1NFDF

An alpha-beta t cell receptor (tcr) heterodimer in complex with an anti-tcr fab fragment derived from a mitogenic antibody
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
222
structure length
222
Chain Sequence
EVYLVESGGDLVQPGSSLKVSCAASGFTFSDFWMYWVRQAPGKGLEWVGRIKNIPNNYATEYADSVRGRFTISRDDSRNSIYLQMNRLRVDDTAIYYCTRAGRFDHFDYWGQGTMVTVSSATTTAPSVYPLAPACDSTTSTTDTVTLGCLVKGYFPEPVTVSWNSGALTSGVHTFPSVLHSGLYSLSSSVTVPSSTWPKQPITCNVAHPASSTKVDKKIEPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Complex (immunoreceptor/immunoglobulin)
molecule keywords N15 ALPHA-BETA T-CELL RECEPTOR
publication title Atomic structure of an alphabeta T cell receptor (TCR) heterodimer in complex with an anti-TCR fab fragment derived from a mitogenic antibody.
pubmed doi rcsb
source organism Mus musculus
total genus 34
structure length 222
sequence length 222
chains with identical sequence H
ec nomenclature
pdb deposition date 1997-08-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1nfdF02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1nfdF01
2VOTA 1UZ8B 5E1AA 1OSPH 4UQ3A 2DQJL 4TVSa 4NQSA 2O5YH 1KIQB 4B0MM 5JW4N 1MF2L 3B9KA 1HXMA 3BPNB 4QRPE 1JGDA 5LAXB 3M17A 1CL7L 1NKRA 1G9NL 3QBTB 3SDXE 2YC1A 4XP6L 3EOTL 5IM7B 2JCCB 5F9OH 1OCWH 4EUPG 5EA0L 4R96A 5K9OA 5F8RC 1X5HA 1BZQK 3TNMB 1FIGH 4QRPA 5FYJE 1EJOH 4WO4B 4NO0A 1YC7A 32C2A 4N0YH 3SDXA 4JY5H 4MA7L 5CEXA 3D85D 2X4PB 1KPRB 1HZHH 2C5DC 1WWBX 4TNVK 3SBWA 5FDWA 1OP3K 1U91B 3MRCA 3HUJE 1HINH 3KLAB 4PLKC 1N5AA 5DD5H 3BZFA 3RWIA 3RVVD 4R2GD 1T20B 1XGRB 4U1LA 3V2AR 2K9UA 3QI9D 3P9LA 1KB9K 4L3ED 2DL9A 3HUJA 4ZPTA 1RZGA 3TA3A 4Y5VB 4OCXH 3UC0H 1ZV5A 1ZWIA 3EO1B 4KJPC 2IADB 2V6HA 2UWEB 4KV5E 2FD6H 1R6VA 1MEXL 5HHOA 1T66C 4NQCB 5L7XL 5GGQH 3TCLB 2J8UB 5FUZL 3SKMA 3VXRD 5HYFA 1MCCA 4AG4L 1IZJA 5CAYB 1M71A 1Z3GH 4UT6L 1B0GA 4GG6B 4U1MA 1VDGA 1AJ7L 3RWEB 1CTOA 3MOAL 5HHPA 3TN0D 3MRLB 4IHOB 5E5UB 2AEQL 5GS0L 5TQ2H 1QO3B 3KXFA 2B0SH 5IB3B 4PJ7A 4PRDA 1D5IL 1FYTD 4P23C 2WK2A 4ONFL 3QUZB 3X3GH 2VWEE 1CTNA 1KGCE 4OF3A 4RZCA 1I7TA 1SYSB 3TVMB 2FZ3A 2FWOA 3PG2A 3L9RB 5INCB 3KWWA 2KBGA 5DRWB 4ZUSB 1EFXD 1ONQA 1HSAB 4NJ9H 1B88A 3UX9B 3HI6L 4WFGE 3IDYB 3O4LD 2Y5TA 3BWAB 3FB6B 3H0TA 5CD5C 4AEHH 3CZJA 4MVBD 4X0KB 3UAJC 1NMBL 3ZZ1A 4PJGF 1ZGLA 4N8VB 2XA3A 3WUWB 5IOPB 2VQ1B 4X7DC 4ALAH 1WUNT 2P49B 4F37K 4P4KD 3Q5TA 3DSFL 3DNKA 4P2RE 1I3GH 1IBGH 5GS2H 5JW4Q 3G9AB 4XNMA 1C12B 1C1EH 2JIXA 4KZDL 4WI7A 2F74B 2B1AH 3NN8B 4DVRH 4BJLA 1CFSA 3LEYH 3VWJB 2ZJSH 3HC4H 1JPSH 4HH9B 2VR4A 2JB6B 5DXWA 5L2JA 4JFQA 4NM4H 1BAFL 3BRDA 2FJFA 4BUHA 1XGYL 5JOEA 3SJVB 3MQIA 3STLA 4H26A 2IG2L 5SWZB 3U6RB 1RMFH 4BSWB 1F4AA 3TT3H 1A6PA 3T0XA 3RA7L 2IEPA 2FX8L 4XRCB 4RA0C 4KHTH 1UA6L 1XF4B 3BO8B 4XXDB 3BKML 4ZXBD 5TE4H 3VFWB 1A3QA 2AERT 1MRDH 2LTQB 2D0GA 4M3JA 1ETZB 2B8OT 1FE8L 5GGSB 4CVZB 2DMBA 3BW9B 2VKWA 5F96H 4NNYB 1QYGL 4PJCE 2QSCL 3DUUA 3TBVA 2ITDA 1J87A 3QIUB 1JIBA 3PJSB 1AO7E 5HYSA 2JCCF 8CGTA 1AGEB 3D69B 2VDRH 1DP0A 4LSQH 3IU3B 3ZKMC 5JW5B 4QCIA 1Q38A 4YUEH 5D8JL 2Z93B 4HF5L 3EGSB 1OT2A 4PJCA 4BZ2H 1F58L 1D6EB 2R23A 5KAQG 4RFNB 3SDYL 5I74B 1D9KC 1AO7A 2FH6A 3FRPG 3ARGC 4WO4D 3BGMB 4H1LG 4XNUL 5JXAL 3DIFB 2AGJH 5H2BB 4MNHA 2A2QT 5B8CB 2HRLA 1K8IA 3DV6B 2DQDH 2FR4B 43C9A 4KJQD 5DD0H 1JNNL 2ICWB 3JTTB 4KKLD 1YPZB 5JIHA 3JWDC 4YGVA 3WLWD 4NN7C 4JB9L 2ZPKL 5MENA 1L0QA 1G7HB 4GLRH 2VL5A 3EO0A 4C55A 5DMKB 1IKNC 2Z0BA 2E7MA 3UROR 4FXGB 3VRIB 5FOBB 4FQXA 4P5KB 4CW1A 5L8LB 4X6FB 3V6OE 3WDHA 1V7ML 2P8PB 3UDWA 4LHUG 3LQZA 5DYOB 2AXGA 3MRBB 4PRHE 4PGBB 3FRUA 2OS7A 5BW7C 4ZO7A 1XF2B 1S9VB 3GMLA 2UWEF 5EUOB 1UXSB 2HH0L 5KSAB 3P30H 3P9MA 2QR0A 35C8H 2DTSA 2VABA 3EO9L 4GS7C 3WD5H 4WEMB 3V4VH 1CF8H 4EI5C 3LV3B 4KK8D 4NQCD 1XAUA 2HFEA 4LGSB 3WE6B 3PWUA 1RD6A 2HJKA 4QTHA 1N0LA 3DTXB 4JR9H 1G6RL 2AABH 1Q94A 4KROB 4W4OC 2X5PA 5ACLA 4L8SB 4NO2B 2XY1A 2LAAA 1IGCH 1DR9A 1K2DB 4QHMA 2DRUA 3O8XA 4UINL 4MQXC 4U1SB 3QUZD 4ZAKB 4OD3H 3OZ9L 2ESVA 4YDKH 4P2QB 4FXKA 2XZCH 5TGBB 4WW2B 3TVMD 5FUCC 2XWJA 3RZCB 4LSUH 2MHAB 4XAWL 4ZFOL 4KRPD 1UJ3A 1RQ5A 3ARSA 5HY9A 4Z7OF 4JCMA 3WIHH 2JF1A 4BSVA 5D70H 4IJ3B 1JGLH 4G9DA 5EWIL 1IC4H 1KULA 4GBXA 1KCLA 3GSXB 1NCDH 2CLRB 2VO5A 3WIFB 4JKLA 3BP4B 2R0KL 2V7HB 2JJTC 3G08A 4JDTH 5DJXB 1OW0C 2NXZC 1A6VH 3VWJD 5KSVA 2CKNA 3BQUB 1LO0H 2ID5A 1J9CT 4F3FA 3RVTC 2DWEA 5F6IB 3V0VA 2EDWA 4OCNC 4LVHC 3LKOA 3SJVD 3K81A 4Y19E 3VFPB 5I18H 5IB1B 2MPAL 5CINH 4PJDA 5JZ7C 2VE6B 4YC2B 5SWZD 2AJ3A 3QEUA 1MHCA 5I1DB 3TESA 1GGUA 3V7AE 3UCRA 4LAJH 1BF8A 1T7YA 4JO4H 4WDIB 3MRIB 1B4JH 2V2XB 2BRQA 4XH2A 1CGSL 3C8KA 3RVUC 1NBQA 4FZEH 2QQNL 2IFFH 4U1HA 2FB4H 5CJOL 5JHDA 4Y4HC 2WINB 1D6VH 5T3XH 3L3JB 3QIUD 1HDMB 1R3JA 4YXLH 3SGKC 5J8OA 1R3LB 3E1F1 2BY0A 4M9PA 4LCIH 1FFQA 1A9BB 4LKXB 2Z8SA 3ILQC 4PJFE 4QHNA 4JN2A 3EYSH 3KPMA 3QYCA 1MUJB 4O5LH 3VFNA 3UBXA 2J6EH 1IGML 3ARXA 1R3KB 3U7YL 4CBPA 3T0BA 1G1YA 1RZJH 2Y06L 5EZJB 3N85L 2VC2H 3O9WA 2JE8A 1YPZF 2X4UB 1TDQA 5JUEL 3RY6C 3H9HB 5ABDE 3VFOB 2J5LC 4R97C 3V5KA 2ARJA 3VWKA 4RMSA 3PQYB 4YNYB 4WHTB 1INDH 1MCPL 5C08A 2DTMH 4M1CC 4OD1H 1OSZB 4LIQH 1X44A 3DX6A 4WWKA 5EUOF 1PLGH 1QD0A 3ZE0E 3CCHB 5KSAD 3RBGA 1T2JA 1FORL 1OTSD 2X1XR 3ESUF 2F19L 5HYQB 4Y16C 2EO9A 3DYOA 4O2CB 3BRGC 1SVZA 4WU7A 5GS1C 4YO0A 1V5JA 1NCWH 1BOGB 1NFDE 3ZYZA 5EU6A 3PGDA 2WSKA 4KROD 5JXED 2J4WH 4KH2A 4YHIA 1CE1H 3NCYS 3MJ9A 1DN0B 1T0NB 2IGFH 4WU5B 4WENB 4V1DE 4R6UA 4MD0A 3ARDC 1NFDA 4MDIA 1MWAA 4ZAKD 4YHLH 1ZA3B 4JRXE 4P2QD 5EO1A 1MLCA 4WW2F 4LRNL 5E99H 4K3DL 4XP4H 3GEWB 3TJHD 1KTDB 2FGWL 2DQGH 3L3HA 1A1NA 1U93A 1P53A 3RZCD 3WNKA 2BMKA 2HT2C 5A2JH 5ALCL 3NCCB 1WAAF 4RMWA 5J89A 4LSTH 5HHXH 1CFNA 1F11A 3TBYA 2VXVL 1X3DA 4YHYB 3BPOB 2XWBA 3MRQA 1G1CA 1ZLUK 5LWYL 4Y89A 3SDDC 3MR9A 3DGGA 3UXFA 1NFKA 1JI2A 2OI9C 4PJXE 3O45B 5FF6A 1NAMA 3GZKA 4NRXA 5D2NC 5IHZB 4OBRA 1T0MB 3FQWB 4AMKH 5E2VL 1AGCA 4EBQH 4UT7L 4MCYA 4P9MH 4ZYKB 4BQBA 3BQUD 2IALB 4PJXA 1XGPB 5A16A 2DQTH 4Z95L 4DGYL 5IMOB 5EIVA 3AXLA 3WJLC 4XHJD 3QCVH 3D48R 2BFVH 4ODHL 4IRSA 2CJUH 4NRYA 3MUZ1 5C07B 1ES0A 5HVHC 1RZKC 3BPCB 3HC3L 4W68A 3HS0B 4M4PA 1U42A 2VLJA 1CR9L 3C5JB 3GHBL 1KYOJ 3W11D 2I25N 3ZKXB 4E41B 2HMIC 2YD5A 1DDHA 4HD9A 1HQ4B 4HIEA 7FABL 2DLGA 1GYAA 4PRHB 2J88L 2VISA 4DAGH 3E8UH 3JWOL 1N64H 2X4NA 4HUVB 3MCLL 4AM0B 3IFLL 5JW4M 2Z31B 4CMHB 1V05A 4Z0BH 2N1KA 1KLUB 2Q86A 3EFDL 5JW3H 5HGGS 4DFIA 2YBRB 4G5ZH 3V5HB 1CICB 5E56A 4MXQC 3FO9B 2W0PA 4ELMB 2X2YA 2J3SA 3EDKA 3SDAC 4K94C 2XKNA 3HG1A 4K71B 5EG6C 2DJ4A 4PGJA 2D9CA 3D39A 4WTZG 5IFAH 3VJ6B 2AEWA 3TYGL 4NT6B 4GQ9L 3QR2A 1AC6A 4EZMA 3BYYA 1BFVL 1U3HB 3PV6B 5I30H 3WFDL 1KGCD 3PQYD 2IQAB 3MV9A 2W9EH 2I60L 3FB5A 1I8MA 4WJ5B 1UKSA 4XCNA 2YPKB 3OKMA 3MGTA 5T1MB 3ZTNH 4XMKH 1G7MA 4WFGD 1JN6A 3I50L 1A6AA 4Y88A 5HI3D 2OL3L 1FGNH 5BO1H 1RUAH 5IQ9A 2GJZA 1GGIL 5GZND 2DM7A 5FYKH 4ZPVA 5IVXE 3IJSB 5EBMB 4G7VL 4I2XE 1Q9KB 2BVQA 1IGFH 3KDMB 4YAQB 4TUOA 1N8ZB 2DBJA 5CD3A 4OD2B 5E94A 3OR6B 1K6QL 3MZGB 1YEKL 1YYML 1OAQL 5BV7C 3GSVB 1Q0XL 4RX4A 2X4SB 3GIVB 4RMTA 3BP5A 3JV4A 3CFBA 2HKFL 3KPRA 5J12B 5EO0A 1P4BL 4JKWA 5FCUH 4QKXB 1N4XL 4ETQB 3K0WA 2VZUA 3GSWB 5ICXA 1PG7L 2EYSA 3P2TA 1HHHA 1NGZB 3NVQA 4XPFH 4TSAL 4NQVA 2H9GB 4NJAL 1VCAA 5FYLH 1QTYT 3LN5B 5CILL 2DB8A 3HPJB 3SKJH 1T89C 5D2LE 1XCTA 2DKSA 1JPST 3IETB 2EXWC 1F6AB 3VI3F 4CVXB 4S1RL 1S7TA 1J8KA 3HE7C 5MI0B 1A7BA 2XYCA 1PG7X 1Q72L 4JM4L 4MAUH 2RHEA 3G6JF 1FFOA 1MWAH 4KI5F 4LAQL 2IPKA 3CSYB 1UWEH 4KI5D 4R4BA 4PJFB 4GW4B 3UJIL 1KB5B 5HPMA 3IRPX 3O3EB 2F9BT 1S78C 4UT9H 4H8WH 2PR4H 4KTDH 4NNXB 3TFKD 5DRXA 3VGGA 3EYQC 3AREA 4PJ8B 5D5MF 3EUUA 4FNLH 3MOQA 5D7JA 4UDUA 5IMKB 5DWUL 4U3CA 3ARBB 2A6JA 1IEBA 4AT6A 1IKFH 3FFDB 4L8BB 3JV6A 3TWCL 4U1IA 2B4CC 1NAMH 3MXWH 4ZOEA 2DIBA 3T3MF 3MBEA 1T2QL 4QRUB 4M00A 3MROB 3S37L 3S88H 3KPSE 1FNGA 5CSGA 3G6AA 5J13B 4PRHD 3ZHDA 2B1HL 4CN6A 1N5YL 1VGKA 3CVHA 1A6WL 3M8OL 3AVEA 4YDVB 3THML 2NW3B 5BZWA 3FCTA 4HIHA 1BECA 4KRLB 4DTGL 3PP3K 4X6DB 3V4UL 4I48B 4OTXL 3O0RH 3B2UD 5AG9A 3RNQA 1UENA 3QO0A 4XVUC 3EJZD 3S37X 3DOSA 1NCCH 4K7FA 1CICD 2G60L 4KXZI 2X9XA 1MAJA 2DQHL 4XVJH 1IC1A 2G9HB 3WUWG 3DMMD 2NPLX 4G42B 4OFDA 2OZ4A 4U1GB 2AJYH 4U2YA 4U0RB 1U3HD 4QWWC 2FBOJ 2N4IA 2BNRB 4GMTL 2VTFA 4LCUA 2XT1B 3P0YH 2VXQH 1QOKA 2KZWA 1J1XH 2W60B 2A77L 2YMXH 3SKNA 3KJ4C 4QXGL 5H94A 3OXRA 1EHAA 1MHPL 5LG1A 4ERSL 2MNUA 1QBLL 2GTWB 4HKJB 3RP1A 5DUPH 1XGQB 3C87A 4PUBL 1E6OH 3ARZA 3EW3B 3Q5OA 2AQ2A 5KVFH 3DRTA 3MYJA 5C09B 1DLHB 2BP3A 3Q2CA 1D9KA 4JGUA 3ARGA 1AGDA 4KGLA 1KPVB 4XP1L 2CLZA 4UV7L 1G7QB 1XF1A 2A9NH 3ETBF 3LB6C 3VD3A 2EE9A 3HAEG 3I6GB 5ADOH 3MGOA 3U48A 3C08H 4ZMAT 4Q6IC 1A0QH 5DSCA 2PTVA 2VXSH 4QO1A 4C57C 2WNGA 3LS4H 3BZ4B 1JMZA 3LS5H 1FVEA 2Y23A 3MRDB 4OGAC 3MACL 5ACMA 4HIJB 1H0DB 1G7JA 1IQWL 1DE4B 3TCXA 5F7NC 1JFQL 1IJ9A 1PYWA 5ESQB 5ISZE 2YWZA 5IB4B 4M93B 3OR7A 4JQIL 3CFCL 1GOHA 3F58L 3UTPE 5TH2A 4U05A 1RK0A 1ZHBA 1P1ZB 5D7KE 5FUOL 1ND0A 4RWYL 1MFEL 5DD3H 1ZT7A 5CFHA 4JAMA 3EOAB 3BYTA 5KAQF 1MH5A 4OIIL 2ZKHL 1LO4L 2CRYA 5KW9H 5E8DL 4FQJL 1DQQB 2MTPA 5GGUB 2W91A 5GSVA 1MJJB 4XBPB 3IVKA 4GT7A 4IOIB 3C60B 3QPQC 5JIIA 5AZ2H 4N90D 3TIDB 1D5MA 1KG0B 4Y5VC 2KKQA 4I18B 1DTUA 2ZUSA 3B8YA 4PJ8D 4JZJC 5DJ6A 4OKVA 4APQC 1JZ7A 1P4LA 5CJXC 2H6PA 3P0VL 1XCQA 3ARBD 3F6IA 2AVGA 5EU5A 5EU7C 4KQ4L 4ONGL 4ODTL 3Q6GL 4NDMA 4OIAA 4U0QB 3WFZA 4X98B 2VN4A 3CXDH 3EHBC 3QWRD 1IGIL 1KCSH 4MSWA 3O2DA 4JJ5B 3CUPA 3MLXL 1KJ2B 1TZHB 5TDPA 5AAWA 1UVQA 1WIOA 1X4ZA 4J3UA 5EULV 4DN3H 1JGVH 2AJZA 2R9HC 4HUWB 4HXAL 1JWSB 2WLZA 2R29H 3BVNB 1NLBH 4BA8A 4QYOB 4K8RC 5C7XL 4PJEB 4PJAA 2OTUB 4XGZA 3GO1H 2W0KA 3EDEA 1L6XA 3QIBC 4QRSB 1I8KB 4X4ZA 4EN3A 2VQTA 3K46A 4I2XB 3DVIA 5L9DL 2D2OA 3O3DA 5BOPA 1U8IB 5I8EB 1PGRB 4QEGA 1XH3A 1WZLA 4R0LA 4XCCH 1QLEL 1ZOXA 2NY6B 4PB9L 2B5IC 4X4XA 5B4MC 4ZFZB 5JQ6L 3D0LB 2NTFA 3NIGE 4JY4B 4M4RA 3REVA 43CAB 3VFMB 3HZKA 3T8XB 1JZ8A 5BRZA 1CBVL 5IFHL 3T4YB 3W81A 1ZS8A 5I1GH 4N0UA 3FHAA 3RWHB 1MHEA 1OT1A 2BVOA 3GSRA 4PV9B 3PWJA 4TSCL 4Y4HA 4NUGH 5D2LB 4UIMB 2G75A 4FFZH 1VADA 1MQKH 1CLZL 3PXHA 5I8KH 1FRGL 4OLXH 5IMMA 3QAZC 1T6WA 5E9DB 2NY3C 2ZUQC 1V7NH 4UILH 3ZLQC 2VDKH 3TO2A 4TVPH 4HWBA 3GMNB 4L4TB 4OCYL 4WUUA 5FK9B 4NQEE 3T2NH 1JWUA 2OZ4H 2GITB 1FLRL 5IR1A 1RU9H 5CLWA 5C09D 3CSPA 4GFTB 1TJGH 3FJTA 4F7TB 2LTQC 5KVDL 4YFEA 1EJ6A 4NQEA 1GGCL 3RWFB 4XVTH 1LD9B 5J3HC 1JF5A 5F3HA 1T1YB 2CKBB 3D25A 5AD0A 2CMRH 2BSRA 4TUJB 4BQ6A 4XC3H 1A6UH 1R3HA 4TNWK 4G80A 1QFUH 2HVKB 5DJCB 4I0KA 3L5XL 5CJQL 1HEZB 3PXJA 1DBJH 3T09A 1YY9C 3FO0H 5GRUH 3KPSB 1P69B 4RMVA 3A67H 4YWGL 4XZUB 4WW1B 1FPTH 4OCSH 1YY8A 3MLZL 4GKNB 4M7JL 3Q1SL 2OX5A 1CK0H 2R2HA 3JWDH 4XPHL 5GS1A 3KLHD 1BMGA 5F3BB 2AK4E 1SVCP 4Z77B 2BVEA 5K9KA 1T04B 2V5RA 4X9BA 3C60D 2BJML 4UQ2B 1Q9WB 2ZUYA 1VACB 2OR8A 2F5BH 3QEHB 4ZS6C 5E00B 3VH8B 1CXLA 3EDFA 1P7KA 5CHNB 2AK4A 4OZHE 5ITBH 5I1JH 2GAZB 1TZIA 2ZCKL 3OKOA 2JELH 4MD4B 5FHBH 2DQEH 2EE6A 1AP2A 1A7QH 2CUIA 2ATPB 2XFXA 2C1OB 3QG6A 2X4RA 3CVIH 4JQVC 2UUDK 3W2DL 3MA9L 5JXEC 1REIA 5DHVA 3FT4A 3UTTA 3BDYL 1JPTL 5D1XB 1NCBH 3SDDA 1RI8A 4RDQF 3ZDZE 1EXUB 4D0BB 3GSOA 3O2VL 4WW2C 3DO7A 3LKNA 5GRWA 1HIML 3GSUA 5D2NA 4BKLA 4E42B 4MS8C 1CL7H 5FM4A 2NY0C 2VXTH 1R5VA 4DGVL 3AU1A 1NMAH 4OF0A 3O2DH 3D18A 1RZ8A 5D1QC 4GW1B 3MLRL 4YDLB 2NY6D 3MFFA 5SV4A 4J12A 1CLOL 3W39A 1F2XK 4A6YA 4X6BA 1MFBH 4FQHB 4XBGA 1OAYH 4N5UA 2Y4SA 1HHIA 3IKCB 4PG9B 5E6YA 4GAYB 4PY7A 3D9AH 5TE6H 2HJLB 4KVNL 5KVEH 4NHCL 4F7PA 5ISZB 4L5FH 1CFQB 3SDCA 4S11A 1FL6B 3PNWB 1IM9A 1MCOL 1AKJB 4RGNE 5IK3A 1FNSL 5HTSA 1Y0LA 3O81A 4JHWH 2OXHA 4P9HC 4UAOC 2CGRH 2H41A 5I8CB 5E9DD 2AXFA 1QZ1A 3A6BL 4WV1B 1BQHB 4Z7VB 5HD8D 3GSNB 3FN3A 4Z6AT 1DBBL 4OF7A 5HGAB 3GMMA 5I75C 4LK4A 3WFCL 5DVLA 1MEXH 1OAUL 2X70A 3LRSA 4KRNA 5CGYD 1L7TH 4ZFOA 4FOMA 2V5TA 1B2WL 3WKNA 3O6FB 4L4VE 2HFTA 5IB5A 5C6TH 4CDGC 2FEDC 3S96B 3VFRB 1OWRM 4HWBH 5EUKA 1KIPA 3LKSB 3GHEH 4NRZA 4G8GB 2D7PA 4W6WB 4KPHH 1UWGH 4HFUL 4MQTB 2P24B 3BHBB 2AQ3A 3DJ9A 2KQNA 3U4EB 4LLWB 3QJHB 2W07A 5FGRA 3KPSD 1P2CB 4K2UH 5HVFB 4LLMA 2I07B 1WIPA 2GSGA 3B3IB 2E6QA 1MRCH 3RBSA 4H25A 2CSPA 3LY6A 1H9VA 4IBLT 5F88A 2Z4QA 5JORA 5I1CL 1RZ7L 2O5ZL 2VITB 4XWOC 3VG0H 4AQOA 1D5ZB 4MA1C 1BD2E 1F2QA 5A2KH 1AFVH 5TF1H 1P7QA 2XZQL 2AJUH 4GXUM 3S4SB 4QOKE 5IP4A 1AC0A 2AK1H 2YPLA 3CMOH 3MODH 1FN4A 5EN2B 4KKBD 4YK4C 3EAKA 1A5FL 1QQDA 3O6KL 3AGVA 4ZS7L 3ZHLA 3WFEH 3FFCA 4PJHF 4RISH 1SJEB 2GK0B 5D93B 2XICA 1KT2B 4J3SA 1MLBB 1OF2A 5I16B 5E4EB 4KRMB 3IFPA 3IS0X 5FO8B 3MRJA 5F89A 1IM3B 1FNFA 1KC5L 1Y6MR 2UYLB 5D1XD 2NMSA 4XMLL 4OI7A 4PBVC 5I1AB 4ZTPH 4R4FH 4MZ2A 2R0ZH 2XA8H 1FG9C 1F3JB 5F7UA 2X41A 2RBLA 3P40A 4QNPF 3UPCA 2ADFH 4QXTA 5E6IA 1NGPH 5T3ZH 1O0VA 4HJGA 5DHVH 3DROB 3CDGA 5SX5K 3MREB 3SDYH 4X6CE 1I3UA 2I26N 2COQA 3QG7L 5IBTL 3BPOC 5F7YC 3P4OA 4R90L 3WL9B 2YK1H 3VFTA 3U7WH 2BNUB 1ZEAH 4UIKH 1MI5E 5IW1A 1RJLB 1RZFH 4NZRH 4ODBD 4F15B 2FL5B 4P46B 5AWNH 5DEFB 3NACL 1I1RA 1YZZA 4S0SD 4X6CA 4HULB 2HP4A 1FCGA 1H5BB 5IBLD 2X1QA 1IAIL 3W5MA 3TFKC 4B41A 5ISZD 2CK0H 4LPCA 2BRRL 5ICYB 3OPZL 1AKJD 1CIDA 2WIIB 4MJIB 2HLFC 5DQJB 4G6ML 5EOCH 4FTVA 2XPGB 3MZTA 3K8KA 5BXFB 2EKSB 2MCG1 1A22B 1NAKH 4RAVB 5TJWK 3U9UB 5ERWB 5MP6L 2AJSL 4A6YH 1S7UA 3KNBB 4MNQE 3T04D 2EDKA 2E7LC 4ZUUA 1RZKH 4HEME 5GGVY 2VNCA 4X83A 4NO5A 1PBYA 4YFLI 2AEPH 1QPPA 5KJRL 5GGVH 3LKPB 1YEHL 4YZFE 3MCKB 2X42A 4MNQA 1JNLH 1I85A 3KPOB 3QDJB 3TJEH 2DS4A 4JFXA 4JZNB 3ROLB 5DUMH 1OTUC 4GW5A 4LF3B 1H3PH 2ADGB 3O6FD 3T65A 2BY3A 4OZHB 2CDEB 1RUMH 1AGBA 3PWVA 2Z31C 4ELKB 3MV8E 1G0DA 1RJZB 1DBAH 1YECL 3MMEB 4G8GD 5DHYA 1MJUL 3MV7E 4NN6B 4Q2ZB 2OJEB 1ZVSB 4NGHL 4S1QH 4NKOB 3X3FL 4F80A 1CDBA 3U0WL 4K94H 4P59H 4WWID 1CXEA 3I02A 3FO1A 5B21A 2MSPA 4M03A 4P3CH 3MV7A 4NQSB 1FAKT 4Z7WE 1HXMB 5JOPE 3NPSB 1JGUL 3M17B 5C0EA 2F58H 2MQCA 4HK3J 3TBSB 3WKML 2FIKA 3NIFE 5ENWA 1AQKL 4OF5A 5ECJE 1JL8A 4ACPA 2IAMB 1MIEL 2ZUUA 3V4PL 32C2B 3ZE1F 4Z7UF 3QNZA 3OGCA 3B6SA 5CEYB 3GB7A 2L7UA 3L5WA 4EQ3A 3W9EB 1JHLL 4DK6A 3MUGA 1TQCB 5FDWB 4UTAL 3PHQA 1NC4A 2WW8A 3VI4E 5J6HB 3QUXB 4N0RA 3MRCB 2F5AL 3VXQA 5C0IA 1N5AB 5HDBF 3KYOB 3RWIB 3HI1A 3DVGA 3QNYB 1GC1L 1QNZL 2AKRA 5ACZB 4POZD 4I3SL 2FECI 4U1LB 2F53A 4HMEA 4DKFL 1G9MC 3MJ8A 1R0AL 1C16B 1Y18A 5BV7H 3ULUF 1WFNA 4Y8DC 4RGNB 5HDQH 1RZGB 3IAQA 5F1NA 3TA3B 4EXKA 2VXUL 2DAVA 3VMPA 3UYRL 2D7MA 3QQ4A 1ZHNB 1KXVC 3G04B 3E3QE 1T5XA 4RCAA 5EC2B 4HC1H 1JVKA 1EX0A 1GAFH 4OFIA 3B2VL 4GJTB 5HHOB 5C0CB 3P3YA 1A7OH 1HH6A 3EZJB 4J4PA 3F6LA 4M62H 2PXYA 3HNTH 3IDIA 4Y4FC 5B22A 4NZDA 1MFCH 1M71B 2CLVA 4U1MB 4LCWA 2WZPD 3HE6C 4L4VB 2WAHA 1QLFB 3MRGA 3KXFB 3QIWA 3WHXA 4BZ1H 4PJ7B 3NAAL 2F8XC 5FYKE 4P46D 4U1KB 3AS0A 1OP9A 5GS2D 2HN7B 1DQTA 2DIAA 4AL8L 5AZEH 4LCCC 2VZVA 1FNLA 2XZZA 1UYWL 4LMQI 5DFVD 3N1MC 3TIEA 4BSJA 4JO2L 2FWOB 5KSBB 1EEYA 1P5UA 3KWWB 4URTB 4KWUA 1TENA 5HI4C 1ONQB 2ZZUT 5FGSA 4MJID 1MCPH 3RZWA 3IJYB 4IOSD 1I9IL 5MHSE 1XR8B 2GK2A 1OP5K 2IPTH 4M6NL 3H0TB 2APWA 1OTTD 2D7TL 3CFKA 1ZGLB 1KTRL 5HVWA 1IT9L 1IAKA 2XWTA 2V17H 3NIDF 2B4CH 4PRIE 4LLUB 4UB0H 4XNMB 5FYLE 1GIGH 4BH8B 4HS8H 1A4KA 1CFSB 3MXVH 4LLVA 4Z5RB 2VLKE 1F3RB 2R2EB 4ODVH 2AW2A 4QOKB 2HYMA 5D1ZB 1X9QA 2FJFB 1S9KC 1GPOL 1AGFA 3OAUL 4HUUA 1WJ3A 4H26B 4U7KA 2VLMD 3DETD 3VXOA 1RIHL 2IANE 4XP5H 2XQBH 1J10A 2FLBT 3WIIL 4NWTH 3RGVC 4GG8A 4MB5A 2P42B 1LP9A 1S3KL 4KUCF 2VDNL 5EC1B 4KUCD 2HFFA 3PP3H 3RPKA 3CLFL 4LU5L 3AC0A 2XIDA 1CYGA 5ALCH 2IC2A 2X7LA 1FZJB 3SO3B 4L8CB 3G5ZA 3DUUB 3TBVB 5B39A 2V7NB 4U0RC 1IFHH 2EH7L 1Q0YL 1TCRA 4MQSB 5GGRA 5IKCB 5HYSB 1FFRA 2MOVA 3BSZL 1FQ9C 5DK3A 1LDPL 4HS3A 4DFHA 5E2WH 1T22B 4DGIL 4ENED 3QPXL 4XNYH 3RTQB 2IAMD 3O11A 1MREL 5JIKA 1C5BH 3SDXF 3CH1A 1CDCA 4MNHB 4GLRI 1OGAE 1YYLL 43C9B 4O00A 5DD1L 2QADB 1LO2L 3MRFB 2GTZA 4AH2A 1NSNH 3SE9H 1GXEA 3QUXD 1K3IA 1HSBB 1L4IA 4ZFGH 1DQJA 4F7CA 4LQFL 5MENB 4WI6A 4E9LA 5GGTH 2VL5B 4OLEA 1FBIL 2APFA 4LSRL 3PL6B 4U6TA 3BN9D 1X5GA 4OZIE 1J86A 1MCFA 2YD8A 4IIQB 3HUJF 3T3PE 4RGND 5F9DC 1W72A 1UADC 3J7HA 5ALBH 5EOTA 3GHBH 2ZG1A 3LQZB 3TA3D 4FP8H 3VFSA 2ZWLT 5DJDA 3BAEL 2VSCA 3OKLB 2APXA 2D03H 3ARYA 3P9MB 4OZIA 2QR0B 4LPVA 4PLJC 2JJSA 2VABB 1RURL 3I9GL 4DKEL 3JWOH 5C92A 1WWWX 5HHOD 5C0CD 1QSZA 2M2DA 2AV1B 1SY6H 5F7DA 3TT1L 1FHGA 2CK2A 4R9HA 2MFNA 4QTHB 1BJMA 4KV5F 3DX9B 2A1WH 2E9BA 4JZOA 4N68A 1CE6A 1UM4H 1EEQA 4WY7L 3TZVC 3L3DA 1Q9OB 2DQUH 4PD4K 4S10A 4WI5A 5H8DA 5C3TA 5JQHC 4QHMB 1RHHA 4L4VD 1EO5A 4DKAA 3O8XB 4RWHA 3FOLA 3KYKL 3KXFD 1N6UA 2W0FB 1PFCA 1P84K 3DX8A 2W59A 4PFEA 4C4KO 3BEVA 3HPLA 2NY7H 4AENB 2DWDB 4FXKB 1CFBA 3VD5A 1L0YA 4JQVA 3C5SA 3HI5L 3E2HB 3VH8G 9CGTA 5SWSE 3I2CH 1BZ9A 3IAPA 1NPUA 1UJ3B 5IHLB 3QO1A 2QEJA 2EXYD 5L6YL 3D0VB 4LHJB 4LARL 4Z18A 3VFGL 2FO4A 5I17A 1YNLL 1PKQE 3S6CA 3LD8B 1NCNA 4Z7WB 1YEGL 3MNVA 3NABH 4N0FA 1IC7L 1SBSL 3G08B 4NKMA 1VKXA 1YQVH 2W92A 1TTGA 4NN5B 1AH1A 3ES6A 2A6IA 5KSVB 5T3XD 5DK0B 2GKIA 3N0PB 4K8RH 4BYHA 3FZUC 3V0VB 3WNMA 3MBXL 4QOKD 5D1ZD 1EAPA 2BXZA 1T1ZA 2NYYC 3LKOB 4JM2C 4EKXA 2DN7A 3BKJH 1NCUA 1BM3H 5ANME 4KK5D 3KJ6L 1J0JA 3BGAA 3GMQB 3RAJH 4HPYH 3QCTH 2OJZH 4XH2B 5IJKC 1HNFA 3VRLF 4IRJC 2P7TA 1GOGA 5SV3A 5BS0B 3O6MH 4U1HB 1NC2A 1K8DA 4LNVA 2YA0A 2VLRA 2VDQL 1BFOA 1B3JA 3BD5A 1N6QL 2HTLC 1FIEA 1VGEH 1RVFH 1X5JA 1WTLA 3D3VA 2C4FU 3O41B 1T03L 1R3JB 1ZHLB 2MKLC 3HRZA 2VLLB 3VA2C 2R1WB 4PP1C 4C56A 4WUKH 4PJCF 2BVUA 3O2WH 4OKDA 3LEVL 1LE5A 4JN2B 3KPMB 4JPVH 4K9EL 1YEJL 5CCKH 3RTQD 4Q58C 3H3BC 2IH1A 1A3RH 4PJIE 1UWXK 4M8VA 1TQBB 4KJYA 4XCYB 5I73B 1FL5A 1OD7A 4X5WA 3O9WB 4CADA 3U0TB 2QADD 2IQ9H 1MI5D 3NFNB 3BFOA 4KI1A 4B53A 1D7FA 3V5KB 4CMMB 4FA8A 3VWKB 1EVTC 1WC7A 4Q9RL 1D5XA 5MEND 5F6HJ 4LOUD 2BZDA 5ILTH 5IHUH 3WXWL 3PL6D 1UT9A 5C08B 3LQMA 4M61A 4JLRB 3NFPB 4HIIA 1WCBA 4FQQA 4LCYA 3CX2A 5GSRA 3W0WA 1TTUA 5E2UH 2H2PC 4TOYH 4WWKB 2E7BA 5L2KA 3MC0A 5DMJB 6FABH 3HR5B 5DVKA 3FB7A 3S7GA 1JBJA 1UJTA 2YKLL 3EIFA 4JFZH 2FSEA 3CZFB 1EA9C 4BQ8A 1F13A 1MAKA 4MLIA 4GKSB 3TH2T 3ZKND 4HHAA 4AK1A 5DJZA 3AY4C 1ZXQA 4U6VL 3INUL 5EU6B 3PGDB 1A7NH 4D0DB 3PGFL 2VLKB 1TVDA 1W72H 1UKQA 4JFOB 4GRLC 4K55A 4U3XA 3O8XD 4TVPE 3S36H 4K3JL 1P6FA 4NQXA 2BK8A 3FONB 4HJJL 4MDIB 3K74B 5E8OA 1MWAB 4S2SA 3X13A 2ZOKA 3LKQA 1MLCB 3T1FA 4HUMB 2EC9U 2IANB 2HTKD 5D72L 2XY2A 1U8MA 5LBSL 4GMSL 4O9HL 3RGHA 3L3HB 5T33L 1N3NA 2Y6SC 1YMHA 3O6LH 5HHMB 4F7MA 3T77B 1QA9A 1QRNA 2BMKB 4HGWA 3S4SG 1BVLB 12E8H 2Y36L 1RY7B 3PABA 4NYLA 2N7BA 3CDYA 4QHUA 2CDFA 4HUXA 4AY0A 2VUOA 3MJGX 2IPUK 3FQUB 4KKBC 1CFNB 1J8HB 4U7SA 1N0XL 5DEZA 3MR9B 1NDMA 3DGGB 5E08L 5I1LB 3QT2A 4XNXL 3HLAB 4L1HA 1JYNA 1NAMB 2ADIA 4NRXB 5BMFL 2BDNH 1KNOB 2C4XA 1PZ5A 2EDQA 1AGCB 1DQLL 2LE9A 4LPWA 2R0WL 1J1OH 2Q7YA 4EUPA 1M7IB 4FRWA 4PJDF 1PQZA 3AXLB 2CIIA 2UUDH 2WUCH 1A7PH 4PJBA 1LMKA 4YPGA 4CU8A 5T1DL 3PWLA 5L88H 1TZGL 2XTJB 4IRSB 1ES0B 3IU4H 4P2OA 5F9JA 1X6LA 5LGJA 1RZIA 5EZLA 1S7SA 1LK2A 2VLJB 1T4KA 3W9DA 1F4WL 2EYTA 2GYSA 3A6CL 4DEPB 5BS0D 1G9EA 4PS4H 2NXYB 1DDHB 4HIEB 3L95A 5M95B 4ZFFA 5EIIB 2DI7A 1IVLA 5GPRA 3RUGB 1QKZL 2VISB 4HWZA 1YQ2A 3D2UD 1P4IL 4JPIA 4PTTB 4PP2A 2BC4A 2E7LA 3N1GC 3CPLB 4RWYH 3FL7A 4YDJA 1XIWA 1HQRA 4MGXA 1VFUA 3MCG1 3M45A 5I19H 3UJTL 3AMLA 1UQSB 1KB9J 3C8HA 3Q6FA 4JPKH 5JR1L 1LO4H 1U41A 1T21B 5EBGA 4QLRA 4J6RH 3HG1B 4N0CD 4P9HH 5FECA 5FCSH 3D39B 4XCFH 4HW6A 3O9WD 2WP3O 2KH2B 3S35L 5FYKD 1NBZA 2HRPL 4YX2H 3VWKD 3F7VA 3FT2B 1KJMB 1W0VB 2H3NB 4OM0L 3GNML 5C08D 2WBJC 3FB5B 1YC8A 2J12B 3LSOB 5ID0A 4NOFA 4YK4B 5SWSB 1JZ6A 3DUHA 4FABL 1MCLA 3MGTB 5MHSD 3JSSA 3S35X 2Y7QB 3BIKB 4MAYA 4WWKD 3TPKA 2JKXA 3MLVL 5IQ9B 4LSDA 1EDQA 1S7XB 3E6FB 4GRWH 4ZPVB 3VCLA 4DN4H 3L3GB 3QH3A 4GKOA 1UB5B 8FABA 5FYLD 3ZE0F 4Y2DA 3UTSA 2IH3B 5E94B 5JLZB 3FT3A 5EORL 5KVGH 2BSTB 3WJJC 5EU6D 2DQIL 4GUPA 4TUKL 2X4OB 1JPFA 2H1PH 1RHFA 4F33B 3QJFA 2VLKD 4PGZA 2D4FA 2A6DB 4FMFA 3BP5B 3JV4B 1EVUA 3CFBB 3KPRB 4RNRB 1F8TL 1NFDF 1HXYA 4NCDA 3BN3B 1DSFL 2YPVL 4R26L 2VAAB 4H88H 1P9MC 4LPXA 5DJAA 4HH8A 2IAND 1HHHB 4EDWL 4PB0L 1K9TA 4ODSL 3ULVC 1EIBA 3IB4A 1BLNA 5HHMD 4OFYD 1H8SA 5I15L 1LILA 3OJDA 1EGJH 4X5LA 3ZYJA 1XCTB 1LQSR 3N06B 4X99A 2Q87A 4YE4H 4OAWB 1ZANL 1S7TB 3CK0L 4YXKH 3T0AA 4F2MA 3GMPA 4O02L 1J8HD 1QSVA 5T5FH 1T7VA 1QSFA 4X6EA 2L7JA 3QWOB 3AS2A 1OPGH 4YLQT 2NY1C 2ZCHL 5FHAH 2H26A 2XRAL 4R4BB 3LIZH 3OF6A 5I1IL 1S7WA 3QFJE 5FKPB 5HPMB 4OQTA 2IJ0C 4Q0XL 4Y4FA 2HT3D 3ULUC 4G6AC 1T3FB 5DRXB 4PJXF 3SPVB 3PHSA 3HE6A 4P57A 2Z35A 3BDXA 2UY7A 3PDGA 3B9VA 4UDUB 2Q8AH 4P23B 3FRPA 4H1LA 4FG6D 3WBDA 1AIFB 2XTJD 3NTCH 4G9FA 4LCCA 2G2RA 1QFOA 1XFPA 5DI8A 3PDOB 3S3PA 1FL3A 4QT5B 3IFNH 2E3VA 3UYOD 3QDMA 4HDIA 1NBYB 2VLJD 2QTEA 5F6HI 3LDBC 3X11B 1NEZB 1FP5A 3MBEB 1Q1JL 1K5NA 2NXYD 1ZE3C 1QVOA 5EFIB 4TSBH 3PHOB 3G6AB 4QGTA 2VZOA 4KTEH 2HJFA 3TO4C 4EUPH 4LEXL 1VGKB 5TPWL 4HK0A 4F15C 5BZWB 4P46C 4HIHB 5IESH 4K3EH 1NUDA 4RRPG 1A2YB 5A3IC 2QKIA 5GQBA 1H5BC 4LHUA 5SX5H 3RNQB 2NZ9D 4MZ3A 1OM3L 3ZL4L 3QO0B 3IDNA 3RWDA 1UM6L 3RX7A 4DQOH 4F58H 4YHKL 3BKCH 4NIKB 4K7FB 2EDJA 4J7RA 3MGAA 2HKHH 4NZUH 4X9IA 3HG1D 4CUCA 3WS6C 2I5YH 3D39D 3WO4C 5HGHB 3BZDA 5DHXB 2BERA 2VDOH 4ZDHB 5D7IE 1I9RH 1UC6A 5GJTH 3K8MA 3EYFA 3LCYA 1LEGB 4XWGL 1T1WA 4NO3A 1U8OA 2AI0H 4YFDB 2L0DA 4I13B 5SWSD 2UZIH 4Q9QL 3SQOL 3SKNB 4NKIL 5H94B 2PO6C 4YHZL 4MDJA 1G84A 4U31A 4AQ1B 1MFDH 4WFEE 1X4XA 4PJ9C 1SM3H 5F7KC 4ZOCA 2FHCA 3FQRB 2Z91A 3C6LA 2WUBH 5KTEH 2OK0H 3HFMH 3SKUD 4XMPH 1Z0NA 3DRTB 4UV4H 4PTUA 3MYJB 4M48H 5HHQA 2X4TA 4Z8FH 4W6YB 4XPBL 2MWCA 1D9KB 3ARGB 4O2EA 3K2MC 1BQLL 4OFPA 2CLZB 2YRPA 2R0LL 2WWMC 1I7UB 2F54E 4FQLH 3MO1B 4JEGB 4NSKA 4FQPA 4Y1AA 1VENA 2FX9H 3B9KC 3OG6B 2VDML 1CGUA 1X4YA 5DSCB 3KPRD 4YQXL 5KS9B 3BXNA 2MQ0A 4WRLA 2ADJB 5D9SA 5ELIA 1QEWA 4MQ7A 2FBJL 4HT1L 4PLKD 1XGUA 4TULH 4I1NB 1T5WA 2YD3A 3QXWA 3SCMC 4JRYE 1V3JA 3STZA 1G7JB 3PP4L 3N9GH 4LLQA 1S5IL 2W9DL 1PYWB 2EDEA 5IBUB 4IOFC 4NHCH 3U4AA 1EEZB 1MJ8L 1I1CA 1HOCB 1ZHBB 1UB6B 2AJVL 1KTLB 4OLVH 3IFOA 25C8L 3KPPB 4KJPD 3SBWC 4GAGH 3GIZL 1IGJA 3RL2A 4C54A 1QSEA 3L3IA 4GS7B 3IAGC 1E4WH 3LEXA 2P48B 1ZT4A 4EI5B 1T66D 4R4NC 5EU4B 1INEH 4M1DH 4BELD 4HKZA 5GISH 3L5JA 1KELL 4GSDL 4G3YL 1G9MH 1LK3L 2BNQA 2B2XH 2ZCLL 4PRPA 3TA3C 1UZ6E 3EDDA 1ERNA 1OARH 1U2CA 2DLFH 4X80L 4LSSH 1DCLA 3LZFH 1WBXA 1P4LB 3GI9H 1G7PB 1TCMA 4OZFG 4P23D 5F72S 1RUPL 1U8PA 3EDJA 1JTTA 3T0EE 4NDMB 1F00I 2O26U 4XT1C 5IVZB 1FH5L 1MRFL 2X40A 1S7VA 2P5WA 1XZ0A 1M6OA 5IMLA 3MRRA 5I1HL 4OGYL 4YXHL 5FGBA 1YEDA 2C7UA 2IBZY 4OQTH 5TDPB 3E0GA 2ITCA 4JRWA 1L0XA 5SX4H 2ZOLB 4JG1L 1QLRB 5CD5D 3SQBA 3UAJD 1JF6A 2NX5E 3VMOA 4AZ8A 5JNYA 3CFJA 2Q20A 3L7EB 1NFIB 4H1LH 1FC2D 5TFSL 5HHVH 2NXZB 3AS3A 4RGMC 3O3DB 3QHFL 4TQEH 4BUGA 2GJ6A 3IDGA 4Y5XA 5ESAA 1KB5L 3DX7A 4TN9A 3V6FA 1DL7L 1XR9A 4K07A 2V2WA 3R8BB 2VDPH 5KN5A 4JM2A 3WO3B 3S9DB 2NTFB 2VYRE 3LN4A 3P77B 4TVPD 5BVJB 1F4YH 3QEGL 2Q76A 3REVB 2WMPA 3HZKB 5BRZB 3T2OA 3BRFA 5AYUH 1O7SA 3ARFA 1BX2A 3CFEB 3OJ2C 4M5YH 3QXAA 4N0UB 1BREA 1S9YB 2OTWB 2LV4A 4IRJA 1MHEB 4QF1A 3UTZA 3O6KH 3QA3A 4OCMC 4Y4HB 1RIVL 3R06B 1H3TA 4BFGA 1KIRB 4UDTB 5TQ0L 1VADB 3F65A 1HYRC 2ORBH 5IMMB 3HA0A 4XVSL 1BFSA 1DBML 4TRPH 5C70A 3GI8L 3D85A 3ZKMD 3I75A 4X4YA 2E27H 1JWUB 4KMTL 1T2XA 5DJ8B 1ORQB 1VSCA 4JFFA 5KOVC 4R3SA 4NM8L 3IXTA 4L9LC 3GJEA 5DVOA 4L3EE 1PSKL 1D9KD 1IL1B 5DC9B 3ARGD 3HMXA 2EDDA 2BXYA 1AI1L 3K1DA 5A2IH 4MA8H 1E4KA 1EZVY 1BEYL 3SO3C 1KENH 1T83A 5CS7A 3QI9A 5CIPH 3SOBL 4TPRH 1TNNA 5F3HB 4XC1H 1NDGB 2A38A 4NWUH 5LQBL 2J5LB 4G6KL 4R97B 3VXNA 2BSRB 5H37G 5EOCJ 2A9ML 3F5WB 1IGYA 2DMCA 4R90H 1J1PH 5IG7A 3VXRE 4JO3L 4O58H 5IB2A 1L9NA 5DFTA 4EVNA 4G80B 3KPQA 5FO9A 4D9LH 3T2QA 1PD6A 4HFWB 4XBEH 3RQ3A 1OOAA 1IARB 3MRHA 4OLYL 2P5EA 3L1OH 4OZGE 5CP3H 3P4NA 3FQTA 1UCBL 1FYTE 2QADC 1IC5H 1LE9A 5K9JL 2PW1A 4FQ1H 5HGDB 5I76A 4FFYH 3NZ8A 1NGQH 4Y16B 5F1IB 3TN0A 4EI5D 3SKOB 5GS1B 1OL0A 3VMNA 5ITFA 2PTTA 2JK5A 5DA0B 5K9KB 3K2UL 3MRMA 4FQXC 3ZT7A 1KLFA 5CKAA 5J0BA 5D71L 4GRLA 4MQXD 1R24A 3RHWF 1TJIL 3QWQB 4PJGE 4AIZA 1EFXA 2CR3A 2YOCA 3ARDB 2ZSWB 4IM8A 1RSFA 2DKUA 1TZIB 5D7IB 3OKOB 1Q9LB 3O4LA 4PGDB 5EZIL 1AP2B 1D3CA 3QDAA 4YH6A 3GRWL 3VD7A 5IEHB 1FNEA 2P8LA 4WTZA 2FYYA 2XFXB 5C0FA 4FQIH 4P4KA 5FA4A 3DPBA 4S1SH 2J8OA 5DHVB 3UTTB 3VA6A 2CRMA 3HB3C 4PJAF 2R4SL 1KLGB 3I3EA 4LFHG 1KCRH 1JRHH 1S8DA 4WCYL 1IMHC 1CLYL 3SDDB 2OI9B 3QXDA 3BD4A 3DO7B 3GSOB 5FB8A 3MNWA 3QFDA 2NXZD 5D2NB 4BKLB 3Q48A 3QDGA 1SJHA 1R5VB 5KANG 1UJ3C 4GKZA 3MX0A 1RZ8B 3JWNC 5LJYH 3RVTD 4RAUA 2CH8A 2R8SH 4ZXBA 3MSPA 1Z5LB 3QSKB 2DQCL 4XCEB 4XAKD 1U8HB 2CR6A 3W39B 2QQKL 2JCCE 2SEBB 1QBAA 3PUCA 4WNQB 4A6YB 4X6BB 1YMME 2HFGL 4XBGB 4GBXC 3AFLA 5BRZD 1KIQA 2VKXA 4MB3A 5HVHB 3MLSH 2LU3A 4N8CL 1FC1A 1CU4H 3HC0A 4XNQA 3GUTB 1DUYB 1UCTA 5LAXA 2ED7A 4PY8J 1HHGA 5IM7A 2ARJQ 3RVUD 3KYNA 4OFKA 4ODUA 4W6XB 3SDCB 1KJ2L 3SE4C 1IM9B 1YEEL 4MNGA 4Y4HD 1Y0LB 3TLRA 5D7SL 1FZKA 3U1SL 1UH4A 3ME0A 3QQ3A 3C09C 1T7WA 3RVXC 4KZEL 2X4PA 2LU7A 2WWKO 5SWQA 2YUXA 3ILQD 2FHBA 3IDXL 1MCIA 1U91A 3EFFA 3GMMB 1KJ3H 3HCVB 3KLAA 5B38B 1OD9A 5GIRB 1UEMA 5DZOA 3SDAB 4PRAB 1PKOA 3LRSB 3BESR 1T20A 5D7LE 5C8JA 1XGRA 4M7KL 5F7MC 1RK1A 3QHZH 2UWEE 4MMXC 4KUZH 3K1KC 3FMGL 1W0WB 1HKLL 5IB5B 3FN0L 2Q8BL 4HV8A 4JO1H 5FM8A 4NQCE 1KV3A 3MYZA 4J1UB 2PYFA 4NP4L 5EUKB 3EO1A 3F7YB 2QJDA 4NRZB 2IADA 2D3VA 2WBJA 1F42A 4M1CD 4LP5A 2DBLL 1PY4A 4GG6E 1OVZA 3HMXH 4HZLA 4JDZB 1J11A 5FIEA 1VPOH 4I8DA 4OB5H 3TNNA 2J8UA 5I73C 1VFBA 1N7ML 3O9WC 5INDB 4OLZL 4LLMB 3ROOB 5BCAA 5GRXG 1P5VA 2Y5EA 2UVFA 2NX5B 4PRBB 4Y16D 1DLFH 4GG6A 4M02A 3RWEA 1UWXH 3MRLA 3SGEH 3UP1A 3VFVB 5IB3A 1QO3A 3BP7A 5GXBB 3ZT6A 4HQQH 3N50A 3WFBH 5IGXL 2DDQH 2NR6D 3VXMA 4Z7OE 5DT1L 5A40E 2OQJB 4GO6B 4QRQB 1NL0L 1P7QB 5E24E 3G5YA 3L9RA 5INCA 4ZUSA 5I1EL 3IGAA 4PRNA 3ARDD 1HSAA 1CD1A 2CKBL 1JHKL 3IDJA 1YJDC 3UO1H 3EZ8A 4EIGB 3BWAA 3FB6A 1MQ8A 4X0KA 1QQDB 1OAXL 3WUWA 2VQ1A 1T6VN 4I3GA 2HT2D 3OSKA 5T3ZD 2XZAL 2MCPH 1FCCA 3UTTD 1UH3A 3SJVE 3ZO0A 1BGXH 3C8DA 1OF2B 2R15A 5E4IA 5J6GB 4OM1L 3HE7B 3GFUA 3MRJB 1DBKL 3VWJA 1I7ZA 3LH2L 1LEKB 2C1PB 2WQRA 3SDDD 3TC9A 1GVIA 2JB5L 3Q0HA 1KXTB 3TV3L 3QQNA 3CD4A 5DMYA 2PYEE 4JN1L 5SWZA 4BSWA 1ZLWK 4QXTB 1RJCA 3BO8A 4M5ZL 4XXDA 4YEEA 2DLEA 3CDGB 3VFWA 3QRGL 2EYRB 2KQMA 3P4OB 5I9QC 5GGSA 4CVZA 1XEDA 3BW9A 4YHOL 3VG9B 5IW1B 3QIUA 3HAEA 4XP9L 3PJSA 1K3ZA 4OJFL 4JFEA 2FX7L 5FDYA 1AGEA 5C0BB 3BE1H 5JW5A 1WEJH 4OSUH 3SDCD 1X5YA 2HMID 1IM9D 2Z93A 3EGSA 4PG2C 2X09A 1D6EA 1ZLSH 4RGOH 4GAJL 3VU2A 3TO4A 3WLBB 1YPZE 2YD4A 2YEZA 3BGMA 4FTVB 4EOWL 3I3DA 1EUTA 3NCJL 5B8CA 1EHLL 1GGYA 2J7LA 5AEAA 1S7UB 3DV6A 4IRSC 5C2BH 2FR4A 1J5OH 4CN1A 5GZOD 5DMGC 3CJJA 2YA2A 3LHPL 1NEZG 4JFDE 3ZDXF 1WWAX 1FFNB 4OT1L 1KPUA 4DEPC 3SDAD 4CAGA 1KUMA 5GHWL 4OLWL 2Y07H 1G7HA 4K7PL 4M1GH 5K9QI 2VH5L 4WTXA 5DMKA 1ADQH 5EUOE 4JFXB 4ZG1A 4GW5B 3VRIA 3T65B 2P8PA 1KN4H 4YDIH 3O3BB 3PWVB 1ROWA 4FQ2L 3L5IA 2RFXA 3OKEA 3G6DH 5DHYB 3R8QA 1UXSA 4HBCH 1MAMH 2ZG3A 4KQ3L 1AE6L 5CEZH 1DN2A 1MCSA 2ENYA 4WFHD 1SJVA 3DYMA 3I02B 3P11H 1VEOA 4HWEH 2VDLL 4KKAC 4WIQA 3LQAC 2NX5D 3N1FC 4NO2A 3VW3L 1A6TA 2GT9B 3GSNL 4IDLA 4YHPB 1FO0A 3NCYP 1RUKL 2RCSH 1ODAA 5ENWB 5KVMC 5TE7H 3F7PC 4P2QA 5F7EH 4U6HB 2FIRT 4JDVB 5TGBA 3QEQA 1WAAE 3GK8H 2ZNWA 1P7QD 3B5TA 4Q6IB 3VXUB 3ZKQD 3RZCA 2MHAA 1HYSC 3QNZB 1YN7B 1OSPL 1X5FA 3OGCB 3B6SB 4UUJA 4Z0XA 2O5YL 2I9LB 2C3WA 1BZ7A 1YMMB 4YHNA 5CP7A 5BVPH 3MUGB 4X4ME 3SCMA 1NC4B 1OAKH 4RMQA 5F9OL 3VXQB 2R1XB 1OCWL 1VFAB 3DUSB 2E8YA 3GSXA 3WIFA 2CLRA 3S97C 4P5TC 3BP4A 1FIGL 1DQDH 2V7HA 4PY8I 5BZDA 1EJOL 3MJ8B 1Y18B 2EXWD 4N0YL 4JY5L 5I66A 3HE7D 1QPXA 3EJYC 4NQTA 1HZHL 4D9RD 4QXUH 3BQUA 4JCLA 3QQ4B 1NJ9A 2OYPA 2JTDA 4IMLB 4LLAA 1HINL 3VFPA 5IIEA 4UNTA 4LLDA 5IB1A 5DD5L 1EO8H 1NUFA 1S78D 5J1AB 4I4WB 3ULVH 5I1DA 5K93A 1OQXA 4Y0GA 1TFHA 3EYQD 4WDIA 3F8UB 3MRIA 3S34H 3IDIB 4JZJB 2M8XA 5D7LB 1FDLH 1S7RB 4APQB 1KCKA 3WXVH 2CLVB 1U3YA 4MX7A 4OCXL 3UC0L 4WHYG 2WINA 2FECL 3MRGB 3L3JA 1I8IA 2CO6B 2FD6L 3K4AA 3RDTA 4X6CF 1R3LA 5C0BD 5GGQL 5EZOH 3NH7H 1U95B 3QUYC 4Q9RH 4LKXA 2NW2B 3ULUH 1B0WA 3AREC 3EOYG 3F62A 3B83A 5D7JC 1Z3GL 3MOBH 4FTVD 2X4QB 3H9ZA 4UNVA 4LVOC 4NHUA 5TQ2L 1H3VA 2B0SL 3QIBB 3PQYE 3CFKB 4DUWA 4JHBA 2Z92A 4RSVA 2HLAB 2ICWJ 1IAKB 2NY5C 2XWTB 4XVUD 2X4UA 4M3KB 3HAEH 3H9HA 2DICA 2KUTA 3VFOA 1RJYA 3E6HB 3RU8H 3MBEC 1AY1H 1F45A 3PQYA 2B5IB 1CZ8H 4YNYA 2C26A 4ZSOB 1MHHA 1A4KB 4LLVB 2EDTA 4NJ9L 3WDIA 1J88A 3ILPA 2YRLA 4U6VH 1JV5A 4AEHL 2EDXA 5A43C 4QWWD 1H3XA 4HUUB 4I3RH 1I1YB 4ALAL 5IW3A 3PDDA 1AXSA 1I3GL 1IBGL 2AV7A 4MB4A 4GG8B 1C1EL 1LP9B 2B1AL 1CGYA 4KVCL 4IDJH 4DVRL 4P2RA 3WFHA 5JDJA 3LEYL 2D7NA 4PR5A 2ZJSL 3HC4L 1JPSL 5HVGB 3QAZB 2NY3B 1M1SA 2ZUQB 4NM4L 4F9PA 2Y36H 1QFWM 1TPXB 5B39B 5EU3A 4X9GA 5GGRB 3OV6A 1RMFL 1WISA 5EBWA 3TT3L 4AIXA 4L9LA 1AXIB 4Z78B 2PYEB 4KHTL 1ZA3A 4HS3B 2XXCB 5TE4L 1AR1C 3O11B 3LB6D 3VI3E 4DJMA 3PE9A 1KTDA 1KN2H 1MRDL 2G5BB 1WFUA 2C3HA 3VXUD 3NIFF 5IJVB 1Z9LA 2QQLH 5F96L 4NBXB 1TITA 1YMMD 4KI5E 4OGAD 3VXPA 4AH2B 3DVNB 4XPGH 1NC4D 2VDRL 3WSQH 4LSQL 3CSBA 4CGTA 1FO0H 3REWB 4F7CB 4YUEL 4BZ2L 3AM8A 4X9FA 4OGXH 4PLNC 4O51A 3HZVA 4U6XB 3IJHB 2H8PA 5DQDH 3D5OF 4HG4J 5GRJH 3EYUH 1ZAGA 1T0MA 5D4QA 1W72B 1RUQH 5EOTB 4ZYKA 3VFSB 1WBZA 5T5NG 5C07E 5DD0L 4F7EB 3KR3H 5I6XB 2EKJA 5IMOA 3STBA 4NC0B 1FV1B 2YD2A 2L4OA 4JFDB 4E41E 2Q3AA 3QPQD 2W38A 3IXAB 4JZOB 1CE6B 3MA7A 3Q3GA 1Z9MA 5D7LD 5IT2H 4APQD 1B0RA 4EJ1C 1XF3B 1MFAH 5FYJH 4CVWA 1RHHB 3V6OA 3FOLB 3NBNA 3V52H 4NZTH 3P30L 4PRHA 35C8L 3DX8B 1RFDH 1U92B 5EO9A 3RHWK 4CU6A 4MJ5B 4JPWH 3WD5L 3V4VL 1CF8L 3EHBD 4ELME 5FYKU 4FZ8H 4AM0A 3C5SB 3RIAF 4ORGB 2ZSVA 1GHFH 2XI9A 2FJGA 2R9HD 4JR9L 2NNAA 2OBGA 2AABL 4K8RD 5C1MB 1CICA 2J1KA 3QO1B 3FO9A 3HN3A 4ELMA 1IGCL 2FO4B 2OCFD 3QIBD 1U6AH 4JHAH 1H15A 4OD3L 3VJ6A 4TTDC 4YDKL 1G9NC 3DMMA 4YBHA 5DR5H 3BJLA 3C5ZC 2XZCL 4N0FB 1JGEB 2NY0B 3CC5B 1SEBA 5IQ7H 1U3HA 3PV6A 4NKMB 5D1QB 1NCAH 3OJMB 4LSUL 3K8LA 2IQAA 5B4MD 4RFEA 3ES6B 5LXGH 1H8NA 4WJ5A 1A47A 4MD5B 3WIHL 1GCFA 4P2CG 1EAPB 2YPKA 5T1MA 5D70L 3QULA 2OSLB 1JGLL 4LVEA 1IC4L 4QTIH 4EN3C 1UXWA 1NCDL 4ZD3H 3MUJA 4Z7NF 4JDTL 1PW3A 4MHHG 3PF2A 1LP9F 3SE4A 4R0LC 3IJSA 1CWVA 1Q9KA 1A6VL 1BBJB 4DWHA 4YAQA 4XNZC 1N8ZA 4OD2A 1LO0L 4UAOB 2ICEB 1R5WA 5D96C 1K8DB 2NY3D 3CLEH 1UFUA 3GSVA 5I1KH 5LGHH 2EE2A 5I18L 1A8JH 5CINL 3GIVA 1UACH 1MJ7H 3HRZB 4NKDB 4Y19A 3U30C 4C56B 4ETQA 5I75B 2PYED 4JO4L 1A1OB 3GSWA 3UJJH 2YA1A 2ZCHH 1NGZA 4OV5A 2IH1B 4FZEL 2H9GA 2IFFL 2ZUVA 3CAFA 1HWGB 3TYFA 2FB4L 2VB5A 5J3HD 4OCWH 3LN5A 5FM5M 1D6VL 5T3XL 3QRFM 4CADB 1WFOA 4JKKA 4I77L 5GS0C 1F6AA 1KCVH 4YXLL 4MXWH 2NTSP 5T1LB 3K80A 5HBBA 4GRWB 5B38G 3W82A 1I7RB 4JVWA 1SQ2N 1WC7B 1D5XB 5EOQH 2PW2B 4X8XA 4N90E 2VZ1A 1PEWA 5CUSH 3EYSL 4O5LL 1TJHH 2J6EL 4ORZC 1YY9D 2YXMA 4HIIB 1WCBB 4PJFA 4GW4A 4LCYB 3BMVA 1KB5A 3MLUH 3OHXA 2DYPA 3OAYH 3O3EA 5IVNA 3JTSA 1RZJL 1NMCB 4NNXA 3W0WB 2VC2L 3QQ9C 5DEGB 4GQPH 3UYPA 4PJ8A 4OZIF 5F21B 1U8KA 4WHDA 1AHWA 4J3VA 2AXJA 5IMKA 3O3AA 1YDPB 3FB7B 1I9JH 3CIQA 3KPLA 3ARBA 4JFDD 2ICWI 1FGVH 1ZSDA 1INDL 1CD0A 4L8BA 5E7BA 4MA1B 4OD1L 4XPAH 3QUMA 2IBGA 4ZS6D 3RI5F 1YUHA 3MJ7B 5DJ2A 4LIQL 2DQFA 2FLRT 4IS6A 4X6DE 2VIRB 3MROA 5AUMB 4MCZA 4FFVC 3GMRA 1PLGL 4JANB 4AEFA 2V9RA 5E8OB 3SN6N 3PGCA 4C59B 4ZOBA 1AXTH 4S2SB 2ZOKB 3LKQB 2B20A 4X6DA 4I48A 4Z9KB 1U8MB 2NR6C 3CDCA 1GZQA 2ATKB 1N3NB 1NCWL 4F7MB 1YMHB 3IKKA 1R3IH 1QA9B 1QRNB 4LSPH 2XQYK 1TXKA 2R4RH 1LWRA 2J4WL 2HVJB 1CE1L 3ESVF 4FFWC 4NYLB 4E5XB 5IV2B 4QHUB 4HUXB 2IGFL 4S0TD 1F3DH 2BNRE 1JPGA 5EB9A 2G9HA 4YHLL 1U9KA 4V1DA 4MS8D 4G42A 2CRZA 5E99L 4XP4L 2NY0D 5HDOA 4JKPH 4WI9A 2ADIB 2EH8H 2DQGL 5B3NA 5D1QD 4JRXA 1J05A 1PZ5B 5T1KA 4CJ1A 3CSGA 5DLMH 4JG0H 1X5IA 4QXWA 1OWWA 3HZYB 2Q7YB 4EUPB 3G6JB 4LSTL 5HHXL 5C09E 1JK8A 4JFYA 2NY4C 1A7RH 2A83A 4PJBB 4YPGB 1X5XA 2GTWA 3PWLB 4HKJA 1A1MB 1XGQA 1UGNA 2D31A 3NA4A 4RMUA 3GBNH 3RPIA 4OCRH 2Q6WA 5F9JB 5LGJB 1RZIB 1LK2B 4PG2A 4AMKL 4G6JH 5C09A 2D4DA 1T4KB 1DLHA 2R1YB 3S5LG 4EBQL 4P9ML 2YSSA 5D5MB 2EEDA 2OP4H 4YHMH 1ZA6B 3NFSH 4YIQA 3L95B 4CNIA 2DQTL 1KPVA 4ZFFB 1YEFH 4DK3A 4GXVL 4POUB 5CZXC 5C0JB 4PGCA 2BC4B 4PP2B 5FAAA 3QCVL 2BFVL 2CJUL 4YDJB 3BZ4A 4C56D 3MRPB 4H20H 3VXTB 1MY5A 4PREB 3SDCC 4HLZH 1OB1B 1M7DA 3PWPE 3O4OC 3L6FB 1H0DA 2V5MA 1GGBH 3Q6FB 2HAZA 5E0QA 1DE4A 5IB4A 1A3LH 5EBLB 5FECB 1LK3H 1TETH 2FEDD 2QQQA 4YBQC 4DAGL 3E8UL 3U7AA 5GZOC 1N64L 4GRWF 5T1LD 4HCRA 4JGMA 1Q8MA 5IW6A 3F12A 4Z0BL 3EOAA 5JW3L 3TM6A 2KPNA 4HXBH 1MIMH 5ESVB 4G5ZL 5ID0B 1DQQA 2BOBB 4XBPA 3CFIC 1IEAA 4IOIA 3C60A 1KBGH 3RJQB 3W0WD 5IFAL 3TIDA 4D2NA 1KG0A 4OLUH 4I18A 5GS3A 5DO2C 4HS6A 5ID1A 3OKKA 3KYMA 1Z2KA 2O5XH 1DFBH 5I30L 1HHKA 3U4BH 4J2XA 1OLLA 3VCLB 4XWOD 3LRGA 1S7QB 3JV5A 2W9EL 3QH3B 4M8QA 5CBEB 3DGCR 1CFTB 8FABB 3AB0C 5TDOA 3UTSB 3DBXB 4X98A 3FT3B 2CUHA 4PJEE 3NCEB 4QRTB 3C9NA 4JJ5A 4GUPB 4ODXA 1JPFB 3ZTNL 1KJ2A 4XMKL 2NLJB 1JZ4A 1CFVH 1U58A 1VEMA 4KGJA 2W9LA 4Y4KC 3SE3A 1M05B 4HUWA 5M7QA 1FGNL 1OAZH 4QYOA 1GRWA 5BO1L 1RUAL 4PJEA 1FVCA 3C2AH 3BKYH 5FYKL 4H0GA 5C0DB 2ZNXA 4P2YA 4JFHD 1VESA 1IGFL 4P5TA 3I85A 2DKMA 4QRSA 5IVXA 1BLNB 1HE7A 1QRND 4I2XA 4C58B 3QUMH 1QFWH 1A64A 1SBBA 1QFPA 3OKDA 1MVUB 1Z0MA 1W0YT 4DOHE 4B5EA 5JA8B 2C3VB 2ENSA 4ZFZA 4F2MB 3GMPB 4KK9C 5FCUL 3D0LA 2X9YA 3G5XB 1YJDH 1QSFB 15C8H 3FQXB 2GCYA 4F57H 3GI8H 2H26B 3KPNA 2O61B 4XTRC 2CIKA 4AEIH 2YN3A 4Y4FB 5FYLL 3SKJL 2XN9E 5E9DE 3MJ9H 2BCKB 1ZHKB 4L4TE 3HE6B 4UI2A 1NUNB 4XI5C 5D2LA 4UIMA 4NUJA 5CSZA 3HMWH 4MAUL 4PJBF 1JHTA 5GRYA 4CDHA 3OX8A 1F4XH 3BPLC 3WNPA 4H1LB 4CKVX 2R56H 3MLYH 5E9DA 1MWAL 4GXUN 4LCCB 1WZ1H 3GMNA 1UWEL 5FK9A 2G2RB 5IFJA 3QUYA 4PBWD 3QDMB 4HDIB 5E6IC 5DJ0B 4UT9L 4H8WL 2PR4L 4KTDL 3RNKB 4IMKA 2HLFD 4F7TA 1E6JH 1MCHA 1K5NB 3H3PH 1QVOB 4LDEB 4FNLL 3BDBA 3VG9C 3RWFA 5C07D 1DQMH 4HK0B 1ZLWH 5L8JB 1IKFL 2CKBA 4NQDB 4FQCH 2QKIB 4NPYA 4LHUB 2CO7B 4HIXH 3RWDB 4E41D 1NAML 1JZ2A 5LCVH 3MXWL 5HYJB 2X1PA 2YS4A 4RFOH 3WCYA 1OTUD 2AJXH 3S88L 2HVKA 5C2UB 5LVEA 1FVDA 2ED9A 2DM4A 1JUFB 3F7QA 4D3CH 2PCPA 2Z31D 3KPSA 3LPWA 5F7WC 5I8OH 4M6MH 4HLJA 4WW1A 3GBML 3O0RL 4LRIC 1ACYH 3EYFB 3M07A 1T1WB 3RGVB 4KAQH 3D1MC 2DLTA 4I9WD 1NCCL 1X6NA 5DGQA 1DVFC 3LOWA 1I85C 4PD4J 4Z77A 5D6DA 4N8VG 5GJSH 1T04A 3BH9B 5CIPB 4MDJB 4XVJL 2FATL 5A2FA 4PJ5B 1MNUH 1P84J 3VH8A 3EYVA 4NOBA 2AJYL 2VR5A 4HCRH 4ONOA 3J8F7 4PTUB 5GRVK 2EDBA 1FFPB 3RVWC 3SGJC 2X4TB 1OGTB 3UTSD 2VXQL 3P0YL 1HHJA 3MRNA 1J1XL 4O2EB 3ZE2F 2ATPA 2C1OA 3IRZA 2YMXL 3FOMA 2X89D 3UPRA 2P43B 3QCUH 1ED3A 4Y1AB 3LQAH 5DUPL 2NY2C 3BXNB 3CH8A 1E6OL 3KLDA 4L8DB 5D9SB 1QEWB 5D1XA 1CXKA 4QNPE 5C0GB 5KVFL 1IAOA 1EXUA 4QY8A 2VQUA 4NC2B 2AAVA 4E42A 1BBDH 2A9NL 5ADOL 1EHNA 3VE0B 1MSPA 4LASH 1F90H 3C08L 1I75A 3IFOB 1A0QL 4G7YH 3RKDC 1UM5H 1WFTA 2VXSL 5DD6A 3UTQA 5C0RH 3LS4L 3ET9F 3OL2A 3JWOC 1QSFD 3BIAX 1QSEB 3L3IB 3LS5L 1TVHB 3U46B 3IKCA 4PG9A 2CQVA 2RAMA 4P4RB 4HKZB 3V0WH 4GAYA 1E4XH 2QLVB 3EKCA 3PWPB 4Y4FD 3TZVB 2FRGP 1ACZA 2BNQB 3WMSA 4Z7VE 5ISZA 1HCFX 3HE6D 1AKJA 3ECBA 4K23H 5DD3L 5HYIA 1A14H 1U8PB 2IMMA 4R8WH 3P9WB 3RWGB 1CS6A 1I1FA 3NZHH 4XX1E 4WV1A 5SX4I 3BH8B 2P5WB 1XZ0B 4J4PC 5KW9L 4QRRB 1L7IH 3R1GH 3MRRB 2PXYC 3QDMD 4PYGA 1YEDB 5HI4D 5ICZB 1VEPA 4KY1H 5AZ2L 5HGAA 2C9AA 1K4CB 3H2WA 2B39A 2R69H 2ITCB 2Z8RA 2BSSB 3RIAK 1JTOA 2C3XA 1U8JB 3JUZA 3QIWC 1E27B 4G8GE 1BP3B 1NQBA 5JNYB 5JOFA 3C5ZA 3O6FA 4NQDD 3JBG7 1MPAH 1ZLVK 4NFBA 1ZTXH 3P0GB 3HNSH 3S96A 1FAIH 3DXAE 4P99A 1TLKA 3BT2H 2ZUTA 3P4MB 3LKSA 1KCSL 1PZUB 1BPVA 4G8GA 5HYJD 2GJ6B 1SMOA 1B90A 3K7UA 4KDTA 1G7IA 1FSKC 2QHRH 4HKBA 3WNNA 3V6FB 4DN3L 1XR9B 2P24A 2WLYA 2Y1VA 1JGVL 5FOJA 1N2RB 5IGXH 2R29L 1NLBL 3U4EA 4JM2B 4LPYA 2XNAB 3QZWB 3LN4B 1P2CA 3GO1L 3IF1B 1EH9A 1PX4A 1G0YR 3H42H 2I07A 3MNZA 2Q76B 1EMTH 5TDNA 2NY5H 3B3IA 3L3KA 4X7SH 3OXSA 4R7NA 4PGEB 4ZTOH 3ARFB 1BX2B 1ZKAA 2JJWA 1KCUH 3LMJH 4M7LH 3NA9H 3RGVD 3QXAB 4Z76B 4U2ZA 1C5CH 3ZE1E 4MWFB 4IRJB 3O3UN 4QF1B 1WBYA 4BH7B 3T4AA 3H7BB 4XCCL 3U2SA 3CVHH 1D5ZA 4PJ5D 4DOHB 1CT8A 2EDYA 2BNRD 3S4SA 4U4BA 5HDBE 1E0OB 1NLDH 1YNKH 3MLWH 4JFFB 3ABZA 4G43B 5I1GL 2FGZA 1QBMH 4N9OB 2HWZH 4HPOH 3ARUA 4P49A 4D9QD 4NUGL 1SEQH 2FCBA 2XN9B 4U7MA 2Z9TA 3KPTA 2GK0A 4FFZL 1AD9B 3EOBA 1MQKL 2VZTA 1TPXC 5I8KL 3GSQA 1IGTA 4OLXL 4Y1AD 1KT2A 3ARVA 3QI9B 1MLBA 5I16A 1V7NL 4UILL 2VDKL 4TVPL 1BFTA 5FO8A 4P3DB 2W65A 5E8NA 3T2NL 2OZ4L 1IGYB 1RU9L 5IG7B 4IRZH 4WEBH 1NBVH 2A73A 5JW4R 4O4YH 4D0CB 5I1AA 4EVNB 5CSBA 1TJGL 4KMQA 4UBDC 3DARA 5C0AB 4XP9H 1ORSB 1F3JA 1KFAH 4LMQE 2ED8A 3MRHB 2P5EB 3BZEA 2DI8A 4XVTL 3P4NB 3FQTB 2GEEA 1LE9B 5E8PB 2PW1B 1BJ1J 1IAMA 3HZMA 3DV4A 4PLJD 1QSED 2CMRL 4NNPH 3U9PH 5IWLA 4XC3L 1W8OA 4WVRA 3WUZA 1HH9B 5KZCB 2BNUA 1PEZA 1A6UL 2A0LC 5ITFB 2VR9A 1RJLA 5CJBA 2OR9H 1AQDA 2FL5A 1QFUL 4MJIE 5DEFA 3TEUA 3PWPD 3MRMB 1R5IA 3TZVD 1E28B 1DBJL 2BNQD 5HI5C 2X1OA 3FO0L 3MLTA 5GRUL 4GRLB 3WNOA 4OLWH 1YNTB 5ICYA 1R24B 3P4LA 5JHLH 5BJTA 5I6XC 3A67L 5FGCB 4AIZB 2EIZB 5DFWH 3RI5K 3S3SA 1FPTL 4OCSL 5DQJA 2JJSC 3WN5C 1CK0L 1RIUH 5L0QC 1UZ6F 3JWDL 3O4LB 5ERWA 5E2TH 3AAZA 4KHXH 3KNBA 4LSVH 3GKWH 4QRRD 2FYYB 5C0FB 1JRHI 3QDJE 3ARQA 3QHTC 5KG9A 4KKNA 1MCEA 3QUKA 1P7HL 2DD8H 5JDSA 4N9GB 2F5BL 2P44B 1HN1A 3LRHA 5ITBL 5I1JL 2VLME 2XTLA 3KPOA 4JZNA 3P73B 4HWUA 4RAHA 4LF3A 2VUYA 1JWMA 2JELL 3QXDB 2DQEL 5FHBL 4OZHA 5KSUA 3QFDB 1KEMH 5ADPH 4PJHB 4XB7A 1A7QL 3QNXB 2VAJA 1T1XB 3QDGB 4M6OH 3CVIL 3HNVH 4GKZB 4JFPB 4OZ4B 3FZUD 4RAUB 4JM2F 2X05A 4G8EB 4JM2D 2NYYD 2GUOA 3H9SB 2DQJH 3RRQA 1NCBL 3W5NA 1MF2H 2XG4A 2OTPA 4KKCD 5C0NC 5E2JA 2UZYB 1G9NH 4XP6H 3EOTH 3ARFD 1GJIA 3HC0B 2P1YA 2YD6A 4WTWA 4XNQB 4HX1B 5EA0H 4J23A 1HHGB 2VXTL 3TBSA 4HG4K 4IRJD 3KYNB 4KJWC 1NMAL 3O2DL 4ODUB 3ARRA 4MNGB 3L7FA 4MA7H 1O5DT 2IAMA 2HTLD 5DGRA 1FZKB 1MFBL 3DYPA 3QQ3B 1OAYL 3ULSB 1HK6A 5CEYA 4PP1D 5SWQB 2GSIA 2F8OA 4DZ8B 3W9EA 1C08B 4JFFD 3D9AL 4WGVB 5TE6L 5KVEL 5DF0A 3EFFB 5J6HA 3QUXA 4S1DC 4L5FL 4EQ2A 1G6RA 3KYOA 5J06A 2XN9D 3QNYA 5JMRA 5CMAB 1VERA 5ACZA 5C8JB 4H5SB 4HJ0D 4L4TD 1RK1B 4JHWL 1C16A 2W1NA 3WEXA 2CGRL 4X5XB 5FO7A 4HV8B 5HHOE 5C0CE 1QR4A 4J3WA 2GI7A 1F6FB 2PYFB 1ZHNA 3G04A 1OQOA 6CGTA 4R7DA 3RL1B 4FHBD 4NKQB 5EC2A 5HXMA 2WBJB 5L7XH 2FEEI 5K59F 5FUZH 1BVKB 1NGWB 2LVCA 5C0AD 3OAZH 1DUZA 5C0CA 4HZLB 1H3WM 2P5ED 4AG4H 5E5MB 3TNNB 3SGEI 1L7TL 5ETUA 3KXFE 2H2PD 1VFBB 1WT5A 4UT6H 4PJ7E 1AJ7H 3MOAH 2EZ0C 5GS0H 2AEQH 3WIHA 5BQ7A 5C6TL 1D5IH 4HWBL 4ONFH 4OZGF 4L4VA 4LNRB 3GHEL 5KZCD 1QLFA 3LKRB 4KPHL 5KSBE 1UWGL 1X5ZA 3BP7B 5MEOB 2APTA 3DXAB 3M1BB 4U1KA 4DZBB 4HGKC 1HWHB 2HN7A 3VXMB 3GM8A 3VXSB 1KF9B 1NMCC 1S5HB 4G8FB 4RRPA 4KDVA 5MEPB 4ZQKA 4L29B 4GRLD 1BOYA 4Y4KA 4K2UL 5KSBA 3G5YB 3HI6H 5CGTA 4KRPB 1A02N 3IGAB 4PRNB 1MRCL 1CD1B 3IJYA 3QXUA 1NMBH 1XR8A 3IDJB 2ZUWA 1T7ZA 4KK6C 2A74B 3DSFH 2D7OA 1DEDA 2VMFA 2BVYA 2Y6SD 5T3XE 3ALXA 4KZDH 4Z7UB 3VG0L 4LLUA 1S9XB 2LABA 1AFVL 5TF1L 1X5KA 4BH8A 4AEEA 2AJUL 4KVCH 4U6YB 4NZJA 1BAFH 4Y5YC 1BD2A 1XGYH 1I7ZB 2AK1L 3CMOL 4Z5RA 3QB7C 3MODL 1QBBA 2R2BA 3KYAA 2R2EA 1LO5A 2IG2H 4QOKA 5D1ZA 1J0KA 5J11C 2NY1B 3RA7H 3CXHK 2FX8H 3ZYOA 3QDGD 1UA6H 4LP4A 3VRLE 3WFEL 4RISL 3BKMH 1J7VR 1MOEA 1CI5A 1V8HA 4A2MA 4OUUA 2J6EA 4U1JA 1FE8H 3H9SD 5EC1A 3ARPA 1QYGH 4U1NB 1F97A 2QSCH 4RIRA 1FG2B 5I2IA 1FZJA 4ZTPL 4L8CA 3FQNA 4R4FL 4MA3A 4E0RB 2V7NA 2BY1A 2R0ZL 3HAEB 5IKCA 2XA8L 5D8JH 4JFEB 4HF5H 4HAGA 4LIQE 1F58H 3RWCB 3LDBB 5H35B 2CXKA 2ADFL 3V95A 2GFBB 3LPFA 1NGPL 5T3ZL 4XNUH 4OF6A 5JXAH 1T22A 2NZIA 2OMBA 2RGSA 3RTQA 1PAMA 3TO4B 2YEZB 3UPAA 1CG9B 5F1OB 1HILB 5DDHA 2YK1L 3SY0A 3U7WL 1JNHA 4B7LA 1ZEAL 1JNNH 2FHFA 4UIKL 5MENE 1RZFL 4NZRL 3VFUB 3SO5A 4P2OC 1YN6A 4BQCA 1I3RA 2P47B 5AWNL 3MRFA 4JB9H 2ZPKH 1MI5A 4RA3A 5CEZD 1GZPA 1HSBA 4N5EC 1KPUB 2CK0L 4ONHB 4CVUA 1HCVA 4P5MB 3U36A 3WO4B 1V7MH 3PL6A 5EOCL 4IIQA 1ZT1B 1NAKL 2HH0H 4A6YL 1XIWC 4LRIA 2RFXB 3EO9H 3OKEB 3OKLA 1RZKL 4XB8A 4H0HB 2FNBA 3OTTA 2WBJD 1G7LB 1DVFA 4OZFA 4WI4A 4LL9A 2AEPL 3ZSTA 5GGVL 3RX5A 2J8UF 1G6RH 1DANT 2AV1A 2PO6B 5JO5A 1JNLL 3TJEL 4PJ9B 4D8PA 1INQB 5DUML 4RQQA 3DX9A 2OM5A 4M9OA 1H3PL 4ZO9A 2ESVE 5CWSB 3V7MA 4UINH 1U8LA 4GG6F 1Q9OA 1RUML 1A6TB 1JYWA 4X7CC 3ZSSA 5F70A 1DBAL 3OZ9H 5CZKA 3QP3A 1TVBA 1FO0B 3V5DB 3SGJA 2W0FA 4ISVA 5DJYA 3MV8A 3DXAD 4DCQA 3LVEA 4S1QL 4KC3B 4AENA 1IEHA 2DWDA 1VHPA 2G5RA 3VXMD 4XAWH 5E1AB 3VXSD 2YD9A 4K94L 4UQ3B 3QEQB 4P59L 3TF7C 3B9KB 4MAYC 5CBAA 4P3CL 4EIZC 2I9TA 1JGDB 4UUJB 4Z0XB 2YC1B 1A4JA 4LEOA 3D0VA 3CDFA 3JZ7A 1BZ7B 5EWIH 4YHNB 5CP7B 4R96B 3SCMB 1BJ8A 2E7HA 5K9OB 2F58L 1TIUA 3ULVF 3NCMA 4Z7WA 3V6ZA 3ULVD 2R0KH 4QRPB 3BMWA 4Y2DC 5B3JF 4NO0B 1WK0A 3SDXB 4ZUWA 5CEXB 3I6LE 1JYVA 5BZDB 4GOSA 4ZO8A 5I66B 4PJDE 3BUYA 3RJDA 3EYOA 5DK0A 4KDWA 2MJWA 1NJ9B 2MPAH 3BZFB 3DO3A 2NY1D 5IIEB 4LLDB 4M7LT 4MXVE 1CVRA 5EH1A 3P9LB 5BS0E 4WI3A 3ULUD 5JHDE 3HUJB 3GMQA 5GRZA 4G6AD 4C4KT 4ZPTB 1CGSH 5BV7L 2QQNH 1ZWIB 5HDQL 5CJOH 5DK2A 5HPOA 3Q5YA 4MJ6A 1WF5A 4MX7B 1X5AA 5BS0A 2BHZA 1CQYA 2DL2A 4HC1L 1I8IB 3T0DA 4LQ1A 1GAFL 4I77H 3O41A 3RDTB 3SKMB 3D2UA 1ZHLA 4UTBL 4JFED 2VLLA 4WFFD 1A7OL 2R1WA 2Q3ZA 4M62L 1IGMH 1B0GB 3HNTL 3U7YH 5HHPB 2FJHA 1MFCL 2XACC 4TYUA 5DUBA 3TO4D 2Y06H 4PRDB 3N85H 2OL3A 4DUXA 3PIQA 5F1SA 2H45A 4NHUB 4RZCB 4XCYA 4BZ1L 5A3ID 5JUEH 1I7TB 2Z92B 3CX5K 3U0TA 5C08E 1MVFA 4RGMB 4TNWF 2FZ3B 2XKSA 1W8NA 5AZEL 3NFNA 3OGOE 4CMMA 1RJYB 1CDUA 3PWNA 2H2SC 1ITBB 1MHHB 1WICA 2Y5TB 2VSDA 2P46B 4JLRA 3NFPA 1S9WA 3L5HA 3ILPB 1J0ZA 2IPTL 1JV5B 5CJ5A 5F97E 2YD1A 1DEEA 1FORH 3C2SA 4Q9CA 1NH6A 2F19H 2V17L 3ZYIA 2JIXB 3HR5A 1F3DJ 1AXSB 2B4CL 5MERA 5EU6E