3QH3B

The crystal structure of tcr a6
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
245
structure length
245
Chain Sequence
NAGVTQTPKFQVLKTGQSMTLQCAQDMNHEYMSWYRQDPGMGLRLIHYSVGAGITDQGEVPNGYNVSRSTTEDFPLRLLSAAPSQTSVYFCASRPGLAGGRPEQYFGPGTRLTVTEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQDPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords A6 alpha chain
publication title Disparate degrees of hypervariable loop flexibility control T-cell receptor cross-reactivity, specificity, and binding mechanism.
pubmed doi rcsb
source organism Homo sapiens
total genus 58
structure length 245
sequence length 245
chains with identical sequence D
ec nomenclature
pdb deposition date 2011-01-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3qh3B01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3qh3B02
2HVKB 2V5MA 2VLRA 3O4LD 3QWOA 5JDJA 5D1XA 2V9RA 5D7LE 2ESVE 3QUYA 2OTWA 1VFMA 4DUWA 1G7QB 3CXDL 1RZIA 5FB8B 2D7PA 5DJ2B 4GRMB 2CK0L 5CBEB 1UJTA 2H6PB 3JBG7 5D1ZA 1DBJL 4OZFG 5DJCB 2PO6C 5I0ZA 4Y5XC 5D70H 1AQDB 3HNTL 4M3JA 5FYJH 1BZ9B 3PGCB 2VQ1A 4OF6A 5JORB 3RBSA 3ILQC 1MEXL 1MWAB 5C0GB 4OB5H 3SCMA 3FT4B 5FAAA 1VGKA 3UBXG 1B0GB 4TPRL 3QWRD 1T04A 4ZFGH 1I8MA 1NUDA 1KPUB 4O58H 5CGYC 3TA3D 5E2UH 2Z9TA 5IBLD 1UZ6E 1NUNB 1A02N 5E4EB 2FLBT 4OFIA 4LF3A 1DANU 3HE7A 1A8JH 2L4OA 1WT5A 1IQWH 1D5XA 5AYQA 2J8UF 1CDHA 4YPGA 1NKRA 3W2DH 1MFAH 1WK0A 1U58B 3EYFB 4RGNC 5ISZE 3BW9B 5ANMA 2L0DA 1KGCD 1GGTA 3GMNB 4G80A 2FO4B 2X10A 3MOQA 2VZTA 4MX7A 1JGLL 4PP2B 4NN7C 1SVZA 4XT1C 3KGRA 2A73B 4JR9L 4KK6D 5IT2H 1YJDH 3FHQA 1FP5A 3DXAA 4U05A 5T3XE 3I6GA 4N5UA 5GS0L 5I8OH 3NAAL 4PJEF 5CSZA 2C1OA 4KV5E 5CEXB 4UINH 3FFDB 4FG6C 4H0IA 1NGZA 1GXEA 5GGTA 3Q3GA 1B88A 3OKLA 1MCLA 3NZ8A 5HHMB 3VG0H 3O6KL 4OLXH 3BKML 4M4RA 2W9DH 3SE8H 1N64L 2C4FT 1FQ9C 3VRLF 2ZOLA 3DRTB 4XXDB 4ENED 2AI0L 2R4SH 4PBXA 3OGCB 4JKKA 1S7WB 4XC1H 4ALAL 5FGRA 1I8IA 3GJFK 4BFGA 4UT6H 1T7VA 4L29B 5CINL 3QISA 4JZJA 4DKEL 4KI5D 1WZKA 5I74C 1LO2H 3EYOA 5KS9A 4U1IA 3GB7A 4YR6A 3ZDZF 2NR6C 4C58B 4L3CB 2ZP0T 2L7JA 3MREB 1SBBA 2MHAB 4YNYB 1JUFB 1RUML 4Y4KA 5HPOA 4LSTL 1H3PL 3FTGB 4ZOBA 1I7RA 1WCQA 4X80H 3VXNB 2H3NA 5HI4D 3BPOC 5E1HB 4PJBA 3X11B 4YXKL 2BY2A 5LWYL 4MA3B 3DIFB 4U7MA 1CI5A 2JB6A 4PD4K 2F54B 4ORZC 4RIRA 4XAWH 5K9QI 4N5ED 1A3LH 5JLZB 1J1XL 1F4HA 2GFBB 2QHRH 2OK0H 1EO7A 3MC0A 4EXKA 4HQQL 3LKSA 5LBSH 4ELKA 3TYGH 4PJEB 4R4FL 3NACL 1DEDA 3MV8D 3U4EA 5ICYA 2ILLA 8CGTA 1R3IL 2YMXH 4ZSOB 2H1PH 4MA7H 4JE4B 3AB0C 2QQLL 4XPTL 4AM0B 3MUY1 4KU1A 4JHBA 3MV8E 3ZDYE 5FYKD 2G60H 4HH9B 4OZFH 3CFEB 5IW3A 3RAJL 1BGXH 4HV8A 1OB1B 4EKXA 2X7LB 1WICA 3GKWH 4Z7WE 4CN6A 1G7JA 3EJZC 3TYFA 2E3VA 5FYKE 3OF6D 4UNTA 1KXVC 2OR9H 2CLZA 2YRZA 3SDXA 2Q1EA 4LQFL 1QSFA 4ZTPH 1AGEA 1BBJB 4DFHA 1I3VA 3HMXH 5C0DA 5TDPB 4RSVA 3HZKA 3FQNA 3UZQA 2X2YA 4I77L 4BH7A 3C09B 5I16B 4I2XB 4JO2H 2NY4C 4WV1A 2GITA 1W0VA 2PYEA 3S5LA 1FH5L 2Q76B 1VPOH 3CU7A 4NT6B 5EU6D 3TFKC 4JFZH 3JV5A 3TBYA 1OY3B 4CMMA 4D0BA 1UKQA 2B1AL 5EUKB 4FQQB 1JWMA 4BYHA 1X5HA 3IJYA 3ECBB 1ZAGA 3N06B 2IALB 5EU6E 5ILTH 2L7UA 3WEXB 5HGGS 4ETYA 3CDGB 3I84A 3I6KB 1JZ7A 4UT9H 4PV9B 1JHTA 2NY3D 4FQIL 3V8OA 4DAGH 4OIIH 2HMIC 4XMKL 3ES6B 1IL1A 1HI6B 2BRQA 3P77B 1CD9B 4MAYC 1TZGL 3C8DA 1X6LA 4LVHB 3LIZH 3HE6D 3TP4A 5C07A 1GPOH 4KKAC 4NGHL 5F88B 4P2OD 5DK3A 2NY5H 4RAUB 2OQJA 3HZVA 3G6JE 5MI0B 5TQ0L 4EVNB 2VLRD 4JHWL 2Z8WC 2R2CA 2D4DA 2MSPA 3FQWA 5I1KL 3QUYD 3DYOA 3VRJB 4HUMB 3GO1L 2WWKT 6FABL 3NFPA 3KPOB 1SBSH 4NCDA 5JHLH 3ABZA 1G7MB 2XACC 1AXTH 4HK3J 3MODL 1BQSA 3LRSB 1S9WB 1N8ZB 2F8XC 3QIWB 2DQIH 4OZGE 3IT8D 2J5LB 3SGJC 1YQVL 2LVCA 5D1XB 4L3AA 3AU1B 3S3PA 2OTWB 1EZVX 1F5WA 3SKNA 4OT1L 3V0VA 1MPAH 1YMMA 4ZODA 4QLRA 1AGBB 3PIQA 3OKKB 1S5IH 5D1ZB 4NQTA 2J88H 1IGML 3MUJA 4HXBL 3MO1A 2D7TH 2HRLA 4Q6IC 1TETL 1A6UL 4D2NA 1N0XH 4CVXB 2Y6SC 5KS9F 3AS1A 1F90H 4GSDL 2GI7A 3HE7D 2F19H 5EFIA 3UTZB 3SCMB 1VGKB 5SWZA 1NBVH 3AUVA 4YFLI 1WTGT 1C5DA 3RVUC 3UZEA 2EDQA 4OM1L 4GG8A 5C0EA 3WFCH 2D2OA 5INDA 2BVUA 2ICCA 4KJPC 2DMCA 3RWFA 2VDOH 5EIIA 3T8XB 5LCVH 1DEEB 5KSUB 4YPGB 3PABA 1BQUA 4LLYB 3TVMB 1LDPH 5E8DH 2I5YH 3CAFA 1FFRA 4ZAKA 3BYYA 4PJ8B 1NMAL 2FEEI 5GGTL 3RKDD 5JQHC 1YN7A 5HHOA 3DXAB 2B0SH 3EW3B 1BREA 4OLWH 4R9HA 5CSZB 2C1OB 3RP1A 1QQDB 1R5WA 2BNRB 1RK1B 1WFOA 2FEDD 1A4KB 2UUDH 4QY8A 4KKBC 2XQYK 1HN1A 5E8EB 3MOAL 2YXMA 2CUHA 1U9KA 3BHBA 3QPXL 4F7TA 1L7IH 3ARGD 3MTRA 3Q3GB 3GEWB 3OKLB 3BRDA 3MRPA 1IT9L 4RBPH 1SYVA 1N2RA 1OAQL 1GGIL 1LD9B 2I9LA 3BZEB 1WISA 1YECL 4LCCB 5GRYA 3G9AB 1I9IH 5AZEL 4Y4KD 3CFJA 1W2KT 3UDWC 1I8IB 1FNEA 4LSQL 1D5ZA 3N1GC 3QIBB 4ODUA 3BIBX 5A2LH 1J7VR 1JF1B 4U1IB 3SDXF 5C08A 3B2VL 3Q2CA 4YR6B 3MGOB 4GLRH 4NZTL 4LSSH 2X4NB 1ZLSL 4M5YH 3UYRH 2A83A 2IH3B 3T1FA 1QFHA 4MD5B 1QSZA 4XMLH 3GZKA 2BJMH 4NKDA 4F9PC 2HFEA 3P0VH 2AV1B 4UAOC 5DWUL 1E4WH 4ZFFB 4PJBE 4UIMB 3EDDA 1I7RB 5I8EA 1NMBL 3K3QA 3IS0X 3RX7A 3TO4A 5AG9A 4LRIA 3BEWA 1BF2A 1MOEA 2PXYD 3NN8A 5MHSE 3L5WB 2BX5A 5TE4L 2ORBL 1KUMA 4M1DH 5T1KB 4P5KA 1Y6KR 4G6JH 5T3ZH 4PGJA 3IU3A 3MYJB 1Q8MA 1UXWA 3WO4B 1MCEA 3LKSB 2SEBA 4NO3A 1J9CT 1P6FA 3MLVL 2KZ1B 4HG4K 1UM4H 3P2TA 3I3DA 3VRIB 3D85B 1DQQA 4G7YL 1EA9C 1KCRH 1OQXA 2DQGH 1ODAA 1GL4B 2Y5TB 1UKTA 2EDXA 1P6AB 3W11C 1Y0LB 4NWTH 4P59H 2Q8AL 3ARUA 1QSFD 3V5DA 4CMHB 3BISA 5DDHA 1L7TH 2ZCLL 4A6YA 1QPXA 3OTTA 4XPAH 4HV8B 3FO9A 5I18H 4NYLA 4PIRF 4Q9RH 3OAUH 4KK9D 4RAHA 4LPTA 4LFHG 1CL7H 1QSFE 3CSPA 4X9FA 3KR3L 4EXPX 2JJTC 2PYED 4JKMA 3WIIL 3VE0A 3WL9A 1D9KD 5DD3L 2X5PA 1AGEB 3B2UC 1OW0A 3C09C 5C0DB 1ZANL 3KPMB 5E6ID 2B2XL 4QHMA 3HZKB 1XMWA 3IFLH 1OF2A 5JPMB 1KACB 1WTLA 4YIQA 5L7XH 2P5ED 5HYQB 2RGSA 2GITB 1W0VB 1INQA 3S5LB 2VQUA 4MCYA 3B8SA 4XH2A 3BEVA 4D0BB 2QHLA 3P40A 1X44A 1S7SA 2R1YA 5FV2A 2P5EE 1JWMB 1UEYA 2ZPKH 3O11A 2CSPA 5GRZA 1JGDA 4DOHB 2F8OA 1KPRA 5F1NA 1P2CA 2YPLA 1KFAH 3GBNL 2CD0A 4WW2A 4UV7L 2NW2B 4JPKH 4PJDE 5DK0A 2YPKA 4NNYA 5C07D 5KVFL 2JKXA 3C60A 4NZUL 1RZ7H 1IL1B 4LVHC 1A6WL 4L1HA 1C7SA 2AJVH 1HH6B 4OLZL 1NDMA 5F7WC 4FFYL 1TJGL 4WGVB 5KVEH 3O8XA 3P0YH 2HRPH 1YNKL 4AEIH 2DLFL 1HKLL 1IQDA 2BRRH 2XA8H 5DJ0A 3DGGA 4JDVA 3HZVB 3WFDH 1A7OH 3DI3B 5I8CB 2EO1A 1FG2B 4OV5A 1NQBA 3TN0A 4LDOB 5F3BA 3QIWC 1CD1B 5IFHH 4LCYA 2J5LC 2PYFA 5D1XC 4FQPA 4Q0XH 3R8BB 2X6MA 2IH1A 1Z2KA 1RIHH 2EXYD 2JF1A 4ZO9A 2HJKA 4L9DA 1U8IA 5EWIL 1BD2D 3OJDA 3PWPB 4HWEL 3SKNB 3QXTA 5DEGA 4F15C 1BHGA 2ZG3A 1YMMB 5A2IH 3V5KA 1T83A 5D8JH 4X4YA 1IGTB 2WBJA 5L8JB 1F02I 1BD2E 3PIQB 4MDJA 4R4ND 4TUKH 1C1EH 1MY7A 1H3UA 3GJEA 1KJ2L 4Q6YA 2V7NA 3MO1B 1JIBA 4JG1L 5GJSL 4M6ML 2ED7A 3QZWG 3IJSB 4RRPG 3UMTA 1G6RA 1QBMH 4MAUH 1QR1A 3U7YH 1FG9C 3V0WH 4IOFC 4MQ7A 1X5GA 1Z3GH 3T2OA 1PKQB 2DJUA 2UWEE 2V2WB 5SWZB 1FLRL 3LEVL 3HC4L 3C2AH 4JM4L 1KJ2B 2EYTA 4L4VA 1UVQA 1C5DB 4FA8A 4YHIB 4OGXL 3WNLA 5EUOA 1U3ZA 3H9HA 3TVMC 2W1NA 2PNDA 3ZMRA 5JTWA 4PJ8C 2C3GA 3PABB 3QCUH 4K55A 2GSGA 3TWCL 3C5ZC 3CX5J 2O5XL 3QDGE 4ZAKB 1PQZB 3MRGA 4XPHL 2WWKO 1YN7B 5HHOB 1KEMH 4G9FD 4M8QB 1ZE3C 1U0QA 2VDLH 4AJ0A 4NKIH 3V52H 1R5WB 2DTML 3BKJL 2F58L 4QY8B 3LKOA 4CRPA 3K4ZA 1HNGA 1EIBA 2OL3A 4G9FE 4BKLA 3DX9A 3VCLB 4MHHG 1X4ZA 1FN4B 3MRPB 4LCCC 3CZFA 4PJ7E 3DBXA 2BVPA 4IRZH 4XCCL 3PWLB 4N0FB 2AQ2A 4JG0H 3VWJA 3QIBC 4JFHD 3BE1L 2I24N 2ERJB 3LHPH 1MRDH 4FZEH 3CFJB 4HUVA 4QXUL 1FNEB 4NCC2 2WUCL 1D5ZB 3C6LC 4AL8H 5GJTL 3ZZ1A 4F8QA 1FORL 2AKRA 3TO4D 1X5JA 3CFDA 2PR4H 1MHPH 2VXSL 2G2RA 2HFEB 1S9KC 2BNQB 1CLYL 3IETB 5ITFA 5CKAA 3BKCL 3U0WL 3QFDA 2FL5B 4IOSD 4LNVA 4TTGA 1CGWA 5D96B 3HAEB 4YAQA 3L7FA 5DYOA 5DD5L 4UQ3B 4XNUH 3BGFB 3SE4A 2W92A 5JW4Q 1FC1A 4GG6A 2XPGA 3MRKB 3QYCA 1YEJL 2Z92A 2IGFL 4ZDHB 4H26A 1MREH 2OS7A 5H94A 2D03L 3IU3B 5I1CL 5TQ2H 3OXSA 3S37H 2VDRL 4A6YL 1YYML 4XB8A 5EU7E 3SKMA 4BFIA 2AVGA 1DQQB 3KPNB 4Z0BH 1PD6A 3IDIB 3DVNB 5MEQB 4CMHC 1OAZL 4C56A 1G9NL 3V5DB 2GYSA 3K4AA 3QFJE 5EO0A 1WIUA 2HTLD 5GGSY 1Y18A 1YEIL 3SDAC 4HIIA 4NYLB 4I3RH 1RFDL 3LS4L 4HHAB 5D2LA 4WI7A 2DKMA 4LHUD 4YUEL 1DQTA 4K94L 1UZ8B 4LLUA 3QR2A 3CFIC 1ERNA 4X4ME 4GAGL 1TPXC 4RNRA 1IGJA 4KTEH 3OJMB 3CVHH 2XN9B 2EIZB 3WL9B 4KRMB 3VXQA 1RD6A 5SV3A 3CJJA 3RWHB 1HHGA 2B4CL 4R0LB 3U4AA 1G0YR 3VH8A 5GRJH 4U49A 2H26A 2BOBA 5B8CA 4WWKA 2XTJD 3ARFA 5JZ7C 5D1QB 4GRWF 4LIQL 2DBJA 1XGPA 4N1HB 4XH2B 3FQUA 4FQ2H 5IR1A 1G9MC 1DBKH 4R7NA 2OI9B 2R1YB 1VDGA 4NQDE 1RVFH 1PSKH 2XTJE 2G5BA 2O5ZL 4K3JL 5AUMA 4U1NB 3C60D 3IDXL 4QHUB 1PAMA 2X70B 1SJEA 3V95A 5E00A 1KPRB 2H2SC 5F1NB 5DMKB 5HY9A 4NP4L 1FYTA 1P7QA 2YPLB 4KZDH 2XKUA 1ORSA 2GKIA 3KPRB 1FPTH 1SJVA 1YEFL 1FAIL 4J4PD 3GBLA 5EORL 4YDIH 1T3FA 1OD7A 3O8XD 5TDOB 4YXLH 3IDJA 1NDGA 3FN9A 3PL6A 3MBEA 5CWSB 2AJZB 2EO9A 4G7VH 3ALXA 3KHQA 4NO5B 2AQ3A 4BM7A 1E0OB 3KYKH 1UYWH 4YC2B 3SDCA 1OAUH 4XI5D 3WUWA 1JN6B 1GGYA 1NDMB 1RUAH 4QOKD 3TN0D 2VDQH 3O9WC 5IBUG 4MJIB 4APQA 1DLFH 5BS0B 4Q74A 4WFED 5EUOF 5GGRA 5F7EL 4M7JH 1MFCL 3AGVA 1IQDB 1KB5L 1B2WH 4QOKE 5DJ0B 3DGGB 5DD0H 4JDVB 5CD3A 4I48B 3VD3A 2DIAA 5BZDA 3MLUL 4LP4A 5KW9L 2JK5A 5F3BB 1WQVT 3NABH 4N68A 4LCYB 4WU5B 1YUHA 4WVRA 3EYUL 2NTSP 1OGAA 2V2XB 2WBJD 4QRRE 4JDZB 4J6RH 1KB5B 4XWGH 1AE6H 1IM9B 3F7VB 3X13B 1D6VL 1MUJA 1NLBH 3E8UL 4NDMB 3A6CH 1BWMA 5E8NA 3BFOA 2AXFB 3GM8A 3P30H 4M8VA 2P7TA 5KANG 1IGYA 4ODVH 5FCUH 3VFPB 1V7ML 2VLJD 1G6RL 1FVEA 2OJZH 3RIAF 1RJZA 5FUZH 3V4PL 4KXZH 4X4YB 3EDFA 4TN9A 2FRGP 4OZFA 1S7VB 4XNXL 2VLJE 1T2QL 3P4NB 4PGBA 2V7NB 3IU4L 1T5WA 3V8CA 3WS6C 2GAZA 3MV11 1G6RB 3CH1A 4RDQG 4JFYB 4HS3A 4XPBH 4MSWB 4NQCE 1KXQE 5HPMA 1T6VN 1QNZL 1T1ZA 3BDYL 2CLVB 3HMXA 2MKLC 3A67H 4XHJD 4GJTB 4HMCA 2XQBH 4LCWA 1FYHB 2EYTB 4L4VB 3I9GL 3DX8A 1S3KL 2I07B 1MFBH 3BESR 4UTBL 3ARWA 5EUOB 4OLVL 1HHKB 4N1EA 1MFEH 3EO9H 1UCBH 2ICWB 2GTZB 3K81A 1LO4L 5KZCB 1MHCA 1AD9B 4QHKI 2N56A 5ICZA 4LASH 3RY6A 4N0YH 5L2KD 1EEZA 3PNWA 1BQLL 4OCYL 5EOCL 3WE6A 3VXOB 4LARL 4OBRA 2OL3L 1DL7L 1MNUL 1NFIA 2R0LH 4FXGB 1LK3L 4X5LA 4LHJB 4YQXL 5L2KE 4I13B 3TT3L 1M7XA 2YN5A 2EDJA 2F5AL 5FYLD 5TFSL 4H1LB 3WJJC 3B9DA 3I02A 3QDJA 5KN5A 3VWJD 4HJJL 3CGTA 2DKUA 3UROR 4F9LA 4L9LA 2FIKA 2NW3A 4BKLB 5FYLE 5DZNA 2VLLB 3RA7H 1JHLL 2QBWA 3CZFB 1QFPA 3DBXB 4L8BA 2BVPB 3D69B 2YC1A 1M4KA 5TE6L 1INEH 3TH4T 5D2LF 3TF7C 4NRZA 2EKJA 4HJGB 3Q1SL 2ZCKL 2FR4A 5ALBL 1B0RA 2JIXA 2BOCB 5IOPB 5FA3A 4KFZC 2P44B 4FQ1H 5D96C 4LBEB 5ITFB 4Z78B 4W6XB 5FHBL 3BGFC 4RMQA 1QACA 3MUGB 4NRYA 4Y5YB 3VXTB 4YAQB 1S78C 4HUWA 4WTZG 4B7IA 5D70L 5FYJL 5FYJD 2EE3A 4K3GA 2VKWA 3QHTC 2XPGB 5KSAA 1N7MH 4OB5L 1FVCA 2Z92B 4JFXB 4H26B 5H94B 3O6FA 3S35X 1M05B 3EO1A 2ADGA 4UT7H 5CJXC 1XGUB 1HHHA 3FN3A 3W0WD 4P49A 2ZSWB 3QI9A 3F7QA 4BFIB 3D9AH 4X9GA 1KT2A 1UB6B 4PGDA 2NX5B 4PB9H 1MI5B 1QRNB 2NXYC 3W0WE 4YPJA 5E5MA 4P57A 2M8XA 2Q20A 4C56B 1NC2A 4PGEB 4JQXC 5DT1L 5JR1H 3FB8B 5EO0B 5EO1A 5BCAA 1Y18B 4H5SA 5MEND 1AIFB 3V4UH 4HIIB 4FZ8H 2OSLB 5D2LB 1BX2A 3BMVA 1G9NC 1YJDL 4H88H 3ZYIA 4QYOA 1NL0H 4ERSL 1WLHA 3JXAA 3IXTA 4RNRB 3OKOB 5MENE 1WBXA 4K9EL 4WWKD 3VFUB 4UB0H 3ARFD 4R0LC 1KIPA 3MJGX 4NN6B 1J88A 1IFHL 1F8TL 1GAFL 1KYOJ 2Y07L 4X8JB 3I6LD 5FHAH 4Q58C 2ESVB 1U2HA 3WCYA 1K4CA 5D1QC 3VG0L 2D4FA 4OFVA 5IB2B 2KQNA 2W9DL 3D18A 4P2RA 5HVFB 3BH9A 2OI9C 1SM3H 5B8CB 3FRPG 3O6LL 4HEME 2B4CC 1FYTD 1Q1JL 5I66A 4JY4B 1CFSA 3LKQB 4MA1B 3FCTB 4XGZB 1F4YL 2IFFH 3PL6D 4JFPA 5K9QG 4LP5A 4IRSD 1N5AB 4ONGH 4MNQD 1CYGA 1P7QB 3K8KA 3D87B 4OF0A 4DTGL 4TSAL 5CEYB 4U0RB 2OJEA 3SDCD 2AV7A 1HH9A 2HT2C 3B9EA 2R23A 4APQD 4PD4J 3GHEL 1YY9D 1LE5A 3LPWA 4MNQE 3T04D 3N9GL 3MBEB 2YD3A 4PREB 4DZ8A 1MJ8H 1BFTA 5EC1A 5F1OB 5CJ5A 4L4TD 1MIEL 3JTTA 1CDCA 5ISZB 4XAWL 2ZUVA 2VDNH 2C3WA 3BO8B 4M3KB 3RWGA 2D0FA 1JJUA 3GMQA 1OGAD 4L4TE 4RFOH 1R6VA 1C12A 2YEZB 3T4YA 3X3GH 1MQ8A 2RCSL 5BXFB 1DVFA 2JK5B 2YMXL 2H1PL 2XOTA 2MCPH 3NZHL 3PHOA 1WFTA 5IB4A 3QJHA 4KJQC 4KGLA 4TNWF 1WFUA 1BJMA 1RUKL 4OQTH 3T0DA 4JANB 3R0MA 3ZDYF 3RUGA 4Z5RB 5E8NB 3NPZB 1MFDH 1TDQA 2P7TB 3LQZA 4KWUA 5D6CA 4YXHL 1FVEB 2UY7A 1ROWA 1RJZB 1FFPB 3FB6B 4ZTPL 3GSVA 4XVSL 2OMBA 3HMXL 5HD8C 2AJYH 2GSIB 1N3NB 4J1UB 4LCWD 4PGBB 2F74A 4TSBL 2BVEA 1T5WB 3WFBH 2RFXB 2GAZB 5IHBA 2VZVA 5F9JA 4IBLT 3OSKA 1GCFA 5CBAB 1LE9A 1ZWIB 3MRCA 3DUSA 4NPYA 4R4BB 1DBAH 2NY2B 5CJ8A 4LSRL 4PLKD 5HDQH 5ILTL 1YEDA 2IADA 3U4BL 4H25A 5EU4A 5E24E 5TF1L 4KMQA 1MHCB 1G6VK 1CGVA 2DYPB 3KLAB 3O2WH 3WE6B 1RUPL 5J1AA 1C5CL 2PKDA 3CFCL 2FX9H 2ZSVA 5GZND 3MJ8B 3V4VH 3TIEA 4KROB 3CFBA 5HYSG 1LEGB 4FS0A 4X98B 3W5MA 3QG7H 3HR5A 1U8LB 4UNUA 3VWKA 5ELIA 4FQHA 4DVRL 3I02B 1TXKA 3QDJB 3T2NH 3LIZL 1YPZE 4L9LB 3BPCB 3S34H 4CN1A 2FIKB 2NW3B 5DC9B 4Z7WB 1RZJC 1W72A 2NY5L 2JIXD 4I8DA 4L8BB 1S9XB 3S98A 4YDVA 3MGTA 3Q6GH 3Q5TA 1GH7A 2H8PB 2BDNH 3RNKA 4PRPA 2YC1B 3HC3L 3D5OF 4PJFE 1JTTA 5DO2C 3T77B 4NRZB 5JHLL 2P45B 4D0DA 4Z7OF 5BRZE 1AXTL 3E2HB 4PV8A 4BZ1H 2FR4B 1RUQL 1B0RB 4NBZB 3IDMB 5CILL 2DICA 3IDGA 4OCWL 4ZUTB 4WIQA 3H9SA 4XP1L 4BFBD 5F7FA 3CUPB 1CIDA 4IJ3C 3TCLA 4PYHA 2CQVA 3DROA 1LGVA 1YNLH 7FABL 4LVNB 4Y5YC 4XWOD 1XF5B 5IVXA 3MA9H 4NSKA 2KBGA 4HBQA 1KLGA 3SOBH 5GS1B 3BUTA 1KG0A 2NZ9D 1S5IL 4M6AA 1NBYA 3O6FD 4Y2DA 3D2UD 2MPAL 3BN3B 3MCLH 5IKCA 4HJ0C 4MB4A 1OSPL 4WEBH 3HR6A 4ZFOL 4HCRL 2NYYC 3QI9D 1QVOB 2J3SA 4JRWA 2VABA 2VXUH 1PZUB 5KSAB 3VFSA 1VACA 4PUBH 5FXCH 4PJAE 3H3PH 3EO1B 3KYAA 1R3KA 4ONHB 3VA2C 4JPVL 4ZFOB 3CMOH 4QGTA 1S5HB 4MCZA 2UZIL 4CADA 1ZA6A 1KT2B 2PW2A 4OZHE 2KDGA 5E5MB 4P57B 2Z8RA 4HDIA 1OTSD 1CE6A 4RMUA 4P23D 1A7RH 4OAWA 4YHZL 1Q0YL 1SMAA 1NC2B 1I1RA 5C0NC 5E8DL 3G6JB 3LB6C 1I85C 1CBVL 4EZMA 3IFOA 3ZTNH 4JFDB 1BX2B 2D0GA 4EDWH 4QYOB 4NN6C 2MTPA 5IJKA 4OLWL 3LRGA 4P2RD 3VD5A 1CD8A 1JZ2A 2DQUL 1WBXB 4FQJH 4OZGB 2AEPL 2E9JA 3UAJD 3CK0H 1ES0A 4WNQA 3K0WA 1HINL 5A43C 3RHWF 2GIYA 1K4CB 4QT5A 4KKCD 4XC3H 43CAA 3D18B 3V6ZA 2XT1B 4HH8A 3BH9B 4MA1C 5AZ2L 3RUGF 3U79A 3H7BA 3F8UB 2B5IB 2N1KA 2DQTH 1T0PB 3BPNB 2APTA 4YBHA 3FZUC 1MCPH 3MJ7B 4ORGA 5DVKA 4U0RC 4U1LB 5DR5L 3WXVL 3L7EB 1KENH 4XMLL 4P9ML 5DMGD 3G6DH 3QO0A 1TZIA 3L3HB 2BFVL 5J6HB 2OJEB 1CICD 1D5IH 4PPTA 1HH9B 3PJSA 1EJOL 2DWEA 5HYJD 1ZTXH 3NIFF 2R39A 1TVBA 4DZ8B 4X6EA 1NAMH 1RAMA 3PWJA 1KN2H 1QR4A 5FYJU 1YEKL 4M1DL 4OCLC 5HYJE 4MLIA 2B20A 3NCFB 1S7UA 2EH7L 2AEIT 1A6ZA 3X12A 1TFHA 1DVFD 2E9WA 5T3ZD 1TZHB 3RWGB 1K85A 2DLEA 3IGAB 5IFJB 4KJYA 2QADB 4OKVA 2GY5A 2FD6L 5IIEB 3OZ9H 5T3ZE 3QAZC 5E08L 5LQBL 3TO2A 3DNKA 1QTYT 1U95A 5JXAL 4PB0L 3PHOB 3OKMB 4I3SH 1RZKC 3GI8L 3JWOC 5D7IA 4DGYH 4XPAL 3T0AA 5I75B 3KXFA 1URLA 1FIGL 4DJMA 4NNPH 3IFPA 4XCYA 3RDTD 3LQZB 5TGBB 4ENEC 2IMNA 1QSEE 1JI1A 1H5BB 4E41B 4Z7NF 4WU7A 4D9LL 1FGNH 4P99A 5CJOL 5HTSA 2FJGA 3MV7E 1TMCB 4JVWA 3H3KA 2FGWL 1KTRL 3IF1B 4ZPTA 4OLYL 5J89A 3WN5B 1FL6A 5ETUA 4CU8A 4RRPA 3VXSD 5SWSA 3OB0K 1BQHG 3QQ9D 3CVHA 5L8LB 3MRCB 3TBWA 5C0IA 3VXSE 2GUOB 3WHXB 4WFFE 1IGIH 2A9MH 3IKCB 5IVXF 2ZPKL 2WM0A 2RJMA 3U6RA 2M1KA 1YEDB 5DFTA 5FM4A 2ICWI 3TCXA 5IMMA 1TQBB 3TNMA 4N5EC 1FIEA 3HI6L 5MEPA 4FOMA 3DV4A 1MJUH 3RPKA 4M7ZC 4KJWD 3FO0H 5AAMA 3L3IA 5L6YL 1FO0A 4PJDF 3GBMH 1SEQH 2AK4B 2ZSVB 2COQA 4MB5A 1C5BH 3F12A 1UH3A 2FLRT 3CFBB 4P5TB 1W72L 2CXGA 3BP7A 2DD8H 3ZE1F 5DQJA 2VDPH 2W0KA 3BH8A 3UJIL 5DHYA 3ZHKA 3HR5B 1OTTD 1AP2A 5F96L 4Y8DC 5DLMH 3VWKB 4OF3A 4PRPD 3P4MB 3TJEH 2FATL 4AEIL 3F58L 2FBJL 2VO5A 2BRRL 4DN3L 4LNRA 2XA8L 3KPPB 1WIPA 3BP4A 3NPSB 1W72B 3OPZL 2GEEA 2R69H 3T3ME 3H9SD 1A1NB 1D3CA 2B7DT 1AO7D 3MGTB 3NCJL 3E2HC 3FFCA 4WI3A 4YDVB 2Z35A 5IVNA 3DX6B 5IK3A 5HI3D 3OJVC 1RIVH 1CIUA 3RVVC 1E4XL 5D7JB 4D0DB 2DMKA 3QULA 1AO7E 4O2FA 1I8LA 1RIHL 3FT2B 4LVNC 5IB5A 2DBLL 1WAAA 1ZV5A 4NQSA 1FL3A 4KMLB 4MWFA 5F8RC 5HGDB 1IC4L 1M6OB 3WFHA 5DJXB 5GS1C 4X4XB 1O5DT 3L95A 5JHDA 3VFOA 1AJ7L 4AENA 1DQJA 1EPFA 1QBBA 2F8VA 2QQKH 5GRUH 2VUOA 5IVXB 4OZIA 2FWOA 4X7EC 4HPYL 4BQCA 1NGQH 1KLGB 2H45A 1KG0B 2R9HD 1E28B 2BXZA 2FJFB 3IDNA 4Y2DB 4QTIH 3U36B 4BUHA 5J9PB 1WBZA 3ULUH 4O4YH 3V0WL 1I8KB 2VABB 1U3HD 2ZCHH 1I9RL 2NY3C 4PJDB 2X9YA 1EERB 5DTFB 4K07A 5IV2B 3VXPB 1QFUH 5I1DB 3S36H 5BMFH 1A0QL 1NCDL 3DURB 4N0UA 2E6QA 3BN9D 3DWTA 4Z7QE 4ESKA 2F53A 3TIDB 3D39A 1L0XA 1ZA6B 4CAGA 5D93B 5BZWA 4LFHD 3HI5H 1JGUH 3A6BH 4WCYH 5HHPA 5T1LB 3HE6C 2HN7B 5GGUB 1SJHB 4P3DA 4PP1D 4D3CL 4DKFH 3RZCB 5INCB 1K8DB 3EZ8A 4NC1C 2VAAA 4P2QA 5K59E 5IB3A 3KYOB 3HB3D 1OGTB 4IEFB 5EZLB 1CTNA 2P4AB 4YLQT 3MA7A 4V1DE 1QUNA 2Y7QB 2HTKD 3ZYZA 4GRLA 5AWNH 1JK8A 5FKPB 5JUEH 2YUVA 4PJXE 3QQ4A 5GSRB 4XVUC 4DW2H 1YYLH 2H2PD 1BECA 1JYXA 1QLFB 1KJMB 2G75B 3HKFA 4LGSB 4KTYA 35C8H 3ARYA 3CSGA 4U6XB 2B5IC 5D7IF 5C0RL 1G7LB 3BPNC 4LLDA 1T89A 1FNFA 1BD2B 1A7QL 2GJ6D 3LZFH 1F2XK 4U1MB 4XCFH 2A1WL 2EE9A 4I9WD 3GSNH 4HFWA 5CS7A 4ORGB 1I3GL 3QNXA 4LPYA 5DSCA 2CRYA 1MJ7H 4WY7H 2GJ6E 3DHJA 3SQBA 1JNHA 1R5IA 2PR4L 1MHPL 1NH6A 3HNSL 1S9YB 4I9WE 2ZOKB 4EI5B 1UWXH 4JM2F 4MD4B 3PE9A 3STBA 4Q9BA 4JRXD 2QQQA 3PJSB 2CR6A 1CG9B 4FFVC 4G8IA 2R1WA 1CN4A 3HG1D 1MHEB 1FRGL 1NC4D 4X6EB 1Q0XH 1FL5A 3PWJB 5GGVY 3I75A 4JRXE 4LLMA 4GQ9H 1PEZA 4ODHH 4YHYB 2H9GA 2HT3D 4PJGE 4Y4HB 3HG1E 2OX5A 4JQVA 1MREL 3KLDA 4PY8I 1AI1L 4GKNA 2QADC 3QDGB 1P4BL 2VL5A 1FNLA 3LKRA 5FGBC 4EIGB 4JZNB 3M17A 2GTWB 5CZKA 3S37L 3RKDC 3CXDH 5AD0B 4WI8A 2ZWLT 3KXFD 5JW3H 4OKVB 1XCQA 1MWAH 3TBTA 2CK0H 5DA4A 1DE4A 4CDHA 1DBJH 4JJHA 2HLFD 2R2HB 4M1GL 1U95B 2WIIA 3TO2B 5I75C 3KXFE 4G9FB 3HNTH 2CIIA 3AMKA 1NBZB 1T1WA 3ARGC 3HI1B 2J6EH 3MRQB 3FO1A 1H5BC 1MEXH 4D0CA 5ID0A 3B4NA 1SQ2N 4XCYB 1JYWA 1W8NA 4L8CA 4TPRH 1NJ9A 4ZYKA 2HFFA 5SWSD 4ZO8A 3DVGA 2EDTA 3WN5C 4WU7B 1EAPA 4ZOCA 2FJGB 3HZYA 4GAFB 1AKJA 4JGUA 5F3HA 5GGQL 4ZPTB 4Y1AA 5FK9A 4AT6A 3S97C 4JM2B 4QHLA 4ZXBB 4MXVF 2CKBA 5IMOA 3EDKA 2DDQL 5IESL 4UDUA 1WAAF 4JQIH 2OP4L 5JIKA 5C0IB 3T0ED 1JGLH 3TBWB 3HHRB 5C09E 3T0VA 2AXHA 3ZSTA 3VFVA 4JR9H 4I0CC 4XBEH 1FV1A 4DK6A 2LABA 3IVKB 3OR6B 1TNMA 5FF6B 2PXYC 1TQBC 1QSVA 3NAAH 4U1KA 3RI5K 4CKVX 1FO0L 4OZIF 4P46D 3EO0B 3R06A 3T0EE 1F3DJ 2P5WD 3U6RB 4MLSA 2E7MA 4B5EA 5C71A 2YD8A 1NCAH 2GW5A 1FPTL 1LO5B 2QEJA 2BVOB 3LN5A 5FDWA 2P5WE 5AEAA 3O6KH 4P5TC 3BKMH 4M93C 1MCDA 1DSFL 1N64H 2XXCB 1FO0B 1XF2B 2AI0H 1VFOA 1GIGL 4KHTL 3CH8A 3E1F1 3QBTB 1ITCA 5EOTA 2B1HL 4ALAH 1U3JA 5DQJB 3KYKL 3MLYL 3BH8B 1UYWL 3NIGE 4U33A 5DHYB 3PQYD 1OAUL 3DI2B 4DKEH 1RUAL 4KC3B 1CFTA 4JHZA 4BZ2H 3NPSC 4HWZB 3QFJB 4HUUB 3UZVB 5C0FA 3STZA 5E6YA 4X6FB 2BHYA 1T20B 4MS8C 3PQYE 1SMOA 3V7MA 4LNRB 1B2WL 4PGCA 1ZHKB 1RUMH 4ZUVB 4KK9C 1H3PH 1U3YA 2XFXB 1KIRB 3MACL 2I60L 3OBAA 5DHVA 2EDFA 5D7JC 4ZNEE 3FFCB 1JHKL 3MCKA 2LU7A 2Z4QA 4S0TD 4LHUB 5IK3B 1ZLUK 4PJ9B 1D9KC 4YXKH 3NH7L 4QHKJ 4XBGA 3IDUA 3QXWA 5DA0B 5CIPA 4O2FB 5LWYH 4ZG1A 3MZGB 2NMSA 5BJTA 1RQ5A 3BWUC 1MELA 2ZKHL 5FCUL 3U46B 1JMZA 1JWUB 1RK0B 3JUZA 4PJHE 5IF0B 1WIOA 3L95B 5IW6A 5JHDB 2OJZL 4HQQH 4AENB 2VITA 3B9KA 4OZIB 2FWOB 4R4FH 3NACH 1NPUA 5A16B 4OQTA 4NQDB 1ORQB 1S7RB 3MBXL 4F3FB 3AS3A 4WTZA 2HJFB 2BVYA 3NIDF 2GK2A 4OGAD 3O3EB 1HHJA 5L2JB 2QQLH 5BO1H 3WD5L 1G7PA 1Q9LA 4J3UA 1FZMA 3L6FB 3RAJH 2EDNA 1P1ZB 2X09A 1N6VA 4P4RA 4LPWA 1BFVL 5DJZA 2IFGA 5SWQA 4MDIA 2XQBL 1O7VA 4TUOA 4U6VL 5D93C 4N0UB 1D5BB 3R8QA 2NY1B 5EO9A 2F53B 1CDUA 4LQFH 3D39B 1P4IH 5KTEL 3RZCC 5BZWB 1JGEA 3T65A 2IBGA 3EFDL 5HHPB 1KV3A 3L3DB 3PWUB 3OG6B 3MJ6A 1P9MC 1U93A 4P3DB 3FB7A 4I77H 4GRLD 4LASL 3D3VD 5LGKA 3IRPX 1CDJA 4P2QB 4QOKB 2DLIA 3GSWA 4EUPB 4NBYB 4MJ6A 1FH5H 2R0LL 3MA7B 2IPUG 3D3VE 2B1AH 4GW1A 4IMKA 4JZOB 3DUUA 1JPSL 2ADFL 4QRRB 1B90A 3JWDC 1UM5H 3QQ4B 2CIKB 4BSJA 1N6QL 2EXYC 4XNMA 1OPGL 2EC8A 1RI8A 3MFFA 3RA7L 4OFKA 9CGTA 2UYLB 4FQIH 5J7CC 3GUTB 4U6YA 4YFDB 4NKMA 4XMKH 4PTUB 3MRNA 4X9BA 4YBLB 3WXWL 4NO0B 5EA0L 4JKPL 4PJ5A 4R4NC 2ATKB 4G8GA 4P4KD 4DUXA 4DVBA 3REVA 4HFWB 4S2SA 3HUJA 2BY3A 1PG7X 3QNXB 4EI5C 1TZGH 5DSCB 4NQCB 3MR9A 4UOJA 3NTCL 5FO7B 2W0LA 4JPIB 2XZQL 1J8KA 1MCWM 3IRZA 3LSOB 5IGXL 1HDMA 1JPGA 1LHZA 4OUUA 1T7WA 2BSSB 2IPUK 4JHWH 1J18A 2H32B 2X1QA 4NUJA 1F3DH 4QRSA 3VXUA 3VXRE 3SPVB 2VLME 4X6CE 4YHYC 5I1KH 1M1SA 4YHPB 6FABH 4Y4HC 1QKZH 1FL5B 3DUHA 4GBXB 3MODH 2HKHL 4KRPB 2DL2A 2H9GB 5HI5D 4JO1L 1YQVH 4N9GA 1S7XB 1U6AL 3PGFL 2C3VA 2AXJA 4GKNB 2FZ3A 4K8RC 2X89A 5E9DA 3ZE2E 2VISA 4LVEA 1QRKA 3LKRB 2XZAL 3MLZL 4J3XA 4OT1H 4HUKB 5I0DA 1CWVA 3D9AL 5ESQA 3O3DA 4YX2H 3JTSA 1JZ5A 2W9EH 3PG2A 5DHXB 2QL1A 2QV2A 2XV6B 1A6UH 2CDEA 1JWSB 3GNMH 4X5XB 3QG6A 5C0CE 5AG8A 1GVIA 3L3JA 1AKJD 2NY6B 3DV6A 5KOMC 3FO1B 4D0CB 5ENWB 3S5LG 4UNVA 4L8CB 1NJ9B 1NL0L 2HFFB 4ZYKB 1TJHH 1UC6A 4L5FL 4RMSA 2CKBL 2Q6WB 3QUMB 1EAPB 4OM1H 3IAPA 4UB0L 4JM2C 3ARTA 1JZ4A 2HLAA 5CUSH 5F3HB 5I6XB 3W9EB 4ZXBC 1MLBA 5C3TA 4Y1AB 2VSCA 5FK9B 5ID1B 4XZUB 3KJ4B 4U7SA 1DJSA 2ZUYA 4QHLB 2M2DA 3GMRA 3UTSA 5IMOB 1IAII 1YMHB 3V2AR 5ITBL 1NMCB 1QFOA 1NMAH 5GGTH 3LV3B 4LLQB 4PBVC 2E7LA 4PS4L 1IM3A 3PV6A 1MJJB 3ZE0E 2HKFL 2NZIA 3DMMD 3IKKA 5CP7A 4LAJH 2A6DB 2X4QA 3ARDA 5D9SA 4PR5A 4JFOA 1PG7L 4F33A 2NTFB 3C5SA 3QPXH 5EU7C 1REIA 4LSUL 4BSVA 5DGQA 2ARJQ 1IT9H 2XY1A 4NJ9L 4PRDB 4FQCL 3ILPA 5LAXA 1OAQH 1U41A 5DI8A 1DUZB 1YECH 5J13B 5D71L 3JSSA 5EOTB 1CDIA 1NSNH 5JOFA 1FAKT 5JDSA 1AH1A 3GSQB 4WO4B 4KDTA 1TJIL 4TYUA 1K3IA 4JJ5A 2VUYA 3HPJA 4G43A 4OFDA 4B41A 1CFTB 3BSZH 4ZS6C 4XP5H 4NZTH 4U1HA 2DAVA 1CK0L 2VDNL 3X14B 1Q9WA 1WWBX 4BH8A 5DWUH 4PGCB 4YK4C 3MRFB 3SDDB 4PJ9C 5JPNB 1ZT1A 4NO2B 3MRLA 1EO5A 3EIFA 1NMBH 3TJHC 4H20H 2Z4QB 4NWUL 2MCPL 5DUMH 2V6HA 2JCCA 4OBSA 4XBGB 3B9KD 3EOAA 5TE4H 2ORBH 4NNXB 4OQTL 5GIRA 4QRUB 4L8DA 1A9BA 2PO6A 3K2UH 5HGHA 4HKJA 2E6JA 1ZS8A 4Y5XA 3PGDB 4WHTA 1Q94B 5EU5B 1HQRB 1MFDL 3K7UA 5CEZE 5BJTB 1J11A 5BOZG 4NQXA 1INDL 1LNUA 4ZD3H 3E0GA 2XTJC 4FN0A 2A6JB 1DBBL 2IANE 5F9DC 3J8F7 3MLVH 2NY0D 5I76B 4G7YH 4GW5B 2AJYL 4LKCA 1LILA 1R3JA 4MXWL 2YZ1A 2X4RB 4GXUN 5FO9A 3WFBL 1HHJB 1S9VA 3F65A 1A9EB 2Q8AH 5D7KD 2HA1A 4ZQKA 3QIUB 3HUJF 2ZCLH 1HHIB 1MRCL 4J4PC 3DRQA 2NY1C 2JJSC 1DBAL 3OWEA 3RPIB 3QO1B 4P4RB 1PX4A 1R24A 5D7KE 1YA5A 3T0XA 4XRCA 4IHOB 4TUOB 3MLPA 5B3JF 3LQAL 2X4TA 4RAVA 2Y1VA 1T1YA 1HWHB 3KR3H 5EO9B 4YGVA 3WIIH 3PP3H 2WWMD 5DD3H 5DK2A 1EGJA 1DLHB 4XI5C 1ZANH 4WFGD 2B2XH 5DVLA 1JGEB 3TBSB 1D6EA 4G6KL 2VL4A 5DD6B 4E9LA 2APXA 2DI8A 1ZHNB 4L4TB 4ACPA 1S7QB 3O2WL 4WFGE 3U30C 4FP8H 2FX9L 5GQBA 4MJ6B 1H9VA 1QHOA 1BM3L 2CH8A 5KSBE 4Q9QL 1XAUA 3DUUB 4OCXL 4OJFH 1MCSA 3T2NL 4Y16B 2HT4C 2QLVB 4PJ5D 1RZGA 1AXSA 2FH8A 3S34L 1EMTL 5JMRA 4G8EB 4XPGL 3GBNH 3MFFB 2LTQC 1VFBB 1F42A 1F6LL 1FNHA 4D9RD 4UV7H 4Y19A 5I17A 3MROA 4Y8AA 3Q6GL 4IIQB 3MLWL 1MCJA 2BDNL 4BSWA 5KVFH 2MJWA 4OIAA 4JFFA 5EULV 4NZUH 3HAEG 4D9RE 2A74A 1G7IA 2VR4A 4BZ1L 4G8GB 4HW6A 1H3WM 4OLZH 1CDYA 1JCKA 4HD9A 3VXUD 4TOYL 2BVQB 3HUJB 4ONFL 1SEBB 1TJGH 4FFYH 4KK5D 1LEIA 3MR9B 4RMVA 1EVUA 4FTVE 1YNLL 4EOWL 2MWCA 2DLFH 5CMAA 3GKZA 3GRWA 3V6OE 1JPGB 3BQUD 4PJIE 1CF8L 3LDBB 4LMQE 4YDLB 3GJFB 4XHQA 3AC0A 4XHJC 4G8FA 1OL0A 2V2TA 2QR0B 4GBXC 4NUJB 2FGZA 2X89D 1BFOA 3SY0B 1FSKB 2F9BT 3KLHD 3BKYL 1MAML 4WEBL 1A3QA 3FOLB 2R0ZH 3X17A 3I2CL 1A1MA 1HOCA 3DGCR 1MIML 1IEBA 5EN2A 4K2UH 1S8DA 4N9GB 1NFKA 5EWIH 4PUBL 2C3VB 3OKNB 5E9DB 3MMEA 2EXWD 2FYYA 3H3PL 4X5WA 4HWEH 4Q2ZA 3EHBD 1OAXL 3EOTL 3D25A 1KEGH 3CMOL 2PTTA 4TTDC 5ESQB 3O3DB 3JTSB 1A6AA 1FGVL 1NCUA 3CD4A 4O02L 2XZZA 2NY6C 3ROLB 1KJ2H 4S1DD 2HFGL 4WTWA 3U7WL 4NHCL 4JG1H 5GJSH 4M6MH 2AK1L 5TH2A 2CDEB 3ARVA 4XXCC 2YUXA 1ZVSA 4M61B 2YD6A 3QEQE 5IEHA 3T0WA 4BA8A 1BAFL 1O7SA 2W91A 3AFLA 2QJDA 3SHSA 1FLRH 3LEVH 5I6XC 2UZYB 2BK8A 4JM4H 2C7UA 1G1CA 3QB7C 3UTSD 5BRZB 1KJVA 5I71C 3B43A 1KC5L 4OGXH 4PLJD 3AY4C 1GC1C 4ELMA 1SYSA 3G5ZB 3UTPD 1ZT7B 1MLBB 5M7QA 2GCYB 1FDLH 4MNGA 3UC0H 1WBYB 2JCCF 4ODXA 4K3HA 4OGZA 5DVNA 1BQHA 3ARDD 1KCLA 3TWCH 3UTPE 5D7SL 5DUBA 4AEEA 2O5XH 3QXDB 5E56A 3CDYA 1U8MA 2MQ3A 4YHNB 1F58H 4R96B 3MPCA 1CXLA 1MCPL 3SQOH 1GZQB 3G5VA 2ZJSL 2DTMH 2DS4A 2F58H 1DANT 4RFNC 2KH2B 4WI4A 4HBCL 4PRHA 4MAYA 1XGTA 3BXNA 3RGHA 3HRZB 4R2GB 4PJAB 3ZT5A 1X7QB 3L3GA 3VFRA 5HBBA 4BSVB 3U2SA 3EYQD 4XCCH 3TT1H 4L8SB 3ILPB 2FIRT 4WO4C 5T1MA 15C8L 3CXHK 4HIXH 3BE1H 4G5ZL 4MJ2A 3L5HA 1EDQA 4CL7A 1GYAA 2VIRA 3WS3A 4KKLC 2FX8L 4QKXB 5JOFB 4QXUH 5B4MD 3VJ6B 5FM8A 5JDSB 1O0VA 2WUCH 2AP2A 4JJ5B 5GJTH 3CC5A 3HPJB 4G43B 1XH3B 3SDDC 1MCHA 1FORH 4S1RL 5KVDL 2VXSH 4RISL 1IC7L 3SGJA 4F7PA 5FUCE 5H37G 2PO6D 5FB8A 1CLYH 3BI9X 3NBNA 4G6FB 4GRMA 1ZT1B 3BKCH 3MRLB 5CBEA 2H6PA 4G6ML 3KPLB 4HWBH 2ICWJ 3FMGL 3RY5A 4LLVB 3ARBB 3ILQD 4DGIL 2XXMB 5DD5H 2KKQA 2JCCB 4FXKB 1AQDA 4I3SL 1BZ9A 3EOAB 3PGCA 1ZA3A 2MNUA 1BZQK 3QA3B 3QEGL 5JORA 4L8DB 1EJ6A 1JYNA 1MWAA 4LCIL 4Q6IA 2IGFH 3FT4A 2AERT 3ESVF 1B0GA 2XIDA 2NNAB 4NQXB 1LNUB 1YEEL 2D03H 1BIHA 3BT2H 4KVNL 1V3KA 5I1CH 5KG9B 2VR5A 2QSCL 4HWUA 3LAFA 3M45A 1FGNL 2VDRH 5DMIL 1JL8A 3JV6A 3PXHA 2DMBA 1X5ZA 2FEEL 2J6EA 4M9OA 4RGND 5L0QC 1R3JB 3QIUC 2E8YA 4AIZB 1OAZH 5HGBB 4JRYD 3O45B 4IRSC 3EYFA 5HHQB 5L88L 1G9NH 4PG9A 3QH3B 3GMNA 1EGJL 4NFCA 4Z95H 5FGCB 2FO4A 1YEIH 5D2NE 4PP2A 1RFDH 3LS4H 4JRYE 5CSGA 2A73A 4YUEH 1XGQB 4K94H 4FG6D 5FECB 2A9ML 1JTOA 4GAGH 1EZVY 2X4TB 4RAVB 1T1YB 3MV9D 4NN7B 5CEXA 1GGUA 4H1LG 3FFDA 5DK2B 3ESUF 3LQAC 4X9IA 1D6EB 3MV9E 2B4CH 4UBDD 3AXLB 3TH2T 1MCRA 2OCFD 1ADQH 3DRTA 3WUZA 4XXDA 3ULVF 5D6DC 2EDWA 2PCPB 4LIQH 1E4KC 5ICXB 4Y16C 2DD8L 4HAFA 4HT1L 3S3SA 2NR6D 4Y19D 2FHCA 4L29A 2XYCA 2Y72A 3ARSA 3MRRB 4K7FB 1IGFL 2O5ZH 4K3JH 3EAKA 4JFFD 3UDWA 1Z6JT 3HPLB 3IDXH 5AYUL 4NM8L 3VFWA 3DARA 4IIQC 3MREA 5I74B 2MHAA 2JE8A 1UB5B 1JUFA 5BVPH 1YEFH 5LGJA 1QSEB 4JFFE 1FAIH 2F5BH 4HIJB 5EORH 3VXNA 5MP6L 4F9PA 5T5NF 4F2MB 2IEPA 3MV7B 3GRWL 3X11A 4MNHA 3W9DB 3OHXA 5EB9A 2A74B 4PJCE 2VDML 1UWGL 3BP6A 3DIFA 1VCAA 3UPCA 4JKLA 4PFEA 4RWHA 2A6KB 1NCBH 2F54A 1H15A 4I4WA 3RIAK 4ELMF 5JLZA 5EOQL 1LEIB 3LMJL 5F7EH 2GFBA 5E7FA 1MFCH 5I1LA 2ADIB 1KB5H 4Z7UF 1BJ8A 5GRUL 4PJEA 2VZOA 3ULVL 3E6FA 1P7HL 1QA9B 1NGWB 4PLKC 3UYOD 5JQ6H 3DO7A 4QXGL 4MQTB 3ZLQC 5F7NC 1BFOB 3GSOB 4QTIL 1I1AD 4QRPA 5JXEC 3ULUD 1EFXB 2Z0BA 4AM0A 3EYUH 1YEHL 1PY9A 2GJJA 4FMFA 3UYPA 3EJZD 4L3ED 5KVMC 3CFEA 1A1MB 1IEBB 1D6VH 2X7LA 3ULUE 2FH6A 1I7ZA 3MMEB 3HA0A 5GZNC 1WUNT 1G6RH 1LP9E 4L3EE 1BBDH 4LSDA 2R29L 4FNLL 1I9JH 3V4PH 4J3WA 1Z9MA 2PTTB 1BBJA 5TDPA 4G3YL 4ZUSB 1A6AB 3U1SL 1KIQA 4PY7B 1T2QH 2JJTA 1VENA 2WMPA 3BGMB 5IG7B 3IU4H 5IQ9B 4DKFL 3TFKD 5CZVL 5TH2B 4KK8C 5I16A 4I2XA 4NM4L 5IP4A 1N6UA 1V3JA 2Q76A 3BDYH 1BOGB 3TZVD 5HVGB 3QRFM 3FT3A 5F71A 2NY4B 1FLTX 5EUKA 4FQQA 3I9GH 2C7UB 4X6DE 3WDIA 5AWNL 2IALA 4N90D 4Z7VE 1L6ZA 4PY8J 3GSXB 4ELMB 3CDGA 1YNTB 2EDYA 2A9NL 4X0KB 2HMID 4MNGB 5B3NA 4X99A 4PV9A 3C08L 1F45A 4Z7UB 35C8L 4H1LH 1GJIA 4UQ2B 2I25N 4XWOC 1BQLH 4OCYH 4XAKE 2OL3H 1MNUH 4PRHD 3ES6A 4XCFL 1LK3H 1HI6A 2MCG1 1A22B 4I1NB 3TT3H 4XPFL 2F5AH 2D7QA 5TFSH 3G5VB 3BD5A 1RZJH 3QDMA 3VU2A 4L8SC 3L9RB 4MAYB 1XGTB 3RL2B 5FA4B 3L3GB 4RAUA 4EVNA 4K71B 4DKAA 3UPRA 3IYLW 3LN4A 3TH3T 4Z76B 1Q0XL 1V3MA 4TNVF 4Y4FB 4YBQC 3Q1SH 4LVOB 3VDBA 2ZCKH 3LRSA 5ALBH 3QIWA 5DZOA 3UTTA 1PVHA 3KWWB 3W39B 3CC5B 2Y9RT 1OTSC 5HHXL 4P23C 1QBLL 4R6UA 5TPWL 3AU1A 5J12C 2BMKB 5C0AE 5DRXA 1CLZL 3T2PA 4F7PB 3Q6FB 3O4LE 5JW3L 3ARBC 4V1DB 1OP3H 1MWAL 2ATPB 1AGBA 5FHBH 4WUUA 4K7PL 3HNVL 3OKKA 2IPKB 4IRJB 5B39A 1G7HB 3BZDA 3UXFA 3JV4B 2Y6SD 2AJXL 1YDPB 2PETA 4OI7A 4CVXA 1ZA3B 3INUL 5JW4M 2J6EL 4N8VB 3MRHB 1H8SA 2FJHA 3RVUD 2D31B 4Q6IB 3TGXA 3UTZA 4KKCC 1YC8A 3PDOA 1LMKA 1T03L 4KJPD 3AREB 3TPUB 3G08A 3JV6B 3G04A 3GMLA 3T8XA 3U0TB 1DEEA 3AVEA 5IWLC 1R3HB 5KSUA 4NZRL 3QEUB 4XTRC 1B6UA 4LLYA 3TVMA 2YKLL 5DT1H 4PG9B 3RNQB 1NGYB 1QHPA 2ZUUA 1K5NB 1CICC 4JQIL 2OR7A 4PJ8A 4MYWB 4YEEA 5HHMD 3D0LB 2ADJA 3C5ZA 4PRAA 4XBEL 2EYSB 3TPKA 2CMRL 4KKBD 3UTOA 1DBML 4ODTL 4ERSH 1KGCE 1PYWA 4Z0XB 5GS0D 5ABDE 3G6AA 1QQDA 2BNRA 1RK1A 2CKNA 4K9EH 2VWEE 1A4KA 4C54A 4PJGB 1JFQL 4FQXB 3M1BB 1IFHH 1F8TH 5E8EA 5JO5A 1GAFH 2Y07H 3IDYB 4NJAH 1NCAL 3BPLB 4B0MM 1A7NL 4QGYA 2ED9A 4HSQA 1LD9A 3BZEA 3O6LH 1JI2A 4LCCA 1Q1JH 3L3OB 4N9OB 4G9DA 1B4JH 4O51B 4YHML 2DF3A 2VLKB 4Y7MA 5C6TL 5DS8B 3QIBA 1ZXQA 2R15A 1J0IA 3MNVB 1JF1A 4BZ2L 1F4YH 3MGOA 5EZJA 1TVHB 2X4NA 2IH3A 3C6LA 4MD5A 5T5FH 5ADOL 3VFWB 1U8OA 3I3BA 2UZXB 2AV1A 4KI5E 3OB8A 4NQUA 4TSAH 4DTGH 3RDTC 5FM5M 2F54D 4ZFFA 5LGJB 4UIMA 4CW1A 3D0VB 5K9OA 2X1PA 2J8UE 4EQ3A 4JFQA 4UAOB 3DVIA 3GHEH 4TNWK 3QZWB 3N9GH 2DQDL 5I9QB 2J8OA 3KPSA 4MNHB 4WDIB 2G5RA 3NFNA 3OHXB 1JV5A 3SE3A 1T0MB 3L5WA 1T2XA 5T3XH 3BP6B 1MIEH 3RGVB 4BUGA 5T1KA 2DTSA 1H15B 4I4WB 4O9HL 5JW4N 2ENSA 3MYJA 2OR8A 4UILH 4JN1L 4XVTH 1CGSH 5C09B 5I1LB 1AHWC 1U8NB 4PJHF 3E6FB 3W11D 4ZSOE 2EIBA 2RCSH 3VRIA 3D85A 1RZKH 3DO7B 4NC0B 5IM7A 1UWEL 3JWOH 3ZL4L 1I7UB 2Y5TA 4QRPB 3ULVC 3NZHH 1Y0LA 3VRLE 3BWAB 5BO1L 2PTVA 1AY1L 1RUKH 4JB9H 4M6NH 2VH5H 2GK0B 5I19L 1FHGA 1I7ZB 4KJWC 4X6BA 3GMOA 4JHAH 3B2UD 2DQFB 3ZDZE 3SDAA 2ZZUT 4YXHH 1FNSL 4KHXH 5E03A 3AAZA 1P4IL 5IW1B 5DEZA 1OTTC 3LN9A 2A38A 4XVSH 3KPMA 1A2YB 1KIQB 3KNBB 4TSBH 1WEJL 5JPMA 5GXBB 3G9VA 1KLUA 3B5TA 5HYQA 5E70A 4EBQL 2NY7L 5KVGH 1DQDL 1KN4L 4RX4D 1X5KA 3FT3B 4LSRH 5HI3C 4IMLA 4UI2A 2GJZB 1UM5L 3U4BH 1BMGA 4U6TA 2X9XA 5TF1H 4X99B 2LV4A 3P0GB 1T66C 2WUBL 4HGWB 2VC2L 4PJHB 5EC2B 2NW2A 2CDGB 1QG3A 3DYPA 4YE4L 3T3PF 3UTQB 1NANH 1ACZA 1RUPH 1C5CH 3CFCH 1HYSC 3KPQB 4P2CG 4AQOA 1HH6A 3W81A 1VERA 3K1DA 4XBPA 2V9TA 4DVRH 5CKGA 1ZGLB 1XZ0B 3QDMB 4K71C 1J8HA 1U3HC 4KUCF 2AGJL 3QUXB 3QPQC 3O9WA 4TUJB 3ARQA 3QIWD 2UUDK 3BUYB 5I8CA 5F7DA 2EEDA 1FG2A 4Y4FC 1QP1A 3BDXA 4LVOC 5D1XD 3BN9C 3UPRB 3LN4B 4W4OC 4OIBA 5I2IA 3VI4F 1V5JA 1CD1A 3HC3H 3JVGC 2QSQA 1QKZL 1T7XA 4RBPK 2VLRE 2ZUWA 1RUQH 5JOPD 3UTTB 5CILH 2VZUA 4OCWH 5D1ZD 3MOBL 4OD3L 1JPTL 4XP1H 1JNNH 4CU6A 3RWCA 3PWPA 4LEXH 1JF6A 4KGJA 3HB3C 7FABH 4IRJC 5DRXB 2EIEA 1BZ7B 4AQ1B 5H35B 1KTDB 1VHPA 1IGTA 3EOYG 3SCMD 4WUUB 4YX2L 3R1GL 2DM7A 3BZFB 4F15B 2FSEB 5B39B 1NEUA 2YSSB 5C2BL 1A6TB 1DDHB 2W9EL 2MPAH 1K2DB 3IJSA 2N7AA 1OSPH 3GNML 3L3KB 4HCRH 4I0PB 1GGCL 3KJ6L 1HXMB 2WP3T 4HEPG 2VXVL 5GISL 3AREC 2FJHB 1PKQA 3WS6A 2V2WA 3PDOB 5F9OL 1TJHL 1KJ2A 4CJ1A 3WIHA 5DVMA 3TVMD 4HIEA 2LFGA 2FX7L 3G08B 4UIKL 4JREC 4YHIA 4JPVH 4PJ8D 2UZIH 3RHWK 5CUSL 3IFNL 4GMSH 3G04B 3GMLB 5ANME 1GOHA 1MH5B 3DXAD 4OD1L 4UOW0 4P4KB 3S9DB 3NCBB 3QJFB 3VDAA 2BNRD 4YHZH 1J1OL 1Q0YH 1IAKA 5GRWA 3MLTA 2EE2A 5HJ3B 3DXAE 1CBVH 1PQZA 3VXRB 2BNRE 2ADJB 3C5ZB 4PRAB 4FQXC 4M8QA 5EPMA 2N7BA 1PYWB 1UENA 2BSTB 3IDYC 5K9KB 5J8OA 3G6AB 1NFDA 3OG4B 4R26L 2DQUH 3BPLC 1G0DA 1I1FA 2AEPH 2HT3C 2APWA 3VMPA 5JO5B 3K8MA 2ZNWA 3NCMA 3WJJA 1OARH 3VCLA 3QIBD 1HINH 1FN4A 2R56L 4PLNC 3BVNA 1CXHA 4GKZB 3PWLA 4N0FA 3O2VL 5AZ2H 5F7MC 1UA6L 4G9DB 5KS9E 1NSNL 1CD0A 2XWJB 1U8QB 3QNZB 2C4XA 3C2SA 4N8PA 4TVPL 5C0CB 4TVPD 3BSZL 4XP5L 5EZJB 3MJ9A 3C6LB 3SE9L 4JFEA 5DR5H 3WXVH 1U8OB 3LRHA 4P9MH 1Y6MR 3SGDI 2BFVH 2BNQA 3IETA 2A77H 5T1KD 5I9QC 5JNYB 5GSVB 2DQJL 4CW1B 2DOCA 2FL5A 1MCCA 1EJOH 2FB4H 5K9OB 3PHQB 2VSDA 3KG5A 4JFQB 4H20L 4XNYH 3HAEA 3RGVC 1TNNA 3KPSB 5DUML 3NFNB 4UQ3A 2CJUL 5D5MF 1JV5B 4KDWA 1JNJA 2AW2A 1JMXA 3D85D 1YEKH 3K2UL 4U6HB 2EH7H 3BJ91 3MRKA 4WEUD 3ETBF 4LGRB 4ZDHA 4GW4B 1F4WL 1N5YL 4ZD3L 4HWBA 2APBA 2YWYA 5E6ZA 4NC2B 3T0EC 1UFUA 3HZMB 1PBYA 2FD6H 3KPNA 2J2ZA 3IDIA 3DVNA 5CJXA 1HYRC 5E08H 5IM7B 2E9BA 5LQBH 4M7KH 4P46C 4RMTA 5MEQA 1U92B 5JXAH 4PB0H 4GUPA 4HS8L 5DJ6A 1UH2A 3VXMA 3GI8H 1X6NA 4WWID 5CZXD 4WGWB 1FIGH 1T5XB 4HHAA 3F7PC 3RJQB 2WINB 4WUKL 4JQXA 4X6BB 3GMOB 1UZ8A 1B9ZA 3SDXE 3SDAB 4RGOL 2WBKA 4KRLB 4D9LH 2IBZX 1CFBA 3SKJL 5CJOH 5I1EL 2XN9A 2EIZA 2YD4A 3AAZB 5C70A 5GGRY 4X8XA 2YPVH 3RWHA 3C8HA 1TPXB 2FGWH 4OLYH 1G1YA 3SKUD 4XCNB 2IAMB 3MRJB 2JTDA 4R0LA 4ZOEA 3WDHA 2PYEE 1E6JH 5JZ7D 1KLUB 1G9ML 2DM2A 4D94A 4FP8L 1JTPA 5D1QA 12E8H 4W81A 1V7NL 3TV3L 4LDEB 4PRIA 1U8HB 5D5MB 2H2SD 4DOHE 1RZ8A 4OJFL 1OP5H 4ZTOL 3QQ3A 4IMLB 4U1NA 5LGHL 5DJAA 1ADQA 4QHUA 3ORJA 2X70A 1IAOB 4I18A 5DMKA 3HI6H 1BVKB 3KPRA 2A0LC 4E5XB 2IANB 3OR7B 4IDJL 4KRNA 5TDOA 5L6YH 5CWSA 2AJZA 1JF5A 4GMTH 1XFPA 3CFKA 3Q5OA 1E6OH 3L1OL 1W72H 4NO5A 4P5MB 3UJIH 5C07E 4NOFA 5F96H 1JN6A 4LU5L 3QUXC 4XBPB 3UJJH 4MJIA 2FATH 4RCAA 4U3XA 5BS0A 3MUHL 1J8HB 1R3LB 4EN3B 3F58H 2FBJH 3O9WB 4W4NA 4DN3H 1PY4A 1S7TB 1QOKA 3H3BC 3OPZH 4FABL 5F7DB 4I48A 3O3BB 2XWBB 1KCUL 1BJ1J 3BIKB 3NCJH 3MRBB 3PWPD 3WLWC 5I2IB 1WZMA 4X9HA 3KHOA 3M8OH 4WU5A 1YMMD 1NLDL 3DTXA 5HVWA 2R0ZL 1E4XH 2V2XA 4HGMA 4JDZA 1KB5A 1IM9A 3F7VA 3X13A 4K2UL 1NFDF 4NDMA 2DBLH 2AXFA 1XIWB 1YMME 1IC4H 3RWCB 1JYVA 1D7FA 3VFPA 2QKIA 5GRVL 2YK1L 1AJ7H 3UX9B 1KEGL 2ITDA 5ALCL 4ZOAA 5T33H 4DZBB 5KSBB 1MVUB 4HPYH 4GS7B 4M1CC 1S7VA 5SWZD 2XKNB 1ZKAA 2O5YH 3DETC 3P4NA 4I0PC 3MNWB 4XP4L 4QXTB 3EBAA 1DFBL 3WIHL 1QYGL 2AEQL 1IC5L 1NKOA 4K23L 4JFYA 4NQEA 4UTAH 2CK2A 1IJ9A 5SWZE 3GGWA 4MSWA 1I9RH 4N0RA 1OT1A 2CLVA 4ZS7L 2X4OB 2YUWA 3S96B 1A0QH 1NCDH 4HIEB 2I07A 3ZKND 4P4KC 4ZAKD 4F7MB 4BQ6A 1HHKA 2X1OA 1FDLL 5HHOD 3UC0L 2ICWA 2GTZA 5DRNA 5ESVB 4FTVB 4UV4L 1AD9A 1OWRM 4D3CH 3HC0B 3LCYA 1EBPA 1IAKB 2R0KL 3MLTB 3VXOA 5HHOE 3SJVA 4FXGA 1CXEA 3QUZB 1F58L 3G5YA 2BNUB 3JWDH 1MY5A 1WWCA 4KPHH 5EPMB 2Z93B 1MCKA 3SQOL 1XR8B 5HDBF 4H1LA 3EDJA 1NFDB 2R8SH 3RWEA 5I30L 1I1FB 5EBGA 5HI5C 3CXHJ 5FOBA 2VLLA 3VGFA 1CE1L 1KNOB 3BVNB 4M48L 5C08D 5JA9A 3TT1L 1C08A 1WV7T 3D69A 3MJ9L 3JWNC 5C0RH 4R97C 2Z31B 1J5OH 4HIXL 1A7QH 2OZ4A 4HJGA 1OD9A 2A1WH 2BNQD 5C08E 2EDBA 1CFNB 4EEEA 2HAZA 4H8WC 2BOCA 3UJTH 1I3GH 4DQOL 4JFHE 2WP3O 1HZHL 3QEQB 1OTUD 4JFEB 3HNSH 5IOPA 1CFQA 5EG6C 3QT2A 2AJSH 1D5MB 5DQ9B 3VMOA 1S78D 2LU4A 4LBEA 5CD5D 2DM3A 4Z78A 3ROOB 2P48B 2W38A 1KB9J 3SE3C 3MUGA 4PRNB 4Y5YA 3VXTA 3ZSSA 4HWBL 4R90L 1MCWW 4HF5H 1R5VA 2XZCH 1FRGH 5IFAL 2CO7B 4JPWL 5C86A 4QF1A 5I1IL 4K8RH 2V7HB 1AR1C 5J06A 4U3HA 3FONB 5C0BA 5E94A 4JFXA 5K93A 1AI1H 4HK0B 4M00A 3SGEI 1M05A 1P4BH 2X1XR 3BT2L 4OCRL 4HPOL 4OZ4B 4TULH 3LOWA 5KJRH 3VG9C 1XGUA 1A3RL 2YZ8A 3CX5K 2AJUL 2FNBA 4HKBB 2ZSWA 4KAQH 1PLGL 4KUZL 4K3EL 3DMMC 4Z8FH 4O5LL 1UB6A 2MFNA 2NX5A 4XCEB 1MI5A 1QRNA 1KCKA 5A2FA 3SGKC 5J3HC 4M1GH 3DSFH 4GUPB 5DJ6B 4PGEA 3VXMB 2Y36H 2XN9D 1OAKL 2NXYB 2J12B 2BXYA 3FB8A 4Z95L 1BJ1H 2Q86A 4MMXC 1AIFA 3H0TA 4EUPG 3OKDB 2OSLA 4RMWA 3BDBA 3S7GA 4LL9A 1I85A 43C9B 4JLRA 3OKOA 1CQYA 2C26A 4KQ3L 2IAMC 3UPAA 3VFUA 4F37K 3FAWA 4QHNA 1BLNB 5GGQH 4BQBA 3QSKB 4Q7DA 4X8JA 3DPBA 4KMTH 3U9UB 1M7IB 5D7LA 2ESVA 3EYVB 4WEMB 4LKXA 2DQEL 4W6YB 5IB2A 1I3UA 3DX7B 1TLKA 1CS6A 1ADQL 3BZ4B 5IUSA 1QEWA 2DDQH 5IESH 3N1FC 2YPLD 2OP4H 3K8LA 3KPRD 4PRIB 2NXZD 1Q9OB 1Q9KB 4JY4A 1RJYB 3LKQA 3FCTA 4MJ4A 1RZ8B 2VNCA 4LAQL 1WSST 3QQ3B 4J3TA 1FO0H 1T21B 2YPLE 4XGZA 2DN7A 4LIQE 5DJAB 2V9QA 4HKZA 2HT2D 4I18B 1N5AA 3DECA 4IDLA 1LQSR 5CEYA 3QUKA 5BVPL 5E8OA 1DTUA 2F5BL 4MJID 5BS0D 1KCSL 1DSFH 1B6DA 1CTOA 4NFBA 4PREA 3B6SB 4WHDA 1T1XB 1GIGH 2NY0C 4KHTH 1T80A 3F5WB 1T7ZA 3VI3F 3CFKB 3QWRA 3UCRA 2B1HH 1W0WB 1KSRA 3MLYH 3TA3A 5BV7B 3LS5L 4EN3C 4YZFF 1NCBL 5ISZA 2ARJB 1I4FB 5ACZB 4H0GA 4EDXB 2A6IA 4LEOB 3KVQA 3QXVA 3BO8A 1EHLL 4XNZB 2IQAA 5IMLA 4NCC1 4ODSL 3MXWH 4S1SH 2YEZA 1K4DB 4OSUL 1IM9D 3O3UN 5T1DL 5BXFA 3MACH 2I60H 4WFEE 4X7CC 5JQ6L 4KJQD 1NEZA 1JHKH 1EUUA 4WTXA 3S4SA 1J05B 3NH7H 3DTXB 2V5RA 1XIWC 4ISVB 3VFGH 4GRWE 4JANA 5L9DL 4Z5RA 3VFNA 2YA0A 2Z8VC 3A0OA 2ZKHH 4GS7C 3NA4A 2QKIB 1BBDL 3KDMB 3PWVA 5MERA 2Q7YB 1I9JL 1FFPA 3P9WB 1LP9F 3FB6A 2ITDB 2R2BB 4G6AD 2GSIA 1N3NA 3MBXH 4J1UA 5I1JL 4L4VD 1EVTC 1MF2H 2RFXA 3WD5H 4NQEB 3V7AE 2DQCH 3GGWB 4BQ9A 5CBAA 1HWGB 1ZWIA 2BY0A 2IG2L 4R4BA 4L4VE 4E0RB 1VFAA 3OX8B 5KZCD 1IBGL 3WHE0 1JNLL 1BFVH 1UJ3B 4U6VH 1P84J 1YN6B 5EUOE 4PJCB 4EUPH 1MRFH 3RX8A 3CZJA 4LLAA 4U1GC 1KXTB 5KTEH 4FRWA 3V6OC 1HCVA 4OM0H 1CFVL 2EZ0C 4C83B 3EFDH 5DRNB 5DFWH 4U0QB 3QUZC 2DYPA 3O2DA 4HULB 3KLAA 3OAYH 3BQUC 1ZLWK 4GAYB 5DUPL 4DEPB 6CGTA 4MZ3A 3B83A 5MEOB 2Z8SA 3MJ8A 4F7EA 3SJVB 3UP1A 4N0CC 1LEGA 4X98A 1E27B 1IKNC 2CGRL 3G5YB 3IAQA 2W65A 1U8LA 1JPSH 4YJZL 2BHUA 1CR9H 2LU3A 1RZJL 2ADFH 2OZ4L 3RWEB 1N6QH 1FC2D 1TTUA 3BPCA 1OPGH 3RWJB 2Z31C 1NGXB 4Z7WA 5FOBB 4BZYA 2EXWC 1LP9B 4L3EB 1GZPB 1S9XA 1BP3B 3EHBC 1C08B 5C7XL 3RTQB 2H8PA 5EU3A 3WXWH 1CGUA 1A1OA 2Y06L 5EA0H 4JKPH 3T77A 3RY4A 2BSRA 3IDMA 3FB5B 2H32H 4QNPF 3DVFA 4ZUTA 1OM3L 4YDJB 3CUPA 4KVCL 4LPXA 1N4XH 3NTCH 4XNQA 2XZQH 1CFQB 4BELD 5IGXH 1NCNA 1XF5A 4IJ3B 2V5SA 5GS1A 3H42L 5DURB 3QHZL 2NYYD 3OKYA 3IS1X 5HGAB 1HXYA 3O41B 4Z7VB 1R5VB 3ZO0A 4PLJC 4GG6E 5HYIA 4QWWC 2HYMA 4FFZH 4QF1B 1QVOA 5GZOD 3OAZH 5GRXG 2HKHH 1CGYA 5FV1L 2IQ9L 4OCSL 4Y5VB 2NX5D 4JO1H 1MI5D 1L6XA 1QRND 5ADPL 1BOYA 5C0BB 5E94B 1FCGA 1U6AH 3GHBL 3PGFH 5FYJE 2UVFA 2Z91A 1RURH 1IEAA 4C56D 3I85A 2XZAH 3MLZH 1EHNA 4ONHA 2ZG2A 4ZFOA 4HCRA 1S5HA 2ZUXA 2HG5B 1UZ6F 2CUMA 4C56E 5DVOA 4FQLL 3U9PL 1ZLWH 3LB6D 4NRXA 3STLB 5D2LE 3G6JA 2EDDA 4ODBD 1GHFL 2V17H 3HE6A 2Q86B 3H0TB 4P3CH 4JFDA 5TE7L 3EYQC 2ESVD 2O93L 1GC1H 4L5FH 3NFSL 2CKBH 5KAQF 1DQLH 4PTTA 4JLRB 2VRAA 3ZKMC 1F6AB 5B4MC 4FXLA 2DQHL 4OZGA 4QHNB 4KV5F 3VGDA 1M71B 5CAYB 5FUCC 2CRZA 3DOSA 4NJAL 1PKOA 5E2WH 5D7LB 3CX2A 1FZOB 4LKXB 5C0AB 5FKAA 2VN4A 3O4LB 1QEWB 2YOCA 5J1SC 4QRQA 2E27L 5ITBH 3I6LE 3FZUD 4CNIB 1P7QD 2HFTA 3SO5A 1B4JL 3RVXC 1UH4A 4PS4H 3SDYH 3N85H 3B5HA 2HKFH 4I18C 3MJ7A 2WV3A 1FYTE 3MBED 4U1LA 4HKZB 4WHCA 5T5FL 3L7EA 2C5DC 1PG7H 1Z9OA 3EYSL 3L3HA 32C2B 4C55A 3RU8H 5J6HA 3QUKB 1NCTA 4OGYL 4G42B 4LSUH 5E8OB 5ISZD 4KI5F 4NJ9H 1BIIB 5EBMB 1RHFA 4FQCH 3REWA 4C59B 1FNGB 2ED8A 5BV7C 3WLBB 5D71H 1UT9A 3B9AA 5T3XL 5T3XD 1N59A 1H8OA 1FJ1A 5D2NC 5IQ7L 1TJIH 3TA3B 5DHVH 4XNZC 1NAKL 2F15A 4MD0A 2EC9U 1YZZA 2VTFA 4GH7B 2A6IB 3O3AB 3VFMA 2J4WL 1CK0H 4UILL 4XVTL 4DN4H 1TZHA 1CGSL 2IQAB 5IMLB 5CIPH 3IGAA 4YO0B 3S35L 3OMZA 5IFJA 4YWGH 2ID5A 3QRGH 4Z77B 5FGBA 4ZPVB 5C9JB 5IIEA 3T09A 1RZKL 3JWOL 1NEZB 3PWNA 4UU9B 3S4SB 1OGAE 4NWUH 2D7MA 2RIKA 4DCQB 3OKMA 3QAZB 5F1KC 2P8MB 4HZLA 1KYOK 4JB9L 1FCCA 4UBDC 4M6NL 3IAGC 2VH5L 2OTUA 1FNAA 4X7FC 2WBWB 3VFNB 2FDBP 1KJ3L 3HMWH 1YEGL 4LSPH 4JHAL 3N1MC 4MA8L 3ARGA 1INDH 5TGBA 3ULSA 4N8CH 1TENA 1DBBH 1H5BA 4HUXA 4KHXL 4O2CB 3HN3A 4E41A 4Z7WF 3PWVB 5MERB 4YH6A 3T1WA 3MRIB 2NY2D 2P8PB 4JO3L 3RI5F 1AQKL 3IF1A 2XWTB 2EEBA 4XP9L 3WN5A 3GIVB 4X7DC 3HS0A 4MXWH 3WNOA 3I50H 4U31A 1SY6L 5BW7C 3NOIA 5A3ID 2JJUA 1UJ3C 5DJDB 4LCWE 5KVGL 1MRCH 5EBLA 2J8UB 2X40A 1VFAB 1CGXA 2E7CA 2GUOA 4Q9CA 3WHXA 3F7YA 2FHBA 3O2DL 1WZLA 2DYPD 2XKSA 3IKCA 1B0WA 3LQAH 3FN0L 4BQ8A 5J4MA 2LVEA 1SVCP 4F58L 4HMEA 1VADB 3O4OB 4KROD 3ELAT 5BOPA 2PXYA 5FEBA 1TITA 4DEPC 4G6KH 4AY0A 1I3RB 5LXGH 2YUZA 3EDEA 1TCRB 3QDJD 5C9KA 4LMQI 4WI5A 2CLRB 3GI9H 1H0DA 2AK4A 4YGAB 5FGSA 3S8WA 4F7EB 2Y5EA 4M7ZB 4P5TA 1A21A 1BM3H 2GY7B 4I5BB 3QDJE 5FYKL 2W65B 3T4AB 2X4UB 1I1AC 3THML 4Q9QH 3CSYB 5EZOH 4OCXH 3ULUC 4F57H 3P4MA 3MV8B 3HFML 4WW1A 3C8KA 4M43L 1EMTH 3RTQC 4JVPA 5GPRA 3KPPA 4XPGH 1RIUL 5HHNB 4M03A 1A1NA 3RVVD 2YD5A 4WHYG 1C16A 3MLWH 3G6JF 1FFOB 5TDNB 5EU3B 3DX6A 4LPVA 1A1OB 3U0PB 5D7JA 2DI9A 2BSRB 3GJFH 5BVJB 1H3GA 1MQKL 5FO8A 3FT2A 1D9KA 3QXAA 4TOYH 3LQMA 1FZKB 4ONFH 2YBRA 3O6MH 1DQMH 1JNNL 4OZGF 5E6IA 5HGDA 3BGAA 4NUGL 1VKXA 1M6OA 2HWZL 5DJXA 2R0WL 4LEXL 4RWYL 4AEHL 4X4XA 4EOWH 4XNQB 5GHWL 2N4IA 1IGCH 4WI6A 3RVWC 5HHVL 1CF8H 3TZVC 2AJ3B 5KSAD 3RQ3A 2P5EA 3SBWC 3LKNA 1E28A 5F6HJ 4X7SL 1HXYB 3RWIA 2FJFA 1QBAA 5EU6B 3U36A 3OXRB 4O2EB 1I75A 3DHMA 5J9PA 3A6OA 4Y5VC 3BKYH 1MAMH 3MLXL 1KTKE 1U42A 3I2CH 1I8KA 5DRWA 4YEFA 5EDXA 1MIMH 4PJDA 5DTFA 5H2BB 5IV2A 2I9TA 3VXPA 4MXQC 5I1DA 2Z91B 4POUB 1IEAB 3DURA 3H8NA 4NQVA 2NY3B 1NC2D 1F4AA 1OAXH 3EOTH 3TIDA 3BD4A 1KTLA 4GMSL 4JFDD 1WZ1L 2MMXA 4ZMAT 3BRFA 1FGVH 1RU9L 4O02H 1Q38A 2ZUSA 5E7BA 5T1LA 2HFGH 2HN7A 4CUCA 5GGUA 3U7WH 3LH2L 4NRXB 1SJHA 4NHCH 3WJLC 1LWRA 3RZCA 2W60A 3CCHA 2AK1H 5INCA 1K8DA 1J0ZA 3D48R 4JFDE 4ZFZB 4XX1G 2ZNXA 4NC1E 3KYOA 4Z7OE 3HE6B 1OGTA 1P9MA 5EZLA 1BAFH 1CXIA 1R0AL 3VD4A 5FFLA 3ZHLA 5C92A 4PG2C 4P2OB 4XVUD 2Y7QA 3VFTB 1QFWL 2VLRB 4PTTB 5FKPA 3QWOB 1JZ6A 1KC5H 5GSRA 3QUYB 4JCLA 4FHBD 3CVIL 1RZIB 1OARL 1QLFA 4P2RE 1KJMA 2G75A 3EOBA 1Q72L 5FKAB 1GGBL 4U6XA 1CZ8L 3AROA 5D7SH 1G7LA 3F62A 4QRQB 1BD2A 1ITBB 4U1MA 1A47A 3L5IA 2VQ1B 2XQYG 3AM8C 5B38A 3X3FL 2ZJSH 1QO3A 5E4EC 5F44A 1T04B 1S9YA 1I8MB 3BYTA 4HBCH 2ZOKA 4FFVD 2UWEA 1NCWH 4EI5A 3CLEL 4MD4A 4YHLL 2A77L 3NA9H 3ZT7A 4MQSB 2FB4L 5B22A 4LF3B 4JO4H 2P8LA 3REWB 3HE7B 1CG9A 5A2KH 4PJBF 4HAGA 1PG7W 1IC1A 4XNYL 3TA3C 15C8H 1D5XB 1MHEA 5E2JA 5IBLC 4G5ZH 1ZT4A 3C6SA 1QLEL 5ANMB 2FX8H 2QADD 2YRLA 4MJ5A 1N59B 4WHYH 1FJ1B 1TTFA 4G80B 4MD0B 4MX7B 4QTHA 3DSNA 4Y4HA 4HG4J 4GO6B 1MCQA 3VFMB 3QDGA 4S1RH 2YN3A 5KVDH 4JZNA 2BHZA 2GTWA 5I8KL 3I6GB 4DGVL 4RISH 1EFQA 1IC7H 4XVJL 5AD0A 1WFNA 2VWEC 4RZCA 3QCTL 4KK6C 1XF4A 2RBLA 1NGZB 4G6MH 5GS0C 3PWNB 4M7KL 3FMGH 2R2HA 3NZ8B 5E4IA 4DGIH 4E41D 3T2QA 4G9FA 3RUGE 4TVSa 1HSAA 1NBZA 2ZOLB 3P11L 3QEGH 4HZLB 3HI1A 4PJ7A 3S88H 3MRQA 3QDAA 3V5HA 1JP5A 2OTUB 5T5NG 4LCIH 1J1PL 4E41E 1ZEAL 3ARGB 3ULSB 1YEEH 4KVNH 2AS5M 4JZJB 2QSCH 1UKSA 3EYOB 4HUXB 5KS9B 2HVJA 1X4XA 1IAIL 3GB7B 3SO3B 5DMIH 4AG4L 1CGTA 1PGRB 1WF5A 2YPVL 1HEZA 2Q8BL 2XG4A 4KI5C 1MLCA 2AABL 3VW3L 4YHKL 4Y4KB 3HS0B 3P9LA 5MHSD 5EH1A 3O0RH 4JM2A 1E6JL 3NIFE 2VDKH 4ONOA 4ODWA 4ZXBA 5L88H 2H3NB 4JDTL 1J0YA 1EGJH 4PJBB 1L9NA 12E8L 5EBLB 1X5LA 5HI4C 3O4OC 3F7YB 4DK3A 2JB6B 3IVKA 3OR6A 5FF6A 4RIRB 3EO0A 2AK4D 1HIML 4P5TD 1P53A 1NGPL 2PXYB 3GK8L 4ELKB 1LO5A 2IJ0C 2BVOA 1CQKA 3VWKD 2AK4E 1T22A 3KPTA 2IPTL 3U4EB 5ICYB 5DQDH 4GXVL 1ETZA 1XF2A 1H0DB 3PDGA 4GMTL 1E6OL