3Q9PA

Hspb1 fragment
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
83
structure length
76
Chain Sequence
SHTADRWRVSLDVNHFAPDELTVKTKDGVVEITGKHAYISRCFTRKYTLPPGVDPTQVSSSLSPEGTLTVEAPMPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Three-Dimensional Structure of alpha-Crystallin Domain Dimers of Human Small Heat Shock Proteins HSPB1 and HSPB6
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone
molecule keywords Heat shock protein beta-1
total genus 7
structure length 76
sequence length 83
ec nomenclature
pdb deposition date 2011-01-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.790 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3q9pA00
1WFIA 1RL1A 1WH0A 3L1GA 3QORC 4YLBA 5LUMA 4MJHA 2WJ7A 3QORB 4YE0A 4YLCA 4PBDA 2JKIS 2RH0A 5DS2A 4PCKA 5DS1A 2Y1YA 3N3EA 2WJ5A 4RZKA 2KLRA 4JUSA 4M5TA 3Q9QA 2XCMC 1X5MA 3Q9PA 3QORD 4JUTA 2KMWA 3AABA 2BOLA 2Y1ZA 2N3JA 3GT6A 4YDZA 3QORA 2CR0A 3GLAA 1GMEA 4YL9A 3VQMA 3GUFA 3L1EA 3L1FA 3AACA 1SHSA 1WGVA 2MNWA 4FEIA 4I88A 3VQLA 3IGFA 2K8QA 3EUDA 4ZJ9A 2N0KA 2CG9X 4ELDA 2Y22A 1EJFA 3W1ZA 2O30A 3J07A 4M5SA
chains in the Genus database with same CATH superfamily
4YSTA 4YXHH 3KH4A 1AGFB 4U1IA 5D7SH 5CZKA 5E7BA 4LU5L 1JPFB 2WWNA 1TVHB 1ZLEA 5B8CC 2A38A 4KV5F 2D7NA 3F5WB 3PDDA 1AXSB 3AITA 1HQ4A 4I0PB 3LEXB 1D5IH 4UTAH 5I74B 5I73B 4JO3H 5KS9F 1GIGL 1DQJB 3HR6A 3UACA 1LVEA 1OD9A 2CJTA 4Y1AA 4FFZL 4DIXA 1REIA 3OLEA 3L3HA 1V10A 3AQDA 1RZKC 4O2EA 1VAHA 1IBGH 2WYIA 3HZMB 5C6TL 1NEZG 1HAUA 3LDBB 4K2UH 1N64H 1UD3A 2YBRA 4Y19B 5B1JC 1FHGA 2W65B 2IDSA 1CGVA 1F42A 4FOMA 4RNRB 1RZJL 2EC8A 3GRWL 4PG9B 4PFEA 3VFNA 3WEMA 1FQ9C 2GABA 3K6SA 4V1DD 1FLRL 1B2YA 4I18C 4JPIA 1R0AL 1ZHNB 15C8H 4UIMB 1AIFA 2CLZA 2DS4A 4QT5B 3WFZA 2ZUUA 1S9WB 2Q7YA 4G1MB 1DJWA 4E5XB 5IJVB 4ZMOA 1QEWA 4X7TB 4FABH 4YL4A 2CJ3A 4CVUA 3MUGA 4XMLH 3HLKA 2R69H 4OD2B 1JPGA 4U3CA 5DZ9A 1G7IA 3FQUB 2R56H 4HZAA 3SE9H 3U7WH 1O9ZA 2BRRL 2YC1B 4XH2A 1X6LA 1W8OA 5IFAL 1H3UA 1SHSA 1CBVH 2JVUA 2P44B 1AGDA 5L2KE 4JHBA 3GIVA 2OJ1A 2CO1A 4M6OL 1DBML 3EYSL 1MRDH 1IEAA 2OV0A 4QY8B 4GSRA 1L9OA 3QB7C 5IFJB 1SBSL 3TEWA 1WWAX 5D1XE 3VWKD 3P3UA 3UPRA 2XICA 1UM6L 2JKXA 3U0PA 4MA3B 1FZKB 4LAQH 2NY1D 1RURL 1BZ7A 3WFCL 4XBMA 5DZVA 5JW4R 3EKCA 5B39B 4MVBD 4ZDHA 3VD3A 3WHXA 4PBVC 1JZDC 1Q9WA 3KXFD 1G4RA 3O3AA 4QRBA 3EJZD 3TBSB 3QO1A 2ZSVA 1F3JB 4BXSV 4OCRL 1CB4A 4JVUA 1H9DA 2R8SL 3DUUB 3QR0A 2ATKB 2PYEA 1TUPA 2B9BA 3B9KC 1DE4B 4GKOA 1EPFA 2EDLA 2QSVA 4FQHA 2RQEA 4P59H 4C83A 3IGUA 1E8WA 3HCVA 1NMAH 4KH9A 3UPAA 2GBAA 2FVNA 3DMMB 4M1CD 5DFVC 3N3EA 3FUHA 1EXUB 3PNWB 5C2UB 1H3XA 1PTZA 2CE6A 2ENYA 2P43B 1MWAL 5A2JH 4JKKA 3QEGH 2QPDB 3TYGL 3ULVL 4TKWA 3LPGA 3LX9A 2WXJA 5ICYA 4J2QA 3F7QA 5I8OH 1A7BA 3GK8L 1ZHBA 3IDJA 5TE4H 4Q0XH 1IC1A 2AQPA 3O3BB 3MMEA 2BNUA 5LVEA 1NGYB 4DQOH 5AVZB 2VERN 4JHAL 3NSFA 3C5ZB 3CDZA 5GS0H 2DIEA 4WIQA 1S8DA 3TCXA 1U2CA 2A0LC 2IAMA 4IJTA 5AAPA 3GJEB 5JIQA 3KE0A 3V9FA 2PWHA 4PV8B 1ROCA 2VLKB 1WZ1H 1R19A 4UILL 3HR5A 5IREA 5CIPA 4X6CE 5I1AB 1D9KA 4MJIE 1CLOH 3WTYA 3TF4A 1BJ1H 4M7KL 3KWUA 3QUHA 4HWZA 1AQDB 4Z7VF 3L48A 5I82A 1TPXB 2WAHA 4LSRH 3WFHB 1A65A 4H1LH 4J6RH 4YBQD 3U9UA 4A66A 4DKTA 5B7FA 5IHWA 3NDZE 4KOCA 5J0BA 1ZA6A 5BS0D 1CDGA 1KACB 3P2TA 2F0CA 2VM4A 4ELME 3IDIA 5HD8C 4XNAA 2EUXA 4YSDA 5MERB 3OBAA 3KPOB 3CSGA 3ZHFA 3CCHA 2PTUA 2YZ8A 1T1YA 3PGDA 5FUZL 2ZJSL 3L9RA 2W9DH 3DYOA 2WLMA 3OG6B 1AR1C 2CXKA 2PYFB 3V4PB 3IM1A 3C6EA 1XCTB 4N8UA 4E36A 1YNTB 5K1NA 3TWYA 2CMRH 3CZSA 1KC5L 2NY1C 2CK0L 4JFZL 4LSVH 4QRPA 1MFCL 1YNKL 4PI2A 3W9EA 5F44A 4GG6B 4BWUA 4F24A 1G5AA 1I4FB 2XVKA 2WZAA 4UM9A 3NCMA 4LCIL 4ZDHB 3OPZL 1E43A 4BSVB 1JE6A 2H4EA 4ZFFB 1SXZA 1JF6A 1MFMA 3QDME 3KM2A 2AANA 4H0LC 4DUVA 1FFPB 3QWOB 5F97E 5ENWB 5K33A 4B9YA 3U2IA 2FBJH 3GMOB 4JPWH 4N0CD 5FA4B 4TVPL 3PF2A 1HX0A 3KYMB 5C08E 1SJXA 3BVUA 5CLTA 1HCYA 4KRMB 3SDAA 2K0RA 1UM4H 3AXIA 1NMCB 2VLME 5HXMA 3ZDZB 1E6JH 3ZTJH 3SZ6A 2OMVB 4GW4B 1JGUL 4PRBA 4XAKE 2B16A 1ORQA 2UY6A 1KCUH 4PN6A 4AYBA 3DMMC 3OKEA 4TVUA 1UVQA 3TBTB 4YGVB 3ZKXC 3VD4A 3II1A 1CLCA 3RIAK 3KCPA 3IMTA 1IC5H 1HCFX 2VLJD 3K8LA 4HEME 3KS0H 5F1SA 3HNSL 1AR1B 4NI6A 4U1HA 2AGJH 4P4RA 3BC9A 4OI9A 3MI6A 3MRIB 5LQBH 3ZHLA 3FU7A 4MX7B 5BMFH 5JLZB 3V2AR 4L4VD 1ODAA 3S48A 3C8KA 2V33A 3F5WA 1QLEB 2DQHH 3MUY1 1TDQA 2IALB 3Q2WA 3HLAB 3WFDH 1WIPA 3QG6A 5IMKB 2AQNA 2C1OB 5F88B 1KPUA 1DP0A 2IAMB 4D7PA 4B0MB 5AFAA 3U9WA 4OLUH 3Q6GL 2EILB 4MQ7B 1E4WH 5CZXC 2ZKWA 3U2SB 1I9JL 4NCC2 1WWCA 4IMKA 1IAKA 4NQSA 32C2B 3DYPA 3HVNA 3NACH 3IDMA 5HI3C 1SLUA 3LS5H 5GJSL 1W0WA 3Q6FB 1CDJA 4XE5B 4OZHA 1BLIA 3FU8A 4EBQL 2ZP9A 5J1AB 1QX1A 1IEBB 1C08A 4EMZA 2ZUSA 3V6FB 2YARA 3NJJA 1PSKL 2GSIB 1WBZB 3LS5L 4Z8FH 2MPAL 1CQYA 1U8LA 3LB6D 4DVBA 1J10A 5LXVA 1JK8B 1G7PA 3W0WB 3I9IA 2Z1PA 4DEPC 1VIWA 2C9UA 4N5ED 5E95B 2GJJA 1MUJB 2CLVA 1CFVH 4V33A 2O6FA 2D3JA 2MCPH 5JW5A 2QQNH 1PZDA 2LE9A 1N9PA 1JFQL 5FW6A 1URZA 4DZBB 2AJUH 2PO6C 3O3EA 4NHUB 5L8KB 3X14B 2XIBA 4NDMA 3QPXL 2MCAA 2KYIA 3P1VA 4JJHA 3QJHB 2WKOF 1WCBB 2Z3FA 1GKEA 2ADJA 1F4AA 3HNSH 5DGQA 3AS3A 2QQLL 3ARGC 1IC5L 4Q89A 3GRBA 1A6ZB 4MXQD 3T0DA 4PJDE 4OGAD 2WUCH 4RBPH 1CFBA 2H6OA 2KUTA 2VL5B 1W91A 2YN3A 3QH3B 1KBKA 4JREC 4LLVA 4LT7A 3UAJD 4RWHA 1Q8MA 4FGMA 3V0FA 3MBEC 3D3VB 5D7IF 1DLHA 4BGDA 2CGZA 1HNFA 5E5MA 2V37A 3MOQA 3BE1H 1UVQB 4P2RD 3WHXB 3D0VA 1INEL 2UZPA 1P7QB 3AT9A 2V9UA 5GGVL 4G7YH 4JDZB 4RMRA 1T3FB 2NNCA 4WGKA 1FDLL 3JUZA 1DFXA 2F5BL 2OBGA 4QRSB 1T5KA 1XAUA 2X0VA 3DGDA 3DIDA 4K5OA 4M3KB 3S2AA 3APCA 4WKZB 4HWBL 3PAZA 4W9JC 3EOYG 4TQHA 4G9DA 7CGTA 5IHZB 1CDBA 5BUPA 4RAHA 5T1KB 1A6AA 2Q3AA 3GT6A 4XZUA 3VM7A 1VEMA 4YC2C 2QEJA 1P2CA 3ECWA 2KZWA 1WGVA 4ADIA 4CC4C 2F7RA 5BQ7B 2F74B 5FGBA 3RRQA 1XBDA 2VR5A 3FQTB 4JNXA 3F01A 4HOZA 1W0VA 4HKZA 2OJZL 3SKOB 4PQXA 1RP8A 3ZX1A 2X4NA 1W16A 3O3BA 1JXFA 2D2CC 1MCBA 1R4XA 5J1AA 3LKPA 4R97C 1CIUA 1B4TA 2CJUL 3QORD 4LHUG 5D1QB 1WZAA 2WWMD 2EEAA 1TYRA 3EYQD 4ZAKA 4D9LH 3LVTA 4PS3A 5TDNB 4WNQA 3MCLH 2Z7YA 4HSAC 4KGLA 2ZXCA 4L1BA 1J18A 5E5RB 1B4LA 3UZEA 2P48B 4LCVA 4RIRB 3IDNB 4PTTA 3JTTB 4NO2A 2EO9A 5CIPB 4HWNA 5D4QA 3FZUD 3FB5A 4LZKA 4KQ4L 3R19A 4UU9A 1OW0C 4NENB 3VXME 3K72B 3TT1H 2X4PB 3DVGB 3OJDB 3QFJE 1QSED 2C9SA 3LN4A 2H32B 5B38B 4IRJC 5FA3A 2P5WE 1RUKH 1T0MB 3L1FA 4LFHG 5GISL 2QHLA 3D0LB 1MFVA 5C0CD 1JV5B 1JGLL 1TQCB 4GQ9H 3L2MA 4GT0A 2ROYA 2DLFL 3E7JA 1FJ1A 2J88L 5KJRL 3C09C 3AROA 3IMUA 4JFVA 2QMKA 4KKCD 4W9FC 4XOEA 1MWAH 4E9SA 5EU5A 3ZK0A 1GW6A 4JGMA 2RH0A 3G5ZB 3VXTB 1PGRB 4QXUH 1YSOA 5K9QG 1AZVA 3LXUX 1XB6A 2P5WD 2V17L 2X9ZA 2J25A 4P2CG 1AXTH 2H8PA 4RA3A 1HEJC 3K6OA 5TGBA 3VMNA 3HPLA 3WLWC 3WJMB 1S7UA 5DJZA 2WTRA 5FYLH 3BVDB 3CIAA 4LSTH 1G6RL 3IAQA 3WGUB 4FFTA 3IE9A 5EZJB 3BJ91 5HVFB 4LSPH 5EUKB 4Y5XB 4BK5C 3T2OA 3MBXL 2ZCZA 1INQA 5D2NC 4M02A 2O5XH 3CU1A 4UT6A 3ZE0E 3I75A 2P5EA 1B0GA 5A2KH 5I1JH 1I85A 5B3JF 5AKVA 1UM6H 5FCUL 2J6EA 5T3XD 1FNGB 4PJXE 3VRIA 5C0CA 4YSCA 4DOHE 5F7BA 4GAGL 4TUKL 5JNYB 4WW2C 3F7KA 1MVFA 1NKRA 1KJ2B 3EO1B 1J9SA 1P0SE 1XR8A 4GAYA 3LIZA 5LDSA 1UZ8A 1IL1A 1LJMA 1KB3A 2AV7B 5KZCD 1HSAA 3K91A 4UNTA 4Z3IA 2JCCF 1CFNB 3MLXH 1BVKA 3OHXC 4Z7QB 4ONHA 2B15A 2ZAIA 3L7FA 2WKGA 5HPMB 3PHAA 5DVNA 1IM9D 2V7NB 3W39A 1URLA 2DM7A 4GAGH 4TUKH 2EH7L 5ESQA 4BH8A 1Z9SA 1EERB 4LOUC 1S6NA 4IRSB 1DO5A 3QG6B 1MJ8L 5IMKA 2OXHA 3EDEA 1OPGL 4FD0A 5H4YA 2DQJH 1HI6B 3E2HC 3QIUD 5D2LE 2BMKA 4Z1PA 3DX8B 2TAAA 2X44D 3MBXH 4AQEA 2HFGH 1QSFB 4QWWD 1U8QA 1HCVA 3L16A 4U0QB 3TZVA 4RVBA 2XJKA 1NGQL 4AKOA 2JTYA 4HK0A 3W81A 4D94A 2BP5M 5ICZB 4B9KC 1I9EA 4JGNA 4FJ6A 3GRWH 4PJ5D 1HXMB 5D93B 3EDFA 1DJYA 4LCWD 4F9PA 1CD1A 2JJWA 5K9JL 1N64L 2E8ZA 3FO2B 5DEZA 1E5UI 2IV8A 4K9JA 5C8JA 1IAIM 1MNNA 2MQ0A 2X6VA 4DO6A 4NOBA 2DI8A 2VJ0A 3WKQA 4JPKH 4O4YL 5EF3A 4YWGL 2VXQA 4H8UA 1GW0A 4NUGL 4X9BA 5F7LB 1R5WB 4DK3A 4UIKL 1P4LA 3LNIA 1BW8A 1CI5A 1HTYA 2ZICA 2XSKA 3NEXA 4QOKB 5I6XC 2XA3A 5D7IA 1VFBA 2Z31A 3QORC 4R96B 3WOVA 5JW5B 1ETB1 1FNAA 5KN5B 4A2HA 2JKIS 5DEGA 3FJTA 4LSQH 5E00B 1FL6A 4NQVA 2KDGA 2DMHA 1UA6L 1MCFA 5GZOA 4BFEA 4HEMA 2CUMA 3QJFA 4ZXBD 3HBQA 5D7SL 5AKTA 2VR4A 5KYYB 1A7OL 1DQML 2FK9A 2WLNA 1ZLWH 3IVKA 1ZLDA 1GYVA 4GI6A 3AG1B 2NY7L 4PJEF 5T3ZL 3WNIA 2BSSA 5C0ND 1BJ1J 4JG9A 1EO8H 3K8MA 1JN6A 3RY6A 4YHYB 4HOMA 5JHDD 3K74B 4HXAH 2F8VA 3KLKA 2ZF8A 3DROA 5I30L 5D6DA 5IW1B 1NUDA 4R4NC 4WWPA 2YPLB 4P2RE 5CSBA 4ZMAT 5F9DC 3QQ4A 5FYLD 1UB6A 4L37B 2G3NA 4PJDB 4JMXA 4WEBH 4GRLC 3OLGA 3IXAA 4DP5X 5C09D 3IWVA 4MASA 1I3GL 5LBSH 1A6TA 1TZ8A 4MJIB 2EACA 3OAYK 1S9YB 4FNLL 3GJFK 2E6PA 2L7EA 4PGDB 2K1MA 3KG5A 1FFRA 4L2LA 4YXLH 1LO3L 3B7TA 3D30A 2AV1B 4PV1C 2XZQH 3Q2CA 1UT2A 4F9PC 4OLWH 1UWXK 5H2BB 4TN9A 2A6IA 4WTWA 5D7LB 1KGCD 4OTXL 2WIIB 3WBDA 4ADJA 4J23A 4OLEA 1DVSA 2QQQA 2B3IA 1WZLA 1XTMA 1QLEH 3S7GA 3SD2A 4MSWB 1A14H 5I0DA 1U8IB 2V9TA 1K4CB 1HI6A 3NRPA 4OF3A 4PJCB 1UT9A 2ALWA 1AS8A 3PIQA 3HG1D 1X5ZA 1UXLA 4DP2X 4JQIL 1U8QB 2Y22A 4L3EB 1LK2B 2HTLC 4FYTA 5I1DB 4H1LB 3LEYL 5IBLC 3KVPA 3S98A 3GIZH 1KY7A 4HWBA 3FBKA 2F5BH 1Q1JL 3HTLX 4PJ5B 4XXCA 4CN1A 1XH3B 1YAZA 3MOBL 5DEJA 3ZUCA 2C1PA 3ABKB 1JPSL 3UC2A 4G8AC 4WCYH 2WNGA 3G6JB 3CQFA 1OTUD 1RZFH 3LXBA 3APMA 2OP4H 4CC1A 5DK2A 4P07A 1HH9A 3COOA 3U6XS 1N4XL 1RUAH 3NJNA 3DSFL 4JMNA 2Y2YA 1QWUA 4G43B 5IBLD 5E2UL 4JE0A 5GS2H 3GBLA 3QUGA 3V7MA 2WUCL 2BHFA 5D7JC 2ICWJ 3CNKA 4WUKL 1UKTA 5IF0A 4OZHF 1NFAA 2AMUA 4LHUA 3WLBA 4PG2C 3NAAH 3OAZK 3NCJH 1B3IA 1IM3B 4MA1C 4AL8L 4MJ6A 1J8HB 1BXAA 1Z9PA 2FH6A 4JDVB 2PPAA 3VG9C 4LDLB 4PRHA 3VWKA 4XOAA 2JK5B 3RIFK 5IOPB 3W38A 4YHLL 5EBLB 3P11L 3FH7A 3KZ8A 1TJGH 3VFRA 1N6UA 5D1XB 3RI5F 3OR7A 3QRGL 3QYCA 3X12B 3FB6B 5HGBA 4HEPG 3DO7B 4ZO6A 4R26H 2ED7A 3BZEB 1NL0H 1U91A 1YN6B 1FH5H 4I3SL 2H2PC 1P4UA 2WM0A 1EZLA 1FIGH 1JVOA 1V3KA 1BAWA 2CRYA 3T4AB 3M07A 2YWZA 4Y89A 1OTTD 4FQJL 4N8PA 1GXEA 5ERWA 3EO0A 4YQXL 5AL0A 2OMZA 3DX9B 4LLDA 1FNHA 3TO4D 2PR4L 3BUIA 3S5ZA 4BKLA 4PIRF 5IMLA 2GIXA 1XH0A 4U1SA 4PRNB 1RU9L 2RIKA 1CZ8L 2C5DC 5E56A 3LSOA 5EUKA 3NOIA 4ZSOB 2F8IA 4ZXBC 2F2HA 3IKCA 5DJ0B 1HT6A 4J5VA 4OLUL 4A2DA 4GKNA 3UZVB 1QG3A 4XPFL 5IUSA 1CS6A 1M71B 1N67A 1SYVB 3B9DA 3QRLA 1ADWA 2EKSB 2XWEA 2EEDA 3L5HA 4OCYL 1TCRA 2R0ZH 1NCAH 2DOCA 4MMXB 5FLVA 1B4JL 1EZVX 2LW3A 3MJ7A 1MLBA 5JHDE 4BBWA 1OO2A 5IQ7L 4ZUSA 5LQBL 4ZS7L 1HINL 4HIXL 4HKJA 4NQCE 9CGTA 1CGSL 5IJKC 2AGJL 3PRZA 1Z3GL 2W94A 1KCBA 3MODH 3S88H 4NX0A 3EH1A 3IF1B 4PM1A 4AUJA 1B6UA 3ORJA 4XVUC 5EOTB 4P57B 4NNPL 2HX7A 3VFOA 1KG0A 2F18A 2QTEA 4L4TA 4F80A 1Z3RA 5ESQB 2GJ6A 2EVHA 1AG0A 2GUOA 1YECL 5DD5L 8CGTA 3V52L 2BZDA 2AEPH 4K8RL 5CGYC 4PTUA 4FNRA 1IQDB 5CJOH 1E6JL 5IB2B 1BZ9B 1KB5A 3FF7A 4Z78B 4NLHA 5MENB 1S9XA 3HC2A 4HG4K 4N2EA 1EHKB 1DQQA 3HI1B 4AQ1A 3MBED 1QAWA 5KTEL 5DT1L 2PCFB 4I0KA 3LNFA 4LCUA 1DVFB 3EUUA 4FFYA 2V8MA 5AVWB 4TVSa 4HISA 2DWDA 4MHHG 4NRYB 1RL1A 4K55A 1TMQA 4JY6B 4M7ZC 2W1NA 2NXZD 5GRWA 3SSGA 5H4ZA 4K71B 4IRSD 4FKHA 2YD7A 1WTLA 4YVUA 4CADA 4JL2A 5F9WB 2APFA 2P8MA 4ZMQA 3OJMB 4LIQE 2XI9A 5KSUB 3KDMA 1OSEA 3M7OA 4K71C 4RGNB 5E03A 3SQOL 2CK0H 2CDFB 3S5YA 3DHPA 3D52A 4MCZB 1N5AB 1C8PA 3O2DL 1QTYT 5E2WL 3VYNA 3MV7B 4KGJA 1P4LB 3HE6B 3AT0A 2J5LB 5AZ2L 4HP5A 4J3UA 4MQTB 5FGCE 1X7SA 1GSKA 2PWFA 3W9DA 3HA0A 4AC4A 3HAEB 2YS4A 3LHPL 1DQIA 5CCJA 1YJDC 2MHAA 2I07B 4PCKA 4MWFA 3MQIA 5FR3A 4NQCB 1KYDA 2AXGA 2DQUL 2DQDL 1NFIA 1T1WA 3VTAA 3K6SB 2X2HA 3WTWA 2YKLH 1SGKA 1CGXA 3BMVA 2EVJA 4JY5H 3VE0B 2NY6C 2APVA 3LSOB 4QT5A 2WQWA 3LPOA 3OAUH 4GS7C 3S96A 5IJVA 5E4EC 4YAQA 5JORB 4FRWA 3ULUF 4P46B 4HULB 4FQQB 4H7VA 4RQQA 1JZ2A 2YXMA 4UQEA 5EU7C 2HP4A 2JJSA 3CFEA 4YNYB 3NFPB 4BFGA 2NXZC 4JJOA 3OHMB 3W56A 1WBYA 2CHWA 3SDAC 4DFHA 3C6SA 1LWRA 1IZJA 4B6ZA 4ZTPL 1M3IA 5FYJD 3SPIA 3BGMA 5JHLL 4MMYA 4P46D 1M3JA 4LCCB 1FV1A 4RAUB 3CBKB 3O4LE 2ORBH 4XGZA 1QR1B 1A8ZA 2DDQH 4UI2A 3O2DH 4QRUB 4TNWK 1XX9C 4WSGA 3GZKA 5E23A 1SYSA 2GK0B 3FC8A 4UZSA 3RTQB 3ULVH 3T0ED 1KJVA 4E42B 3VWKC 3CZJA 3FUEA 1MAMH 1NCCL 3OF6D 2DEWX 4WHTA 1BF2A 4L8DB 4NNYA 5HDOA 4GKZB 4XXWC 3AB0B 2PWEA 3CFCL 4PJ9C 2BJMH 4XMPH 1IQWL 3NGBB 4X5LA 5DR5L 4Z7NE 2ZCHH 1A1NB 3CZFA 5IWLA 3O2WH 3R7QA 1D6EB 2D7QA 5DT1H 3WKMH 1ITCA 1M57B 4FJYA 5DXWA 4D0CB 5DTFA 3PV7A 3VQ2C 2UVEA 1A9VA 3C2AL 2RAMA 4P3DB 4F33A 3G6JA 2J8UE 2FIKB 1VGKB 2DPKA 4H8QA 3U4AA 3L1OH 4LAQL 5DD5H 5L8JB 5EPMA 5ISZB 1O6SB 2CNYA 1OB0A 4JN1L 2BC4A 3GJFH 4NNPH 3ECQA 2NR6C 1T83C 3BUYB 1SBSH 2ESVB 1MCNA 2IGTA 3KYOA 5L9DL 4KO7A 1PAZA 1X5LA 2ITDB 3BWUF 2IBBA 3WAKA 2E0PA 3MRPA 3MRQA 4JDVA 4PJ9D 4Y4HD 3OC8A 5GGRB 2GJZA 5DRXA 2AQ3A 4NWUL 3ROOB 4Z7QE 2ILLA 5DHVB 3RFRA 2R69L 4AVKA 5BJTA 3QNXB 3WD5L 3WS6A 3WGVB 5CCKH 3W5NA 4F58H 3VGFA 2XFXB 3JV4B 1PNCA 1A2YB 1ORSB 4OCMC 3RDTB 1Q38A 1BFSA 3TH4T 3CXHK 3QEUB 3ESPA 1I7RA 3CD4A 3FRPB 2ZOUA 1R0AH 4YK4B 1HN1A 1KB9J 2ZX9A 2VUKA 3NFPA 1HQRB 2JCCA 5ITFA 3PQYB 4R2GD 3TP4A 4ZX6A 3MRLB 1M6UA 3C9NA 3ECBB 1I7UB 3N55A 2GB2A 5LHDA 4GRWH 5DA4A 4Z18A 4KO9A 4OZGB 3N44B 2ZWKA 2VXSL 4YDIL 3UG5A 1FL5A 4EN3C 3HG1E 4UT7H 3PWJB 3ZKXB 1UH2A 1ZLVK 5C0AA 1FORL 3VM5A 5DD0H 3BP6B 1WZKA 3MV7D 3MV01 1DJZA 3QDMB 1GGBL 5CJQH 1MCDA 5EEZA 4D3CL 4I3GA 3BKYH 4LMQE 3DYMA 2BSBA 5KYWB 4QRRB 4WJKB 4F2ME 3WO4B 1D5IL 1BAFL 4UTAL 3OAYH 2W07A 4AZ8A 1QZ1A 4X7DC 5HI4C 1GZQA 4M1DL 4XVSL 5KEZA 5G55A 5C7XH 3EBIA 3NG5A 1UGNA 5BRZE 4AL8H 1ZSHA 5DI8B 4V2CB 2GUYA 2A74A 1KYAA 3LRGA 3LB6C 5A3IC 4IS6B 5LGYA 4CNIA 2BFVH 1WH0A 1VFAB 2ENJA 1TETH 1IMHC 2N1KA 1RUAL 1N4XH 3UBXA 5CFHA 3EGXA 4NFCA 3UTOA 1H5BC 1J9TA 1OCZB 1BF5A 1O6SA 5CEZE 1RZFL 3GDBA 1DJHA 4NUMA 2DTSA 4WFED 5TFSH 5MENA 4BQCA 3HN8A 1AR2A 1SXNA 1KLFB 1J87A 2I7OA 4U2ZA 5DK0A 2XQBH 1JNNL 4AQ1B 3QFJB 5I66A 2C9PA 4OH2A 4L5FE 2C3VB 3LEYH 1BVOA 1K3ZA 1JVLA 2ZXAA 3N43F 5C0RL 4F91B 2OYMA 3QZBA 3GO1L 5IUCA 3DBXA 3FT4B 5FYJL 5EN2A 3ILPA 3MO1B 3HLAA 5T1LD 1JDAA 4L4JA 3U0WH 1JF5A 4GYBA 5F88A 4C56B 4QHKJ 2G60L 4U3XA 3WUWB 3IJEA 5KBLA 1MFEL 2R2EA 1HE8A 4MLSA 1JHKL 2AXHA 3UO8B 5KYNA 4X4YB 3GDCA 4FQ2L 2WQ8A 1CE6B 5SWSA 3BPCB 2OS7A 2VW7A 3FQXB 4YPGA 1OE3A 3CXDL 3ARDA 3I74A 4YE0A 3HUJF 3TESA 4OV5A 4ZW3A 1I3GH 5LBSL 1X5MA 5D6CB 4E9VA 5BO1H 4XOCA 3MBEB 4JZJB 3K71A 3B8YA 1QBBA 1PY4A 5D2LA 5H37A 2HVJA 1NBCA 3MV9A 3SBWC 4FLRA 4N2KA 1JRHL 1J1OH 1JOIA 3CDYA 4XPGL 2OPCA 5FW8A 1YQVH 2ADYA 1AZRA 1EFXB 5CM1A 3PV6B 3JWDH 2YR3A 2HH0H 3I6LD 5F1IB 5INCA 4YDKL 1VCBC 1LL1A 2NX5B 5DS1A 5I1KL 1H6FA 1DUYB 1U8NB 4GP8B 4NPYA 3AU0A 4BWWA 1J1XH 2WXQA 2ENQA 4TTGA 2Y1ZA 1BFOA 3TCLB 4N0YL 3MRNB 3MLRH 2LV4A 2W38A 3JZ7A 4HUUB 2HFFB 3B2UC 3QO1B 5C0BA 1RUPL 2WGXA 3H9SE 3N85L 1BOYA 3V4PA 1PKQA 1ES0B 2FX8H 2HLFD 1QO3A 2VQUA 4N26A 4P5KB 4W6WB 4NUGH 4YWGH 3GSWB 4LPUA 4B7IA 1RPKA 4BFFA 1P7HL 3QDJD 1EEQA 1WPCA 2PLTA 4PREB 4HKBA 1N3NB 3T0AA 4KMTL 4HUXA 5GGRY 4M1GL 3VXSA 1BFVH 2AK4A 2PW2B 2QFPA 4PGJA 5IV2A 4I3RH 4UDUA 4WWKA 4ODVL 3O4OB 4P23D 4PJHB 1NWOA 3L5XH 1P7QA 1USQA 2R15A 3DTXB 4HFUH 4WTQA 4QJ5B 1AHKA 5DHXB 4UYQA 2AC0A 3GSRB 1XH1A 1KJ2H 2WINA 3K2MC 3EFFA 1R46A 5DS8A 2A4ZA 1V7NH 5HJDA 2EDFA 4CVXB 1D6EA 1OP5H 1KSRA 3QIBC 2V8LA 1CURA 4M7ZB 5DZPA 2F8OA 4NKMB 3DURB 1PCSA 5DUJA 4AY0A 3TO4A 2I24N 4EZJA 3DX7A 3B83A 5C09B 4NN7B 6PCYA 4AVJA 4AKPA 4ZNCD 3WUWA 5A6LA 4R90H 1MCWM 1COBA 3PPSA 4N8CL 1T2JA 2HKHL 4KKAD 1KN2L 3MVSA 1QFUL 4HUKB 4WO4C 2XXCB 5EFIA 2Z93A 1I1RA 4FERA 4OGXL 4I48B 4FHJA 4JLRB 1JNHA 4X4YA 1H0DA 4KK6D 2AZAA 3GB7A 4HMDA 1E4JA 1NCJA 3ULUE 1AHWC 1KFAH 2BSRB 3DTDA 3IDXH 1X5AA 4AEIL 3F00A 4IOFC 2VDKL 1WFMA 4PRHD 3WFHA 4KKCC 4HSQA 2X0WA 4OZFH 4PJIE 4XOBA 5I1JL 1A4CA 1SZNA 2CBQA 3FF8A 2UZXA 3ZKND 1PZ5A 1R3HA 3AACA 1CR9L 2C34A 2DB8A 4FJZA 4M8UA 4YEEA 3U30B 3B9VA 5IESL 1T22B 1TQBC 3V4UL 1E2VA 1HKLL 2VXUL 3P4OA 2OYPA 3FRUB 1EGJH 4OF0A 1MRFH 4IRJD 2VQTA 4P4KC 1J5IA 4MVBC 3S5LA 1W0WB 3Q6FA 5D1ZB 4LSTL 3NJMA 3S9DB 1I8KA 2DJ4A 3T9WA 2BSTB 1F1AA 1WFJA 5CGBA 4QHLA 4Y5XC 4NM4H 4RSYA 4NPYB 4DZ8A 3PQYA 3FZUC 4M6ML 2H32A 3ARBC 4MD0A 3UGXA 5CZVL 2KMWA 2NW3A 3W5MA 4OVUA 4XVUD 3QUXA 4QXUL 1CTNA 5F6IB 4PRIA 3ML8A 1GC1C 4LEOB 4KNSA 4U1MB 5CWSB 3UTTE 2H45A 4P06A 5CEYB 1IZKA 4E9WA 2X09A 2HRPH 1KTBA 2DM4A 4B9FA 1BEXA 2QSCH 4LCWE 4PD4K 5F7DA 4OLYL 4JFXB 1QVOA 2FSDA 4X6DB 5DMGD 4U1LA 4Z7UB 4PJ8B 2VRQA 3H3PL 1RUKL 1MF2L 3EYOB 4X6CF 3N44F 3V0VA 3V0JA 3ZTNH 4S2SB 5CFAA 1L6PA 4GI9A 2DD8L 3P30H 1UTDA 1M7DB 5LKNA 2Y5QA 3O0LA 1AC0A 1RSYA 4Q52A 1T4KB 3QC6X 3WNOA 1EBAA 1LO5B 4NQUA 5J1TC 1XGYH 3QUYB 4J4PA 5CSZB 5KYXB 1FVDA 1UH4A 2L7UA 4GKSA 3MV8A 3NRFA 4LEEA 3RA7H 2NRDA 4OR1A 4FF9A 4AE0A 4TSAH 3NTCH 1YEJL 1OZTG 3OAZH 5HGDA 1V3LA 3Q8AA 1NBVH 4HX1A 1KJMB 2JFCA 2QTVA 2X0UA 2YD0A 2CKBL 4AGNA 1IKOP 5I1CH 3CFUA 1U3ZA 1DVYA 1Z9LA 3T2PA 2JELL 2G2PA 1BX2A 4N22A 2JQAA 5ACZB 1AE6H 4EN3B 3UOAB 1BXUA 5HJGA 2WLHA 1YEWA 5T1LA 2Y7QA 4WJ5B 2CJUH 4EN2A 1NWPA 1SF5A 3AT8A 3NCWA 1DN0B 1OAXL 2WZPD 1KEML 2BP8A 2XWXA 3OKMA 5FYJU 1KLFA 5IQMA 1UD5A 1FO0B 1KIRB 2XPGB 2J43A 4IOIB 3U2SA 4HA1A 1ZEAH 3WY3A 3FOLB 2NR6A 4OM0L 3UEQA 1S7RA 2XA8H 2VZSA 5J11C 1CDIA 1RSFA 2MKLC 1EAPA 1G9ML 3Q2NA 2NY3B 5DUPL 3KPPA 2WZ0A 4UUJB 1BD2D 2DYPA 3ZE1B 3S35H 1L4IA 4BE5A 1FHNA 1CD8A 2C3WA 1JK8A 3OSKA 1OTSC 1H3GA 1M1XA 4I77L 1INDH 3RILA 2XHNA 2YUVA 2ZX7A 5T3ZD 3MNZA 5E99L 2OM5A 1X5XA 1XFPA 1NIEA 2RQ8A 3H9SD 3KYAA 4H8PA 3GSNA 3QE5A 3PDGA 3T3MB 2B1HH 2H0JA 3FTXA 3AS0A 2ZAHA 4HUNB 3UYPB 1JZ6A 1G6RB 3E6HB 4WSKA 1ZGLP 2PN5A 3F84A 4DZBA 3VW3H 3ROLB 2D3VA 3DGGA 3OPUA 2V3DA 1R5WA 3CWGA 3IGFA 2BCKB 5HHPB 4Z3HA 4RLDA 1FFNB 4R8WH 3N2JA 5DD3L 2JJSC 1KB5H 1TXKA 1RXLA 3NZUA 5C9JA 3GSQA 1A6ZA 4PJXB 4N9OB 1CU4H 2HVKA 2QQLH 35C8L 3PHOB 1XGQB 3GSUA 2VRAA 1HJBC 4OFPA 3D25A 2LVCA 3OJDA 3QPKA 3PXHA 2COVD 1RHFA 4EIBA 1Z5YD 5E6ID 5K59F 1BLNA 1NLDL 3ESNA 5CAYB 5E5MB 3WFBH 1JFQH 3MGOA 3HE7C 2IOMA 4N4YB 2GYSA 5IZ7A 2A83A 4NQDE 2IBZY 5IB3A 5ESAA 1MDAA 4W9ZA 5IBUB 1S5HB 1MAJA 2PXYB 3ERXA 3OZLA 2X4OA 3PWPB 5I18H 2O26U 1FGVL 3F7YA 1ZHLB 2YBGA 1GYCA 3GMMA 6PAZA 2ATPA 4X50A 3GJFA 4MB3A 4HKBB 4JZJC 4D0BB 4OLVL 5CHNA 4RGND 1S9VA 1LDPL 4AGPA 3P0VL 4GMTL 5E9DE 3VD2A 1I8LC 3FXIC 4S1QH 4UF7C 1XR9B 4CRPA 2K3TA 4Y4FB 5GJSH 5IOKA 3WKYA 1SJEA 5EA0L 1C9SA 2OR8A 3RZCD 5GRYA 5FO7B 2FE0A 4UM8B 1ZTXE 2IMNA 3BKJL 1MCRA 1UD6A 3B2PA 2W60B 4G59C 4TPRH 1W0VB 1JHTA 2XN0A 4NBXB 4RGNE 5CEXB 1IGMH 4PVBA 2W81C 3GBMH 2X4NB 1HHKA 3MLYL 3N06B 3SPVB 1B0GB 4RMTA 3GC3A 4JFDA 4AEFA 4R7DA 4I0PC 3NQIA 4A1RA 1HHIA 1WZMA 3WFDL 2DWEA 2EICA 4D8OA 1SXCA 1OIOA 4BFBD 2NDFA 4JFYB 4CVZA 2UX7A 4X8GA 3KPNB 3M1BB 3MX0B 4F2MB 1KBVA 1SEBB 4WV1B 2DZEA 4K7PX 4AQ8C 3GSVA 4OCNC 5BRQA 1RK0A 4GXVL 5L88L 2VERA 5DDHA 4J4PC 1MFAH 4QCIA 4AM0Q 3WNNA 1VADB 2VDNB 1KBGH 1T6WA 2V3EA 4TNVK 5HPMA 1CD9B 3Q7JA 2WBKA 4HIQA 1KYOK 4RRPM 2APXA 4ZFOB 4ZK8A 4BE6A 2V2XB 2EXSA 2ZWZA 4FXKA 3IJ7A 3NMEA 2V2TA 5BS0A 1OLLA 1WISA 4TL5A 2AI0H 1F6FB 5T1KD 4F8TA 3BAWA 5EBMB 4FL4B 3X13A 4EIUA 4H8WL 3H42H 4F15B 5I17A 2NDGA 4RZCA 4HJUA 4BV1A 2EH8H 3DDGA 2GFBB 5T5NG 1OHQA 5TQ2H 4MJ6B 2E47A 5AOKA 2OTWB 2QGCA 4P49A 1RZ8A 1QRNA 2XWJA 1I7ZA 3D85D 4XBPB 5J12C 4FQXB 1SVCP 1WAPA 1BLNB 3OPZH 4LCIH 5GRZA 2XNAA 3G5XA 4PJEA 4XODA 3PU7A 1NGZB 1S9WA 2Q7YB 2A1WL 1MFCH 1LEGA 1YNKH 4IMLA 4ZPTB 3ZGIA 3CQQA 2V5RA 4X4ME 3C60C 2VXVH 1S5HA 3UG4A 3V0HA 2W9DL 2WWKO 5FUZH 2JF1A 5J1SC 5EC1B 3THML 4KXAA 4TLUA 1RZKH 4XVOA 3VXMA 1P5VB 1PLCA 1P5UB 4JHUA 3ARGD 3D87B 1IARB 3S3BB 3U1PA 4TSCL 1ZVSA 1MNUH 5JIKA 1K8DA 3LDBC 4EZLA 1WA1X 3BVWA 4LSRL 1NBZA 4LVOC 2HRLA 1NANH 2HTKD 5L4JA 2MNJB 3HG4A 3F64A 5TJWK 3E2HB 5DZJA 1P6FA 1IVTA 4P2AA 5T3XE 5FF6B 3NRQA 1FVDB 1SUJA 2K8QA 3SCMB 5DHYA 4NZRL 3EO1A 3WTXA 3MRCB 1MHHA 2X10A 1TPXC 2HMIC 5CNHA 3T3PB 1A5FH 1HSAB 3S36L 1CQKA 3FOMA 4M3JA 4N1HB 1GKOA 1DEDA 4GB9A 5EORH 1O5PA 3FUMA 5BVJB 5AW0B 3IFNL 3E6FB 5I0XA 2P1YA 5F6IC 1AQ8A 3QQ4B 25C8H 4OB5L 4YUEL 2VLKE 1Z9SB 2YZ1A 4TNVF 1FZOB 4KHXH 2J72A 5AVXB 3ASWA 1ECZA 4A2MA 5DRWB 1AG6A 4N2DA 1S78C 1NFDB 2HG5A 2WXHA 5GIRB 3V0EA 5TE4L 3UXFA 3PS6A 4X9IA 4TV3A 4KI1A 1SY6H 2OZ4L 4IGBA 2VDOH 3MA7B 4LGRB 2VL4A 2XQYA 5IVZB 1S7RB 3TL5A 3GINA 4HGWA 3MROB 3MXWL 2VDPB 2ZX6A 2CKNA 4GQZA 4MB1A 5C08D 3TYGH 3V0WH 1EBPA 4NC2B 3ISYA 3Q3GB 3TO2B 1KB5B 1U58A 5ES4B 3F6IA 4ZS6C 3SDDB 2IDQA 4ZOBA 3WMQA 3FDWA 3ULUH 3HI6H 4L1TA 5F3HB 4MBOA 5BRZA 1S7WB 2PTTB 2VIRB 2JKSA 3X3GH 3NA9L 2FAUA 2LTQC 4BH7A 2VO8A 1VZGA 4YBHA 2B4CL 5EU7E 1F3DJ 1KCLA 3DPDA 3WKPA 2WWMC 2NX5D 2PTVA 2BZ7A 4OCRH 5EHFA 2Z31B 4R96A 5C86A 4WFGD 3WS3A 4MB4A 5F9JB 2Y5EA 2Q8AL 1P69B 1SJMA 2PPDA 3NJVA 1J86A 3HHSB 4ELMA 2AJXH 2R83A 3EYVB 2QQKH 3CX2A 1JZJA 5JQHC 4M48H 1BPLB 5EDSA 4IRJB 3D4GA 3X1GA 4J3XA 5IMOB 4APQC 5TD4A 2VDPL 3FQRB 1U6AL 1AZCA 2NY3C 2VISB 3PWUB 2DLGA 1Z9MA 3JV6A 2AJSL 3UJTL 1PZUB 1BZ8A 4RESB 2K45A 1YQ2A 3CSBA 3P69A 5IROA 3TM6A 1QFWL 2QT6A 1U3HC 2YOAA 3DX2A 5DS2A 2O4EA 2BPBA 2R56L 3FCGA 4Z3GA 3MJWA 1AMYA 1G94A 4KOBA 1T1YB 3PGDB 1URIA 4XCEB 4L37A 1TJIL 2VLRE 1PIGA 2CDGB 4MNHA 1LO2L 1OB1B 3K6NA 5DHYB 1J5DA 1IGJB 2ITCA 4FABL 1H5BA 5TE7H 1J5HA 1M7XA 4G8FB 5AAMC 2CHXA 3J2PA 1PG7L 4BFIB 4LRNL 4PJIB 2F08A 1U91B 1YN6A 5EEXA 4E41A 4RRPG 2VZOA 3IDGA 3NZSA 4FQIL 4LVHC 2YRPA 3STBA 3T4AA 2Z65C 4NFDA 3FUJA 3IBEA 4OM1L 3RWEB 1K5WA 5EUOB 4E41E 1RZJH 1WCQA 3NIGF 2MCMA 3JWNH 5JHMA 2Y69B 1T5WB 4R2GB 1MOEA 3S6CA 4HIHB 1FV1B 4FNPA 4TL4A 2Y23A 3BGAA 4LSSL 1AD9B 1OE2A 2IV9A 4YPJA 4H8HA 4GMSH 3D0AA 4K8RD 1F4WL 5IROD 3JWOH 1CDYA 4FCAA 3T1WA 2VLLB 1H3PH 4PRBB 4IBUA 3IKCB 3CMOL 4ODXA 5IW3A 5IG7A 3KPRB 2X4RA 4C54A 4PLKD 4Z7NB 2C1PB 2W0KA 3LZFL 4JGUA 3ZKMD 3D9AH 4HJ1A 5CJXA 4NQXB 2IO5A 4GKLA 5E6SB 4QNPE 3DNKA 3SOBL 2DWEB 3SGKC 2EABA 1F1GA 4XCYA 3F7VB 1SHXA 4HIEB 1W72H 5DURD 3K81A 3CUPB 3M88A 3QZWB 2G4GA 4MX7A 2XWZA 4UAOB 4WFFE 1WAAE 4AUYA 3RQ3A 1WHOA 4QHMA 1QWHA 1MJJB 6FABL 3NP4A 3J07A 4OD3H 4HUCA 4RBPK 3ABZA 1I75A 3ZTJG 3UYOD 3PJLA 3CFNA 5L7XL 1S7SB 4MZ3A 1D7FA 2F54A 3BP5B 4S1RH 1XGPB 4ZQTA 4N8VB 5LCVA 4ZI8A 3VFVA 4AQOA 3CK0H 3K4ZA 2EC9U 3EYVA 4MLIA 3DO3A 5EPMB 5ISZA 4PTUB 3NIDE 4E9QA 1IAII 1DSWA 1ID5I 3L5WB 1YEEL 3KJ4C 4HCFA 1CGYA 4HS8L 4CKQA 4PV9A 4RWYL 3D69B 2E3VA 4HF5H 3M8OH 5DQDH 4LLUB 2O61A 4XBEL 3B56A 3P4LA 1UKSA 2AW2A 1YMHA 3D33A 4A63A 4QOKD 4MAZA 1RI8A 1QFOA 5FWQA 1CXEA 4DGWC 1UWXH 1OT2A 2WY3B 1VACB 1QLRA 3BAIA 1TEFA 2G4EA 1H6EA 1U8KB 4F7CA 5IB4B 4R4FH 1XIWA 3AVEA 4ZT1A 2OQJB 1NM9A 3IJHA 3TEUA 1NQBA 4PRNA 4KJYA 2FNBA 3MLUL 5C0FB 3RX8A 3QPQD 5GPRA 2IOIA 3DMMD 3MLSL 4S1DC 4Y5YC 3UTTD 2MOVA 2VDNH 5EC1A 4CDHA 1OP4A 1X9QA 4H20L 4WJG3 5ITFB 3VAEA 2MHAB 4F2EA 4DGYL 3OB8A 3RHWK 3ZQXA 4UANA 1CYGA 4FNUA 4NAJA 4PJ7A 5HY9B 4JUTA 1FFTB 3QPQC 4JZOA 1N7MH 3E38A 2H32H 3KWWA 1PIFA 4GT7A 4B53A 1VEOA 4ONFL 1DEEB 4P5TA 3FHQA 5LXGL 3BSHA 4MMXA 1GZHC 4U3SB 1MHHB 5EZOL 2DF3A 1QASA 2R27A 2JB5H 2VLLA 4Q4EA 4ODWA 3ILQC 4OZGF 5HYQB 3LY6A 2ZPKL 5SWSD 1ANUA 3PPEA 2GY7B 4KXCA 4UV7L 1V3JA 3RWCA 4K7FB 5I76A 3I6KA 1B6DA 4QXGL 4HLZG 2FECI 1P1ZA 1ZTXH 5T5FA 3E1ZA 4RGNC 3T3PF 2OX5B 4QRTB 3C5SB 2R0KL 3ELQA 5IB1B 1K6QH 1BQ5A 4PW3A 3HJ0A 3BIKB 1U8HA 1DQKA 2Y5TA 4HJIA 5GIRA 3HMXA 1YC7A 1FGNL 4G8EA 4WFFD 3BKCL 1XGUA 2JLLA 4EQ2A 3QFJD 5I16B 2WQUA 1D2OA 4O02B 3BIAX 2BNRA 3GEFA 1T1XB 1UXMA 2GJ6D 3UJIL 1I8MA 4LQ1A 3QHZH 5KVGL 4EDXB 1XCQB 2A3TA 1A6WH 1EDQA 2IAAC 1IKFH 3TNMB 4J3OC 4A67A 2R23B 3ZHDA 3US0A 3M7FB 1E4KA 2J8HA 4DW2H 4XXWA 4MD4A 1UOLA 2H41A 2HLAB 1T2QL 3BN9D 5E2TH 4H0IA 4J3VA 2W9EL 4HAKA 4D2NA 1TZOA 2C7UA 3G04A 5DHVH 4ODTH 4E0RA 4D8PA 3BEVB 1WSST 1YEKH 2XXFA 4J7RA 4NP4H 5HYJA 4QI3A 1PG7W 3FTVA 4MAYD 1FFOA 3EO9L 4L4TE 4EDWL 3GXTA 3I2CL 1RZGA 2IOOA 3OKOB 3ZT7A 1JZEA 1RZ7H 3BUTA 3CHQA 1OF0A 2DI9A 1OAZL 3BPLB 5KSAB 4L8SC 1XIWB 4WWKD 3MXVL 5F89A 3QXDA 3REWA 4LQFL 3CVHB 5D5MA 3VU1A 1U8MA 2WBXA 3QEHA 4PSRA 4YSEA 2QKIC 2YD5A 2E6QA 4NGHH 1UFUA 3VFPA 4PY7A 3SYOA 5J7CC 1E3ZA 5LWYL 5E8DL 4XP4L 4KJQD 4IRZL 2VLRD 4IEFB 4HBCH 1PCXA 5HY9A 1Z6JT 4OFKA 4ABUA 4QKTA 4Y7OC 2BY3A 3IE4A 3N9GL 2GSGA 1I8LA 2UZYB 3D7PA 4LAJH 4N2BA 5IVOA 1DQLL 2NTSP 2D31A 4HHAB 5DYFA 3IFLH 3CX5J 3SE3C 4J3BA 1OSZA 3H9YA 3K2UH 1WFTA 4MAUH 3BAJA 3VX0A 4BQ8A 1WLHA 2EDRA 4NRXB 5GGSY 3PY9A 1E2WA 3B3BA 3QNZA 5AYUL 3NUKA 4NJAH 3RWCB 4J8QA 4R9HA 5E6IA 3HI5H 3P4MB 3G5VB 4M5ZL 2Z8RA 1FSKC 2BVPB 3CSPA 3QO0A 4HJJL 4NQEE 3KBEA 5EBWB 1U8PA 2G2NA 1NSNH 4J4PD 3LN9A 5SWZE 3C5SA 2W5PA 5B39G 4G72B 3SBQA 4L8CA 4IBVA 3BZ5A 2AJVL 4JQVA 1XGRB 2P24A 3O41A 4QRQB 5KSVB 4DP1X 2XPYA 1QO3B 3MFFA 5KVDE 3LKNA 2F1EA 2EUZA 1GS6X 4WFGE 4X8XA 4AQAA 2Q20A 3DHMA 3K4AA 2ZWYA 2WO2B 5B7MA 1KGXA 2AK4B 3HRPA 2DQIH 1QHQA 3JT2A 4G11A 1TZIA 4B41A 3SE3A 3O45B 3HRZC 3L6FB 1VGKA 4LRIC 3A4DA 3DX4A 4FX5A 3SGJA 3P3RA 4WHYH 3BISA 2B1OA 3QG7L 4A04A 4G8GD 1RLWA 4G70B 4UT6L 1IFHH 3L3DA 4QHMB 5FDYA 2OXGB 3TT3L 5JW4M 5IQ9A 3FNKA 2A77L 5F2FA 4XMZA 1OCOB 1V8HA 4RGOH 4YK4C 5DJDB 5IM7A 3HBZA 2E5EA 3RAJL 5CEZD 3M46A 3QCTH 3BDYH 4HOWA 1M4KA 4PB9L 3ZL4H 4JRLA 4DN4L 1AKJA 1A4KA 3QXAA 2WANA 2IALA 2CO3A 5E70A 1CN4A 2J2ZB 2OL3B 1J05B 4ZUVA 3L5WA 3BPLC 2Y6SD 2YPLE 1IILE 2IPKB 4P2RB 5HD8D 4CMMA 3TURA 1HXMA 4LXFA 1UYWH 4NBZB 3RWIA 4J3WA 1E5AA 5D7IE 5M95B 3VI4A 4QTIL 4PJ7F 2ZG3A 4UDTA 2X89D 1WVZA 3DVNA 1N0XH 3MRFB 2WV3A 3T2NH 3U46B 2KZBA 4XVJL 2FR4A 1S46A 1JGDB 5JHLA 4IMKC 4XE0A 1IEBA 4NWTL 4JQVC 4AJWA 1IVLA 1XF4A 4IJ3B 2V7HA 2MTAA 2WKLA 4HHAA 4OJYA 2N59A 3EBGA 5L2KD 4HIPA 5ECJE 3BPNB 3VGEA 4EUPA 4OZGA 4JFQA 1TSRA 5INDB 1PD6A 3LIUA 2QADC 2DQ6A 4K3EL 1KGUA 3FCSA 2H2SD 1PDKB 1X5JA 4KROC 3TGXA 1DL7H 3VDAA 3LKQB 3EOAB 5AB2A 1FVEB 4WEMB 4KZEH 1HHJA 4X4XA 2ZONA 3HHMA 4KK6C 4G2AA 4X98B 5TQ0H 4ETQB 2BSCA 1EHXA 4FYRA 1C5CL 4EEEA 2FX9H 1EX0A 4JZOB 1TNNA 3CPLA 2C7FA 2VN4A 1LE5B 3E3QE 4OKVA 2Z7UA 4KKBC 2MNWA 1N26A 4OUOA 4MA7L 2ADJB 2BVYA 2YK1H 4FKEA 5EOQH 3U6XA 2CBPA 2IANE 3NP3A 5ISZE 2KI6A 2YPVL 2F19H 5D2NE 1T20B 2HFEA 4E9LA 3LD8C 1THAA 1E67A 1ADQL 1UD4A 3CH1A 3NZ8B 4OFYA 3PHSA 4PBDA 3VCLA 4DKFL 1ICTA 4XMXA 1M7DA 4MMZB 4EIZC 3O6KL 5GGTH 5I76B 3SJVE 4NUPA 3VH8B 4JHWL 1E8XA 1T7WA 2GHWB 4ODBD 5FYKD 2X6AA 5GRVL 5C0DB 5EN3A 3QIWB 4X6CB 3RGVA 3H2WA 5EMYA 2APTA 2HFFA 1LE9A 4ENEC 1EEZA 1MFBL 4O2FB 1DANT 4XI5D 2CIKA 1EHLH 4BK4A 4OJDH 3QFJA 5FHBH 2NCEA 3QI9B 3LNGA 4URTB 1GGUA 5I26A 4KUZH 1YMMD 1A3ZA 1BGXH 3U25A 3CSYB 3TEZA 1JAEA 3A6BL 3EJYD 2YHGA 3D5OF 2DQGH 2HKFH 2FD6L 4YSSA 4LHUD 5CBEA 1TTUA 4YLQT 3SGEI 1GYWA 2MNUA 3DX6B 2J2ZA 2YMXH 3BQUB 2VMFA 4MTMA 4OT1L 4JFSA 3UAAA 5GGSB 1DN2A 3CC5B 5CD5C 2DTMH 4R5TA 4GW1A 1QTSA 1T7YA 2P8LB 3BP4B 5E1QA 4XWGH 1JZ3A 1Q9KA 5CP3H 3N04A 1T0NB 4OD1H 5GGQH 3FQTA 1RUQH 3QDGE 4EI5B 1KPVA 2H1PL 4CVXA 4HJEA 4TUJA 1NGXA 1OAQH 3WTSA 2ADIA 2G5BA 3TYFB 1YN7B 4P4KA 3TJHD 1U95B 2WO3B 3S34L 3QXWA 5E9DD 3UC0L 4URKA 3QSKB 3UTPD 4BZ2A 3HZKA 2IH1B 4PB0H 4CMHC 4J12A 3UZQA 3SDCA 3ZJAA 4ZMZA 3TEXA 5I1LA 5JW3L 1CXLA 5G5DB 1CG9B 3GI8L 1RFDH 1E27A 3BHBB 2O5YH 1HILA 2OI9B 2WCPA 3R06B 5TF1H 4KNQA 3CVHA 3CLFH 1ZHNA 4PR5A 1FE8L 4MCYA 4HC1H 2CDEB 1RMFL 1ZT4A 2J8UB 5CUSH 3VWKB 1F3RB 1JZIA 5IBUG 1TYEB 5HJBA 4UTAA 3T2LA 4ODSL 1H3VA 1I1AB 3QJOA 2R2BA 1I1FA 3REVA 2DH2A 2V4LA 3UIZA 3FBQA 5GZND 3ZDYE 5F9OL 4WI3A 2KERA 4IEFA 4XPAL 3NJHA 5C0IB 3VUAA 5ID1B 2XKSA 3DI3B 4WQOA 3T3PE 4B95C 1DLFH 1F8TH 1MHPL 3HMWL 2WZ6A 4PRPE 5F9AC 4H2AA 3S36X 2X38A 5G4NA 1BFOB 2D4DA 4L3FA 1M53A 2IGLA 3MNVB 4NHCH 3MJ9L 1ZT7B 3P4OB 5FYKU 1NDGA 4EI5C 4NKDB 2CO4A 1B88A 1XGTA 1KGCE 4WY7H 4CU6A 4H8WC 5GXBB 2DQTL 1DBJL 2F7PA 2OMZB 3DX9A 4LLDB 1A64A 4IYKA 4QO1B 3WIIL 5BPPA 3KYNA 4IK6A 4OZ4B 1DDHA 3ZKNC 3QCUL 4PMFA 3QT2A 3TIEA 4A6YA 5I8CB 2BNRD 4GUCA 1E28B 4JW3A 3SKJL 2GVYA 4ZUTB 1J5OL 5EBWA 3GUTA 2R29A 3QIWA 4X6CA 1FCCA 4BDVA 1KCRL 2IH3A 4MDIA 2GCYB 1OQOA 5HYJE 1LE9B 1F4YL 3CVHH 5T3ZE 2XTJC 3MC0A 4QRPE 4K07A 4M03A 5IKCB 2IDCA 2Z8SA 2XBTA 1F4YH 3CVHL 1KXVC 4YFDB 4EPSA 4NQEB 3MHZA 1EIBA 3VGGA 4MXWH 4E2OA 1E65A 1IAMA 1MCQA 2ZKHL 3C5XA 2I7SA 4XAWH 4Y4KA 1FWXA 3BRGC 3POCA 1ML0A 4S2SA 2P52A 1KXTB 3N1MC 1IBHA 5B7EA 1CVSC 2Z91B 1E9PA 4LASL 2YXWA 4KJWD 2N3JA 4NCC1 3DIVA 3F6JA 2JQZA 4LMQI 4X6FB 1LWJA 1MHEA 1E7VA 1QSFD 2B59B 3C6LA 3MRMB 4HZLA 4I5BA 4WY7L 5EOTA 3RVXC 3ZKMC 2VNCA 1K4DA 1D5ZA 5JR1H 3AXLA 3C2SA 3IFPA 5C0BE 1QD0A 3KHOA 1X7QB 3QRBA 4IKKA 3HS0B 3INUL 1BQRA 3IDJB 4P9ML 1NPNA 1VENA 2PPCA 4Z7OF 2DBLL 5ILTL 5D1ZC 4KTEL 1AQMA 4PJBF 1F8TL 4PYHA 3MMEB 4PWJA 2D2OA 2XTJD 2ICWB 1AJ7L 2A9CA 2HZHA 3CVDA 3W39B 2ZXEB 3DARA 1EUTA 5JW4Q 1YCSA 4BH8B 1WA0X 1NAMH 5IY5B 1Y0LB 2AXWA 3Q13A 4JRFA 2IFGA 2X88A 4FQHB 2BS71 2VC2H 4BZ1L 2Y6TE 4MCYB 5HJ3B 1NC2A 1D5MB 3CC1A 4HC1L 3TZVD 1MVUB 4FS0A 2C3XA 1EAJA 4HV8B 1T22A 3RWJA 5JIMA 3W3BA 2CM5A 3IU4H 4GRLD 4HS6B 2E4FA 4NLAA 5JW3H 2ZQKA 1SN0A 4K23L 5JPMB 1F00I 3HHRB 3AQYA 5BUAA 3JV0A 1A6PA 1MCJA 5FHAL 3JVFC 1RUML 3T1FA 4OSUL 1OARH 4JFFA 3UTZA 4U31A 2F68X 3GBNH 4EOWL 1QPKA 2FJFB 43CAA 2AP2A 3MJGX 2H1PH 1HE7A 4BQ6A 4UOZA 2DICA 2DKUA 4OD1L 5IP4A 4XNXH 2Z7ZA 3CCHB 4YMPA 5BO0D 2MRYA 2AQSA 2R4SH 3D18B 3JTSB 5C0GB 3A3YB 3GRGA 3HNVH 2BHUA 4NO3A 4WTXA 2I60H 3LRHA 5HVWA 3WNJA 2IBGA 3VSTA 1ASOA 4X6DA 4GEJA 4PS8A 2APWA 2DKMA 3P54A 3QWQB 3B2MA 5HHOD 1E6OL 3EYOA 5F21B 4X6EB 1MQKH 1I4FA 1KXVA 2DQGL 3QQDB 1AGBB 5GRJL 1K5NB 2G9KA 2P5ED 2YEVB 5E1AA 5F7FA 2Y06L 2OL3H 3I50L 1O9WA 3ROLA 1AGFA 2A9NH 2DMGA 4U1IB 4N0UE 1IC4H 3DI2B 5FHBL 1BMWA 2VTFA 1FNEA 3Q5TA 3SGDH 3PYCA 1QNZH 5BUGA 3MV8B 1LK3L 5D72L 3RI5K 3I9GH 1R17A 1EJOL 1WQVT 4FXGB 3RDTD 2DJUA 2ARJB 1KJ3L 1ZVSB 4RFOL 1P9MA 2B1AL 5MERA 2O5ZL 4TUOB 3V7AE 3O9WC 1TTRA 4QRAA 5I1IL 2X4QB 5DQ9B 5H94B 3U4EA 1CFTA 4P5MA 5DJYA 1EZSA 4X6FA 4KAQL 5KAQF 3MFGB 4OJEH 2QVIA 4TULL 2Y4SA 1ORQB 4HPYL 2F19L 4GIOA 1DBAH 1R1CA 3MRMA 3QHFH 4I5BB 2GW5A 4OF8A 4PRIE 5JPNB 1T1ZB 5FFLA 1A7QL 4WJ5A 4M61B 3MZTA 3ARYA 1OZUA 4FEMA 1WP6A 3UTSD 2YBRB 4Y19A 1S3KL 3HNTH 4XCCL 1U3YA 3HG3A 1Z5HA 4BM7A 2ZT9C 2XWRA 4GG6A 1MIMH 4O51A 5AUMB 4Q97A 2FUQA 3UO1H 1NFDF 2PKDA 2X1QA 1D7BA 5C92A 3G6DL 5ID0A 4ONGL 4DAGH 2EIEA 3ARBB 4KKNA 4HKXB 4P46C 1TLKA 4GP4B 2F53D 1ZVHA 4PWGA 2ARWA 4HWEL 4GSXA 4PJ9A 3FTYA 1DL7L 4YL9A 1T03H 2NY5H 2HG5B 3PHQA 2OTUB 2DQEH 3SDAB 3VYOA 3V0IA 2XRAL 4MQSB 4LPTA 2ZWSA 2P42B 2LFGA 4UQ9A 2VR3A 4XP9L 3ATDA 4F37F 4LEXH 2AF2A 1L7TL 4FMVA 4GW4A 1G7LA 4RMSA 4KC3B 3QUMA 1ACYL 4N2HA 1BIIB 2MQCA 2GIMA 5DLMH 5T3XH 1OANA 1BVNT 4LBEB 3GSNB 3JYCA 1O7DE 5EF2A 1T04B 4R7DB 3T2NL 3SDDA 1N0XL 43CAB 3GMPA 4N0FB 4HW6A 4QY8A 4Y19D 4JY4A 4IDJL 3WY2A 3C5JA 4UQBA 2HJLA 5JIPA 2V3FA 1WT5A 3FSOA 4BH7B 5EDXA 5TTRA 3MRPB 1XXDC 3KXFA 3QAZC 3C87A 3MUHL 3S3PA 1ZT1A 3U9PL 4AE1A 2CH8A 1N6QL 4WI6A 4O2CA 1ZSDB 2Q2LA 3DUHA 4Q9QH 2JIXD 4B5ZA 3HMXH 1AGBA 1J8HA 3NIGB 1O6VA 3GHEH 3ULUD 4WRLA 4HUWB 2JK5A 3GI9H 5C2BH 3QQ3A 1EH9A 1FYTA 4NO5A 4QR7A 4MYPA 7PAZA 2ADGB 3MCKA 3QIBB 2A7BA 1ZY9A 4G80A 1TEYA 5EIQA 1JG9A 3ZDYB 1YEFH 3TT3H 2VH5H 2DH3A 2X4UB 3HG1A 1BQSA 1MIEL 5IMMB 5KVDH 4RMVA 4ABVA 4AIOA 5ESAB 3DO7A 3BCDA 5ANMB 5B1CA 4HD9A 3KWTA 4F1SA 2ED6A 2WBJD 4IW4C 3V8CA 4B27A 2PXYA 2ODHA 3PWPA 4X7SL 5DJCB 1G7QA 2CO7A 4TUOA 3CDGB 1QRNB 4H5SA 4F57L 3UADA 3DBSA 1Q0YH 5KSBE 4FQXA 1G7PB 4KPHL 1JIBA 1K2DB 5E2VL 2CLVB 1IGJA 2ITCB 2QPEB 3V4VL 3L1EA 3MJ9A 3ZBMA 4RFNB 3QJXA 1OP3H 3WEXA 3OWEA 3KD4A 2Y7OA 1AP2A 2AJVH 3Q1SH 3TONA 5EUOE 4E41B 3C5ZA 1UZ6E 2GI7A 1K3IA 1PLGL 1AC6A 3GS4A 4UQIM 1YNLL 1QEXA 4Q6IC 4RCAA 3QJHA 3GXUB 3E1F1 3UTTB 1X5FA 2CBMA 2HX8A 4W4NA 1KCKA 3CE1A 1TJXA 3DIFA 3T71A 5A40E 2Z4QB 4MKTA 1L9MA 4W70A 4N2LA 1HHIB 2VDQL 2PABA 1BVZA 5FGSA 1G1KA 1R5VA 4HWZB 5FF6A 7FABH 1VGEL 3GSNL 3KL0A 4WK0B 3T0VA 3K0WA 3IFLL 2C9RA 2QZ5A 3R0NA 5LN4A 4HKZB 1Z32X 3B2DC 3QULB 4HCRL 2UWEA 3S4SA 2F1BA 1PYWB 3Q43A 3RZCC 3HFML 2IDUA 5HVGB 3UH8A 1CL7L 1F11A 4R7LA 1QKZH 4PRAB 2EIJB 1FO0H 2W59A 3FULA 3SDCD 1Q9LA 1YLBB 1RVFH 5AKSA 4AQ8A 3DV4A 2D3NA 4XP4H 1BD2E 3SO3C 3A67H 1AO7B 2EXWD 2F53A 3BZ4B 4YDMA 4PJ8C 4KX8A 4PWHA 3TBYA 1JPFA 3U1SH 1QA9B 1D5MA 2RALA 4M00A 1E42A 2VO5A 3M1OA 5I6LA 4MRBA 5AOZA 2EXYD 1C12A 1U93B 3FQWA 3WY1A 4IGBB 1XF5A 3K6FA 3ABLB 3VG0L 4OAWA 4Q9RL 2IG2H 1IGYA 1YMMA 4NENA 3QUZB 4NZUL 3BMWA 3I2CH 2ZKYA 3CHRA 4KUCD 5LLIC 1HOCA 3L3HB 2VAJA 4NM8H 2CGRH 1CF8H 3RLSA 2XOTA 1R3JA 4KJQC 4YPGB 3ARDB 1GZPA 4XC1H 1HIML 1DO6A 3L5JA 4FQXC 3RFZA 1T2QH 3QIUA 2D0GA 2YRZA 4HZ1A 5I0YA 4ZW5A 5JXEA 4RMUA 5KVFL 1OP5K 1AS7A 5IEKA 3JXAA 4AQ1C 1M42A 4NM8L 4ZD3L 5FKAB 5FOBA 4XVTL 4WHCA 4PWKA 1XXFC 5I8EA 2Q86A 2UXTA 1PKOA 5E5LA 3VXTA 3HAEA 3S37H 1T2XA 2DRUA 1BBDH 2HTKC 4HETA 3O4LA 1P6AB 4X6EA 4CC0A 5KVGH 2HVJB 3MV9B 3LIZL 2AQ1A 4G1MA 3F6LA 3FQ1A 1U8OB 12E8L 3RHWF 3DRTA 3GHBH 1ETJA 2CRMA 3FB5B 1FNEB 4S1SH 4EUPH 1KPRA 2R0KH 1RQ5A 2OMUA 2X4PA 1CICB 3J7HA 3TF7C 4Z7OE 2XBDA 1DJGA 1W6WA 3HZ3A 4JK0D 1ZTXL 2BVUA 1OOWA 4Y16C 2HTLD 2V5YA 4JVPA 4WTZG 2D73A 2DMBA 2M2DA 4KVCH 3B9KA 2X1XR 2G3MA 3DIFB 4MAYA 5EH1A 5MHSE 5H94A 3U4EB 3N1GC 4EVNA 1CL7H 4YNYA 5L4IA 5C07A 5KANI 4ZW8A 4YSPA 3EBAA 3T0WA 2VLKD 4K5PA 4DFIA 4OCSL 4K3HA 5I19H 5EZOH 1VGEH 3GSNH 5AW1B 1RJCA 4P2OA 1F4HA 3DVFA 3DECA 4OGYL 1IL1B 4BZ2H 4XMUA 4RAUA 2I85A 1FIEA 1FNLA 4F8NA 3K0YA 5J13B 5CGYD 1FVCB 5FC9A 1NJ9A 2A9MH 2CBTA 3PLYA 1JZFA 2ZSVB 5I1HH 2EXWC 1YRKA 2AXFA 2GTZA 4H20H 4XNMB 2JH2A 5CO1A 3IETA 3DXAB 5G4MA 3ZTDC 3D39B 1WUNT 3KPLB 4UT9L 4KTDH 3VFWA 4R4ND 3U0TA 1YDPA 3IGAA 2IQAB 2AXJA 1EXUA 1TQVA 5K9OB 4I89A 1OCWL 3LV3B 2CBOA 2YMOA 1H8NA 1IE4A 2EDEA 3X14A 1T1XA 1JGVL 2JMRA 2HT3C 1W8NA 3FU9A 4Y16B 4KTGA 3L1GA 4ZMYA 4FP8H 2OMBA 1NCNA 1CTOA 4DN3H 4KPHH 3OHXB 2X4RB 1UZ6F 1AKJD 4OW6A 3C5ZC 3STLA 4DESA 2D03H 1JYVA 1TZGH 2DIBA 2NUPA 1IX2A 4A68A 3S3DB 1HXYB 4A7SA 3T3MF 5FO9A 3M8OL 4EZMA 3WTTA 1NIBA 4ICWA 3QZWA 4PJBB 2AEOA 2BC4B 3MKGA 1IT9H 3KXFB 1DYZA 4D8PB 2ESVA 2J56A 3ZOAA 4FZ8L 1ZOXA 4PS4L 3TNNA 3L7EB 4WO4A 2Q86B 1TZHB 4UQ2A 4XPTH 4X9YA 2W95A 1ECYA 4AEEA 1AQKH 4GRWF 1UXWB 2EIMB 2H3NB 3HAEG 4MJID 3MRRB 4Q9QL 4R83A 2YAPA 4PUBH 5GGRA 1O6TA 1YYML 2D7MA 2X9WA 3QIBA 3U9PH 1CE1H 1XVSA 4BD4A 2B20A 3CTTA 1KY6A 4ESKA 4M5YH 8FABA 4QTHA 2YPKB 1DQDH 1MCOH 1P84K 2XFXA 3FUDA 1XHHA 3O9WA 3BLBA 2L7JA 1MKFA 2J1XA 3QDJE 4KFZC 1VERA 5DD1L 2F58H 3KNBA 5IMMA 5L4FA 2XXGA 2I9TB 2ZKXA 4RISL 4R5VA 4MD0B 5FUOL 4YBQC 4QWWC 3CFDB 4XXCC 3FQYA 5EEVA 1SDYA 5C8JB 4JO8A 1YEGH 4O5LH 3T77B 4AWJC 5BQ7A 1KCVL 1X5GA 3WO3B 3HOGA 3LZFH 4LEBA 3V0DA 3EXLA 1XO8A 1ADQA 1EQWA 3A5VA 4K5NA 1OGAE 5F96L 2IGFL 1LGVA 2FGWH 5BQDA 2G0LA 3NN8A 1U3HB 4MA8H 3JWNC 4XP9H 2UVFA 2FLMA 1T5WA 4ZTOH 1OWRM 2VZTA 3CFQA 3JWNG 1N8ZB 2FUTA 4ELKA 4Z76B 3MOAH 3JTBA 5I23A 2BNQE 3MTRA 3RNKB 1JXDA 2VDQB 5D96C 3FQNA 3ILEA 4KK9C 1KELL 4AKQA 4FFYH 3QC5X 1KYFA 1QWNA 2AJYH 4HH8A 1W0YT 2R9HD 4YHYC 4LNVA 2KS0A 3UAJA 4M6NL 2B08A 2OMTA 4A55A 3VD1A 4DAGL 3DXAA 1X4YA 4X0NA 4HIIB 2VLRA 4LVHB 4LRNH 1ZS2A 4HX1B 1PG7H 1XGRA 3O41B 4Z7UF 1BMZA 2NYZA 1C5BL 3DVGA 4JKNA 3ZYIA 1I9RL 4FQCL 4M5SA 4PJAF 5ALCH 1MJJA 3DOSA 5T1LB 5HYQA 1JGEA 1QFPA 4KZ0A 1MELA 2FGZA 4B9JA 4YGVA 3V4VB 2JB6A 3AG4B 2O5ZH 3F85A 5I1IH 1IM3D 3DHJA 1QFWH 3NBNA 2Q2EB 3OZ9H 2XTLA 5MEQB 2C4FT 5JDJA 5C08B 3VSVA 3WDHA 2IAND 2VDPH 1H19A 2JKWA 1EAPB 4H0GA 4FULA 2NY0C 3FQ4A 1GOGA 2BIMA 4A7GF 1DFBL 4ABQA 4G8GE 4YX2L 1U93A 3FQWB 5HHQA 2A9NL 3PP4L 3GS7A 3HG0A 5KANG 3CMGA 5ESVA 5GRJH 1F90H 2NSQA 2R59A 4LFHD 3WIFA 1LD9A 2OJEB 4NNXA 1IGYB 1YMMB 3VXOA 3DBXB 1BZEA 3FT4A 2KLRA 4NYLB 2MKWA 1IBDA 5L2KB 1NTDA 1YJDL 4DCQA 3QWRD 3IPBA 2FL5A 4FI8A 2I60L 1WFUA 4PJGB 2YKKA 3UTPE 2FLRT 1NICA 3FONB 3L4YA 4I88A 3L54A 2R4SL 3KNBB 1V55B 1YUHB 4AGOA 4H0HB 1CUOA 3GMRB 3ULUL 3V8OA 4XO3A 1FNGA 4ZO7A 5C0CB 3VRIB 5E9DB 1UJ3A 1BF8A 3T77A 4K9EH 2EYSB 1OAYH 1G87A 4APQD 3UG3A 2FHCA 2FR4B 2NZIA 2OSYA 5BVPL 4WWOA 1RUMH 4XCFH 4UMGA 4KK8C 3FTGB 1Y1UA 3IK2A 3APDA 5AVQB 4Y4KC 1ZVNA 3IEAA 1KCVH 2WOBA 1SY6L 4BFNA 2G9HB 3TN0C 4LF3A 3MRDA 3Q2VA 1PDKA 3APNA 4X99B 2DWXA 3LKQA 3QCVL 2XG5A 2GY5A 1HH6B 3IU3B 3EG9B 1JK9A 1ZA3A 5CR1A 4GAJL 4PU2A 2F53E 5LNGA 4FQLH 4YUEH 25C8L 2VAAB 3II3A 4X8JA 5D1QD 1TQSA 4QHNB 4ZYKA 3FH5A 3LS4L 3NSJA 5AZEL 1PX3A 4JFFE 3ARDC 5C07B 4FQPA 5AAMA 3FQUA 1U8NA 2YAFA 3FSAA 5K9KA 3LZRA 2OSWA 4Q9BA 4Y2DD 1GA2A 1XGZA 5DUBA 1JWMB 3RVVC 3UFIA 4KQ3H 2XQ0A 5KVEE 2NX5E 1Z2KA 1WFOA 1NCWL 2B39A 5MEOB 5T1DH 3IWUA 2HWZL 1YPZA 1IT9L 3AQXA 5BV7L 4XMKH 3NZ8A 2SEBB 4A7UA 1DBBL 1Q90A 4BKLB 4G8IA 4FC3E 5GS0C 2XN9B 3O6LH 1KG0B 4PGBA 4I4WB 3VFMB 4FA8A 3IPEA 4PJ7E 3AS1A 2GIYA 2XX0A 3VXSB 1QW8A 1RZKL 3V6ZA 1R3IL 2BVPA 4QOKA 1ED3A 3EGDB 3KHQA 1JERA 3THMH 4WTZA 2F5AL 2F6AA 3UAFA 2GI0A 4F8LA 1JHTB 5JQIB 5DHDA 4IQHA 4Z77A 4L8CB 2VR6A 3F12B 4IU3A 4QHPA 4KU1A 1NC2D 2JIXB 3N1FC 2Z6FA 3BW9B 1NUNB 4PWIA 5CU5A 5HYSG 1TVBB 5T8IA 3AGVA 1JF1B 3FU6A 3ZN6A 4UT9H 1GJWA 3UZEC 5KS9B 3CXHJ 4ZUSB 3L08A 5FO8B 1SMOA 3F7RA 5AVTB 3SKOA 1RK0B 2RMNA 5TQ2L 2YLKA 1TCMA 2EJ1A 3NJGA 4X5RA 4M4RB 4TF4A 3UYRH 2I69A 4NJ9H 4MJ2A 1VF5C 3JWOC 3L3KB 3VGAC 3H8NA 1UUNA 2IAMD 1VFUA 3MV7A 1N10A 5DSCA 1I3RB 2EE3A 2AI0L 3OKDB 4AJ0A 3IXAB 1KN4L 4PY8I 3LCYA 1H8LA 3ARFD 5IHUL 2FJHB 1ZCRA 4N0UB 5T1MA 3EYUH 3W9DB 3KPSA 4HPHA 4APXA 4U0RC 4QJ4B 1F58L 3L4VA 3UZQB 2HB0A 1XEDA 2W0PA 2TSBA 5HDQH 4JFWA 1KBGL 3SN6N 3LPWA 5A2FA 2JCWA 3ULVD 1IGIL 2G9HA 1XL6A 3BWAB 2Z7WA 5D1XC 5D70L 1G9NL 2G3ZA 3G6JE 3G9VA 5CUSL 3GJEA 5DUML 5KBDA 3ARFB 3MTXA 3OZKA 3CLFL 4YHKH 5JW4N 4PV8A 3KJ6L 2EDTA 5K1VA 4LP5A 3RVTD 4CADB 4BFOA 1XT5A 1K4CA 3FRUA 1I1FB 4JFTA 3REVB 3RWFA 4LB8A 1OF2B 1DCEA 4FA6A 5F7YC 3ME0A 1DVFD 3CFDA 4PHXA 4ZOAA 2ERJC 3MGTB 3FPXA 3VXPB 3UC0H 5DZLA 2TSAA 1U3JA 4DGVH 5F3BA 2LTQB 3LIZH 4M93B 5DRZB 2VXTH 4JM2D 1BREA 1BBDL 4Y4FC 5CLZA 4EJ1C 4Y4HA 1IBYA 4AL8C 3BKJH 4TPRL 4C47A 1RUQL 2IH8A 5D1QC 1UQSA 3H54A 3ATBA 5DC2A 3ARPA 5GZNC 1T6VN 1XGTB 1F86A 4XWGL 2VZ1A 4JB9L 5CN3A 1E50A 3IDYC 2Z8WC 4YZFF 4Z0BL 5LCVH 1HIMH 3LKNB 4XC1L 3BSZH 4C59B 5GHWH 3ASNB 2DW5A 3BZFA 2CHZA 3HS0C 1OY3B 2XTSA 4QRPB 4YC2B 3MU3A 2FBOJ 1TT6A 4OLVH 2WSPA 3RIKA 3SQRA 3IDYB 1ZK9A 4APQB 3T65B 2AJZB 4PLJD 3SYPA 5E0FA 4HIIA 4JQXC 3K3QA 5DZNA 1LEIB 2EEXA 2L04A 4X6BB 5DGRA 3CVCA 5JORA 3QYMA 1IM3A 1LE5A 2IG2L 4FQ1H 4OV6F 4IK7A 3KBFA 4KY1H 3QUYA 5E4IA 4PJAB 2VN3A 4JKPH 5HYJD 2XV0A 2ZKMX 4TOYH 3I6GA 2ICCA 4YFEA 4QRPD 2RCSL 4XB3A 1LDSA 1ET5A 3NCFB 2BVTA 1RLBA 1D7DA 3WV0A 2BW5A 4L5FL 3LJ3A 3A67L 2YFNA 1ZKAA 3QXUA 4NKIH 2K78A 2WLLB 4FZEL 1WEJL 4OI8A 3F2LA 5JTWA 5SWZA 1CU4L 4EQ3A 1GMEA 2CPUA 2YK1L 4HT1H 3HRZB 4HCRH 2KQMA 1KENL 1J9CT 2A6DA 4IIQC 1WHPA 3V5HB 4G6JL 1WITA 5I1GH 4LIQH 3VRJB 4LKCB 4L4VE 4K94C 3UTQA 3H85A 1PL3A 2Q7AA 2FX9L 2ZSWB 4IIQB 2R51A 2JV6A 2J55A 5B3SB 2HJFA 2AK4D 1NCGA 4X5WA 4L4VA 4UV4H 3VWJD 2QGEA 3QNXA 3C09B 1M9SA 1JNLL 2C3GA 1HAWA 2BP0B 4I77H 4K15A 4C4UA 4AMWA 1LXMA 4HH9B 5GJTL 4KNUA 1UXSA 1A21A 1GCYA 1RAMA 4PCSA 2BS9A 3RB7A 2MPVA 3NCYS 3ME0B 4PJHE 2DL9A 4ELMB 5MENE 2G5BB 5LUMA 2X40A 2CPCA 1CFQA 2CR6A 3QW9A 4NWTH 5T5FH 2XZCL 2GITB 1A6VL 2DYSB 3F8UB 3GRWA 3I3BA 3V4VH 4E41D 1ILUA 3BH9B 5D1ZI 3AU1A 3NFSH 3HZKB 5SV3A 2YRLA 4DPCX 3GM8A 3NEOA 4JCWA 5TDOB 1HILB 3MLZL 1NEZA 4UOW0 1YY8A 4XN9A 5T33L 1NM4A 4ZTEA 1IAIH 4X7SH 1XF2A 4P23C 2XG5B 1OAXH 1MIEH 5KVDL 2VMEA 3BRDA 2GJZB 5B38G 1ZA3B 3K80A 3O3AB 4J3TA 4DGIL 4YE4H 3W2DH 1F2XK 2HVKB 2GT9B 2B0SL 2UZIL 3NSDA 4Z3JA 4X5QA 4UTBL 3AUWB 2ATKA 2PYEB 5IWLC 2JJUA 2HLFC 3WN5B 2IWKA 5BXFB 4G6FB 3ES6B 3SB3A 1JXJA 4IKJA 3ARED 4BFIA 1WGOA 2YA2A 1DVZA 1HK6A 3X3FH 1UA3A 3FRPA 4XX1E 4YE4L 2DQCL 5IW1A 4UT6H 5FXCH 3RGVB 3UDWA 5I5IA 1EJFA 4LCCC 1AY1H 4KX9A 3PE9A 5B21A 5IB3B 2EDHA 2XT1B 4O2FA 2F9BT 3WJLC 1UWEH 3FFCB 2DI7A 3UMTA 4LLWA 1P53A 1KLUB 3VFGL 4AVIA 2CO6B 4IOSD 1GAFH 1JPST 3AG2B 1G7HB 2WAQA 1S7XA 1DLHB 1EXGA 2PPFA 4N3UA 3UBXB 5LAXB 3IPFA 1E9QA 4WFHE 3GM0A 4GSDL 1KV3A 1AHWA 5DLML 5T3XL 4Q8BA 1OLZA 4D9QE 2Q76A 1B2WH 2A6DB 1U41A 3CPUA 3VRJA 3O6FC 2X5PA 1NPUA 4MCMA 2VCOA 3DC0A 4YFLI 1NSNL 1I1AC 4EO5A 5ID0B 1G7MA 5CIPH 3RNQB 5ALBL 1TVBA 2I32A 1CVRA 3F7VA 3LPFA 4M5ZH 5AW9B 1T03L 5E6YA 1X44A 4K3GA 3TX4A 2Q6WA 3DUSA 1DSYA 3FTWA 1RZIB 1A7PL 4H25A 4NJAL 3ZQWA 1U8CA 2BOLA 1A4JA 2X4SA 3ZDZF 4LARH 4ZRGA 1D9KB 1RZJC 2ZCLL 1CG9A 1PLAA 3LRKA 3BCFA 2PETA 5ICXA 2A6JB 1S7SA 3V4UH 2JNZA 1EZVY 3UO1L 4CMHB 4LK4A 2ZE0A 3FFDB 5DSCB 4I1PA 1MIML 1G1YA 4WV1A 2EDNA 3BVVA 1WBXB 3VNZA 2HRHA 4GAAA 4R7XA 1D9KC 2EADA 1S3KH 3HNTL 4XCCH 2GAZA 3VXSD 2NYYD 3BGMB 1ERNA 1RKRA 4OV5B 1O75A 1MW1A 1QQDB 1SQ2N 5J5EA 2YQ2A 2YOCA 4ZFOA 2ZWLT 3AAZA 3EIFA 2X42A 3PWLA 1AR1D 3BWAA 2R0LH 3UL4A 5BS0B 5HI5D 4LLMA 2Q3ZA 3F7PC 5D9SB 3T0XA 5SX4I 3EXJA 1NZRA 3S8GB 2WXRA 1CFSB 4JKPL 1QNZL 4PRDB 2K6ZA 5A16A 4NO2B 1ND0A 3K2IA 1B0WA 1TR7A 1LEKB 4YZWA 3R4RA 4P23B 3I50H 4JDEA 4M8QA 1HEZB 1Z0NA 1CTMA 1I82A 4XX1G 2E9IA 3EO9H 4XBPA 2XQYK 4XMVA 4MXQC 3K8KA 1L7IL 3FU5A 4ZO8A 3FO0L 3JWDC 4M8VA 2JWYA 1CE6A 3KGRA 2N56A 3BRFA 4Y5YA 4Y16D 5F9WC 1XAKA 2XZAL 1KJ2L 1AI1H 2ALAA 4PG9A 4NO0A 2KT6A 1XF1A 5CP7A 3LXCA 5HI4D 3ULUC 5C0AE 1ZLUK 1CT8A 1SOKA 1FNSL 1DUZB 4JEGB 3ZE1E 4JPIB 3LAFA 1S7QA 5KOMC 2CLZB 4EOWH 3KYOB 5FECA 1QABA 2X2IA 3P2BA 1KDJA 4YHNB 1D3CA 2FBRA 1OARL 5D4IA 5E8PA 3ARTA 3F58H 3KR3H 2Q76B 2QLVB 3PAYA 1ASQA 2FX8L 5IR1B 1FGNH 5DVMA 5GRVK 4K23H 1E90A 4QXWA 3PQYE 5F70A 3RIAF 5D8JH 1TEGA 4JRXD 3GLEA 3NPZB 4WLCA 3HB3C 3Q9PA 2EKSA 4DT2A 1NGWB 1ZHKB 2BNRE 2GBUA 3RBSA 3C60D 1G9NH 4YLCA 3UTTA 3DUSB 3CGTA 4KXDA 4H25B 3MNDA 3OC5A 5DQ9A 2LFEA 4PJFF 1DQTA 4ZFZA 3U6RB 1EXHA 3EBHA 4W9KC 3W82A 5I2IB 3ETTA 1LQSR 1R34A 1KIPB 3T3ME 4XNDA 5EZPA 4I48A 2DBLH 4JLRA 5DRWA 3UJJH 5C0JA 3CZUB 5ILTH 3NIGE 5LXGH 4AV0A 3ZHNA 3QULA 2XJLA 2ZTBA 4O51B 5AUMA 5B39A 5K5YA 2E7MA