BP6A 1KN2H 5FB8B 1ZA6B 5I1EL 1LO0L 4JO1H 1BP3B 4X4XA 3F12B 4UINL 2FD6H 4R7NA 1U8KA 1S5IL 3AY4A 5CJOH 4CADA 1T20B 3GMMB 3CMOH 5I1DA 1CLZL 4NQDA 4P23B 2UY6A 3EYFA 5JW4N 5D2LE 4PRHA 4PJFE 1DBJL 3SE4C 4LEXH 3X17A 4M4RA 1CFVL 4BUGA 2CLVB 4QXWA 3O4LA 1OP5H 1JGLH 3C8KA 1IAIL 1M7XA 4WY7L 4MS8C 5M94B 1JZ3A 4JRYB 1D6VL 2VWEC 4U3XA 1F3RB 4LLDB 5D1QA 4KXZI 5SWSA 3UYRL 5DZOA 3DGGA 3MV9D 3C8DA 4OV5B 4KI1A 1KIQA 35C8L 5ACZB 3UYRH 3DARA 4PRHB 5JW5A 4NPYB 3X3GL 2XN9A 2CO6B 1OCWH 1ZLVH 2C1PB 5E9DE 3WKMH 2F5BL 2ICEB 3DURB 3MMEB 4KKBC 3BZFA 1PG7L 4ZNEE 3DIFB 3IDMB 2E7MA 3T0BA 5IW6B 1H3TA 1WCBA 1FPTL 1G6RL 3ARGD 2W9EH 3IGAA 4G8EA 5J1SC 1S3KL 2EKSA 5IQ9A 3BP6B 3S37L 5JHLL 4N8VG 3W81A 3G6AA 3OF6D 5HGHA 3WO4B 2VYRE 4NZJA 3LD8C 5JA9A 4GXVH 4QHKJ 3MOAH 1CFTB 4QY8A 1I1AA 4QXGH 2Z91A 4U0RC 1YEJL 1Q94A 2JKXA 5F89B 3G04B 3QR2A 2PTTA 1VADB 1CE6B 1ULVA 3L1OL 2F8VA 3BPCA 3B4NA 1BHGA 4GXUN 3IGAB 1AP2A 4M8QB 5IT2L 1HNGA 1I1YB 2X42A 3HS0B 1CD8A 5C0AD 2Q7YA 5ADOH 1OP9A 1MCKA 1QFPA 4X99A 4ZFOL 2E6QA 3RPIA 5D7KD 3O45B 2NZIA 4UUJB 4OLZL 5ISZB 4WI9A 4KRPC 5E7FA 2EH7H 3C60C 1GZPB 5SWZB 1ZLUH 5BV7C 4E0RA 3BPLC 3LN4A 4PJIE 5C0CE 2V17H 4GS7C 5HHVH 3HPJB 5E6IB 5EBLA 3R1GL 2Y5TA 4M1DL 2PUQT 2CDFB 4U1JB 2AERT 3FQTA 1SEBA 3EBAA 3H9HA 5E6IC 4LPWA 2IALB 2MPAH 1DANU 2OTWA 3MRJA 5D1XA 3GMOB 4JHWH 5CHNB 2D7MA 3MRIA 2DQDL 2B0SL 1IAOA 4F7TA 2P8MB 2R2HB 4PRPE 5CIPH 4EQ2A 3ABZA 1EFXA 2OR8A 3GNMH 2AGJH 3WFEH 1BIIB 3MFFA 4FZ8L 3ZE1F 1NJ9B 4OV5A 3QULB 3T0EB 3OR6B 4K2UH 4HFWB 2AKRA 3DYMA 4O5LH 5MEQA 1AQKL 1NGWA 4AG4L 3FJTA 3LKPA 3R8QA 5I1LB 1HN1A 5KSAC 2J4WL 4M7ZB 3V6OA 4KMQA 2DLFH 5C0AA 3P0GB 1TZHB 1JIBA 5GRXG 3OMZA 3R8BB 3B3IA 4YX2L 2DQUH 3EDKA 3ZHDA 4CU7A 2MTPA 3VDCA 3WO4C 25C8L 4TNWF 5DWUL 2VLLB 1T0MA 3GM0A 1WTLA 4M1CD 4YX2H 4XGZB 1JWUB 1PBYA 4MHHI 1FVDA 3TBYB 3QDGA 3BX7C 3T0XA 1KPRB 3QFJA 3SE3C 3D2UA 5ITBL 4X6CB 5DQDL 4Y4FB 1E4KA 4XHQA 3D9AH 2G2RA 3HE6D 4L4VE 2APXA 3A6CL 3CFEB 1B4RA 2EYSB 1OB1B 5HI4C 4PLJC 3H3PH 3D6GA 1BZ9A 1IEAB 2DWDA 1FBIL 1DR9A 2LABA 3F8UB 2AAVA 3D39D 3TCLB 4CMMA 5GS2D 4AEFA 4P46C 4JPVH 3FB7B 4F58L 5FM5O 4GW5A 1A3QA 1HXYB 1S7UB 4J6RL 4KRPD 4TVPH 1RUPL 3JV6A 2V9TA 4DVRH 4F2MB 5L7XH 2C4FU 2H9GB 2QQNH 4RA0C 3K80A 4GKZA 1X5KA 3PGCA 1MCSA 3P4OA 3VXSD 4NO3B 1TCRB 3OKNA 1X6LA 1I1FA 5EBMA 5L7XL 1U58B 1DQDL 2D7QA 3DHJA 3ARGA 3WFCL 3C5ZC 1JFQL 2DM3A 4JJ5B 5CEZE 5DLML 3BMWA 1NCBH 4PGBA 2Q1EA 4H88L 4NQXA 3FO9B 5DLMH 4P49A 3PIQA 4LDEB 3WE6A 5L8JB 3LAFA 1G7MA 1NFDE 2P8PB 4Z78A 2AEPL 2MQ3A 3MTRA 1RIHH 4JFXA 2H9GA 4MJ6A 1KJVA 3CVIL 2NXZC 3EZ8A 4MDJB 4ODTL 5CJXA 1VFUA 4N0UB 4EXKA 2G75A 5CP7A 3HAEA 4J3TA 3OKLA 4BH8A 2PYFB 3NFSL 4LEOB 5FFLA 3W39A 3MCG1 3MXWH 5C6WH 5LGJB 4HT1L 2ITCB 4XBEL 3U4EB 5FOBA 4Z7NF 4K7PH 4YDKH 2DI7A 3MYZA 1OY3B 3ZSSA 1R6VA 2PTUA 3F62A 5GJTH 4BK5A 3UO1L 2RR3A 2D9QB 1QO3A 3AROA 4GAGL 1MCJA 1QLRA 4D2NA 3QA3A 3WHXB 1BAFH 1FNGA 2IFFL 4NC1C 3CZJA 2ZUUA 3DVNA 3HG1B 3S96B 1EUUA 4MYWB 3S6CA 5C70A 3KNBA 2P45B 1J0IA 3FQWA 5EUKB 4UOW1 5T1MB 4LLYB 1H3GA 4WJ5B 3FHAA 3QPXH 4ZAKC 4GG6B 3RL1A 3GBMH 2VQUA 2D31A 3B9AA 5FHAL 5IOPA 1PG7X 3IFPA 5EG6C 4NO5B 4IDJH 1BJ1H 5KSVA 1AR1D 2BVUA 4KKCD 2N7BA 1GVIA 3NTCL 43C9B 5I16A 4HLJA 3LN4B 3RUGA 3QISA 3FO2A 4OZFH 3O3BB 2H2SD 1R5IA 2XWJB 4JY6A 5B3JF 3OG6B 1JPSH 1I8LA 4KWUA 2QQLL 5ALCH 5KAQF 1YEDB 5TE4H 4PJXB 4P2RB 5EPMA 4WV1A 1MELA 3D25A 1S78C 4MD4B 1YNKL 3UDWC 2ZKHH 4LGSB 4X4YB 1X6NA 2WP3T 3TVMA 4G6MH 2R9HD 3O11A 1IAOB 4F7TB 1YNKH 3L9RA 4Y19A 1NMAH 1X5FA 3WXWH 1KTDB 5D9SA 2AK4E 4QTIL 4U1SB 2WW8A 4X0KA 3QH3B 1F4YL 3OKKA 4K7FB 2P8PA 2V2TA 5K9QG 1MUJB 5IP4A 1DN2A 1NL0L 5L6YH 3DETC 3ZHLA 4TUKH 5D5MF 1HH9A 4OD1L 4UINH 2B1AH 4OFKA 5IHUL 3ELAT 5FCSH 1QFOA 3PWVA 3IDGA 2Q86A 3PP4H 4FTVB 3CX5J 1WBZB 4YZFE 1CLZH 5JLZA 3H9YA 4FP8H 2EECA 4XWGL 3WUWG 4M6ML 5IHUH 1MLCA 4WTZA 4GRLD 2HFFA 4DGIH 2XN9E 4MJID 1SEQL 5MERA 2CIKA 3H3BC 3MGTA 4NO3A 1RZJL 5E8OB 1UA6L 5DGQA 2Z35B 1G9NC 3EO1B 1GOHA 1KCRH 3OKKB 1D6VH 1I7RB 3DV6A 3RU8H 3C60D 1NFKA 1FE8H 2W0FA 1N8ZA 2HFTA 4UT9L 3SDDA 1HXMA 4QRSA 3LEXB 1MFCH 5E2TH 4K9EL 5BO1H 4TULH 2VB5A 1D5BB 1QPPA 3OF6A 4PJ7A 1HYRC 5IMOB 3U2SB 1FVCA 1NFDB 1EUTA 3AMKA 4LLQB 3DRQA 4X4YA 2D4FA 1ZE3C 2YPLB 4M3KB 1OCWL 4IHOA 4EOWH 4PYHA 4WI2A 4QRUA 2F5BH 1YNTB 4K3JH 1EAPB 4X7FC 1HYSC 3V5HB 3FTGB 4JRYD 1KTDA 1FZJA 1NAKH 4EOWL 2W9EL 1TTGA 4KTDL 5B8CB 2YD9A 3SGDH 4XXCC 3G5ZB 3SCMB 3O9WB 1BQHA 3IETB 1CZ8H 2ZPKH 3G9AB 4F7CA 1MHPH 4R7NB 3V4UH 1MFBL 4Z0BL 2X9YA 4M7LT 3OXSA 4NQSB 5GGUA 5B8CA 4X6CA 1QFWL 4ZFZB 1P1ZA 4X9HA 4CDGC 5IROC 3MOAL 3MLRL 1YEDA 3FQXA 5DJAA 3D2UD 2Z92A 3NGBB 3DLQR 2EH8H 3LZFH 4RIRB 3VG9C 4URTB 1N7MH 4XX1G 5D7IE 5TE6H 2N4IA 2JCCF 1R0AL 1IM3B 3CIQA 4IRJC 4OF5A 3WYRA 5KN5A 1F3DH 2XY1A 1KLUA 2OJZH 1AFVH 3MV8B 4KKAC 3JV4B 5GS0C 3ZE0E 1UVQB 5IM7A 3ILPA 3LS4L 5DJCA 4YPGA 3L3JB 4M1CC 1SYSB 2DL2A 4NDMB 3VWJA 3RDTD 2Q3AA 4G9FE 1I7ZB 5IVNA 4G5ZH 1JTPA 2JLLA 3QB7C 1SVZA 3S3PA 2YPLD 4P0DA 1QBLH 2XWBA 4YAQB 1ZHKB 3VXTB 4CADB 1H3VA 5C0BA 2WBKA 4YHML 3HN3A 1QQDA 3C6SB 4P2OB 2XWTA 4GLRH 3H42H 3VXNB 4MZ2A 2VO5A 1WFOA 3KJ4B 4JJ5A 3NPSC 2VNCA 1FDLH 2BY2A 3I02B 5IG7B 1ZHNB 3SDAC 4UTBH 5GS0L 5FA3B 3VI3F 4HJ0D 1PSKL 3WE6B 1BBDH 1EHNA 1FIGH 4QRPA 4LCIL 5A16A 5ESVA 3GNML 3GRWA 5F7UA 2FYYA 4LASL 5I75C 1FIGL 3FCTA 5EN2A 5GS3A 5JQ6H 1A3RL 4YFLF 4LASH 1TQCC 4O5LL 4Z7WF 2WBJB 4ERSL 1CCZA 2ZOKB 4L8SA 3VI4E 5I8OH 1NAMB 2NY2B 2CUMA 4LSVH 3D69A 4PJEF 2HG5B 4PS4L 3OJ2C 5J9PB 3P0VH 1CQKA 3SBWA 1CFQA 5A40E 3D87B 3U36A 2R29H 3L5WA 1OLLA 4ODXA 4M6OL 1KPVB 3K81A 1SBSH 1AGDA 3HUJB 5C0JA 2XOTA 4ONHB 1K8DA 4MJ5B 2WNGA 4Q2ZA 4IRSC 3CSYA 1K8IA 5IB4A 5DQDH 5HDBE 3HC4H 4IRJB 4J3XA 5DT1H 1T83C 5GZOD 2VR5A 5E95B 5J13C 1LEKB 1IVLA 3WCYA 5F1OB 5ISZE 4JPIB 3AAZB 1PY4A 3I75A 1MAML 3HC4L 3LEVH 5DT1L 3SE8L 1X5AA 1QSZA 4Q97A 4FQCL 1A1NB 3M17A 5F93C 1T04A 2RFXA 1I7TA 4LEXL 3RWHB 4CNIA 1OT2A 4U0QB 4RFNB 3TH4T 1IE5A 2FD6L 3QHTC 3MRDA 1MJUL 1SHMA 3QYCA 4TQEL 1S5IH 5CJOL 3TBVB 4NNYA 5B38B 1U8QA 1H9VA 2ENSA 3MJ9L 4DVBA 4XAKE 4UAOC 1BWMA 1B0WA 4U2ZA 4OIBA 3PJSB 4M43H 4H0GA 3IRPX 3MJ9H 2AJXL 4PJBE 1W2KT 3KAAA 3LKQA 1G7IB 4L3ED 5JXED 1IJ9A 3L7FA 3NPSB 4S1DC 2VOTA 4N5UA 3NA4A 1VEMA 5FK9B 3NCBB 5J0BA 1FQ9C 1V5JA 4ZUTB 2R15A 4ZO8A 1EO7A 4Y4FC 3PWJB 1IAKB 1BZ7B 2XZQH 4J3WA 4OD2B 3B2UD 1FPTH 1G6RH 1MIEL 5DJ6A 3PWPA 1S7TA 4QOKB 2LE9A 1IAKA 5IIEA 3A6OA 3ZKMC 4TVPE 1MCEA 1OAQL 3THML 2PCPB 5FYKE 1RIHL 1HE7A 1Q38A 1BFTA 5EBMB 5HVHC 2BX5A 5D6DC 1AIFB 3IJHB 1BLNB 3VRLF 3KWWB 3SGEI 5HD8C 4AL8H 4TNVF 1H5BC 3KLAA 2MSPA 1A6ZA 3UTPD 3UJIH 1HKLH 2NY2D 5SWQB 2J7LA 5HPMA 2VXTH 4Q9RL 5D7IB 4O2EB 4ODXB 2GAZB 1NC2A 1X3DA 3BQUD 4M5ZL 3LEXA 3UJIL 5EU6B 3MUGA 2J8HA 3QXTA 5H8DA 1BFOB 1ZTXL 4F7MB 4L8CA 1JNHB 2DIJA 1JGEB 4PJ9A 1H8NA 1I1YA 2AXGA 3F7PC 2EH7L 1EK3A 3MUY1 2NW3B 3VFUA 1ZTXH 4JPIA 1AE6H 2I24N 2VZ1A 1OB1A 3MV8D 1NMCB 2X4UB 4MJ2A 1FC2D 3MBEA 3OR7B 3QPQC 5I1KL 3WIHL 1UWGH 2BHYA 4S1QH 4DKDC 4N9GB 5JORA 3D39B 1B6DA 4OGAD 1HHJA 1VFBA 2ICWI 1UWGL 3NIFE 4UOW0 4JHWL 5FHBL 3PDOB 4AIOA 5HHVL 1ADQH 2B0SH 1VA9A 3WUWB 1I1RA 4R90H 4EIZC 1JGDA 2YUWA 1Q94B 4MA1C 1R3KB 5FHBH 4PJ8D 2X1PA 5E24E 4ORGA 3AM8A 4NHUB 4ZUWB 3UPAA 1JYVA 2EEBA 1JNNH 1KSRA 3LKQB 4LSSH 4XPGH 1NLDL 1OM3H 2YKLL 4KY1H 2IAMA 5E9DB 5GHWH 5HY9B 4MAYD 3RWEB 1AJ7L 2VN4A 4LP5A 2NR6C 1HSAA 4AQOA 3NAAH 5DRWA 1OM3L 4K94C 3TV3H 2H6PA 1OAKL 2JK5B 5A3IC 4OJFH 1IGFL 1U92B 1WT5C 2NZ9D 3S4SB 3DYOA 3BSZL 5CJQH 5DJ6B 4MNQE 2XTJE 1I7UA 3L7EB 1A7RL 3L3DA 4U2YA 2XXCB 4G6KL 5H35A 2A38A 1JPFA 4PP2A 1CD0A 5JPMA 1S7WB 1FNFA 2IAND 4TUKL 1U8QB 1CD1A 4BZ2H 4LCCC 3B3IB 2YMXL 3M07A 5IR1A 2B4CC 3D5OF 1ACYH 1MF2H 2D7TL 3PWUA 3PJSA 2YSSA 5H94A 5BJTA 4RFEB 3D39A 1M71B 2YRLA 4L4TA 2OMNA 3VFTB 4R0LA 3BN9D 4OFPA 3RWFA 1K8DB 4MJ5A 2X70B 3J7HA 4K94L 2EYTA 2P5WD 4K3DH 1MRCH 1KEGL 3BAEH 1T89A 2IPTH 1FNHA 1S9VB 2C4FT 1LP9B 4YXLH 2CKBA 4OLVL 1U8JB 3PL6B 3ILQD 3UYPA 2IPTL 1PKQE 4NKQB 2CDGA 3QUYC 2ZUVA 4GSDL 5SX4H 4OLVH 1ZXQA 1DVFB 4MX7B 5IBTH 1WK0A 3QEHA 3DBXB 5DHVH 1QFWM 5ERWB 2PYEE 1RFDL 5F3HA 3WFHA 4OZIB 1QSFD 4JPVL 5DJ0B 5MHSE 1HHHA 5FGRA 5TDOA 4OFVA 1NAKL 4WRLA 5MI0C 4RGNE 1FFOA 2X40A 4KTDH 4P4KB 4U6HA 5CZVH 2E7HA 1FO0B 5F9WC 4PREA 2ZG3A 3RKDD 3UC0L 3EJYD 4LOUD 4IDLA 3UP1A 1BD2E 5DD0L 4FS0A 4RMUA 2P43B 1G9MH 3NFNB 1KIRA 4OLWL 4H1LH 3SN6N 3ES6A 3KYKL 5JLZB 3OSKA 4PJAF 1UJTA 3RGVC 1A7BA 3MREB 3UC0H 1CFSB 1JP5A 3BIBX 5D70H 1JNHA 3NZHL 4GQPH 4PGZA 1KN4L 4WGVB 3KYKH 5KS9F 3OJVC 1TVHB 4GAYB 5FYLL 1NCBL 2BSED 4J4PA 2BSSB 1YEGH 2YXFA 2D3VA 2E27H 2GCYB 1A0QL 3GUTB 2PXYC 1U3ZA 5TE7H 1AGCB 4KJWD 4X9GA 1Z2KA 3BN3B 3VG0L 1BQHG 4L9LC 2L4OA 3PP3K 4ELKA 1N2RB 3QUML 1BQLH 1T1WA 5KAQG 5SX5K 1MREH 3PABB 5FYJD 4NM4L 4L9LB 3K0WA 4HT1H 4NC1E 5E1AB 2ZNWA 3UTQB 4EI6B 3EYOA 1G1CA 4PTUA 1DBML 1JPGA 1KCKA 2HH0L 4QHKI 1QNZL 2ICCA 3D39E 4JM2A 5GJTL 2FATH 4LCWB 5CS7A 5DC9B 5FGSA 1RIVL 5DHVA 3LVEA 2LTQB 4M1GL 1EFXB 1I8KA 1U3HA 4H5SA 4Q7DA 1AHWA 2X70A 1FDLL 1FO0A 1T20A 3MRNA 3QUXA 2AXHA 2APWA 1EA9C 5D7LE 2DYPD 1A7OL 3K8LA 4XNMA 4PJEA 1FFPA 3IKCA 4BFIA 1PZ5A 4QRPE 3QWOA 4KHTL 4YC2C 2IFGA 3T2OA 1MCNA 3RWDB 1GOGA 1Q0XH 2C3VA 3T0DA 4OGXL 2CDGB 4X8JA 3HI6H 3VXSB 5BW7A 2BC4A 2J88H 5CEYB 1HEZA 1KTKE 2BHUA 2QQLH 4G8IB 3BT2H 1GHFH 5ALCL 1YY9C 3RZCC 3QUZC 3TIDB 4U3HA 5DZNA 5SX5H 4HFUL 5DK2B 4GG6F 3O8XA 5FM4A 5EB9A 3TIDA 3D1MC 5AYUL 4YWGH 1QLEL 1NCWH 2C26A 4MGXA 4PY7A 4M6OH 3V8CA 3J8F7 1RURH 5EN2B 5C0BD 1FZKB 1NCWL 3MGTB 3IF1A 3HZVA 1N3NA 3MR9B 4LEOA 2DJUA 2DQFB 5I30H 3N0PB 1DBAL 2ITCA 3QQ9D 4OGYL 3U4EA 4OFYA 2OTWB 4R4BB 1W72A 3DUSB 4PJGF 4N0FA 1I7RA 2NY3D 4XBGB 3UTPE 1NGXA 3WDJA 1AHWB 2W38A 4JFXB 4YK4C 4OFDA 2H2PD 5CWSB 4POZC 4Q0XL 3FQUB 4HWBH 3QA3B 1KXVC 2ZUQB 4BSWB 4ZO6A 3TJEL 4DW2H 1KTLB 1FNEB 1D5MA 2B1AL 1Y6NR 3HRZA 4Q0XH 1MJUH 5IW6A 4EDXA 1JE6A 5ADPL 4RCAA 1EXUB 1NGZB 5HYJD 3S88H 1L9MA 4OD3L 1VFOA 4JEGB 2I07A 3PWPE 3HLAB 1JGLL 1A2YB 1SJEB 1S7RA 2BVEA 4G8GD 3S88L 2WWKO 4TULL 5MEPA 4HBCL 1NDMA 1JN6B 2IQAB 2VDLH 4WHTA 3MREA 4Y5VC 4M4PA 4IIQB 2NPLX 4M7JL 1ZHLB 1HQRB 2QSQA 1V3MA 4ZYKB 3VFPB 4APQC 2AJVL 1G7JA 3E3QC 4DGYH 4X5LA 4LRNH 2VDLL 1IZKA 4WUUD 2FX9L 4RISL 3B9DA 1MFCL 3D3VE 1XZ0B 4XBPA 1VPOH 3T04D 4PJFF 3X3GH 2A83B 1XF4B 2ZWLT 3T1FA 1FVEB 2GITB 4YBQD 2WAHA 3ZTJG 4NZDA 4QCIA 3MACL 2C3WA 3EFFB 2ADJB 5C0ND 4HMEA 1XIWC 2QSVA 3FOMA 1T6WA 5IFAH 4KTEL 5I9QC 3FO2B 5CEYA 2FIKA 5T3XL 5AUMA 2GEEA 5DJZA 4RMRA 1LNUB 2I27N 3DMMB 4MCZA 1I7ZA 4F37F 4JHBA 5BZWA 5DK2A 5F9DC 5LGKA 4P2RA 5EPMB 3DMMC 4M8VA 5J6HB 3KPMB 1UCBL 4KC3B 3I6LE 1F90L 2E8ZA 4O51B 3RY6C 5AAWA 1U93B 4JY5L 4IS6B 4JFOB 4ZDHB 3X12B 5C0AB 4N0YL 4E41B 5TE6L 3MLTA 4ZS6D 3DRQB 5INDB 1RJCA 2F8XC 1AFVL 3IFPB 3ARZA 3B43A 4EXPX 4NN6C 3QJHA 4HKJB 3IDYB 4N0YH 1F6FB 4J3OC 4HSQA 4YK4B 1T6VN 1AE6L 2ZCLL 5C3LD 2OI9C 4TTDD 5TQ0L 2VTFA 2XN9D 3T2NH 4PG2A 4C58B 1T5WA 2CO7B 1LE5B 4NZRL 5HYQB 4JQVA 4PJIA 3VFVB 2ZCLH 3WIHH 1KOAA 4GQ9L 3VXRA 1X7QB 3IJSA 3WEXA 2V17L 1KG0B 1RZ8B 1DANT 4JN1L 2B2XL 4KROB 4JHZA 1A1MB 3TNNA 5C92A 4NGHL 4W6XB 5F72S 5CP7B 3R1GH 1XCTB 3DROA 4MS8D 3R0MA 4LAJH 1KIRB 2B2XH 4KGLA 4I13B 3EJJX 2GSGA 4F8TA 4U0RB 3UTZA 3K4AA 1RVFH 3KJ4C 4AM0A 3LHPL 5T3XD 4Y4KB 4ODUA 2IPKB 4JDTH 1INQB 1A3RH 1EBPA 4PJAA 3GSVA 5SWSE 2CQVA 3U7YH 3ZSTA 4PJIF 5DFVD 4HUVB 3VDBA 2HT3D 4RRPA 3TV3L 1MRFL 4IMKA 2IADB 3H9SE 2X4NB 3TNMA 1NMCC 4LCUA 4V1DD 4Y1AD 5GRJH 4UV7L 1MQ8A 3TYGH 1IGTA 5ALBH 2CH8A 1VKXB 5BMFL 2DLFL 3TN0B 3OKMB 1MCPH 3AREC 1P6FA 4YLQT 3O0RH 4BZ2L 1RQ5A 1PG7W 2BERA 2EC9T 1OAXH 1INQA 2YMXH 4QY8B 1MH5B 2C3HA 4K3EH 3KPSD 3LY6A 1FORH 1ZGLP 3VMNA 4OV6F 5ITBH 4JFPA 3LEVL 1S9YA 3PG2A 3T65B 3T0AA 4JGUA 5D7IA 4QHNA 3MUZ1 5JIKA 3MR9A 1ZLVK 4QRRE 4YR6B 4KMLB 3MJGX 4K3DL 2Y25A 3SCMD 2JCCB 4MDIB 4LKXA 1NKOA 4NN6B 3C6SA 4L8BA 1P4LA 4UILL 1T3FA 5FUOL 4YHPB 5DD6A 5I1LA 3MJ9A 1KXTB 1JWMB 2OXGA 5FO8B 1QRNE 3N06B 4PJ8B 4LLMB 4D3CL 4G80A 5F9AC 5FUOH 1Y18A 1FAIH 4PRHE 2JIXD 1J05B 3QDMA 3MRPA 4GRWF 1D9KC 3AB0B 4PP1C 3PE9A 3T4AB 1MWAL 5BZDA 3GSNA 1KB9J 1G9NL 2NY4C 4FFWC 2MCPH 3BRFA 2AABL 1CFVH 3F7YA 4B5EA 3DVGA 2QL1A 2WUCL 3GIZL 1CICD 2DJ4A 4GG6A 4R8WL 3GJEB 2J8UA 1JGDB 5FKAA 1LK2A 1VENA 3GKWH 4K07A 5EOCJ 3S37X 3TLRA 1JFQH 1KT2A 5EORL 4NT6A 3ULVC 1CT8A 3C5ZD 4LIQH 5HXMA 2VDPL 1IT9L 2YD6A 2ZNXA 3NZHH 4DUVA 1N59A 2W9LA 1DUZB 3T0EA 3M17B 3KYOA 3KJ6H 1DLHB 3Q2CA 4MA7L 5DRWB 3RVUD 5D7LA 5IEKA 4X80L 5FF6A 32C2B 2GQHA 3GBLA 4LU5H 1P4BH 4QHMB 4AL8L 3H7BA 2BVQA 5I1IL 1FV1B 3TN0C 1T1YA 4L8BB 2QADB 4XWOC 3HB3D 5LGJA 5HVHB 1BQLL 1OWWA 3ZL4L 3KLDA 4OM1L 2GJ6E 4X7EC 1WZMA 1UJ3C 3VXRD 8FABB 1CGSH 4G6FD 2Q6WB 1HQRA 1YEJH 5HPMB 5JOEA 4PJBA 1DEEB 1WEJL 2EDLA 4U6VL 4Q9RH 4Q6IA 3V6ZB 4M6AA 4KJQC 1DQQB 3I3DA 4M1GH 1Q9KB 1V3LA 2BZDA 4AEIH 1MI5A 4DGVH 3CDGB 1BJ8A 1W0VB 1OAUH 2QQKL 3AAZA 1OF2B 1YEHH 4C4KO 4JFDE 3TA3B 1EZVY 3SGKA 2R23A 4AEIL 1A7OH 2NLJB 4Q6YA 4RMSA 4Z7NE 2WSKA 2PCPA 5TH2A 4U1MA 3GBML 4KHTH 5HGDA 4FA8A 2AK4A 3MXVL 2P8LA 2CGRL 1HCFX 1TJIH 1LP9F 1Z3GL 2YD4A 4OGXH 3IJHA 4NKIL 4BQCA 5SV3A 4QNPF 3NTCH 3WIHA 1XR8A 1OD9A 1ZT4B 4QWWC 2J88L 1Z3GH 3HPLB 3VA6A 2VZ3A 2LFGA 3HR6A 5KS9B 3WFZA 1HHGB 3TNNB 2JJTC 2HVKA 5ECJE 1JPFB 4RAVA 2GK0B 1ADQL 3K74B 1CU4H 4MJIE 5T3ZL 5I66A 2MPAL 3DVGB 3D0LA 4JFEA 2ERJB 3CH1A 1FGNL 4YDJA 1MRDH 1MWAA 2ARWA 5MERB 5D72L 3FQNB 4FQXD 1I8MA 1GH7A 3HNTL 2Y36L 1OTUC 4G6ML 1R5WA 2VABA 2XTJC 1NANI 3BSZH 5CJQL 1RZIB 1LE9A 4XRCA 3ME0A 3EYSH 1DBAH 4FZ8H 3NAAL 2AXJA 3HNTH 4OGYH 1JTOA 5F44A 3ARQA 4QOKA 5EC2A 4FXGB 4L4TD 1MAJA 4WWKC 4UQ2B 5DD6B 3SKOB 1HH6B 3QIUB 2YD1A 3OKEB 4AG4H 5BS0E 3K2UH 1SVCP 1MF2L 2D7TH 5DZLA 1A7RH 2D0FA 3JTSA 5DR5L 3S97C 3S36H 1WBXB 3UPRB 2DOCA 4L4TE 2HJFA 3PP4L 1JMXA 3QIUA 1XF1A 5J7CC 1N3NB 4W68A 1FRGL 2B20A 5DR5H 3TJEH 4DW2L 1YYMH 3GSRB 1KLGB 5GXBB 3BDBA 4LNRA 4HIIB 4JFQA 1N5YH 1JL8A 3PXHA 1A6AA 4M62H 2HMIC 2XG4A 4FFVD 1EGJA 4EN3D 3CC5A 4JG1H 1LHZA 2DI9A 2ZSWB 2R0ZL 4XPFL 2BDNH 3BKMH 3RU8L 1QSEA 4F7PB 3VRIA 2LAGB 3ZYZA 1LO2H 2HP4A 1SMAA 4X6DF 5D5ME 3JVGA 2ZUSA 3ZYOA 3ULUH 5DI8A 5JA8B 3OGOE 4Z7VB 5ITFA 1I1CA 1FBIH 1UXWB 1T21A 3GRWH 1BBJA 4K3GA 5DJXA 2E9IA 1MIML 1EEYB 4M8QA 1XGRB 2XNAB 1T5XB 2XTJD 3HE7A 4G7YH 3KGRA 1FHGA 3VFNA 4H1LA 3SY0B 4OZHA 3RZCB 4S1DD 5I18H 4PJCB 1UWXH 5FKPB 5EOTB 2A0LC 1M7IA 2EE6A 3Q5OA 1F5WA 1PKOA 3L3OA 4YH6A 4Y16A 2AS5M 4PTTA 1ZGLA 2ICWB 1OW0C 4LP4A 4DVRL 3P11L 2K1MA 4JRXE 3ARBB 4W4NA 2QQNL 3V4UL 5LJYH 1KYOK 2BJML 5D70L 5ICXB 4G8FA 2UYLB 5L8KB 4FN0A 3BZEA 4DZ8B 3OX8A 1D5MB 1A8JH 4JN2A 4BH7A 3QEUB 1IKNA 2E27L 5JZ7C 4OLWH 5IB2A 1A0QH 5I1AA 1H15B 1LQSR 5IVXF 1JTTA 4JY5H 4Y4HB 2OJZL 2P5EB 2FLRT 4FQJL 4EN3C 4G9DB 4IIQA 2AEPH 4RSVA 2GCYA 1KIQB 5ACZA 1CL7H 1N6VA 1Q72H 5E8EA 3WHE1 1AGCA 2I9TB 3C9NB 1BFVH 3O2VL 1U3HD 4D0CA 3HMWH 2ZUQC 4QT5B 1T2QL 4PJ7E 1P84K 1WFTA 2APBA 5T1LD 3QUMH 4NZRH 3UTSE 4NM4H 1T2QH 2ICWJ 4FZEH 4WI5A 2ZCKH 3S7GA 4JN1H 5C0BB 3KPSB 4JKLA 1QA9B 2VDMH 3NFNA 5BVJA 4HXBL 3MLZH 2WBWB 3VWKC 3ETBF 4N0UE 3S5LG 1FH5L 1UEYA 4PD4J 3LRSA 4HF5H 4Q6IB 2IH3A 4UTBL 4YHKL 5I16B 4OZFG 3G5YA 1Q0XL 4RBPK 1NCDL 1ZEAL 4PP1D 4Y7MA 2DMBA 1WAAA 2IG2L 5A2KH 1ES0B 1I85C 3SKMA 4Z7VA 1WUNT 5MP6L 2JJSC 5SWZD 1B2WL 3IDYC 4PY8J 1OT1A 5C9KA 4IDJL 2EDJA 3P77A 4HX1A 5D71H 5MP6H 1C16A 1KCSL 4P57A 5J1AA 4L8DB 2Y9RT 2W9DH 5IF0B 1B2WH 3C87A 4YWGL 3ROOA 5F7MC 4C55A 3K8MA 3BT2L 1GHFL 1JPGB 4M5YL 2YUVA 3GBNH 3CX5K 3VI3E 3ZZ1A 4R0LB 4JFEE 1RURL 2D0GA 3V5DB 1UM5H 3OXSB 3HUJF 2IMMA 5TE4L 1AR1C 5D2LB 1XMWA 3T8XB 5KVGH 2RAMA 3MYJA 3TBYA 1NGZA 1G6RB 3B9EA 4DN3H 3S3SA 2BNUA 4PRPB 4WFHD 4IRSD 4PJEB 4WTZG 2QADD 3MV7A 4P46B 5ICZA 3EO9H 3ZT6A 3VI4F 1FCGA 4L9DA 5IHBA 3FB5A 4Z7WB 3WXWL 3RWGA 3O3EA 1S78D 2W59A 5I1EH 2OLDA 4LMQE 5F1NA 1CICA 3FO0L 2AK4D 4F7EB 3PIQB 4Z77A 5B39B 1S9WA 2HG5A 3GHEH 5F9OL 4MMZC 4GKNB 2AQ1A 3BEVA 4XP1H 1KFAL 4B0MM 1G7LB 4RGOH 3GI9H 1KPUB 3VXMA 1VCAA 3FB6B 3AMLA 3KYMA 4KK5D 4OLEA 5CKGA 3S4SG 5DVKA 4K55A 4JANA 3H8NA 1BGXH 2DQEL 3E0GA 5DJDA 4DGYL 4M43L 4RGOL 2WBJD 4WFEE 3LDBC 5EO9B 5EZJA 5I0DA 1J0HA 3A67H 4N5EC 1VGKB 4U7KA 3JXAA 4Z7OE 3REVA 1CIDA 3MJ7A 4JRWA 2DBLL 4N9GA 5JORB 5EO0A 1ZHBA 3A67L 3S9DB 3FFCB 2M2DA 5H2BA 3GSWB 4X7DC 2BXYA 4XX1E 4QRTB 2FX9H 2WINB 1IT9H 4NC0B 4OUOA 4ZTPH 3TO4A 5J57B 4UIMB 4KAQH 3FZUD 1ZLSL 2XNAA 5IQ9B 2X9XA 4PUBL 3OGCA 3KPQA 4KKLC 4PJBF 3T4YB 4KAQL 2FO4B 3GMNA 5BRZA 3SDCC 5I1IH 1FO0L 1H3WM 1CLOH 4J23A 3LV3B 5BV7B 1XIWB 2ADIA 4G9FA 5F3BA 4PUBH 3BPOC 1UCBH 1J1XL 1I8IA 3VXOA 1CZ8L 1MFBH 5CD5C 4MB3A 5MENB 1FNSH 3C6LC 3X3FL 1QP1A 2E9BA 4WWKD 4D9QE 5T1KB 3RDTB 4EUPH 4JO3H 5GGQH 4GO6B 5JHDD 2X7LB 3K46A 3G5XB 3F7YB 4X4ZA 2BSRA 3SGJA 1F90H 4JFDD 2X41A 3O6FD 2DDQH 1QTYT 3O4LB 4JZOB 1OAUL 4PGEB 4Y1AB 2FZ3A 5T3ZD 3RI5K 2VDNL 4KRMB 5L8LB 3GSOA 3VRLE 2FECI 4JAMA 4OZ4B 2YN3A 5GGVL 1YQVH 2P46B 2P5EE 3B9KC 3FO1A 1U3JA 4DFHA 1II4E 1RI8A 3RX7A 4YHPA 4K23L 3U79A 1T5WB 3RI5F 3PWPD 1D9KB 3TZVC 3RZWA 1QBLL 1MLBA 2ESVA 3N50A 1TJIL 1CG9B 4HZLA 4NKIH 3CJJA 2F8OA 4KPHL 2ZP0T 2AVGA 1RMFH 3FQTB 3H9HB 4I4WA 2VH5H 3K7UA 3L5IA 4XCCL 2OZ4L 3U48A 3G9VA 4XCYB 3UTSB 5DMKB 5T1KD 1LWRA 2UWEA 4ZO7A 4LFHG 3C09B 4JM2D 1SJXA 1I3RB 4U1MB 1V7ML 5L88L 5E5RB 4XPGL 4F9PC 4X7TB 2C7UB 1NUGA 3EYUL 4S2SB 3QXAA 4LAQL 5HVFB 2ORBL 3RWIA 2CDFA 5DVNA 3VH8G 1YMME 3I9GL 2A6KA 5CZKA 4BKLA 3QNXB 3OXRA 1UT9A 4PBXA 3HHRB 3VJ6A 4YXHL 4D9QD 5BMFH 2QTEA 2VQ1A 1CQYA 4YBLB 4DKFH 2B5IC 5E70A 2V7HA 5F7WC 3O0RL 1IC5L 4LRIC 2FEEL 3UTTD 1YEIH 4JE4B 1NCCH 5GRJL 4NZUL 1HH9B 25C8H 3S36L 1AKJB 1G7PB 1U2CA 5F7YC 4S2SA 3BWUC 2Z93A 4HUNB 5D2NB 2D2OA 3B6SB 1QFHA 3LN5B 3NIGE 2EC8A 1ZLWH 2HJLA 4C59B 1IEBB 1TNMA 2P49B 5IV2B 4ZS7L 4OFIA 1MVUA 4I48B 4XP6H 2EYSA 4IRZH 2FJHA 1UFUA 4Q74A 3ARFA 5ESQA 4XCEA 2VLRE 3TT1L 2APVA 2NY1D 4Z7UA 1T80A 3BXNA 5F6HI 3BGMA 4R2GC 5IVZB 4YXLL 2CRZA 2VLKB 1AO7D 3ARPA 2CKBB 2R2BB 3MNWA 1A02N 5FYJU 5C0FB 3QXAB 3RWIB 2Z31A 5IBTL 2HFGL 2MCPL 3VWKD 1NEUA 4JM2F 1GOFA 1KGCE 1J1OH 2B1HL 3MGAA 4OGAC 5J4MA 1A6TA 1ORSB 3MRBB 2DLHA 4D3CH 2WMPA 3PWUB 3VFWB 5KVMC 1KPRA 4Q9QH 3GSNB 2BVQB 4HHAA 4RBPH 3GKWL 3MRMA 3CZFB 5IB5A 5EORH 3SKNA 3V7MA 4Q9QL 5I73C 4P5MB 4AY0A 1KJVB 4MDJA 3ZTNL 1L0QA 5C0IB 3HZMB 3KNBB 4PJXF 3O3DB 3BESR 1TZHA 3KXFD 4M9OA 3KJ6L 4MA7H 5KJRH 3ARSA 4PRNA 1UKQA 3LRGA 3MOBH 4Z5RB 4WFGD 4LU5L 3O3AB 1TITA 1R3JB 1RUQH 2VITA 3D0VB 3AU1B 3CFIC 3CUPA 2FZ3B 1UACL 5KJRL 4LCWE 3E2HB 3HG1D 4H1LG 2VR9A 3O4OB 3MO1A 2NX5A 1OTTD 2YPLE 4WWID 5DJCB 4P2OC 4YBLC 3SDXE 4NO0D 1FLTX 5IMLB 4WEUD 1Q72L 3MX0A 4AZ8A 5HVGB 5HHPA 3DMMD 3MXWL 2HT2D 4JKKA 2ATKB 2DB8A 2FX8H 5D7LD 1VB9A 1XH3A 1Z9OA 4NQCA 5ESAB 1CBVH 1R3KA 3L3HB 3SDXB 1WEJH 4QTHA 2HTLD 2GY7B 5KS9E 5F1IB 3V0AC 1I1AD 1CBVL 1XR8B 1ZT4A 4NQCD 1YMHB 4DGVL 2YD3A 2X05A 3RA7L 3HI1A 4GKOA 4ZNEA 4YDVA 3FO9A 4EKXA 1CFTA 1AKJD 3VGGA 4P3CL 3OG4B 4TRPL 4N8PA 4LF3B 1KENH 4TTDC 3BRDA 1MVUB 1PQZB 3DTXA 2UYLA 1F4XH 2PTTB 3HRZB 4UOJA 4NN5C 4OZFB 1MEXL 3NCCB 2E5EA 4Y2DA 1N5AB 5FHAH 2UUDH 5ESVB 3H9SB 2AQ3A 3OAZK 4I0PC 2XRAL 1KB5B 1RJYB 4MAYA 2J2ZA 4LIQE 3QO1A 4MVBD 4S1QL 3I3EA 5F3HB 5EZOL 5B39G 1H0DA 3V4PH 1RUKL 3QUKB 1RY7B 3F7RA 4P3WA 1OTTC 5FAAA 1KCSH 4DJMA 1TQBB 2XFXB 4HZLB 3RZCD 5IFJA 5I2IA 2DTMH 3FN0H 4JKMA 3V4PL 2Z35A 5EOCL 2ADFH 4DTGL 4KKNA 1GGIH 4MNQB 1IILE 4H0IA 1ZHKA 1ED3B 1K4CA 4MNHA 5I74B 1QACA 5HYQA 4HH9A 4OZFA 5AYUH 1EJOL 4JKPH 4NM8L 1XEDA 3SPVB 2CIIB 1A6VH 2UVEA 1NLDH 2YKLH 2YUZA 1A6AB 3IXAB 4FTVA 3BHBA 4QRQB 2DICA 1N59B 2CMRH 5FA3A 2JJUA 2P8MA 1OAKH 1VDGA 3CXHJ 4BKLB 4OJFL 2NY7H 4YPGB 5FA4A 1VFMA 1MUJA 4PJDF 1YDPA 2CPCA 3RJQB 4PGCA 4Y2OA 3C2AL 3GMQA 3BUYB 3VWJB 5J6GB 5J6HA 1RHHA 4HKJA 3RX8A 3RQ3A 2GK2A 3EAKA 1IAIM 3FQRB 3CDCA 3C2AH 5HHPB 5I8KL 1G6RA 2HTKD 3ZT7A 3SE9H 4A6YL 4XP1L 1NBYA 4YUEL 5HHOA 5I8KH 4W6WB 2ICES 3OHXA 3SCMC 3WL9B 1RK0B 3SE9L 1LO2L 1SY6H 4XP4H 4LVOB 5LGHH 2HJKA 3RIFF 3MLPA 3KPSA 3SDAD 5KSBE 1F11A 4HJGB 4U1NA 1QRNB 1U8HA 3V6OE 4X5WB 2BDNL 4GOSA 1IMHC 4MXQC 1NGQH 2XACC 5HI3D 3LB6C 5EFIB 3U2SA 3IETA 1SBBA 2P5WE 2M1KA 5KS9A 1PJ9A 2MJWA 1LEKA 5D93C 3DRTA 3RWDA 4I0PB 3GRWL 2VL5B 3QZWA 1N8ZB 1JI2A 3BGAA 5DMYA 1DJSA 4X4ME 1ZVSB 3P11H 4LLYA 5JW4Q 3FL7A 2R9HC 1GGYA 1HSBA 4XPBH 1BQUA 2ZUXA 1KNOB 1BQHB 3KHOA 1UB6B 3I2CH 3FN3A 4PJ7B 5I18L 5LAXA 4Z8FL 1BVKB 3CFJB 5DFWH 1FO0H 3MUHL 4PJHF 2YEZB 5AG9A 4GH7B 5A2FA 1LE9B 4HKZB 5CZVL 5ANMA 4E42A 1J1XH 1YNTA 1HXMB 3VRJB 3X11A 3IFOB 1TJHL 2AW2A 1UXSB 3S34L 1JRHH 4JREB 3AS3A 1JHTA 3X3FH 5ESQB 4C57C 3UTTB 1R0AH 3WDHA 2FYYB 4ORGB 2OYPA 1J0ZA 3K1DA 1W72B 4YJZL 3HMWL 1MY5A 4Y4KA 1HILA 2DDQL 2V5TA 5K59F 4IOSD 4Z7UF 5TE7L 2VLRA 1G7MB 3U46B 2ZG2A 1RJYA 3S35L 1ZS8B 1CL7L 4Z78B 3LB6D 4FZEL 4BYHA 1VEOA 2JIXA 3QEQE 4U1KA 4U1HA 2R1YB 4NQVA 3D18A 2GHWB 4HXBH 5IEKB 4GQ9H 2E3VA 2CKNA 3VRIB 2Z92B 4XNZC 3RBGA 2H3NA 1C16B 1X5HA 4NGHH 5KBNC 4YHKH 3QAZB 1BVZA 2V2WB 1KPUA 4K8RC 3OL2A 1TCRA 3OKNB 1TVBA 1RIVH 1HILB 2Q76B 1NCDH 1ZEAH 3VMOA 1BFSA 3N85L 3VE0B 5E5UB 4FG6D 4WV1B 4L3AA 4XVJH 3UAJC 2J3SA 1Q9OB 4HPYL 1KF9B 5BJTB 1QVOB 1UZ8B 2LV4A 4OZHB 4JRYE 4HF5L 5DEFB 1GPOL 3MGOA 1SYSA 1N64L 3I85A 3O11B 5I0ZA 1FLRH 1UXWA 1NPUA 4AENB 1U8IB 5IMMB 2EE9A 2P4AB 1DN0A 1UCTA 1ETZB 3HCVA 5TFSL 2DBJA 2W9DL 1RULH 5FGBA 3FQWB 5EUKA 4ZFOB 1ZT7B 4NNYB 3LIZL 1KTRL 5F7FA 5C0NC 4F33B 3HI6L 1FFQA 4P57B 5HGAA 5MHSD 2JJWA 4XMLH 4P23C 4DCQA 5ENWA 1OTUD 5D96B 3LQAL 2LU7A 4N8VB 4YHOH 5ICYB 2IQ9L 5HDOA 2CIKB 3BP4B 1HK6A 1N6UA 1V3JA 1PW3A 3Q5YA 4Z6AT 3PL6C 2XPGB 4EBQL 4HUKB 3FT2B 1RJLB 4V2BA 2HRLA 4M93B 2DYPA 2IQ9H 4IS6A 4JFOA 5DMIH 3IS0X 4ZS7H 4HH8A 4EBQH 4I3RL 1FVEA 4HIEA 5IB3A 5FOJA 3QIWA 3RNQB 5DMIL 1FN4A 4PYGA 3GHEL 5HHOD 2EDKA 1QSED 4QRRD 4FG6C 3UAJD 3ARXA 1HDMB 4P4KC 1NBQA 4QOKD 3R06A 1YEFL 4HWBL 2R2HA 3QDME 1TDQA 5EDXA 4F9LC 1DDHB 3LKOA 4FQHB 2DMKA 3D48R 5EU7C 1REIA 3RGVB 1TTUA 4JQXA 1ZSDA 1ED3A 3W11C 2VLME 4A6YB 2CLRB 1ITCA 5I8EB 5JDSB 2V5YA 4DKAA 4GKSB 4JN2B 2AABH 3X14A 4LLAA 3U6RB 3CLEL 4POUB 2HVJB 3DX9B 3GIZH 1BGXL 2DQEH 3BKCH 5ID1A 4KK6C 4AM0B 2RCSH 3WMSA 1J8KA 3FT3B 1G7HB 4R3SB 1MCQA 3NFPA 2OJEA 3ZKQD 4RISH 3HZYA 3PWNB 2PW1B 4KQ4L 2H8PA 1MIEH 3CFDB 4GRWE 1MFAL 3ULSB 3WN5B 4RFOH 4ZTPL 4APQD 1GGUA 1TPXB 2W92A 4JGMA 1OAZL 5D7LB 1P4BL 3ZKXB 2B8OT 2UY7A 3MACH 1ZLSH 2IH1A 4NO2B 5DI8B 3C2SA 3BZFB 2KQNA 1JYWA 4LHUD 3GSNH 4GXVL 2DWDB 4JO3L 5GGQL 1Y0LB 1WBXA 3UPRA 3MJ8B 3HB3C 3ORJA 3ZL4H 4PJ5E 3GSNL 3VXME 1G0YR 4O9HH 2VXTL 2GUOA 1UB5B 5EOTA 4CU6A 5DEGB 3PQYA 4CVUA 1VACA 5F7NC 5DJAB 3PV6B 4P3CH 2ZSWA 4DAGH 5F70A 1JUFB 4N90E 4OLZH 1YEHL 4QF1B 5GSVA 4K23H 4OGZA 2PW2B 2R69L 2YN5A 4OCNC 1V3KA 1NCNA 3KPQB 1A9BA 2EDWA 4D0DB 1K5NA 2PO6D 2XRAH 2R69H 4Z76A 1U8OA 1BZ7A 3ARDC 1P4IL 1O0VA 4U33A 1QO3B 4WTXA 1ORQB 3MROA 4KTYA 1BD2B 2VUOA 5D7SH 3NACH 3PABA 3QI9B 1P4IH 4B7LA 4TSCH 3WDIA 4JDVB 2ED7A 4OQTA 1GGIL 1JF1A 2ORBH 4PJHA 3NACL 4BSVA 5F8QC 3OKLB 1IFHH 3P9LB 1C7SA 2Z93B 3STLB 1ONQA 3V52H 4EZMA 2UZIL 3OJMB 2HT4C 4YHNA 1P7HL 3HAEH 4HBQA 5EU7E 5L88H 1IFHL 1A6VL 3N1PC 2FSEA 3SJVB 5I17A 5IB2B 3U7YL 4R96A 1AD0B 5E4IA 1R3LA 4NZUH 1HQ4B 1AC0A 3RFZC 4DZBA 1FL6B 4NQVB 2W65B 4JFPB 4NCDA 3K2UL 2J5LB 2H32B 2DQUL 5E4EB 5CWSA 4HJJL 1TJGH 3BKJL 1U95B 1IC5H 4PLNC 1D5XB 5KVDH 4D0CB 3ISWA 2Z9TA 5BS0B 5BXFA 5CD3A 1WGOA 1P7KB 2HT3C 5E4EC 5C08D 5GS1A 3TF7C 2NY0D 1CD9B 3CX2A 4OCWH 4XMKL 3K4DA 1YJDC 5D2NA 4UU9A 1ACZA 5D2NC 1D5XA 3CFKA 4Y2DC 1NGYB 4UZGA 5ERWA 1R3LB 3V95A 5KSBA 1AY1L 1MRCL 1KEGH 5LGHL 1B88A 1FAKT 5LVEA 4MLSA 4YDVB 4XP6L 3VW3H 4KRPB 3OX8B 3QHZL 3RWCB 2XTJB 1U8JA 2QHLA 3VJ6B 1MCHA 4ZUSB 4MJ4A 2C1PA 3CFEA 4XAWL 3SQBA 1G0XA 4FMKA 3RNKA 4UILH 4JFYA 3W0WD 3VW3L 4F58H 4HGWB 4J8RA 3BOVA 5C07A 2EDEA 1RFDH 4XZUA 5AG8A 5H94B 3L3KB 3V6FA 5IHLB 3G6AB 2MMXA 4QHUB 3W0WE 1J1OL 2FEDD 4XPBL 3U1SH 1G9NH 4HAFA 3BO8A 5INCA 5HHQA 1X4XA 4JRXA 1FYTB 4Z9KB 2WUCH 3L3GA 5DD0H 1L6XA 4HULB 1P7QB 2Y7QB 3QUXB 1VESA 1RUQL 1ERNA 2R39A 4JGJA 4F7PA 5DA4A 1KCUL 4E41E 2ADGB 5IJKA 2BY3A 3H6JA 4GG8B 3B8YA 1RZIA 3QQ9C 4KZEL 4KKLD 4KVNH 4WO4C 2WUBL 2K7QA 3UTQA 4XTRC 1YJDH 3KPNB 4DEPB 5C0FA 4C56E 3ZE2F 2GSIA 3EYVB 1NUDA 3QCTL 3BN9C 3MCKB 1OLZA 3TBTB 1T04B 1N2RA 3EIFA 5F1KC 1BFVL 3MRBA 2IF7A 2Y7QA 3PGDA 3S35H 2X1QA 3CD4A 3U82B 4JZJC 2G75B 1X9QA 4G3YH 3JUZA 5DJYB 2H32H 2FX8L 2KZ1B 1VFBB 3IKCB 1H0DB 1QNZH 1Z0NA 4GAGH 2MKLC 4QRRB 3WO3B 1ZA3B 1S8DA 4NRYA 5IVZA 2I26N 4LPYA 5IVXE 3NZ8A 3GMNB 3L3KA 5JIIA 4P2RD 1X4ZA 4FFVC 4MCZB 1V05A 4LPXA 1S7RB 5F3BB 1RZ7L 2OR9H 2P8LB 4JG0L 4P99A 2FEDC 1ROWA 2DTSA 1HWHB 4W4OA 2Z31B 4RMTA 2OCFD 2BNQD 1VACB 1F2QA 1NFIA 1IGIH 3U7WH 4ZUVB 4ENED 3DTXB 2VISA 5B4MC 4PJ7F 1C5CL 4OCSL 5DRZA 4PPTA 3ULVL 1GPOH 1Q9LB 3LH2H 5EZOH 1T0PB 1CK0L 1N26A 1JYXA 4PJ9B 3C60B 5GGTA 1FL5B 1EMTH 3IJYB 5CSZA 5FUCC 5JIHA 3PHQB 5ID0A 3IDJB 5GGSY 4CBPA 3QG6A 4KI5C 4I1NB 2GTWA 4ZOBA 5EOCH 1H5BB 4D0BA 3QO1B 4OCRL 4MHHG 5C2BL 1EJOH 1QSFB 3HR5A 5AYQA 5BS0A 1KULA 2ZUWA 2PO6B 3W9EB 1JPSL 2I07B 1I3VA 2YD7A 1C8PA 1IEHA 5SWSB 4LRIA 1M7DB 3WFDL 1WF5A 3CDYA 1J10A 3OB0H 2DTML 4ZUVA 2WP3O 1ZVHA 4OCXH 2R0KL 4JQXC 4KK8C 3WFDH 1KXQE 4LF3A 5DFTA 2W60A 2EO9A 1T0NB 5CGYD 3RWFB 1I4FA 2IAMD 3GSUB 3IDIB 2DKUA 4Z5RA 3KPOA 1R5VB 4JZNA 5FYJE 4ZDHA 3X12A 1OOAA 3TPKA 2O5ZH 3EYSL 4UDUB 1B90A 2WQ8A 2CMRL 2FL5B 2WLYA 2EDXA 4LSUH 5JNYA 5KSAB 2P47B 4PGEA 5D9SB 3HZVB 4FQXC 3RIAF 2APTA 3O8XD 4G8GA 4UV4H 2VLKD 4GAJL 4X9BA 3SHSA 3V6FB 4HHAB 3T08A 4PJIB 3UJJH 4XNMB 4JO4H 3V5DA 3QI9A 5A1AA 3VXPA 5DUML 3QUMB 4V2CB 2GJ6A 3GI9L 1F4WL 1HIMH 5DYOA 4B41A 1WCQA 4GBXA 3IT8D 1N5YL 3B9KA 2E7LA 1I9RH 4M62L 4HBCH 4FHBD 2D7OA 1UG9A 3WUZA 4JG1L 1SY6L 4XP4L 2WIIA 5I1HL 2VWEE 1GZQA 2P1YA 5E2TL 3BKML 3VFTA 2MKWA 1L7IH 2BRQA 3EUUA 5BRZD 2DBLH 5J8OA 3QPQD 3BIAX 3N1MC 4M9PA 3IU4H 2C1OB 2GT9A 1VPOL 5I1HH 5E7BA 1WICA 1F6AB 4YR6A 1TVDA 3ZE1E 3P9MB 4TUOA 5T1MA 3C6LA 1NCAH 1Z9SA 1PD6A 4FXKA 1H3PL 5C07B 5H35B 5JW4M 3ZMRA 1BOYA 4MA3B 3AFLA 4ZG1A 4U31A 4QGYA 3UBXA 2Z31D 1U8PB 2F5AH 4XPTL 2N7AA 3UEZA 1JRHL 4G6AC 4UUJA 4JFFD 3MOQA 5HHNB 1JYNA 2IBZX 5HHXL 5A2LH 4EIGB 4KROC 4L29B 3QIBB 4EI6A 1SMOA 3MRKA 3TH2T 3TBSA 5KSBB 1FGVH 1ADQA 3U0PA 1A4KB 3BMVA 2Q7NA 2H3NB 4X98A 2A0LD 4HIHA 3L95A 1J0KA 3LQAC 5EO1B 3IB4A 2WLZA 1FGVL 2A74B 4HDIA 2IANE 3ZKMD 3U4BL 3MUJA 3R4DA 1I3RA 4ZNCD 4FQJH 1A3LL 3OPZH 1A2YA 3V4VH 2G60L 3S5LA 3KPRE 4Y5YB 3I02A 3S8WA 2VE6B 4JB9L 5GGRB 4KJYB 2IGFH 4RMVA 2G60H 1J8HD 4J4PD 3WN5C 4WDIA 1G7JB 3MRKB 1KJ2A 4FMFA 3GFUA 32C2A 2Q8BH 4U1LB 3D18B 1IBGL 3SDCB 2NY4D 5ANMB 1PAMA 3H42L 2Q8BL 3W0WB 1MQKH 3P40A 4XVJL 3MZGB 2VH5L 3JWOL 1CICC 4M61A 3CFBB 3RVXC 3UTSD 4JVWA 4WHYH 2X10A 4F7MA 3NZ8B 3MLZL 4TSCL 2N1KA 3OKOA 3LHPH 1XIWD 4QHLA 1V7MH 3DUHA 5TFSH 4J2XA 4JDTL 3EYUH 4ZUUB 4LAQH 1JZ8A 2I60L 4ETQA 2HN7B 1UB5A 3LIZH 3MRNB 1N64H 3KHQA 1BX2A 1JHLH 1RV6X 1YECH 1MRFH 4NBYB 5LWYH 4ZODA 1DQTA 3EHBD 4N0FB 3AGVA 1NFDF 1TPXC 4ETQB 3E6HB 1INDL 4LVHB 4ERSH 2XYCA 4XT1C 3UMTA 2YPVL 4E41D 4QHMA 4DKFL 4LLWA 2NX5B 3DX8A 2PTVA 5HDLA 3EYFB 1HOCA 2IPUG 4XWOD 1P1ZB 1YEIL 1SM3H 3DI2B 4YAQA 1BPVA 2NXYC 1T4KA 4DCQB 5F6IC 1JVKA 1EFXD 5DO2D 4M5YH 1SBSL 2RHEA 3DX8B 4H1LB 3KXFE 3SCMA 4Z0XA 1UWXK 4LKCA 2JJSA 4PFEA 4LCWA 1S9YB 2Y6SC 1UVQA 5HPOA 5C07D 2H41A 4ONHA 3U4AA 4GBXD 5DC0A 1LDSA 2EIEA 3S4SA 1R5VA 4XPHH 5IWLC 3L7EA 4GW4B 4PRID 2YBRB 4HUUA 1LEIB 1EO5A 1S9KC 1R5WB 2VABB 2AKRB 3RVWD 4LLMA 5DMJB 5BRZB 2V2WA 2XZAL 3FO0H 4TQEH 2X1WL 4U1GC 3NIGF 2Z0BA 5GGRA 3JTTB 2DS4A 3CVHA 3DO7B 3WN5A 2OZ4A 3EFFA 5C0CA 2KPNA 3VCLA 4LKXB 3EHBC 2YPKA 3BKCL 3P9WB 2HLFD 1JWSB 4NP4H 1MCFA 2RCSL 3DUUB 2MHAA 4QRTA 5F6HJ 3A6BL 4GW4A 1M1SA 4QRPB 4Y4HC 3RUGF 1D3CA 5IBUB 1LD9B 4FABH 4MA8H 3D85D 3CLEH 5DQ9A 3PHOA 2CLZB 4S10A 3A6BH 1YQ2A 3QNZA 4EN3A 3KPOB 2DMCA 3RVXD 4MB4A 4GKZB 1V7NL 3KXFB 3MNVB 4AT6A 2J1KA 2HFEB 3AS2A 4NRXA 4RFOL 4MWFB 1YPZE 4FNLH 3Q3GA 4POYA 1H15A 1B0GA 3RPIB 2W0PA 4HS8L 1N0XL 1PVHA 1BF2A 4KQ4H 4PV8A 4RAHA 3OB0K 3MV9E 2V2XB 4CMMB 1N0XH 5FYKD 1S7TB 4P2OD 4L8CB 2A9NL 1QBMH 4PJ5B 1OAZH 2KDGA 1HI6A 1AGEB 2XZCH 3OB8A 3WLWD 2HT2C 3MA7A 1E28B 1CLOL 2F74B 2NXZD 2A9NH 1YN7B 4OM1H 3MNZB 3GEWB 5FKPA 3C5JA 3HE7C 1I9JL 4MXWL 3L3OB 1X5XA 4JFQB 2HMID 2L0DA 2EE2A 5IB1B 1KCVH 4AMKL 2DQTH 3SDCD 4EQ3A 4H8WC 4MD0A 4MXWH 3PXJA 3G6JF 1D9KD 5EZLB 4YGAB 3V0VA 1DLHA 1UQSA 1DUYB 2QQKH 2A6IA 3CUPB 2IH3B 1D5ZA 4Y5XA 5KSUB 2E7LC 1F4XL 3G5YB 4U1IB 4XMPL 4GBXC 5F96H 4N1HB 1A21A 3DPBA 4TNWK 5CBEB 2VDNH 1OARL 2PW2A 3MXVH 2F53B 1CK0H 1IC1A 4HG4K 5FKAB 3MZTA 5F96L 1EMTL 1LDPH 5D7SL 3RHWF 3T0EE 1KT2B 3WJLA 3LCYA 3ULVD 1XH3B 3QIUC 2C7UA 5KVFL 1CXLA 4HIIA 5BQ7B 2IANB 4I18C 1K4DA 1YC8A 4FQXA 1CDUA 3GJFB 2R4RH 4NO5A 2YD8A 3VG9B 3V52L 2DLEA 3QDMB 2YD2A 5T3ZH 3ZYIA 5HHQB 1QSVA 1Y6KR 2EDNA 5I15H 5GHWL 4EUPA 4JKPL 1YN7A 1I8MB 1AXIB 5JZ7D 3RX5A 1CDYA 1I3GL 2R56H 3TVMD 3TO2B 4PRNB 2GTWB 2VLKA 4GMTL 1J87A 4HK3J 4PRDA 4CGTA 5J12C 4NQSA 2D9CA 5D7IF 5KVEH 2Z31C 2BVOB 5EC2B 5DK0B 4DEPC 4JM2B 3GIVB 4ZQKB 3ZE0F 2JCCA 3OJDA 3GSXB 1EERB 2ZOLA 2VIRB 4P5KA 1F8TH 1W8OA 4I2XA 4HUVA 1MCIA 2R1XA 3I50H 1A6ZB 3I6KA 3GSQA 5ELIA 3PQYB 4JVUA 5A2JH 2J5LC 2IBBA 1OP3K 3VD9A 4NQEE 2DAVA 5BXFB 5KVDL 4X5XB 4RQQA 4JO4L 3DSNA 2OQJB 2GJZB 3OKMA 1AY1H 5JTWA 5DJXB 5F9WB 2NYYD 4R26H 5IW1B 1A6WL 3L3IB 2DI8A 3VXOB 4P59H 3PDDA 5BS0D 4BQ6A 4XPFH 5EU5A 4PJDE 4BZ1H 2NY3C 2YWYA 3DX7A 3SJVA 5CEXA 3DECA 4U1NB 4P59L 5IW1A 2Q6WA 3ZYJA 1NCTA 5E5MA 1S7QB 3TT1H 3FRUB 1QUNA 3GSVB 1B0GB 5LQBL 4ZSOB 3QHZH 2O61B 1KJMB 4RFNC 1MIMH 4BSWA 4NBXB 2NW3A 1W0VA 1Z6JT 2EXYC 1L6ZA 1IQDA 5JHDA 3KLHD 4JZJA 4N1CA 1N4XH 4OKDA 1YC7A 3RNQA 5EUOE 3SDXA 4OF6A 1NEZG 4I18B 5FECB 3DBXA 3TN0A 3NVQA 1CD1B 5KSBF 3GSXA 4HK3N 1BD2A 1QEWA 4NYLB 4JCMA 5BQ7A 5CFHA 1Y6MR 3RP1A 2X9WA 1K3IA 1LEGB 5TJWK 2OX5A 1UH2A 2VDOH 4I18A 4NQDB 4Y4FD 1CFNA 4CNIB 4KZEH 3QDJE 3ULUE 5DJ8B 3B9VA 3T0EC 4LVOC 2VDOL 3WJLC 2YXMA 1MFNA 3VGBA 4KU1A 4KUCD 5SWZE 2J8UB 1YEGL 5HDBF 1D5ZB 4NQTA 4Y5XB 5HGAB 5M95B 3Q48A 1YN6A 5HY9A 1FP5A 5IQ7H 2VERN 4CJ1A 3UTTE 4Y5XC 1IGYB 2WUBH 3UBXG 3BPNB 1T3FB 4U7SA 1YJDL 1A3LH 3IU3B 4HUWB 4PJHE 5DA0B 5DJ2A 5K93A 5IR1B 3QQ3A 4JAMB 4OZ4A 4RZCB 2VLRD 5KSVB 4MJIA 5MEOB 3MLSL 3BUTA 2BVPB 1J0JA 2C3XA 5FDWB 5IHZA 3IRZA 1RZ7H 2OR9L 3GMMA 2ZCKL 3CDFA 3RWCA 3TC9A 4U3CA 4PRAA 4F7CB 3QNYA 1QBAA 2VDML 2G9HA 4NFCA 1WIPA 3CPLB 3VGAB 4WNQB 4FQ1L 4JFYB 3RA7H 3TIEA 5B38A 4NUGH 5E8OA 1OSZB 1ND0B 4DK3A 5CIPA 2IAMB 3ARUA 1CFQB 4HPYH 1KELH 4M7LH 4NUGL 3DX7B 3T77A 3RWHA 2B4CH 2EEAA 1KIPA 2X7LA 5J11B 3P4MB 1G84A 3JWNC 2CK2A 1IGIL 2I60H 3HUJA 4NQEA 4I48A 2AI0L 4YDLC 1QHPA 3ARFB 4OCSH 3ULVH 3BJ91 1T22B 5F1SA 5GS1C 3VA2C 1RZJC 5EIIB 1B0RB 4Y4HD 3WNKA 5ID1B 4PJDA 3C8HA 4PJGB 4HFUH 1OQXA 5GS1B 2A9MH 4P9MH 5JO5B 2VXVL 1HINL 4LHUA 3WIFB 1SQ2N 3LQZB 1TZIB 4Y4HA 4FOMA 3C5ZB 2R0KH 4GLRI 2AJYH 2P24A 4R9HA 1EEUA 4PJFA 1QR1B 4OIIH 3HC3L 4IMKC 2CUHA 4O2CA 43CAB 5B3NA 2GI7A 15C8L 4X6EB 3X13A 1CICB 4HS3B 4F7EA 2YHGA 3UPCA 2YRZA 4CMHB 4DN3L 5AAMA 1NH6A 4PJFB 4OCLC 5DFVC 1ZOXA 3EOYG 5C0BE 3G6DL 4CMHC 1YY8B 4XNXH 1I3UA 4I3RH 4X7TA 5DQJB 2ATPB 4YIQB 2NY4B 4DN4L 3NBNA 4KDVA 5DF0A 5IWLA 3BPNC 1KGCD 4R97C 1A5FH 3UJJL 4NJAH 1BF8A 4LGRB 3V2AR 2P5EA 4DN4H 2BP3A 1CN4A 3ARDA 4PJ5D 4NWUH 4ALAL 2VDKH 4LLVA 5ADPH 4UV4L 4L5FL 2Q3ZA 3G5ZA 1JNJA 4FQ2L 2F54E 4ALAH 4A6YH 2NXYB 5F1NB 2GW5A 4YUEH 3BPOB 3CFCH 3UBXB 2NTFA 1YUHB 2XWTB 3BYTA 5DJ8A 5AEAA 4W6YB 3G5XA 3RBSA 5DUPH 2FHFA 1FSKB 3P77B 4NKMB 5KOVC 2VLMD 1I9RL 3PWLB 1NCUA 1R24B 1XR9B 2FJFA 1UKSA 2FO4A 3K4ZA 3GMOA 3ALWA 1FSKC 1IEBA 2X4RB 1NGQL 3RY6A 1FZJB 3QFJE 5DEGA 2EZ0D 2O26U 3QDGE 3IU4L 2DQIH 3PWNA 5EBGA 1MFAH 3MA9H 4DKEH 5DJ2B 2Q20A 4HS8H 3V7AE 1U93A 4NO0A 4JFFA 1YY8A 2X1XR 3G5VA 2VXSH 4P2QD 5HHXH 1CXFA 1NGWB 1I8IB 1QSEE 4DZBB 3SKJH 1LO5B 1NLBH 3MRGB 5EZJB 1IAII 3VWKA 1MJ7L 1FC1A 5J9PA 5F97E 3MV01 3RIFK 3SKJL 9CGTA 1T7XA 3RWEA 5L2KE 4UI2A 1ZANH 1SJHB 3DO7A 5EO0B 1MHCA 4XTRD 3T4YA 1F58L 2YA0A 5JPNB 1I9JH 1MCLA 5HD8D 5BVJB 3U4BH 4P3DB 5DEFA 2FBJL 2WINA 5TDOB 2O93L 1JMZA 1MFEL 2Y1VA 4OZIF 4JB9H 3VH8A 4BQ8A 1J8HA 3FQUA 4QLRA 3QEQA 3VGFA 4UDUA 2V5MA 3CU1A 2GSGB 4HXAH 2COQA 3HPJA 3KS0H 4R97B 5JW3H 5E08L 5TDPB 4NCC2 4Q9CA 1WIOA 3T2NL 3WS3A 4EDXB 1NGXB 1O5DT 3ROLB 5E2VL 2P42B 3HRPA 4GRLB 3U30C 4YHLH 1GZPA 5SWZA 1CG9A 2IGFL 2NX5D 4OFYD 4WDIB 2AP2A 3JWOH 5TPWH 2F15A 1LDPL 3TJHC 1NMBH 4HAGA 4Y4KD 2RGSA 5DUBB 3CU7A 4KPHH 5I76A 1M6OB 2QLVB 4RMWA 3W11D 3BGFC 2EDFA 3AREB 1OP5K 4XCCH 2OZ4H 4NPYA 3RL2A 1MQKL 2Z8VC 3WFHB 4OZIA 4UIKH 1LO5A 3MRGA 1CE6A 3NCEB 2EE3A 3L95B 1NC2B 3Q5TA 3IDGB 5CJBA 4YDIL 5DJYA 3L7FB 1FZKA 1YMMD 2EDRA 3SOBH 1FN4B 1R24A 3L6FB 1INDH 2C1OA 2GT9B 1EO8L 4G6JH 4BFGA 3MPCA 3C8KB 5DMGD 5E8PB 1JZ5A 1IQWL 2HN7A 3SOBL 3P3YA 5ICZB 3P9MA 4TUOB 3ULVF 4X5WA 2J12B 3LKRA 1AO7B 1SM3L 2ESVB 2VKWA 2VSCA 1RULL 1K5NB 1WWBX 1JHLL 4UV7H 5J3HD 4LSDA 3NIDF 4LVHC 1EDQA 3BDYH 1WC7A 3VXPB 2KZWA 1MI5B 1XGYH 1MNUH 5C6PB 1DUZA 3QFJB 1HOCB 1TJGL 3ARVA 4QXTB 2ENYA 4PRAB 3BDYL 1WAAF 1XGYL 2AV1B 5FGBC 4L8DA 1LO4H 3QEGH 3BVNB 5F6IB 2VLLA 2YR3A 3IDNA 3DX6A 4OCWL 4CRPA 3ROOB 4QTHB 4XMKH 3QI9C 1L9NA 4JVPA 3LQAH 1P69B 4ZOAA 1K3ZA 2FO1A 2HA1A 5A43C 2BY0A 3TA3D 3T3ME 4ZUUA 3FT4B 3V0WL 2W91A 2Q87A 4HV8A 4NQXB 1AHWC 1S7VA 2FGWL 1EV2E 5J12B 3QT2A 2AK1L 2XIDA 4YIQA 4R7DB 5C0CD 2IH1B 4NO2A 4JM2C 3BZDA 1YMMA 2BCKA 1CDJA 5T1LB 4NSKA 1YEEL 2HFGH 4H25A 4GXUM 4X8XA 4NHCL 5E8NA 3KR3H 1QBBA 5HHOE 1EGJL 3ARYA 4Z7UB 4U1GB 4U1LA 5C8JB 3HAEG 5EIQA 4NHCH 3KR3L 3PHSA 4D0BB 4UDTB 4IMLB 2XFXA 5IFJB 4QHUA 2UUDK 1FG2B 4Y4KC 4GG6E 1QLFB 4RWYH 1BVKA 1K4CB 5IGXH 1MFDL 4O02H 3TBWB 3IDJA 1MHHB 5JR1H 1FFOB 1JGUH 4QHLB 4FABL 4Y8AA 4XAKD 1UXSA 2HT4D 4Y1AE 5EO9A 1JV5B 5FIEA 2Y07L 4N0CD 2YRPA 1T5XA 2B7DT 3VFSB 4X80H 5MEND 5HSFA 1U8LA 1KB5A 4PGDB 3ZDYF 4OCMC 4PJGE 4V1DE 3PGCB 2EXWD 2EYRA 1P4LB 3F58L 5EFIA 1DEEA 1AP2B 2Q8AL 5K9QI 3V9FA 2FCBA 3QCTH 1LGVA 1UZ6E 2R1WA 1BEYL 2FRGP 1FVDB 1JGVH 4W4OC 4Z77B 5B39A 3W5NA 3F58H 3O9WD 2PXYD 2XXMB 1QBML 1BEYH 5AZ2L 4Q6IC 3B5HA 3LMJL 5D5MA 1KCVL 3O3BA 5GGVY 4AMKH 3VXQA 5JQHC 1NBVL 4CW1A 4FXKB 3EYQD 1T1YB 1LK3L 1RUML 3WFBH 4OUUB 3LKPB 5L0QB 3KDMA 2Y23A 4O9HL 3HE7B 1K6QH 1A6PA 2YSSB 3INUH 4Y2DD 3GJFA 2LQRA 2HJFB 2F58H 4O4YH 5TF1L 1EHXA 4TRPH 5FYKH 3TVMB 1NGPH 2DQTL 2MOVA 3FB7A 3VE0A 4F80A 5HI3C 3FFCE 3UZVB 3HE6B 4M7LL 2ZJSH 3BISA 3QDGB 2B4CL 1PX4A 4LSRH 4WO4A 3LH2L 4R0LC 3STZB 3T0WA 4R7DA 3G5VB 3HZMA 5CLWA 1OARH 5IJKC 4CN6A 4NN7C 5BCAA 1NJ9A 1C5DB 4WNQA 1U8MA 2CIIA 4IJ3B 2XICA 2YPLA 1JK8A 3D85B 5IMKA 1NBYB 3L3JA 1FV1A 1ZS8A 3MLTB 2C3VB 4N1EA 5IVOA 4JZJB 4S0TD 1K4DB 4IJ3C 2F53D 5EWIH 2ADFL 4DTGH 1WJ3A 3B2VL 3UJTL 3P73B 1CU4L 1JK8B 1QR4A 4WJ5A 1ORSA 4HD9A 1MCDA 5GRUL 2EIZB 1FGNH 3P4LA 6FABH 5K9JL 4KHXH 5IEHB 1MRDL 2X89A 3SPVA 1XCQB 3CSBA 3P4NA 3STZA 2CR6A 3S96A 2GTZB 3VDAA 6FABL 3VXRE 2O5XH 3VXMD 2NW2B 1T0NA 1I3GH 2R56L 2IAMC 1WV7T 1Q9LA 1W0YT 1TLKA 5CHNA 5CAYB 3CLFH 3BPCB 4XCEB 5C1MB 1TQCB 1OGAD 3DVFA 3FAWA 1WBZA 1YEKH 5C2UB 2NLJA 4NNXA 4P2QE 1HZHH 4CDHA 3CLFL 1XF2A 2PW1A 3U46A 1OGAA 4MSWA 5FEBA 5ACLA 1QSFA 5DK3A 4D8PA 2P5WB 4OB5L 3E8UL 3I50L 4MAYC 4C4KT 4PJBB 4E0RB 4LDOB 3QXWA 3VXUD 3HA0A 1FG2A 1XGRA 1IKFL 1A7QL 1UM4L 4LPUA 4ZUSA 2OQJA 5CLTA 4ZXBD 2PKDA 2PYEA 3OKYA 4GKSA 3GM8A 3EJZD 1J8HE 4KRLB 4LCUB 4NZTL 3EYQC 3CFCL 4NUJB 4MB5A 3O6MH 5K9OA 1FFNA 3Q6FB 4R26L 2XG5A 1BLNA 4X83A 2PR4H 4O2FA 5TH2B 3QDHA 2RB8A 5B4MD 5DTFB 1ZT1B 3Q6GL 4ONFL 3OJDB 4OM0H 1S9WB 4Z7VF 4JY4A 4YFDB 5EU6A 3VD5A 5IBLD 2YZ1A 1WSST 2E6PA 1H5BA 1CTNA 1J5OH 1RZGB 1KJ3H 1OGTA 5T3XE 4YBQC 1PYWA 3I2CL 1U91A 4LARL 4Z8FH 4XPTH 2XQBH 3FN9A 5CUSL 4P2OA 3GK8H 2BJMH 1NLBL 3P2TA 5FA4B 5C0RH 3LKOB 2BNRD 4Z76B 4N9OB 2GKIA 4LARH 4MNQD 5HBBA 1TJHH 1AIFA 4PRIB 4MNGA 3VFVA 3MROB 3QQ4A 4DOHE 3EGSA 5FO9A 4JQVC 5ACMA 1NAMH 4YDJB 1JF1B 4PJHB 4Y4FA 3O2DH 3V5KB 3SQOL 5DK0A 4HLZH 1RZFH 4JPKL 4HIJA 5IM7B 5C08B 3OPZL 5IQ7L 3SQOH 4ZUTA 3QWRA 4QF1A 4RWHA 1JF5A 2JB6B 4HWZA 2J8UE 3PWJA 3PGFH 1SYVB 1LK2B 3QQ3B 3MSPA 4ISVA 2C5DC 4RGNC 4RIRA 4MAYB 3ECBA 3VFOA 1PLGL 1WWAX 2W1NA 3CXDL 1GC1H 2DM4A 5AUMB 1U92A 3ARTA 4MQ7A 1NMBL 3DMMA 2EDYA 4KJQD 2FX7H 1AO7E 1J1PL 1KELL 2R0WL 5KZCD 1FH5H 4KJWC 4MMXC 3MA7B 4R2GD 1ZT7A 1F3JA 3BEWB 3GMLA 3GDBA 5D96C 4WU7A 1MCOH 3BZ4A 4CVXB 1XIWA 2ADIB 3MV8A 4G9FB 3QHFH 3VXSA 5I1JH 4LSPL 3ZDZF 1ETZA 5E6ZA 5MENA 3QHFL 4G6JL 1EO8H 1E4XL 1TXKA 2JTDA 1HHIB 3MUGB 3TZVD 1E6JL 5E8EB 2NNAB 5GGUB 4HKXB 5JMRA 4QRSB 3AS1A 4G42A 2ZSVA 1AGDB 3EDEA 3H9SA 4L8SB 5FUZL 4KMTL 4OCRH 4A6YA 4XMLL 4V1DB 1NC4D 1DFBH 1QYGH 4GMSL 4CU8A 4Y5VA 1XGUB 2UZXB 2OSLB 4L8SC 3BE1L 4KMTH 1CIUA 4ODWA 3U36B 3LS5H 5FO7B 5HGBB 1DFBL 1QYGL 2M26A 4GMSH 1U9KA 5KVGL 1PEZA 4RGND 3DIFA 3G6DH 4P2CG 4F9LA 4OIIL 3HI1B 4HUMB 3TCXA 1WZ1L 2OS7A 4F9PA 3P4NB 5I71B 3EO9L 4Q9BA 4P4KA 2CKBH 1F97A 4OD2A 2BVPA 5HYFA 2P7TB 2YA2A 3NPZB 4XPHL 3SDAA 5I71C 2PETA 2CLRA 1HDMA 2O5ZL 5JDSA 3BP4A 3WHE0 3QIWC 3BD5A 1B0RA 5HGGS 2P48B 2QSCL 2UWEB 3FT2A 3TM6A 4HIJB 2WIMA 4A2MA 5D7JB 1CXKA 1TQBC 5F9OH 1A5FL 4YBHA 1QZ1A 1RZKH 1YEFH 3MCLH 4FXLA 2F19L 3RVWC 2C4XA 3KPNA 1KLUB 4NOBA 3PL6A 4GAJH 1KUMA 3O6KL 5DRXA 2A6JB