3Q9PA

Hspb1 fragment
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
83
structure length
76
Chain Sequence
SHTADRWRVSLDVNHFAPDELTVKTKDGVVEITGKHAYISRCFTRKYTLPPGVDPTQVSSSLSPEGTLTVEAPMPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Chaperone
molecule keywords Heat shock protein beta-1
publication title Three-Dimensional Structure of alpha-Crystallin Domain Dimers of Human Small Heat Shock Proteins HSPB1 and HSPB6
pubmed doi rcsb
source organism Homo sapiens
total genus 7
structure length 76
sequence length 83
ec nomenclature
pdb deposition date 2011-01-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.790 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3q9pA00
2K8QA 2O30A 1RL1A 2WJ7A 1WH0A 3EUDA 3GT6A 3QORC 1WGVA 4FEIA 4YE0A 5DS1A 4ZJ9A 4ELDA 2MNWA 3L1GA 2KLRA 4M5TA 1X5MA 2Y1ZA 3Q9QA 4JUTA 2Y1YA 1SHSA 2N3JA 3Q9PA 3VQLA 3N3EA 3IGFA 2XCMC 4RZKA 1EJFA 2CG9X 3AABA 3J07A 3QORB 4PCKA 3W1ZA 2WJ5A 3QORD 2BOLA 4YLCA 4YDZA 4JUSA 4M5SA 4I88A 3GLAA 5DS2A 2JKIS 2CR0A 3L1FA 1GMEA 2KMWA 3GUFA 1WFIA 4YL9A 3L1EA 4PBDA 5LUMA 2N0KA 3AACA 3VQMA 3QORA 2Y22A 4YLBA 4MJHA 2RH0A
chains in the Genus database with same CATH superfamily
1HILA 1PKQA 5ICUA 1A1NA 4FN0A 1IM9A 4ZFOL 2CDEB 1FIGL 3HZ3A 2QDVA 5F1SA 3ZYOA 3L9EA 3MCKB 4XRCB 4JG0L 4ALAL 3SO3B 4FQPA 1W9XA 4G6KL 4A55A 2O5ZH 3L45A 3U9UA 3O0LA 4LLVB 3ATBA 3V5KB 2J5LC 4QF1B 4QTHA 4XH2B 3NFNB 5AVZB 4HPHA 4J6RH 4HOMA 5LG6A 1OZTG 2UZXA 3H9YA 3VFTB 4CU7A 5MENB 3ZHLA 3RZCB 4KRPC 3OXSB 2XYCA 5FCSH 3R0NA 4WAFA 3FTVA 5KBKA 3KPSB 3KGUA 4IBUA 2OZ4H 4AENB 2EO7A 1Z7JA 1Z0NA 3T6WA 1MFCH 1GS8A 2AVGA 4CMMA 3GLDA 2VR8A 3LEVH 4F7EB 1C16B 1UCBH 2BNQD 2CR6A 4HBQA 4RMQA 4MDJA 5C7ZA 1FO0B 1T3FA 5BOPA 4LVEA 4FQXB 4LCWD 3RWJA 5BS0A 1UJ3A 2R0ZH 3GUTB 2BVUA 3V6OE 1Z9SA 2EYSB 4JFDA 4ENEC 4C4UA 3QIBC 5I1GH 4LEOB 4MKMA 4NT6B 1CLZH 1UD2A 3ZW3A 2AGJH 5K1VA 3CSYB 1QSFA 5CEYA 1CICD 2AI0L 2JQAA 3QQXA 5C0CB 1WFTA 1JL8A 1XX9C 2F61A 1E6OL 1IIIA 1EEZB 3LN4A 5F1IB 3QFJE 2R69L 3KLSA 1FE8L 3CQFA 1R3IL 4PG9A 4CBZA 5K9KA 1SVZA 1AJ7H 2ZXEB 4YZWA 1J5HA 3HE7C 1XGUA 4AGMA 1HAWA 4CW1B 4JZOB 5HHPB 4AWJC 3FJTA 3BAIA 1SHXA 5HPOA 4O02A 1TZHA 4Z7UA 35C8L 4AUYA 3IJHA 4GI9A 4W6YB 4FFWC 2GW5A 5I5RA 1BVNT 4G7RB 2R56L 3UTTA 1T7XA 4WF7A 5AKTA 5FYJL 1QTSA 1FSKB 3KDPB 1T5XB 2HPOA 4F2EA 4NI3A 3MLPA 4AZ8A 5IKCB 2DEXX 2OYLA 2D7NA 1O6TA 3O9WC 1XL4A 3GMOB 4K2UH 2W9DH 2WBWB 3QCUL 4XBEL 4BEIA 4F7KA 4UTAH 4NZRL 2JCWA 4R4FH 5E7BA 2AEOA 2V2XB 4X7SL 4ELKB 4E36A 5JOPE 1KENL 1LP9E 4Z8FL 3F5WB 1B90A 2R2HB 4IU2A 3VI4E 3DTXA 4G8IB 3O3UN 2ODIA 1HL4A 2IPKB 1DDTA 1JWUB 1NKGA 2VR4A 4IKLA 1TSRA 5EB9A 3KL0A 3K4DA 2VMFA 1H8SA 3TV8A 3MUGB 1UVQA 5EC1B 3OLDA 3SJVA 1WC7A 4AK1A 3H42H 3VX1A 4Z9KB 4B5ZA 3QUXA 1QTPA 2VC2H 4QHMA 3X3GL 2DQMA 4TM9A 4H8HA 2QPFA 1IC5H 2H6UA 1E8YA 4CL7A 1CFMA 2HRPL 4QYAA 4XB7A 1KBWA 2WAHA 4JFPB 1RVFH 1H3UA 3DMMB 4TRPL 3NSDA 4QXVA 4XPAH 2YC1A 2EDKA 4LHUD 1U8KA 4WY7H 5KANI 1G0YR 1CT8B 5CKAA 4QTIL 2B3IA 2FX7H 2YAFA 5FFOA 5E1AB 4PS3A 1UKSA 4ONOA 3BFWA 4G1EA 2H6PA 4R90L 1AS7A 2GHWB 1AQHA 1YMMB 1RCYA 1NMBH 1B9KA 4MDIB 4Z7WA 5FW8A 4M3KB 1WITA 3DX3A 4FQLL 4E9YA 1XR8B 2J4WL 4LKCB 3V9EA 2G60H 3GSXA 1RZJH 4KI5C 3FAXA 4MMXC 1T89C 2AK1H 2O5YL 5BUGA 4P9HL 5HJDA 1A7OL 1CGYA 3KGRA 3TA3C 5F7LB 3M1BA 4XGZA 4EUPA 2F54B 1TLMA 2VLLA 1RZKC 3DGDA 3GTTA 3GXFA 3QXTA 4HCRL 4MSWB 1EO8H 3PHOA 1LGVA 4YIQB 5AB1A 1WIPA 4N90E 4OI8A 3G3LA 5JPNA 2R4SL 1S6NA 4AYBA 2BDNL 3GINA 1UYWH 2AQSA 3IB4A 2ZUWA 4RRPA 2A5UA 1T1ZB 2R9HD 1Z1WA 5I19L 3ATDA 2JCCA 5FM5O 3MBXH 2QQLL 3D08A 5IFHH 1UOWA 2XJLA 4HUUB 4LSSH 5LXGH 2XQYG 5I73C 3ILQD 4XWOD 2B4CL 5CJXA 3QORB 4D2NA 4IU3A 1PGRB 4X9BA 5AVUB 4AT6A 4BRJA 4GP5B 2JJTC 2EABA 2ZCHH 4P4KD 3D4GA 4LSUL 5AQ0A 3GI9L 3SKJL 4YJZL 1G9NC 4M9OA 2C3WA 1OP3H 1NL0L 2WLJA 5DUBB 3KH3A 3P0VH 4K71B 2DJUA 3TZVB 4X9FA 1ZT1B 5CM1A 1UUNA 2WCPA 3RE0A 1TZIB 3HUJE 2G3MA 4DW2H 1P1ZA 1WCBB 2Q7NA 5FLUA 2FEJA 3BIAX 4N0FB 3VFRA 2UZPA 1Z3RA 2JWYA 3FKUS 1Y1UA 4NUQA 4X4YA 2Y2WA 4G7SB 5F9JB 2WXMA 3IGAB 2J71A 3BEVB 1HILB 3N43B 3IFNH 1PKQB 2ZZUT 5FGCB 1A1NB 1MCRA 1R9FA 1IM9B 3GMPA 4WRLA 5JXEC 1H8OA 4MXQC 3UTQB 1KSRA 2CO4A 4CVUA 2VDRL 2CHZA 3QAZB 2N1TE 5F7EH 1YEKH 1K9TA 4LPXA 3OKYA 3U9UB 4P3CH 3AQXA 3M1OA 4QTHB 4FS0A 2UZXB 2DQEL 4I9WD 5CBEA 5FC9A 3WFCH 1QFOA 4JB9H 3GBMH 5EU4A 2CGRH 2GJ6D 4UYQA 4ZSOA 1YEJL 5M95B 3PRZA 4OU3A 5DJCA 5I0XA 1KIUA 4A6YA 4HCIA 4ZQTA 4JG1H 2WANA 5CZKA 1HCVA 4CMMB 1PY0A 3HR5A 1Q0EA 3VWKA 4XNBA 4EN2A 1IGFL 1KC5H 3QQNA 4MDJB 4IDJL 1A6VH 1GGUA 3G5WA 1Z0MA 2VDOL 1T3FB 4MJ4A 1F1GA 1OZUA 4OFYD 3QZOA 5AYQA 2ZP9A 5BS0B 2CLZB 1UJ3B 3H6JA 2VWEC 1ZGLA 4YNYA 1Z9SB 4JFDB 3UAAA 2CBOA 1J5OL 5E9DD 1MW3A 2DI7A 3C5SA 4DQOL 1BMZA 3CFBA 2A6JA 3B7TA 1A65A 4LOUC 1QSFB 5CEYB 4UB0L 4CC1A 1WWAX 3LN4B 3BMVA 4KDTC 4OTXL 4HFWA 4Y5XC 1QVOA 2CM6A 3NJJA 4PG9B 5K9KB 2A6KA 3PAUA 1F3DH 2HLEB 3TBTA 3VW3L 2PNDA 4U33A 1XGUB 2XWBA 4Z7NB 4QPEA 4KVCH 4O02B 4Z7UB 5KYXA 4EVNA 3IJHB 2JJSC 2ED9A 4PJXE 1THCA 3T3ME 1UZGA 1ZJAA 4QRAA 1EO5A 3UDWC 3FS9A 4HUWA 3W56A 5LDSA 1MCJA 2GEQA 4NC1E 5EU7E 5LBSL 3UTTB 2GI7A 1Z2KA 2PYEE 4AKQA 1D9KA 4OLZL 1YRKA 4I77H 4XNQA 1AI1L 3UJJH 2X3CA 3MKKA 2CHXA 2ZG3A 1KUMA 5IHUH 1O7DE 5DYOA 4AZ8B 5L4MA 3X1BA 1Y07A 4O5LL 3CDGA 5E6RB 1L5GA 2GYSA 1MQ8A 1KCWA 2LAGB 3JUYA 4QDGA 1W8OA 4XPFL 5IHHA 3WFBH 1SBBA 4AMXA 4AMWA 5TQ0H 3COOA 4IU2B 3DTXB 4UAOB 3QWNA 1TR7A 5EDXA 4PPTA 2JLPA 2K6YA 3NACL 4WO4C 3BGFC 1CE1L 7FABH 1DLFH 4LZKA 4TOYL 2BO0A 3N0PB 6PAZA 2YPLE 2ATAA 3MXWL 1J05A 3CAFA 1UVQB 3DRTA 4TUKL 4FXLA 1WC7B 3SJVB 2EINB 3VAEA 4LOFA 2L7EA 3QUXB 3M7FB 1ZLVK 4QHMB 4P59H 1MAKA 2AJXH 3MRCA 2ZP0T 2TSBA 4E0RA 2V33A 1BZQK 4KJWC 2DMHA 4PCKA 3RKDC 3MLUL 5HHME 2YC1B 2YN3A 3FRPG 1U8KB 5FHAL 3HMXA 2V9UA 4G6JL 3BUPA 1J87A 4G1EB 2EH7L 2H6PB 4URKA 5CAYB 2EIKB 2B5IB 3LS4H 1U8PA 3Q6FA 4Z7WB 4YSCA 3K1DA 2ENJA 2WJ5A 1KV7A 3VDCA 5E1QA 4BINA 2NY0B 3KYKL 3N1MC 4Z0BL 5CHNB 4Z7OB 5CU5A 5C0RH 5I1CL 3H85A 3NH7H 2YWYA 1Y1DA 3GSXB 4MNGE 2BERA 3QCTH 4X6BA 4AMKH 4NCC1 3EYVA 3NFSH 1YG9A 2XBDA 5AAMA 4LRIC 4K9EH 5GQBA 4UCFA 3M1BB 1RUKH 3FQWA 3IS1X 1N68A 4QJ3B 1XIWC 5C0BA 1MRFH 1YECL 1A5FH 2VLLB 3QUYC 3S3PA 3P9WB 3PHOB 4NN7C 3AXHA 4XMKH 5BZDA 1MAMH 4BWTA 1AO7A 3NSCA 4I89A 4YHKL 1QWNA 2P8PA 5JPNB 4FZ8L 1X6LA 3UL4A 3MROA 3IDGA 3LXUX 4GW1A 1A1OA 4G71B 1BEYL 1MN4A 2ZNWA 5KG9A 5K93A 2JCCB 3CBRA 4LKXA 4WCYL 3PABA 1I8UA 5C0DA 1VGKB 3QS2A 1K4CA 4WVRA 3UJTH 4DGVH 5L6YH 2FBJH 4FYSA 3ZT6A 5F9DC 1UQSA 5J5EA 2V9QA 4CSSA 3IT8D 5HYSG 3PL6A 3N55A 2MQ0A 2ZAHA 3DGCR 1F6AA 3HKZA 4L9DA 4TN9A 5ALBL 2PYFA 1XXDC 2V7NA 1HHJA 1TJMA 3O8XC 3JWNH 1P1ZB 1NBVH 3D2UA 3VFRB 3CQQA 4FG0A 4J1UA 1QLRA 4NPKA 4X4YB 4PJIE 3V6ZA 4MJ2A 2ZCLH 3LH9A 4FNRA 1MW1A 5CBAA 5DD3L 5AL8A 3P0YL 3D05A 1FNFA 3GMPB 5IWLC 5JW5A 1I8KB 2R1YA 4NCC2 1EFQA 4IBYA 4L5FE 1FAIH 3QI9C 2BPBA 1FNHA 4JLRA 4E2OA 3AMLA 4LSPH 5I1AA 3PGDB 2X3BA 4KTDL 4LVOC 2X1XR 2C1PA 5KTEL 5AKVA 5CBEB 2L04A 5EU4B 3CQPA 4ZSOB 3IFPA 2EILB 1IFGA 1BPLB 1KIUB 4XTRD 4DPRA 2OK0L 3L13A 4WI6A 5DRZA 1MI5D 1QUNA 3HI1A 4PJ7E 3HR5B 4OD1L 2HKHH 2OP4H 3IM1A 3VWKB 3ZE1F 4UOW1 1LO5A 2BJML 1MEXH 1XCQA 1MFUA 2YMXH 1MHPH 3CFCL 3F7KA 1VKXA 1SQMA 3HLKA 1QSZA 3R4RA 3LZOA 2VZ3A 1QEWA 3CSGA 4MB1A 3SN6N 3SY0A 3HA0A 1FH2A 4A2EA 4YNYB 1NIFA 3LD8C 4OZ4A 5DZ9A 1UGNA 2J1ZA 1JPST 1ZANL 4N8UA 3C5SB 4OR1A 3CFBB 2A6JB 3EYQC 4UT6H 1G9ML 2X2JA 3LY6A 2JIXD 1ODUA 3UP1A 1G1YA 3U4AA 5AVRB 4HFWB 5DF0A 1HN1A 1QVOB 4Z3TA 4PJCA 1IGCH 2A6KB 2ZWNA 5CINL 3NJNA 2NQDA 1A2YA 3FO1A 3TBTB 5T1KA 4Y16D 2XWBB 2HKAA 1XT5A 1QNZH 1DBJH 2G0LA 4HUCA 2OW6A 1PSKH 5KYXB 4EVNB 2XSKA 1ACYH 1BV8A 3H2WA 1WGOA 3NG5A 4LSRL 1CI3M 1RAMA 4JO8A 4HUWB 3KPRD 4OCSL 2PXYD 6CGTA 2I7SA 1AMYA 4KK5D 5LCVL 4XNQB 3HE6C 4Y4KD 4HBCL 4JANA 4NZUH 1J11A 5DYOB 4CAGA 1JVOA 4QRQA 3CDGB 4GRWE 1L5GB 1T4WA 2HVKA 2QJDA 5CSZB 4NQDD 5D1QE 4JR9H 1YDPA 1QASA 4UTBA 3REWA 4KZCA 4RMBA 1KB5H 4HUKB 5TF1L 2ARWA 4X98A 4XAWH 3FUNA 2J1KA 3D52A 4NERA 2MNUA 3ZRFC 1F4HA 2Y6SC 1IE4A 4KUCF 3SD5A 1J05B 3DRTB 4NENA 3D51A 1NANI 3CMOL 2Y5QA 4HPOL 5T1JA 2VZSA 4PLNC 1JCVA 4HSCX 4PG2C 3D50A 2XC8A 4TVPL 5CEZL 1J8HD 3MRCB 4OLVL 4BGLA 4E0RB 3RVWC 1KXVA 4RSVA 1OTSC 2R0WH 4G2AA 5IB2A 3TEZA 2XZQL 4P2OA 3W11D 5JHLL 4IRSA 4P57A 2BOCA 3WSQH 1B4LA 2B9AA 4V11A 1K6QH 2Q8BL 3MPCA 3VQMA 1U8PB 3Q6FB 2GAZB 3PWPA 3UPAA 3QYCA 5T5FA 5IEKA 1IAMA 4X6BB 1G87A 5FO2A 3I50H 3N1QC 2GY5A 2BP3A 3ULUD 2GVYA 3EYVB 4JY5H 1P84K 1YJDL 5TE4L 4E9WA 3UZVA 4LOVA 3I6GA 3OAUL 3FQWB 3FU6A 3S8GB 1EWHA 5C0BB 1F4XL 2BNQE 3E7JA 2PTTB 2OCFD 3IJEA 3EYFA 1DBBH 5BZDB 4AEIH 2DQGH 3OJ2C 1AO7B 3VUAA 5HI3D 1JYNA 1WJ3A 4MD0A 4ORZC 2P8PB 2WXRA 4JHWH 4LCWE 4QI3A 3MROB 4KO7A 4OGZA 2OMVA 3IDGB 2PP7A 4KMQA 3UPRA 4GW1B 1A1OB 4QJ5B 3KYAA 5KG9B 2B20A 5IVXA 3TT3H 1K3ZA 3M8OL 4GKLA 4LKXB 3PABB 5C0DB 1JV5A 3ISRA 2BFGA 2QQNH 5DEFA 1K4CB 1LO4H 1CFVH 5IQOA 2HFGH 2L7JA 4J6IA 3AY2A 4LSTL 4M7JH 4WFED 2IQ9L 3Q0HA 1UQSB 4JO4H 1D9KC 2VABA 2D3JA 4EEEA 3TV3L 3PL6B 1FO0H 3L7EB 5IVZA 1F6AB 4G6AD 4EIUA 2PYFB 3MLWH 4XN8A 3ZHFA 4F1SA 2APXA 2V7NB 1GYUA 3U2JA 3JQOB 1HC1A 1HHJB 4HSAC 3CVIL 3R18A 4HXAL 5CGYD 3D2UB 3HRZA 4J1UB 1QLRB 4NM8H 3SDAA 1WAAE 5KVFH 5EEYA 4M48L 3VI3A 4HIHB 3V6ZB 4ODBD 5F3BA 3HC4H 4Y2DC 4FABL 5CBAB 2OM5A 1SF5A 5D70L 1NC4A 3ZK0A 1D6VH 4S1DC 2HYMA 2IWGA 5FFGA 3DSFH 3CN1A 3MRRB 5JW5B 3WTUA 5JW4R 2X89D 3TVMA 2CALA 3EDDA 3RDTC 4FQ1H 1IKNA 3D0AA 4JLRB 2H41A 3BT0A 5JIPA 4H8VA 1F90L 3TF4A 5I1AB 2NZ9D 1P4IH 2C1PB 1DQLL 3O0RL 3GDBA 3MRLA 3IFPB 4RAHA 4HAFA 4N3UA 4P5TD 4LGRB 1UKQA 1L0YA 5CJ5A 5DRZB 2HLFD 4E5XA 1QUNB 3HI1B 2OKMA 2QL1A 4Z7VF 1XCQB 4N5ED 5BCAA 3L4VA 1KWGA 1VKXB 1NGPL 2XXMB 5BMFL 4TLTA 3CCHA 1NCCH 3L9YA 1YEGL 2WP3O 3IDNA 3QDME 4PJ9D 1QEWB 2PW2B 3FHEA 3WG7B 3SY0B 3QDJD 2BWIA 1U3HD 4IMKA 4OZ4B 4P99A 3WAKA 3ZU8A 2B9BA 4PLJC 3QZWA 9PCYA 1MW2A 1GS6X 2BS9A 1YPZF 3WTWA 2Z1KA 5JIKA 5I6OA 5CFAA 1J12A 2AQPA 4IRZA 4F33A 5K9QG 3CV5A 3IFLH 1XB3A 1RD6A 2PWFA 1HSBA 4ECNA 5I6LA 5SWZD 1SEQH 5L8JB 4N8PA 4TSCL 1CDUA 3X12A 4PJCB 2HT2C 3MRDA 1LXMA 2ZYIA 1A2YB 3FO1B 5K1JA 4ES8A 3IEAA 3UERA 5G5DA 3ZTJG 3WUZA 2NMSA 1U30A 4BFIA 3I9PA 2QADD 1MJUL 3QJSB 4LHUG 3QWRD 4KHTL 3GFUA 2GK2A 3UCRA 3MLXH 2Q5BA 3WJJC 1JTOA 4BXSV 4R7DA 2YAQA 4JANB 3ZDZB 4FA7B 3W38A 3I3BA 5GRVL 5D7IB 3QFDB 2VISA 1YNKH 5SX4H 1DN0A 4QRQB 4LAQH 4GAYA 5CZVH 1W2KT 2HVKB 5DO8A 3HN5A 4WW2A 1YDPB 3JBG7 2NY6B 3SSGA 1AACA 2NY7H 4OSUH 1A7NH 3P11H 5EU3A 3REWB 1TETL 2E59A 5T33L 3RX8A 1NCAH 5LJYH 3QFGA 1SDYA 4WO0A 4YXLH 4UNVA 3V79C 4S0HA 4I1RA 1WA1X 5B1JC 5HI4C 3ULVC 4KK8C 3T6ZA 2NT0A 1BGXH 4TULL 5BO0D 4LCCC 4FL4B 4LVHB 4Z23A 4N1HB 5I71B 5IBLD 4TMPA 1DSWA 3ZY7A 5H4ZA 2I60H 4UM8A 4UAHA 2W88A 1P7QB 1ZXKA 2BZCA 5FPIA 2VLKE 4OZGA 1PLBA 3ORJA 4X7TB 2A9MH 1L0XA 5IB2B 1J0IA 4L9LC 5T3XH 3EFOA 4P2OB 1Q90A 4IRSB 4KGLA 2BOCB 4P57B 4RQQA 5EOCJ 4LXFA 5CO1A 5F0LB 5F9AC 1YY8A 1QNIA 5D5MF 1I1YA 2F19L 2Z4QA 5LG1A 1LE9A 1PKOA 1QHPA 2DLGA 1BFOA 1A7RH 1PPIA 1DQKA 3PWPB 3N06B 1O7VA 3BN3B 4I9WE 4HCFA 2ZNXA 1XH0A 2WNKA 3HG5A 4FQJH 4XNUH 5I6XC 4ESKA 2GJ6E 1PZ2A 3CN3A 3EJJX 4N0UE 3PPEA 1MWAA 4Y9BA 5GRJH 5IV2A 4M1GH 1YNLH 4PH8A 5GZOC 3I6GB 3V0AC 2AV1A 3BVWA 2HCZX 4HJ1A 4TVSa 3HAEG 3SGEH 2G9HB 4FTVD 3IJEB 3EYFB 4RAUA 4ZXBD 4JUTA 1J86A 2XQYK 2XVBA 4MD0B 4XMVA 2AZUA 4X8JA 2AJYH 4U6HA 2OMVB 2XWCA 3UPRB 4X6CA 3VXSD 2EE3A 5IVXB 2ZKYA 4X8GA 3IJ9A 5E9DE 5HY9B 4TSAL 1NMCC 2AF2A 1JV5B 1KN2H 1NCDH 2NY1B 4XO8A 2YXMA 4NUGH 4XO9A 5DEFB 5GJSL 4M6OH 4B9JA 2WBJD 1P7BA 1F4WH 1OTTD 3NDZE 2Y72A 4WUUD 2NY3B 2EZ0D 3FN3A 3S97C 2VABB 5IK3A 3X13A 3ABZA 1SFDA 5JIIA 4U1GC 4N4YB 2XWZA 4R2GC 5IVZB 2MTAA 1VPOH 2EXWC 3K5RA 3WL9A 4FEMA 4XCEA 4BFBD 5KVEH 4HK3N 3GPEA 4OCYL 1C5DA 3BH4A 3HRZB 4AW7A 3SDAB 1T6WA 2NY5C 5CS7A 2ZUQC 5ADPH 4DO5A 1X4YA 1WT5A 3CDZA 3VI3B 2ZUUA 3FQTA 1B2WL 1F6FB 2M2DA 3LMJL 1R1CA 5EOCL 5TPWL 3WMQA 5F3BB 1IC0A 1DTUA 1T1YA 3SDDA 4U1NA 2QTEA 2H4EA 1I4FA 1BF8A 4P2RA 3IGUA 4U0QB 3G7TA 3GTVA 2E9GA 2OR7A 3RUGA 3TVMB 1TJHL 2A2QT 4YDKH 1KJ3H 1QSEA 2MPAL 4XNYH 1C9SA 1YYLH 4FYQA 5AG8A 4PB0L 2CR3A 2F1AA 2X88A 4KROC 4O02H 1EHLL 5TH2A 3R8BB 3MRLB 1DVSA 4X8XA 4A7GA 4X4XA 1XCTA 4NO0A 3DX1A 4LDEB 4E5XB 1S9YB 3GRGA 3BDBA 2ED7A 1Q4NX 1TTGA 4IW4C 5CZXC 2OJEA 5IB1A 3W2DH 1CI5A 2Y6TE 1UUSA 3AU1A 1BQLH 4FC3E 4ETQA 5JQIB 4G70B 2FX8H 1UWYA 2J88H 2ZYRA 3B56A 3CCHB 3SDXF 3RGVA 3CE1A 3IDNB 5MP6H 1P6WA 1ZLSH 2AQQA 1AQ8A 2CO6A 1FL6A 3QZWB 1FNAA 2VW4A 1JPGA 5BW7C 5E8OA 2WYHA 2WSDA 2FL5A 5T1LD 5DEGB 4JFQA 1USZA 1F1AA 4OIBA 2WZ0A 3B7UX 3BD4A 1H3PL 2X42A 2D9CA 5AVTB 3APNA 3EJYD 4BA0A 2XI9A 3NCEB 3L3JA 1HSBB 4J8QA 4HHWA 1S7VA 3X12B 5DZAA 1NFIB 3LKOA 1RIUH 3MRDB 4WEMB 4XX5A 5E2TH 2BP8A 2C26A 3X1GA 2EUZA 3VTMA 4JHUA 4LCIL 2C3GA 5G5DB 3WKNA 2VQUA 3FT9A 1JXGA 3C60C 1XMWA 3P3UA 4J2XA 3UACA 1EZVX 4XWGH 5BZZA 1N3NB 1Z9MA 1JE6A 3UO8B 1DVFD 1MQKH 2D03H 4Z76A 4GMTH 4XO4A 1K8DA 2BX5A 5IGXH 4HUVA 4R7DB 1B0WA 3OX8B 4TVUA 1RL1A 4J6RL 4ANVA 4XCNA 2E3VA 3SKMA 3SPHA 2VISB 4KFMA 1DN0B 1KPUA 3HNVH 4GAYB 2GBUA 1YC8A 4HIXH 4PVMA 2UZIH 4JHVA 4PJDE 2OZ4L 5T3ZL 4B0MM 5EU3B 4HGWA 4EUPH 4QXWA 3C5ZA 1UCBL 4OF7A 1L6PA 1N2RA 3LRHA 4R6UA 5E6UB 3U30C 2E4FA 3HB3B 2LTQC 1MW0A 3EDFA 2C34A 1VDGA 1S5IH 3FT3A 2BVTA 2UX6A 4TNVF 4PJEA 4YHZL 2CJ3A 3BJLA 3TT1L 1CLZL 4UM8B 3OC8A 3VSUA 4ODTH 5DMGC 5KS9A 4OZGB 2FR4A 4L4TD 1OP5K 3EOTH 1DJZA 1NDGA 3UBFA 4YFEA 5KSAD 4ZO9A 1L9QA 1HHKA 3EFOB 1D7DA 4RQQB 4DPCX 1M3JA 2HVBA 2PP9A 1YY8B 3T0EA 1I1YB 2Z4QB 3ZE0F 3RWFA 1LE9B 2CBTA 4OI7A 1AZVA 4OLEA 4GIPD 4PRHD 4OCXH 3FUIA 1BFOB 1JUFB 3QXDA 1AIZA 4NRZA 3KGSA 3NRQA 1P5VA 3BOVA 2AJ3A 2MNWA 1FVCA 1JK9A 1OAJA 4JQIA 1YLBB 4K94C 4Y2LA 5SWSA 3S6CA 2XVGA 4M3HA 3V2AR 5KAQG 3ZKNC 4B9CA 2BIIA 1F4YL 5IV2B 1MI5E 4MJ6A 4Z78A 2KZWA 2QHLA 2AV1B 1BXAA 2IO5A 2XA8H 3CUPA 3L3KA 1U95A 1Q0XL 2L3BA 4RAUB 2RHEA 1U8QA 2LVCA 5EZOH 2FEEL 5GGQH 2DQTH 2OZNA 2GIYA 2OBGA 3IFOA 4X8JB 3S3BB 3SY6A 4U6HB 5FF6A 3I84A 1JIBA 2FEDC 3RVVD 4XVUC 5F96H 4Z7UF 3ATFA 5E2UL 1WPCA 4OH2A 3FB5A 1LO0H 2VT0A 4X5XA 2VJ8A 1HQRB 4A6YH 4ZW7A 1NCUA 2XWDA 3ARPA 3VYPA 1J5CA 5I66A 5I0VA 3MCG1 4ZX6A 4ZMYA 4EDXA 3IN0A 5DZOA 3H42L 3FFCA 3X13B 1KGUA 1XGYL 4S1QL 1WBYA 2HT4D 2VC2L 2ZKXA 4LDOB 2ISDA 2F7QA 1JNHA 1T2JA 3QB7C 1BJ1H 2CO2A 1SXAA 2VN7A 3D4ZA 3WL9B 2FWLB 1C5DB 5I75B 3TNNA 3V52H 2WGNB 1DQDH 1LO3H 1EA9C 4BQ8A 3CDZB 4MCNA 4DKAA 2Y7LA 3EJRA 3KPRE 1HZLA 3ARDC 4PJ5E 1BWMA 1IBDA 1T1YB 3SDDB 3JV6A 4P2RB 5FKPA 3WS6A 3CHQA 1DQQA 3EADA 1XBDA 3RUGB 1UOVA 1MREH 2G60L 1QSEB 1UEMA 2X28A 4H0HB 5E24E 1OHQA 5E4EC 2VAAB 1J5IA 2XV6B 4N2LA 5HDQL 4XAKD 1UH4A 3V6BR 5TH2B 5EH1A 5GHWH 5ALCL 3WFDH 3QXAA 5DS1A 3CZJA 3E38A 4X4XB 1XCTB 4NO0B 3V4LA 3RVUD 5DJ6A 1IUZA 3V8OA 5IW6A 4Q9QL 4R4ND 2OR8A 4RFNC 5FW7A 4Z7WF 4MA7H 1UYWL 1CS6A 5HHNA 2OJEB 3BN9C 5IB1B 1UC6A 2BNRA 3AU1B 3MBXL 2QVFB 5HHVH 4ZUUB 1S7QA 3S5LG 4ETQB 3UGUA 4TTDD 4B9IA 3BESR 1K3IA 2BHZA 1WAEA 5F3HA 2ZE0A 5GRYA 5I18L 4B9PA 2AABL 2J1XA 2CO6B 2ZTBA 5I74C 5GGVH 4AQ8A 1FL6B 2AEPL 4B9YA 1JPGB 3NPSC 3U1QA 5E8OB 3TBSA 2ZCHL 2FL5B 1M56B 1AG0A 5BNXD 2F08A 2MOGA 4JFQB 4JM2A 4KV5E 2IAMA 3P0VL 3CZUB 1XGZA 2HX9A 3LQAL 1AHWA 3AQDA 3L3JB 3KD4A 3OLIA 5CP7A 3V6OC 1S7VB 4KZEH 3CU1A 3LKOB 4FMVA 3CN4A 2QPEB 4PREA 1Z9PA 4FFVC 1MCKA 4PCYA 5DD1H 3ULUE 4GUPA 3FU0A 1MY7A 1YC7A 3B1TA 3D39A 4J4PA 1JPTH 1O6SB 2DBLH 3U1PA 3HMXH 1KEMH 2V17L 4Y4HD 4Z76B 4R3SA 5F7EL 3FB8B 1YEKL 3C6SA 1EEQA 1K8DB 3F7VA 1JFQH 1OAYH 3TEWA 4P5KA 2APFA 1XV8A 2P80D 4HUVB 2G0KA 1P6FA 2F0CA 1CXIA 2YUVA 3B9EA 3SKMB 1O6VA 3WFCL 3B43A 3WDHA 5KEZA 3PYCA 2CGRL 1KPUB 3UIYA 4IIQA 1AP2A 2XG4A 3S9DB 2A74C 3I9IA 3HPLA 2N0KA 4PRPD 4JG1L 3ZT5A 1ZHKA 5DFAA 2G4EA 4QRPD 1J1XL 4MAUL 4WFEE 1ZOXA 3AUWB 4HGWB 5AOIA 1ANUA 3C5ZB 2QFPA 1N2RB 1OT2A 2ILLA 1A6VL 2FJFA 3ARRA 3HIZA 1Q94A 4RZKA 3TJEH 3FT3B 1H19A 1U21A 1EBAA 4PJEB 2YS4A 3PQYD 2ZKMX 1PS3A 1I31A 4W9KC 4CMHC 1GJWA 2VXSH 1MCIA 4CC4A 1ZT4B 5IJDC 4PQXA 5KS9B 3O6MH 3OMIB 3Q8FA 2FR4B 1TQBB 3SE6A 6FABH 1AKJD 1JMZA 5F1KC 2DYSB 3A4AA 4MAZA 4JDVA 4OCMC 1HHKB 2WXNA 5D2LA 5GGTA 4DEUA 4LLAA 1VADA 2B1HH 1DE4A 3E8VA 3CXDH 3T0EB 3WIAA 4ELME 3RWFB 5GZNC 1KGIA 4IOFD 1WO2A 2V8LA 4M5ZH 5D6CA 5B1KA 3QXDB 3RGVC 4NRZB 1QLEB 4KVCL 1P5VB 2YEQA 4XNZB 4Q9BA 4WSGA 1VCBC 4NQSA 2X1QA 2AJ3B 4KOCA 1FVCB 1JK9B 3MACL 5SWSB 1CGSH 3IJYA 1FNSH 5BVJA 3QJUB 1UD5A 2Y07L 5DK0B 5H2BA 4RISL 3NJVA 4MJ6B 3UJJL 3NJMA 4Z78B 1L9PA 3CUPB 3L3KB 4F9PC 2EIEA 5A2AA 1U95B 1A0QH 2OL3B 4C55A 3NCYP 1U8QB 1T0OA 5L8LB 3IFOB 2G3ZA 5FF6B 4UANA 5EMYA 1UXMA 3QDJE 4JKMA 5ICYA 1YCSA 3WFBL 3I2CL 2WXOA 4NP9A 2XFXA 5TQ0L 4LFHG 3F85A 3FB5B 5E2WL 1JZEA 1X5FA 1NCHA 3DDFA 4QHKI 2EDTA 1H3VA 1TXKA 4M93C 4OJCA 4HJSA 2LU4A 1SBSH 4ZODA 1L9OA 7FABL 5I66B 1DLFL 4QXUL 4AVKA 4ODSL 4A04A 4P04A 3DTDA 4EDXB 4YSPA 2NUPA 5E7FA 3FFCB 4AIXA 5SX5K 3CBJB 5ITFA 1WBYB 3BVUA 2VW7A 1PFOA 3ARFC 4P59L 1AXTL 3V4UH 1QR1A 5IY5B 2IANA 4IHBA 2MOQA 2UVFA 4PJHE 3MRBA 3ZDXB 4ES9A 1JVKA 4WEBH 3KS0J 3TNNB 1QATA 1KPVA 2XT1B 3TYFA 2EO1A 1RZ7H 5K69A 3HNTL 4AEEA 4TTGA 1T7VA 4MB4A 2HKFL 4DNLA 3FQXA 5KSBA 3SDYH 3B9KD 1CFSA 3LN5A 3JV6B 5FKPB 4PTTA 5KYUA 2G9KA 4GP8B 1DQQB 5E6IC 1N5AA 4ZMOA 5D1XE 3EXJA 2ZXWB 4R26L 1ZA6A 1V7ML 5AW1B 3BYYA 3AB0C 3HMWL 4JN1H 4HLEA 4RVBA 4MXWH 3NABL 1XVSA 1RUKL 1W8EA 3ABLB 3QXAB 1U8CA 5HD8D 2X9YA 1NDTA 4XNAA 4EN3D 5AW9B 5DJ6B 2C9AA 3QG7H 5IW6B 3CZNA 1JNLL 3SDCB 2QEJA 1CBJA 3HBQA 1BEXA 5HHNB 3NZHH 1G7MA 3CX5J 2ED8A 4F2ME 4K8RC 2YQBA 2BNRB 3DO4A 2AANA 3GEFA 4JRFA 1S7QB 1N6QL 1RQ5A 1URIA 4KXCA 1GCFA 5F3HB 3UJTL 2FDBP 2CKBL 5KYYA 1TTFA 1E0OB 3MV8A 4MBOA 4X2UA 1EJFA 2KZBA 5L6YL 1G9EA 4K3EL 3GO1H 3TBSB 1Z5LA 4BFOA 4UTBH 3P54A 4M29A 4OIIH 4KK9D 2EH8L 4M8UA 4C83A 5LXVA 4ZOEA 1V3KA 1R3LA 4JM2B 4BSJA 2IAMB 5LQBH 4XMTA 1E9PA 2EE6A 3GJFK 2AVFA 1OK0A 2XWRA 4Z6AT 4GXVH 1KN4L 2J8HA 2PTUA 3SE9H 3TP4A 1AHWB 3FSAA 5B4MD 5A6IA 2NX5E 5CP7B 4YFLF 4MB3A 4M43H 1NBVL 5D4QA 1BFVH 4PREB 5BRQA 3O2VL 2L0DA 1QP1A 1SDAB 2ZCLL 2PO6A 4GUPB 5MEOB 3KE0A 1DVXA 3D39B 1GIGL 4NAJA 1N0XH 4BGDA 1OD7A 1TU2A 2CJSA 2DICA 4L3ED 4RBPK 4FTVE 2ZSWB 1HZKA 3U9WA 3F7VB 1FAIL 2P5EA 1OARH 3WMSA 4P5KB 3H9ZA 5HJGA 4BFEA 1JGEA 4X5QA 1R0AH 3VXSE 4MNQD 2O30A 4YDZA 2LU7A 4QOKE 5CN2A 5D7SH 1CMOA 4IIQB 5HI5C 2XG4B 2VDKH 4YZFF 5E8DH 3DO3A 5K9QI 2YZ8A 3HPLB 1DEEA 1RSFA 5EU7C 2XWTA 2ESVD 1ZHKB 2CM5A 4WUUE 2VUOA 1F11B 1MEXL 3PWNA 4R84A 4OFPA 4HVBA 2FJFB 2GB2A 1O7DC 1UG9A 1ZV5A 2DRUA 1T83C 1GMEA 3SYOA 5JW3L 4YSSA 1PZSA 1OXYA 1WZAA 3I6LE 4DJMA 1Q94B 4L0ZA 4MWFA 5FLVA 2CKNA 4C4KT 3ECUA 3OAYH 5H4YA 4YEEA 2DAVA 4AL8H 3CGTA 2YD6A 4JPIA 5C71A 5K9OA 3N41F 4XXCA 2VDML 3DVFA 2VR9A 3N42B 1NPJA 2Q1EA 4JDVB 5D9SA 5D2LB 3MGTA 2WQRA 1VADB 1AY1H 4HUNB 1IC7H 1DE4B 4IIZA 3VVWA 4OB5H 3C2SA 5DZPA 3RY5A 5D6CB 5T1MA 5AAWA 1MIMH 4MJ5A 2A0LC 3CFJA 3VMOA 4DESA 1JGLL 3IDYC 4Z5RA 5D6DA 1PSKL 1KYOJ 1PBYA 4C47A 4NQSB 2H1LM 3W57A 2K45A 5HDBB 4OD2A 5EUOA 4R97C 5DZLA 3L3OA 3IJYB 2BW5A 3EYOA 5BVJB 4NWUH 4HKZA 1P1VA 5H2BB 5CP3A 3SPVA 2NR6C 4GNKB 1HCYA 4ZOBA 2OS7A 1A7PH 1DYZA 1AOZA 2E7MA 4JQXA 4P48A 2B14A 3DVIA 2NY4C 3FTZA 2WBKA 3HI6H 3ATEA 5DVPA 3S37X 1SHWA 3EDEA 5JIQA 1R3HA 3U2SA 3U0PA 1HHIA 5DFWH 4GMSL 4JR9L 5JPMB 1U8OA 4AEHL 1HOCB 5ICYB 3KPMA 1FG9C 2XFXB 4K7FA 1WZMA 3EO1A 3PWVA 3GZOA 4QRFA 3SQOH 4E41A 3RWGA 1PG7H 1ERNA 3O6FC 1AR1D 1FYHB 2AAAA 3ZDZF 1FRGH 3IS0X 3U1SH 5D7IF 5DMIH 1GYCA 3JTSA 5ITFB 4IBQA 2ZCZA 2DIAA 4BFFA 4NO5A 3CVHB 1ZHLB 2AQTA 2H2PD 4YSOA 3BFQG 4DEPB 1QR1B 2IANB 3LZRA 4ZTPH 1VESA 5C07A 3VM7A 3EAKA 3IDXL 5I6MA 4JKPH 3HHSA 3OB0K 3CXHK 1E40A 5CJOL 5INCA 5L2KD 2WXPA 2FNBA 1KPVB 2YRLA 4M7KH 3J8F7 3TYFB 4QHUA 2E7BA 5EA0L 5KSBB 4IRZH 2RIKA 1K6QL 3DHMA 3A23A 1BIHA 1CFSB 3LN5B 1BAWA 1N4XH 1LEKA 4OQTL 4EZJA 2O72A 4PTTB 5KYUB 3WFEL 3QYMA 1N5AB 2CRIA 2ETWA 3PP4L 2HG0A 2IFFL 4PJBE 3DXAD 4QRBA 3I50L 4H0GA 4LBEA 4KQ4L 3ZO9A 4JY5L 4YSAA 3N85L 2HTLD 3LB6D 4PWFA 2E6PA 2V7HA 1JDDA 3GBEA 4KTEH 3ZDWA 4B7IA 1U8CB 2NXZD 1T7ZA 4AEIL 2DQGL 3QPKA 3GK8H 2VLRE 3LCYA 4NZDA 1RFDL 4JHWL 3U83A 3K0WA 2GTQA 2ZIDA 3D5OF 1G7MB 4XR8C 1E28B 2FBRA 2RR3A 3ZYJA 5ESVB 3QJVB 4Z0XA 3TT3L 5IHLB 3ZT7A 4H8WC 1CFTA 2VRQA 4KXBA 2QQNL 3DJSA 3ZSSA 3T2OA 1CFVL 4O4YH 5KYYB 4R5TA 3MV8B 5MEND 3RZCD 4L4TE 4KK6D 1GL4B 1Z5LB 2CGYA 3FO2A 4LVOB 3WKML 4C83B 3KPSD 1MFNA 2G2RA 2RB8A 3E6FA 1G94A 1PZBA 1R3LB 3NGBB 1E9PB 4G11A 2F18A 2F8XC 3MLWL 4DO6A 3S8FB 1WICA 4PRHE 5E8NA 3RX5A 1E4XL 2GCYA 4X7CC 2XV2A 3R1GH 4H88L 1IBYA 3QUZC 4TLSA 1BFTA 3KWWB 3JVGA 4AYDC 4FQXD 4NM8L 5ENWA 3L5WA 2R2BA 4AGNA 3BFOA 2OMTA 4F15C 1JZIA 1ZLUK 2YGOA 2PO6B 2R27A 2XTJC 3N1GC 4BQBA 2VXVH 4AV4A 1JYXA 1FCCA 3IDIA 3NYKA 3VD0A 1RZKL 1D6VL 3GS7A 2R0KH 1GAFH 3LZPA 2QVTA 3DSFL 5C0CD 3IETA 1THAA 1BD2E 2GJJA 3MODL 4X80H 2F1BA 1CR9H 4FQ1L 4G6ML 1SNRA 4YXHH 2F5AH 2P5EB 4ZMXA 3OGCA 1CGWA 1F45A 2KERA 2JI1A 1JGEB 1P4IL 3BLPX 3MAWA 1JZ5A 1UD4A 2N01B 3IKCA 1YEEL 3VI3F 3GD1C 4M6MH 5DI8A 4OVUA 2FATH 2P45B 1D5XA 4OGXH 4YBLB 3SE3A 2ICEA 3SKNA 1DEEB 4FCHA 1K5NA 5HTSA 3UH8A 5EIIG 2XWTB 1MWAH 3L4CA 3NDYE 1L3NA 4APQC 2EDRA 4KO9A 1G9NL 5EEVA 4YLQT 3OWRA 1WFMA 2H26A 3GRWA 1G7PA 3PWNB 1GY1A 1MPAH 3ETTA 3JV0A 2AAVA 4U6TA 3QO1A 3FL7A 1GC1H 1LL1A 3TNMA 2VN3A 4MWFB 3MJ8A 1E3XA 1OB1A 5H94A 1H3TA 3ABKB 2OJ1A 1TZGL 5D1QC 4YR6A 4PJFB 1DZBA 3ZUNC 3WS3A 2QHRH 4NO3A 2UXFA 4JPIB 5DS2A 4F1ZA 5K9OB 2QGCA 2QSTA 3C08H 3ULSA 3KS0H 4JHZA 5D1ZA 5CGMA 3TJPA 5J11C 2F15A 2DDQH 4JRYB 5D9SB 1SEQL 2BWDA 2QSQA 3MGTB 3QUKA 5T1MB 2IPTL 3BQUB 4MJ5B 4DCQA 4J3VA 4XAKE 4Z5RB 1NBYA 1YEWA 5C08A 3V10A 4BDVA 3FCTA 3BSHA 3NJGA 3VA6A 4OD2B 4CRPA 3IAQA 1DVYA 3L3OB 3HPJA 1ORQA 3EYOB 4JFTA 4EO5A 3PDOA 4HKZB 3DMMD 2VXTH 1TITA 1V3JA 3MLXL 3SPVB 2O5XL 5FEBA 4PY7A 4KJYB 4LT7A 1NFDE 3RFZC 1EXHA 3VDAA 2EIZA 1AE6H 4NPJA 1YMMD 2Y7NA 3JZ7A 5E8EA 4EKJA 4ALAC 1L9MA 4LAQL 5AOMA 4G8AC 5DHDA 5CMAA 3B9VA 1HHIB 3U2SB 4HV8A 5DJ8A 1RZIA 4HWUA 1U8OB 1Q72L 4J3TA 1UM6H 3P11L 3KPMB 4P46B 4UQBA 4N2FA 4K7FB 3BIKA 1NCAL 3MLZH 1PAMA 3EO1B 3PWVB 4X6DE 4Z7IA 3NMEA 4CSTA 4E41B 3RWGB 4DAGH 2F54D 3LNFA 4F7CA 2DLFL 1WZKA 2ENPA 4QNPF 1BGXL 2HXAA 1RIHH 4RFOH 3JTSB 5HDWA 1JS4A 2I60L 3W5MA 4NO5B 4Q9RL 4HIJA 1JZHA 5C07B 3BT2H 4XBGA 1CICC 4PBXA 3HHSB 5DJYA 1N19A 5AYUH 1WWWX 1K5WA 1PTZA 4OUOA 1TJIL 1DDHA 3TH4T 3POHA 3QORD 2JB5L 5DA0B 3EGDA 4HZAA 5MHSD 3E6HA 2WLKA 5T3XD 1L3WA 3FULA 5EORH 3W0WE 1LEKB 1AGDA 3FUMA 3NIFB 4LB8A 1QTYT 1UOKA 3TZVD 3JWDC 4Z7QE 3VD1A 4XNUL 5GRUH 1JWSA 5ETUB 1S7RA 3F65A 1SXNA 3GIZL 4LBEB 4OZGF 5CLYA 1V7NH 2F7PA 3I9GH 3FUKA 4M1GL 3RU8L 4WHYH 5I1IH 1AH1A 2V7HB 3H3KA 2XN2A 4LGPB 2IALB 2FIKA 2BY1A 5HJBA 1P6AB 3F01A 1TO4A 1ZSDA 3OZ9L 4J28A 4URTB 4A67A 5I9QC 3FK3A 1IM9D 2QELA 2AJYL 3WJLA 1KBKA 4HWNA 3RWEA 2WN3A 1TIUA 2FGZA 3NTCH 4L3AA 1A6UH 3PQYE 4Z0XB 3MA9L 4KZDL 1CFTB 1JRHH 1NCDL 3EZ8A 4NUGL 2Y7QA 1ZSHA 4AQAA 3VXME 1F4WL 5C9JB 1OGSA 3NZ8B 2VLJA 4B9FA 3D12B 1F58H 4K23H 1EFXA 4OZHE 4XP1L 3FO2B 5DJ0A 5DGQA 5FUOH 3ZO0A 4EI5B 2W65A 2VSCA 2QGBA 2BIOA 3ECBA 4MD4A 4U6YA 1ZLWK 3WGUB 2G2RB 4LNVA 3E6FB 1R3KA 3VA2C 3FUJA 3Q8AA 3H1ZA 2PABA 3BSZA 4XP6H 5DD0H 2HFEA 4WGWB 4AEFA 5E8NB 4TSBH 2GCYB 3X14A 4QY8A 4JDTH 2GUOA 4I0PA 5DRWA 5B39G 5BS0D 2WO2B 5ENWB 2R2BB 4OJEH 1TNMA 4W9JC 1Q0YH 4JFDD 1OTUD 1TQUA 2OMTB 4POYA 4BUGA 5D7KD 2VZTA 3IDIB 1A4CA 4HS8H 4D0BA 1BX2A 4OCWH 1QSFD 5ABZA 2ZOKA 3T3PF 1A9VA 3IETB 1A6TA 1V3MA 3VM5A 1L6ZA 3IJ7A 1C8QA 4YDKL 3VG9C 1KJ3L 2A99A 6PCYA 4XNYL 3UP6A 4TLKA 3OGCB 1YYLL 4LVNC 1E2ZA 1QLEH 1IARB 3V6FA 4NO2A 1UB5A 3IKCB 1F56A 1U3NA 2WYIA 4JQIH 5DI8B 3SKUD 3TCTA 2R2EA 3EOYG 3PUCA 1D5XB 2ICEB 3SKNB 2IMNA 5IBUB 1K5NB 5BUPA 1DSFL 3CWGA 1INQA 3I3DA 3O2DL 3O6LL 4OI9A 5TQ2L 1EANA 4B6ZA 3W2DL 2H26B 1G7PB 3UTTD 5GS1A 1EGJA 4OD3L 1HH9A 2R9HC 2J88L 2A9NL 3QO1B 4EF3A 5AZEL 4NGHH 3TNMB 5MP6L 3MJ8B 1ZLSL 4GLRH 1OB1B 1BZ7A 2P24A 4ZPTA 5H94B 5IR1A 3ILQC 1C5CH 4XWOC 3S3SA 4YR6B 3T2LA 3WS3B 4P4KC 3BPLB 4JN2B 1N6VA 2B4CC 5CR1A 3CN2A 3IU3A 1A4BA 4XPGL 2VAJA 5D1ZB 4Y4KA 1OAXH 4NNXA 1KBGH 1HE8A 4XNDA 5F2FA 1B0GA 1A3LH 5CSBA 3VWJA 2Z8SA 3FN0H 1MHHA 3QUKB 1E43A 1SY6A 4ZQKA 3SJVD 1QPXA 4Z95H 1JMXA 4DCQB 3QUXD 1OLZA 1NBYB 4L29A 4BDVB 3WO3B 3TH3T 1ULVA 1U41A 3FCTB 4YPJA 5JOEA 1KJ2A 3ZKQD 1E6JH 1NAML 3DV6A 4ZTEA 1ORQB 1MQKL 3PDOB 1HNYA 1X44A 4OUUA 3ULAB 5J1AB 2DL9A 4KAQH 4PY7B 3IGFA 4KI1A 1QFUH 1SUHA 1ZE3C 2QGDA 2EIZB 4HFUL 1RJLA 5E5MA 4NRXA 2NXYB 5E8EB 3HNVL 3JVGC 1W16A 5CMAB 3B8YA 3H3PH 1DO6A 4HV8B 5DJ8B 1RZIB 2GUYA 2NY0D 4BH7A 3BKMH 3ETBF 2IDCA 3KJ6H 3MJ7A 4XNMA 4X0NA 5IB3A 3BIKB 1UXSA 3RIFK 3UMTA 1BM3H 2NCMA 3EDJA 4BWUA 3VFOA 5KSUA 1EXGA 1IFHL 3BVVA 4F7CB 2MFNA 1Z9OA 4RA3A 1HXMA 2NT1A 5IEHA 2A83A 2DQHH 4HIJB 5E08H 5HDLA 3JWNE 3QWQB 1A6WH 4ODTL 5SWQA 2B7DT 2AXWA 4XBGB 4OY9A 1LK2A 2LLGA 1GYWA 1RXLA 3EOTL 4NQXA 5DJYB 2Z91A 3G5ZA 1J48A 1B4RA 1IGMH 2BNUA 1DDHB 5ACMA 3NSXA 4YSUA 1RPUA 4L3EE 4KKLD 4ZD3H 3EGDB 4DN4H 3E6HB 4DVBB 2G5UA 1F0LA 3RL2A 2X5PA 3QH3A 5DMJB 4CVWA 1AGDB 1ES0A 2AXHA 1SQ2N 4P4RA 1LJMA 3PREA 4MNQE 5DVMA 1J9SA 4BK4A 2DV6A 1QAWA 4KJQD 1JWSB 4Q56A 2J8UE 4Y1AA 4M7ZC 2Q20A 4POZD 2OPCA 3JWNG 1VCAA 3PWUA 5C7XL 2DQUH 2C4FT 3NQKA 1BMWA 3D7PA 1NICA 4ZJ9A 1ZSDB 4DT2A 3B8SA 2ZUQB 5E94A 3ZJAA 5TE7L 5KVGH 3D85A 4NFCA 4V2CB 5GRVK 3M17A 5CF3A 3KBHE 5BV7C 1Z3GH 2B39A 2EAEA 4JDZA 3NUKA 3U46A 2OTUA 4POUB 1IGIH 2AV7B 1RUML 4I18C 4I88A 2LU3A 4PCSA 2Y7QB 4HS6A 1SEBA 1M1XA 4A6YL 3V0WL 4IBZA 4ZFZA 2VLJB 4G8GA 4L1HA 3K3QA 1X7QA 1EFXB 1JNNH 4JE0A 5DJ0B 2E6QA 2W65B 3ECBB 4MD4B 4QGTA 3ZE2B 4U6YB 3ZDYF 1UH3A 2JMRA 1GGTA 3FCBA 5DD5L 2B15A 1J0JA 2DLIA 4Y9GA 3Q05A 3VWKD 4CU6A 2W0KA 2WC7A 5LGYA 2HFEB 3X1NA 4PW3A 3NCWA 5JNYA 2F6AA 3X14B 3CZGA 4QY8B 3ALXA 2GUOB 4I0PB 4MASA 3V52L 4KKPA 4ONGL 1X5KA 4PJGF 4DGIL 2CU9A 4FP8H 5FECA 3BDYL 4D0BB 3QEUA 1A9BA 2FQDA 2ZOKB 4AIOA 4WSKA 4NKDA 5GGTH 1A6TB 2D7QA 4YSTA 1SF3A 2F5BL 1MRCL 3CFEA 3CFIC 1WHPA 4ZOCA 5FR3A 1T0PB 2NDGA 1GYVA 1GOGA 3ZDXF 2MCPH 5L0QB 4EQ3A 4Z7VE 2E9IA 2MKLC 4HJ0D 4NO2B 4PJAA 3WFDL 1UB5B 4NDMA 4HWZA 5GXBB 2C3HA 2R2EB 4LQFH 1QLFA 1I8LC 1G5AA 1X5AA 1INQB 1BVNP 1RLWA 5I1EH 5JQHC 1L4IA 2Z7UA 3QR2A 4U1SA 5GS1B 3P3SA 3RPBA 1BZ9A 1HH9B 3EJZD 3THMH 2AZAA 4WV1C 2J6WA 2EDNA 4NP4H 4QWWD 2OSXA 1MFMA 4C57C 4FLSA 3UYPA 4ZPTB 3TBWA 1BZ7B 2P24B 5IR1B 4BHUI 2DWEA 3O4OC 2YD5A 4KDWA 4ONHA 5L2KE 1TFHA 5GGRY 4LSQH 2E27L 5HSFA 3B7RL 4J3OH 1UT1A 3QWRA 4Y7OC 2X9ZA 3RI5F 5L4JA 5TFSH 1HNGA 3IU3B 4FULA 4KX9A 4ZFQA 3VXRA 2OR9H 4NNXB 5DQDL 3WNMA 5IBTH 3RNQA 1B0GB 3UZEC 4KZEL 3BZ4B 3VWJB 2O6CA 1FFOA 3LKNA 4XNXH 4ANXA 3DXAE 1EJOH 1MHHB 4Y89A 2MQ3A 1X7SA 4ZQKB 2Y2YA 1QFWH 4YVNA 1AMXA 3NCFB 1JPTL 1XGTB 4L29B 5CCKH 3CVDA 4DH2A 3TH2T 1KJ2B 5AVWB 3T0VA 1WBZA 4JM2F 1CD0A 1KEML 3DV6B 5EOQH 3Q13A 2MPVA 4HWBA 5F8RC 4YLCA 2E4TA 1IGYA 4JGUA 2JKIS 1OAYL 1TFPA 2YLHA 1T5WA 2YBRA 2ZXCA 1E9OA 5LGHH 1XSJA 4FQIH 3BUDA 2QLYA 3RGHA 4OGAD 2VMCA 1RJLB 5E5MB 4NRXB 3UTSE 2VXQA 5DWUH 1EHNA 1A3RH 1S46A 3DYOA 4WJG3 4IKJA 2WQWA 1I9EA 2E6JA 4BH7B 3AT8A 3FF8A 4XTRC 5MENE 3MBEA 5GJTL 4XNMB 3MJ7B 5BJTA 3C12A 2AS5M 4BKSC 5IB3B 2Z0BA 3CHPA 1UXSB 4QXGL 4WDIA 4ZFFA 3KPSE 5LAPA 2UZYA 15C8H 2F8IA 3VFOB 2QGEA 5KSUB 1Z9NA 3ZBMA 4YDLB 5C0BD 2A9DA 2CHDA 4EZMA 2EDMA 1M42A 1AO7D 3C6LA 1HXMB 1JZGA 5ANMA 5IEHB 1EPFA 2A83B 1OLLA 4U1KB 3FN9A 4JQVA 5ESQA 3K8KA 2ED6A 5KJRL 2W92A 4G82A 2D7PA 1LK2B 4NQXB 4YK4B 5KOMC 3E2HB 5KVFE 2Z91B 2E5EA 3K5SA 2UWEA 1J1PL 5L8KB 2BNUB 5H8DA 3US0A 4D9RD 1R46A 2ATPA 4NQCB 4LCYA 3ZRSA 4FHBD 3UEZA 2ZX7A 4UQ2A 5I1IL 1ICTA 1W72L 3RL2B 1UACH 3QH3B 4Y16C 1UASA 1ZXQA 3PL6D 4TS6A 5KBDA 4P4RB 5F6IC 1YNTF 1RKRA 4YHLL 3QPXH 4EQ2A 2B0SH 2Q3ZA 1MJ8L 4Y1AB 4OCRL 2Y1ZA 4LO9A 3D2UD 3PWUB 2PXYC 3OHMB 4KK5C 3A67H 4KZ0A 4DTGL 1IEHA 4F91B 5D2LF 4ICXA 1Y6MR 2DTSA 2OMUA 2WZPA 4XI5D 2AQ3A 3LIUA 1P5UC 2WUCH 5E94B 3UC0H 3V4PA 3ULVL 1K72A 3FTXA 2EDOA 3D85B 2NSXA 1VEOA 5EIQA 3M17B 3RBSA 3SO5A 4JDZB 5HDBF 4BM7A 3U46B 2OTUB 4LU5H 5I0DA 2WQVA 5J12B 2F74A 3KPTA 1MVUA 2W9EL 5D8JH 1PZCA 3PFUA 1FL5A 1SEBB 3GSNB 4HS6B 1BF5A 3X11A 1M1XB 2KI6A 4HKBA 2DL2A 4ZFZB 2FYVA 4G8GB 4A2DA 1EUUA 1X7QB 1XL6A 4LBAA 4KXDA 1NWPA 2VKWA 3T2QA 1A3QA 3IU4H 4PTUA 1QZNA 3V4UL 1JZDC 3X2QB 2UUDH 5JNYB 4KX8A 3DLQR 2FIRT 4WEBL 4B53A 3DROA 3S36H 4DF9A 5D7JA 2NTSP 3IVKA 1FF5A 2X6AA 4J3OF 4WU7A 1VFOA 5DRNB 3W11C 1YN6A 4LQ1A 4JM0A 3SDYL 5FECB 3TL5A 3DSNA 3KVQA 3NP4A 4PAZA 4YC2C 5I28A 3QEUB 5DGRA 1A9BB 1JHTA 4W9LC 4JZJC 3L4ZA 4JVPA 4NKDB 1YMME 3Q8EA 4EJ1C 4NN5B 3CFEB 3D33A 4AQ1A 4KKZA 1AOHA 4JN1L 3ULUC 3GTNA 1KFGA 3IBEA 1FZMA 1S4IA 2IGTA 3VJ6A 4PJAB 2VIRA 3QS3A 1RU9L 4NDMB 1TT6A 4MA1C 1F8TH 4HWZB 3K2IA 2HVJA 1MF2H 3ZXAC 1QLFB 4MA3A 1N10A 2VDNB 5CP3H 5HI3C 2F54E 2P44B 1M1SA 4U1SB 1IRAY 3BISA 1BZ9B 1EBPA 4APXA 1J5DA 1E4WH 5F7MC 1AHKA 2DWTA 2IH3A 2OMXB 5KW9L 3UYPB 3ZKXB 3TBWB 3PAZA 4ZO7A 2DWEB 2JJWA 5A16A 3NIDF 4DOHB 5FO9A 2NY5L 2LV4A 3KCWA 1S7TA 1T6BX 4ONHB 4OIIL 2AP2A 3BUIA 4MS8D 3GSUA 1TVHA 1D5RA 4F5CE 3AG3B 2NY6D 4WGKA 5ILTH 2PPEA 4I48A 1DQJA 2WY3B 5MHSE 5IB5A 5T3XE 2EDHA 4GXVL 4G6AC 4NHCH 4WKZA 3NPZB 3VXRB 1CU4H 3KBEA 3UJIH 1GKOA 4UM9A 1AC0A 3RNQB 1MHEA 1FFOB 1UZ6E 3LKNB 1X3DA 4NWTH 3CDYA 2LHAA 4HC1A 5CGYC 3AREA 4LPYA 1LNUA 1DQMH 4P3WA 1OOWA 2ZUVA 2MWCA 3VMNA 2JNZA 2WAQA 3LV3A 4L8SC 4FA6A 1I3GL 2GIXA 1RPKA 3AG4B 1P7QD 5HHXL 3T0AA 5A7BA 2KL6A 1WBZB 2Q6WA 4M03A 4E9VA 4YHYB 3MN8A 1IGYB 1PKQE 1T5WB 2YBRB 1E9OB 4P2OD 3VGAC 3MLVH 4IRSD 3AXLA 3RA7H 4OFQA 1ZVSA 5FFLA 4GT7A 1NFAA 3WE1A 2NZ9C 3TXAA 2RJMA 3QPQD 5D7SL 2YPLA 2VDKL 4LGSB 4BA8A 2XYBA 3PWPD 4R83A 3ZTDC 4F93B 3H0TA 4HQQL 4P5TC 4TUJB 3MBEB 1QKZL 2HLFC 5BJTB 5D96C 3LSOA 4O2FA 2BLFA 4Q4IA 4XP4H 4ZFFB 2UY6A 5A2IH 2UZYB 4N5EC 2X09A 1NM9A 3L4WA 2H3KA 4P8QA 4PJ9C 2IF7A 4NKOB 1U3HC 2E0PA 3C6LB 1CF1A 5ANMB 1TZAA 3TFKD 1CXFA 3IE9A 4Q58C 3TBYA 2X2YA 4JFDE 1MWOA 3EGSA 4ZMLA 5ESQB 4G7YL 4LPVA 4RWYL 3MJ9A 1OW0A 3Q2WA 4YSDA 2NY1D 5DMYA 2E86A 1OP3K 2UWEB 5J06A 1CD8A 4PGZA 1QSFE 3T0DA 1P84J 2N56A 2ATPB 3FTUA 2C1OA 4LCYB 4UOQA 1JZ8A 1AY1L 4UQ2B 2J56A 2NY3D 1KEGL 2ZOLA 3AZUA 3EOAA 3VSVA 4I3RL 1MIML 4XPTH 1FHGA 1Q9OA 3ZQXA 4PJFF 3K6DA 1XH1A 3OKKA 3BE1H 1FQ9C 3ILPB 4JJOA 4YHNA 1PX4A 4Z7NE 2QADC 5JMRA 1J0YA 4RLDA 2V5TA 1AR2A 4Z7UE 5B1BB 3IMSA 1GZHC 3SDAD 3Q06A 1UA6L 3WEOA 2BXYA 4HIPA 1KF9B 3OV6A 4O2CA 2OMUB 3UTTE 4DGYH 1YAZA 1MNNA 1CYXA 4YAQB 5AOKA 4B9ZA 4P3DA 5E4IA 3UTZA 1T03L 1NC4D 5D1XC 25C8L 3V4PB 3AADB 1Y0LA 3BWZA 1MNUH 2DTML 3DOSA 3TVMD 1CLYL 3R7RA 3MOAH 3FUHA 4ZX3A 2XKNB 3QQ4A 2DD8L 2F74B 3UAFA 2FQEA 4XVSH 1OALA 1MVUB 1X5YA 1S7SA 1FL5B 3SQOL 5BXFA 3X11B 4HKBB 5IROA 1U8MA 5AAPA 4FNQA 3U1SL 3GRWH 2D9QB 1LLAA 2CIIA 4PTUB 1BLNA 5IBLC 1NKOA 2ZAGA 1CPUA 3GI8H 3RNKA 4UV7L 2UY7B 3SJVE 2CRZA 3UX9B 5A2BA 5T5NF 4R9HA 1QBML 4YWGL 3WJMA 2WZ6A 3DROB 3OR6A 4I5BA 3BKCH 4HT1H 5D7JB 3IVKB 4PYHA 4WU7B 4QRUA 4U3XA 5CUSH 1JTPA 1RHFA 3F62A 3LQZA 5IM7A 1QQDA 3QT2A 4FFYA 2WZAA 5EZJB 3U0WL 3DSNB 1JHTB 5F9OL 1DANU 1UWGL 2ENSA 3DX7A 3WIHL 1AAJA 4ODUA 4R7NA 4OKDA 3NCBB 3MNVA 2XTSA 4FXKC 2XZCH 1YY9D 4NZTH 4XMWA 3WGVB 3QIWA 4AQ1B 3C5XA 4CKQA 1X9QA 4GEJA 5GRZA 1KYDA 2HWZH 3AU0A 4Z7OE 1NA8A 1J8KA 1MLCB 1JD7A 4KTEL 1DCLA 1FZMB 1MFEL 2D7OA 1VLXA 2VIRB 3DGGA 4LP5A 3VJ6B 1B3JA 3CFMA 1H3WM 2JKTM 2YPVA 2HVJB 3F6LA 3GJEB 4MA3B 4NS0A 3PPSA 2D7TH 4ZXBC 4C54A 3NIFF 1QSVA 1FN4A 4F58L 1G5GA 4L0PB 2MJWA 3P30H 1NIEA 1C08A 3U4KA 4RDQG 2KT6A 4APXB 3B2XA 2JI2A 2WPGA 3DPBA 5F1NA 3BHBA 4OZIA 2AITA 2IH3B 2D2CC 3Q44A 3LDBB 1FFTB 2JCCE 3PDGA 5A16B 4HALA 2WBJC 5D4JA 1V27A 2A9BA 5FO9B 1OTTC 1UM4L 1S7TB 4G59C 4UU9A 2IEPA 4GG6F 1TVHB 2EZ0C 2WXQA 4OLYH 3QHZL 5D7LE 4DP4X 1FGNL 4I48B 1HCZA 1DQJB 5D71H 3PS6A 4UNUA 5IB5B 3NAAL 2OI9C 4WKZB 4EUPG 4UM9B 2J6EA 3HB3D 1MHEB 4PS4H 1LEIA 3L16A 4I2XA 3NSFA 3QQDA 4PVLA 3AREB 1LNUB 3WTVA 1NSNH 1S78D 5KZCB 4PRPA 4RRPG 5CN3A 3ZRCC 1H15A 1YO4A 4N68A 4HOZA 3LV3B 1I7ZA 1T21B 4O9HH 2R0KL 3K6SA 3VYOA 3T4YA 3CX2A 2Q6WB 2BY0A 3DIVA 4X5WA 4X80L 1VAHA 3L6FA 5KANG 2F5AL 1CD1A 2IGFH 1P9MA 3ABMB 5FHBL 3AXLB 2XZAH 3TPUA 2ZCKH 1WTLA 4HPYH 2V37A 3IE4A 4I8DA 2BMKA 1YEHH 2YPLB 4FLHA 4YDNA 1H8NA 4ZI8A 2EEBA 1KCRH 1WFUA 3SYAA 2FATL 1ID5I 2HP4A 1BOGA 1I85C 2A1WH 1NZRA 3H0TB 4LNRA 4PIBA 1MWAL 4OLWL 3V0DA 4RETB 4ZSOE 1HL8A 3AGVA 3LSOB 4BJLA 3IDYB 2Z64C 4TQPA 2K9FB 4L1LA 1MPAL 2UY6B 3LS5L 5ISZA 2X2UA 5E4OA 1GC1L 3NFPA 5JHBA 1G84A 4UZSA 1IZKA 2Z92B 4IKIA 3MUJA 3OPZH 1I82A 4WHTA 4ZMWA 12E8L 3CIAA 5DDHA 3A6CH 2AMUA 2QHRL 5CCGE 4NQEA 1XF2A 2YOCA 3HCVA 3TBYB 1I1AA 3EGSB 3MTXA 3BPOC 4LMQE 4DPAX 1NBZA 3LKPA 4MNGB 2CGZA 2XACC 4XMLL 1NM4A 1PLGL 1RPQA 4ILDA 3C09B 4WK4B 4H1LG 1FIEA 1EHKB 1L0PA 3EJYC 3APCA 2B1AH 3LHAA 2C1OB 4D9LH 1Q8MA 4B96A 3VRLF 3ZLQC 5DO2D 4A68A 1JF5A 2ZOLB 3BSZH 3EOAB 5J6HA 3FQNA 1Q9OB 5D2NA 4F7MA 3RTLA 2HMID 3OKKB 5BVPL 2D4FA 3HNSH 1LQSR 3BKJL 4YHNB 4AUUA 3QHFH 1VZGA 3FDWA 1I9JH 2HRHA 1TMQA 2MOVA 3MR9A 2VXTL 1DVFC 5JUEH 1IBGH 2ICWI 3OGOE 5JYMA 2F7IA 4E9XA 3V0HA 2NY2B 3FYEB 4O2CB 1XAUA 4P3DB 3UTZB 3SDDD 3DJRA 4QRTA 1Y0LB 4P2RD 3FFOA 1ASPA 1T1XA 1XF4A 3ESMA 3GM0A 4MZIA 3U9PH 3L17A 2V3FA 2CHWA 3DOSB 1UM6L 2R69A 4IGBA 2CCLA 1QSED 2C5DC 4CGUB 5JYLA 5HGDA 4RNRB 2O93L 3VH8A 2DLTA 1MFDL 4OVVA 2JLLA 5BXFB 1NGQH 3BRDA 4YHML 1TEFA 2CUAA 4WENB 2ODHA 4PVBA 1ZV9A 1WFJA 1U8MB 4JFSA 4JFOB 4NO0D 4HG4J 2OAAA 4IS6A 2OJZH 1L7IH 1RIHL 3K74B 1OB0A 1MFBL 1EGJH 3WCYA 3BMWA 1BLNB 1BREA 2DN7A 1BXXA 3ZR6A 1FHNA 2XLLA 3RNKB 4LLUA 5ECJE 5ID1A 1YMHA 5AYUL 5DFTA 2DI9A 2WOYA 3OR6B 1TJGH 4I5BB 4BKTC 1PDKA 2ZOOA 4Q4EA 3FXIC 3O11A 3TN0A 5KSAC 1I3UA 4QRUB 3R0MA 5L9DL 2OX5A 4LIQH 2JJVA 2BSTB 4UZUA 1JGUL 2MQCA 5IM7B 1QQDB 3DJTA 1SXZA 4OGYH 2OXHA 3DX7B 5CIPA 2MCAA 3QG6A 4ODUB 4PB9L 4R7NB 1IV8A 1TG8A 4MD5A 5GRUL 3QEGL 3I6SA 3QIWB 4P2AA 1EDYA 1SY6H 3MXVL 4H25A 4OF6A 3QDMA 2CA4A 5JORA 3IMBA 2R2CA 3DGGB 3ARQA 4M3JA 4MVBD 5JIHA 5F7AA 4XCFH 1OGTB 1E3ZA 2BIPA 2BY2A 5C0BE 5KBPA 5CLTA 1GGIL 1ZAGA 1FN4B 4KU1A 2R0LL 1A66A 1C08B 1AO7E 1U8NA 5EZIH 3RVVC 4XPBL 4PI2A 1XSKA 4UBDD 5C1MB 1T2QH 2APVA 3DPBB 5F1NB 1DJHA 8FABA 3VFGL 3BHBB 1D7CA 3GBLA 3S35L 3A22A 3OHXC 3TC9A 4OZIB 1FAKT 3KLAA 5E1GA 1F58L 5CD3A 3EF4A 4UU9B 4D0CA 1WSST 4UINL 4UT9A 4D9RE 5J6SA 4N28A 4MZRA 1RUPH 4A7TA 5J57B 5INDA 2HT4C 3K6NA 3C5ZD 4G9DA 4L8DA 4RRPM 2X2HA 4WI3A 1EO7A 4PS7A 4TSBL 1LEIB 5IUCA 4HCRA 4PP2A 4I2XB 3OKEA 3QQDB 4N9GA 4PBWD 1CTNA 1HNFA 1JSYA 1Q0YL 4NYLA 5AUMA 3LPOA 1T66D 3G6JF 2WTRA 4YXKL 3L1FA 5F0MB 1H15B 2ESVA 3T4AA 1I7ZB 3DYPA 4LASL 4RGNB 4W4OA 3UC2A 1BQHA 5LLIC 1E5ZA 3K6SB 1I9RH 4KHXH 5C2BH 3T4YB 1UD8A 1R5VA 4YZFE 3DETD 4X5WB 2PWEA 2C3VA 3KM1A 2BRQA 3TOPA 3ZHNA 4FXGA 3L6FB 5TDNA 1U8LA 1CD1B 2DWXA 4ANKA 4YSEA 5JLZA 1QLEL 3T0ED 3JT0A 3TPUB 2W1NA 3K6OA 3ULVE 1CC3A 1BHGA 2BMKB 1KGCD 4GS7B 2AEQL 1RZJC 5F7NC 1IZJA 1NIDA 4JL1A 2Y1VA 1BOGB 1WK0A 4QRRA 1QMUA 3MX0A 1DUYA 4H20L 4LNRB 3RVUC 2XXFA 2YEVB 1X5IA 4M62H 4PD4K 4R4NC 5SWSD 5A2FA 1HEHC 2VLKA 3DDGA 2HUEA 2FB4L 4NJ9H 5C0EA 2OMNA 5ISZB 4Y1TA 3L9RA 3NFPB 2AFNA 4QKTA 4TTDC 5E6ZA 5EF0A 5I1JH 3GNMH 3APMA 3ARGA 5T1DL 1OAZH 2JJUA 2J72A 1J1OH 2H1PH 4ZFOB 4WZ9A 4LSVL 5DDHB 2D3VA 4J27A 1OGAA 1JPSH 3DPDA 5EG6C 3H56A 1CVSC 1MIEH 1T1WA 3B6SA 3HCVB 4NQEB 1I1AB 3PE9A 1XF2B 4MRCA 4PJ8A 1NBZB 3LKPB 3KYOA 4BSVA 3D9AH 4AQOA 3F58L 4X0KA 2EVHA 2DH2A 3K71A 1NQBA 2IVFC 4M4PA 3Q43A 3WXWH 1ZGLM 1E27B 3GBNH 4NNPL 5J6HB 3FQNB 3FFCD 5D2NB 2O61B 4PJCE 1QUPA 1TCRA 2FH6A 1ZD6A 5DUMH 5GGRA 4C4KO 2X0WA 5AVYB 3VQ1C 4H4NA 3MR9B 4ZT1A 4Y4HC 5FO8A 1DR9A 3MLSL 3L9BA 4KAQL 1INEL 1YPZA 3EJCA 5F6HJ 4JK0D 2Y06H 3QXUA 5E2VH 4LRNH 4N0CD 3MOBH 2ZAIA 4Z1PA 3E8UH 4JW3A 4JO3H 4QRTB 2MCMA 4IM8A 1T1XB 1XF4B 4S10A 3ZDZE 2VM3A 3HC3H 4X8CA 3FTGA 3KJ6L 3IN2A 4IGBB 5FGBA 3SGDI 5HYQA 1JXKA 3ALPA 5J1TC 3GSVA 4TXVB 3VH8B 1ECZA 1F3RB 2WWMD 3KLQA 2VDNH 3HLAB 4ZFGL 2EDBA 1U3YA 3B34A 3HS0B 4UUJA 5A2CA 2ZP8A 2GKIA 4HZ1A 2EXYD 3S0PA 1YAIA 2E7CA 4IS6B 3US9A 1SOSA 5I8KL 2YZ1A 4BZYA 1B4JH 1PJ9A 5DJAA 3QC5X 3SDCD 2NYYD 2BC4A 1PAZA 5DJ2A 4NSKA 2I07A 2FO4A 3AG2B 5LBSA 3IMRA 5EBWA 4DFHA 2X6VA 4ERSH 4S1SL 1CLVA 2BNRD 4LLUB 1PZAA 2OMBA 3P9MA 3UAJA 5ID1B 5JXED 3RL1A 1UT2A 1AS8A 1PDKB 1U2CA 3IMTA 1Q9WA 4PCTA 3O11B 3TN0B 2YD8A 4ONFL 3G5VA 2OX5B 5J4MA 2X53A 4MAYA 2EADA 2F7OA 2BVEA 5DYFA 4XP9H 5ANHA 3WD5H 4IOFC 4AE0A 2OXHB 4JM2D 3VU1A 4OZFA 3MV11 2IAMD 4OIAA 5CIPB 1PLAA 3QG6B 1PF3A 2FT6A 4MD5B 2FQGA 1ZVHA 2EP6A 3V5KA 3QIUA 3NFNA 1WGVA 2ZUSA 4H25B 5KUMA 4XPHL 3N9GH 2WB1A 4U05A 3QDMB 5JORB 2HZHA 4MDRA 5KVDH 2WWKO 1XBRA 4BE5A 2DZEA 1AQKH 2R1WA 3GRBA 3D39D 1D2PA 4HWBH 4J4PD 2EC9U 4BK5A 3AFLA 1P4LA 4F7EA 4A66A 2DEYX 4QXTA 1QR4A 1RURH 3MREB 4LCVA 1BAFL 1U8NB 1ASOA 1SGKA 1Z3GL 4PU2A 3GZQA 5D5MA 5JXAH 3RG1C 2VL4A 1IGIL 4NOBA 2VXQH 4O58L 8FABB 3JV4B 5ERWA 3RP1A 2KLTA 2X2IA 5IVXE 4XVTL 1G7IA 2N1KA 3KLAB 3MJGX 1EMTH 1V3LA 2ZXBA 5AZ2H 4GSXA 4EOWH 1OCWH 5CD3B 4D0CB 1XF1A 3DVNA 4NKIH 1JAEA 1FLTX 3EBGA 2GG1A 1NCTA 2QKIC 5INDB 1CTOA 4FQHB 4G9DB 4WFHD 4L8DB 1MJ7L 5JW4Q 2AK4A 3O6KH 1OAKH 3BVDB 4B0MB 3LZQA 4PP2B 3U36B 1G4RA 3OKEB 5HHPA 1UOLA 4N9GB 1OWWA 1HS6A 4J3UA 5AUMB 3MFGB 3KYNB 4NYLB 1WH0A 2YQ3A 3QNZA 2WTRB 2V4LA 4FFZL 1IT9L 3T4AB 2NZIA 3RDJA 1O75A 1YA5A 3QEHA 3BH9A 1BQHB 1YEIH 3B9KC 5DWPA 1F97A 1F3JA 4MXVE 2BIQA 3BPCA 3LPWA 3R06A 1R5VB 4G1MA 3HZVA 1IAIH 4FXGB 1MKFA 4L5FL 5TDNB 1X9RA 1U8LB 3RVXD 4QHLA 2MCPL 1C5BH 1UADC 3F05A 5E8PA 5JLZB 1PYWA 4H8WL 3WIFA 3GQFA 4XC1L 5EO9A 5AVXB 5I0YA 5SX4I 4GXFA 4RWHA 2W91A 2HG5A 4OJAA 2RTTA 3FH8A 5HD8C 4WHCA 4K9EC 3MX0B 4QRRB 5DURB 1DUYB 3K2UH 5IQ9A 2YD1A 4EN3C 4Y5VC 3QQ9D 4M02A 5D93B 3AM8A 4FNLH 1ASQA 5IFAL 3B1UA 5I1EL 4WI8A 3PP3H 1PIGA 2VLKB 4NKQB 5C0EB 3THML 3HAEB 4O2EA 3DUSA 3L9RB 3V4PH 1HZHH 1CFNA 1UT9A 2Y3NA 3ARGB 4TNVK 1NC2A 2YWZA 1A8ZA 1BZ8A 2Y9RT 1MCQA 1OGAB 2VDRB 4LSQL 3V0FA 5ES4B 1T1WB 3B6SB 4JFPA 4KK9C 2WQXA 3UGXA 4PJ8B 1QX1A 3KYOB 4BSVB 1KXTA 2PWHA 3BYTA 2Y36L 1YEFH 3NRFA 4J3OD 4X0KB 1N59A 3K71B 4GKOA 4HMDA 1ONQA 5B4MC 4WTWA 3H7BA 1DLHA 3H9SA 4TQ8A 1EJOL 3ILDA 43C9A 2EIMB 4Z18A 3HI5L 4E5XG 1J9QA 1X5GA 1QFWL 3P1VA 2LLLA 3JWNC 4R8WH 1SM3H 3OSVA 4N2GA 3DECA 5I6PA 1TCRB 5TTRA 5GGRB 4CJ1A 5CCKL 4LARL 2QQKL 2IAND 3SDXA 4PWKA 5DSCA 3QGVA 1RULL 3FQ4A 5G2NA 5MEPA 3DVGB 1NGWA 5B22A 4XN9A 1R5WA 3U48A 5FO8B 5IHWA 5TK4A 3QZWG 5ESAA 1YPZB 1LK3L 5FKAA 1IM3A 4MSWA 2MQGA 2OA9A 1CLOH 1E4KC 1XMEB 1UXWA 4WI7A 3SGEI 1NCWH 2WLLA 4NN6B 2AEIT 4JY6A 3WXVL 5KBNC 4PY8I 1I3RA 2X0VA 3SCMA 5LGKA 2CWRA 4MTMA 5TE6H 3Q01A 1TLKA 3G04A 4HXBH 3VNYA 3QCVH 3DJ9A 2BFVL 5FYLH 2CUMA 4MQXD 4FMKA 3FTGB 5SV3A 4MQTB 5HYQB 3AY4C 1AD9A 5CNHA 4QHNA 1EH9A 5FYKD 4Q6IA 2Q3AA 5K33A 2QPDB 3VI4F 5B8CA 2KZKA 2OSYA 4GAGH 4JFFE 3LRLA 4UUJB 1BPVA 1UD3A 2ERJB 2EC8A 1RUAH 2UXVA 4PJ5A 4GBXC 4TNGA 4F8OA 2Z7WA 1MJJA 5DJAB 5IT2L 3F2LA 1YSOA 4ENZA 2BC4B 5DJ2B 4NSKB 2I07B 3T2NH 1S2EA 5EBWB 2G2NA 2JVUA 3P9MB 1TQCB 2Z31A 3RL1B 2I69A 2Q9OA 1CURA 1M7DA 1KDJA 2LE9A 1WQVT 1TYEB 4KY2A 3CLFL 1Q9WB 2CO7A 2AW2A 2IG2H 3MV8D 3BEVA 3G5VB 4NQQA 5PAZA 4MAYB 2Z8VC 4WFGD 4P5MA 3B2PA 3IWUA 1IQDA 4KKBD 3UTQA 3SBQA 1JOIA 3NK3A 4P2QA 3WEBA 4DP9X 4BELD 2DS4A 4ZNEE 1OPOA 4OZFB 3TJHD 1PJWA 5JR1L 4H7VA 1LVEA 3QPXL 5I30H 1DJIA 4HC1H 1G6RL 3QIUB 2ZX5A 1MCPH 5F9WB 2VQTA 5C3TA 4H44C 2UWEF 3IBOA 2LABA 1D5IL 1N26A 4Q2ZA 2PO6D 3Q8BA 2Z3FA 2R1WB 2AJUH 4GJTB 4OF5A 4OLUH 4ZS7H 3UYRH 1HEJC 2WUCL 5DMKA 3VYNA 1P4LB 1DO5A 4G5ZH 2CPCA 2J57A 4I0CC 4JREB 3AMKA 4QXTB 4FZEH 4M1DL 4WNQA 3X3FH 4JO2H 1BP3B 1E8WA 2BHYA 4JHAL 5D5MB 5JHLA 2CLZA 2P5ED 4OGQC 2Z4TA 4XP5H 4OJFL 5C09A 3BAEL 4X6CE 5ERWB 1LTXA 2MEJB 2A6DA 5EU6A 1G7IB 3UABA 2NDFA 3U7YL 3L1EA 4BFKA 1AR1C 5I15L 3DVNB 3KJ4B 4MHHG 1AFVH 1V10A 2YXVA 4ZPVA 5BPPA 3S8WA 2GIMA 1OSYA 5C9KA 3OXRA 4LLYB 1KTKE 2H2PC 2KLRA 3EYSH 1KTCA 1ZEAH 2AK4B 3JWDL 4GAJH 1WRFA 2WGXA 2DY2A 3ZN6A 3OSKA 5HGAA 3SE4A 3X1FA 3O3AA 3QNZB 4WV1B 4B9KC 1N64H 1NKRA 2DQIL 4DZ8A 2GBVA 3MJ9H 5CSGA 5CR8A 5J13C 5IJKC 3QEHB 3BH9B 5LWYH 1HIML 1F3JB 4N86A 2O6PA 4PJDB 3BPCB 1RZQA 3R06B 4G1MB 3HZVB 1WA0X 3L5JA 3FYIB 1GXEA 1CLCA 3U4BH 4JRYD 4F9LC 4H40A 4P2RE 1NUFA 4QHLB 5A6LA 1FPTH 3ETSA 5E8PB 1PYWB 3RUGE 4HKXB 2HTLC 3LB6C 3WIFB 5EO9B 1OAQH 1QSEE 2HG5B 3A6BL 3BQUD 4U2YA 1IILE 1MF2L 2D3NA 2NXZC 2V9TA 3KCPA 4W6WB 3A6OA 1QI3A 3FFDA 4DK6A 5IQ9B 1DBML 4G9FE 5ADOH 2EYRA 3GF8A 4YL4A 2EKSB 3MV9A 2JKNA 1FDLH 1IKFL 3U6XS 1RHHA 3K7UA 4O2EB 1A8JH 4HJUA 2DM3A 3DUSB 1E4WL 3SO3C 4KVPA 1UA3A 1CFNB 1LDPH 4Y4FA 1TPXB 1NC2B 3FHQA 1S7XA 4L05A 4KUZH 2EEAA 3RZCC 4KK6C 1HK6A 2AQNA 4NM4H 5ILTL 3AC0A 3V5HA 3EFFB 4P46D 2EDWA 2VZUA 1KXTB 1CO1A 1XFPA 1CU4L 1NCJA 1N59B 1Q1JL 1TUPA 1ONQB 4E41D 2VDPB 3H7BB 1DLHB 3H9SB 4JCMA 4JFWA 1H5BA 1NCGA 4FQXC 2I5YL 4TKWA 43C9B 1ID2A 3TO4A 4I13B 3FBKA 4AV5A 5GGSY 4BKLA 2RMNA 5CHNA 2NSMA 5F70A 1E4HA 4NXKA 4NPYA 4P07A 4UILH 4ZNCD 4FG4A 3SDXB 4UWQB 4ABQA 1MUJB 5C07D 5DSCB 3O41A 5MEPB 2LFEA 1NGWB 1FLRL 1R5WB 4PJXF 5DC4B 3T3MF 4YMPA 1JYVA 4RGOH 2KQNA 5FCUH 5ESAB 1URLA 4FFYH 5FKAB 1IM3B 1M3IA 2KDYA 1UXWB 2OLDA 2JELH 2WLLB 5TGBA 4JGNA 4JY6B 1ZVYA 1I3RB 3SCMB 3WHXA 2VN4A 4RH4A 5C0FA 1MAJA 4D3CH 3G04B 3UPCA 5E99H 5BZWA 3JWOH 1KFAH 4CN6A 1VGKA 2OSWA 3ESNA 1MZZA 2E7LC 1S3KH 1SLWA 1AD9B 4PJHA 1PZDA 4XP4L 2E47A 2CG9X 4DN3L 1YQVL 4NJAH 4QHNB 2YPVH 4Q6IB 4YHIA 3CXHJ 5B8CB 5HYEA 1R5IA 4TUOA 4WW1A 2WTPA 1UTDA 4WHYG 4LF3A 3SBWC 1FSKC 1KT2B 3F7RA 4JO1L 2R23A 4OM0L 3MKGA 1WA2X 4JFEA 5CILH 5E4AA 4CILA 4KH9A 4PJ5B 1IQWL 1ZIBA 2YKLL 1VGEL 1MJJB 2W9LA 4ETYA 3CFDB 4ZAKA 4KXAA 5C8JB 4PJEE 4LMQI