3Q9PA

Hspb1 fragment
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
83
structure length
76
Chain Sequence
b'SHTADRWRVSLDVNHFAPDELTVKTKDGVVEITGKHAYISRCFTRKYTLPPGVDPTQVSSSLSPEGTLTVEAPMPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Heat shock protein beta-1
publication title Three-Dimensional Structure of alpha-Crystallin Domain Dimers of Human Small Heat Shock Proteins HSPB1 and HSPB6
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone
total genus 7
structure length 76
sequence length 83
ec nomenclature
pdb deposition date 2011-01-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.790 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3q9pA00
3Q9PA 3QORB 2N3JA 4JUTA 4YLCA 3VQLA 1X5MA 1RL1A 2CG9X 5DS2A 4ZJ9A 4M5TA 2MNWA 2Y1YA 2Y1ZA 3AABA 3J07A 1WH0A 4JUSA 5LUMA 2KMWA 2N0KA 2Y22A 3Q9QA 1GMEA 3GT6A 4YE0A 3AACA 3QORD 2WJ7A 2BOLA 4YLBA 4MJHA 4ELDA 4M5SA 1SHSA 4RZKA 4FEIA 4YL9A 2XCMC 3GUFA 3VQMA 1WGVA 1WFIA 3EUDA 3GLAA 4PBDA 2K8QA 4PCKA 4YDZA 3IGFA 3QORA 3L1GA 2RH0A 3N3EA 3W1ZA 2CR0A 3L1FA 2O30A 4I88A 2KLRA 2JKIS 1EJFA 2WJ5A 5DS1A 3QORC 3L1EA
chains in the Genus database with same CATH superfamily
2X0WA 1OAZL 4K94L 5DHXB 3NA4A 4RIRB 2X1XR 4IIQB 4HH9B 3NZHH 4UM9D 3S36X 4AQ1B 1ZIBA 3IK2A 1WFOA 1HOCA 5I16B 1A8ZA 5J0BA 1LO2L 1IGJA 1FI8C 3Q06A 1BM3H 2OMUB 3BZ4A 1IGYB 2AEQH 5HHPB 4Y4HC 4PRIE 3NGBC 5TQ0L 1J0YA 2E7LC 3ZMRA 1ZS8A 3JWNH 4NO3A 3UC0L 1N12A 1ZGLM 1BPVA 5J12B 2GIXA 4ANXA 3B9AA 4CDHA 3NSCA 1JYVA 3LKSA 1MUJA 4ZUUB 4U6VL 4IIQC 1AR1D 3FCUB 1UH2A 1E4WH 2J57A 3NAAH 4OJDH 5CIPB 5FYKE 1EDQA 1RCYA 2IGTA 2UXVA 1NTDA 4TQEH 2DEWX 2B5IB 5EEWA 3WFZA 1KLUA 3SPJA 4UT6L 3HZYB 1OTUC 2XTJB 1P5UA 4MZIA 1R75A 3MUHL 4H8WL 3RKPA 5IJVB 2BWIA 2FJSA 1W72H 4XN7A 2DTMH 5I1LA 1EIBA 3EYUH 3DVFA 4GRWE 5DQDL 5TH2A 4UMSA 4FXLA 1G6RB 5CEZH 1MCPL 3KDPB 4FLOA 4NJ9L 5D4HA 3LKPB 5DMYA 1AMXA 1X5HA 4DN3L 3U4EB 2Y5QA 2ZCKH 3F7YA 2H2SC 2C9RA 3UAAA 4OGXL 1EV2E 4IRJC 4ZQKA 5IUCA 5E8NA 5D7JA 2W0KA 4ZPVB 4NYLA 4AVHA 2AK1L 3BFQG 1DQML 1G9NC 1JDCA 3RHWF 4BEIA 4LU5H 2BOLA 2HTLC 3BSZA 5I76A 2QT6A 4OAWB 4GQZA 5F89A 1NL0L 4DPRA 2EDQA 4KKRA 3P9MA 4P46C 4ZXBB 3REWA 5JZ7D 4HIXL 4P5TB 4F2EA 3RWDA 5DMIH 3I50L 4RLDA 4ZUWB 5FOBB 4Z3TA 3ZQXA 1C5CH 2AFNA 2ZCHH 1E27B 1M7DB 3QDGB 1DVQA 2WJ5A 4S1QL 1UH4A 3M6DA 5ISZA 1D5MA 2LHAA 1D9KC 5T5FH 4MXQC 1NBCA 4LQFL 2XBZA 1KFAL 4IBYA 1P5VB 2CUAA 2MNWA 2Y2TA 4CC4A 1W8EA 5JLZB 4E5XA 4BFFA 2CMRH 3BVDB 2QV2A 4AEHL 3O4LE 3H9SE 5MERB 3L5HA 2JWYA 5FHBL 2WVSA 4NRZB 1TLKA 3SB3A 5GJSH 2VR7A 5IQ7H 3HOGA 1X9UA 2A9NH 2OXGB 1LP9F 5T3ZL 2HVBA 5C0BD 1E4JA 3SD2A 1RZIB 3W39B 3WNLA 4PGCA 2ED6A 4NFDA 3V55A 4X8GA 3RNQB 1U42A 4MHHG 1FIGH 4G7RB 3KLQA 5TQ2H 4BM7A 4TNWK 3VI4A 3MV7E 4RZCA 1L5GB 2J6EL 3GXTA 4X7EC 3CFDA 1E30A 2HH0L 2V9RA 3BESR 3QXTA 1QOKA 1E6JL 4JQVC 5CLYA 3DA0A 3VXTA 1WZAA 2H9GB 5G2NA 3ARED 2EICA 3DARA 3QJTB 2FYYA 4OGZA 1CTNA 1OE2A 4W9ZA 3ZKSD 2A6KB 4CKQA 1BX2A 5IHBA 1YEHL 2Y7SA 1KEMH 1OD7A 4HUXB 3HW7A 1S9XB 3KLLA 5I6XC 1ZKAA 2J1YA 4D7PA 5HJGA 3EYOB 3DK0A 1T1XA 4V2BA 2X44D 3ATFA 2C7UA 4OD1H 5IIEA 2ARWA 1FCGA 4NQCB 4OVUA 3ZXAC 3RUGF 5B3NA 3QQ9D 3KJ6L 3QZOA 4NQSA 3LN5A 4R83A 1SHMA 2X42A 3FO0H 3V4VL 4TRPH 4Z78A 4E41E 1A21A 2PWEA 1YYLH 1EJOL 1U9KA 2NX5E 5BO0D 3CFEA 1T04A 1R3LB 1U8IA 2I60H 4FXKC 1OTSC 1G9NL 1AZUA 4YBQC 2GJ6D 2VITB 3LNDA 4L29A 2H8PB 4EO5A 3G5XB 1AHWC 4Z6AT 4OI9A 3H42L 4CJ0A 4DKAA 3FK3A 3DOHA 1KCRL 3IT8D 3TA3C 5BVJB 5T3ZE 3M86A 2OJEA 4X6DA 1IMHC 3QRGL 1NUGA 3NCYP 4JY5H 4PJIA 3VO0A 4ANVA 4MJ5B 2OSWA 3O3DB 4JFDD 2CIIB 2BWQA 1SYSB 2VJ8A 1A3ZA 3NCBB 3VD5A 1A7QL 3OWEA 5DVMA 3KEHA 5E2UH 1X7TA 1K8DB 4N2GA 4S1RL 5HHXL 1I8IB 2A6JB 3H2PA 2G9HB 4MNHB 4V1DD 4RFNB 5KANG 4KBPA 1AS7A 3UMNA 4UQCA 4WW2C 3QXDB 5E2TL 5B7FA 1BPLB 1EFQA 1MRCL 5EU3B 3CE1A 4OZIF 3PWUA 4IK6A 4UTCA 1DLHA 3H4FA 3QUYC 3UIYA 3QIBA 3QNZB 4O4YL 2A9ML 1WA1X 2B1AL 2FLRT 4PVLA 2EO1A 3EOAA 5DYOA 5IBTH 1DANU 1JPGA 1VESA 3GSXB 3DV6A 4FQLH 4WFFD 3GSUA 3BSGA 4H8VA 3RJQB 4DK6A 4DN4H 4F58H 2PABA 5BUAA 1I3RB 2CM5A 3Q8CA 4TVUA 4ZYKA 1NBVH 4PJCB 5E70A 1RUPL 4ODXB 5AUMB 3V0FA 4JO3L 1TQUA 2W5PA 1SQMA 2J6EA 4MS8D 1CDUA 1UM5L 1BAFH 4TULL 1HT6A 2IFFH 4RIRA 5JR1H 4HH9A 1WZKA 3OPZH 4HW6A 5I8KH 4JANB 4ZMPA 4AQ1A 4M61A 5I16A 2MQ3A 4PJ5D 1CO1A 2OMUA 3IGLA 1IGYA 4L3ED 5HHPA 3ZKXC 3VFOB 3MOAL 2D9QB 3OKDB 4NM4L 5GGRY 2UXGA 2GB2A 1MCNA 4NI6A 3VXNB 1EAQA 1WC7A 2EXYC 3DK2A 3ZDXF 1MAML 1Q1JH 4FX5A 1Q0XH 1Z66A 1A7NH 4L23A 3BUQA 4YHIB 1CE1H 2A0LD 4Z9KB 2NXYD 3MA9L 3NJKA 4ZUUA 5KVGL 4HPYL 5F9JB 1ODAA 5CIPA 3PLYA 3ZMNA 3ZT6A 4G8GE 5D1XD 3NABL 2Z31B 1J18A 1VZGA 4WUUD 1JGDB 3HZYA 3N5AA 2CK0L 2EIDA 1JHKL 4N68A 1BEYL 3MRJB 2BLFA 4R9HA 3WEOA 4X5QA 3VYNA 3HTLX 5IJVA 1NBQA 4JE0A 4KK8C 3BUDA 5F8RC 1WHOA 3D51A 5L4IA 2XZAH 3QJRB 4L1LA 1J5OH 3PABA 5LGYA 1G6RA 4BJLA 2A9BA 4PJEE 1AGEB 2Y69B 2X40A 1C8QA 1LO0H 1S7WB 3D69B 2Q9OA 1NKGA 1WVZA 3LKPA 4JG0H 3TWCH 2R69H 4JLRB 4NBZB 5IB4B 3TVMD 3U4EA 2FX7L 1QFUL 4P4KB 1CBJA 1CL7L 2NY5C 3RIAF 3DRTB 3FH7A 4UV4L 1DN2A 2I07B 1NC2D 5AW1B 1FORL 4AM0B 4ZPVA 3PJNA 4GI8A 3UPRB 2BNRB 1I7UB 2P5EB 3QUZA 3UGXA 4AZUA 1RI8A 1KBKA 2G75B 1YUHB 3CMOL 3KNBB 1MFEH 3MODH 2XJLA 2D0FA 5A2KH 4OLVL 5DVKA 4ZXBA 2EZ0C 1OANA 1A6WL 3RWGB 2OR8A 4K2UH 4H1LG 4P5TA 4ZUWA 1YJDC 2QQQA 5FOBA 1YMMD 2CUIA 5DO2D 4HJUA 3QDGA 3MLWH 1E27A 1M7DA 2H3NB 4KC3B 5F7YC 4ODVH 2XFXB 1IGTB 4L3CB 2I5YL 3P2BA 4AGOA 3ERXA 4PD4K 3LZOA 4IRSC 5D5MF 2H2PC 1P5VA 2VDMB 4HGMA 1UT1A 3DUSA 1CGSH 5JLZA 1R34A 4JKWA 5DS8B 5F0PB 3T0XA 5I2IB 1PIFA 4YZFE 1EO5A 3ESOA 2L7QA 1JK9B 4JRXD 5MERA 3OJ2C 4NRZA 1QO3B 2NY6D 3BP7B 5D2LF 1SJVA 3TYGH 2VM4A 2OXGA 5DT1L 1ZWIB 4DGVL 1CQYA 3W39A 1RZIA 4O58H 4A2DA 3RNQA 5L9DL 3FQNA 5HDLA 2HT3C 1H3VA 1L5GA 4NCC2 1TDQA 5AAWA 1U4FA 3MRHB 1JI1A 4IJ3B 3GQFA 2B20A 4YDIH 3PJSB 2XN9E 3IDYC 4PV1C 1IAKB 3WMPA 4X4XB 1DBJH 4HXAH 3H55A 3IETB 1RZFH 2WWKO 1OCCB 2DLFH 2IAMB 4AC4A 4KZDH 4CN1A 2H9GA 4PJFF 5ESQB 3RAJH 2X41A 1ACZA 5E9NA 2F1EA 3GB7B 4PJ7B 3CTTA 1BBDH 2N56A 3CZFB 3QR2A 3S3PA 2A6KA 4KOCA 5LGJB 4JHAH 4HUXA 1S9XA 1F58L 1Y18B 4MCZB 3CLFL 2WP3O 4UNIA 5ACLA 4FQIH 2GEEA 1IGCH 5DEZA 4JCWA 1WSST 3TESA 4I3GA 2WLZA 4DGWC 2NY5L 4EZJA 4NQCA 5LDSA 2XIBA 5F1IB 4FTVE 2VAJA 5F44A 1WDAA 2IAMC 1TZGL 2O26U 1C9SA 4K9EH 2YC1B 2ZXCA 2XG5B 4JRYB 5F7AA 3ARYA 1RLBA 4DNLA 3KYNB 2VITA 1RZJC 1YEDA 2H8PA 3BVTA 3G5XA 5IHUH 5B3JE 2HX9A 4KKNA 4JO5A 1RY7B 3CDYA 4QRSB 3P9WB 5BVJA 4AYBA 2N1KA 2VJ0A 1YJDL 5LBGA 2EEFA 3VXMD 2X12A 3O3DA 2CIIA 4EOWH 4AX3A 1SYSA 4FFYH 4IRZA 3LZFL 5MHSE 1K8DA 4F9LC 5D7SH 3ULUE 5J13C 3BWSA 2A6JA 1LE5B 4PY7B 2ZP0T 1CBVL 2G9HA 4MNHA 1TOXA 4QXUH 3FMGL 3ZK0A 3QVAA 3QXDA 1L7TL 3BWAB 4W81A 1RP9A 5EU3A 4DP0X 1FBIH 4HHGA 3QNZA 2KQNA 2R15A 4K3GA 1DHKA 1RMFL 1TJIL 3DO4A 4TVPH 2JJTA 4MJ4A 1XV8A 3ZL1A 1CLZL 2Q3AA 5E5MB 5BUGA 4DO6A 2J88H 3BEVB 3I9GH 3S3CB 3GSXA 2JCCF 3MRPA 5TE7L 1AIFB 4PJXB 5IBUB 1OHZA 4Z3IA 2VDML 4JJOA 2B59A 1I3RA 1QBBA 5SWZB 3QRLA 3BPOB 4K3JH 4LAJH 5E2VH 3ZW3A 1WUZA 4PJCA 2AABL 4AZ8A 2JI3A 4IIZA 3AQXA 2FWSA 3VFMB 4BCXA 4ODXA 2IQ9H 4XGZB 5AUMA 3BRGC 5JDSA 2AQSA 1QTYT 1WAPA 1UC6A 5DJ0B 2FBJH 1V3KA 5I9QB 5IQ9B 1O9ZA 4B9JA 4JANA 3CN2A 3SY0B 4ZDHB 4ZTOH 1JDDA 5DVOA 3V0EA 3V4UH 4KKQA 1F97A 2XN1A 3VFOA 5GZOD 3VFGL 3OKDA 4IKIA 1T7XA 2BINA 4CUCA 4YGAB 1JMXA 3VXNA 3FB5B 4J3OD 3C75A 1XGRB 4YHIA 1RD6A 3C2AL 3EH5B 4FNRA 3B56A 3OMIB 4TXVB 1JXGA 5F9JA 2VGLM 2NSMA 4PVNA 3SKJH 1AR1C 4S1DC 2Z31A 1RZJL 1ANUA 3HNTH 2MRYA 4R6UA 4DPBX 1JGDA 5IQOA 1IVTA 1N0XL 1QPXA 2DM7A 3U9PL 1D2PA 3MRJA 2GJPA 3NJFA 2DYRB 1ZHLB 5GSRB 1AGBB 3FPXA 1B3IA 2G2PA 1QFWH 1NFKA 4HJ1A 2F18A 1AGEA 1V3LA 1KYFA 3L4VA 1MY7A 3D69A 1S7WA 1N6UA 4PG2C 1NEZB 2R4RL 4I87A 2X09A 4JLRA 5IB4A 2VLRE 4P4KA 1N0LB 1WAAE 3E7JA 4ZNEE 3ZE2E 1U21A 2XBTA 1WT5A 3DRTA 5H35A 3S6CA 2I07A 4OUOA 5F1KC 4AH2B 1A3LH 2IEPA 3AS0A 3LH2L 1MFVA 3LKNB 4GMSH 3UPRA 2OXHB 2BNRA 1HVXA 1I7UA 2P5EA 5K33A 3ZX1A 1I8MB 4N8CH 2QVTA 3VI4F 2G75A 4F92B 2YWYA 3KNBA 5DJCB 5AW8B 1Y6MR 3BAKA 1SBSL 1KCVL 2HRLA 2B16A 1DSYA 1MH5A 5CJQL 4YBLC 4K23L 2F9BT 3RWGA 3V0WH 3WFHB 1A02N 5JZ7C 3P11L 4Y16D 2H3NA 3VMNA 1IGTA 1XGZA 1LILA 1V7NL 4L3CA 4Y4FA 4AQZA 2VC2L 4Z8FH 4MAUH 3ESUF 2MHAB 1I1AB 2JLPA 2WLLA 4WY7L 3ROOB 3DGDA 3O9WB 1G4MA 2RH0A 5DS8A 2EDBA 5I2IA 3P0VL 2PR4H 4X83A 1JK9A 4XN5A 4Z95L 1QO3A 3BP7A 4M00A 3PF2A 2P43B 5HGHA 3S9DB 2M2DA 2FH8A 1IBFA 1ZWIA 1WD8A 2A77H 4CSSA 1MHHB 3AS1A 3NMEA 1CPUA 1YO4A 3SQOL 4TNGA 3TLRA 1EMTH 3T65A 1M4KA 4W4OC 1PLAA 3I6LD 4Y5VC 4PY8I 4LVHC 4DKDC 3VXSE 1IU1A 1AKPA 5DQJB 1HXMB 4AE1A 4NGHH 1KTDB 4BFRA 3MRHA 1AYOA 4OJCA 2EXSA 2ZG2A 3ZTCC 1NCJA 1PG7W 4XOAA 3PJSA 2BSTB 3OV6A 1GR7A 3TURA 1IAKA 4X6DF 1VEPA 4X4XA 3IETA 4QTFA 1N7MH 3T0BA 1AXSB 3TT3L 4GW4B 5GGVH 4XNQB 4U6HB 1HU8A 5ESQA 3EH1A 3GB7A 4PJ7A 5LUMA 1AHMA 3CZFA 3AREC 3F5WB 5IMKA 4XBEL 1FL3B 3RY4A 5LGJA 1TEYA 1TVHB 2C4XA 4UOW0 5C0CA 1Y18A 1BF5A 4MCZA 5D4IA 3ATDA 2R9HD 3QS3A 4BZ1H 2A6DB 5F1IA 4BH7B 2XPYA 1Z0MA 2UWEA 4QAMB 3QQ9C 4MA7L 5T1JA 1J1PH 2YC1A 2XG5A 4JRYA 5K9JH 1Z3GH 4IKNA 4U0RC 5D2NC 4DQAA 2NXZD 1BWWA 3KYNA 1X5LA 3GNML 4JUTA 2OZ4A 2J8UE 4MNQD 3S5ZA 3A4EA 2N0MA 3DMMB 3L4XA 1LMKA 1ZTXL 3F04A 2HMIC 1EHXA 1GA2A 4QRSA 1ADQL 1CZ8H 3BWUC 3KGRA 3NIGF 3NFSL 2AMUA 1CCZA 2XN2A 4ONHA 2BSEA 3TFKD 5AAPA 4ZOEA 2H4EA 4X80H 2DICA 3OHXC 2ZP8A 5FYJH 1LEGB 5D7JD 4UTBH 1RPQA 2O6DA 4ORZC 5F7BA 1NAMH 1IGFH 1LE5A 4LCCC 1QZ1A 3HA0A 4PY7A 5E1GA 4OJYA 4YHKH 3TO4D 1NLDL 1AC0A 4DOHE 3TH3T 3BWAA 1GPOH 3GGWB 4JM2B 4YHLH 5B3SB 3NRQA 2HKFL 1AJ7H 2CJTA 4G6ML 4W9HC 4A63A 1KIQB 4HOMA 3D87B 2WYHA 4MMXC 4HSAC 1A6TA 2H41A 2XQYK 3NTCH 1HN1A 4P2YA 5E5MA 4KI5D 2OW7A 1GJIA 3BEVA 1XSIA 5ISZD 1AIFA 2XT1B 4PJXA 7FABH 1EVTC 3UTTD 5I1HL 1EZVX 3IMBA 3CDZB 4NKQB 4K15A 1U0QA 3VFMA 2WC7A 4XGZA 5KS9B 2ZF8A 5JHAA 1IAIL 1TITA 1AFVL 5DJ0A 1CICC 4MS8C 2XWCA 5IQ9A 1L3NA 3RVWD 1J8RA 2PPAA 4RDBA 5DEFB 5JPMB 3MKKA 3QQ3B 4N2BA 1F18A 4K7FA 4Q14A 4ZDHA 2DWDB 4KDTC 5HHNB 2DLIA 4ONFL 1WBYB 2DQEH 1FNAA 2EDTA 4X7CC 2R0WL 3WS3B 5ILTH 1MQKH 4HFWA 3CFMA 4P2QD 4QRPD 5GHWL 2EDRA 2UX6A 3RU8H 1XGRA 5DR5H 4O2EB 3RL2B 1W91A 3LCYA 4UILH 4Y2LA 3T08A 1AH1A 1MJ7L 3VD2A 1X5ZA 1L0YA 2IV9A 5DFTA 2R29H 3GRBA 2NXYC 3M1BB 4XPHH 3IF1A 4B9KC 1H3PL 5E23A 2CUMA 2W9DL 3MBXL 5KSUB 1V5JA 3T3MB 5E1IA 2HVKB 1ZHLA 3L9BA 5K9KB 3W81A 2GPZA 2XLLA 2CO7A 5GSRA 1IO4C 1AGBA 1REIA 4RDQF 4Z7UE 2FT7A 3REVB 5C0BE 3A67H 4TLTA 3HI5H 1MRDL 4OCYH 4WV1B 1JZ8A 1AR2A 1N4XH 1G43A 4B9FA 1YNTA 2HFFB 4GXFA 1NEZA 5F88B 4X6CF 4RBPK 2R4SH 1QHPA 1T4WA 2ADIA 1N0LA 2Y1YA 2Y1ZA 4FTDA 4XCEB 4ABQA 3TVMC 5DZAA 3QJQB 4LSVH 1ZANL 4AIOA 3D30A 4AH2A 3ARSA 3LKNA 2AQPA 2OXHA 1MPAH 1I8MA 5C6TL 2OMWB 2XV3A 2Z1KA 2AJUH 1KNOB 4AGPA 2AV1B 4UT9L 2MPAL 4PV8A 5DJCA 4CMMB 2UYLB 3Q5YA 1FFQA 3KBEA 1FH5H 3HC0B 3WFHA 5GRJL 2YOCA 4GOSA 3V95A 5B1CA 3GBEA 3KPSB 1OP3K 5DO2C 5I5RA 4NQTA 4KJQC 5EBMB 4KGLA 2MHAA 1I1AA 2QKIC 3D2UD 2QELA 3ZHKA 3IMRA 3G6DH 4ZZFA 3SY6A 5LG6A 2P24A 3O9WA 4XPTL 2GJ6E 1NOLA 4L8SC 2F08A 3MLVH 3TCTA 1H8SA 1OM3L 4ZO6A 2QSCL 4E0RA 3L4YA 2HT2D 1W0WB 4M7JH 1HHGB 4C59B 5AW6B 1QZNA 1TJGL 3FQWA 5JW4N 1JXFA 4JFDE 25C8L 4N3UA 1E4KA 4AJWA 3MO1A 2ICEC 1HXMA 1FLRH 1DDHB 1KTDA 1PG7X 2JCWA 4PJDB 3HIZA 1H5BB 2M1KA 4JFSA 4YXKL 2BSTA 3N42B 4PLKD 2NPLX 4V1DE 1EBPA 4ZO8A 1VHPA 4A38A 1AXSA 4GW4A 1SXAA 4XNQA 3PNWB 3H0TB 4PJ6A 3RJDA 3I6SA 5I1CH 4L9DA 4S0SD 5A3IC 3X13B 1S5IH 3IMTA 5DDHA 3F5WA 4OF3A 4LRNL 3MGOB 3FUKA 1FE8H 2ED7A 3GMPB 1TVHA 4IOIB 2X2HA 4WFFE 1MLCB 1R3IH 2QSTA 3GINA 3K8LA 2F7PA 3SDXB 1ZLSL 4EDXB 2Y22A 2NQ3A 2NLJB 3QDMD 4LEBA 4PP2B 3M7FB 2A6DA 2YN3A 3KCPB 4BH7A 3RTLA 3UYRH 1TO4A 5HVWA 5KAQF 4K7PH 4G7YL 3LYRA 4HMEA 5LCVH 2WLIB 4AG4H 4GIOA 1BVOA 3NIDB 1KJ3L 1NJ9B 3DX3A 1X5GA 5AYUH 3D4GA 1CMOA 3VXOB 4NSKB 1H0DB 3L3HB 5F72S 3VXQA 3BIBX 3DMMA 2E7CA 2NW2B 5FV1L 1L0XA 1HXKA 4PJ5E 1MG3C 2YFNA 3O6FD 2XZZA 4NX0A 4PJCF 3QYCA 4EI6A 2JQAA 4L3EE 2BX5A 4MD5B 3SYQA 1C12A 3FQXB 4ZMLA 4XX1G 1NDGB 5I73C 2WBWB 4UT9A 2XZQL 2HJKB 1A14H 3QIWC 4JDZB 1QRND 1LEGA 3M17B 5EOCL 2VW7A 2APWA 2W38A 5EO1B 2JNZA 4Y1AD 3QUZD 3P3YA 5J6SA 1BQUA 3PU7A 2OMVB 4WHYG 4F1SA 4JM2A 4WUUE 5H37A 1VFAB 1HHHB 1PSKL 1THCA 3WS6C 2DQUH 5DGQA 3T09A 2O6CA 1KIQA 3U0TA 2IALB 4JFYB 4P5TD 4MDJB 3ZDYB 2XFGB 4UYPA 2BVEA 4HH8A 5FA4A 2VZSA 1S9WA 3GBNL 4C58B 1TQWA 4RBPH 4PJ8D 1L7IL 3HC4H 1GYCA 5TF1L 2C9PA 1LP9E 2X4NB 3FZUC 4UB0H 2P46B 3AG4B 4KXDA 4O02B 3SQRA 5AENA 1P4IL 3CDZA 1JNLL 5KYYB 5EUKB 1PIGA 5EZPA 5KS9A 3UFIA 2O30A 1BYPA 4AYSA 3MRLB 3GIZH 5K39B 3KWWB 1KTRL 2YPLB 5DEFA 2ALAA 1JNNH 2WXGA 5F21B 5JPMA 5F0LB 4YVNA 3GMNB 3QQ3A 4X7TA 1GHFH 4FS0A 1F5WA 1A25A 1IC4L 2DWDA 3OXRB 4LEOB 4Y2OB 5E99L 5HHNA 1DUZB 1WBYA 1HYSD 1CC3A 2DMCA 1OP3H 1YMME 3WS3A 1OQXA 5GZOC 2ZJSH 1G9MC 1D2OA 2VXTL 3WO3B 3WKMH 4O2EA 3RL2A 4J3OC 4R0LB 5F6IB 3VGAB 1JZ7A 1CF8L 4PR5B 1ZV5A 1ILUA 2J1KA 4OLYL 2WYZA 1FPTL 3QQNA 4POZD 5B38B 3M1BA 3RUGE 1XSJA 3IDMB 5GPRA 1NCUA 2ZOOA 2E9BA 3OKEB 5J9PB 5KSUA 2YMOA 3B3IB 1NKRA 2Y7LA 3GSQB 1F4WH 1VKXB 3QDAA 3K71A 3F58L 5K9KA 3WIAA 5J57B 2FX8H 3UYOD 3ULVL 4ENED 2JQMA 1X4ZA 2RAMA 5CN1A 2VYRE 2WANA 4WV1A 3D0VB 2CJUL 5EF2A 4R0LC 5F6IC 2HFFA 3FQUB 3WEMA 5EC2B 1IT9H 5D1ZB 5F88A 2KZ1B 5DYFA 2APBA 3RLSA 4XCEA 3WAJA 4L8CB 1S2EA 3JBG7 4G83A 3L2MA 3P69A 2VKWA 1I1RA 2OMWA 1BFVH 1NMBH 4G5ZL 1KNOA 4BWUA 3ZE1B 2AV1A 1OP9A 1U3YA 1DO6A 2NYYD 2NY3D 2UYLA 1MXDA 2Y07L 5E1QA 5LBSH 3U7YL 4CMMA 3MRNB 3BIAX 4CVWA 3DVNB 3IMWA 2XQBL 1FO0B 5DA0B 3HG1D 3HC0A 3GHBL 1PY4A 2PWHA 3QH3A 4JO8A 4M62H 4CA4A 4L2LA 3DO3A 2BP8B 2A74B 4H8HA 1IBZA 3KPSA 2AK4B 1KIPB 4Y16C 5EBMA 1K3IA 2D73A 1LNUB 5DC4B 3ENEA 3BKCH 2AQNA 3VH8G 4LSUH 4AJVA 3GHEL 3QQDB 2O5NA 3BUPA 3L4ZA 4ZS7L 2K9FB 3E8UH 5IJBC 4UBDD 4HIEB 4R7DB 3NCCB 1WBZA 1PW3A 4YSRA 4ZRGA 2OZNA 5IB5B 5EU7C 1QW9A 2K9UA 4R96B 3N04A 3W56A 4ZMVA 5AD0B 1MFAH 2BIOA 4KUZL 4TQIA 1GZHC 4P5RA 4ZT1A 1HHGA 2UWEF 3VXME 1JPTH 3WSQL 4NKIH 3V8CA 1BQHG 4M8UA 5L0QC 3RVVD 5DJ2B 1G9ML 1SUJA 4U3XA 4ODTL 4BWWA 4ISVB 5EOQH 3VD3A 3RX7A 3NJHA 1DDHA 1XGQB 4PJDA 1Y6NR 4J3WA 4PMFA 4XXDB 5FGSA 5FUOL 1I8LA 1H5BA 1N19A 2YD1A 4GFTB 1KGIA 3T04D 3ZDXE 3ABMB 1A3RL 3KPMB 4A2HA 5FKPB 3ILQC 1C16A 3GRWH 4PCTA 5F1SA 1XF1A 2P9RA 3H0TA 3IFNH 1H3UA 3PNWA 5E9DD 5JHDB 1R5IB 2BJML 3RZCB 3N1PC 4HG4J 3X13A 1A0QL 1KGUA 4PSRA 4QNPE 3MGOA 5JA9A 5TDPB 1NQBA 5KJRH 3GMPA 4IOIA 3B5TA 4OFIA 5KW9L 3NBNA 3BGFC 1F4XH 1MLCA 1SEQL 7TAAA 1RSFA 2X4SB 3SDXA 2C3WA 2AJXL 4B6ZA 4EDXA 2ATAA 1IGMH 2AITA 4W9DC 5AVYB 4LEEA 3SN6N 2NLJA 1RULL 4PP2A 3OMZA 1T0MB 2R9HC 3KCPA 2O1AA 2YQ3A 1USZA 2ZSWA 4JG9A 3JWDH 3TBCA 1A3QA 2GSMB 2BVQB 4W70A 4NPKA 2WLIA 3MROA 3VW3L 5I19L 2VQUA 1NJ9A 3NFPB 3KBHE 2JELL 3A22A 4PJXF 3VXOA 4TYUA 3HZKB 4NSKA 3GO1L 1H0DA 3L3HA 2NXZC 2Y3NA 4KRMB 3UO1L 2NW2A 2IANB 2UZIL 4YK4C 4MD5A 5F0JB 3GEFA 3JWOH 1HEHC 2BCMA 2FT6A 3HHMA 3FQXA 4HD9A 5DZJA 3PS6A 1MNUH 2FDBP 1RSYA 1IZKA 1NDGA 2DYPB 3O45A 2HJKA 1TJMA 4G1MB 4N5ED 4P5MB 3SCMD 3TFKC 4JDZA 3ZIYA 5KBKA 3WTSA 2VLJD 4HA1A 4P9HC 3WXWH 4ABVA 3M17A 5EO1A 2GBVA 4M7KH 3QPQD 4HFUL 3V4PL 2GY5A 5FGCB 2OMVA 5D5ME 1MFCL 1U8JB 2FVNA 3TT1H 3TO4C 1VFAA 1HHHA 2AV7B 4L3AA 1LGVA 1FO0L 4L4TD 2VDPH 5I1KH 2ROXA 4L1SA 2IALA 4AVIA 4M93B 1O0VA 4X6EB 4MDJA 5JMOC 4UU9B 5D2LE 2Q6WB 4Y4FD 1DJWA 4KI5C 1O9VA 2K7PA 1T89C 2W81C 3C8KB 4LPVA 5D93B 2X4NA 4I18C 3M7OA 1ZLWK 1BV8A 4O02A 1V7ML 4JREB 5CXPA 3U2IA 1TU2B 3BUBA 2H3XC 4B7LA 4XVOA 1KPRB 4OLXH 5KYYA 1SVCP 5EUKA 3QBTB 2DI7A 3GSRB 1A2YA 1MVFA 3MRLA 2YSTA 5K39A 4LIQL 1YNTF 2WMPB 3CNKA 3KWWA 5FS5A 2BDNH 2YPLA 3CZNA 3GMNA 3TBBA 3CZKA 1R3JB 3OXRA 4LEOA 4Y2OA 4HOWA 5KUKA 4XXWA 1DUZA 2VXQL 2E74C 3NZ8B 3BRDA 5C2BH 3C60D 2DQDH 4NQQA 3O2DA 2E9IA 1BAWA 43CAB 1JFHA 1ND0B 1F4AA 2IOIA 1TTBA 2QZ5A 2K6WA 3N41F 4GB9A 3MLRH 5JOEA 2D03H 5I5IA 4N22A 5B38A 2K4AA 1R0AH 4NQEB 4PWEA 5EU7E 3IDMA 3WKYA 3QWNA 3DIVA 3VXRB 3QUMB 1SQ2N 3OKEA 3RY5A 5J9PA 2BVUA 3B3IA 5AG9A 3GSQA 4EN2A 1E90A 4YIQB 1J8HB 5C0CD 1VKXA 4KQ0A 1WE5A 4HOZA 2DQCL 2EDDA 2ZOUA 4KZEH 3R06B 1L3WA 2BCKB 5EA0H 4M4RB 2V3DA 4JGJA 3DDGA 4P5SA 3TM6A 4H88H 3D0VA 3I6LE 3FQUA 5EC2A 5D1ZA 4ZBJA 4Y5XB 3MBWB 3O6KL 2CE6A 4JRYD 4KPHH 5DXWA 1Z1WA 4ALAH 5AVRB 4I1RA 4L8CA 3EDKA 5K9OB 3QNYB 2DBLL 4PS8A 3FO9A 3C08H 3LS5H 3N1MC 3FT3B 3OQRA 3U4AA 1UA6L 2FQEA 4JPWL 4HHAB 3DVNA 3FJTA 3JXAA 2DIEA 4Y5XC 1FO0A 3BE1H 4BRJA 3I9PA 5F7MC 1PFCA 2HVJB 3O4OB 4RWYH 5HDQH 7PAZA 1UT9A 2BP8A 2A74A 2CK2A 5IHWA 2JCCE 5DMKB 5DJAB 1PLGH 1USQA 2AK4A 1KIPA 2W80C 5FB8B 5JIPA 5INDB 2OKMA 5IY5B 2PP7A 2GSGB 4ZMAT 2DEXX 1LO4H 3GUTA 3QQDA 1F1GA 4LSRL 2DOCA 5BRQA 4PJGB 4MJIA 4AENB 4MNQE 4HIEA 1KT2B 4R7DA 3T3PB 1YEGL 5F9OL 5CJ5A 5IB5A 3GMOA 4R96A 5AD0A 4XC1L 2B77A 1OSZB 2KMWA 3ELQA 2YD8A 4FXGC 5FYLL 1K8IB 1TENA 1VGEH 3I85A 1Z5LB 3FFDB 1Q1PA 3UAJA 4KAQL 2B1HL 1MY5A 2DQJH 2WO3B 3TTSA 4YHYB 2WZAA 2HT2C 3M46A 3VX0A 1KDIA 4JJ5B 4UQEA 5DJ2A 2FRGP 3O11B 3LPFA 1ZLUK 3SJVB 2JB5H 2FO4B 4ISVA 2VXQA 4QF1B 1XGQA 2F54B 1KULA 4XXDA 2JKSA 4KO9A 4XMWA 1XF5B 3SPVB 4G6KH 5IB3B 3KPMA 5FKPA 2J1WA 2YGNA 3UXFA 3P77B 1QSED 2RBLA 4PLKC 1HZHH 4R2GB 5LBVA 4XB7A 5JHDA 3RZCA 1F3JB 3RWJB 5FCUL 1ZSDB 3C6LB 3EGXB 5TDPA 4KI5E 3EO9L 4F7MB 1KGJA 3TN0B 1J10A 1BFSA 5KVFE 5ISZE 2MCAA 1GJUA 4LO9A 1ZLWH 2X4SA 4JM2F 3CVHB 4XWOC 3UTTE 4PRPD 4X99B 4YHZL 2VUYA 1YEJH 4HEMA 1GTFA 1A8JH 1MJUH 1JWMB 4FI8A 1A7BA 2I69A 3FSOA 3F12B 4WU7B 3RWHB 1WIPA 3UDWA 2BVQA 3D4ZA 1JD7A 5KYXB 2ODIA 5BRPA 3UIZA 3KL3A 4I8DA 3FT4B 4XPFL 1ADWA 3HZKA 5AYTA 5TK4A 4AEEA 1CD8A 2IANA 1FAKT 1MAKA 5DD5L 1DVZA 3ZTJH 3O6FC 5KS9F 1VFUA 5M94B 3KVQA 4BHUI 5T33L 4P2QE 4QRPE 3MBEB 4ZAKD 2LT9A 2DYPA 4FOMA 4G1MA 3SDDB 3B2MA 4NC1C 1VEMA 1UASA 5DVLA 1IBGL 4OGQC 4AEIH 1SVBA 3RGVA 4U1KB 2X53A 3VSQA 1U8JA 3WY3A 2ZYSA 2AV7A 3VWKB 3WDHA 4P99A 2GJJA 2OL3H 5E9AA 2DQHL 4A39A 2FGWH 3JTSA 1J8SA 5E6YA 4UU9A 4JR9L 1L9NA 3SDDC 2JKXA 4WTQA 1JUFB 3EJSA 4KQ3L 3C8KA 5IP4A 3MOBL 2O5YL 1F02I 4PJ8C 3T3MF 1DBAH 4H26B 3PWJB 1TU2A 1DBKH 1Z2KA 2ADFH 1KPRA 1GCYA 3GSRA 1Y07A 4MQTB 3LIZH 4OFYD 4XOBA 3QJOA 2WMPA 3OSVA 5IJKC 3K80A 3QWQB 3FU7B 1GIGL 3HRZC 1R3JA 4GLRH 4GNKB 3L17A 5C9KA 1E40A 4GAYB 4YHMH 1A6VL 1G7QB 2BFVH 2XWDA 4MZRA 4QR7A 4LP5A 3ZL4L 3BQUD 1G87A 43CAA 3GMMA 3DUHA 2XYBA 2RCSL 3ZL2A 1AQKH 4PLJD 2GK2A 3LVTA 5BW7C 3NOIA 2F53B 3C09C 3EO1B 1X9LA 2GYSA 3WKPA 5JXAL 2AJYL 3IXAA 4ERSH 1DJHA 2BVYA 4GRLB 2OYPA 3VXRA 3QUMA 1IAII 4X5WB 2YQ2A 1SPDA 4NWTL 4YIQA 1J8HA 4R7XA 4ONOA 4HZAA 1TYRA 4E9WA 3R06A 3KJ4B 5DUJA 2UVEA 2WXLA 2BCKA 5ESAB 4HJJL 5K1JA 3W0WD 4LVOC 3NIGE 4KJPC 4F7EB 5L6YH 4OQTA 3FO1B 2LGNA 1RURH 2X4PB 3MBWA 4NHUB 4ELMB 3GT6A 4FNLL 1W72B 4UMGA 1F3DH 1N3NA 3CVBA 4H4NA 3HN8A 1XIWC 1MXGA 1TCMA 5K9OA 3QNYA 3HUJB 1P9MA 4K8RH 4B96A 5CD5C 5JO5B 5GS1B 4AQ8C 2BIQA 3FT3A 2HG5B 2NR6A 3B2VH 5IM7A 2C3HA 5D72L 1KYOJ 4DEPB 1OAUH 1R24B 3G5VB 4FN0A 5CCGE 4HHAA 2H0EA 4RFEB 2PWFA 2H6UA 2NYYC 1D6VL 4XCFL 2NY3C 3FCTB 3N42F 4Q8BA 1SLVA 2RB8A 1BYNA 4WSGA 2UXTA 5DHVH 3MGTB 2HVJA 4J3UA 1TUPA 3K72B 3QDME 4OCRL 4U1NB 5DD1L 2CALA 5DMKA 5DJAA 4R26L 1OLZA 2P80D 5INDA 4OCXH 1JF1B 2FECI 5CZVL 5GS1C 5K69A 3HB3B 2GSGA 1CG9B 2ICWB 5DUMH 3QFJD 2R0LL 4PJGA 4JO2L 2E59A 4AENA 1UD8A 3SDXF 1KT2A 1XD1A 4BXSV 5L8KB 3LRKA 1ETJA 3HZVB 5D96B 1I9JH 5IB1B 3PUUA 1K8IA 2CDEB 1Z5LA 2J43A 3FFDA 2OX5B 1LWRA 2BW4A 2WWKT 5D1QA 5GQBA 3RY6C 1H8OA 3EJQA 3NIDF 4JJ5A 1Q9WB 1JRHL 1JZJA 1NGQL 2XX1A 4RQQB 3O11A 1KTKE 3K74B 3SJVA 2WIMA 2FO4A 1FNLA 1QRNE 3Q1EA 3RVVC 1TETH 3QJVB 4QF1A 2F54A 3NIFB 1QBMH 5E6ID 35C8H 3SPVA 4Y1AE 5IB3A 1XX9C 3L2LA 2WP3T 4FZEH 1WZ1L 2FZ3B 3N0AA 3ULSB 3P77A 2FWLB 5HVHB 2YD3A 1RJYB 3UCQA 2WUBH 2JJVA 1F3JA 2MCG1 4K5PA 3RWJA 3WIHL 3ARPA 3C6LA 3EGXA 5JPNC 4F7MA 3LPGA 3TN0A 2EDYA 2BSRA 1GW6A 3ATEA 1Q72H 3MTXA 4S1SL 2DQIH 4NP9A 4MWFB 3PPEA 1SHSA 2AEQL 3CVHA 4NN7C 4OCMC 1KCSH 3B37A 4X99A 4XXCA 4Y5YC 5DTFB 5I17B 1JWMA 4XVJH 4YC2B 2C9SA 1OLLA 3M07A 3F12A 4P3CL 5C0ND 3RWHA 4X6CE 2BP0B 3ZDYF 1XT5A 5I1IL 5KYXA 1ZXQA 3V6OC 3FT4A 3DRQB 4UINL 1U8LB 3IPEA 3SGJA 1DQQB 3IE4A 2XTLA 1XWVA 3F83A 2QTVA 4XN8A 2AQRA 4ZX4A 1XF4A 3A47A 1J9TA 3X1GA 2L7EA 4WNSA 4GW5B 1UEMA 3EJJX 3BMVA 3ARGB 3EYUL 4G11A 4OBRA 4YC2C 3MBEA 1T83C 1WTGT 1Z9MA 4BCZA 3BAYA 2OSLB 4LOFA 4NEHB 1B2YA 3OHMB 3PCYA 4MMYB 5F6HI 2IBZX 4N5EC 4HCIA 3SCMC 1R19A 3NSFA 1XEDA 4H0LC 3H4HA 3TV3L 4EKXA 1TSRA 2GVYA 3ESPA 4HJIA 4U1KA 5FGBA 4ODWB 4KTDL 3QPQC 2HSIA 4NUJA 5L2JB 5B21A 3LHAA 1R46A 3VWKA 1BF2A 1CT8B 3BP4B 3MCKA 2ATKB 2XWJB 4O2CB 2CHDA 2QR0B 5JQ6H 4Q9RL 1IC5H 1U8KB 2WZ0A 4FC3E 5ALCH 5ADOL 3IDNB 4MCYB 2J8OA 3MLUH 4LPXA 3WG7B 1U8HB 1ZSHA 2DTSA 2EILB 3BKJH 2XV0A 5MP6H 1EAOA 3SDAB 4H26A 1F8TH 3FS9A 2X2IA 3PWJA 2XKUA 3EBAA 4FYSA 1P7BA 4JQXC 5EUOF 4I9XA 4LSPL 1IQDB 1JK8B 2W8CA 3QNXB 4UNUA 4W6WB 5HDWA 4K3HA 1F13A 3P3SA 2VO8A 4OJFL 4LCYB 1SGKA 1Q0EA 1NIFA 3GXUB 4FQQB 2CMRL 4XN9A 3CFIC 4F7TB 2YLKA 3FU7A 4HISA 3NQKA 1KGWA 3P4NB 2P5WB 3G6JB 3FTSA 3HG1E 4I3RL 4GAYA 5I8OL 4YDKL 4MYWB 1G7QA 2A9NL 5FGRA 3NA9H 2MQCA 4FFZL 5FYKH 1YEFL 4RMVA 3C60C 4HDIB 3ZE1F 3AM8A 3RVXD 5TDOB 2F53A 3EO1A 5D7EA 2JVUA 5E7BA 3LQAC 1QQDB 3B5HA 4GJTB 4GRLA 4XH2B 3HBPA 1YEIL 1R3KA 2WZ5A 4QOKD 4X5WA 1X5FA 1YY9D 4XPAL 4D9QD 3FRUB 4X4MA 2K4WA 2E46A 5FK9B 5B7MA 1UD4A 1E5ZA 2DMBA 3WUWG 1BGXH 4N86A 3T0EB 5ESAA 4NN5C 2LLLA 4FG2A 3IGFA 4M8QB 1AZNA 1NANI 3AWGA 3UBXG 1KEML 4F7EA 4Q56A 3GD1C 5GS2D 4HUCA 2FE0A 3FO1A 2GEQA 1OAZH 2X4PA 4K94H 4NHUA 1J9QA 4L4JA 4ELMA 2D3LA 2F2HA 2XN0A 3DI2B 1MW3A 1W72A 4U1JB 1EDHA 2CKBB 2A4EA 2WYIA 4O9HL 4LLMB 1KB9J 1DLFH 3OKKB 1E3FA 3TBYB 4WK4B 2VZTA 3HUJA 5E9DE 4JKMA 5JO5A 1AY1H 3G7TA 3SGKC 2HG5A 3NYKA 4CSPA 1GZPB 1MWOA 1R24A 1XTLA 2R2BB 3G5VA 3UC0H 3CZJA 4RFEA 4WKXA 4CDGC 4AYGA 5F3FA 4K5MA 3F6JA 2PTVA 1L0PA 4DKEL 3S4SG 4U6VH 1J0ZA 2XXCB 3MGTA 1XGPB 4FRWA 1EO8H 2D4FA 5FOJA 3K72A 4EZKA 3NPZB 3Q9PA 4JY5L 4U1NA 5EZJB 4UT6H 2WWNA 2HJLB 5DHEA 3QULB 1JF1A 2HUHA 4JQIL 4H8WH 3VDAA 4JHZA 4LHUB 1CG9A 5CEXB 2ICWA 3FUNA 1UENA 3LOWA 1WP6A 4QYOB 2EDKA 1SXSA 5DQDH 4MVBC 2ED9A 4PRBB 5BQ7B 4PTTB 5EDSA 3HZVA 1MCPH 1OT2A 4PGEB 5T5FA 5IB1A 2YO3A 4IKJA 3OPUA 2CDEA 1BQ5A 4M56A 1TCRB 3ZDZB 4N8PA 4DN3H 4H13C 4QWWD 3DXAB 4OGXH 2Y7MA 1ZVNA 3CG8A 3N55A 4EQ3A 1Q9WA 1JXJA 4L18A 3N1QC 1CI5A 4RQQA 4EI5D 3AAZB 2VLJE 4FKHA 1GOHA 3EUUA 1EAJA 2AK1H 1DQMH 1IAOB 4J4PD 3II1A 1W15A 4FKEA 1DSFL 1NL0H 3GK8L 1NBVL 2D7PA 2FZ3A 4GT0A 3ULSA 1VENA 3CGTA 3BRFA 1EHLL 3BN9C 4HIXH 1HIMH 2W60B 4L4TE 4PJAB 5JW3L 5IG7B 5DZVA 3I50H 3PYCA 4PP1D 3ZE0F 2HG0A 5JR1L 1QI4A 4OB5L 4S1QH 3OF6A 2XPGB 4GBXB 5KVMC 2J20A 1M7XA 1UFGA 4LQFH 1MCLA 2YSSB 3GZPA 1NBZB 4HT1L 4MWFA 4OSUL 4ZODA 1GC1C 4AK1A 2IDTA 3K6IA 1NSNL 3DLQR 1HQ4B 2ZOTA 1CTOA 5DTFA 5I17A 5INCB 4OZFH 1Q1JL 1HZKA 1A7NL 2BP0A 3AUWB 5C0AB 4YUEL 4I77L 5CU5A 3ISYA 1LM8V 1M3JA 2A4ZA 4HXBL 4QXWA 5EEYA 5T3ZH 5C09D 1JZEA 1UB5B 3DRQA 1B9KA 2P52A 4NIKB 4P2RB 3UZQB 5KN5B 1DQQA 2NY0B 4Y7MA 2ATPB 3A21A 2VAAB 3DTDA 1NGXA 3VSTA 5I1GL 3L9RB 1IL1B 2F7OA 3HE7B 4GW5A 2HH0H 3ARGA 3HI6L 4Z7QB 2RD0A 1C5DB 2CKBL 3GM8A 1X6NA 3FW6A 4WIQA 3WMQA 4YXLL 1E6JH 2FJFB 3GXDA 4BCYA 2CBPA 4ZAKC 4MMYA 3N9GL 1LO0L 2E9WA 3ZTDC 3TWCL 1HCFX 1RKRA 2HTKC 2IBGA 3Q2VA 4ODWA 1YEHH 4DO5A 5L2JA 2V8LA 2DN7A 4X2UA 2V8MA 5IEHB 1K3ZA 3EJRA 2PO6D 1CT8A 5C0CE 5TGBB 1EO7A 1LWJA 3BP4A 2R2CA 2JE8A 3HE7C 5FDWB 5AVSB 5CFHA 1IIIA 3SE3C 2ATKA 2XWJA 2DWTA 2QR0A 3LXUX 2PLTA 5J6HB 3BP5A 3MVSA 5DHYB 1U8KA 3DBXA 3FBKA 3HS0C 4HK0A 3KJ6H 4AYMC 2WB1A 3V4VH 3IDNA 1J11A 4PQXA 5E5UB 3C5JB 2MCMA 3HAEG 1EJOH 2UWEE 3VFSB 3DURA 3KPRD 4BK5A 1G9NH 3SDAA 3C8DA 4JRYE 5TDNB 3S35L 4XNUH 3INOA 5DSCB 1YHPA 1S9VA 3MLWL 4MJID 3H42H 3LSOB 1IQDA 1JK8A 3QNXA 3PAUA 1AVAA 1G6VK 1KCRH 4RA0C 5I30L 5ELIA 4D8PA 2CO6B 4LCYA 4XAKD 1QEXA 3QRGH 3UAFA 5B39B 3R8QA 2HN7A 4FQQA 4F7TA 3NCXA 4UNTA 4WI8A 2ICWJ 2ZXBA 3N0PB 2P5WA 3AWEA 2QADC 2WO2B 3QEQD 3G6JA 4S1RH 3U1SL 4PVBA 5BOPA 1MHPH 1BLIA 5HHXH 1UATA 3DGGB 3LQZB 4NLAA 1UD6A 1DBML 3WBDA 3UG5A 3QR0A 2VLKA 5E2TH 1MRCH 1RJCA 4HDIA 4D8OA 4U2YA 3BQUC 3KPQB 5DHDA 3AROA 2OPCA 2FQDA 2WOYA 4JKKA 4O4YH 2A9MH 5TDOA 1TSHA 4EIBA 2HLAB 4PLJC 4KH9A 2B1AH 3BYYA 1QQDA 3OLDA 4YDIL 3RP1A 3JSSA 4NENB 3BCDA 4V11A 1DBJL 4HXAL 1RZFL 4Z7WB 3FRUA 3J07A 2DLFL 3KPLB 3ZGHA 4DF9A 1NCDH 1XBDA 2WXJA 2HYMA 4TL4A 5FK9A 3UTZB 3S34H 2RJMA 3EJTA 4TUOB 3UTSB 1BBDL 2C4FU 1P84K 5LAXB 3T0EA 1ZVYA 1RUPH 4LMQI 4M8QA 5DJ6B 2Z7WA 1SJEB 2YA0A 4PJGF 3WHE0 2CA3A 4WSJA 4JO3H 4TOYL 5LB1A 3T3PF 4FI7A 4Q6IA 1UM5H 2ITCB 2UZYB 4FQIL 1MI5E 2X2UA 2J21A 2X4UB 2CKBA 1V27A 4LLMA 1BJ8A 1QSEE 2WXNA 3OKKA 3QHZL 3P2DA 5EU6A 3TBYA 5DUBB 5JNYB 2IAND 2XWEA 4OLZH 3N1FC 4K9EL 3VWJB 4AMXA 3NSDA 3MOAH 3V5KB 4NM4H 2R69A 5E8OB 1PKQB 1IARB 4PYHA 2P45B 2R2BA 3PDGA 3QT2A 3D3VD 4FP8L 5IHUL 5IMLB 4W68A 4YHOL 3BPNC 1S8DB 3MA9H 2E7DA 5DCCA 2ZCLH 5KVGH 4N24A 5JHMA 4MA1C 4PRPE 2A6IB 5EO0B 1KBVA 5EZJA 3RGVD 2K8MA 4MHHI 3MKGA 3EXJA 3BLBA 1H3TA 4EOWL 3TZVD 2HJLA 4IDLA 2CK0H 4GG6B 5FYJU 1TEFA 1JHKH 3PXLA 1BEYH 1BYOA 1ZA3B 2CJ3A 1X9QA 4LHUA 5BZXA 1NCBL 5CEXA 1QLRB 4JK0D 4I48A 1CXLA 4QYOA 3QGVA 2VTFA 4PRBA 3E6HB 4PTTA 5DRNA 1JOIA 2AEPL 2BSCA 2XWZA 1THAA 2BHYA 4XTRD 3B2PA 4Q4EA 5FC9A 3X3GL 3F6IA 3APFA 1TCRA 1BIHA 3STZB 2FX7H 4FULA 3EJYD 2DF3A 3RGBA 1YG9A 1UXWB 2J2ZB 4GSDL 1DJZA 1WHPA 4EUPG 1R47A 1OY3B 3PJLA 3VXUA 3Q6GH 4HZLB 3MUGB 2WXRA 3H9HA 4IQHA 1GGTA 3OGOE 3SDCB 1IAOA 1P1ZA 2MJWA 3QUXC 1WITA 3CMOH 5AOJA 5E6IC 5E2VL 4K3JL 5DC0A 3POHA 3A4AA 5I15L 4OLVH 1O7SA 1T7YA 1A6WH 5A2FA 1LEIB 4MJHA 4PJAA 1VERA 5IG7A 3VH8B 4U6YA 2O72A 2WNGA 4OCSL 1YECL 1HKFA 2I5YH 2XPGA 1JBJA 3MJ7B 4GBXA 2YSSA 2ZPKL 3U2SB 1XSOA 1NBZA 3LRHA 4EE2A 4AL8C 2JTDA 4U1GC 1V05A 1GYWA 4M6ML 4F8TA 1HQ4A 5DGRA 4OFKA 5DLMH 5INCA 1HYRC 4AKOA 1ZHNB 1FFRA 3QJUB 4U1MB 5C0AA 2UUDK 3VM7A 5C0NC 5DT1H 4WWNA 3LS4L 4D94A 1KCKA 1UB5A 5KANI 2M83A 4LCUB 3UZQA 4Y19D 5KN5A 2ATPA 3ARBD 4TQPA 2FEJA 2HZHA 3L9RA 1IL1A 4CGTA 1BVZA 5F7UA 1NCHA 5IROA 1C5DA 4J27A 4GQPH 4IBWA 1QFWL 5HYJB 3MV8B 5ABZA 2FJFA 5BZWB 3KR3L 5HJBA 1TYEB 3PAVA 2VQ1B 1LTXA 4HIQA 3U25A 1TZIB 1GH7A 2ZNXA 1U92B 2J5LB 3FQYA 5C07D 2XTSA 2X28A 5F70A 4ZUTB 1F58H 5IEHA 4PRAB 2CCLA 1JGLL 3L95B 2ETWA 2IJ0C 3CLFH 5FDWA 1PLBA 4WWKD 1NAMB 4Q0XL 2NY5H 5J6HA 4JDVA 3U1PA 4BFJA 3HCVB 3W0WE 2ITDB 1TZGH 4LL9A 5EPMB 3D25A 5FX3A 4GO8A 3QW9A 3VFSA 1XZWA 4DKTA 2DJ4A 2E8YA 5TDNA 4HPHA 1I3GH 5D6DC 5BXFB 2Y3AA 3PE9A 5DSCA 2DDQH 2PCXA 1IE5A 3ZHFA 2RALA 5C97A 3FYEB 2X9XA 3LSOA 4PVMA 2WWMD 3HVDA 2CO6A 3KWXA 5LNEA 1YJDH 4NP4L 4JZNB 2P49B 2D7NA 2EIMB 2IH3B 2CH8A 5B39A 1WV7T 2VN5A 4GKZB 3OJVC 2EVFA 1SOKA 2YUVA 4H8QA 3BD3A 5D1QD 4ELMF 3LZFH 4DGUA 4BKLA 4Y4KB 4BUHA 4AL8L 3MRKB 1UACL 3DGGA 2Y06H 3BT2L 3LQZA 4TNFA 1CBVH 1A1NB 1A1OB 3HUJF 3IGUA 4YDMA 2V17L 3WNPA 1E50A 2P48B 3DOSB 3KPQA 4UAOB 5EBGA 2XCMC 5GRXG 3U6XA 2HLAA 2MNUA 1ECYA 1RMFH 1TJIH 3QFJE 1OV8A 1MJJB 1CLZH 3WNMA 4JZJC 5LDUA 2BFGA 3C6LD 1MFMA 4NENA 4XO5A 3HG0A 5TE7H 3EFDH 4Z7WA 2VDMH 1DEDA 3KPLA 3GFUA 5I0YA 5FIEA 1YY9C 2FT8A 1M05B 3UTZA 1WIOA 2EH8L 1MCQA 4TUOA 3UTSA 1DP0A 1XO8A 2AABH 5LAXA 1Q9OB 1EX0A 2C9UA 5DJ6A 2CLVB 3ARZA 1SJEA 1YN6B 5IVZB 5ITFA 4PJ9B 5KS9E 2X1PA 2ITCA 2UZYA 5ICYB 2X4UA 3QSKB 5EN2B 5CJBA 5B8CB 3RI5K 4G7QB 4BZ1L 5JUEL 4UQBA 5FAAA 2JQZA 3FU5A 2K0RA 3S96B 4F9PA 5JNYA 5DUBA 1F6FB 2QPUA 3RNKB 2QGEA 3ASWA 3FUEA 1ET5A 3VWJA 4AT6B 5FWRA 1K72A 3CCHA 1Z3GL 3V5KA 5E8OA 4MJJA 3VFGH 1PKQA 2A73B 2Z3FA 3Q43A 4M48L 3NIFF 4LOUC 5IWLC 3C2AH 4PJ9C 1PFOA 1S8DA 2BS9A 2GTWB 3GM0A 1BVNT 1CZ8L 4H40A 3MRFB 4DGIH 3KL0A 1EDYA 2A6IA 4QHNB 5EO0A 4MYPA 5BRZB 1RZJH 4N85A 1SMAA 4GG6A 4G8AC 4KROB 2UUDH 3U9PH 1BQSA 1ZA3A 3FB7B 1RJZA 3T3ME 1N64H 3VWKD 1QLRA 1CE6B 4NB7A 1IGFL 1KLFA 1E42A 3G3LA 3E6HA 3ECVA 2P3YA 4PRDB 1V3JA 4L37B 3WN5B 4YHLL 4NZRL 5AVVB 1AJ7L 3DJTA 2BY0A 1BMZA 2CHXA 2V5MA 2OQJA 3STZA 1SLXA 3NUKA 4N0RA 3NTCL 1UXWA 2IDQA 4QWWC 3QI9C 3AS3A 3PWPB 4HZLA 3ASOB 2QQLH 3MUGA 3Q05A 5BS0B 4TKWA 3DX8B 3A6OA 4RGNB 3SDCA 1JWUB 4EI5C 7FABL 4BA8A 2QDVA 2OAAA 1OP5K 4B3VA 1PDKA 4J4PC 4JFPB 4BFNA 1KCVH 4JG1L 2FD6H 4FXTA 1B0GB 4OZFG 4BQCA 3MJ6A 4CSZA 4WAFA 1LEIA 4QXVA 4N87A 1WICA 3VH8A 3PXJA 4ZQTA 2JMRA 5I24A 3CDGA 3P11H 2YD2A 1F2QA 1AQHA 1V7NH 3MJ7A 2VC2H 4M5ZL 4KRPB 4WY7H 5E4EB 3WI9A 2DQEL 4WENB 3OM3B 3D34A 4FLQA 4PJBA 5IW6A 1JRHI 5ID1B 2YAFA 1TMCB 4NCDA 2OMBA 1XD0A 5ILTL 2KLRA 5KSAB 3NEOA 1ZHNA 5F2FA 1QR1B 2EEXA 2ZNWA 1KXVC 3IRCA 4U1MA 2YD4A 4U3CA 3U7WH 3TBSB 2W0PA 1HK6A 2QDWA 5HDRA 3VFWA 3SKNB 2WWOA 2EDNA 2R29L 4J2QA 1N5YL 2VR9A 4LCUA 3FTUA 4XPHL 5DHMC 1QAWA 4KFZC 4BZ1A 1YQ2A 4RX4A 3JVGA 4B41A 4X9IA 5A7BA 1OL0A 1Z0NA 4KH2A 3BC9A 4FHBD 4PD4J 5LGHL 3A67L 5KSAC 2L7JA 3BDXA 5HYJA 2ZXGA 3HI5L 3MV8A 4OCYL 5KVDE 5BZWA 3TT3H 5CEZD 1NC4B 2PTTB 5CBEB 2VQ1A 2HKAA 4EQ2A 2R0ZL 1AOHA 1RHHA 1TZIA 3B2UC 1TVDA 2PW2A 4XBEH 1U92A 1CURA 4QOKE 5D55A 4ZUTA 1TG8A 1H6EA 2X70B 4JFTA 4D9QE 1Z9NA 2YD5A 3L95A 3O8XB 3OKLA 4N8VG 1L9TA 4UTBA 3S8GB 2PO6C 5EIIG 1MPAL 4KKCD 1NAMA 2LW3A 3ZO0A 4F2MB 4Z7IA 3V6ZA 1B4JL 1U8MB 2B39A 2ITDA 2JIXD 5EPMA 2GITB 3KGUA 5DI8B 4WJKB 4QGTA 2NY2B 1ZT1B 1H6FA 4HEPG 3PV6B 2Q20A 4TSAH 3HPJB 4HC1L 1J5IA 5BXFA 3GNMH 4MAYD 4LLQB 1SYVB 4HGWB 4BE5A 2BNQB 1YYML 2WXHA 3K91A 4NIYE 3W2DL 1ZTXH 3WIFB 3I75B 3GIVB 2VDNL 1ADQH 3MUZ1 1IQWH 4R4BB 2XYCA 4W9JC 4XE5B 3NFSH 3LN4B 4JZNA 2IH3A 3G6DL 4GKZA 3F2LA 1ETA1 2P7TB 1J0HA 2WQRA 3LRMA 5FCSH 3CSYB 4WI4A 5FW6A 4DK3A 4P2OA 4Y4KA 2XIDA 2NUPB 5F3HB 1GYUA 1PPIA 3MRKA 4HP5A 2A9DA 5E6UB 5HVFB 4KNQA 4TNWF 5EWIL 2Z0UA 4N0FB 1A1OA 1NLDH 5C7XL 4K7PX 2ZX9A 2YS4A 3UZVB 4R97C 3BGMB 3DOSA 3A0OA 4LXFA 2HKFH 4G6MH 3BAEH 4X8JB 2ZUVA 5HHVL 1HJBC 2JKLA 4ADJA 1S3KL 2ERJC 4XR8C 4CU7A 1QSZA 2WQVA 4EDWL 2XWXA 4YLBA 1MJJA 4LCWD 5G4NA 4HLJA 2ZYIA 5CJ8A 3OF6D 3EGDA 3ZDYE 4KTEL 3TPUA 3L16A 2W88A 5I1HH 1OCZB 2K6YA 2Y25A 4BQBA 3ZYIA 2R29A 1Q9OA 4DEUA 1HL4A 2CLVA 5EOTB 3UACA 4X4ZA 1UOLA 1YN6A 5IVZA 1IAIH 3KGTA 1LD9B 1AFVH 1R3IL 1QATA 3Q2WA 4D9RD 2EECA 2WSPA 1OP5H 2I9TA 5ICYA 3T9WA 5EN2A 3UTPD 3ZDZF 1MF2H 5AOKA 4YWGL 5B8CA 2Y36L 3Q48A 3DHPA 3UYRL 5LG1A 4QI3A 2KPNA 5LCVL 3RNKA 4AT6A 2EDLA 2R0WH 1D7BA 2AJVL 2BM3A 1AQ8A 2A73A 4PJHB 2CO1A 4F33A 4KK6D 1IJ9A 1AGCB 4NXKA 3WE6B 2APSA 1XXFC 2A4CA 2AHIA 3N40P 2GTWA 1FNEB 2B3RA 3MCG1 1UGNA 2EKJA 4BGLA 3GLZA 4GUQA 4QHNA 4OU3A 5BRZA 4PJAF 1H3PH 2W9DH 3MBXH 5HI3D 5AZ2H 3SDYH 2WXOA 4ESKA 1A14L 4YL9A 4GP8B 1GGCH 3NPSC 3TZVC 1J5HA 4J3VA 1CE6A 5L4MA 1OW0A 5C09E 5EUOE 4AIZB 1MRDH 4PRDA 2COQA 5C08B 1INQB 4L37A 1I4FB 3WN5A 1NOFA 4HOXA 1P7KB 4EN3B 4NUPA 5JXED 2P47B 2B14A 3EH3B 1C8PA 1IFGA 4YSSA 3K6NA 2WXKA 3EJYC 1ZANH 1KXHA 3PWPA 4N26A 5BS0A 3DX8A 3HC4L 5EZOL 1JWUA 3BT0A 4NNXB 5C6TH 4Q6YA 3WJJC 2MPAH 1OO2A 2FAUA 4R8WL 1EGJL 5C8JA 2WNXA 3ZE1E 3FUIA 1B0GA 1K85A 1A66A 2VM3A 3OX8B 1ID5I 3N06B 5GRJH 2CO4A 4NZTL 2C1OB 3DX6B 4S10A 4BYHA 3GI8H 1IBBA 5C2UB 1WO2A 2CDFB 2EADA 3H3PL 1NEUA 4BQ8A 3V10A 4RAVB 2VLKD 1VCAA 4X9HA 1HEZB 4U1IB 1AYRA 3KPRE 3FSAA 1MCEA 4XPTH 5ID1A 5KYNA 4Q9CA 5I75B 3V79C 3L13A 1BJMA 3CPUA 4MJIE 2R56H 3WYRA 4PTUA 1OM3H 4XN4A 2OTPA 2QSCH 1QR1A 2FHCA 4A2FA 1FNHA 3VA6A 3TBSA 1KY6A 3IMVA 1I7RB 4XAKE 2YD7A 4OTXL 2CBMA 2VMJA 1DVFD 3B2XA 3HMWL 1COBA 1YQVL 1NINA 1G7MB 2QQKL 3ARDA 1D7FA 1OGPA 4XMLL 3TU6A 2X4QB 1U36A 4YHNB 3QEQE 3ARBC 1F4WL 5LCVA 3T5WA 1YAZA 3JZYA 4YXKH 3RDJA 1A22B 4MQ7B 3HC3H 4UOQA 3T4AC 2VWEC 2IH1A 4GO6B 2IF7A 4Y2NA 3P0YL 2AJSL 1BVNP 3B8YA 3CQFA 2MPVA 1NC4A 2PTTA 3KGSA 3OTTA 5EU6D 2MKLC 5CBEA 2WSDA 6PAZA 1MG2C 1ZK5A 1I85C 4LRNH 3B43A 2A99A 2EDXA 3EBHA 2E76C 4KKBD 4JRWA 5C86A 4YSDA 3W38A 5AKSA 2X70A 5LJYH 2PTUA 3O8XA 4E9SA 4X5XB 1ZLSH 4P23D 2PR9A 1F1DA 3LZRA 1ZA6B 2EDHA 4ZFFB 4WWKC 4F2MA 4OV6F 1QWUA 5FV2A 3LV3B 1UA3A 4G7YH 2GI0A 2GITA 1TPXC 5KOVC 4C56B 3EHBD 4IOSD 1MHEB 3PV6A 2LV4A 4UQ2A 1KJ3H 2PXYB 2VDPB 3HPJA 3EJUA 4U3SB 3TBVB 4FFVC 4Z7WF 4G6FD 4LLQA 4HGWA 5L2KD 3SYCA 2BY1A 3EOTH 2GHWB 3I75A 4MQXD 3L3GA 5AZEH 1NUFA 3GIVA 4YBHA 3L08A 4R4BA 2J6WA 2IANE 3LN4A 1NPNA 4LSUL 4JDEB 5T8IA 4CMHB 3FFCB 3VRLE 3ESNA 3E8UL 2P7TA 2XZQH 3BLKA 3CLWA 4YHPB 3D3VE 1EGJA 4RGMB 2WJ7A 3CSYA 2YBRA 2BY2A 5DURB 5ALBL 3VXUD 2IV8A 2NUPA 3QEGL 5F3HA 3ZE0E 1WQVT 3B3BA 4FMFA 2B3IA 2IQAB 3OLIA 5FM5O 4N0FA 1SXBA 1X7QB 1LVEA 4N1EA 3UZVA 3BGMA 1PSKH 4YR6B 3QPXL 5D4JA 2YPKB 1JGVL 2G3MA 2ZX8A 4KV5F 1X9RA 3DX9B 5DK2B 1MCWM 4CMHC 3ZKQD 1RL1A 1FZKB 1D5RA 2E86A 2Y5EA 4RGMC 4Z7VB 2A7BA 5IJCC 2X3BA 3LNGA 2XA8L 4GBXD 1BCIA 3CPLA 3WY2A 3ET9F 5JOFB 1BVLB 4HWEL 4WWID 4GG6F 1RZQA 3LXAA 4NZDA 2CR3A 5T1KB 1P4IH 4OF5A 1NLBH 4W9LC 1JNLH 5EOTA 4AYEC 3NEXA 4XP4H 3N85H 1LD9A 2DWSA 3GYRA 1GS7A 4IMKA 2IPUG 4S0TD 3BVUA 3U6RB 4U7KA 1R4XA 2D7MA 4HF5L 5E99H 1IC4H 3VFRA 3SOBH 1TQCC 4BSWB 1NANH 4K4KA 1ZOXA 2LU5A 2YAEA 2P8LB 4ZMTA 1FF5A 4IU3B 5LXGL 2VQTA 2FYVA 2FJGB 3VSVA 2VISB 3I84A 4N28A 5AW5B 1HE8A 3JQOB 3WE6A 5GGTL 2VXTH 4OUUB 4FYRA 4PGBB 4AJ0A 5GRVL 3B9EA 1LO5B 4K5NA 3K4DA 4OLYH 1FPTH 1FFPB 3JWOL 2DS4A 3FONB 3WUWB 1KWKA 1R17A 2ZWLT 2E75C 5LBSA 3UBXB 1DQLH 4ECNA 2XY2A 4L05A 5I0DA 3IS0X 4E2OA 4BZYA 3ULVH 1E9QB 2E56A 3RTQB 2WLJA 1BMGA 5DJDB 3RDTB 2Y7OA 5E2WL 4Y19E 1CGWA 1KB5B 2CJUH 4PJBF 5C08A 3TT1L 1DZBA 2ZXDA 4FQHB 1INQA 1I4FA 5T1MB 1E7VA 1P7KA 4EN3A 2VDPL 3QIUD 2VWEE 4LPTA 5F7DB 4V33A 3SBPA 1ZDSA 4BQ9A 4WI7A 1E6OL 4G9DB 5HYQA 4TVPD 4Z7OF 4HGKC 4N0YL 1IEBB 2KC0A 4HULB 5DRZB 1A6ZB 3MC0A 3S4SB 4NNXA 2C5DC 4MB3A 4F3FA 2NOYA 2GAZB 3RTQC 3RDTC 4GSRA 1UOWA 2Y07H 3OBAA 5C07E 1RUAL 3O41B 2XQBH 3BX7C 3OX8A 4IM8A 3GHBH 2L4OA 2XV2A 1Z32X 4JCLA 4CILA 4HCGA 2C1OA 3DX6A 1X4XA 2H1XA 4HUKB 4GUPB 2CDFA 3KYAA 1E8WA 4RAVA 4PCYA 3GRWA 2AXGB 1UWFA 3MUJA 1HEZA 4FJ6A 4G8EB 3WTXA 4U0QB 4Y8AA 4ZS7H 1L9QA 2DQDL 2DQGL 4HS8L 5ENWB 4I0PD 4KUZH 1ET7A 1I7RA 4XCNB 1IKNA 1YC7A 3B7TA 3BHBB 5MEOB 1AO7B 1G7MA 1G9MH 5D1QE 4HUUB 1G0XA 1J0KA 4YHNA 1GOGA 4J3OH 1YLBB 4TSBL 5B1JA 4Z5RB 4MQ7A 4KZEL 4WHCA 4F37K 4LSTL 3RIFK 1T0NA 5GGTA 4FA7B 4DETA 3P9LB 1WWBX 3NJLA 1EAPB 1ZT7B 1CFMA 4I7ZC 3TJEL 1TTGA 4KHTL 3E9UA 2NNFA 4DP7X 5KW9H 4JB9L 4PSPA 4F5CA 2AJXH 1A5FL 2OW6A 4X5XA 5IW1A 1U58B 2QQNL 3LS5L 5F8QC 5HDBE 3UTQB 1ZA6A 1RULH 4HLZH 3NCJL 1DQJB 4N2IA 2DLTA 4XVSL 3OL2A 3LV3A 3SO3C 2FK9A 4C56A 4C83B 4N1HB 4JE4B 2H26B 1JERA 3VW3H 1UXLA 3RPKA 5I19H 1MHEA 2ADJA 2OL3B 3VDBA 1UD3A 2PXYA 3OZLA 4L5FL 4U3SA 3TBVA 4AITA 1JZIA 2APFA 1I3UA 4G5AA 3GO1H 3MV9B 4L9LB 2WBJB 2PMZA 3T1FB 1KB5L 4MAYC 1JFQL 1H8LA 3ZPDA 2UZIH 2N1TE 4NUMA 4CNIB 3QCUL 4LFHG 3K6DA 1J9CT 4JDEA 1WFJA 3MLZL 2XPZA 3FFCA 3R19A 4IMLB 5GZNC 2EVHA 3S37X 1UZGA 3AY4C 2FLBT 1A6AB 3JT0A 4JHBA 3TBTB 2IQAA 4HFUH 3V4PH 2DQJL 2KT6A 3V0GA 4OLWL 4OF0A 2FIKB 1II4E 2Y6TE 1MFCH 1X7QA 3L3OC 4A2GA 4URTB 4YR6A 3SSGA 5JYLA 2YPKA 3NH7L 1GYVA 2RQEA 2ZUXA 5CAYB 3DX9A 2ZG3A 5DK2A 3K0WA 3ILPA 1FZKA 5TJWK 2ZOLB 4G6KL 2WGXA 4Z7VA 3L1EA 4HVBA 1AC6A 3TBWB 1HX0A 2KDYA 3RFZC 3BW9A 4KMTH 1WJ3A 3KS0H 5JOFA 5L7XL 3IJHB 4KVPA 4R7NA 1V7MH 5T1KA 4JHVA 4MASA 4MBRA 4XE0A 4WKZB 4L5FE 1HE7A 3F62A 3PIQB 3C5SB 4LIQH 4WO4D 4M6OH 4OH2A 1FN4B 1U8PB 3U6RA 3OAZK 3R7QA 4N8UA 1U3ZA 1DQVA 3IJEA 3PL6D 3UZEC 1G1YA 2F68X 3CN1A 3MLTB 3V0IA 3V9CA 2PN5A 4RX4D 1HI6B 3TOPA 1RZ8A 2GT9B 3K0YA 1VFOA 4PHZA 2P8LA 2OULB 3S8FB 4IU3A 2FJGA 1FCCA 2VISA 1CLCA 4X50A 5AVUB 2VZ3A 4LT7A 4OUUA 4KY1L 4PGBA 3GXPA 1DSWA 3MV8D 4KK6C 1LO5A 1QA9B 5EB9A 3VGGA 4NRXB 1FFPA 1CFSB 4L1BA 3FONA 3P30H 3D0LB 3FN0L 2JKRM 1Z9SB 1IM9D 4QRTB 5I0WA 4XO4A 1UQSB 4RVBA 3V0VB 4JFEB 5HI3C 2DQCH 4I85A 5D7IB 3RWCB 4ZFGH 5FYJD 5DHVB 1E9QA 4AI7A 3C6SB 4AEIL 4ZW5A 3L9YA 3W9EB 5DJDA 3U30C 3OKOB 4ABUA 3LMJH 1E4XI 1KB5A 5E8DL 5EFIB 4QYAA 4FQHA 2DJSA 4P9HH 5T1MA 4RMQA 1MCCA 5CCKH 3ARFD 3O6KH 3ZT5A 2PWDA 5CZXD 1T21B 5J56B 1GGIL 1QG3A 5F7DA 4ELME 2OLDA 2J44A 2M8XA 1U3HD 4ACPA 5JXEC 2ED8A 4G9DA 2NY4B 2EXTA 1ETZB 1IEBA 4OZHF 4XP9H 2DBLH 2R7EB 5CEZE 1A6ZA 1KPVB 4TPRL 3WHXB 1C1EL 1OCOB 3MJ9L 1UA6H 2CO3A 2FL5B 5I8EB 4JPWH 4KKLC 4Q9BA 1DBKL 5IREA 3WU1A 4LDLB 1A65A 4OLEA 5AW0B 3MJGX 3P4OB 1JNHB 3Q5OA 3O41A 1ROCA 4QLWA 5KVFH 1OWWA 2QEJA 3HJ0A 4FL4C 1XZ0B 4NO5A 4P2OD 4Y4KD 4RCAA 3LIZL 2JTYA 2X38A 3NN8B 1Z3RA 3TH2T 3GZQA 1I9RH 5CNHA 5AAMA 5T1LD 1ZV9A 3IJSB 5AB2A 4GUPA 4DSYA 1JV2B 2NY4C 1VEOA 2PP9A 1LQSR 5FW7A 1J5CA 4XNBA 4RRPG 2AXGA 4GAGL 4G8EA 1NEPA 1PCSA 1FSKB 4LSRH 2Z91B 4Q74A 4XBPA 2YD9A 4GQQA 4YHML 4G1EA 2GQHA 1YEGH 4MX7B 4NQVB 5F9OH 1H6TA 3W11C 3KYOB 3LHPL 4TNVK 4XC1H 5ENWA 3JYBA 5FYLH 4QRRD 4I2XE 3J8F7 3GC3A 3VI3A 4KAQH 3BLPX 2B1HH 1JZFA 4IGBD 4XCNA 3BHBA 5MEOA 1AO7A 1DVFC 2G3ZA 4HUUA 1NGWB 2X4OB 5GS0D 1WGVA 1WFIA 1KUMA 5C70A 1SMDA 1XDTT 2L0DA 12E8H 4Z5RA 2F74A 3CX2A 4TL5A 4NQDB 2QJDA 4QHLB 2OMXB 2VMFA 3HE6D 5J1TC 5L6YL 1EAPA 2LTQB 3K4ZA 4ZX5A 2A83A 4OI8A 2WW8A 4LCWE 3EO9H 3R1GL 4LNVA 4RRPM 4G6JL 3ARVA 4KKBC 4B53A 3GUFA 4PBXA 2PYED 1AS6A 3PUCA 1U58A 3LZLA 3FRPA 3Q13A 4YXHL 3UTQA 1JNJA 4P23C 2DBJA 3MUY1 5SWSE 4R7VA 3ABZA 4KX8A 5CKGA 2GCYB 4OFQA 3D85B 2G0LA 4ZOAA 4C83A 1ITCA 2H26A 1CD9B 3IKCB 1DN0A 2ZXWB 3DPBB 5LGKA 2OL3A 5LWYL 4D9RE 3EH4B 3EHBC 4XPFH 4ZPTA 3H8NA 1GGBH 3ABKB 3MV9A 2WBJA 4L9LA 4XI5D 3UTPE 4PB9L 4NLHA 4PHXA 3VG9B 4ZSOB 3FYIB 4N6QA 4G71B 5DD5H 3BAJA 3QHTC 5ECGA 3FT0A 4OCXL 4MQXC 1V8HA 1AGFB 4KDWA 4JMNA 5DUML 1JYWA 5T33H 1CN4A 4IMLA 1IAMA 4PWKA 3RA7L 4PW3A 2BS8A 2KS0A 3FHQA 3HRPA 1FJ1B 1VIWA 3DOIA 5FKAB 4G8FA 1S3RA 5D8JH 4URKA 3E38A 3OAWA 1I9JL 1NKOA 1A6AA 2YKLL 3PWPD 1IBGH 3TBTA 3AT8A 5BS0D 4HKZB 4E42B 3F7RA 3LIZA 1KTBA 1U6AL 3KHQA 4ZJ9A 5DZPA 4NM8L 2QHRL 3AWFA 3OD3A 1N6QL 2FIKA 3B7YA 3NEEA 1ZAGA 4IJTA 3EGSA 3ABGA 4J8RB 4AYFB 7CGTA 1G7HA 3NACH 5I0ZA 4HJ0C 2H1PL 2DQHH 1NPUA 1CUOA 3WTYA 2Q10A 4C54A 2ZAHA 2ZOLA 1T20B 3JV6B 4FZEL 3TBWA 1S7QB 4KQ3H 4QUOA 3MOBH 2V5YA 4N9GB 2Z7UA 3IJHA 2EEBA 4LSDA 4YN3A 1X5MA 3N43F 3RILA 4FDWA 1BZOA 4GRWB 3L81A 4POYA 1DVYA 4N0UB 4AV0A 4EXPX 3FULA 3C5SA 3PIQA 3WLWC 5GGSY 4MJ6B 2FCBA 4HX1B 5DZ9A 1U8PA 1KCSL 2EEDA 4JRFA 3MLTA 1GIGH 1BLNB 4LOEA 3MXWH 2YXFA 1XXDC 3ARDD 2EH7H 4XX5A 4OZGB 1HI6A 2GT9A 4H1LH 2F15A 3B6SA 3CFQA 2VH5H 3BKMH 1M6OB 5AG8A 3EOYG 4ILDA 1LXMA 2WQXA 2ZYRA 2VLKE 4LLWB 2RCSH 4JFZL 4JM4L 1MCFA 3QAQA 1QA9A 3PP3H 4EPSA 1B4LA 3T2QA 5JXAH 2AJYH 2IGLA 4NRXA 1CFSA 1FFOB 3D0LA 1HHKB 5HPOA 1Z9SA 4QRTA 1S7XB 1CLVA 1XF3B 1M2VB 3V0VA 4NWTH 4DP1X 4JFEA 2D0GA 1QSFB 1VPOL 2EAEA 4OD2B 3V0DA 5D7IA 3RWCA 5DHVA 1CLOL 1AANA 3LDBB 3R4DA 3UG4A 1P7HL 3JT2A 2WLHA 3W9EA 3OKOA 2HKHL 4MB5A 3B9KA 1CFNA 5EFIA 3BI9X 1F4YL 5CZKA 3RX8A 5LQBL 3O4LB 1RUQL 4N6RB 1T5WB 2JH2A 3H7BB 3AMKA 4DZBB 8PAZA 2D7TH 3H9SB 1T21A 1AI1L 4FNLH 3HR6A 1I53A 1UB6B 3QIUC 5EC1B 2C9QA 3H9ZA 2WZ6A 1XGYH 2VDRH 1IC5L 5IQNA 3L3IB 3SBRA 2HAZA 4UT7H 2R7EA 1ID2A 1KPVA 2P4AB 5EU6E 3WHXA 1OIOA 1NIDA 1P53A 5D72H 1RK0B 3MV7B 2FL5A 1JZHA 2Q2LA 2WQ8A 5I8EA 2ROYA 1NGYB 1AXIB 1D6VH 1NDTA 3CZLA 1JNHA 3P4OA 4XCFH 3ZYZA 1UJ3C 1OAYH 1L0QA 2ZE0A 5EZIH 1AZRA 4NUQA 3MLSL 4HBQA 1XZ0A 4OIIH 3VB9A 3NN8A 5KSBF 3IJSA 3D7PA 5DD1H 2ZUSA 4P8QA 4YDLB 1SM3L 3OJMB 3IVKB 1JV2A 2DQFB 3QORD 1JDAA 4IHOB 4LLAA 4F24A 2D3NA 5BUPA 3BAWA 5CZVH 1GXEA 4PCSA 3ECQA 2R0LH 3AC0A 2Z91A 5KOMC 3KVPA 3JTTB 2BK8A 4MX7A 5L2KE 4NQVA 1ITBB 4K3EL 3KYOA 4ICWA 5FYKL 1MHCA 4LLVB 1DQDH 1KBGH 5M95B 2F8OA 3M88A 2W91A 3P40A 3WTUA 2YFOA 2JV6A 1RZPA 4I0PC 5FFOA 1CK0L 2QPDB 2YUZA 3K81A 1XB3A 4GMTL 4E41B 4A55A 2NX5B 1UZ6F 4YDLC 3ZRSA 4NCC1 1JRHH 1NGQH 5CMAB 1NGWA 2X4OA 3MUUA 3FU3A 4OZFB 4TMPA 2C8NA 2JJSC 3UCRA 3VXUE 4R3SB 3DKHA 5B4MD 1SUHA 1QI5A 1FZMB 5AB0A 4Y4HB 1N59B 2Z8RA 3NGBB 2CLZB 1E5YA 1YSOA 1WZ1H 2X89D 4I4WB 4NQDA 3SGDI 1ZGLP 5DF0A 3EO0A 1ESOA 3ZBMA 3FQTB 3QXUA 4QHLA 2OMXA 2ODHA 4YE4L 1FZOB 1UZ8A 2OFQA 3WIHH 1S4IA 1P4LB 2H6OA 3FAWA 1JTOA 1Z7JA 4PH8A 4HZ1A 2JF1A 5FF6B 2GUOB 1DLFL 1SY6L 2Z9TA 4ICXA 4S1SH 4XRCB 3L4UA 3NZUA 1JE6A 2NDFA 1XGTB 1AY1L 5CCHE 4D0DB 1T2XA 5C0RH 2ALWA 2GCYA 3ARQA 3D85A 4P3CH 1VA9A 3TL5A 4DP9X 4F15C 1KF9B 4Z7VF 3IKCA 4DWHA 5I1IH 4XWGH 1S7SB 3DPBA 2CSPA 5C7ZA 2H32H 1QPKA 2X10A 1F3DJ 3GRGA 5J5EA 5LO7A 2GTZA 1EO8L 4UINH 4ZNCD 3GJEB 4M29A 2AXWA 5I5MA 1CIUA 1XBRA 3KM2A 4IRJB 2IGFL 4ZSOA 3V4VB 1FA4A 2VN4A 2O93L 3U46B 5BCAA 3IAGC 1AGFA 2Z34A 3LRLA 5CJXA 4GRMB 5TPWH 1V3MA 4HPOL 1FJ1A 4OIBA 5FKAA 1CU4L 5F7KC 3CLEL 2OTWA 4HIHB 4QTIL 5HYSB 4P46B 2RA1A 4S11A 5ANMA 2IMNA 4HKZA 3TV3H 4PB0H 4KTDH 4AYFA 4J8RA 1D9KB 1OM9A 1WTLA 1RK7A 3Q5TA 4XZ4A 4IBVA 2COVD 5HHOD 3ZR6A 3B83A 3P2TA 4UIKL 3U36B 3V52L 4YOKA 4Q9RH 4GKNB 2QZQA 5ADOH 1T20A 1NWOA 3JV6A 4F91B 1ORQB 3FUMA 4G8GB 3WY1A 1MCRA 1HIML 3BEWB 4QCIB 4N9GA 5KBNC 3B1TA 4FNQA 3EFOB 1TTAA 4LSPH 4TVPE 3WJMB 2HRPH 2NT0A 5E94B 4N0UA 5D7LD 4OJFH 2ICCA 4PJEB 4MJ6A 4HX1A 3UYPB 3SHSA 4WO4C 1YPZF 3MV11 2E47A 2GG1A 4NFCA 5AZUA 2MQGA 1Z5HA 5FUCE 1UOVA 4LFHD 4PY8J 1KCUL 3RVTD 3PL6C 3B9DA 3SYOA 1M9SA 3D4CA 4OZGA 5LNDA 5E08L 4I3RH 4LEXH 5I8OH 4YDKH 2FLMA 3ILEA 1M6OA 3LQMA 4FFZH 3W57A 1ED3B 1YEFH 1DO5A 2KHAA 2X2YA 5A6MA 3LRGA 4LLWA 1V10A 2V37A 1SY6A 3G9VA 4HBCH 5AKTA 5FM8A 5I6XB 2CHWA 2ENPA 4QHKI 2VZ1A 3AQYA 1HHKA 4L1TA 1YEIH 4ZI8A 4MS6A 1S7XA 5J3HC 1XF3A 4XPAH 3VRIB 1M2VA 4P06A 3TXAA 1X5JA 3U82B 1QSFA 2DB8A 4Y9BA 5KUMA 2VUOA 3D39D 4OD2A 3SODB 2QVKA 3CZGA 4KMLB 4FXKB 3UEZA 1S78D 4HWZB 1IEAB 2Y0SA 4L2YA 1AHWB 3UO8B 4UT6A 2F8XC 3WGVB 3DETD 3O4LA 4N6RA 1T5WA 1RJLB 3H7BA 3ECUA 3FQRB 4M3HA 4UUJA 3H9SA 4FNUA 3TA3B 4J3XA 5HGGS 4DZBA 2J73A 3DYPA 3AVEA 1UB6A 3ARFC 1J12A 5CZXC 5EC1A 2EEAA 4GKSB 1SXZA 1XAKA 4O9HH 3QFDA 2WKOA 3I3DA 3L3IA 3VI3F 1S9KC 1MOEA