1NFDF

An alpha-beta t cell receptor (tcr) heterodimer in complex with an anti-tcr fab fragment derived from a mitogenic antibody
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
222
structure length
222
Chain Sequence
b'EVYLVESGGDLVQPGSSLKVSCAASGFTFSDFWMYWVRQAPGKGLEWVGRIKNIPNNYATEYADSVRGRFTISRDDSRNSIYLQMNRLRVDDTAIYYCTRAGRFDHFDYWGQGTMVTVSSATTTAPSVYPLAPACDSTTSTTDTVTLGCLVKGYFPEPVTVSWNSGALTSGVHTFPSVLHSGLYSLSSSVTVPSSTWPKQPITCNVAHPASSTKVDKKIEPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N15 ALPHA-BETA T-CELL RECEPTOR
publication title Atomic structure of an alphabeta T cell receptor (TCR) heterodimer in complex with an anti-TCR fab fragment derived from a mitogenic antibody.
pubmed doi rcsb
source organism Mus musculus
molecule tags Complex (immunoreceptor/immunoglobulin)
total genus 34
structure length 222
sequence length 222
chains with identical sequence H
ec nomenclature
pdb deposition date 1997-08-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1nfdF02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1nfdF01
5CMAB 1OT2A 4NFCA 3OX8B 5IHZB 2XIDA 4EI5A 1ND0B 5FO9B 2EDNA 4PYGA 3LPGA 3VFMA 2Q86A 4LSPL 1BVKB 1XF1A 1AKJA 4XRCB 1YNTB 4PJ5A 4RAHA 3WJJA 1U36A 2V5YA 2BRRL 1TQBB 4HG4K 4EIZC 1JTTA 2DYPD 4NBYB 3DX6A 3MJ8A 1E4WL 4IRZL 5F1NB 4C83A 3SDCB 1ZT1B 3ZE0E 1MAMH 1NANH 4TOYL 3QFDB 4U1SB 4WFHD 4Q58C 4HWBH 1MFCL 3MLUL 3JUZA 3IFNL 1BHGA 3NGBC 2F5BH 3O6LL 2AJVL 3E2HB 2AXGA 1X5AA 5BV7C 5EBLA 1L4IA 5I16A 4YDJA 2CDFB 1KPRA 5EA0H 5D7KD 1IE5A 4OI9A 1UB5B 3IDGB 4NO0B 1IAIM 2I9LB 2H6PA 3X3GL 2AK1L 3S4SA 4U7SA 2AI0L 2VL4A 4FG6C 4WFEE 4CAGA 1AJ7H 2Q1EA 1A22B 5GGRB 5D1ZC 3GUTA 1P5VA 3FONA 1VESA 3LEVH 3QXTA 4Z7WB 2MPAH 1KJ2H 2NY6C 1WAAA 3K3QA 2X5PA 4G8EB 3BZFB 3LIZH 1TZGH 4R0LB 3P4MB 4XCCH 4PV8A 3QSKB 4BH7A 5JOPE 1HE7A 1ZANH 3KPMB 1KENL 4N0YL 3VRIA 2X1QA 1NL0L 3ARDC 2XRAL 4UIMB 5F7WC 1ZLWK 2R0KH 2AJZB 2VITB 1ZT7B 2HVKA 3LKRA 2NQCA 3LS5H 5EZLB 3GSOB 4OF3A 3PL6C 2VNCA 3LQMA 1RMFH 4MA8H 4YBQD 4ZOEA 1MFEH 2DQTH 4QHNA 1PBYA 2WIMA 3CVHA 2IQAB 1VERA 3TO2B 1WEJL 5D8JH 3RIAF 2I07B 3PHOA 2H3NB 3DVGA 4LHUD 1YEDB 2Z31A 1MF2H 3PGDB 1EJOH 4WI7A 3STLB 1QPXA 5EC1A 3UTTB 5C0FA 4EZMA 2D7QA 1YMHB 4FZ8L 1RJYB 4M3KB 3LS4H 3QUXB 5DUMH 2NY0B 1JYWA 2NW3A 2R4SL 3BGFB 3L7EB 43C9B 4XBEH 3RVTC 1HSBB 2AEWA 3D1MC 4MS8D 4Z95L 3GO1H 4PS4H 3FO2B 4Y16A 1I8LC 4XCNB 3UJTH 3VXPB 4HDIA 3FL7A 4XXCC 1YEIL 3E6HA 4UQ2B 2D7OA 5DEZA 3MV8A 5TE4H 2XV6B 5FCUH 5T3ZD 2Z91B 1IC5H 1CDCA 4RIRA 5E8NB 2CO6B 4PBXA 2NLJB 4XNQA 2BHZA 4L4TD 1V7NL 1Z3GH 1IKNC 3TP4A 5CBAB 3HE7D 1NFDA 4HKJA 5C2UB 5K9KB 2O5XH 5JORA 5IBLC 3QNYB 2ILLA 3UYOD 3EYUL 4X4YB 4XXDB 4PJXA 3T65B 4O5LH 2CH8A 2OL3H 2A74A 3C60A 4OIBA 3MV7B 1OTSC 5DJAB 2WBJB 1XGUB 4K7PY 3SKMA 4ZNEE 4KZDL 3QCVH 5FHBH 1A3QA 2ED9A 3M8OH 3FB8B 1UA6H 1PSKL 1TTGA 1U8LB 4M6NH 5DJ6B 3MLSH 3IDMB 1YMMA 4ENEC 1T1XA 3RY6A 1MRFH 3D87B 2VN4A 1CD0A 5K9JH 4CVXA 5JW4Q 1I7RB 2K7PA 2IMMA 4PJDB 4LEXL 3TN0D 3RWHA 3BUYA 5H37H 2VZTA 4NNXB 1P9MC 3H9SE 2Q6WA 4YIQB 2E27L 3ULUF 2AJSH 4I2XB 4ZUVB 3KR3H 1OTUD 3FTGB 2E6JA 3WFDH 4MQSB 2VN7A 4X5LA 1QFWI 1G7JB 3WHE1 3VE0B 1INQA 3MRCA 2MQCA 2GW5A 1NMAL 4FQLL 3EO0A 3P9LA 4AENB 2JB6A 4UI2A 5KANG 3GDBA 2D31A 4QO1A 1TJIH 4QRPD 4NQDD 4Z5RA 3L3OA 2IAND 2YHGA 1H3GA 4X7SH 4H26A 1B4JL 4X4ME 1JHKL 2LTQB 2NY2B 1J0KA 4YPJA 1QG3A 4H0IA 4M93C 2FGWH 3VRLE 1QVOB 2VUOA 3D69A 1JNJA 2F9BT 2KQNA 2BMKB 1ITBB 3VDCA 4ONFL 4YDIH 5F7FA 4ELKA 4PJHA 3KYOA 4KKCD 4RQQB 2X4PA 1JUFB 3TBVA 3IJHA 5FYJL 2D0FA 4LPWA 1Q9LB 3BPLC 3DYOA 4UB0H 1H3PL 1I7ZA 2YSSB 3W82A 2MJWA 1SVZA 1CQKA 2A6KA 2ATPB 4TQEH 1K5NA 1UZ8A 1V3JA 4MDJA 5C9KA 2CK2A 2EKSA 5D1XB 2NY3D 1QRNB 5DI8A 3VXMA 4HXBL 1YNKL 3QP3A 1HN1A 1KTKE 1M7IB 3QQ4B 3GSNB 4JFFB 1G7LA 1ZHNA 4NJAL 1I8MB 3FQTA 3AREB 4PPTA 3WIIH 2ZNWA 1N0XH 3EZ8A 4RMVA 1S9WA 3RU8L 5CZVH 4DK6A 2CIIB 1SBSL 5CEZL 3QNXA 4F58H 5B8CA 3ARGB 4FTVD 1FO0L 4X8XA 1FL5B 4L1HA 2XYCA 3QHZL 4HS3B 1WZKA 4LPVA 5F9WB 5JHLL 4D94A 2VDML 1S7UA 2V5TA 1DVFA 1X5IA 1X5YA 4MNQD 4PJFF 5DO2C 1I3UA 1ZGLP 1UCBH 3U4BL 1XCTB 1YJDC 1I9IL 4JFED 1YN6B 4TVSa 2R9HC 3NPSB 3CSPA 2X1PA 5DJ8B 1FFPA 4FFZL 5GRZA 3HG1A 4R4ND 3BQUD 3NTCL 1J0JA 1U3HC 5LVEA 1JNHB 4KJPC 3VI4E 2ZP0T 1BVKA 1OP3H 4QRTA 4PB9L 4Y8DC 1D6VH 4JQIL 4AT6B 2HG5A 3CVIL 3KXFE 1NCWH 1D9KB 1OCWH 1V5JA 3FFCD 1D5IH 5D6CB 2OS7A 4FP8H 1B0RA 4M61B 3S3JA 5DXWA 1JMXA 3B3IB 2EIBA 4IOFD 4XWOD 1Q9KA 1G0YR 4U1SA 3SHSA 2BOCB 2VAJA 8FABB 2JJTA 1BOYA 4KRPC 1Q0YL 1JNNH 4S1DC 1NBZB 1RIUL 3HPLA 4QRQB 1MFDL 3Q1SL 5ALCL 3T2PA 1PKQE 3GHEL 4DKEL 4OCRH 5TQ0L 2CDFA 15C8L 1RIVH 1P4IL 1RUML 3IFLH 1MH5B 1I9RH 5ESVB 1KT2B 1UB5A 3LQAL 4LASH 3IDGA 4NGHL 4NO0A 5D9SA 4E0RB 2QSVA 1DBBL 3L6FB 4J7RA 5IB1B 1A6ZA 2JCCF 3CX5K 1F3RB 2CK0H 4QRRA 5CP3A 1K2DB 3QEQA 5DA4A 3R0NA 5GGRA 3L3HB 3D39E 3MNWB 5T1LD 3F62A 5TE6H 4GAGL 4JR9L 2B1AL 2I26N 3F7VA 1A9EB 2QQKH 5I1AA 2VR4A 3EYOB 6CGTA 2R2EA 3BPNB 3P4MA 3E0GA 1FN4A 3HI5L 4GKZB 2L4OA 3KPOA 1KELL 1KPVB 4LCWB 3NOIA 3KPMA 4GO6B 1VHPA 4KI5C 2QKIA 4XPHL 1KLFA 2UYLA 2P24B 4ZTOH 3LPWA 1KB5B 3MV9E 4JKLA 5T1DH 2X89D 2PYFB 4RAUB 4NO3A 1RUKL 4X80L 1CVRA 5T5FH 4G9FB 3W0WD 4O02L 2FX9L 4FG6D 1W8NA 3T0WA 1Q94B 1GIGL 2VITA 3GM0A 1ZT7A 3QJHA 3GI9L 4MXWL 3HZYB 4MSWA 1OW0C 5D1ZD 4C57C 4CU7A 4JO3L 5EZLA 3GSOA 3MLZL 1IGIH 4P2RB 1J86A 1QR4A 5DUPH 4HIEB 2DJUA 4IIQC 1T7VA 4Z78B 5INDA 1VGEL 2AJ3B 2EKJA 5E5MB 1FJ1B 1UKSA 2IQAA 4GOSA 1F6FB 3HFML 5DYOB 3NZHH 1MCLA 1CGUA 1HHIB 2H3NA 4KROD 4WFGE 4LLAA 4HUNB 4Y89A 5CIPB 4C56E 4OZ4A 1IVLA 1N5AA 3RWGA 2ESVD 3H7BB 3ARDD 2FIKB 3UTTA 4X6BA 4WV1B 4YUEH 5I66B 3L5XL 2VQTA 3QUXA 3DYPA 2FZ3B 4XI5C 4CNIA 4ODSH 4OLWL 3GIZH 3IGAB 2HVJA 3PL6D 4PRIA 3L7EA 2PYEB 1HSBA 2WLZA 4FFWD 3VG9B 3FOMB 5CZXC 2OK0H 2IWGA 3FO2A 5TF1L 1NLDL 3VXPA 3IU3B 4F7PB 5HPMB 2WSKA 2IPUG 1N6QL 5EWIL 1YA5A 4UQ2A 1B6UA 3L1OL 1A6UH 4P23B 4Q9QL 1HI6B 4CADB 4TRPH 5E8NA 3DXAB 4NC2B 2R1XB 5GRJL 4P5TB 2DWEB 1ZTXH 2OJZH 1T89C 4XVJL 5JQ6H 5IW1B 5EO0A 5I1CH 1UH3A 2A9NH 3I3DA 1IFHL 2VABA 1J87A 1JBJA 4RDQF 5EBWA 1WLHA 1A6AB 1CD9B 4NCDA 4P2OB 1AE6H 4NQVB 2ITCB 5IR1A 2Q3ZA 3ARVA 5DDHB 3RVTD 3LY6A 5KVEL 3QUZC 3MV7A 2WBJA 5J8OA 2XPGA 1DUYB 2AABH 3EOBB 5KSVB 1FV1B 2HTLC 5DURD 2EYSB 3H9SB 1ONQA 4BQ6A 3U7WH 4IEFB 2B1HH 5DJ6A 4AEHL 4EXKA 5HHPB 2W38A 3IDMA 2ZUYA 4HK3N 3QJFB 4U6XB 3H3PH 1I7RA 3BWAA 1N4XH 4XP9L 5KW9H 2VXQH 5EUOB 4NNXA 4NNYB 3LKPA 5IBLD 2XZQH 4NHUB 5I30H 3QCUH 4YIQA 5KSUB 1FNEB 3PWLB 4AH2B 2M2DA 1OTSD 1G7JA 2W60B 3V8OA 1YECH 3VE0A 1LDPL 2WQRA 2ZG2A 3S34H 4U1IB 3MRKB 2CIKB 3CC5B 3VFSB 4PJBA 2DLTA 3GKWL 4H1LB 5TDPB 2GIYA 1BP3B 5IWLA 2B4CC 4PRNB 3VXOA 4PJEA 2Y6SC 5AYQA 3BPOB 2YD2A 1NDMB 1R3JB 4PG2A 5T1KD 1DZBA 5DD1L 2ZKHL 2BMKA 3MRFA 5CINH 3IDYB 1AIFB 4KY1L 5DHYB 5D6DA 5K9OA 5C0AB 5LGHH 2MQ3A 1DE4A 3TO4A 4JHWH 5FKPA 1JUFA 1M7DA 1Q9LA 4IJ3B 2HJFB 2NTSP 2YSSA 3W11C 1MJUL 4BZYA 1R0AL 1BMGA 4LSSL 4MAYD 1OWWA 2J6EL 1MCOL 1FCGA 2VIRB 5IK3A 1QRNA 1IL1B 4RMRA 4XCYB 5EU6D 3T0BA 3KPLB 3PE9A 4PJGF 1I8MA 3AREA 5KSAC 4J1UB 1U91B 3E3QE 3DIFB 2CIIA 5GS1C 5F70A 4M5ZL 3O9WB 1J8KA 5IW6A 3WLWD 3ULUE 4KRLB 3X13A 1EHLH 3HZKB 4U1NA 5DVOA 1PDKA 2QADB 1LO4L 1T21A 3HRZB 5BJTB 5KTEH 5HHXL 3WHE0 4D0DB 1XIWA 2FNBA 4HC1A 1WIOA 5J13C 2JIXA 4KH2A 5FYLH 3KXFB 2FD6L 3ZTJG 2Y36L 1IAII 5B38B 3MNVA 1WBYB 1GZQB 4YXKL 1X5XA 5DR5H 1JNHA 3RP1A 5HDBF 1GGIL 4AT6A 4G6JL 5D93B 1MWAL 4Y4HC 4XVTH 1AO7D 1D9KA 3SKOB 1FORH 5BS0E 1NCAL 3GSVB 4OFKA 5MEOB 2BVTA 4M61A 4P9MH 1AHWC 5CD5C 1RZGB 1T1ZB 1HXMB 3B3IA 2P45B 3H8NA 5DO2D 3IAGC 5FCSH 3QDGE 3GBNH 3QWOB 4NN5C 2BOCA 2R9HD 3BSZH 3KJ4B 3DVNB 3HAEH 8FABA 4KAQL 4LAJH 1BX2A 3BEVB 1NBZA 4PGJA 4JO2H 4OM1H 4P5KB 1U3HD 3G6JB 2YPKB 4KJPD 4YJZL 3D39B 1CLZH 1JNLH 2HN7B 5C0JB 3UBXB 4HWBL 5ETUB 5B22A 1KT2A 2QEJA 1HHKB 5I18H 4P2QE 3QWRD 4J2XA 4LCYB 3L6FA 1G7HB 4QT5A 3BMWA 3BZ4B 2GT9A 4Z18A 5IB1A 4XCEB 2VE6A 3BKJH 1K2DA 2N56A 2ICWI 2YD8A 4OAWB 4Y5XA 3QDME 5FM8A 5JR1H 2P5WB 3C5ZC 2FHBA 1A9EA 3MV9B 1F3DH 3CSYB 4HAGA 1JWUA 4MJ5A 5HTSA 1JZ7A 1YNLL 3GMOB 2J5LB 5L8LB 1PEWA 5CSZB 4KRPD 5HVWA 4H1LG 3GSXB 5A3IC 3V4VH 4HFWB 4XC3L 3TT3H 3WL9B 4NT6B 5I0DA 1AQDB 4PJFE 1KPVA 1BVLB 4O2CB 5TQ2H 4BH8B 3KDMA 4LFHG 4F7MB 1IAIH 4L9DA 3SE3A 2P24A 4KTYA 4P5MB 1W72B 4MNHB 1OAYL 3WS3A 4RAUA 1CE6B 3OAYK 5IQ7H 1D6EA 4ZPTB 5JIPA 1KTDA 1PAMA 4XCCL 3MREB 4PGEB 5IFJB 3CLEH 4KQ4H 5J57B 2DLFL 3RRQA 3UTZA 4EN3A 1ZANL 4B41A 4U1MB 3ILQC 4G43B 4PGBB 2XA3A 4X5WA 3PABB 2PTUA 4Q74A 4OSUH 3TPUB 3HZMB 5E08H 2AJ3A 5IP4A 5E5MA 5I1HL 1UM4L 2DQGL 3DARA 3LD8B 2B7DT 1HHIA 5KANI 4KI5D 4HWZA 1Z0MA 1H3XA 5CIPA 4YLQT 3SOBL 1TJGL 2DF3A 3H7BA 1RMFL 3FB6A 3MPCA 1MFEL 5JW4N 2DQTL 3DMMB 4GBXD 4WV1A 4ZFOA 5D8JL 3L3GA 3V6FB 4W68A 1RPQA 3CDCA 2X4RB 1QFUL 3C08L 3MODH 1I3GH 5HYSB 1UWEL 5A40E 4LLVA 5HHVL 1LD9B 1MF2L 3V52H 3HC3L 3LHPL 1EJOL 1PEZA 1P7QB 2JJUA 5J06A 2JCCE 4U6HA 2Y06L 1UACH 5JO5B 4MA3B 4J3VA 3AU1A 3KYKH 4P23A 3TYFB 2EC8A 3LN5B 5E0QA 4IBLT 3R1GH 4LF3A 4P5TA 3P0YL 4AK1A 4XBEL 4LGRB 5KN5B 5B38G 2F58H 1JPFB 2UZIL 1HZHH 3LZFH 1R5WA 3EGSB 4ONGH 5TE4L 5FCUL 3AM8C 3R06A 2H2SC 2PXYB 5HHME 5JW3L 2ITCA 4YXLL 4WUKH 3RZCB 3EJZC 3STBA 2HWZH 4GW1B 3ALXA 3CFKB 1FO0A 2BVPB 5ID0B 5DD6B 1DUYA 3EOBA 3RVWC 5FYKU 5BRZD 3H9SA 4KC3B 2QSTA 2GSIB 3K8MA 1FE8L 1NMBH 4MQXD 3T8XB 1RUQH 4LVOB 2OL3L 5IT2L 3OR6B 5D1QC 5B4MD 2ZOKB 5TPWH 5ILTH 3V79C 3CFJB 2A9MH 4NNYA 2QR0B 4M6NL 4YEFA 2ED8A 2XKUA 1FNEA 4N68A 4NZTH 3L3DB 4NP4H 2AK4E 3LRSB 3QUZD 4O9HL 4JFYB 3G9VA 4H8WC 2HTLD 4X4MA 4U1IA 2CIKA 1J05B 3CC5A 4HCRH 3VFSA 2AJSL 3KR3L 5DJ0A 2HT3C 5DQJB 3WFDL 2JB5L 4N8VA 3WN5B 5AZ2H 2WINB 5GHWH 1MJJB 3ROOB 1LK2B 3P2TA 3EYVB 1IC4L 4L8BA 3MACH 3WXVH 1FIEA 1TJIL 3SKNA 1R3JA 4YHPB 5TE7L 1RFDL 1ADQA 4LU5H 1AIFA 4LSRH 1HILB 4OLYH 2J8UF 1UJTA 2IH3B 2FGWL 3L3JB 1MFNA 5F96L 1JTPA 3CDGA 1IGCH 5HYIA 1LE5B 3L3IB 3A67L 3GGWA 4ODTH 3V4PL 1R5IA 3O8XB 1FYTE 4G42B 4R3SB 3QUKB 3VFPB 1IL1A 3RWIB 4ZTPH 3IS1X 2Y6SD 2Z93B 4FQXC 5FUCC 4NYLA 1FBIL 1NDGA 1M6OA 3KLSA 4P3DB 4TQEL 1U91A 1CL7I 3WNOA 4CJ1A 4JVPA 1AQKH 5F7MC 3QPQC 1T04A 4JN2B 4M3JA 1IGFH 5HYSG 1N0XL 4QGYA 1BF8A 3HZKA 1LEGB 1OLLA 5BJTA 3PDOB 3W11D 2C7UB 2VLJE 5CZVL 3JTSB 3KHOA 1BFVH 2KZ1B 1JF6A 3V5KA 3G5XA 1MCRA 4KV5F 3VXRA 4F58L 5I19L 1A5FH 2OXHA 3ARFC 3SY0B 3OKEB 5BS0B 3QIUB 3EFFA 3HE6C 3DV4B 4JZJB 2L7JA 4K8RH 4HF5H 5I1EH 3QRGL 5FYKE 1GZQA 1C5DA 3I6LE 2E8ZA 3QEUB 3TF7C 4JPKH 1TQBC 1UXWB 1UCBL 4UOJA 5DVMA 5ICZB 3SDCC 3RHWF 1AI1L 3WUWB 1I9JH 3S96B 1YEJH 2FX8L 5EOQH 2YRZA 4ISVB 4XTRC 4GMSH 3CD4A 1BJ1H 4PRHE 3MMEB 1RZGA 1PKQA 4F33B 3T3ME 1AGBA 4HXAL 3ARSA 4LLDA 4Y5VA 1QKZL 3CXDL 2XNAB 3SN6N 1OCWL 5EO9B 1I85A 3E2HC 5DK0B 5L2KE 1D5IL 4JRYD 5CBEB 4FP8L 3VA2C 1TTFA 2XOTA 8CGTA 2HT4C 1SJEB 3LV3B 2YPKA 3FMGH 3UTSD 3UBXA 4U0RB 4J4PA 5ACLA 4Y4HD 5HPOA 3B9KB 4K94L 1HHKA 1P6FA 2J88H 4PUBH 4MD4B 4NPYB 4X6FA 3DSFL 1JNNL 4YH6A 1G7HA 2XWTB 3BZ4A 4I4WB 4A6YH 1MCQA 2VDRH 3O3UN 5CD5D 5ALBH 1A4KA 4IMKC 4XZUA 2YC1B 4HMCA 1KN2H 4LGPB 1ZLWH 3S7GA 3IFLL 4R0LC 4DQOH 1HKLH 1I9RL 3MV9A 3CSYA 2GHWB 4LASL 1JPGA 4MB4A 3GMOA 3WXWH 5BW7A 2EDHA 5FGSA 2BHYA 3RUGF 1PKOA 2NY4B 1AD9B 2NYYD 4HJGB 2VDLH 5MHSE 1AQDA 5I2IB 3RPKA 4KKLC 2ATKB 4NUJA 4NKOB 4P5MA 2QQKL 3IFOA 4FS0A 4NRXB 4HUXB 4PY8I 4ZPTA 4MVBC 4PGEA 5C0BE 4NJ9L 4DVRL 1TPXB 1NAMB 5HDBE 5HI4C 4ELMA 1FVEB 4U1MA 5GRXG 4C56A 3ZHLA 2HLAB 4PGBA 3C5ZD 5A2LH 3TIDB 3LB6C 2E5EA 3Q3GA 1U58B 3DX8A 4CGTA 3UDWA 5F3BA 3HZMA 5T5FL 3BI9X 5T5NG 5A3ID 3GIVB 5CJOH 2NPLX 3DV6A 2AW2A 3OAUL 3T4YA 3C8HA 4UINH 3BKYL 2X05A 5FA4B 2NX5B 4U6VH 4DWHA 2JCCB 2NY0C 1LP9F 2OTUB 2HRPL 4KDTA 3HC0B 3NZHL 3AGVA 4BZ2H 3ILQD 4EJ1C 2VXVH 1LD9A 2GSGA 4APQC 5J11B 1RJZB 4W70A 5DZLA 1DN0B 1DQDH 2DICA 2RQ8A 5KOMC 4WWKA 1WV7T 1KB9K 1P5UA 5E7BA 3VWJD 3D2UD 4ODSL 4PG9B 1WBXA 3LN5A 5HHMB 2IPTL 1S5IL 3CUPA 1IEBB 1BAFH 1INEL 3CPLB 3SE8H 1I7TA 1JPFA 3MA7B 1MHCB 5KG9A 4R8WL 5I8KL 1XF2B 5DQ9B 5CEYA 1RV6X 3FJTA 5C0IA 4WHDA 4TRPL 4RRPG 2EXYC 2PXYA 2P8PB 1KJMB 4WFHE 3WUWG 1T03H 3CLFH 5HXMA 5I1CL 2A9NL 3CFKA 3C9NA 4WTWA 1MLCB 1HOCB 2GSIA 4YDKH 2IBZY 3QCTL 3F5WB 5D7KE 3FO0H 2N7BA 2MCPH 4M6MH 2AK4B 2Y4SA 3QQ9C 3SGJC 5FYLD 4ZUUA 2AABL 3DETD 3I6KA 1MLBA 1X6LA 4DJMA 3D18B 3U7WL 4HIJA 2QR0A 1U8JB 4YQXL 4D3CL 3QO0B 5DD0H 2H2SD 4WI4A 1G9NL 5E9DA 4OKVB 3L3DA 2WANA 3EJZD 5D2NC 1N4XL 4NWTH 4V1DB 3O6FA 2VXQL 3OGCA 5IB2B 4KWUA 3RVWD 1I4FB 5ITFB 5I30L 5MEPB 1XGYH 3GHBH 5ESQA 4QHMB 4O4YL 1ACYH 4FN0A 3RGVD 4G6AC 2LTQC 2BY0A 2ED7A 5D1QD 1BM3H 1MJJA 3S34L 2X2YA 3UC0H 1J8HD 3EYVA 4HGWA 3MRMB 5A43C 4W4NA 1CICB 4RZCA 3O2WL 1BQHA 4JM2A 4OBRA 5JUEH 1GC1C 3QIBA 1YEGH 4ODWA 4DW2L 3L3JA 1A64A 3ELAT 4HKXA 1EAJA 5D1XC 1LE5A 1JGUH 2HT3D 4PRDA 5CINL 4XPAH 3O8XA 4LPXA 2GKIA 2M1KA 4R3SA 3DTXA 1EFQA 2X09A 1LHZA 3NFNA 4K9EH 1ZS8B 4LDEB 4I0PB 3IXTB 2IPKA 2CKBL 2VLJB 5F7HA 4P3DA 3BDXA 2B5IC 3LDBB 1Q0XH 4OZHB 1ITCA 3VH8B 2YA2A 4JN2A 5T3ZE 5BVPH 1QQDB 4GG6F 5IFAH 1MHPL 3ZKSD 2C7UA 4OD1H 3JTSA 4P3CH 5IB4B 3NPSC 3EJJX 4L4TE 3MXWH 1A6PA 4NQUA 2A6DA 1MREL 5IESH 3D25A 3TWCH 2WUCL 2YUZA 1FRGH 5BS0A 1AR1C 3VGFA 2DI8A 3CMOH 4FQXD 1WGOA 4P46B 3IYLW 3TYGL 1KV3A 4DUVA 2XY2A 4GW5A 1PG7W 4MA1B 2R69L 3S88L 4PTTA 3QEUA 4U1LB 1YN7A 1UXSB 2HFGH 3U0TA 1TVHA 3QDGA 4XPFL 5JOEA 4LOUC 3QPQD 2ZUSA 3RL1B 2LAGB 4HHAB 2AXJA 5L2KB 2EE9A 4JKPH 1A3LH 4ISVA 1GHFH 5DR5L 1N5YH 3WKML 4F33A 4OM0H 5KZCD 5HDOA 1T7XA 4WW1B 2XNAA 1NGYA 3FZUC 2J8UE 4X6DF 4PJGB 3ARFD 1F2XK 1FORL 5EO9A 4P2QA 4OCWH 5DK0A 3HE6D 3ECBB 3MUGA 4P9ML 1DQLH 1NBVH 3LV3A 3TH2T 1WCQA 3OHXA 1CFTB 3ILPB 3MGOB 5DQDL 1X5LA 4HUWB 1XGTA 3QDMA 1K4CB 2APWA 2PO6A 3UP1A 2YRPA 2RIKA 3BVNB 3O4LD 3HI1B 4QRPE 1OAZH 4JO2L 4XTRD 4NQDE 4OM1L 2YOCA 2IANE 1IARB 4PJFA 2YC1A 2GTZB 3IDXH 4JPIB 3ZKMC 4LBEB 4XH2B 3C6LB 2DJ4A 3BPNC 4WHTB 3VD7A 5HGHB 4GQ9H 5I18L 2FLRT 2NY5H 5FA3B 5DHVA 3DROA 3NFPA 4JDZA 5I76B 2AERT 4XNMB 5KOVC 4AM0B 4XVUC 2HT4D 4PJAA 4YE4H 5C0BB 4JM4H 5EUKB 3MJ9L 2VRAA 1V7MH 2H9GB 4KV5E 4FQQB 5L7XL 4FA8A 1K6QH 1OF2B 2GTWB 3Q5TA 5E1HB 4QTHB 3BP4A 3CIQA 1U8HB 4HUXA 2CLRA 1XGRA 5GGRY 3V4VL 1ZGLB 1VKXB 1QSVA 2DQJL 3OG4B 1XR8B 5FGCE 1NAMA 2BSTB 5TQ2L 4NFBA 2YA1A 1MCPL 3KG5A 3UBXI 1U58A 4K7PL 4H5SB 1BGXH 4KQ4L 2K7QA 4OD2B 1QZ1A 4KKLD 1FG2B 1MCWW 4K71C 4FTVE 1OM3L 4OSUL 2JCCA 3NCYP 3CCHB 1XAUA 3FQWA 4MVBD 3U9UA 4WEUD 2OTUA 3CX2A 1T83C 4KPHH 5C1MB 3HC0A 3UEZA 1DR9A 1QBAA 4MNQE 3ARTA 3P9MB 1EV2E 4JFEE 5MI0B 3PWUA 3LB6D 3VH8G 1S9VA 1RJZA 3ESVF 3KPTA 5T33L 2DYPB 3VRJA 4NRYB 4XWGH 2OX5A 1S9XA 4Q9CA 2VXUL 5ISZB 4X6CF 4Y4FD 4PG9A 3MCLL 3MODL 1I3GL 4L4VD 4I48B 4RX4D 4JJ5B 3F58H 2G60H 1IAKB 3V52L 3C8KA 5IROA 4P49A 2HKHH 3FFCE 3RUGE 3JUYA 2IAMA 4P2OC 3BIBX 3GKZA 3G08B 2FHFA 4R7DA 2AVGA 5DD5H 3KYKL 5EU3A 4EUPB 2ZJSH 1KF9B 5DS8A 1R3HB 5J0BA 3RJQB 4KI5F 4XT1C 4APQD 4XP5H 2Z92B 3CSGA 4GXUN 3MYZA 1YYLH 1A4JB 4XP4H 3F7QA 1HZHL 3LZFL 4WO4A 1XR9B 4JQXA 4LLWA 4WWID 2IH1B 3JWOH 3BZDA 2ZZUT 3VFNA 4WEBH 3HZVA 1MI5D 5DUBB 4UZGA 4JZNA 2GAZA 2AK4A 5E94A 3TBSA 3BD3A 5HI3D 3DRTA 2XWJB 1U95A 3O2DH 5L88H 1FLRL 4DZ8B 4AYFA 3DSNA 1U8JA 1NMBL 2EXYD 3OAZH 1RUQL 2DQCH 4RWYL 1ZA3B 1A1OB 1C5BH 4OKVA 3SO3B 4LNRA 2HA1A 1IMHC 3QXVA 4YFDB 5TPWL 5ILTL 5C2BH 5JHDD 3MLYL 5J4MA 3SJVA 2A9ML 3O3BB 1IQWL 2O61A 5JW5B 3OZ9H 3BIKB 4M43H 3BKMH 2CKNA 4NZTL 4OCMC 5IW3A 4ZS6C 4NP4L 3UJJH 3QQ9D 2XN9A 1U6AL 2FEEI 2NY5C 1IILE 4HKZA 3W0WE 4KMTL 1OAXH 4HCRL 3MRBB 1RZKC 2CRYA 4PGDB 2XTLA 1CTNA 4P57B 3S37X 2HJLA 2HFFB 3IDYC 3N06B 3GBLA 4F8TA 3HPJA 4HMEA 1HIMH 2VZVA 2FO1A 1FYTA 4G8GB 4JB9H 4FOMA 4LKXA 4IJ3C 1MCCA 4PTUB 2CGRL 2BCKA 1A2YB 4GAYB 1I7UA 4HGKC 3CFEB 1RZJC 4HH9A 2ESVE 2I27N 4G6AD 5FUZH 4P9HC 2BC4B 4LSRL 4OLYL 2X10A 2NR6C 4I18B 2D7TH 4U49A 5EU4A 4D9LH 2XWBA 1J7VR 1UC6A 1MQKH 4ZOAA 4JCLA 2Y5TB 3VCLA 1ZS8A 1IGCL 4I0PA 4XNYH 2VLJA 2OR9L 4L8DA 4ODTL 5HVGB 3O9WC 4L4TB 5FM4A 3BPCB 4JKKA 3OB8A 1OARH 3HE7B 3NIGF 1KYOJ 5E6IC 4ZTPL 1RJCA 2MOVA 5I1KH 1CD8A 1YEFL 3VH8A 3RPIA 4LLMA 3HKFA 1G9ML 5D1XD 4PRPA 1KSRA 4ZUTB 4JFFD 1CLYH 4HLJA 1AQKL 4M4RA 3ALWA 3UAJC 2JE8A 1IGFL 4OLVL 1OGTB 3ZE2F 1AFVH 4PRHA 1FFQA 3K1DA 4RAVB 5I8OH 1HH9B 2R1YB 3FQUA 3CNKA 3TNNA 4OJFH 3BRFA 3P0GB 3SE4C 2J8UB 1A5FL 2V5MA 3RL1A 5MEND 4EUPG 4XVSH 3QPXL 1P4LB 4HHAA 4NC1C 4K8RL 5EO1A 3QNZB 5I1DB 1E4KC 1EUUA 2ARWA 5DZOA 4BK5A 1N7ML 4B7LA 4OI8A 5CCKH 4F7CA 5DJDB 5ADOH 5E2TH 5F7DA 4YPGB 5CJ5A 3VXTA 2YUXA 2YS4A 3QR2A 3QO1B 1BD2B 1NEZB 4ORGA 5LBSH 1AR1D 1ZOXA 5EOQL 4YHML 3EOYG 3QISA 1EEQA 1S7VB 2IJ0C 2GFBB 1Q9OB 1H15B 4QRPB 3GB7B 4NQDB 4P3WA 4LARH 4JAMA 4ZQKB 2IANB 4G6KH 3ILPA 3LAFA 3TIEB 1YYML 3T0EB 1N2RA 1WJ3A 2XICA 4WGWB 3LN9A 4YNYB 4MYWB 5B21A 1HYSC 1I1YB 1T1WA 1BPVA 1C1EH 3OAYH 4UT7H 5ITBH 2EDXA 4JY6B 2Q8AL 3V5DA 2J5LC 3IDJA 5FGBC 5IHLB 4LIQH 1JK8B 4Z77A 5HGHA 3OF6A 4PUBL 2KUTA 5ANMB 5AUMA 3CXHJ 1LVEA 4GG6E 4U1HA 5I76A 2YN3A 4A6YL 4XNMA 2CR6A 4AM0A 1TCMA 5C0BA 5EUKA 5FGCB 1KN2L 3CFBB 2H9GA 1OGAA 4FQQA 4U33A 5LJYH 2NY3B 2YR3A 4JN1H 1FVDB 1HKLL 1OF2A 5L8JB 4BSVB 3IAQA 4UV7L 4QTHA 2V7HB 2CUHA 2F54D 3WXWL 2V2XB 1U8HA 1DQML 3ZYZA 3REVA 1CTOA 5FM5O 4MX7A 5EZOH 4U7KA 2BSTA 3MJ7B 2VSDA 3OXSA 2P5EB 1S8DB 5J9PB 4FTVB 1PX4A 4XHQA 4N0UE 5EU6E 3PWPD 4H5SA 2I5YH 3GRWA 4LCWD 4GRLC 3QUYB 2SEBB 5C0ND 4MNQB 5I8EA 4X6DE 4ZYKA 2R8SH 2NY7H 1B0GB 4JFEB 3DMMC 4LP4A 4G9FD 4G7VH 4K3GA 4K3JH 5I1LB 3BP7B 3SPVA 4RFEA 1QR1B 5CJOL 4UIKL 3BQUB 1NCTA 3MRGB 1U2HA 1MUJB 2VISA 3WMSA 3EDFA 4P2RD 4MAUL 1ZHKA 4UINL 1T7YA 1X7QA 2KDGA 1IRAY 3AXLA 3CGTA 1X5FA 1X6NA 1OAKL 3AMKA 1X4YA 2ADIB 3RUGB 2DYPA 3PGCB 4NRYA 3MOAH 4DTGL 4F9PA 3GMQB 2YUWA 1TZIB 4BZ2L 2FR4B 3VMPA 2VXVL 3NAAH 3WIHA 4X6EA 1AO7E 4F37K 3RIFK 3TJEH 1JVKA 4PJ8C 5FV1L 4X8JA 5KVFH 4HIHB 3G08A 5LWYH 4L1DA 2PYED 4LQFL 4R90L 5LXGH 2BSSA 4IRJB 4WFFD 3MC0A 3EOAB 3X14A 2Z92A 4ZNCD 2DDQH 4G6MH 2BK8A 4GAFB 4ZAKB 4DFHA 3DXAD 3FQRB 4YXHH 3GMNA 4LVOC 2BNUB 3CU1A 3IFPB 3F7YB 5A2IH 3RTQC 1LO5B 3CLFL 1VGKB 3FKUS 3FOLB 1LP9B 3FO1A 4GKOA 4S1QH 2VWEC 3BEWB 2P46B 1FSKB 1FL3A 4YDKL 2VQ1B 4JDVA 1FFNA 2AV1A 1P1ZA 4YHIA 2PW2B 4OD3H 3UCRA 3LPFA 5INCA 2DI9A 4LSUH 3VFWB 1J1XL 1ZA3A 1R24A 1A1OA 4JEGB 2MCPL 3WFHB 3MYJA 2COQA 3BN3B 1A1NB 4KJWD 5MEQA 5JNYA 3W0WB 2VZ1A 2DQFA 4HV8A 5D1ZB 4OIIL 3WN5C 3SQOH 5C0EB 3TBYB 3K1KC 3BP5B 1EO7A 3OKOA 4M6OL 3WDIA 5FFLA 5IVOA 4X6CE 1JGVH 3GHBL 4NSKA 5M94B 1R3LB 4KUCD 1XGPB 4KROB 4P57A 4QOKD 4N0FB 2X7LB 2LE9A 3OKMA 1ACYL 2YPVH 4LHUA 2GJZB 2UVEA 2ESVB 4TUJB 3BH8B 5J1SC 1JV5A 3P30L 3AS1A 3OKNA 3LKOB 4XMLL 3UC0L 3E6FB 3QG7L 5DK2A 4U1JA 3ZYJA 2AXHA 2Z8VC 4F3FB 3E3QC 1DBMH 4FQJH 4D0CB 1A2YA 4LRIA 4KI5E 3MSPA 3PL6B 4X4XB 4ZS6D 2EZ0C 4FXLA 1JN6B 3PNWB 2BC4A 3ULUC 4K23H 5GJTH 5JUEL 3HLAB 2QHLA 1E6JL 5DEFA 2ZSWA 3O2VL 3I75B 2WAHA 3OKLB 1G6RA 5JPMB 3H9HB 5T3XL 4QHUB 4PLOB 2X4TB 3VXQA 5J6HB 4XPAL 1F4WH 5J1AB 2VDOH 2IALB 5IMMA 2VLRD 1F90L 2A6IA 2BVQB 4K9EL 5GISH 4HPOH 4NBZB 2QSCL 5K9QG 4AMKL 5E8DH 1NCBH 5C07A 4XPTH 2FLBT 3QIUC 2F5AL 1DFBH 1FNSH 4JZJC 4KRNA 1Q0XL 5CP3H 5DURB 2NR6D 3HMXL 4IS6B 3C5JA 5F7UA 2NZ9C 4X7TB 5F7EH 4MJ6B 4Z8FH 5BVPL 3DWTA 1OGTA 1NUGA 4NZUL 4F7EB 1TJHL 1IGTA 2XXCB 4OD1L 4P3CL 2EE2A 3O9WD 3MXWL 5HJ3B 1MWAB 5MP6H 5DFVC 4B7IA 5DEGA 1YEKH 2IADB 5IESL 2EIZB 4NOBA 5F9JB 4XX1G 3TN0A 3TWCL 5E6ID 5BRZE 2BJMH 1P4LA 2PKDA 5EN2B 1X4XA 2BNRD 5EC2A 3LH2L 3QNZA 5I1DA 1MJ7H 1X5JA 1DSFH 3KJ6H 1E4XH 4RGND 2GJ6D 4UBDC 2HFGL 5DJDA 2Y9RT 2UWEF 3V0VB 3HUJF 4YPGA 3UAJD 1IAOB 35C8L 1NEZA 1WFUA 4JE4B 1G0DA 1GGUA 4KDWA 1S7VA 1A3LL 2OLDA 2GFBA 4J3OC 4JLRB 4PIRF 5IIEA 1FC1A 4NQDA 5FB8A 1AXSB 1KN4H 2FJHA 1N5YL 2IANA 1SYVB 1XMWA 4OM0L 1PG7X 4M48H 3B9KC 4JREC 4D0BA 4PJ9A 5C70A 1J1OL 3Q6FA 4HKBB 4GG6B 4X7DC 4KK8D 2VAAB 4NCC1 1DQLL 2VB5A 2XZAH 3OKYA 1NBVL 4CMMB 3GSUB 3NIGE 4JY6A 1WFOA 3RL2B 3PWJA 4XMPH 3BJ91 4JPWL 1CIDA 1RJLB 4HUUB 1D5BA 1F4AA 2K3TA 1CG9A 4OZFA 4BJLA 5LGKA 4U6YA 3IDXL 3F8UB 2YBRA 3AAZA 3CFBA 3DVIA 3MJ6A 4MAYB 1SYSA 1KJ2B 1WTLA 3FQXA 1FVDA 4BSVA 3S5LA 4WNQA 4N0UB 2V7HA 5IEHB 1XF4B 1TCRA 2WIIB 5H94B 3KWWA 3U2SB 1HNGA 3ZE2E 3BHBA 1TQCB 1D5XB 2H26A 1HYSD 2YWZA 2BNQA 5CWSB 4ODUB 4ZSOA 4YE4L 5CJXC 2P5WD 3UPRB 2H41A 5DLMH 2CXGA 3PWVA 4X6DB 1K6QL 1S8DA 3EOTL 5IBTH 4FTVA 1TVDA 3U7AA 3MRJB 3BPLB 4HZAA 3HS0B 2SEBA 3GNMH 4LSQH 4MNQA 4M1GH 1CU4H 4QY8A 4WJ5B 3WS6A 2DWDB 3G6DH 5GRVL 3RJDA 3KPPB 1TZHA 2JJSC 1E4JA 1BGXL 3C6SA 3GJFA 3T3PF 5HHNB 3DHJA 3P4OA 4HULB 1NFIA 1NKOA 3BQUA 2VUYA 3N1FC 1MUJA 5F97E 1F3JB 1S7RB 5J11C 1QLRB 3NCYS 3BFOA 3IKCB 4NO2A 4POZD 1AO7B 2X41A 3WIFB 1JI1A 2A2QT 3FFCA 3PIQB 1MIML 3RUGA 4LSPH 5CHNB 1NGQL 1Y18A 4KPHL 2CRZA 3GMQA 3DUUA 2WUBH 4GRLD 4Z7WF 1TZIA 3MOQA 4OUUB 2BRRH 3DYMA 4R4FH 2FR4A 2HLFD 3DMMD 1E4WH 1PJ9A 4IRZH 4J8RA 3MO1B 2W07A 1A6TA 4HPYL 4PREB 1EEYB 2ADJB 2AXFB 2FJGA 4TOYH 3QQNA 3C2SA 4HIHA 2DQDL 4W6XB 2E9IA 1U3HB 3MLUH 1FZMA 1MOEA 3IFNH 5E6ZA 1HWGB 1AGCB 3F58L 4JQVC 1CXIA 3OJVC 4GAJL 1RURH 3D0VB 3VDBA 4MHHG 4R7NB 2HKHL 2AJVH 1VFOA 3BAEH 2CUMA 1UM5L 4JRYE 2AQ2A 5HGDB 1CT8B 3FQRA 4IOIB 3U4AA 4WRLA 3QDAA 1G84A 4GSDL 2OL3B 5T1LA 4AEEA 3UTSE 3F7YA 1F4XL 3RQ3A 1ZT4B 1RK0A 3X3GH 2AK1H 4XP5L 3IVKB 1LO5A 3ESUF 1VGKA 1YC7A 1OP3K 1YYLL 2AI0H 3D85A 1E27B 4XP4L 4Y4KC 4KRPB 1WCBA 1UZ6F 4PJ8D 1AC6A 4GKSA 1KXVC 1MFAL 3BEWA 3C5SA 2MHAB 4FNLL 5DRWB 2VQ1A 1RHHB 4Q6IB 3VI3F 4WEBL 5IEKB 2X89A 5GSVA 3TCXA 2DQIL 4IDJL 1NCUA 2YUVA 3OKKB 5CP7B 3W0WA 4X6CB 3JWDH 1KENH 3QA3B 4EIGB 5EG6C 4R9HA 3HHRB 4G80B 4N0YH 1KTLB 3QG6B 5D1ZA 4WVRA 5DFTA 2FH8A 5C0EA 2XRAH 3TBYA 3RTQD 3S97C 3TFKC 5JQHC 3CH8A 1FDLH 4NN6C 2DM3A 1CICC 4ZUWB 3OZ9L 4K3DL 2A1WL 4Z7UF 3BKML 3IETA 4YAQB 3U0PA 3UJJL 2GJZA 4DFIA 3C09C 3ARDA 3FAXA 1U8NB 1WEJH 3E6FA 4GBXB 1CXKA 3VJ6B 1OAXL 1NGWB 4NM8L 4F3FA 1MJ8H 5CSBA 5AG8A 3PL6A 4X4XA 4FZ8H 3AB0B 1GL4B 4HQQH 2R4SH 3HLAA 1FIGL 1HQ4B 2NTFA 1CCZA 1HH6A 1D5MA 3I75A 4I8DA 4Z95H 3OKLA 1T6WA 5CEXA 1F13A 3H9HA 5GS0C 4Y16D 1KCKA 2X4OB 3LDBC 4NKDB 3E8UH 1D5ZB 3KS0J 3LKSA 3MV8D 3KPSA 1NEUA 2JF1A 5E8PA 3ZZ1A 2IALA 5KS9B 2D7TL 1M4KA 1IZKA 5TF0A 5FO8B 4D9LL 2DKSA 4LVNB 1V7NH 4XNYL 4ZFGH 4H88H 5KVDL 2EZ0D 2EC9T 2E7LC 4P46C 1I8LA 3EYUH 4XP1H 5I1KL 1NUNB 4XXCA 5J89A 4MA1C 4MJ6A 3ES6A 4Z7VF 1KCLA 3NABL 5F7NC 4YBLB 4FFVC 4X9IA 5HJ3A 1IKNA 4KZDH 1H9VA 1JJUA 4WY7L 2IADA 5DZNA 4OFVA 1YMMD 2ZSVB 4M7LH 3ZDYF 1B2WH 1KEGL 1JPTL 2AV7A 2F8OA 1U8KB 5JA9A 1AFVL 5I8OL 1ZHLB 5DD3H 4XBPA 3QUZB 2X6MA 5FYLE 3TZVB 1FNFA 5GGVY 4I5BB 1BVZA 4QCIB 2NZ9D 1JTOA 1KLGB 2EDLA 4JG0L 2VMFA 4JLRA 3M1BA 1AXSA 3MUHL 1SYVA 2E7MA 1EAPB 5KVGH 2ENSA 3U4EB 2OCFD 1FZJB 2KL6A 5DFVD 3NA9L 5DWUH 3ZTNL 3GMRB 4ETQA 5LBSL 1P9MA 2DL2A 4HKBA 3VD9A 2R23A 1R5VB 1WF5A 4ZPVA 4G3YL 4YHKL 5FEBA 2DQHL 2YK1L 5T1KA 4CMMA 1P7KA 4EOWH 1JWSB 3GSUA 4BFIB 2LU4A 4UBDD 1B4JH 1JHKH 2XZCL 3CVHL 3W39B 1I1FB 25C8L 2N4IA 4MB3A 2FWOA 1J8HE 4LSVL 5SWQA 1T4KA 2P42B 4L3CB 3FO9A 4ONFH 1PD6A 5F8RC 5J7CC 1C1EL 5F9OH 4NBXB 3EYQC 4O2FB 4POUB 5IJVA 4NQCD 3B9KD 1KJ2A 1MELA 2A38A 1G7QA 1F5WA 5EU6A 4XNXH 1EA9C 2WIIA 3U2SA 3P4LA 1XIWC 3ULSA 2APVA 4PB0L 3NPZB 4PJIF 1MCBA 2GCYB 5DGRA 4MJIA 2N1KA 4QRUA 4HXBH 1IKFH 5IB3B 1DEDA 1U41A 2VLLB 4X6DA 3ZL4H 4CRPA 5ICXB 1C7SA 2ZCLH 1UB6A 5IVXA 5C08D 3U9PL 4KKAC 4WW2A 2D7NA 3OR7B 4TULH 5C09A 1Q72L 3HS0A 4F15C 5EZOL 2EDBA 4ZS7L 3HUJE 1FO0H 4C4KO 1P2CA 4WJ5A 1GAFH 2DWDA 1VFBA 3MLVL 1S5HA 5EOCJ 2P7TB 1DVFD 1T7WA 5HHNA 3TBTB 4BA8A 3LSOA 4K07A 1A0QL 1SM3L 1K8DB 3IKCA 3HG1D 4G7VL 1DQQB 3VW3H 1AO7A 3ZKXC 5CHNA 3RWDB 3V5HA 5FUCE 5SWZB 3I50H 3G9AB 5JW4M 3IJYB 1KJVB 5I17B 3WNKA 3B6SB 3IRZA 3V4UL 1J0YA 5IVZB 2NX5D 4QXGL 3MO1A 1BBJA 2IEPA 1I8KB 2ICEA 4JRYB 1NBYB 4E41A 5GS2H 4XBGA 1FVCB 3MOAL 1QLFA 4KTEH 2AXFA 4KJYB 1NUDA 1UWXK 1U3HA 3UROR 2OJEB 1F02I 3UTSB 2X9XA 3V0WH 1Q0YH 4X98B 5H8DA 1RIUH 2EDEA 4WHCA 4DN3H 4R7NA 1ZK9A 3QWRA 3Q1SH 3JTTA 5ALCH 3RBGA 3GHEH 4DKEH 1ADQH 5TQ0H 5HDQL 15C8H 1AHWB 2ARJB 1P4IH 1RUMH 5JMRA 5LXGL 1P6AB 2GI7A 4NGHH 3P4NB 1BFOA 1ZVSA 3ET9F 2X42A 2DDQL 2GK0B 1A3RL 1EGJA 4KHTL 1WK0A 4QRRD 1AGDB 4LCCB 5K9QI 3O4LE 3MLWH 2WWKT 4YXHL 3P3YA 2MHAA 4GAGH 1HYRC 5DRWA 3B2UC 5DJ2B 3SO3C 1RHHA 4MA7L 3FN9A 2YD1A 4LLUA 4OGXH 1KEML 1S7SA 4NC0B 1FH5H 4PP2B 4PRAB 3IS0X 1J12A 3KPNB 3FN3A 4MGXA 3T3PE 5J6GA 1AXTH 4S1QL 4DGVL 2P1YA 4X6CA 3QA3A 4ORZC 4MCZB 4G80A 3QG6A 3DECA 5ADPL 2PTTA 3GI8L 4QF1B 3DUSB 2P47B 1XH3B 2EDJA 4X0KB 5E8OA 2VOTA 3C5ZB 2LAAA 1GOGA 3T0XA 4Y4KD 2FX9H 3CZFA 5JDSB 1GIGH 2A77L 3UYRH 3GI9H 4X99B 4U6TA 4JO3H 4Z7WE 5D5MF 1JGDB 4ZUWA 3N1GC 3VFVB 3MLZH 3BZEA 4DGYL 4GUPB 4V1DD 2OMBA 1REIA 1VGEH 1ZEAL 1MPAL 4WTZA 5IMLB 3HFMH 1OAUH 3LKNB 5JXEC 2AKRB 1LE9B 4MS8C 1OW0A 3GSQB 3RDTC 4MDIB 2KQMA 3OB0K 2QQQA 3GMLA 4I18C 5DMJB 3TFKD 3PXJA 4IIQA 3L7FA 2A6JB 3HNSL 2F74A 3RNQB 4OLWH 5DJXA 1CICD 3VWJB 3D2UB 4PRID 2DBLH 4A2LA 1DBML 1VACA 5IF0A 1JHLL 1KC5L 5JTWA 3HE7C 2P8MB 3BW9B 1KBGL 3SDDB 1NLDH 1UZ6E 3BUTA 4FRWA 4LNVA 5EUOF 5HHQB 4N0CC 4Q9QH 2R0WL 5GJTL 4MD0A 5FO8A 3VI3E 5L0QB 4XVJH 4HJJH 4L4VE 4KUCF 1IFHH 4J3SA 1MAJA 2XI9A 1F4WL 3JWNC 1JHTA 2V7NB 3IDUA 4OLXL 4TSCH 1SEBB 5BRZA 3N85H 5EIIA 3ABZA 3K4AA 4KQ3L 4YDLB 2DM2A 5D7IF 1VEOA 3HR6A 1BBDH 1T89A 2NXYC 1M71B 5EPMB 1XFPA 4XPTL 4XAWL 1A8JH 1WT5C 1FNSL 4Q9RL 2UZYB 3MCKB 4OCSL 3GSWB 2DJSA 1U8OA 4Z7UE 1QEWB 4AQ1B 1U8KA 3G5YB 1G7MB 1MI5E 3QDJD 2HH0L 2X40A 32C2B 3BX7C 1ZHLA 4U3CA 3SCMC 2G75B 3BO8B 3GM8A 3QUZA 3MZTA 3FRPA 4P46D 2BJML 4QCIA 3ZLQC 2FEDC 1WSST 1EXUA 5IKCB 4TN9A 4N8PA 4UNVA 4P4KA 3KJ6L 4V2CB 2BHUA 3LQAC 3RGVB 3T0EC 1J88A 4WDIB 5D1QB 3G5ZB 1B90A 3HAEB 1E6OH 1J8HB 3GKWH 3GMRA 5JHDE 5A16A 1MCKA 4QKXB 1L9MA 3A6OA 5C0CD 1HINH 1R5VA 5FK9B 1KN4L 4GW4B 5J1TC 5D7LA 1JWSA 1DQJB 4NQEB 1S7TB 3JV6B 3FT4B 1I1FA 5DC9B 2XFXB 1T3FB 2AQ1A 5DHXB 5DD1H 3I02B 2ZKHH 4MHHI 2V2TB 1ZA6A 5ACZB 3QHTC 3VXUD 2ZOLB 4O2FA 1ZSDB 3DURB 1KIQA 5D2NE 3B9DA 1NGPL 4M1DH 4W4OC 1C08A 3O3EB 4LLQB 3K8LA 4XNUH 1XGQB 1S3KL 1KGCD 2OTWB 2G5BB 1MJUH 4Z7VE 3GJFK 1R0AH 5J3HC 5IQ9B 3KYMB 4LSSH 1QBML 1X4ZA 1MCOH 2UWEB 3KS0H 5L6YL 3HUJB 5C8JB 3ZYIA 5IB3A 2VH5H 3C8DA 5D71L 2IF7A 2BZDA 2EYTB 5F6HI 5GGTA 3ZDYE 2E9BA 5HYQB 4Y19B 1RSFA 2DIBA 3QUYC 4FQCH 3T1FB 3CK0H 3IF1A 1IGJA 3MROB 2X70A 1UEMA 3EYQD 5EBMA 4M5ZH 4QYOA 3AVEA 2X1OA 5I15H 5E95B 2YEZB 3TCLA 4KK9D 1LO4H 2P7TA 3TPKA 4FQXB 1XIWD 5LKNA 2R0ZL 3U1SH 5KSAA 1XF3B 1OY3B 5I73B 2JIXD 5KSBB 3QQ3B 5GPRA 1V8HA 4JFFE 4M1GL 3MNZA 4ZG1A 5GS1A 4IRSC 1CU4L 1JRHH 5F93C 43CAA 1NFKA 3T1WA 1DEEB 4HLZH 3G6DL 1CGYA 1PQZA 2O5YL 3PV6A 1FNGA 5AZEL 4YXKH 5TH2B 3NCBB 1XZ0A 3S3PA 3O6MH 4KKAD 4ACPA 4IOFC 3ZSSA 1UH4A 1XF5A 4UOW1 1Z5LA 4FQHB 4G6JH 5KZCB 1CVSC 5HGBB 5BZDB 3QXAB 2GITA 2AQ3A 1NCAH 1JYVA 3STZA 5JOFA 3FT3B 2V17H 1A1MB 3ARFB 4MCYB 5MENE 1EFXB 4EDXB 3HE6B 4HUMB 1NBYA 1S7QB 3MLTB 2ICWB 2GUOB 4RGMC 1ZWIB 4IRJC 2WUBL 4JY5L 3FT2A 4WHYH 5J56B 1VDGA 4TNWK 1U8MB 4R4FL 4ALAH 4FXGB 4ZAKC 4CL7A 3IKKA 2QSQA 4X98A 5GSRB 3BWUC 5SV3A 4KAQH 1IGYB 4Y4HA 4PJ7F 5ISZD 1JGEB 1FFRA 3O4LB 1CN4A 2Q7NA 4PJIE 2C9AA 4PRBB 5CKGA 3UTPD 3MGAA 1CFSB 1YZZA 2FB4L 1RURL 5D70L 1FSKC 1QFHA 2GK0A 4RMQA 3BAEL 4URTB 5IFHL 4YHNA 2ZUTA 1T5XA 5IMOA 1KCUH 3S35L 3S36X 1CFNA 3DX7B 4PR5B 2O5ZH 5IM7B 4QEGA 1YNLH 3HAEG 4AIZA 1CYGA 4NN7C 1HQRA 5ERWA 4Q97A 4PRAA 1KG0B 3U46B 4XC3H 2Z9TA 2MTPA 1CD1B 1GC1L 2Q3AA 2IFFL 3O45B 2ZNXA 3QUMA 3H42H 1J0HA 4WI5A 4LEOB 5M95B 5A2FA 2PNDA 3MQIA 1OAYH 3DUSA 1L6ZA 3C5ZA 1MNUL 1HSAA 2F54E 2J4WH 2DLFH 2HP4A 5H35B 1T66C 2QHRH 3SKUD 4KROC 2DMCA 3JWDL 2W65A 1JGDA 3G5VB 5SX5H 3B2UD 4JANB 1N3NB 4IDLA 3JSSA 3D0LB 3RWFB 4E5XB 1BZ9B 5B3NA 5EOCH 3K4DA 1NGZB 4JFQA 4M7ZB 3TH3T 5I1HH 3PWPE 1UM4H 3REWB 3LKQA 3D3VB 2DQGH 1FDLL 5CJ8A 4LCWE 4I3RL 4DAGH 3Q6GL 3TJHC 4HC1L 3SOBH 4FFWC 1TJGH 2XG5A 1WITA 4YWGH 2LU3A 4S11A 1U8QB 4JRXD 1G9EA 4G9FE 2YXFA 1AY1H 4I0KA 2EO9A 2A6JA 2YKLL 1PGRB 1QFUH 3C08H 2ADFH 3V7MA 1UWEH 3WNPA 3WDHA 5HHVH 4Y4FB 4P2RE 4BZ1H 4L4VB 1MJ8L 5HHOB 3HC3H 3MRQB 3LHPH 4W6YB 4E42A 5HYJA 2P8MA 4G8GD 2Y06H 4UQ3A 5FYJD 4MQ7B 4HQQL 5HHQA 4FQ2H 3P0YH 1JF1B 4FZEH 5JXED 5L2JB 3JBG7 1EEZB 3BESR 5BQ7B 2EH7L 1F97A 1L0YA 4MNGB 3RDTD 1XT5A 2UZIH 3E8UL 4APQB 3PG2A 4DKDC 4JHBA 4JFOB 4DK3A 4M7KL 4DZBB 1CFQB 3TESA 3O11A 5JW3H 4Z7UB 4YXLH 2PYEE 4G8FA 5LCVL 3QEGH 5CEZD 3WSQL 4CN6A 4ZFGL 1MI5B 2FGZA 4H88L 4WFFE 4ZO8A 1SY6A 3KLAB 5EPMA 2CDEA 5DHVH 1NCCL 3FHQA 4WIQA 1B0WA 1F6AA 4M7JL 4LCUB 1N8ZB 4N0CD 3MCKA 4GXVL 4XP1L 4F2MA 1FE8H 3GSWA 4Y2DC 4JG1H 3DXAE 5D5ME 1G7PA 3MX0A 4WI2A 5IT2H 4R26L 3AM8A 1JCKA 4X5XB 1TMCB 2RCSH 3G5YA 2RR3A 5F44A 1W8OA 4UNTA 3S98A 1VB9A 1B6DA 4NQXB 5T1MA 3BO8A 1N0LA 2D03L 1AGFB 2QQLL 5JHDB 3BMVA 4H0GA 4M7LL 3HNTL 4N9GB 1B2WL 4P4RB 5T5NF 1BIIB 1FGVH 1Z6JT 5TDNB 1H5BB 4EQ2A 3DO7B 4YHLH 3CH1B 4WUUB 4NQSA 1NGXA 1FFOB 4O9HH 5EOTA 2NXYD 3EYFB 4M6AA 5DD3L 1NFDF 1T5WB 1P84K 4P99A 5D1QA 3G5ZA 3F6IA 4G7YH 4WI8A 1J8HA 3EDEA 5GS2D 2DQEL 3IU4H 4PJXF 5FK9A 1ORQB 3GMPA 2JB5H 5F8QC 3F7PC 2UUDH 1DQJA 5EUOE 1BD2D 1IC4H 2AEQL 3JV4B 3JV6A 5D2NB 2R39A 3SCMD 5KVGL 4Z9KB 5DWUL 5EU5B 2XFXA 3BT2L 3TNMB 1SEQL 2FEDD 5TE7H 1RFDH 4A6YB 1EIBA 4Z7VB 3B2VH 4JFHD 2V2TA 2CDGB 4MAYC 5F1IA 3QXDB 4QOKE 5ACZA 3GBML 4EOWL 2DM4A 3OJDB 3R0MA 5IG7B 1ZSDA 1Y0LB 3DURA 5KBNC 3T0ED 3NFSL 2BVOB 3O3EA 1TQCC 2EEDA 4LLQA 4ZFOL 5F96H 2VERN 5D7IE 4K3EH 3WO4C 3VFRB 2OTWA 3A67H 3IAPA 4UDUB 3KYMA 4H25A 3V4PH 1MSPA 5F9OL 5IJKC 4MLSA 5C8JA 3L5WA 1BWMA 3WLWC 2Z35A 3WYRA 3AY4C 1OB1A 4X7EC 3WE6A 4JVUA 4XNXL 1FBIH 3KYNB 4EBQL 4ESKA 1WZ1L 3BH9A 5K59F 3T1FA 4Z76B 3WEXB 1DDHA 5H2BA 2C1PA 2Z8RA 2E8YA 1QHPA 3PHQA 2LV4A 5F89A 1IKFL 3W9EA 1LO2H 3ZL4L 4OCXL 2BY2A 2VLRE 2ZCLL 4GH7B 4BSWA 3F12A 4FQXA 5C9JA 4CVZB 4TULL 5J3HD 1DUZA 2FJFA 2P5ED 2XKNA 1F11A 3VXRD 4YX2L 5I19H 2B5IB 3L9RA 3VGAB 1LQSR 1DEEA 1GAFL 3L3KB 5MENB 3QRGH 4MQTB 4IMLA 1C16B 3QUYD 2M26A 5TH2A 4EI6B 3O6KH 4KZEL 3S8WA 5FO7B 3S3SA 4R97C 1AI1H 5BZDA 5HGBA 1JMZA 3QXAA 5CMAA 2FX8H 5I75B 5IHZA 3OX8A 3QZWB 3VW3L 1QPPA 4YZFF 4DN4L 1ND0A 1A1MA 3ARFA 5FO9A 5DRZB 3HE6A 2BNRE 2FO4B 2ICWA 3I50L 4HXAH 4PJIB 2GUOA 1ZWIA 4XRCA 3H0TB 1QKZH 1YNTA 4RGNE 3CXDH 2GJ6E 5KAQF 3V6OC 1U8MA 1NC2D 4FXGA 2YZ1A 4IRSD 2RAMA 5GSRA 5F1NA 1MEXH 3SDCA 1IGYA 1ZT1A 2GY5A 3IB4A 3JV0A 2FSEB 2P44B 3O4LA 4KTEL 4ZODA 2O26U 3QFDA 3ARRA 1HHGB 5AEAA 4K94H 5JLZB 5IBUG 3V0WL 3RA7H 3DSFH 1KIRB 4DN3L 2VJXA 4NKMB 4NC1E 2IC2A 1DBKH 4Q6IC 4U05A 1ADQL 4GXUM 4IRJD 3DX7A 1WISA 4U1KB 1H8NA 4PR5A 2A83B 1ES0B 4ZAKD 2I9LA 3NZ8B 1KG0A 4HWNA 2F54B 1RUPL 3A6CL 5I6XB 1J11A 1CD1A 2ICCA 3G6JE 3MLWL 2WQ8A 2QV2A 1KXTB 4Z7WA 2OR8A 4IMKA 3JXAA 1ODAA 4OGXL 1FH5L 1YQVH 3MRLB 3BZFA 4G8EA 4R0LA 2KH2B 3QFJB 3THML 2XG4A 2CJUL 3PWPB 1Z9LA 4UOW0 1AXTL 2DLEA 3B9EA 4NJ9H 4DVRH 3DJ9A 3G5VA 5DSCB 2P5WE 3VD5A 1N3NA 1ZAGA 1IEHA 3INUL 4UIMA 1OAQL 3TA3B 3BGMB 1BZ9A 2BSRB 1YY8B 1NGZA 4GBXC 1JWMB 1DLHB 5CS7A 3REWA 5GJSL 1J18A 4BSJA 2AJZA 2CO7B 3UYRL 2PTVA 3OAUH 4G8IB 3BKYH 3OKDB 1UADC 4S1RH 5GIRB 5BMFH 3G6AB 2CLVB 3AB0C 3FCTB 5EU7C 5GZOC 1H0DB 4PJ7E 4NZRH 3MV11 2HRPH 5ID1B 3TO2A 1IQDB 1T66D 2E9JA 2I07A 4UMGA 1OAUL 2VC2L 1AGEB 1YEDA 4L4VA 4RX4A 3PGDA 3QI9B 3STLA 1JZ2A 4K71B 1YMHA 4WWKD 2BXZA 3VXSB 4TTGA 1RJYA 3T2QA 4MQ7A 1GRWA 3OWEA 1FCCA 1Q9WB 4LVNC 5GGUB 2IPTH 5GRVK 1S5IH 4RFNC 3TJHD 1JF1A 2RBLA 1QNZL 2DBLL 43C9A 5C0GB 3GJEB 2HYMA 1EEZA 1INEH 4GKNB 4L3ED 4OFPA 4XCNA 5ICYB 3B43A 4R8WH 5I8KH 2EH8H 4JFOA 3D48R 1M7XA 2Z91A 4DZBA 5D5MB 3SGKC 1CFQA 4MQXC 3PQYD 1IBGL 4Z7UA 4MZ2A 2NLJA 4YBLC 4HJJL 3HMWH 3WJLC 4R4BB 4ZXBB 5B4MC 5CBAA 4YGVB 3QZWG 3ZSTA 4N8CL 3KLAA 3QXWA 4R96B 5K9KA 2OP4H 3QNYA 5FKAB 3AROA 2AJYL 3QCTH 4X4YA 4TSCL 4XXDA 3RWCB 3RWJB 3N85L 1QHOA 3T65A 3ZT7A 2NW2B 1IEAB 3U36B 1BBDL 5DJAA 3TZVC 1RY7B 5DK3A 1QSZA 1XGUA 5E7FA 1A9BB 4KVCH 3HI6L 3FB8A 1AGFA 1U8LA 4YQXH 3WLBB 4D3CH 3SDYL 5JHDA 1UJ3C 4IM8A 4N9GA 1AP2B 1CQYA 1G9NH 5E9DD 1BIIA 5TDNA 1KTRL 2Y25A 4PJDA 3BJLA 1W72L 4NDMB 3O6FD 4TSAL 1U3JA 2ZUUA 4K94C 3WHXB 3EYFA 3SGJA 5HYFA 3GRWH 1T0MB 1PX3A 1MCIA 4Y2DD 4O4YH 2GJJA 4I2XA 3RAJL 1NKRA 4OIAA 4ZUVA 1WZMA 3FTGA 2FECL 1ORQA 3O0RH 4QOKB 1LEIB 4QHKJ 4EKXA 1IGMH 5D2NA 1E6OL 4OZHF 4AENA 1YC8A 3DX9B 2UZXB 2VWEE 3QULB 5D7IB 4WU5B 1HINL 1SMAA 5F21B 3M17B 3L5JA 3NN8B 2CDGA 1T0PB 2KZWA 3QXDA 4M62L 5TFSL 2EDFA 4I77H 3VGGA 3O2WH 4XMKH 4FXKB 3TH4T 5IG7A 1Y0LA 3UTQB 4JM2D 1BJ8A 3OAZK 4TUKH 2D7PA 3Q48A 4NRZB 2P8LB 4DW2H 1QVOA 3VFRA 5C0DB 1DL7H 1B88A 5IMKB 1MCJA 2P4AB 3WD5H 3DVFA 4ETYA 1T20B 4M1DL 4LIQE 4RQQA 4XNUL 2FDBP 3OBAA 4CW1B 4MB5A 2VLRB 4PJBF 2CKBH 1BZ7B 2ATPA 5E8EB 2FYYB 5D1XA 5F88B 3MGTB 4JFFA 3QQ4A 1M7IA 2VH5L 3GSNA 1KCSL 4PJEF 3MV8E 1MCFA 4U7MA 3JV5A 3SGDI 4S0TD 4FQCL 2ZG3A 1MHPH 3ARUA 3HRPA 3CK0L 3LMJL 4PGCB 3ROLB 3C87A 1Q1JH 3PUCA 2XQYK 5LAXB 1NFDE 1VEPA 1MREH 3ARGA 2WUCH 1FL5A 5I15L 1C12B 4PV9B 1QBLL 1UWXH 4HS3A 5E6IB 3TYGH 4PJXE 2R69H 4EI6A 2BNRB 3S88H 3U1SL 1WICA 4XPFH 1W0VB 1XCTA 4RGNB 3VG0H 2GJ6B 1YN6A 3RVVC 2VO5A 5IGXH 3MFFB 4D9QD 1JRHL 5DJ8A 5D72H 5I8CB 1CLOL 1YMME 3V6BR 3O6ML 3WKMH 2FO4A 3U0WL 4XC1L 4PJIA 5CD3B 1X44A 2MSPA 4MD5B 5E99L 3M07A 4Y5YB 4OGAC 5IOPB 4LGSB 4M8QB 3AS2A 4CVUA 4AY0A 3X17A 5D6CA 1A7NH 2V17L 4J3UA 1FZKB 4GS7B 2FBJL 5TDOB 3VD3A 2EC9U 2MKLC 5ELIA 3WFCH 4M00A 5AWNH 4OFYD 3WV0A 5DQDH 1PZ5B 5DMKB 2I9TB 4FQ1L 1I3RB 4ALAL 2LVCA 4NKQB 3T09A 5JLZA 3B83A 4LCCC 1WBZB 4F9LC 5BXFB 5K59E 2EYRB 2X1WL 4QRQA 3EZJB 2NYYC 5KJRH 1QD0A 1KLUB 1VFMA 1G9NC 3ZE0F 3ULVH 2R0LL 3MA9H 2NY1C 1P84J 3SGDH 1MH5A 5ESVA 1OSPL 3OXRB 4E0RA 2QQNL 2Y72A 5D7JC 5HVHB 4OF7A 4U2ZA 5T3ZH 3VU2A 1KCUL 1G6RH 1QFWM 3MJ9H 3L3HA 3MNWA 1RI8A 4LMQI 1WTGT 5L7XH 4RNRB 2O5ZL 4GMTL 2APTA 4NQCE 1F58H 3QYCA 3MRLA 3EYOA 3AC0A 3JZ7A 3ULUL 3BP6B 2QL1A 4RGOL 4GKZA 1CDBA 3PWPA 2DQJH 4UV4H 1Z9SA 3TGXA 4LCWA 5FUOH 3OB0H 3H42L 3MZGB 3BE1H 3HN3A 1WWCA 1MCPH 4QRSB 4M02A 1KB5A 5CFHA 4L9LC 4YR6B 2PYFA 4K7PH 3VFGH 2W92A 4YZFE 2D4FA 1X5ZA 4PJ7B 4DVBB 3FRUB 4G9FA 1YY8A 2A0LC 2J4WL 4H0HB 4L8SC 1Q94A 1MRDL 5C08E 2QHRL 1I1AB 3HZYA 2VKWA 4G8IA 4YDVB 1OPGL 5LGJB 4P2RA 5GIRA 1CGTA 1OM3H 4HIEA 3ZDZF 1JI2A 1WVZA 4Z78A 5EOCL 5GGVL 4HH8A 5DVLA 4PY7B 5ID1A 3UXFA 1FJ1A 3VWJC 3VFMB 2Q86B 2VR5A 4IHOB 4OB5H 5DYOA 4DAGL 4R2GB 1DLFL 2X4QB 4GRLB 4EVNB 4PJ5B 3SDDC 1ZLVK 3W2DL 1CGSL 4YWGL 5HVFB 2FIKA 5T33H 3DX6B 3MJ8B 3HG1E 4C83B 1A14H 5I66A 1J1PL 1AY1L 2VXUH 4I9WD 5JZ7C 2FZ3A 5L0QC 1MFBH 4YHOL 3MCLH 2ADFL 3LRGA 2CXKA 1T83A 3IGAA 3PJSB 3K81A 4RBPK 4KKBD 2PYEA 3WO3B 4BZ1L 3GJEA 2HTKD 2NX5E 3OSKA 4WENB 1CF8L 3FOMA 4GLRH 5GZOD 4F7PA 1MCNA 2IAMD 3IU3A 4PD4K 5HPMA 2VDQH 4NZDA 2AXGB 4YDLC 5EBLB 1HI6A 4CADA 4YDJB 3DXAA 2R1XA 1EO8L 4FQ2L 2DWEA 2W9EL 4FZEL 3DRQB 5IW1A 5IV2B 3WNNA 2H1PL 3BN9C 2H6PB 4AJ0A 4WO4D 3DETC 4R96A 1V05A 4LVEA 4ZNEA 1MIEH 4S2SB 1A6AA 4PJ8B 1CR9L 3GUTB 3FONB 4P2OA 4OZFH 4NQVA 3RWCA 4F8QA 4TSBL 5DDHA 3QEGL 2I25N 1IEAA 5CSGA 5IHBA 3H9YA 4TPRL 4PV8B 5KSVA 1FV1A 2W0FB 2EYSA 4QRRE 1FLRH 5SV4A 4JG1L 3WLBA 5HHPA 4RWYH 3V7AG 3QJFA 4NWUH 4U6XA 2RCSL 3RGVC 2DL9A 1GXEA 4NDMA 2ZCKH 1JFQL 4AL8H 3RTQB 4EQ3A 3SJVD 3MLYH 1TIUA 5EUOA 1ZLSH 4NHUA 1IQWH 1KULA 4KUZL 2HVKB 3LKRB 3QH3B 5EZIL 5KSUA 4JKMA 1NAML 3FFDB 3PWLA 1FGVL 1SQ2N 4AH2A 4YHLL 2NNAB 2JKXA 3T2NH 2XN9D 1MCWM 2W60A 4QOKA 3SE9L 3TZVD 1LEIA 1U6AH 3GJFH 3NBNA 5C92A 3MRIB 3MRKA 4KMTH 4G7YL 4H1LA 3DX9A 5TDPA 3DVGB 5D7IA 3IU4L 4WU5A 3PDDA 3NN8A 4KXZH 4J6RH 3RVXC 5I1GH 1IAMA 4ODBD 4V1DE 1K8IB 4PRNA 5C0FB 4FXKA 1CK0L 4WI3A 3ARBC 2YD5A 4DEPC 1FPTH 1NMCC 2NW3B 1VA9A 1NDMA 2CGRH 1YEEH 5GRWA 3CDYA 2VDPL 3B2VL 1EVUA 1KCRL 2EICA 1UT9A 1GCFA 5IMKA 3DHMA 1GPOL 4Y16B 5DHYA 4WCYH 4HDIB 5C0AA 3MV8B 1J0IA 3A6BL 3RY5A 4RIRB 5JA8B 4K3EL 2HJFA 1OT1A 4XNQB 2OR9H 4PRIE 1BZ7A 1F4YL 3BYYA 1RULH 2G2RB 1NFDB 2VIRA 4HKJB 4XCYA 5E03A 4TTDD 5JORB 3ISWA 3KPLA 1YEFH 4OZGF 2XQYG 3GFUA 4LK4A 1QSFD 4PJXB 5I73C 1G9MH 1DBJL 2XZZA 3IJSB 2A74B 4J1UA 4PRPD 4YGAB 3DIFA 3C60B 3UPAA 4O58L 4N90D 5SWSD 3VWKC 2ZG1A 3TEUA 4K2UL 3O9WA 3SKMB 1LO2L 4OLVH 4AG4L 4PV9A 5E6IA 1YMMB 5BV7H 1T1XB 3HRZA 4GRWH 4D0DA 1IM9D 1Y6NR 4PYHA 4RFOH 1DBAH 1P7HL 2GJ6A 2PCPB 3RWHB 3BUYB 3KXFA 4OZHE 3QPXH 12E8L 2IBBA 2Q6WB 5B38A 2Y7QB 1WBYA 1N7MH 2FH6A 3O6KL 5C6TH 5EDXA 1INQB 3MRCB 3QDJE 5B39B 3EO0B 3SKOA 3GSVA 3P9LB 2JB6B 4YHMH 3SE4A 5SWZD 5MEOA 4Z5RB 1FZKA 3L3OB 4CUCA 1NJ9B 1T1ZA 1HXMA 1K4DB 4JVWA 1E4KA 3VI4F 3QWOA 1PZ5A 4KK5C 4Y88A 4HFUL 3RVVD 3DVNA 1YYMH 1U3YA 3PWNB 1NUFA 4PJBE 1MEXL 3BEVA 3EW3B 2EYRA 4P5KA 5C0CE 5F71A 1OD9A 1KLUA 2BOBB 3G6JA 3T0AA 3D39A 3RKDD 3N1PC 2HN7A 2Q8AH 5C0JA 2E9WA 3VDAA 4PJEE 1ULVA 4OF8A 2D9CA 4OGAD 4NQCB 3OF6D 4PJGE 5ETUA 4ELKB 4JREB 3KYOB 4PJHB 2IGFH 3OXRA 3RA7L 4LCYA 1EO5A 2ZPKH 4XCEA 1DBKL 1K3ZA 2XTJD 3N9GH 2A6KB 1UZ8B 1OGAD 3KPRD 4MDJB 4OAWA 3KNBB 3VXUE 5IB5B 2P5WA 4ONHB 2H32H 1N6UA 4UV7H 1G7LB 5CSZA 5F7YC 4UT6L 3FQTB 3GSXA 1DQMH 5FGBA 1WQVT 2F53D 3BP6A 4HFWA 5EORL 3WL9A 1KGCE 4NT6A 2NXZD 5C08B 1BVLA 4O2CA 1BECA 2JELL 4BH8A 3QNXB 4CU6A 4F7MA 4Q0XH 2NY1D 3TVMC 4M7ZC 1W72A 4MNHA 1AD0B 1YQVL 1CE6A 1EZVX 3NCJL 3MREA 5D7JD 3FRUA 5E4EB 5IFJA 5DC4B 5FYKL 1S7UB 1QP1A 1WIPA 3HCVB 1DVFB 4G43A 5LGJA 2F19H 2NCMA 2DRUA 3PABA 1FGNH 2R29H 3TPUA 1FFPB 3RY4A 3HG1B 1YEHL 3VGEA 5F1SA 4UIKH 4PY7A 1CDYA 2H2PC 3K74B 4Y4FC 4IHOA 4MAUH 1T1YB 4QRTB 2X4QA 4S1RL 4GRLA 2HG5B 4EVNA 4PLJC 3DNKA 1CWVA 1QBBA 2UVFA 3RI5F 5BMFL 4ZDHB 3UZQA 4U2YA 1OAKH 5AYUL 2BDNH 3DMMA 4NZRL 1B0RB 1KYOK 4DTGH 5C0RL 2A0LD 4D2NA 3V6FA 1G9MC 2X4RA 5HYSA 1Q9KB 5EZJB 3S6CA 3PJSA 2FATL 4ELMF 4GFTB 3H2WA 1ZVHA 1GGBL 1P7QA 2IQ9L 5FYJU 2AJXL 3KLDA 3HPLB 5JO5A 5E70A 4MA3A 4M1CC 3I3BA 3TYFA 1CDHA 3FQNB 4LQFH 4M9PA 4R90H 2R2BB 2EEBA 3QWQB 4QWWD 3RGHA 3MOBL 3SDDD 2VXSL 1U92B 3DRQA 1HCVA 1CE1H 5IV2A 1CI5A 5D9SB 5KN5A 5HI3C 1A6ZB 2OI9C 4FQIL 2B39A 2EIDA 4K8RC 3EGSA 2EH8L 4QRRB 4S2SA 5ISZE 4PJ8A 3QEQB 5JZ7D 1TETH 1SHMA 3F7VB 5B39G 1EJ6A 5CJQH 3HMWL 1YPZF 3RZCA 4OLUH 2DTSA 4BQ8A 4GW1A 3UTPE 1BQLH 5I1AB 3H6JA 2OXGA 2BVPA 2R2EB 5DD6A 5ID0A 1FN4B 1UGNA 2OP4L 2W0FA 1EERB 3KPOB 1H5BC 4P59H 1FG9C 2QKIB 4XPBL 3T8XA 1J1XH 2UYLB 3ZDZE 4ZUSB 4YHYC 3OR6A 4NO3B 3RKPA 2ZOKA 3BN9D 2VKXA 1EMTL 3RTQA 4X9GA 3CFJA 4KVCL 4Y4KB 4NIKB 4MJ4A 3QJHB 2Z8SA 3QH3A 4MSWB 4UUJB 4OIIH 3FFDA 4JDTH 1J5OL 1P4BL 3CFCL 3LRSA 2NNAA 4ZFFB 5E00B 4M6OH 2Y1VA 3UO1L 2WV3A 4RMUA 5INDB 4JFYA 3W81A 3GRWL 3MRIA 4PGZA 1J05A 3CXHK 1JGLH 4RWHA 4Z0BL 1G7IB 4ZD3H 3CFIC 3X3FH 4OZ4B 3ZT6A 5DQJA 1N5AB 3RWGB 3O0RL 4OT1H 3WN5A 4CBPA 4F37F 3RIFF 3P30H 2WINA 4BK4A 2IG2L 4WTXA 1K8IA 3Q0HA 4Y0GA 3ROOA 1LK2A 4X6BB 4XMLH 4EEEA 1IGML 4GG8B 3QG7H 2Q87A 1T0NB 4J3TA 1RUAH 4CNIB 2ITDB 4NN6B 5KAQG 4YHPA 4RISL 2HVJB 4DKAA 4CDGC 4CKVX 4PRIB 4NQED 3ULVD 5JW4R 3V2AR 1YJDH 2AGJH 4I77L 4XMKL 1HILA 4JRXE 3VMOA 4IOSD 4TUKL 5I1JL 3C09B 3PP4L 2IH3A 4W6WB 1E6JH 3EHBD 4JCMA 3O2VH 2OQJB 3L3IA 5T3XH 4KGLA 2IPUK 1UM6L 1RIHL 1DL7L 1BFTA 5EO0B 3RVXD 3WIHL 2G2RA 3G04B 3WD5L 4G42A 1AR2A 2VABB 4G8GE 3QUKA 5DJCB 3VFPA 5EBWB 3RWIA 1A6VL 3ZMRA 3ARBD 1F90H 1LK3L 1NCDH 5FYJE 2Z93A 1KIUA 2DAVA 3D9AL 3ZKNC 1XEDA 5IR1B 4L5FL 3IJSA 2QSCH 4AMKH 5C07D 4BQBA 3VGAC 2F5AH 2XPGB 1EGJH 2ZUXA 3HMXH 1ONQB 4Y19D 4OQTL 3BD5A 4JM2F 1NC4D 3BGAA 1GGTA 1LEGA 4NZUH 1MY7A 3K80A 1TJHH 3PDOA 2L7UA 1Q1JL 3BKCH 5CEZE 3CSBA 3BWAB 5K93A 3ZHKA 1T22B 4PD4J 1QLEL 3QDJB 5I75C 4C59B 2PCPA 4MXQC 3SY0A 3LKPB 4RMWA 3OKEA 3QIUA 3DV4A 4JZJA 3LH2H 2Y7QA 1L0XA 4OZIF 5LQBH 1JE6A 1KIPB 1UXWA 4RRPA 2G5RA 3VWKD 3VG0L 1RHFA 5ICZA 5IGXL 2E7HA 5B39A 1QA9B 4RMSA 3WUWA 35C8H 3S96A 4PJBB 5D72L 3MXVL 3QIWC 5FIEA 1NJ9A 3MMEA 5C0CB 1K4DA 1HWHB 1ACZA 5TJWK 4OCYH 4JRWA 4RCAA 4PJ9D 3VXOB 4PJEB 1A6WH 2PW1B 1EFXD 1J1OH 3I9GL 3PWNA 1LNUB 4J23A 5CBEA 1A7NL 1F6LL 5E6YA 1NLBH 1SJEA 3WFCL 1A21A 5AWNL 4LDOB 1RZ7L 2BOBA 3MRFB 1LO3L 1H3WM 3VXUB 4DUWA 2YPLD 5K9OB 4OZGE 3UX9B 3GK8H 1BD2E 4NQCA 3B9KA 1DE4B 3TO4B 1F3DJ 4MD4A 5I6XC 5FKPB 4NPYA 4JPWH 4WW2C 1M7DB 2XWTA 4I4WA 1YUHB 3LVEA 5KJRL 2B0SH 2ZCHL 3BISA 4JFHE 4KMQA 4G6FB 3IXAB 4UT9H 3ORJA 3ULVL 2Y5EA 4KK5D 1GVIA 3KNBA 1K9TA 3MA9L 5IK3B 5IB5A 2V2WB 4ONHA 3T0EE 5DA0B 1OTTC 4NUGH 4GJTB 5BVJB 5T3ZL 3JVGC 2BNQD 1AD9A 4HJGA 5C08A 1G6RL 3Q2CA 5I2IA 5C0NC 3SBWC 4ZFZB 3RZWA 2ATKA 4NKOA 3TA3C 2RB8A 3EOTH 4TNVK 1F58L 4NRXA 3NACH 1AD0A 1DANT 5ANME 3HR5B 5IW6B 3X13B 1X5KA 4JFXB 4U1NB 4CN4A 5E24E 4QXTB 1DQTA 1QFWH 1T21B 3AMLA 5DF0A 4UV4L 1XIWB 3HCVA 5FUOL 4ZOBA 3TV3H 1CBVH 2Y07H 3SKJL 2CD0A 3BE1L 1FVEA 1O7VA 2JIXB 5CJXA 2HLAA 3TIDA 4OLZL 4QTIL 3VFGL 2FRGP 4UDTB 2ZUVA 3MNVB 3GIVA 5CILL 1UWGH 1I75A 7FABH 4PJAF 1T1YA 3QI9C 2B2XL 2P5EE 1TNMA 4F15B 2APFA 3VXRE 1EH9A 4ZDHA 5FA4A 3TVMD 2NX5A 2XKSA 3D3VD 1O7SA 1MIMH 1NGQH 1PG7H 4K9EC 2JJSA 4OB5L 2ICWJ 2HRLA 4L3AA 5F7LB 5EZJA 2ARJQ 1R3IL 3DI2B 4HPYH 4FFYL 1FAIH 1DN0A 1A14L 1BX2B 2DQDH 3ZKXB 2H2PD 1MFBL 3FQNA 2APXA 1ZHBB 5HHOD 5GQBA 4ZXBC 1FHGA 2R2BA 1IEBA 3PP3K 4PLJD 1U92A 2AEPL 4GAJH 3CPLA 4KRMB 2GEEA 1L0QA 1UM5H 3MA7A 1MHCA 4QT5B 2GT9B 4OGYH 2VDQL 5IHUL 1XF2A 2VE6B 3MCG1 1OVZA 5DQ9A 3NCMA 3EIFA 2YXMA 4GSDH 2P8PA 4Y5XB 1KJMA 1HCFX 1F4XH 2B4CH 1GZPB 4MJ5B 1JWUB 3CMGA 3D85D 4L29B 4JQVA 4KJWC 1J9CT 2R2CA 1MFAH 2YA0A 4XX1E 4HBCH 1MLCA 1MIEL 1HOCA 4M1CD 2C3VB 4FNLH 2WP3O 4U4BA 4KK6C 2OMNA 3T0DA 5L9DL 4U1GC 3F5WA 3KDMB 5CZKA 3MRNB 4ZUSA 4C4KT 5GGTH 3WS3B 4K3HA 1D6EB 1KTDB 2DQIH 4IDJH 4K8RD 3D18A 1N64L 4Y4KA 3UTZB 4EN3B 1W0YT 3QO0A 5AG9A 3LEYL 4UUJA 4NWUL 2B8OT 4X5WB 4LHQB 2NY6D 5ACMA 4ZFFA 1J0ZA 5E00A 1LP9E 1I1CA 2ZCKL 4V1DA 4AL8L 5IB2A 1I4FA 5ITFA 1ZLSL 5KS9F 5MEPA 4K3DH 4LHJB 4BYHA 2A1WH 1UCTA 4AEIL 4QHMA 4WUUD 1G7IA 1LWRA 3C2AH 2VTFA 3HC4H 4ELME 4HWZB 3IT8D 3T2NL 4OTXL 3FB6B 1LO0L 3RX7A 4JRXB 1HDMB 4GG8A 3D5OF 1D7FA 4ZFOB 5CLWA 3L3GB 3MBEC 1T0NA 4XGZB 3MRMA 4NM8H 5ECJE 2ERJB 3MRPB