1NFDF

An alpha-beta t cell receptor (tcr) heterodimer in complex with an anti-tcr fab fragment derived from a mitogenic antibody
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
222
structure length
222
Chain Sequence
EVYLVESGGDLVQPGSSLKVSCAASGFTFSDFWMYWVRQAPGKGLEWVGRIKNIPNNYATEYADSVRGRFTISRDDSRNSIYLQMNRLRVDDTAIYYCTRAGRFDHFDYWGQGTMVTVSSATTTAPSVYPLAPACDSTTSTTDTVTLGCLVKGYFPEPVTVSWNSGALTSGVHTFPSVLHSGLYSLSSSVTVPSSTWPKQPITCNVAHPASSTKVDKKIEPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Atomic structure of an alphabeta T cell receptor (TCR) heterodimer in complex with an anti-TCR fab fragment derived from a mitogenic antibody.
pubmed doi rcsb
source organism Mus musculus
molecule tags Complex (immunoreceptor/immunoglobulin)
molecule keywords N15 ALPHA-BETA T-CELL RECEPTOR
total genus 34
structure length 222
sequence length 222
chains with identical sequence H
ec nomenclature
pdb deposition date 1997-08-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1nfdF02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1nfdF01
3GIVA 4Y2DD 1J1XH 4TNVF 1DVFD 2M8XA 3KLAA 1AR1D 3MODL 2IANE 4M6MH 4PJ7F 2W65A 4RDQG 4PV8A 3MRNB 1T21A 1ITBB 3QPQD 2X1PA 3RZCA 1MVUA 1AR1C 3CLFH 4PRDA 4IOFD 5J8OA 5FO8A 2YPKA 3GSNL 5GRXG 1MFDL 4KDTA 3D18B 3SJVA 5KAQG 4Y5VA 1U0QA 2HAZA 3GMRA 3V7AG 3IFLL 4G9FA 5IM7B 2C3WA 4P5MB 3OR7A 3JUZA 5TGBB 2V2XA 3MRLB 3P40A 1FFOA 4KKBD 1KPRB 1KB5B 2GUOA 4DOHB 4OD2B 3AY4A 3BH8B 3RL2A 4QRRA 3RY4A 4JVUA 2P8MB 1KPUA 1B0GB 5DGRA 3KWWB 3CLEH 4HFWA 1H3XA 5FYKD 5F44A 5F72S 1P6FA 4GRMA 5FYKL 1C08A 4NBZB 2Y4SA 2YD6A 4E41E 5E8NA 3REWB 5KANI 4HUWB 2YK1H 4RFNC 1ZT1B 4KI5E 1CR9H 4PJ5E 1IL1B 1NUFA 1AGEB 3OHXB 3WNNA 1A14H 4OZIA 2RJMA 4XNQB 4OLWL 1DLFL 2HTLD 1RULL 1T1WA 3HE6A 2DTML 3VI4E 4U1IB 2BY0A 2P5ED 1Q38A 4NRXB 3LS4H 1Q0YL 2J8UB 3OF6A 1UA6L 1NDMA 1NC4D 2OQJA 3MLSH 5CEXA 4OTXL 4D0CB 1MFEL 3S9DB 1A6UL 4GFTB 4JHWH 3DRTA 3OB8A 4EVNA 3KYAA 1JPFA 4X80L 1NJ9A 4Z7QE 3HC0A 4WUUE 3T0EA 1CU4L 3IETA 2GYSA 3U6RA 3PDOA 1S9XB 3OGCA 4TVPD 1TVHA 1NFDF 4GLRH 2VR9A 3BPLB 2F53A 3HE6C 4CNIB 5F1IA 2GK0A 4WTWA 4MDIB 4PJEE 3T3PE 3GHEL 3O3UN 3X13A 5IFHH 4KFZC 1P53A 2AS5M 1OGAD 2FO4B 4LLMA 2FJHA 2VN4A 1DQQB 1MSPA 2C9AA 3L3GA 4KQ3H 5FYJU 2HKFL 4UV4H 3SKJL 1IAOB 1GIGL 4MA1B 4XVTL 5JHDE 5L8KB 1A64A 2HLFD 1RHHA 5TDPA 4I8DA 3G5VA 5C09E 4QRSA 3CCHB 3L3OB 4FFYH 4KH2A 5IB3A 1CBVH 1I4FB 4ZXBA 1A7PH 2EH7H 4JN2A 3DX8B 4WFHD 2XV6B 2GAZB 4RGOH 4L8CA 4L1HA 4ZUWB 4V2CB 2ZSWB 2G60H 3RTQA 1M7XA 2ZCKL 2CO7B 3QDGB 4LQFH 2RFXB 1EAPA 4ZUWA 4IOIA 1RFDL 5EBGA 4UU9A 3RY5A 4EUPG 3UPRA 2E6JA 3T09A 2VLMD 3QG6B 1ZVYA 3F7RA 1KTLB 5IB4A 4ALAH 2BSED 5SWSB 4JFDD 4DKFL 3LQZB 3VE0A 5J4MA 1F58L 2BSRA 4C59B 4I5BB 5C0BA 3PWPE 4YNYB 4OT1H 2IF7A 4OLXL 2HFFA 4LNRB 4F8QA 4FABH 2ATKB 3O3EB 3GSRA 4FTVE 4PJEF 5B38G 2XICA 2FJHB 5DVLA 1I1AA 1BJMA 1RV6X 3QWOA 4GG6A 2VISB 4NT6A 1A1OB 3CC5B 3EYSH 4NJ9H 3SE4C 5I2IB 2BMKA 3D3VE 3FO9B 1OAXL 1CFTA 3Q3GA 4HMCA 3V4VH 4DEPB 5MEOB 2H1PH 1XGYL 5I8KH 2IQAA 1FBIH 3D2UB 5LWYL 3NPZB 5F8RC 3QNXA 3TIDB 1D9KC 1H3UA 4M6OH 3EYFA 2CGRH 4MXWL 3X12B 5IWLA 1QSZA 4LL9A 5FUOH 5C6PB 1IM3A 4G8IA 4K3EH 1OP5K 3EYUL 5CEXB 1MCOL 4MA1C 4NKQB 4GMTL 1WFOA 4M9PA 4JZOA 2QQLL 3V4PH 4F9LA 1IAIM 5IG7B 4PRPB 3MLRL 3K4AA 1BD2D 2LTQB 3HLAA 5JW4R 4TUOB 4PRPD 4H8WC 3SY0B 2DM4A 4XXCA 1KG0A 4PTTA 3FRPG 4GRLB 2O61B 5E8PA 3STLA 4KZDL 4OZIB 3AXLA 4M7LH 1X5JA 3R0NA 5E7FA 4LDEB 4NO3B 3TH2T 2V17H 1JRHL 2IANA 3MCG1 2QR0B 1FZJA 1BZ7A 3IDMA 2AJYL 4WO4D 2ZOLA 1BJ8A 5HGAB 3RVUD 4PJFF 4PRBA 4CVZB 1JZ6A 2ZUVA 5C6TH 2EDEA 3CDGB 4DUXA 1EJOH 3ULUC 1S7RA 3M8OL 2FEEL 3DHJA 1D6VH 2VE6A 2X4UA 3LMJH 4PLJD 1KJ3H 5DJCA 4LLUA 4BQ9A 5DJXB 5I74B 3CMOH 3ZT5A 3LQAC 3ET9F 3AGVA 4PY7B 3QIBA 3IFLH 4YIQA 1FFOB 2AK1H 2CRZA 1IEAB 1GAFL 5DJ8B 1K6QL 3ARTA 2DMKA 3H9SA 1ZLVH 1OGAA 4L1DA 1QSEA 1QTYT 5E4IA 5JOFB 3RVTD 4PJHE 1A1NA 4QY8A 4M7ZC 3IFNL 5FYKH 3LEXA 3RZCB 1D9KD 3IGAA 3WN5C 5DUML 1ZOXA 4YBHA 2OBGA 1AH1A 1WK0A 2ZCLL 3D9AL 2XPGB 2BOBA 3OAYK 3WEXA 2D0HA 1TXKA 3PE9A 4JQVA 4MWFA 4L29A 2NY1C 4NOBA 1CR9L 3KPRB 3O3BB 2A74B 4LBEB 4ZMAT 4WENB 2KKQA 3HPJB 4K23H 4F7TA 1S7TA 3UYRH 1R5WA 2EYSB 2BSSB 1WBYB 3IFOB 2APBA 1YEJH 1ITCA 4L4TE 3ARXA 4NWTH 5DD1H 3BKJL 1BF2A 3U36A 5E6IB 3VJ6B 3C6LA 1KCLA 4KTDH 5J56B 4WO4B 5JORA 2HT4D 4A6YB 3GMMA 4I0PD 2BNQA 2XOTA 1HKFA 1Q0YH 2V2TB 3F7QA 4R4NC 4APQD 4N90D 1CDUA 1HINH 5F1KC 1QA9B 3MLSL 5GRJL 3AAZA 4YH6A 4Y16D 2QADB 5LQBL 4KU1A 2WBJA 1BZ9B 4NKMA 4X80H 1SY6L 4Y4FC 2FIKB 2FGWL 3T8XA 4HWUA 3DROB 3NABH 1CU4H 5F70A 4KK5C 5C0AA 5J6HA 3MV8B 1F11A 3E8UL 1P84K 3GSOB 3MV7E 3QULA 4PTTB 3BQUD 1MWAL 4HJGB 3MGTA 2NXZB 4PB9H 3AS2A 2VAAB 1OP3K 1YY9D 4BK4A 1Z5LB 4GOSA 5D1XC 4ZNCD 2Q76A 1PJ9A 1LK3L 4M02A 2X4QA 3WCYA 4S11A 2H32A 1N5AA 4X99B 3AS3A 4PJ9D 3R06B 43CAB 1WUNT 2WK2A 3V6ZB 1J7VR 2ERJB 4N0YL 4FA8A 1U6AL 3MRBB 3HPLA 5MENB 1MCHA 4I0PB 3DECA 4P3DB 5EBWB 3S34L 3D2UA 3EIFA 2HLFC 2F54D 4WNQA 3O45B 4AIZA 3JV4A 1BFSA 2NW3B 1EEUA 3WHXA 4QHNA 3KS0H 2XWTA 5I2IA 3MFFA 4JLRB 1MREL 1SHMA 4X7TA 3RPKA 2J7LA 1XFPA 4ETYA 5E2TH 4DKDC 4WHTB 3V7MA 4ORGB 1I1AB 1IC7H 1OGTA 2A0LD 5KSBE 2ZCKH 1EZVX 3UROR 1TTFA 3LVEA 4HS6B 3V0WL 5CGTA 5GSVB 3ZYOA 1RZ8B 3OKKA 3WHE0 3G6JF 3SE3A 4ALAL 1R5VB 3ZKQD 4GLRI 4U1SB 3NH7L 3H3BC 1UGNA 3LH2H 4JB9L 2WAHA 1I7UA 1VGEL 2H45A 1HI6A 3LKSB 4LLQB 4I3SL 4HPOH 4TUKL 4OLXH 5FOBA 5SX5K 2CLVB 25C8L 3ARBC 5JOEA 4NNPH 3IDJB 4QRRE 3WFCH 1A9BA 2XZQL 1TZGH 2W0FB 2NW2B 1LEKB 1JWMB 4ELKA 4I18B 3TO4A 4HGWB 4TPRL 2NY2B 4XCNB 3EYSL 4NJ9L 5BZWA 2YD4A 1NGWA 2ICCA 1PX3A 4U6YB 5EPMB 1QP1A 3LDBB 5GS1A 3FQXA 4FQLH 1E4KA 1X6LA 4MNQD 2E9JA 4JM2A 2E8ZA 5I8KL 3V6FA 1FBIL 1UM6L 5CS7A 3U46A 3H42H 5L0QB 4WEBL 5C86A 3QT2A 1T7XA 2CGRL 5GXBB 1FYTB 4PJXE 1C7TA 1ZT4A 2RIKA 5IOPB 4QWWC 4PJDA 4OCSL 1LO5B 4BH7B 4ISVA 2BFVH 2JJWA 5LG1A 1T3FB 3V4PL 3Q2CA 1DN0B 4EDWH 2F53B 4YX2L 4O02H 1A22B 1TNMA 2IGFL 1WZ1L 2ZUYA 4QHLB 3ULUF 2KL6A 1X4XA 5F6IB 1BREA 3VXRB 4P23C 3ZE0F 2VDOL 4FP8L 3LQMA 4XPTL 3L3JA 3LIZH 5HYJE 3NOIA 5ACZA 5D7LD 1GPOL 2Y7QB 2FX7H 5L0QC 1R6VA 3QI9C 2DL9A 2OQJB 2XQYG 3TZVA 2QEJA 4O2EA 4M61A 2AVGA 2ED7A 5IVNA 5EORH 5HDLA 5ERWB 5M95B 1JZ5A 4O00A 4HJ0C 5EO9A 4OCLC 5MEQA 5DDHB 1EJOL 4YGVA 3WXVH 4U1MA 1R3HB 2J1KA 4M8VA 43C9A 2A9ML 3LMJL 5JNYA 3ZHLA 2NY1D 3CMOL 5GGRB 3C09C 4U3CA 3CMGA 4XPBH 5HHOA 1EGJL 3U9UB 5JA9A 1NBZA 2K7PA 4Q58C 4R2GC 4KI5C 3BAEH 3K80A 3NFNB 5HHNA 1MIML 4N0CC 3KPQA 3CVHB 3VRLF 1C08B 5MEPA 2ADJA 1XGUA 4NPYA 4V2BA 4OSUL 2C4XA 3IFNH 4NO2A 4QRPA 1LGVA 4HFWB 2G75B 3Q6GL 1GGCL 2R0KH 1I1RA 4ONFL 4Z7UA 2ZCLH 3WE6A 3D9AH 5DK2B 3VA6A 1T2QH 5CAYB 1TCRB 5DUBA 1A6AB 2AV7B 3OL2A 4QNPE 2NZ9C 2VZVA 5HGBB 1A2YA 4OZFA 4Q6IB 2XA8H 5C71A 4HS3B 5CLTA 4UTAL 4LQ1A 2Y6SD 3DUSA 4LCWB 4OGXH 4NWTL 2E7CA 1YEGH 5GGSY 2DAVA 3D25A 4JEGB 3W39A 1MVUB 1EFXD 1JWSA 2A2QT 3HS0B 4PRID 4WFGD 4OKVA 5IB1A 4JKWA 3L6FB 1U93A 3GSWA 1JV5B 4JFXB 3VCLA 3QAZB 3SKMB 2VITA 5F7DA 1CLOH 1Z2KA 3BQUB 1UWGL 1HH6B 3KG5A 3GIVB 4QT5A 1K85A 1SY6H 3BGMB 2FGWH 5C0JA 4MXQC 1LK2B 4M5YL 4X4XB 4O58L 4X6BA 5FYKU 2QHRL 2UZIH 4PB9L 5CD3A 2EKSA 3LS5H 1R5IA 5D2LB 3PG2A 4BQ8A 3UTZB 5ISZD 1MHPL 4XVSH 4TUJA 2B4CH 1NGPL 3PL6B 3FT4A 3LV3A 3EYOA 1ZHNB 3DJ9A 2MPAH 1CGTA 5I18H 1FO0A 4OZHB 1U6AH 2JE8A 3RVWD 3RWGB 4DGVH 3CZFB 4XPFL 5D5MA 1QLRA 1HXMB 3D39A 4U3HA 5A3IC 1I8IB 1AGBB 4HIIA 4K94C 5DS8A 5DWUH 3SHSA 2ZKHH 4MD5A 4LKCA 4GBXB 1MREH 5TH2A 4JRYD 3UO1H 5D7SH 1A9EA 1INQB 3HI1B 4FG6C 5E2TL 2WANA 4F7PB 2Y9RT 4HBCH 4OGYL 4PTUB 4U33A 3ZL4H 1IC7L 1HHGA 1I7RB 3PWLB 4UUJB 1M7IA 3MV11 1HSAB 4MAYA 3GJFK 1Q9LB 1EHAA 1S7SA 4AYFA 4CW1B 4E5XA 2X7LA 2BY3A 3T77A 4ZAKA 3TBTB 1AXIB 1FFPB 2DQUH 3ZE2E 1RAMA 4N5UA 4Y5VC 3PP3H 3DRQB 3KS0J 1YEHH 4JRXA 2OJEA 1KJ2A 4L3CA 1CF8L 4Z7WB 3TA3C 2C26A 4U1LA 5EC1A 4TUKH 1CD9B 3H7LA 3MSPA 5HYIA 3LD8B 1HOCA 3PQYA 5ENWA 1QNZL 1ZTXH 8FABA 1XZ0B 2XZQH 4AIXA 5I30L 1T0NB 1U95A 5JXAL 4U05A 3IKCA 3RWEA 4XNXL 3EDFA 5CIPH 2UY6A 1JGDA 1DEEB 5BXFB 1AR2A 4TPRH 4U7SA 1DQML 2HG5B 3R1GL 4W6WB 1W0VA 1CGUA 3QUYB 3Q6FA 3WN5A 1ACYH 3GMOA 3EJYC 4JDVA 5BZDA 1OQXA 4EN3B 5E7BA 4EI6B 3FB6B 5BRZA 2ZPKL 1XF4B 1HQ4A 4NQVA 1UM6H 1HSAA 4MAYB 5ETUB 4LCCC 1WITA 2Y1VA 5I1DA 3AM8A 5H94B 3WKML 3TBSB 3E3QE 2YN3A 4BSVB 4DN4L 1BD2B 2L0DA 3BJLA 5TH2B 2NXYC 4GBXA 4OCSH 1MLBB 1NCAL 4Y5YB 5J11C 1MCKA 4HIIB 5DS8B 3HB3C 5FO9B 3MYZA 2FJFA 4G9FD 1BWMA 4O02L 1A3LH 1FIEA 1WZ1H 3B6SA 1WZMA 1JZ3A 1ES0A 4UT9L 4FP8H 4ZUSA 1CGSH 4YFEA 3RWGA 3V52L 5DQJA 3QDJE 4OZHA 3QRFM 3FJTA 3IKKA 2AXFA 3JTSB 2FX7L 3EYOB 3LV3B 3NCFB 3PL6A 3DNKA 4NN6B 3DO3A 3CH8A 2YWZA 3X3GH 1TDQA 5CP3A 3ZKND 1QHOA 3ROLA 2DI8A 5JMOC 1GC1H 3W9DA 1K4CB 3VXSB 1OARH 1YEDB 3GM8A 2QTEA 3QEQB 3W9DB 4YDLB 4LU5H 1WFUA 5F7NC 1ND0A 4K3JH 2OS7A 2F74A 4Z8FH 1N2RA 4JFED 4W6XB 5F7UA 3U4EA 3DI2B 4XPBL 1EGJH 4X4ME 5F7DB 2VITB 1RI8A 2VQ1A 2VO5A 5I15H 5CJQH 1P7QB 3C08L 4O2CB 1MIMH 4RA3A 4S1DC 4DJMA 3MUZ1 2PYFB 4MXVE 3BPOB 3RWIA 5IMLB 5BS0A 4LCWA 4OSUH 3IS0X 3L5WB 1P4IL 4GRWE 1TPXB 1F4HA 1BVLA 5EN2A 3LZFH 4ZQKB 3FKUS 1T2QL 4O51A 5F6IC 3ZT7A 3KPMB 4HV8A 5T5NG 1E27B 1VACB 3VMOA 3L7FA 4IMLB 3QUZC 4PFEA 2G75A 3GI8L 4NPYB 1YEGL 5GGSA 3S3SA 3QDMA 2Z9TA 3WBDA 4D3CL 5DD6A 3SBWC 1W2KT 5JOPD 4EN3A 3IAPA 1XIWB 5JR1H 1NGZB 3FTGB 4F2MA 4R4FL 3C6SA 4Z77A 2H26B 4HUVA 3BXNB 2CDFA 2X40A 4XBPA 2AI0L 1Y0LB 3TBVB 3VRLE 4JFPB 4NFBA 4P23D 1T0NA 3ZDZF 1RMFH 1T1YA 1XZ0A 5DJAA 2CR6A 2P5EA 1OP5H 4GSDL 5GGQL 1JPST 5DRXA 2EXWD 4JGJA 5MEQB 3CSPA 3QXAA 2UZIL 4LIQE 1TVBA 1NCWH 1FVDB 2HVKB 3LPWA 4WV1B 1IGCH 2V7HB 5C6WH 5EU4A 1T2JA 4M6AA 5EBLA 1N5YL 1MHPH 5KVGH 4DZ8B 4YHKL 4PPTA 3GBNL 3BIAX 1JTTA 4ZD3L 2HN7B 3U1SH 1YEIL 3RU8H 5H37G 1E4XL 4HT1L 4MJ2A 5EIIB 4OZ4A 5IMMB 2VOTA 5DI8B 2HP4A 4OUUB 4KQ4H 3DOSA 3L3IB 4MZ2A 4RWYL 5SWZE 4X5XA 1NGXB 1LHZA 4L4TB 5SWZB 4G6AC 4NKDB 1JHLH 2R2CA 1F4XL 4QYOB 1CVSC 3MRRB 3PWJB 3GGWA 3OKOB 4XMPL 3KNBA 3BMVA 4EJ1C 5ALCH 5D7SL 4ODBD 1JYWA 4KXZH 5M7QA 2DB8A 5HY9A 4KTEH 5FCUH 3RA7L 2GI7A 4PGZA 1MFBL 4S1SH 4ZUTA 5TDNB 4MVBD 3U46B 5JPMB 4OJFH 1AQKH 3QI9A 1MFAL 1VFBA 2X4OA 3DMMC 4HBQA 4XCCH 4MLSA 5HPMA 3IRPX 4PLKC 5F9OH 3P9MA 2B8OT 3BZFB 4RGNC 2DQUL 1DLHA 2COQA 4UIMB 4XPHL 3V9FA 2BVYA 3WJLC 1D5ZA 1YEHL 4G7YL 3T0AA 1CF8H 3F5WA 1P6AB 1J1OL 4D8PB 4KC3B 4PGBA 1FIGL 1INDH 4MZ3A 4FFWC 1Z9LA 4L3EE 2QJDA 3WNKA 1CXLA 1CTNA 4JJHA 3S96A 3GK8H 1KJ2H 2D7MA 2VKWA 1CG9A 3DVIA 1NMCB 4RMSA 1ZTXL 1ZA3B 4JFOB 1U36A 5I30H 3VDCA 4MNQA 4JFZL 5JXAH 3F12B 2MQ0A 2XQYK 5KSVB 1SYSB 2HFEA 1FL5A 1HEZA 1HNGA 2AJZA 2VXUH 4M62L 5CD5D 1HHIA 2JJVA 2IAMB 1N8ZB 4XPGH 3FFDA 3SGJC 3MLTA 1B90A 2IAMC 3V7AE 1JMZA 2ZPKH 1GL4B 4PJ7A 3VFVB 3MOQA 3BEWA 4PGBB 3UYOD 4LSTH 4KVNH 2M1KA 2OMBA 5DTFB 1CCZA 4YHIA 3SDXF 1BVKB 3SOBL 3IJHB 2CQVA 4RFOL 5DUBB 4DN4H 5DUPL 3C60D 5T3XL 4JPWH 4YQXH 4KZEH 4JG0L 4QHNB 4W4OA 1DCLA 5MEPB 4ZO7A 2XFXA 3KDMA 1G7JB 2YUWA 1I9IL 4HKZB 1CGSL 1OSZB 5JLZB 4X6FB 3V52H 4IRJC 5FYJL 5F9WB 5DMKB 4R4ND 1XF3A 1HDMB 4XBEH 3DMMB 2PYED 2R1WB 4LSVH 4C56A 2ZNWA 43CAA 1U8OB 1KCRH 3LEYL 3IYLW 3X3GL 4MJ4A 1T7ZA 2FX9H 3T2NH 1SJXA 3ZZ1A 2G5BA 4Z76A 3S8WA 1R3IL 1N4XL 1GCFA 4HIHB 1N64L 1ETZA 2CKNA 3QZWB 1EHLL 4HDIB 1XGTA 2VL4A 4XX1G 3MGTB 2RCSH 4LSDA 3VFRA 1FZKA 4YFLI 1KB5H 4LU5L 2NR6C 4YC2B 4BUGA 4Z8FL 4KPHL 4HW6A 4IDLA 2BC4A 1LEIA 2R8SL 2NY3C 5L2KD 1PAMA 1OL0A 1C7SA 3VFUB 5F89A 4HXAH 5C07A 5CJQL 3TGXA 1NEZG 5HYJA 3SJVE 3KPSA 2R0ZH 3PNWA 1LD9B 3B9KD 2MHAA 4S0TD 5DRXB 3QUKA 2A77H 5B3JF 2DJSA 5C2UB 2R29H 1FP5A 5DRNA 4IMKA 4MJID 3O6KH 1AFVH 1IVLA 1DDHA 5ESQB 1UYWH 4XMLL 1IFHH 2BSSA 4GG8B 4OM0H 1U8QA 3BHBA 4YPGB 5HHMB 1LO5A 1OAKL 1ZSDA 2A74A 4P57B 2UWEE 2B20A 4D0DB 5KS9E 2GJJA 2NNAA 5EU5B 1YYML 8CGTA 1CN4A 2E9WA 4MA8H 4JANB 1KLUA 1FFNA 4GQ9H 3O8XC 5SX4H 3ULVC 2DQGH 3GI8H 5JW3H 2ED9A 5C09B 1UB5B 1NCDH 3QNYB 3AC0A 1Q1JL 4Y2DB 2H2SC 4G9DA 2AJXH 2WWKT 1OGAB 1RUPL 1U3YA 4XWOC 5JXEC 3T4AA 1SJHA 4HF5H 3TBYB 1U8HA 5BVJA 4FQIH 4Y1AB 4EI5D 2AI0H 1LO2H 2WWMD 2R69L 1UT9A 2Y72A 5J13C 4WWID 4XWGL 3EJYD 4GSDH 4TRPH 5FOBB 4Y4KB 1E6JH 3UTSB 3KJ4B 4TYUA 5H37H 1XH3A 2ZOKA 1MIEH 3IDMB 1R5VA 3C8HA 1N5YH 2FCBA 3MRJA 4MD4A 4YHKH 3TO2A 3B2VL 3M17B 1EFQA 4ZD3H 4PJDE 4OGAD 1C5DA 3VDBA 3SDDD 4HQQL 5DZOA 3RU8L 4HT1H 1L0XA 1QKZL 3U4BH 1LE9B 2AAVA 2Q7NA 2Q6WA 1HILA 4KQ4L 4ZO8A 1T22B 2HMID 2PKDA 3LQAH 1FORH 4MD0A 4I2XE 4WFEE 3NIFE 4JFFB 2EXWC 2AXFB 5DR5L 2R4SL 2NY5C 3TVMA 4D9RD 5C8JB 4NIKB 2FZ3B 1I3RA 4G8IB 4OF0A 4LCUB 1CXKA 5JOPE 4QXGH 5E6YA 5I1LB 1CVRA 4NYLA 4C57C 4GRWF 3ULVL 1G9EA 3MCKB 5CHNA 5E03A 3OAZH 5MEOA 2GKIA 1BFOA 4J3UA 5E1HB 4UDUB 2BNRD 5DVOA 1CICA 2VWEE 3TVMB 2VDNL 3RWDB 2Y5EA 3UTQB 3BYTA 4PB0L 4FQCH 4K3DL 5H94A 4YLQT 2Q76B 3K3QA 3VXPB 4N90E 3VWJB 1J1OH 4XBGA 1TZHA 2AJVH 2R0WL 5T33L 1QPPA 5TFSL 1UJ3A 2VH5H 4XAKE 3OKNB 1ZVSA 2ATKA 1RIVH 4WUKL 3UEZA 1KJ2L 3TN0B 1RZGB 1T80A 3F7VB 4I9WD 4NKMB 4O5LL 4P2YA 3VXMD 3NBNA 3BO8A 4Y4KC 1UVQA 1DEEA 4XZUA 2R2EB 4LCWE 3ARYA 3MRJB 3ZE0E 1A6ZA 3U4AA 3FT3A 3DUUA 4DVBA 2BNRE 3HAEA 4P3WA 2DM2A 3VGGA 4X98A 2NX5B 3C9NA 5AEAA 2VXQH 1RHFA 3BUYB 1BOYA 2BDNH 1U3HD 3ILQC 5ICZB 4LSTL 2O5YL 3UX9B 3QBTB 2R1YB 3IF1A 3LKOB 3MV9B 1FC1A 4JKPL 3P0VL 5H35B 2GAZA 1RZIA 5DUPH 5T3XH 5BW7A 5FEBA 2CDEA 4JPWL 3VH8B 4KZEL 1MPAH 1BIIA 4NN7C 2VSCA 3S37X 2KDGA 1FE8H 4PJHA 3K2UL 5HVHC 1EXUA 1M7IB 2RBLA 1HHGB 1I7RA 3KPLB 1GH7A 3ULVF 1I9IH 4F9LC 4LRIC 2FNBA 1SM3L 4UQ3B 3BE1H 2QQKL 1U58A 2NY6B 3L1OL 3HE7A 4XC3L 4K8RC 4LSVL 4D0DA 4LCWD 3MO1B 1KEGH 1E4XI 3SQBA 3NN8B 4MLIA 4NC1E 1G7LB 1N4XH 3DHMA 3HC3L 3U7WH 5IBUB 3KR3H 4QF1B 2E5EA 3BSZH 4LHUD 4FQXA 4LLYB 4JREB 1RZJC 4YBLB 5DRNB 3PGDB 3FB8A 2LTQC 3IETB 2NY2D 2X6MA 2MHAB 4KPHH 1HSBB 1FZJB 5KTEL 1H3WM 1VFAA 4LPUA 9CGTA 3IDXH 4P5TD 3VFUA 2AEPL 4OLVL 5TQ0L 4H0HB 4U0RB 5DRZB 1GRWA 1ZHLB 5AZEL 1YEFL 2DDQL 2ITDA 4ODVH 4HJ0D 4N9GB 4RMRA 2O61A 4NN7B 1QFPA 4WGVB 2CMRL 3WLWD 2R0LL 2A77L 2HYMA 3BN3B 3GRWH 3BGMA 5D72H 4R0LC 5K9KB 4HIHA 1AFVL 2NLJB 1S3KH 2I07B 1PBYA 2EIDA 1FSKC 4OM0L 5I1EL 2EDKA 1P1ZB 1KV3A 4WIQA 3B4NA 1WZKA 1BEYL 4WDIA 4DKAA 4A6YH 5LAXA 1RQ5A 4GO6B 4UT7L 3FZUD 2A6KA 4IRZH 1CWVA 3FQRA 4OQTL 3OR6A 4HS3A 1Q1JH 4KKNA 3SDXE 3JUYA 2WUBL 1UWXH 1FDLL 2D0FA 1VEMA 3U7AA 5FV1L 3BH8A 3GBMH 3H3PH 2Z35B 5J3HD 1A1OA 1YEEH 4JFDE 3TYFB 2JIXD 1FRGL 4M8QB 4MGXA 4XNZC 1T1ZA 4M5ZH 3T0VA 5TDOB 4G9FB 1C5BH 5KSBA 4JO2H 2Z91B 4NO2B 5ISZB 2VXVH 4MDJA 4PY8I 4GRLD 4UILL 4YO0A 3O3EA 3KHQA 4NQDD 1QACA 4BQ6A 2VLKB 2VC2L 2DLEA 5DQDH 1A3QA 1B4RA 4XCYB 1MCCA 1Q9KB 4E41A 1ONQA 4GMSL 5D7JB 3RDTA 4PRHD 3U9UA 1ED3B 1BIIB 2DQEH 4WFHE 3UPRB 1HNFA 1W72H 1SVCP 4J12A 5BO1L 1X5HA 1DJSA 4OCWL 2DICA 4L5FH 3BPCA 3QUZB 1QKZH 1BOGA 2FSEB 2Z93B 5IHBA 3G6DL 2DWDB 3NCYP 5ICZA 1WBXB 4RNRB 1AGCA 1GC1C 4J3WA 1FORL 3SDAC 4X98B 4Q0XL 2EIEA 1G9MH 3DX8A 5HHQA 1AP2B 5I75C 5EO1B 5DR5H 3L3OA 4PJXF 5HHXH 2YPVH 5ACZB 2F5BH 2XWBB 3QG7H 3MLYH 1FAKT 3PXJA 3VXMB 3E3QC 1CFQB 3H9HB 1JHKH 2XT1B 3G6AB 3PV6B 1AC6A 3X11B 1JHTB 1NLDH 3ALPA 3F7YB 4IM8A 1T5WB 5GZNC 2BVEA 5JW5A 1EO5A 2VUOA 3WL9A 3L95A 1MVFA 3U2SA 5HY9B 1L0YA 1F3DJ 2FR4B 1BHGA 2VDNH 1JPTH 2H6PB 5IOPA 3GGWB 3VWKC 3MRRA 3LRGA 4K3DH 1B3JA 4ZG1A 3KXFB 4X6DB 2FBOJ 1J8HB 4H1LG 2AXHA 1C12B 3L95B 3WV0A 3TC9A 4JM4H 2LV4A 3S3PA 4F7MB 15C8H 4NZUH 1XMWA 3L3IA 2P1YA 3K7UA 5T33H 3F7YA 5TFSH 2VH5L 3P11L 3PV6A 1RIHH 1MAML 4WUKH 2ZUTA 4PIRF 5CHNB 2XWBA 3NFSH 2V5YA 1R3JB 4O5LH 1F6AB 1KTRL 5D1XD 3CFEA 4LVOB 4DZ8A 4HMDA 4N1HB 2HTKC 3HNVL 3TO4B 5K9QG 3RNKB 5JUEL 2J88H 1UM4L 1RY7B 5GSRA 1AGCB 4KI1A 2VQUA 1UG9A 1WBXA 4RNRA 2GJZA 5I19H 5F6HI 2PO6A 2FSEA 5KSAC 4FN0A 4NRYA 4QTHA 1T22A 1CLZL 1HHJB 1CFNB 2PF6A 1AC0A 2BDNL 1JL8A 4Z18A 5KZCB 3B5GA 1I7UB 4LHQB 3JWNC 2O5YH 1B4JL 2DBLH 2NY7H 4G8GD 5EOQH 4P59H 5F7LB 3IDNB 3O8XA 1B88A 3ARGC 1Y0LA 3M17A 1ONQB 3ZE1F 2H26A 1BQHB 3D87B 3VFWB 5HD8C 4XCYA 2QSTA 1NGZA 3VXTA 3QB7C 2NXZD 4LFHG 4A2MA 4PJ8D 4GRMB 4GKNB 5CGYD 1EEYA 5KSAA 5E1AB 4GRWH 3O4OB 4PJ5A 3ZHDA 3ZDXF 4PJEA 4PRIB 5IHZA 4AEHH 4PJAF 2WW8A 3L1OH 4FQXD 1NAML 4HV8B 1XGQB 3Q1SH 3BP6A 1AXTH 1V3KA 2R1XB 3V95A 4HIXL 3PHOB 1VFUA 3O45A 3OF6D 2XN9E 1N3NA 4AIZB 2DM7A 2EE9A 5T1LA 1F4WH 1J1PH 3U7WL 4Y1AD 1JTOA 2DLIA 1WF5A 5C09D 1MCBA 2H2PC 4YHLH 3RWIB 4G9DB 3GMQB 5JHDD 4UQ2B 3NCJH 4NNXB 1BQLL 3QEGH 2VDPH 1IKFH 1WZLA 4O2CA 4PLOB 2DQDL 1JWUB 2UWEB 3GSQA 5KS9B 4LLDB 1S7VB 3FQNA 4OLEA 1XT5A 3KYMB 4YXHH 1RUKL 4YPGA 3ZTNL 4NSKA 4GG8A 3MV8A 3OAZK 4LPXA 5C0AB 5J6HB 2EXYD 1MFCH 3GMNA 4NZRH 3FO2B 4K7PH 1OSPH 4MJIE 3R4DA 4KMTL 1BQSA 1PY9A 4LCIL 2EE2A 3CUPA 1FNGA 4PG2A 4FQ2H 5CEYB 5ADOH 4KJPD 2C4FT 1KOAA 2X1OA 2CIKA 2KQMA 1WT5C 1B0WA 2V9RA 1WWBX 4PJIB 2R4RH 4J3VA 2D2OA 4RDQF 3AS1A 1RU9L 5EZJB 3GMMB 1YNTB 3EO9H 4H88H 4LHUB 1JNJA 1CICC 1J11A 2ZJSH 3PGDA 4UT7H 5IJVB 4ZUSB 1JJUA 4PJHF 4PGJA 2BRQA 4QF1A 3B6SB 4UINL 1KGCE 1T6WA 1ZMYA 1WBYA 3I3EA 4OQTH 5IW6B 1JUFA 3JTTA 1KYOJ 4JCLA 1K2DB 4F3FA 1DFBL 1YUHB 4HDIA 1MEXL 2BNUA 4MMZC 3K74B 3GBML 5EA0H 5B39B 4L29B 5K93A 5EU6B 1NKOA 1MUJB 3LRSB 4YDJB 1XGRB 1AQDB 4M5ZL 2FHCA 2V7NA 2AJUH 1C5BL 1NL0L 3OG6B 1MJ8H 3KPLA 4W6YB 2OYPA 4UI2A 2F54E 1L7TL 3GMQA 1AO7E 4ODXA 1RZJH 5DQDL 1S5IH 4OF8A 3KDMB 2DKUA 2XFXB 2DQTH 1I1YB 3ARFB 5L88H 3RY6C 2JB5L 3LB6D 1DBML 4NQDB 3FO0H 4GMSH 4ELMB 3VRJA 4LMQI 1CQYA 4G5ZL 3IF1B 1CFSA 2DQEL 4Y4KD 2E6QA 5DJXA 5GJTH 4LLUB 1W72L 3MXWH 3DTXB 4BQBA 1MNUH 5BO1H 2YD9A 5IHZB 4OCWH 1S7RB 3T3ME 1XAUA 1N6VA 1HOCB 3BP5A 4FXKA 4CVZA 4PP1D 1DQJB 5FFLA 3BEWB 1D3CA 4EI5B 4NN5C 1JPSH 5AUMA 5I8CB 4A2LA 4POUB 3QIBC 2JTDA 2CKBH 2OJEB 2DWEB 4APQA 2X4TB 1G9ML 1WLHA 1N8ZA 3SDYH 4ODTH 1FO0H 4KRLB 3OMZA 3X3FL 1PG7H 1U8JA 1FFPA 2H9GA 1QSEE 3X17A 5K9JH 3T0WA 2DLTA 1KNOB 1JHKL 3TN0D 3P77A 3TT1L 3QQNA 4HLZH 3MJ8A 3SDCD 4M03A 1KEML 3QIUB 4PRPA 4NQSA 5EUOF 1INQA 2AABH 1GVIA 2HT4C 3MGOA 1JPTL 3MRFA 1V05A 4Y19A 2H3NB 4QCIA 1CICB 5I17A 1UEMA 2XNAB 4YAQB 1BFOB 1ADQL 4JE4B 2KZWA 4JM4L 4ZXBC 2GTWA 4XVUD 15C8L 4G7VL 1QLRB 3LSOB 4S1RL 5AAMA 4L8DA 5KN5B 1KIPA 3P11H 3VFSA 3TZVD 3ZKXB 3O2VH 2EDXA 1VFBB 3H9SD 4JRXE 3QI9B 1EDQA 4D9RE 4C83A 1AHWC 1C1EH 3QWRA 4PJFE 4X6DA 4HKBB 5GHWL 3TH4T 2DD8L 4X6CE 3NIGF 2YEZA 5INCA 2D31B 3OGOE 4G6KL 1HHHA 4Z7VE 3P73B 4PJXB 2XN9A 3DMMD 1JNNL 3UMTA 2NY6D 5L7XL 1MJUL 1QQDA 2H32H 5LGHH 1OOAA 2NY7L 4NFDA 3SKMA 1KTLA 5IB4B 3VCLB 3IRZA 2ZOKB 3HZMB 3ULUD 5HHQB 1HWHB 3ZSTA 2PCPB 1J86A 2BXYA 4U49A 1FQ9C 3UTSA 3CDFA 3U82B 4P2QE 5ILTH 4S2SA 5DEGA 2Y07L 3I6LD 5FB8B 3CVIL 2AERT 3QXAB 3DXAE 1DBAL 3HZYB 4WW2F 5I1GL 4NCC2 1M4KA 4I18C 2P5EB 3T0ED 5IROA 4L9LB 3TBYA 4M48L 4MSWB 3MZTA 5ACMA 3ORJA 3Q1SL 5IB3B 3ES6B 5E4EB 3I3BA 4QRSB 3D85A 5TE6H 4HIXH 2FDBP 1AIFA 5GS0D 4K7PX 1J1PL 1D5BA 3FTGA 4F2MB 2UWEF 5KS9F 4FFVC 2IWGA 1FCGA 1F3DH 2J6EL 3QDMB 5GGSB 3NCJL 3VFGH 2VDPL 4LSPL 2XTLA 3ZKMD 5KSBB 4M8QA 2HFTA 3OV6A 1WTGT 3RUGE 2YA2A 4WFGE 2ZUQC 2HJKB 4GAGL 1TVHB 3CX5J 1RUKH 3TA3D 5D9SA 1SEQH 1I1AC 1UXWA 5C0NC 4DN3H 3ARBA 1SBBA 1MF2L 3FQRB 4KDWA 5C08A 3NIDE 5IHUH 4KMTH 1RUMH 1I85C 4LCIH 4Y16A 2A6KB 3UC0H 5JDSB 4FQ2L 5ADOL 5C07B 4Y4FD 2E27H 4RSVA 1C16A 2GY5A 2BC4B 5I1HH 3HZMA 1RU9H 4JFEB 3NCYS 1H0DA 2HLAA 3EO9L 4LSUH 1EK3A 2ZJSL 3B9VA 3HAEG 4I0PC 3L3JB 5GGUA 4Z7VF 5IVXF 3VFRB 2OTWA 5JIHA 3BW9A 1FNHA 2AKRA 3MCLH 1XF2B 5A2IH 4CRPA 4XNQA 3LB6C 5DD3H 1K4CA 2AV1A 5DFWH 2BVOB 1U8OA 4KK9D 3L3HA 2R1WA 4C56B 5DRZA 5FKPB 3D6GA 1T04B 5CSZA 1NL0H 3CFBB 5ECJE 1A7OL 2DMBA 3BWAA 4LASL 3H3KA 3I02A 4FQXB 4LLYA 2QHLA 3RNQA 1YEKL 1X5ZA 2P8MA 3X14B 5GGTA 4HMEA 3PHQA 3N0PB 4YUEL 1OW0A 2JB5H 2FJFB 3MBED 5C0AE 3FO0L 2V6HA 4NHUA 4OM1H 4RFEB 2Q86A 2YPLE 4U2YA 5L2JB 1HQRA 1UQSA 1MQKH 1UXSA 3SGEI 4YHIB 1MRCL 1MLBA 3ARFD 5CUSH 4Z7WF 5HYQA 4Y8DC 3ZE1E 1FNSL 4ERSH 5DMYA 3TBSA 5CSGA 5TQ2H 2APFA 3QIUA 4ZFZA 5A1AA 5GZND 4R6UA 5D71L 1FZMB 4K2UL 2FJGA 2OL3L 1FYTD 4R26L 1XF4A 1JPSL 4PJHB 3UTTA 3P77B 2Z31C 2N56A 1KNOA 3GSUA 3EZJB 2W65B 3G9VA 3FB6A 2HFEB 4O4YH 1QZ1A 1T4KB 4P9HC 3CFCL 2IADA 4K7PY 4MNQB 3WN5B 2I9LA 3QDAA 1E0OB 2ED8A 1VESA 5TPWL 1FO0L 3X3FH 5DRWB 4XB7A 1JGDB 5GISH 2GT9A 4AEIL 5K9JL 2C3GA 4P99A 5AUMB 2UUDK 1J05A 4LPYA 4W4OC 4OZFG 4J6RH 2AGJL 2X4PA 3KGRA 2MCPH 5D1ZA 4ZODA 4C58B 3UXFA 1QBML 3CVHL 3P9MB 1ZE3C 4JFHE 3H7BB 1KJ2B 2W0LA 5HYSG 4OIAA 3UJTH 4JZNB 2X4OB 4RZCB 4WI6A 3JWDC 5MERA 4G7VH 3F65A 4S1RH 5D6DA 4ZUTB 5TDNA 4OCXH 4MQXC 4ZPVA 4UIKH 3WS6C 1I7ZB 3HPLB 5MENA 3D39D 3HKFA 3ZE2F 5LBSH 4C54A 4PYHA 4F7PA 4QRPD 2DD8H 5A2KH 4NQXA 1TQCC 4HK0B 1Z5LA 2UZXB 4WEUD 3I6KA 1JN6B 1YUHA 3WDIA 1JNNH 5D1XA 5ICXA 5IW6A 2LU7A 2ESVD 4KK8C 3DARA 3MRCA 4PJFB 1QEWB 5HI5C 4EBQH 3HUJF 1IE5A 4I0KA 4JREC 4YBLC 4JQIH 3IJSB 3GSNB 1SJEB 2YS4A 3PIQA 2P48B 4JFFA 5EZJA 3EAKA 2FL5B 4WWKD 3V0AC 2BNQB 2X1QA 1T83C 3UTZA 5D1ZB 4H25A 1TJGH 3PJSB 4DKEL 3U36B 3CUPB 5JQ6L 3CVIH 3GHBH 4TVPL 1J05B 3NACL 4KRPB 4QHMA 3FFCE 3PWUB 5I1GH 1WAAE 4XBPB 4HUUA 2OTPA 5HTSA 3K4DA 3NPSC 3KPRA 3O3BA 4S1QL 4Z77B 3BQUA 4P5TC 1MHEA 5DO2C 3P4NA 1S7VA 2Z92B 3BIKA 4M43H 1NSNH 5F3BB 5AAWA 3WEXB 4GW5B 1JV5A 1JWUA 3GSQB 3RIAF 1XH3B 5CILL 3T3PF 2KPNA 1JWSB 3LEXB 1A1NB 4QY8B 1QFUL 1MCPH 2X41A 5D2NB 4OBRA 3VFMB 1RJLB 3QDGE 3L7FB 4NQTA 3BYYA 4WI8A 2PXYA 3P0YH 5HJ3A 5IQ7L 3KYKL 5CIPB 3D69B 2YXFA 4JQXA 3TPKA 4Y1AA 1QVOA 2JJTC 5F3HA 1KF9B 4NHUB 4PY7A 4RFEA 5L2JA 1SJHB 1KCSL 4CDHA 2PXYB 3QCTL 3PHQB 1RJCA 5E2VH 4KJWD 3VFMA 4FZEH 5HI3C 1CGYA 5EUKB 2Z8RA 3RNQB 1YECL 4PJDF 2KZ1B 3V8OA 4P46C 3QPXL 4JANA 2EC8A 3UC0L 1E6OH 2E27L 3AMKA 5HXMA 4BUHA 5EZOH 4D0BB 5E8EB 3S5LB 5C0AD 5I1HL 5JZ7D 1EHNA 2F74B 4NO3A 1RUAL 1S7WB 5AG9A 4LSUL 2NTFA 1YEDA 1VEOA 2D7PA 3GJFH 2XG5A 3MCLL 4MJ5B 5GJSH 4U1MB 1LP9F 3FB5A 1H9VA 1LD9A 4JGMA 5EO9B 3AUVA 5IK3A 2AK4A 4UAOB 2VXSL 4DEPC 1MWAA 2X9XA 5B39G 3IJSA 1NEUA 1S7UA 4YHNA 1A3RL 1J0ZA 5BJTB 2VLLB 4UB0H 1ES0B 4LHJB 5DMGC 3TIDA 5EULV 3SKOB 5JTWA 1GOHA 2C1PB 2YSSB 4FQ1L 5C08B 3N06B 4MCYA 4X5WB 1XR8A 3QP3A 1KYOK 4NGHL 3ULVE 3WIHA 1FGNL 3FO9A 4IOSD 3BT2L 1CTOA 4F7MA 3TJHD 2H41A 4OM1L 5KJRH 4WTXA 4BYHA 3QQ4A 4BH8A 5EUOE 4IRSD 1FYTE 1PY4A 4YFDB 1HDMA 5JQHC 1HQ4B 4OCNC 3WJJA 1X4ZA 2D4FA 4XAKD 5D71H 2DQCL 1G7QA 5IFJA 5KSUB 3O2DH 4R26H 4YNYA 5DHVB 5HDOA 5C0BB 2GTZA 2KBGA 1DTUA 3VE0B 5IEHB 1B0RB 2EE6A 5CGYC 1G0XA 4O4YL 3SE9H 5TF1L 4BSJA 4M6NL 1T2XA 3UTSE 4NUGH 4M1CC 4I18A 4ZYKA 3O81A 1LEKA 4LFHD 4AEIH 4RX4D 4MX7B 4I2XA 4QRRD 5MHSE 4PJ7B 4U1LB 4X9BA 1FJ1B 1DR9A 1U8PA 4TTGA 4DFHA 1YN7A 1IM9A 1FZOB 1ADQA 2AGJH 2DOCA 5DRWA 2PO6D 2W9LA 4FG6D 2AEQL 4XCFL 2GQHA 1D5XA 3LAFA 1QBMH 3CVHH 1TFHA 2BJMH 1FG9C 2PCPA 3WFHA 3RVTC 4U1SA 1A4JA 1LEGA 1Z0MA 5EZIL 5E4EC 1MI5D 2IBZX 3E2HB 3OKKB 1S7SB 4CW1A 1RZ8A 1P2CB 1YC7A 2EDFA 2X4SA 3HFML 2DMCA 3HRPA 4G6MH 3AREC 4CADA 5I0DA 4OCXL 4QRQB 1KN4H 5D1QC 5H2BB 3P3YA 3SBWA 3W81A 2IPTH 2E8YA 2YUZA 4ODUA 2IFGA 4MYWB 2P5WB 2D31A 3UJIL 1NCBH 4OBSA 3QDMD 2BY2A 2NZIA 3BD3A 2YEZB 3T2PA 1HQRB 1UQSB 3RX5A 1L0QA 3L3DA 4NQEA 3X13B 5ELIA 3BKYH 2VWEC 2J2ZA 5D6CB 4X7TB 3TJEL 1DP0A 5J1SC 3MFFB 5I0ZA 5GIRB 4L3AA 3HUJE 3FHQA 4CKVX 4PJBE 4LEXH 3QWRD 4K3HA 6CGTA 3OR6B 4ZOEA 5HI3D 3T0EB 5TE7H 2K3TA 5F71A 4NN5B 5F1SA 3W5NA 3I50L 4P9MH 1UCBH 4EBQL 5CJXA 4BFIA 4PJ9B 5I76A 4WDIB 3OKOA 5I17B 2BOCA 2F53D 3G6JE 2YMXL 4OCRH 4ONHB 1IT9L 2XTJD 5E9DD 3AS0A 2AV1B 3BEVB 1MJJB 1NCCH 4L4TA 4NRXA 5GRVL 1M71A 2I07A 4PJ8B 1JZ4A 1IMHC 1TJGL 3A0OA 4DKEH 3HE7C 2DIAA 4KAQH 5CCKL 3NACH 2XXMB 1MHHB 5EIIA 1HH6A 4X8JA 3MOBH 5T3ZD 1H0DB 1A7RL 5DGQA 5JW4Q 5HVFB 3S36L 1U2HA 3EDEA 1LILA 3RWHA 4M43L 4APQB 5EU4B 2FD6L 2IPKA 3AAZB 4HUWA 1WWAX 4F15B 2HWZH 3MJ9H 2V2TA 5DJYB 1MCPL 3FB8B 4JM2F 4WUUD 3MLVL 4JPKH 2HJFA 4TVSa 1IQWL 1PEZA 2APVA 3V5DB 3UYPA 3SKUD 2HJKA 1WWWX 5EBMA 5F93C 5IT2L 1QG3A 5T3ZL 5DK0B 4GRLC 5LXGH 3G9AB 1SEBB 1OTTC 3HN3A 3QUXD 1ZT7B 4APQC 3C6SB 2WIIB 4IRJD 1Q94A 3BZ4A 2DLFH 4WW2A 5I16A 3WDHA 5E2VL 2NY5H 3PL6C 4HULB 1BX2B 1YPZA 4MS8C 4OLYL 2RQ8A 1EBPA 2YPKB 5CJOH 5SX5H 1YECH 4M4PA 3KPQB 1AIFB 2BHZA 1E6OL 5C0CA 3RGVB 1ZGLB 1I1AD 2D4DA 3EJZC 1OVZA 3FZUC 5C0RH 1QBLL 1RUQL 3SGJA 1UH3A 5MHSD 2DQJL 2R1YA 3MV9A 5DDHA 4GAJH 2EYTA 5CKAA 5FDWB 4XVJL 4EDXA 4Z0XB 1L9NA 3VFOA 1QFWI 4IJ3C 1HYSD 3EUUA 2Z4QA 3BUYA 4PS4L 4XP6L 1W8NA 2VIRA 4Z5RB 3QH3A 3BI9X 1UKSA 4WUUB 2VQ1B 4Y7MA 2A6DB 3Q0HA 1K8IA 4NKIL 1JPGB 3LHPL 2CIKB 5ACLA 4OZIE 4HAFA 4UB0L 5GPRA 3QQ3B 3QJFA 1KIRA 1RZGA 4G6FB 1F3RB 5F1NB 1HCFX 1BJ1H 3VXSA 3P73A 4N0UA 3QNZA 1NEZB 4PJXA 1QD0A 1XCQB 4DAGH 4HC1A 1IGIH 4GXVL 2Q7YB 4PRPE 3BT2H 3DXAA 3EFDH 1PLGL 3HLAB 3GSXA 3A6CH 3BDYL 3TCXA 1EX0A 3UTPD 5KJRL 3ULVD 4MAYD 3Q5YA 1FYTA 4NNYA 3JTSA 2D9CA 1JFQH 5IGXH 2JCCF 5BQ7A 3T65B 4NNXA 4JZJB 3VFSB 1WGOA 4L3ED 5K9OA 5KZCD 1FVEA 3EYFB 4D9LH 4G8EA 2D7QA 5I66A 4XP5H 3O2DL 3SGDH 3FB7B 2IQAB 3CFIC 3CDYA 4G6JH 3UZEA 1NGYB 2DQHH 2DLGA 2GY7B 4RX4A 3TWCL 4ELKB 5ITFB 4Y5YA 2MTPA 4L4VB 2OX5A 4U7KA 1NCUA 1KBGH 4M6NH 3RWJB 1OAYH 4KRNA 3CU7A 4MD0B 4U6TA 5E95B 2AEWA 5I1DB 1LWRA 4B0MM 1IGFL 4P2OD 3N50A 1C5CH 5C0FA 3FQTB 3HNTH 4IMKC 1OAUH 4XP9H 4AEFA 2MQ3A 1KPVA 3VWKA 4W4NA 1DBKH 1RJZB 4U1GC 3WXWL 1NFDA 4XCFH 1W0VB 3TO2B 2HG5A 4MNGA 4JJ5B 4ACPA 2HT3C 5SWSA 1RPQA 4KK6D 2ORBH 3WYRA 4H1LB 1FLRL 4WCYL 5KVEH 1QR1B 4QKXB 1NMAH 1KN2H 4LGRB 2E7BA 4IDJL 4NQED 3BP5B 4FXKB 1I9RH 3FQTA 2LU3A 1IC5H 1NH6A 3PQYB 4X9GA 2IPTL 2EECA 5EC1B 1KULA 4XH2A 5EC2B 4MQSB 4I0CC 3U30C 1G1YA 1CFSB 1FAIL 4K07A 4ZFOB 1R0AL 3ZDYF 4L8CB 5GS0H 3S4SA 3BKYL 5C1MB 1KJVB 2WINA 3CFEB 1NC4A 4ZAKB 3GB7B 3TBTA 4ZXBB 2ICWJ 4AENB 1X7QB 3SCMD 1AGFB 3QQ9C 3VD5A 4E5XB 3RX7A 5E6ZA 2HFGH 3AFLA 5TDPB 1FVEB 3MA7B 4DFIA 5K9OB 1UB6B 5C0EB 4UNTA 4PJCB 2WMPA 4KROB 1A9EB 2J8OA 3LRSA 4PJ7E 3MC0A 1S7QB 4LARL 3L5HA 2FO1A 1BM3H 3MV7A 3BP4A 1F6LL 1IT9H 1K2DA 1CFBA 1EUUA 5IB5B 3ARPA 1N6QL 4N0UB 5D7JC 3OKEB 1FNEA 5E2UH 3UBXB 2PR4H 4TVPE 3MV9D 3FAWA 4L4VE 3B2UC 1CDGA 4JM2C 1RIUL 1BMGA 4XHJC 1A7RH 4N0FA 1JPGA 1ZS8B 3KPSB 1QA9A 3S36H 1A21A 1T0PB 5HYJB 4WUUA 4EVNB 3D48R 3DRTB 2OP4L 2PW1A 3H6JA 2ILLA 4WO4A 5JORB 3B5TA 3B8YA 4XNZB 1RZKL 3CU1A 3RWCA 2JIXA 2HWZL 3MJ9L 5ANME 3SE8L 3AMLA 3LKRB 4XP4H 4NZTL 5E6ID 2JLLA 2DWDA 1I8LC 2EYTB 2ICEA 3EKCA 4JPKL 1T1WB 3B9DA 1XGTB 1GZPB 2NY4B 2XY1A 2YD5A 3VGAC 3GIZH 4LLDA 3RVXC 5T3ZH 4TSAL 2XPGA 4K71C 2X05A 5LXGL 2P8PA 2A73B 4OKVB 3F8UB 2O5ZH 1XF3B 4L8SC 1NFDE 2DLFL 3RDTD 3HTLX 4TNWK 1U91B 1CT8A 2NY5L 3P9WB 2N7AA 3REWA 5JLZA 1MRFH 3DVFA 1QO3B 5I8OH 5CJOL 1G7JA 1HKLH 1V7ML 4QOKA 5ESVA 3RJDA 4YO0B 5FYKE 3SDDA 2H2SD 1Z9MA 4J3TA 3TCLA 1I9JL 1N26A 4QRRB 1A6AA 2AV7A 4HIEA 5I6XB 3WE6B 4DGYL 3MRLA 1U3HC 3CDGA 2W0PA 1HXYA 2HJFB 4GAJL 2D03L 4OFDA 4XVJH 3FT2A 4J8RA 7FABL 4GKNA 1A4KB 4M1DH 4V1DE 5HGAA 4D94A 1L7IH 4KV5E 4OCMC 4UOW1 1XR9A 3QUML 4XXDA 1NBVL 2QR0A 1BQHA 2EEBA 3VFWA 3KHOA 1G9NC 5DD5L 3N1QC 4KI5F 5D1QA 2FHFA 1UM5L 1P1ZA 4H8WL 2AJSL 2M26A 4NKIH 2WBJD 2EC9T 2F58L 3MV9E 3LHPH 5B4MD 5DO2D 3WIHL 1UWXK 1MHHA 1HHJA 3EBAA 4F7CB 4TUOA 1EO8H 2IQ9L 4BFBD 4KDVA 4LVEA 3DETC 4Q9RL 4HWZB 4GXVH 2GJZB 4IBLT 3D5OF 3BEVA 1CFVL 1RURL 4ONOA 4JZOB 4YE4H 4F15C 4HG4J 5CMAB 4N9GA 3WSQL 4U3XA 1ZHLA 5FA4A 5D7LA 4PREB 2CIIB 3HR5A 4DQOH 4KRMB 4PJ9A 3RBSA 5FUCE 2P4AB 3TBWB 5JXEA 1YMMD 1R3JA 4JKMA 4YHZH 4XPAH 1RZFH 3QXTA 3C2AH 2PTVA 3IB4A 4JR9L 1X5YA 3CGTA 3G08A 4Q2ZA 5BV7H 2JB6B 4D9LL 2EEDA 3Q48A 3BD4A 4YK4C 3P0GB 4G6JL 4Z95H 4DW2L 3CC5A 2GSIB 1BAFL 3HHRB 4ISVB 4JPIA 4GG6B 3KNBB 2Y06H 3MV7B 5J06A 2J3SA 2P45B 1OAYL 3HC4H 2R2HB 2WNGA 1U58B 4FTVD 2VAJA 4X5XB 2CJUL 5JW5B 1KUMA 4KUZH 4PJCA 2DYPD 1OAUL 3H9HA 2X4SB 4U1GB 3N85L 1OY3B 1P2CA 3FRUB 3ARVA 1I8MB 1OF2B 3KYNA 1NGWB 4Y5XB 4OI8A 2GCYA 4G3YL 1KJVA 4UU9B 4KGLA 1FVCA 1B2WL 1FLRH 2RFXA 4WCYH 3QEHB 4LRNH 1U8PB 4M7JL 3TM6A 1NMAL 1VPOH 4WV1A 4LPVA 1FVDA 3OJMB 1I9RL 2X4NB 4IIQB 3ZDYE 4HWBL 2R9HD 2NX5A 2PUQT 2F54A 3LKQB 1DQDH 3RZWA 3KPOA 3VRIA 5MP6H 1I7TB 1FAIH 4H1LA 1WBZB 1E4JA 5E99L 3ULUH 1QFWM 1OHQA 4JZJC 5GS0L 2NTSP 4ZAKC 3G5VB 2OTUB 2X89A 3JV6A 5MEND 4R2GB 1H8SA 4R8WH 3F7VA 5BMFL 2VLKA 4U7MA 3I2CH 5DD6B 1Q9OA 2ATPB 2HFGL 4FMFA 3IFPA 1A7QH 3MV7D 4JVPA 3VWKB 3MNZB 5GZOD 3RGHA 1L6XA 4KTYA 5D4QA 1OD9A 3SKNB 1TPXC 2A6JB 4WI2A 1S5HB 4CJ1A 4MDIA 4PRIE 1ZWIA 3REVB 3BVNA 3DUHA 4UV7L 3LOWA 3M1BB 3B8SA 1CZ8L 3ISWA 2CXGA 1S9XA 4CMHB 3HC0B 4MCYB 4OIIH 4X5WA 3SDXB 5EOTB 2EDYA 4Z0BL 1H5BB 4GKSB 3GSVB 4G8FA 5JO5B 1OTUC 3KJ4C 1RIUH 1RVFL 2ITCA 4PGCB 3NFPB 1HYRC 3E6HB 3QUMB 1EEQA 4M7KH 3HR6A 5J0BA 5J13B 1F00I 4DK3A 2OP4H 3UJJL 4JO1L 5FUCC 3RPIB 3TLRA 3DV6A 4RMWA 1DL7H 1RZKH 2ERJC 2DLHA 3U0PB 1G7PA 1HE7A 2Q8BL 1TLKA 3VXUB 1NEZA 3QCVL 5D93C 3QFJD 2LAGB 5I1JL 1BZ9A 4EUPB 5ESAA 3HUJA 2FBJL 3QQ3A 2W59A 3CFDB 1KT2A 4ODWA 4TSAH 4LNVA 4D0BA 4AM0A 3H9SE 1T20B 4U1KB 1YC8A 1U8IA 3IVKA 2O5ZL 4FQPA 4QRUA 1NGQL 4Y4FB 3CSBA 2V9QA 2A6IA 2WLZA 1PZ5B 4Y5YC 3HZKB 4RRPG 3CXHK 4CBPA 3KPSE 1MRFL 4Y4KA 1DBBL 5KVMC 1UH4A 3QXDA 4F9PA 3MREB 5C0CE 5I1CL 1G7LA 3QIUC 3RTQC 4OFIA 5FYLD 4EDXB 4F7TB 5FDWA 1KB5A 2E9BA 2GUOB 3HPJA 3MO1A 4LIQL 4PBWD 3DX9B 4XTRC 5L2KB 4HCRA 5BCAA 1EHXA 2BOBB 3IXTB 4KGJA 4TNWF 5ITBH 1ZHBA 3KAAA 4BFEA 4Y8AA 1PD6A 3T2OA 7FABH 1UB5A 5SWSE 3QO1A 3MNVB 1QFWH 2BHYA 1QSEB 2NY1B 2VN7A 1KLUB 4RCAA 3QUMH 2MKWA 1JBJA 4G80A 3ECBB 3D0VB 2Z92A 4JDVB 3I6GA 2Q1EA 1ZT7A 4V1DD 3U79A 4R3SA 2AJSH 4PG9A 3F6IA 3SGKA 5I1AB 3IU4L 3QWQB 4QHMB 5DLML 3NCEB 4F58L 3V5DA 1XGPA 4Q9RH 5E9DE 3C9NB 4JO3L 3WFEH 4R90L 3VFNB 1K3ZA 3ZKXC 3FRPA 1X5GA 4CVWA 2NPLX 4YE4L 1A6ZB 2UY7A 3WSQH 2VZUA 4JQVC 4RGND 2ZWLT 4P2CG 2I60L 1VGKB 1RZFL 3C2AL 5FM5M 3ARQA 1ZVSB 1CK0H 4P2QD 5L9DH 3L3KA 2XKSA 4X8JB 2A0LC 1JGUH 5L6YH 5AYUL 4QTIL 4XBGB 2OR7A 4FTVA 4AMKH 2NY6C 4PJ8A 1D5MA 4Z95L 1DQLL 2ZSVA 4ZOAA 2ENYA 5L2KE 4BSWA 3FO1A 3GI9H 3FFCB 3VXSE 2ZG3A 4X7EC 1GHFL 4YBQC 5HHPB 5ID1A 4MD5B 1T0MA 5C9KA 5F7EL 1S8DA 1W0WB 3X12A 2HKHH 1BGXH 5D96C 1QSFE 4YPJA 5C0GB 4HKZA 4NYLB 3CZJA 1T03L 4TSBL 1DZBA 5AWNH 2VDRL 4RZCA 4HCRL 1NMCC 1CDBA 3IDYC 1HK6A 3OPZH 4AH2B 3EGSA 1IGML 3ZTJG 1M05A 1ZHNA 1X5LA 1CLYL 4PJ5D 4OLUL 1WAAF 2GJ6D 2XQBL 4LLWB 5EUOB 1QHPA 3IJHA 1FL3B 1T1XA 4ZNEA 1B2WH 3MRQB 2B1AL 2H2PD 5FAAA 2Q20A 2O5XH 2EKSB 1LE9A 4NJAH 3ULSA 3LRHA 2V2WB 2BRRL 2MNUA 4KUCD 4LNRA 5KG9B 2X89D 1L6ZA 2GT9B 1S9YA 2VDQH 1N59B 3FOMB 5IQ9B 3ELAT 3LQZA 3TN0C 4ZUUA 3NA9H 1VKXA 3EO0B 3C5SA 4NQCB 1EFXA 5C92A 2DQIL 1OTSD 2YOCA 1SYSA 1CXFA 3F12A 3V4UL 1QFHA 3D25B 2FJGB 2DI7A 3I2CL 1VCAA 1IRAY 4UTBH 3QDGA 3SJVD 2QSCL 2Y36L 5D7KE 2HMIC 5HD8D 3EO1A 1NMBH 3ULSB 1GZQB 1FN4B 3BGAA 1K3IA 3CD4A 4P46A 4JN2B 1D5ZB 4DGIL 1I1CA 4K7FB 4NM8H 2QSQA 2XZZA 4LLWA 5EUOA 1KENL 1DLHB 4UIMA 4UV7H 5FCSH 1CL7I 5T1MA 1J0JA 3WS3A 4AH2A 2ZG1A 2HA1A 3I02B 2GTZB 5F96H 5DMIH 1FFNB 4TTDD 1Q72H 1RVFH 3MRMB 4P2RB 3PDDA 3S88L 3UTTD 5GRUH 3NFNA 1F45A 3P9LB 3GZKA 2VNCA 4G6FD 1NBZB 4JO1H 4QYOA 1UZ6E 4LCYA 3OAYH 4OFKA 5F1IB 4X7FC 3E1F1 2CK2A 4H5SB 3IDIB 4XI5C 1F2XK 2AKRB 3OGCB 3BN9C 3JWDL 3QUKB 1CXIA 5GZOC 4XNMA 5C9JA 3MRDA 4NDMB 2J6EA 3MODH 3UBXG 4M6ML 4B7LA 1K5NB 1EMTH 4LLVA 2YD8A 4JFEA 3UTTE 3VFPA 3PGFL 1NANI 5IUSA 1VGKA 2W38A 1F2QA 3CLFL 1OQOA 3RI5K 3TZVB 4YDIL 1WCQA 5BOPA 1JK8A 3LKPB 1JGVH 3CDCA 3GSNH 1FL6A 2AK4B 3G5YB 1MFDH 1C8PA 3VFPB 2V7HA 1NGQH 1TVBB 5F9DC 1FZKB 1U2CA 4B53A 3QEQE 2Z8WC 5AZ2H 2QQNH 1DEDA 1AHWA 5I1CH 1J8HE 3IDIA 5I1IH 2W9DH 4AT6B 3VD7A 1A6TA 1AGEA 1IL1A 3RIFF 1ZT1A 2LU4A 3MLPA 5ITBL 1XIWA 2DM3A 4HD9A 3ZSSA 3PP4L 2EC9U 2EIZA 5TJWK 4X7DC 3T08A 3S98A 1D5BB 1YJDH 4GXUM 3BH9B 1A14L 2IPUK 2Y5TA 4QRTA 3V79C 4U6YA 1ZHBB 1Q8MA 1DLFH 1KPRA 3KPMA 5E08L 1BVKA 5L2KA 5E8OB 4HGWA 3KPRE 1BVLB 1LP9E 2XKUA 4HPYH 1EBAA 3HZYA 5EN2B 3D18A 1P4LA 3LS4L 5DLMH 5IW3A 3O6FB 1UA6H 5E5RB 2J5LC 4HG4K 3RUGB 1IQDA 1VADB 4L4JA 3WFEL 2EKJA 2PYFA 1A6UH 2XI9A 1T21B 1P7QA 4CJ0A 1V3MA 5DJ6B 1FC2D 4GW5A 5D7IE 4LEOA 3RAJH 4WI3A 5KSVA 5T1DL 4QGTA 3PWNB 4ZUUB 2FWOA 1MCIA 2CDGA 4G8GA 1ZA3A 5FDYA 1T5XB 5IW1A 4MS8D 3C60C 5DVNA 4KROD 2HH0H 3GHEH 4WHDA 4X6CF 5IFHL 1JGUL 2IG2H 3L9RA 5AYUH 2VLKD 1GGUA 2EIBA 4U1JB 5HGDB 1JRHI 3PJSA 1JF1B 4GUPB 4HEPG 2Q3ZA 4ZPTB 5KSAD 5F9JA 2OJZL 4JLRA 3WIFB 5IWLC 3MRKA 5JHLH 1X5XA 5IESH 2FATH 3FQUB 3UCRA 1PYWA 2HKHL 3VD4A 3JV4B 5JPMA 1ZLWH 3B5HA 4RQQB 4RMVA 3TYGL 4GKSA 3ZLQC 3W0WA 5BOZG 2X1WL 4YDLC 1UKQA 5D1XB 5ICXB 3SDXA 4RGOL 1MRDL 3H0TA 4PLJC 5GRYA 3V6ZA 3GDBA 5FM8A 4QOKE 2G60L 4TSCH 5T3ZE 3ARDB 1CLYH 2UUDH 2XQBH 3FO1B 5FGBC 1BD2A 4LAQL 5J57B 2YPLB 4NN6C 3QXVA 4YR6A 1LE5B 2B1AH 5DI8A 3TV3L 5DT1L 1BF8A 4U1NB 1I7ZA 5DHXB 4PGDA 1F11B 1HCVA 3QULB 3EFFA 3V6OE 4PBVC 4I77H 3DROA 4DKFH 1Q9OB 3DSNA 4PLNC 2VDQL 5D7IF 3ARBD 4XGZA 1F58H 4KJQC 4Z78A 1BIHA 3NCBB 2FHBA 3OKLB 5EBLB 5HHVH 4OZGE 1J10A 3C5ZD 1TQCB 1WQVT 3DGGA 3NGBC 3STBA 4HWNA 5CJXC 8FABB 4J1UB 1CS6A 4GG6E 3K8KA 4N0UE 2XZAH 4CN1A 4JFPA 1NC2D 1OAXH 3ZT6A 4JFEE 4R3SB 4HUVB 3VRJB 1XGYH 4RWHA 2CUMA 3F62A 2DIBA 1IGJA 3LKNB 4JGUA 4MWFB 5FECA 4NHCL 3BRFA 3ARED 4JY6A 4K71B 1TTUA 4ODXB 3UTTB 3EYUH 1MCOH 5F96L 1O0VA 5D7JD 5GQBA 4UDTB 4DTGH 1Q72L 5F7YC 2H8PB 1ZLSH 1VACA 1VB9A 1AQDA 4TQEL 3V5HB 5EH1A 5GRUL 1PFCA 2KH2B 2R2HA 5DJ8A 5IVXA 2BNUB 3C6LC 5A16A 1O7SA 4LKCB 5FGCB 4K55A 5A2FA 4PJ9C 4KZDH 2DN7A 1HXMA 5BS0B 3TP4A 2R23A 5C7XL 3ARZA 2FGZA 3X14A 2VE6B 4UT6L 1JRHH 3JWDH 2QQQA 1Z0NA 1QRND 4BJLA 2JB6A 3DO7A 1EMTL 4N8PA 1FO0B 2YR3A 3RI5F 1U8IB 2RAMA 3PGFH 2PN5A 2VLKE 2ZNXA 1RK0B 4V1DB 3S7GA 4AM0B 3HMXH 5IMOB 1CXEA 2QL1A 3NZHL 4NBYB 5EG6C 3M8OH 3KYOB 1ND0B 4OB5L 3AXLB 1QSED 4WW1A 4N8VA 5CJBA 4IHOB 4X4XA 4NSKB 5CJ5A 2DIJA 2QQNL 4F7CA 4LK4A 3OJ2C 1ZEAL 5I1IL 1MI5B 3KYMA 1D9KB 4LOUC 3CSYA 4S1DD 3DIFA 2UWEA 5KS9A 1Q0XL 1YN6A 2VMFA 3L6FA 2RGSA 1DSFL 3QCUH 1FGVL 5DUMH 1HIMH 5HVGB 4Y19D 4UQ2A 3PP4H 1XCTA 1F4YH 5EFIB 3DUSB 35C8L 5DC9B 4PJIE 1YJDL 1Z3GH 5T1LB 4EUPH 2F53E 4JFQB 1ZVHA 3R8QA 3GO1L 4L8SB 1UXWB 4F7EB 4K23L 1NDGB 1A2YB 4Q6IA 1V7NH 4GH7B 3UYRL 4EEEA 1OTUD 4FQQB 3MLUH 1YEJL 5E08H 4X6CB 1S5HA 1AO7D 3VH8G 3GUTB 3BKJH 1MELA 2E9IA 3SKNA 2B0SL 3BJ91 4HPYL 4AQ1B 1TITA 3SE3C 5BRZB 1XGUB 2QKIB 4U6XA 5GRJH 2AXJA 2ATPA 5DHYB 4JRYE 2EDQA 1WISA 4FQHA 5LQBH 3S6CA 2BSRB 1OAQL 4F37K 1MH5A 2EYRA 4L9DA 4LVHC 4RGMB 5HI4C 2XRAH 4U6HB 4H20H 1CE6B 4LCCA 3RAJL 3IKCB 3RWEB 1CE1H 5T1DH 2P8PB 4RAVB 2QADD 5GGRA 2Q8AH 3ABZA 3O6LH 4WFFE 5ENWB 1AE6H 1DE4A 1GZPA 2HH0L 5CZVH 1J88A 3DURA 4EOWL 2VQTA 3DVGA 3ETBF 4L3CB 5F9AC 3RWCB 1MCDA 4N0YH 1X5KA 4XVUC 1O7VA 4ZXBD 1FYHB 1T7WA 3S34H 3GJEB 5I1KL 2FATL 3STZA 3T77B 5DXWA 2D0GA 3BGFC 5D7IB 4W70A 2FIRT 1QR4A 3VI3E 4N5EC 3TYGH 5HDQH 5LCVL 4GAFB 4IIQC 3WD5H 5IR1A 5FGCE 1MRDH 3BKMH 2NY3D 1TENA 1DQQA 1HHHB 5CBAB 2ZUSA 4NM4L 1JI1A 3KXFD 4J3OC 2FO4A 3BP4B 2IALB 4HGKC 4HKBA 3QPQC 3D39B 3V0WH 3T0DA 5DURB 5FK9B 3ARWA 3QUYC 2FYYB 2VKXA 5E0QA 3BOVA 1T5WA 1DVFC 3MZGB 3PDOB 1BQUA 5ALBH 4U6VH 1KIPB 4I77L 3H2WA 3NH7H 4MAUH 5GS1B 4JB9H 2NCMA 1VGEH 4AENA 4YHMH 1IAII 4I3SH 4HPOL 2FEEI 5DC0A 4XCNA 4KKAC 5HHVL 2WINB 5FA4B 3MLXL 3OKDA 4NNPL 3VG0H 2D7TL 3JWOH 3LN4B 3WFCL 1KELL 1A9BB 4HWZA 3C8KB 2DQFB 1LO3H 1IGTB 4U1IA 5F7FA 2SEBB 2WP3O 3KXFE 4X83A 4BM7A 2CLVA 5C0JB 3MA9H 2GITB 4QT5B 1YNLL 1BBDL 3OKMA 1VENA 4FQLL 1TJIL 3U7YL 3T1FB 3U83A 5D7JA 4IRSB 3WJLA 4LSQH 5F97E 1Q9KA 1RZ7H 3H42L 4KHTL 1CD0A 4WEBH 1KTKE 3SGDI 4PP2A 3BGFB 4U6XB 4EI5A 5HBBA 4MDJB 2MQCA 1R3LB 5IEKA 1B0GA 1KPUB 4WHTA 5E94A 1ZLSL 1T1ZB 1T66D 4EDWL 1AXSB 1TCRA 1N0XH 1G7IA 2VDOH 2WWMC 4CU8A 5TGBA 4D9QE 5IIEA 3LIZL 5IFAH 3F58L 2X9WA 3F7PC 2ZUXA 4WNQB 2ADJB 5C7XH 4LLAA 4DCQB 3ARFA 4HK3N 4DZBA 2OI9C 1J1XL 1NBQA 4KJPC 3ZMRA 1LDPL 1FCCA 5INDB 4X0KA 1CT8B 1KTDB 5HHNB 4OFYA 3DVNA 2C3VB 5HYSB 3O2DA 4L8BB 4JG1H 5IVXE 5AD0A 1LO4H 2PTTB 5I9QB 3WO4C 5HHOB 3K2MC 4KXZI 3KLAB 2KUTA 3NZHH 1YQ2A 4RAUA 4Z7VA 4AEEA 1FNLA 1MI5A 2BCKB 1CDIA 1G7MB 2ADIB 3UZQA 2P43B 5HGHA 1JUFB 3JTTB 3MJ6A 1XCQA 3ARFC 4BKLB 5CEZE 4RA0C 4O2FA 1I3GH 5F1NA 1ZEAH 3AU1A 4EXPX 5LGJA 1AY1H 3KLDA 5FYJE 4AIOA 2L7UA 4Y4HA 1VFAB 3QCUL 3Q6GH 1HIML 1GGCH 3TPUB 3AU1B 2YK1L 4WHYH 5DYOB 3D3VD 2VZ1A 2OI9B 35C8H 5DSCB 4P2OA 4U0QB 4Z0XA 1S7TB 1T3FA 3SEPA 4PV9A 3F6LA 3VGBA 2WUCH 4OLWH 1QRKA 1KCVL 3MLUL 4Z7VB 5SWZD 2APXA 4OGXL 5GGTL 2BVTA 4G43B 1S9VA 1U3JA 5F1OB 1DUZB 1ROWA 3JWOC 2YBRA 32C2B 4JM2B 2DJUA 5GGVY 4OTXH 5DEZA 1MFEH 1CLOL 1X7QA 2J5LB 1UWGH 3VH8A 3HI5H 5CBEB 1DUYA 1OAQH 2CDEB 3CFJA 3G6JA 1Q94B 2AXGB 5I16B 2OK0L 4X7CC 4H20L 4M5YH 3VFTB 1IEAA 5J6GB 1CE1L 2QHRH 1G7IB 3WUWB 5DJCB 4M00A 3LS5L 1AE6L 3BZDA 1U3HB 5E1AA 4XVSL 5DJYA 1NGPH 3HAEB 3FT3B 3BPNB 4OGZA 1SYVB 3VI3F 1V5JA 5I8EB 3VXTB 2HKFH 4XZUB 2FH6A 4P23B 3SKJH 3OJDB 2LFGA 4DGVL 3BO8B 1CGWA 4Z78B 1GIGH 5J7CC 3AM8C 5BRZD 2A1WL 4DVRL 4YBQD 3OKMB 5I74C 5JW4M 4PUBL 5E5MB 4FFYL 2HT3D 2XTJC 3A6BH 1UJ3B 1A7PL 2EH7L 5LCVH 5HDQL 2ARJB 3SY0A 3V6BR 3MR9A 3WD5L 2VR4A 3VXPA 4P4KB 1TTGA 3BKML 4K8RD 4YR6B 3BUTA 1M71B 4QLRA 4HBCL 4OGYH 1NAKL 1RD6A 3ZL4L 4HHAA 5GSRB 3B3IA 4J3SA 3WHXB 4JDZA 2NY4C 4LQFL 1FG2A 3ZDXE 1NGYA 1IM3B 2NX5E 3H0TB 2WZPD 1AD9A 2BNRB 4LMQE 5I66B 3OZ9H 4CN6A 5EBWA 2V5SA 5C07D 4RGNE 1EA9C 2CD0A 2VL5B 4LCUA 5ALBL 4U6VL 4MQ7B 3MPCA 1PYWB 4YHPA 4MAUL 3A67H 4KJWC 5FO7A 3BDXA 4YHML 1CICD 1C12A 5FK9A 1JNHB 3TH3T 4E42A 4OT1L 5IF0A 3MLXH 4NT6B 1NUGA 2VAAA 3VG0L 3DXAB 4OUOA 1JF1A 4HJGA 3QFJB 5F88B 4ZOCA 4N9OB 1LO3L 5D93B 4XNXH 5CKGA 2DYPB 4B7IA 3O6FC 3MA9L 4N0CD 5JMRA 1DQMH 1BP3B 1JHTA 2A9NH 3AREA 4H1LH 5HHOD 4M93C 5C0BE 2FX8L 1BBDH 3HCVA 3U7YH 4YHYC 3V4VL 4WJ5A 2H1PL 3IT8D 1A4JB 1LEGB 3MGAA 5EO1A 5SV4A 5DJ6A 1P9MC 2EEAA 3QH3B 3UDWA 4A6YA 3VD3A 4KHTH 1OLLA 4MXWH 3IJYB 5CWSA 5J3HC 1NUNB 4KUCF 3O41B 5FUOL 1PZUB 2P42B 5ICYA 1FZOA 4K3EL 2Z4QB 4XX1E 1OD7A 1ULVA 4K94H 3ZYJA 4GMTH 2ZG2A 5EU3B 2G9HA 3D3VA 3MLRH 12E8H 1VERA 3EYVA 1A3LL 3OB0H 1N0XL 1KFAH 3T4AB 4UT9H 3RGVA 1ZGLA 3CCHA 4B50A 5IFAL 4E41B 1MH5B 2EYRB 1WVZA 3QNYA 4M7LL 5F7HA 2V17L 2N1KA 4YFLF 4LAJH 1LDPH 3W11C 4N68A 1WEJH 2AJYH 5EU5A 1UKTA 4NZJA 2NXZC 5AG8A 3E6FA 4HUXA 2ICWI 5DZNA 4P57A 1GC1L 4JG1L 1LO4L 1SEBA 4YIQB 3BHBB 1OARL 3AB0B 1I3VA 3BWUC 1U8QB 3GMLA 5C6TL 5BV7B 1D6VL 2Z35A 1M1SA 3QSKB 1YMME 1KJ3L 4CNIA 4AT6A 5FKAA 5A2JH 4AK1A 1TMCB 5FHBL 3BDBA 2AK1L 3L5JA 1EIBA 5IHLB 4PRBB 1I3GL 1GAFH 3C08H 1K6QH 1BZ7B 3PXHA 3WUWG 1OGAE 1RK1B 1AY1L 2IPKB 1OB1A 1YA5A 2IANB 2VABA 1X5IA 3RWHB 5A3ID 3VGFA 2NXYB 2UVEA 2HTKD 1A8JH 3RVWC 1NBYB 1K5NA 1G9MC 4ELMF 3QA3B 1IAKB 1QYGH 1H3PL 4TULL 5IG7A 3VXNB 3P4OB 3INUH 3OHXA 2WUCL 1BJ1J 1KCVH 1MY7A 3P9LA 2AP2A 3MFGB 4MB3A 5GGTH 4Q9CA 1D7FA 5DD1L 5E8EA 5EU7E 3H8NA 4P2RA 4KTDL 1OSZA 2D9QB 2NY4D 5JR1L 3OX8A 5MENE 3TA3A 3NA4A 5J1TC 1HSBA 2EZ0C 1HINL 2HT2C 1FH5H 1M6OA 3KWWA 5EUKA 5GIRA 4JAMA 1RMFL 3HAEH 3HI5L 5SV3A 2CK0H 5I75B 1S78D 2OK0H 3BPNC 4OF6A 2BNQD 4NUJA 3HB3D 3NABL 1TETH 5GGQH 3QISA 1PKQB 3E8UH 3G5ZB 2DI9A 5DTFA 3GMRB 1IM9D 1MWAH 3MBEC 1AJ7L 1LVEA 4Y5VB 3L7EB 4UQ3A 1RSFA 1JZ7A 1LK3H 5B8CB 4ZS6D 4MB5A 3MLTB 2Z31B 2ICES 4K9EC 4AZ8A 4PRDB 2ARJQ 3IXAB 3NGBB 4PV8B 3U1SL 1E4XH 1FL5B 1HEZB 2AJZB 3VXME 4LDOB 3UAJC 4JRYA 3PUCA 1AKJD 5H35A 4IOIB 4RWYH 1MOEA 2A1WH 4DVRH 1MLCA 2HRPH 4I4WA 4PUBH 2ADFL 1U92B 1F4XH 1HHKA 3A6BL 3RTQB 1ORQA 3T4YB 4MMXC 4UZGA 5ALCL 4FQXC 4ZYKB 2PETA 4KTEL 4JPVH 5FCUL 4HX1A 5HVHB 2E6PA 1NAKH 1I4FA 4ZTOH 2W60A 3BIBX 1AQKL 1KIQA 3WNPA 1MFAH 5K59E 4NO0A 1ORSB 3GSNA 1JI2A 5CP7B 1CGXA 5F9OL 2F19L 4XGZB 5KSUA 3BISA 3OZ9L 1QEWA 1F97A 1CIUA 3SDCB 3L3GB 4G7YH 1F90H 4ZNEE 4JY5L 1LNUB 4YDVA 2GFBB 3A67L 3LH2L 4P5KB 4RAHA 1FIGH 2CSPA 2BXZA 5FGSA 3JBG7 2L7JA 5HHPA 3PWJA 3HA0A 1AGDA 3GK8L 5I71C 25C8H 1X6NA 1T83A 3CPLB 3ARDA 4OUUA 1TZGL 2E7LA 3CH1A 2GSGA 2YWYA 2VXUL 4M62H 4M4RA 2C1PA 2VUYA 2YSSA 3SDCA 2HN7A 4FHBD 2A9NL 2FX8H 5TF0A 3DSFH 2EDLA 1IJ9A 5HYJD 1NDMB 3MRKB 3VWJC 3H7BA 3GM0A 5BVPH 4OV5B 5IK3B 4HK3J 3DV4A 3GMPA 2C1OA 3T0EC 4D9QD 1J12A 4KMQA 1R3KA 2X4PB 4HX1B 4ZFOL 3SOBH 2YUVA 4K94L 3T4YA 1SVZA 2ZUWA 4YQXL 2G2RB 2BFVL 4KDTC 3VG9B 4JG0H 2NTFB 3MJGX 1P7HL 4MXQD 12E8L 1UZ8B 5JDJA 4YX2H 5MI0C 2IGFH 4G8GB 1KFAL 3C8DA 4ODSH 2IADB 2IFFH 4YGAB 2E7HA 4LEOB 4XPTH 1P69B 3QFDA 3HZVB 1GPOH 1RJYB 1U41A 4RMQA 4RRPA 3LEYH 3NVQA 2ESVA 2MCG1 4X6DE 1QSFB 1A7NL 2FX9L 3T2NL 1MJ7H 2JCCE 1TJHH 1WEJL 1R3IH 1V3JA 1GYAA 5DHVH 3DX7A 5EORL 4R7DA 5MI0B 3SCMB 4ZQKA 2C4FU 3ROOA 2WP3T 2YUXA 4R7DB 2I24N 3WXVL 1UXSB 5T3XD 2A9MH 4F80A 2C5DC 3PWPB 2AK4E 5L8LB 4Y4HD 5FHBH 3ZTJH 3MREA 1R24A 3WHE1 2R8SH 5D1QD 4QHKI 2EDBA 4HXAL 4ZDHB 3BAEL 3HZKA 5LJYH 3I84A 4MB4A 3B2UD 1H3TA 3OX8B 5F3BA 1B6UA 4HUUB 4OZGF 2OL3B 5K9QI 5DZLA 1DBJL 1OCWH 1UYWL 1IFHL 4MA7H 4XMLH 2R0KL 4ONFH 1A6WH 3QEUB 4R96A 1OAKH 4YK4B 3DBXA 4M1GL 3MMEB 1QYGL 4H25B 1H3PH 4TULH 1R3KB 2XA8L 1J87A 3INUL 3ALXA 5A2LH 2HLAB 4IOFC 3LDBC 4UTAH 4HFUL 3G04B 2EDTA 1NCDL 3W11D 4JY4A 3E6HA 2AJXL 3RTQD 4KK5D 2YRPA 1OTSC 2VABB 1RUPH 4PJFA 5FA3A 3W0WE 4Q7DA 3QUZD 5JO5A 1SY6A 5JDSA 3CAFA 5CGMA 4X4YA 4LLVB 1FH5L 4PG2C 1LO2L 1YMMB 3I6KB 3MRIB 2CK0L 2VLJE 1YMHB 3EDDA 3BVNB 4FXGA 4LCYB 5DA4A 3DGCR 1TETL 2XACC 1HWGB 3QIWC 4TRPL 3IU3B 4O58H 1ZV5A 2LAAA 4X6EB 3GMLB 1FPTH 1E6JL 3ARGA 1W72B 2OSLA 4P5KA 4KJYB 4XXCC 1AJ7H 4YDVB 1QLFA 1MIEL 4GAYA 5A40E 2D7NA 2OXGA 2B4CL 3MV8D 4POZD 5F7MC 3LCYA 3B2VH 2MPAL 5BZDB 1WCBA 1WTLA 2IBBA 1G6RL 4P4RB 4HKJA 4LVHB 1GGIL 4RGMC 5CP7A 5I18L 5M94B 2OTUA 1S7XA 3ES6A 1CDJA 1I7TA 4XPFH 3KPOB 3VRIB 2CH8A 2PW2A 2VJXA 1ZA6B 4G42B 4OAWB 4JFFE 3LQAL 3HRZA 2YA0A 3O6FD 3UPAA 2HRPL 5DWUL 2ADFH 2ZKHL 1H3VA 1JF5A 5J1AB 1BD2E 1KXQE 2R4SH 5E56A 4CGTA 3UO1L 1A02N 2P5WD 4ZOBA 3RY6A 4JPVL 3EDJA 1INEH 1BLNA 3J8F7 4GW1B 4QXGL 4ZTOL 3ULVH 3BP7B 2B1HL 4X9FA 1VEPA 4MCZA 2F19H 1HH9A 3PWLA 1CG9B 1QQDB 2Z8VC 1IZKA 1XF5A 4PB0H 4PTUA 4M3KB 3S96B 2NXYD 3MJ7A 1F90L 4MA3A 4KKCD 3HI1A 4JY5H 1QOKA 1OWWA 3PWVB 2AJVL 2R0WH 5HYQB