3Q9PA

Hspb1 fragment
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
83
structure length
76
Chain Sequence
SHTADRWRVSLDVNHFAPDELTVKTKDGVVEITGKHAYISRCFTRKYTLPPGVDPTQVSSSLSPEGTLTVEAPMPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Three-Dimensional Structure of alpha-Crystallin Domain Dimers of Human Small Heat Shock Proteins HSPB1 and HSPB6
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone
molecule keywords Heat shock protein beta-1
total genus 7
structure length 76
sequence length 83
ec nomenclature
pdb deposition date 2011-01-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.790 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3q9pA00
4YE0A 5DS2A 1RL1A 2K8QA 3GUFA 3AABA 1EJFA 3GT6A 3L1FA 3QORC 3W1ZA 4FEIA 1WFIA 3QORB 5LUMA 3Q9PA 3GLAA 2N3JA 3J07A 5DS1A 4ELDA 2Y1YA 4YDZA 3N3EA 4JUTA 2KLRA 4YLBA 3QORD 2MNWA 4M5SA 2RH0A 2JKIS 2KMWA 1WGVA 4YLCA 3AACA 3IGFA 3EUDA 3L1GA 4PBDA 3VQLA 2WJ5A 1WH0A 3VQMA 4MJHA 4PCKA 2O30A 2Y1ZA 1SHSA 2Y22A 2CR0A 1GMEA 2WJ7A 2BOLA 4I88A 4YL9A 2N0KA 2CG9X 2XCMC 3QORA 4ZJ9A 3L1EA 4RZKA 4M5TA 4JUSA 3Q9QA 1X5MA
chains in the Genus database with same CATH superfamily
2FJGB 5E0QA 5AAWA 1SEBA 1UZ8B 4XAKD 1G0DA 2AXGA 2VQTA 2C1PB 4JO2H 3Q48A 2BVUA 4JPWL 4HDIB 3DRTA 4IIQC 5I6LA 4HCRL 5A2CA 2BSDA 2Z65C 2X4QA 2YKKA 5C3TA 1CFSB 2DYSB 4IOSA 3MGOB 2C7FA 2F1EA 3L1GA 4RAUB 3NABH 5C0BD 2H2SC 4CA4A 5D2NA 4KITB 4JQXA 4ETQB 4QOKA 3PHQA 5AB2A 4FFWD 1A3RH 1KCRH 1TLKA 4M7KL 1MRDH 4X4MA 1DN2A 1F58L 25C8L 2VDNB 1DVQA 5E94A 7FABH 3U0PA 5D7LA 3O41B 1CGUA 3FO2B 1QSZA 1F18A 3MZGB 4Y2DA 3QHZL 1UGNA 3G5YB 3LVEA 2YD7A 3RIAF 2QPSA 4GIAA 2G2RA 4IEFA 1AI1H 4X4ZA 2GIMA 1HCZA 1G6RA 2PNDA 4QCIB 3HA0A 4D2NA 2MSPA 4FLHA 3S2CA 4IU2B 4CN4A 1FH5L 1OALA 4U6HA 5F9OH 2CR0A 3JYBA 4HOXA 1AGDB 1QTYT 4QXGL 3TJEL 2KPWA 1EK3A 4XWGH 1TU2B 4NRXB 3ZKMC 3U9PL 1PD1A 2FYYB 4QWWC 1J86A 1GGIH 4APQB 3AQDA 1ACYH 1I9RL 1S7TA 2VL5A 3KS0J 1TQVA 2Y36L 3HUJB 4DP4X 3N0AA 1QD0A 4K5OA 3B4NA 5EFIA 1A7NH 4MNQD 2UZYB 2O5XL 3KR3L 4GQZA 3LDBB 1LLAA 4W9ZA 2VQ1A 5E95B 3T08A 3V0FA 1ZLEA 3W81A 1T1WB 3DSNA 3DXAE 5I76A 5IESH 2AQTA 1WQVT 2N0KA 1ZLWK 2VDOB 4FL4B 4EN3C 15C8H 3LHPL 4LMQI 2YJLA 1LO0L 1H0DB 3QXUA 1A3LL 1WEJH 3MLZL 2R8SL 4XAWH 3LNGA 4ZAKD 3CFTA 1CTMA 3X12B 4LSSH 1SDAB 4OQ1A 4W1TA 1SEQL 1U2YA 4O2CB 1U0QA 4RGOH 2EE3A 1OAUL 4JPVH 3U0TA 3BRFA 2H0PA 5AD0B 1RUPL 4R97B 2PXYD 2ITDA 1HE7A 3LSOA 5FCSH 3QB7C 3KG5A 1T6BX 3VGGA 4ZMPA 5KW9L 1C5BL 1TZGH 3OKDB 3P4OB 1ACCA 4ESKA 1XGQB 1JV2B 1L9TA 3C60D 3QZWA 4RLDA 2ZKHH 4Z7UB 4ZYKA 4XE5B 1NPNA 1A8ZA 1SOXA 1JZ7A 3O3DA 1RMFL 3CFJB 4NQED 1ZLSH 3X1FA 3QIUD 3DX3A 3L2MA 4UV4L 2ZJSL 2PWGA 4AM0A 2AS5M 5ICYA 3NCEB 4XCFH 1PNDA 4YE4H 1HDMA 3EFOA 1NGXA 1VKXB 2GJPA 3MRNA 3L3KB 3JV6A 5HYSB 4P2OC 2EDYA 2ZOLB 5MERB 1NCTA 4PP2B 3BPOC 1FNHA 3P77B 3K4DA 3UO8B 2O26U 4U31A 2JMRA 3BPLB 4PI0A 2ZXDA 4WK4B 1PCSA 2NYYC 5AWNL 4GUPB 1X4XA 4DPRA 4NIYE 3AS3A 5BS0A 3FUHA 1ZLWH 5MP6L 1QW9A 4POZD 5AW8B 1CFQB 3DO7A 1C8QA 1IBZA 2AEIT 3ECQA 3ESMA 4BE6A 4MDRA 3HJEA 2DQDL 1NFDE 2N0MA 3KYKL 5GS0C 1SF3A 4B9GA 4ZW6A 2XYBA 2G75B 3BH8B 2DWXA 2IPUK 4PGCA 4NQEB 3NRQA 4WHYG 2FYVA 4AIEA 5ITBL 4P5TD 5IMLA 1IIIA 3CLWA 1KJ2B 4BFOA 1GC1C 1PZ2A 1YEDB 4F57H 2AK1L 4IBUA 2VDPL 2R1XA 5F88A 1TJHH 5FUZL 4F92B 2DIJA 4G6FD 4LLUA 3T3MB 4GRWH 2G5UA 4XCEA 5ANME 2NLJA 5AVSB 1AGDA 2XA8L 5CHNB 3F7KA 3X1GA 4F8TA 3HPJA 2IAMC 2J8UA 5TK2A 5FV1L 1ZIAA 5KVEH 3FJTA 5AW7B 4NKMB 4YZFE 4L48A 3N3EA 2Y5QA 5IROC 2XXFA 3GNMH 2XN9A 4XC1L 3UBXB 2B2XH 1GJIA 4Q2ZB 1D7BA 1HX0A 2OMWB 15C8L 2VDRL 3JWDC 4DOHB 1II4E 2VN7A 2AERT 4LSDA 1Q9KA 3GKZA 1UWGL 1IZKA 4K3JH 4LOUC 3RDTC 1I4FB 3LZFH 2ZUQC 3WFDL 1QSFB 2EDXA 1KLGA 1KTDA 2GT9A 2R56H 5JNYA 1BBJB 2H1PH 2XA3A 3MACL 4PJ5B 3LIZH 2C7UA 4EMZA 4C47A 3DWTA 2CPUA 3MFFA 3G6AA 3PHOA 5JOPD 2IPKB 2YMOA 5AKTA 4YMPA 2Y72A 2CXGA 3KVDD 5BQ7A 4A04A 1EO8H 3Q5OA 4NO3A 5D9SA 1A3ZA 32C2A 4HWBA 5EO9B 4C83B 3FT3A 1CC3A 1KZYA 4LIQE 1UJ3C 1MCDA 1AZUA 4K0OA 3SDDD 1JNHB 5LGYA 3CSYA 1U8MA 4AGMA 5GSRB 5DWUH 2F53E 4TLTA 5TE6L 3RB7A 3V10A 2I9LA 3II1A 4KRMB 3VFTA 5I30H 4C4KT 4JZJC 4P2OB 1IQWL 3ARBC 4BFGA 2DQCL 2I07B 3MRRA 3CFMA 1I1FA 2FECL 4ZFZA 1A65A 3V4PL 4K9EC 4BKLA 4XNBA 3OLIA 3QAZC 4WO4B 3SO5A 2R0ZH 1BIIA 2EUVA 2K7PA 3LZOA 4PJ7E 2Y7OA 4I5BB 2BW5A 3EAKA 5DO8A 2OMNA 2K4WA 1AS6A 2YPVL 3GM0A 2AMUA 3FO2A 3PAUA 3VE0B 3MBEB 3MLUL 4Q0XL 3UJTL 1W72H 1UA3A 4U6HB 3QCUH 1IZJA 1T03L 5CMAB 3V0VB 4CU8A 3FN0L 4G5ZL 3N91A 1ZA6B 3NZUA 3UTSB 5ISZB 1IC5H 1EHLL 5ESAB 2FR4B 3BUIA 4Q4IA 5J12C 3IJYB 4YFLF 3GI9H 5HHQB 1BVZA 3CFKA 1C5BH 1TZGL 3CQPA 4G43A 4IRSA 3ZW3A 3PHSA 4MAYB 1CFBA 1JGLH 2IH1B 4UI2A 5AVTB 1RZFL 2W9EH 4WTZA 2D3NA 4CKQA 4LLYB 4RAVA 5GZOC 5I24A 1P7HL 1L5GB 5C2BL 3DETC 4AT6A 1FFNB 1AANA 2NCEA 5HGDB 3BEVA 5E1AB 3KMDA 1EQWA 1FFPB 2WCGA 1J1PH 2QADB 4NIKB 4GSDH 3GLDA 4OGXL 3QNYB 5HJBA 3H9SA 1ROWA 3C5ZD 4PJ8B 4PHZA 3TV3H 1XCQA 2HFGL 4OTXH 5LG1A 4DF9A 1T1ZB 3GSXA 4FEMA 4KPHL 3UP6A 3MJ6A 4PLJD 1JGVH 3VQ2C 1S7VA 2ZKWA 2BXYA 4LVHB 4PIBA 1G0XA 4KK5D 5IB2B 1UCBH 5F7BA 2VW7A 3RFZA 1CXHA 4FQJL 1WWCA 1IAOA 1ZSDB 4E5XG 2PO6A 1OGTB 1HHJB 3BH4A 1NFAA 2R2HA 3QIBD 4P2RA 2Y4SA 3KPRD 5CUSL 4X6DB 3B1UA 4DP0X 4BGDA 3FMGH 3SY0B 4CN1A 4N8VG 1IAKA 1J87A 4JW3A 4JUTA 2FVNA 5EUKB 4Z3TA 2Y2WA 4QYOB 1J1XL 2YAQA 4N1CA 4OLYL 2R27A 1E65A 3D2UA 2HJKA 3IAGC 5I1IL 4MKMA 5JTWA 1F6FB 1F13A 1OCWL 3CMGA 3ARFC 3M07A 4UUJA 1E5AA 5D7SH 4AUYA 4ONHA 2QHRH 2VDPH 1BFTA 1G7PB 2YGPA 4JY5L 4RSYA 4KO6A 5SWSD 5IHWA 3GT6A 2E46A 3G6JA 4X6BB 5J56B 4EI6A 4X8GA 2RQEA 3EO1A 3MLTA 4QRTB 3DKHA 2PN5A 4OLVH 1XDTT 3SDYH 2ZCKH 4P3CL 1MQ8A 2ORBL 4M29A 4MJ5B 1YDPB 2VXQH 2WYZA 3DUSB 4UMGA 1EJ6A 4YAQA 4ANXA 1L0PA 3UPRB 4MMXA 1I7UA 3DHUA 4OV5B 4N8PA 4U1MA 5D4QA 3PWPE 5EWIH 4DKFH 1XF2A 3BUYA 3SHSA 1PG7X 3V0GA 4Z76B 3NZ8B 4E41B 3HCVB 2N7BA 4X8JA 1RIHH 2DQ6A 4L9LC 2ZUVA 2NY3C 5D70H 5HHXL 3N9GH 1RJLB 2IC2A 2G5BA 2P8LA 4NRZA 2NPLX 1AGEA 3CZGA 3RNKA 3RX8A 1GIGH 3L3DB 3GINA 4J2QA 2NXZB 5EU4A 1MCJA 3VXTB 5AVUB 4G83A 1JGLL 4OJCA 5MEPA 3MLWL 4UUJB 1DFXA 4GIPD 2FO8A 4JB9H 1NZRA 1S4IA 1XSKA 5KSVB 4FKHA 1FVEA 4YQXH 2H7WA 1FI8C 1MCEA 3RVUD 2BSRA 2NY4B 4R96B 12E8L 2UY6B 5F1IA 1SXAA 5A6LA 1KN2L 3U79A 5IVOA 2N4IA 5FYJL 2Y69B 4I3SH 1LNUB 1WFIA 3AQYA 4HX1A 4UU9B 2X7LA 3DX2A 5DDHB 2A83B 5MP6H 2HJFA 1UZGA 5AKSA 4HPYH 3BSZA 5KSAD 1FFRA 1ZVHA 5ID0A 5EN3A 4P4KA 5FKAB 2BVQA 2KQNA 1INQB 3MCLL 3BX7C 3MYJA 5K9QI 2Z0UA 1CBVH 4DZ8B 1RY7B 3TIEA 4PWJA 3EYQD 2O5ZH 3O9WD 1QZ1A 2BIPA 4MAZA 4PJ8A 1T6VN 4O2FA 4YIQA 5E4OA 2GKIA 4QOKE 1MI5B 4XXWC 3DA0A 1F4HA 3EJJX 1FNAA 1I9IL 3ZL4H 4RMTA 2NSMA 3ARSA 1S9VA 5DJXB 4WTZG 3UYRH 4RAVB 4RX4A 1GGYA 2JQAA 2EDTA 3UAFA 1KDIA 4WI6A 1XCTA 3RUGE 3AGVA 3TZVA 1QBBA 3HNTH 3LRSB 3LTVA 4GKNA 4FXKC 3STZA 1N8ZB 4IOFC 4JFTA 2ZP0T 1U8CB 4KO9A 3VI4F 2C4FU 3ULUH 1S7RB 2OA9A 4HIJA 4J1UB 1G7HB 4AEHL 4ZUTB 1NDTA 1WBZB 2DEYX 1NM9A 1R33A 2WVVA 4KOCA 4UQEA 5KS9F 1UZ6F 5TF0A 4Y5XA 4G6ML 3GLEA 1AHWB 1FL6A 4H4NA 4MZ3A 4O5LL 3VW3H 4BQ6A 3IGUA 5LGKA 5EZOH 3RDJA 3QC6X 2Q6WB 3E80A 4G8GB 1V27A 4X9IA 4YVNA 1FO0L 1LO5A 2QMJA 3ULVL 5D8JH 2MRYA 2YD9A 2WW8A 3CFEA 5C0CE 1DO6A 1FA4A 3QA3A 5DC0A 1Z9MA 4HEPG 4Z7NE 4JHAH 1LEIB 3VSVA 2ZX7A 3F83A 1YY9D 5DS2A 5I1JL 2HT3D 5HGGS 2MHAB 3AS0A 5C09E 3QS2A 1IAMA 3MGTA 3KPTA 3OR6A 1QFUH 5I1LB 3NJJA 4UZUA 2FJUB 4KXDA 5F7WC 2OJ1A 1XCXA 5DS8B 3FB5B 4U1HB 3LZNA 4U7SA 1CPUA 1ACYL 2AK1H 2N59A 4NP4H 2Y1AA 2EAEA 5DFVC 3KPOA 4XVSH 4A1RA 4PJCE 1VACA 4KJWD 3WFEL 4XC3L 2DJ4A 3QIWD 2Y3NA 3O0RL 3TYFA 3NRFA 1A25A 4PM1A 4PY7A 1T89C 4LLQB 4JY5H 3L7EB 5FGSA 5BS0D 5E08L 5KEZA 2H47C 4MFHA 4PJXA 2KL6A 1G6RL 4JM2B 3SE6A 3ZN6A 3QP3A 3GLAA 2CAKA 2Y07H 4N2NA 1DBBH 1T3FB 1VCBC 4ZAKC 4XPFL 4LPVA 5FB8A 4G8GA 4WI0B 1FO0B 3GKWL 1L9SA 1ZTXL 3QPXH 4FYTA 3ULVC 1UVQA 1WBXB 5JO5B 3N55A 2K3TA 3GTNA 5A2KH 1KGWA 4OGYH 1E8ZA 5CGBA 3LXAA 4LLMA 4W68A 5TDNB 2R2CA 1PX8A 3PL6D 5C07B 3AFLA 3C5JA 1PD6A 3RWCB 3HBPA 2OSXA 4XCYB 1ZK5A 3S36H 2ADFH 1UGKA 5E8PB 4PRIB 5KS9B 3RWFB 2BIIA 4PYHA 3G3LA 5HDBB 2ADGB 3TO4C 1JN6B 3W9EB 2CK0L 3E2HB 5DMYA 4NUQA 3GXDA 1JHKH 4MMZA 3UBGA 5J6SA 4DJMA 5HJGA 4NNPH 2OV0A 2VJXA 3VXNA 4J3VA 4KO5A 4XNYL 3TWCH 4XBEH 3KPSD 1NCBL 3IMVA 2WTRA 5LVEA 1BZ9B 2W94A 4WKZA 4G8IA 3KVPA 1E6JH 3D25A 2CJTA 3ULUD 4L9DA 1XSOA 4AC2A 1TG8A 4P4KB 5FKAA 1AHWC 1WV7T 1RPKA 4H8PA 2IADA 2ESVE 1NKOA 2JB5H 3NMEA 4GSUA 4DEPB 4AGOA 1KEMH 2GSGA 3K91A 1I7RA 4K7PX 4KDTA 4KAQH 5DRXA 3O8XA 1CGTA 4S2SA 4F8QA 2KUTA 4BINA 5DHVH 3VXSE 1ZV5A 4RCAA 4K2UL 4ATWA 4AVJA 3KH3A 5EIQA 5F9AC 4BXVA 5BVPL 2GIXA 2HRHA 2WQRA 3OXRB 5K39B 4JHZA 1J8SA 1T7VA 3LHAA 5DHMC 4OF3A 1MZYA 1FAIL 3NT0A 3HUJE 2A9CA 3K74B 4MCZA 4OCRL 2CO7A 4P5TB 1T5KA 5HHVL 1CQKA 5B1JC 2MKWA 4LHQB 1A4JA 3NPZB 4JHVA 5F72S 5ADPH 3UG3A 3S2AA 2OX5A 4WO4D 3U0WL 1NBCA 3OMNB 4K9EL 4LVNC 1FYTA 2RTTA 4FQXA 1UXSA 2R1WB 4M8UA 2J56A 2WKLA 1BEXA 4Z76A 3C09C 4UT9H 5JLZA 3OKEB 2VAAA 5E6IB 5ETUB 4I2XB 3V5KB 5FYJE 4JE0A 2WLKA 5EZIH 1DQVA 3MOQA 3QDGA 5DLML 1FZJB 1O0VA 5B21A 5BZWB 1DL7H 4XPTH 1TZHB 3TH3T 4MNGE 2BMKB 1NMAL 3JTBA 5GQBA 2YOAA 3QUGA 2XDHA 2YD8A 4N4YB 3RKDD 1RUKL 1WIPA 2YK1L 3CHOA 3EH5B 5BRQA 4MB5A 3BE1L 1XB8A 4S1DC 1H8NA 3QR2A 4LCYA 5BRZA 1SF5A 5J6HA 3LJ3A 3QHFH 4RISH 3TA4D 2PTTA 3QZPA 4NNXB 4Z7UE 3JWNG 1CYGA 4YE0A 3PJSB 1XB6A 5DJ6A 1J8KA 1KGUA 4C55A 5IOPB 4QTIL 1T4KB 4FNPA 4G80B 1MCFA 4HUVB 3BI9X 2XVKA 1ZLVK 5DEGB 1IO4C 4LLDA 4UDUB 2PKDA 3FBQA 2NZ9C 4NGHL 3K81A 4DCQB 1RUAL 1GL4B 1TOXA 4Y8DC 4WTXA 1KNOA 1Z6JT 1GYUA 2Z92A 3G6JF 3OQRA 4EUPH 4P2QB 1FG2A 1KENL 2HTLC 4GRLD 2XWTB 4QXUH 4AKOA 1SDYA 2QKIA 4IDJL 7CGTA 2VXUL 2P80D 1BZDA 5AW1B 2X12A 5CZXD 3FS9A 1JZ5A 2NNRA 2WN2A 4LKCB 1TLMA 3JTTA 2P48B 3Q8AA 4X6DF 4BQBA 2PTUA 1O5PA 5HJ3A 5C0BE 2V17H 1EHLH 2LW3A 3P11H 3CSFA 3IFPB 4LDOB 4J3OG 1LJMA 3VXMB 1LVEA 4GSXA 2NQ3A 1QEXA 4P23D 3F5WA 2J4WH 3L9RA 1N5AB 1HNFA 1NC4B 3OGOE 4WWKD 4ZTOL 2BVEA 1WZLA 1F4YH 4MA8H 3WLBB 4HHAA 1WD9A 3L95A 2HB0A 2GPZA 1FVDB 2O72A 2XOTA 5DJYA 5ECGA 2BNRE 4PGDA 3GGWB 3LXBA 4QHLA 3REWB 3X13A 1A6TA 3WHXB 3IFOB 3KPSA 1H5BA 1F90H 4M03A 3I6KB 2P5EB 5GISH 4X6FB 4ES8A 5HY9B 3KWWB 3ZKNC 1HSBA 3LRLA 3DETD 4DP5X 4FS0A 1F42A 1VRSA 3QG6A 2Y22A 3LKOB 4YK4B 1OARH 1P84J 4DOHE 3PV6B 4UQIM 5HI3C 3KNBB 2WCPA 3HW7A 3FO1A 4OLXL 4OQTA 1IL1B 4M5ZL 3TNNB 1M42A 5GS0H 5EA0L 2E3VA 4KK5C 3H56A 3V2AR 5TDOA 5C7XL 1FYTB 4FQXB 3QORB 1YN6B 1A6WH 5DMGD 2J72A 3ARED 4QXGH 1U8OB 3H42L 3QNXA 4O4YH 1T21B 3ECBB 3TJEH 4FA8A 2Y5EA 4JFYB 3V4UH 1L7IH 4JHBA 1QFUL 1RURH 1HL9A 1DLFH 1OCCB 4LRNL 1D5BA 1K72A 1S8DB 4MAYC 3HE7D 1BG1A 5D1XB 3MPCA 4G7YL 3VD1A 1QX1A 2ENJA 3I85A 2EDEA 3FBKA 3RPIA 5K9QG 1UKTA 4J3UA 4ZMXA 2XIBA 5KVGL 3V52H 4EDXA 4CW1B 3F00A 4Y1AD 1I85A 1C5DB 3UXFA 4PIRF 3T0EB 2WLNA 3QZMA 3OKEA 5E6IA 3WHE0 3BPCB 4NO5A 4ZZFA 3MJWA 1Q38A 4QXUL 2OXGB 1TFPA 2DMGA 4HXBH 3GK8H 2BHUA 4X4ME 1CI5A 4XB8A 1TTFA 2J1YA 2CCVA 4FDWA 3OKYA 5BXFA 3TF7C 5IB5A 2WINA 5IT2H 4XI5D 1MCHA 2EDQA 2ZUWA 5HGHB 5DI8A 4S1RL 1PQZB 1XF5A 4YR6A 3WEXA 2D2CC 5KYXB 2CR6A 4IOIA 5AW4B 2VDMH 3JBG7 4RRPM 5M7QA 3VI3F 4EI5A 4L8SB 4N85A 2WXNA 4GI6A 4IGBA 3FL7A 4ORZC 3KEHA 1F58H 3AQXA 4IGBD 5DYOA 1E4HA 1KCRL 3UTSE 3V6ZA 4KUZH 5D7HA 3H9SD 3MRJA 4XVOA 4M6AA 1BFOA 1ET7A 2QVIA 1HQ4B 3VU2A 3CUPB 5L6YL 2NTSP 3GBNL 3L5XH 1OAKH 4PJDA 4UQ3B 4P99A 3BZEA 5IFAL 1FDLL 2PCPA 2AQSA 4U6VH 3UCQA 1M7UA 1EUUA 3GHEH 3BH8A 4WI0A 3QWOA 4QRPB 4AQ1A 4RGNB 5LGHH 3ZHKA 5FECB 4LCIH 4WEUD 1OLLA 2IV9A 2LLGA 2X9XA 4NWUL 3U9PH 3A5VA 1M4KA 5DUBA 3MA9H 2O93L 3C5SB 2JVUA 5C0AB 4BFJA 2YOCA 5GS0L 5DUML 1W0VA 3S6CA 3MNWB 4NQCD 2R0KL 5EO0B 2XZQL 4JRXE 3HS0A 2BLFA 4BFBD 5BRZE 4YXKL 2AAAA 3ZHFA 5HYJD 2ED6A 3LV3B 3L08A 1NGYA 4BIKA 4J28A 4H8WC 4AGPA 3HR5B 2EDBA 2FX7L 3RBGA 3MOAH 2EIZB 2ZPKL 4NCC2 1JZ4A 3IVKA 5EIIG 2J1WA 3E8VA 4JL1A 1I3GH 3O11A 1ECZA 2EYSA 2J71A 2X6AA 4H20L 4JFZH 2GK2A 4GMTH 3DX6B 2AVGA 1RFDH 4RA0C 5DHYB 5E6UB 1VFAB 2R8SH 3QJRB 4AM0B 1PZ5B 2P8PA 1T7XA 4WSGA 2AV1A 5JHBA 4LSQH 4HPOL 1CLOH 1LEIA 3CFJA 2BOCA 5TPWH 4ANUA 1DQTA 4OVVA 1HVXA 2J5WA 1YEKL 1EA9C 2X5PA 2R2EA 1CGSL 3BMVA 1EFQA 2NR6D 3B3BA 5FOBB 3LIZA 1ZS8B 5L4MA 1UG9A 3CVCA 4G7RB 4JFDA 3MOBL 4QHPA 2DYPD 1G9NH 2CHZA 3TEYA 2XWRA 1A1OB 3ZDYB 5C0FB 1ZXKA 2ZKHL 3FTGA 2ZD0A 5D6DC 1VFAA 1NBZB 3T77A 3RUGF 3FO9A 5F7UA 4PSRA 4HYTB 2A99A 1XGZA 5J1SC 4F2ME 4XN2A 3Q9QA 4ZUSA 1UACL 2AJSH 2DQTL 3EO9L 3TCLA 1RJCA 4MBOA 3CVHH 1U92A 3KLAB 5DT1H 5LXVA 3HR5A 2HT4D 3E9TA 4NPYA 1NGYB 1YYML 3RA7H 3ARGC 2NNXA 4BGLA 4P07A 5ICZA 4HF5H 1YY9C 3W0WE 1WZAA 3QUMH 2FWSA 3O11B 4GI8A 4K94L 2WBJB 2OM5A 3I2CL 3RL1A 1WH0A 1R3KA 4NS0A 3B6SA 4BA8A 4D9RE 2HUEA 4LLVB 2I27N 2I32A 2X4UA 4ZPTB 4BELD 2A74B 3BJLA 1CK0L 2NY3B 4FFVC 2HMID 1S9KC 4HOMA 4CNIA 3RGBA 1FL6B 5I6PA 4N87A 1I8LA 4PCSA 2Q76A 3ZKQD 4OB5L 2ZUYA 1A7PL 3KEDA 1HQ4A 1EERB 1MWAH 4WNJA 4EIUA 1LE9B 3WS3B 4XAKE 1AGFA 1MJJA 4HX1B 4ODTL 1A6VL 4UQDA 2PCPB 4PVMA 4BJLA 1S9YB 4H0HB 4E5XB 1JVLA 5EU5A 3KH4A 1O9WA 1SY6H 5HDQL 2DM3A 1LO4L 2C9UA 5ITFB 5J06A 2XVGA 4G59C 3TVMC 5K1VA 1A4CA 3DJRA 5KVGE 2IMMA 2OSWA 2F68X 1JMZA 1UXLA 3MA7B 4PG9A 3P54A 4RMSA 2WB7A 3NRPA 4GBXB 1YSOA 1WWAX 4DQOH 1DUZA 2AF2A 2VERA 3MBXL 1AJ7L 5LG6A 3VG9B 2J7LA 3RURA 1FBIL 3VFGH 5GISL 5KOVC 1TTRA 4NN5B 3SDCC 3LMJL 3DURB 3C6LC 4OFKA 2RQ8A 1MCBA 4MJIE 5ID0B 4CADA 3UTOA 2OTPA 4DWHA 1KB5L 4PCYA 2EC9U 3Q1EA 5DJAA 4AKQA 5B38B 4HWNA 5CLWA 2WTOA 3QPKA 5DDHA 4K7PY 5A16B 3GHBH 2IANA 1E27B 5DRNB 4X83A 1NBVH 2I85A 2W0FB 4HZLB 3QZBA 1R1CA 3L9EA 1U8QA 4N24A 5EEYA 5A40E 4L4TE 3S5LB 5DQDH 1KBGL 3KM1A 1AIFA 1XXFC 3ULUC 3FSAA 1C5DA 3T2LA 3L3IB 5EORH 4JJHA 3MLSL 3MMEA 4L1TA 5C0CB 4HH9A 4M5TA 4XNUL 4YS4A 2CUHA 2QADD 5EUOE 3GXFA 3HB3D 3TJHD 1PTZA 1U3HA 3IM1A 3B9VA 3BKJL 5JOEA 1DVXA 2HJKB 4PV9B 4LEOA 1CFMA 1KXQE 1JIBA 5E9AA 3UGEA 4A68A 4ISVA 4A7UA 5EOQL 1ZT4B 4U3SA 3L3OC 1XIWB 4LSVH 1K8IB 2BX5A 1BVNP 1C1EH 3Q8FA 5KAQF 3NJVA 3A4AA 5C6TL 1BLNB 1R3JA 3WHE1 2CA3A 1DYZA 2YKLH 2RCSL 3PGDA 4RZKA 3P9MA 2COVD 4JQIH 4JREC 1QQDB 3Q2NA 2NY5L 4K3JL 1Z3GH 1TEFA 3U1SL 2G0LA 3I9GH 2BXZA 2FX9H 2W1NA 1T83A 2A74C 5DEJA 2WZ5A 1P7QB 3FB6A 3WHXA 3M17B 2EVIA 5IMOB 1FVCB 4G8FA 4UTBL 5AENA 2FWUA 4LEXH 1KFAL 1XCQB 2CJ3A 5IW6B 4BZ2L 4JM2C 1ET5A 3EJTA 5J3HD 5B38G 2H9GB 1F2QA 4OFIA 4OCSL 1SHSA 4Y4HD 3VD7A 2J6EA 5C6PB 4I9WD 4KDWA 3DUUA 4KZEH 5D6CA 4M8QB 2EDFA 5HVHB 4I87A 2GEQA 3UTQB 5BO0D 4PJ7B 4CJ1A 2F7PA 2XU9A 2VXQA 1ASPA 5I0VA 3RX5A 3EFFA 3MNMA 1IJ9A 1F11A 3HNSH 3H2WA 4I9WE 1NCAH 3FOLB 1KYFA 3AS2A 4NHUB 3LEVH 2FDBP 1UOVA 1MJJB 2FSDA 3L81A 1JNLH 3GWJA 1MAKA 1NM4A 3M8OH 1OGTA 2UX7A 3BGAA 4D3CL 3L5XL 1LE5A 1MRFL 1ZSDA 1BWMA 2Q76B 2WIIB 1V3MA 4OCWL 3SGDI 1JXDA 4YC2C 2Z92B 5FR3A 1BLIA 4ODHL 2PF6A 5MEQA 1M7DA 4CAGA 2P7TB 2XBTA 4KKZA 3VXRE 3QRFM 2A4ZA 2AV7B 2E0PA 3X1NA 4JPQA 3EFDH 4LPYA 2FSEA 1D9KA 4U4BA 3K6FA 1PZAA 4PJ9A 5DD6A 2Z7UA 3SOBL 1UOLA 3MV9E 2F9BT 4AYFB 1DJZA 2JK5B 4B3EA 4G3YH 1FG9C 2DQMA 1NGPH 3BAXA 4ZQKA 2RHEA 2D4DA 4ODWA 3VFPA 3HE7B 2F61A 2QHRL 4JFDE 3FONB 5JORA 3O2VH 2ODHA 3MR9A 4TUUA 1KCUH 2XHNA 4MAYA 5E00B 4ZSOE 3KWUA 1QFPA 2CO2A 4P23C 3ZYIA 5JW4R 5DMIL 1HIML 5FHAL 4WWKA 3CFQA 3UZEC 3FQNA 4M93B 4PGBA 4X6DE 1CFVL 4X7SH 2P1YA 3OLEA 2NYKA 3F58L 1D5XB 1ZLUH 3WJLC 4YHZH 4EKXA 4HJSA 3MRKA 3HI6L 4KKCC 1TYEB 4DP1X 1CUOA 1ROCA 4Z3FA 3C60A 5DJ8A 1F86A 1EFXA 1DTUA 3MOBH 1SLUA 3ARPA 4PR5B 4UQAA 4WDIB 2GT9B 5GGTH 3NIDF 2MOQA 2BOLA 2KBGA 5D72L 4OFVA 3QUXC 1AFVH 5TH2B 1MFAH 5DHXB 4L0ZA 4LCCB 1P5UC 3PDGA 1F5WA 3RTQC 3S4SB 4KVCH 5CIPH 3GSOA 5C0RL 4OF6A 1NUGA 1W6LA 1F0LA 5HI3D 3HE6B 2E9WA 3D9AL 4NO2B 5AZEL 4KJYA 2JQMA 3ZDXB 4N2IA 1V3KA 1EZVX 4F33A 4M5ZH 2CHDA 5BUAA 2GUOB 3NZSA 2WZPD 1WIOA 4ADGA 3ZMRA 12E8H 2YXMA 2Y6SD 2O6FA 4LVNB 4C57C 5EO9A 4C83A 5JW4Q 1AD0A 1KYUA 3WXWL 1NAKH 4FLQA 4ODVH 1ADWA 2VH5H 4N25A 5C92A 2R1XB 4WU7A 4U1KB 1FFQA 2XZCL 1URIA 3BHBB 2X0UA 4LAJH 4NUGH 3QJTB 3QR0A 4PMFA 5T3XL 5MENB 2O6PA 4NQEA 1BZOA 1QHOA 4K5NA 4EQ2A 2FJSA 4UQ2A 3S3CB 4WLCA 2L7EA 3H6AA 2QEJA 3FFCD 5F44A 3QJUB 4UB0H 5D4IA 3BLPX 4LLWA 3MX0B 2Z1KA 1Q9KB 3DMMD 4IHBA 2JFCA 3EJZC 4X9GA 4L29B 1JWUA 3WEOA 2NY6C 3H9ZA 3UDWC 3ABGA 1R5IB 2A9AA 2PUQT 4HSCX 5B3JF 2H32H 3CNKA 2UX6A 2DQFA 1OB1B 3REVB 1QPKA 2E9JA 3MRGB 4LT7A 2PETA 4A66A 3C5JB 3RWCA 5ILTH 3G5ZA 1KV7A 5G5DA 1VKXA 4DTGH 3KDMA 1JN6A 3MX0A 3DVIA 3EO9H 5IW3A 1SQMA 1OQXA 2XXGA 3NEXA 1OTTC 3PWJB 1R5IA 1E5UI 1VFMA 4KHXH 4YSTA 3ZDZB 4YSUA 5F0LB 2ZZUT 4Z7VE 4R7DB 5IFJB 1MI5E 3MNVA 4DQAA 3QULB 2QQLL 5MENA 2ZWKA 4HP5A 3DO7B 4HUWA 4D0CB 1U8JB 1KTCA 1S78D 3D39D 2O5YH 4J3OC 1G1KA 1IE5A 4FTVB 2J1XA 1D5MA 4FHJA 2P5EE 5AUMB 4LFHG 3LVTA 1QR4A 3NGBC 5J57B 2KZKA 4NQSB 4M61B 3ROLA 5FHBL 5C2UB 1J5HA 3PXLA 2G3XA 1X9LA 4DETA 3QEGL 4X9YA 1HS6A 5GRUL 5J11B 3S8WA 2WLHA 3QQ4B 2C9QA 4Q9RL 2IQ9H 4IMKC 1C16B 4YUEH 3EOTL 3I3BA 2WB1A 3ASOB 4FNTA 4MRBA 3RVXC 1U8JA 3F05A 3TYGL 2ICEA 2EIEA 2GC7C 2HWZL 1I75A 4G8GE 4F91B 4TSCH 1PGRB 5C08B 3H1ZA 2A6IB 3B2UC 3QXVA 4FRWA 4UB0L 3Q8EA 5KSBB 4MD0A 4FZEL 1WHPA 3P2BA 4HETA 2EXWC 2XWXA 3HE6A 4NO2A 4YXLH 3KE0A 3GZOA 3OKDA 1U91B 2XIIA 3P4OA 4RMWA 3RHWK 3VXOA 4AGNA 1N18A 3G9VA 1OOAA 2IPUG 2X3BA 3EH2A 3MRKB 3WTXA 1WAAE 5TE7L 3RL2A 3W2DH 3TT1H 3B7TA 1H3XA 1J0IA 2D9QB 4LCCA 5DRZB 1AHWA 4RZCB 2IXQA 2PYEA 5AB0A 1YQ2A 3IJ8A 3PGCA 1OT2A 3HAEB 4WTWA 3FPYA 5CEZH 3WN5C 3Q13A 3T5WA 4AL8C 4U0QB 4GH7B 1HINH 3GSNH 5FO2A 4IRSD 3I02A 3L54A 1ACZA 2RACA 1RCYA 1HT6A 4R97C 3V6OC 3SKOB 4XP9L 4KPHH 1AIZA 3GZQA 5T1MA 2ZAIA 1HL8A 3QFDB 3PXHA 3NJKA 1H3PL 4FERA 2BM3A 3X1EA 2ZWSA 2R4RH 4XPBH 1AR1B 4WI4A 5I6OA 3G6DH 4NNYB 5F7YC 3OMIB 4W6XB 2D7QA 3T3PE 2ZXBA 5D2NB 2J1ZA 3WE6A 3GMNB 2FSEB 3T0EC 5GGUA 3QS3A 3J8F7 3VFPB 1J5CA 3KBHE 1UACH 1NGQH 2AJSL 2BNQA 4QRQA 3ABLB 4MB4A 4ABVA 4R7VA 1XGYL 1NCBH 4Y7OC 3ARGD 1ZDSA 2DN7A 3N1QC 3K5RA 5E8DH 3TPKA 3QXWA 4PTTA 3B2XA 2J6WA 4S1QH 1B4TA 4DFIA 3GRWA 3DV4A 1D9KB 4O2FB 2EIDA 3EJPA 5CGYC 3EHBD 4YIQB 4BA0A 3IJEA 1G5GA 3JV0A 4QCIA 5AYUL 4UTAL 4LIQL 4MD5B 4M1CD 3IMWA 2ALWA 2Q2EB 2XPYA 2ZG2A 3QQ9C 4DT2A 1AXTL 4PRIE 5KS9E 2YWYA 3SE3A 2X4SA 3KL5A 3AM8A 3LKSA 5CBEB 4J5VA 4QI3A 4XWOC 5DK0B 3TH2T 1WRFA 4WWID 3CJJA 1QFWL 5H37H 4EN2A 4H8HA 1E4XI 5T1KA 3NGBB 4FNUA 1EAJA 5SX4I 4CGTA 4JCMA 4KRPC 4N2CA 1UWEH 4P5KB 2ZF8A 5I8CB 4A7TA 5L7XH 4FG6D 1N8OE 2DL2A 4AV4A 3MGOA 3Q05A 2VLKD 2K6YA 4N2MA 4UAOB 1G7QB 4Y9CA 1D5ZA 2V2WA 3IXAB 4ICWA 4ZNEA 5BRZB 3MREA 5D6CB 3KXFD 3DUUB 4URTB 1C8PA 4WUKL 1GOHA 2J8UF 4EI5C 2FBOJ 5DR5L 2HKFL 2WSDA 1HYSD 1U8PA 2WKGA 4K23H 4XVJL 3BMWA 1E3XA 2VLME 1SEBB 4AEIL 2HX8A 3VXTA 2WQVA 3N6YA 2WBJC 3BP6B 5TQ2L 1MVYA 1RHHB 4X5XB 1MWOA 1NCAL 5DZ9A 2XETA 1YUKB 2V5TA 3L1OH 4H1LH 3RWEA 4HU8A 3LEVL 3QAZB 4X0KB 3N40F 1QKZL 3T04D 4BKTC 2JCCA 1I8IA 2LVEA 2AJUH 5TDPB 4WNQB 1IJNA 1QQDA 4EIZC 5K5YA 3B43A 3LNEA 4NUPA 2CLZA 2Q3AA 4ABUA 1MVUB 3U9UB 2PO6C 1R3HA 5FDYA 1S3KH 1U36A 5GRVL 2V4LA 2H3KA 2FQGA 3HLKA 3HRZA 3F12A 4GAJL 4K9JA 3MV8D 4LU5H 2PABA 1IV8A 2X4NB 2QSVA 5FA4B 5HD8D 3FF7A 3B7YA 3IU4L 3D2UB 1TETH 1T5XB 1Q9LA 2GBAA 2F1AA 3QZLA 1S2EA 4DGVH 3A23A 1HSAA 4PRHA 2APXA 1GVIA 4XXCA 2JIXD 3SKUD 2OTUA 1NEZG 4P2RD 2R29H 5I19H 1DVZA 4LQFL 3S5LG 3UZEA 3IE9A 1GYCA 3NJFA 5T3XH 3TBVA 2QADC 3FOLA 2BP0B 3EDJA 4KFZC 1TYJA 1MKFA 4H2AA 4ZK8A 5B38A 1ESOA 5DVKA 3AAZB 1TQTA 4RBPH 4G6AD 3GXPA 4I3GA 4JK0D 4M8QA 2FWOA 5D71H 4GSDL 4LVOB 3DX9B 3V4VB 4B0MB 2UXTA 4PV1C 4D8PB 4P49A 1UQSB 4NZUL 4AQOA 1E30A 1IC4H 1QSFE 1FL5A 4F1ZA 1SUJA 1AGCB 1KFAH 4H1LG 4JDEA 5KN5A 1FLRL 2YAOA 4KV5E 4XO3A 3SBRA 4JO1H 1Y0LB 2FD6H 5JQHC 4PLKC 1WA1X 3J07A 4AT6B 1VPOH 1L4IA 1P7QA 3DGGA 5GRJL 1S7QB 1JL8A 3ESUF 3P73B 1OAZL 4P59H 5DMKA 3MBEC 2IH1A 3GMNA 5H94A 3S34L 1T2QL 5T5NF 4NO0A 3GM8A 3UAJD 1B6UA 3H2PA 2V5YA 3E7JA 3GTVA 1Q0XL 3HS0C 5IB1A 1FFNA 5I1HH 2O5XH 3KR3H 3O4OB 4JM2D 2DKSA 3WUWG 2RR3A 3NSFA 3WDJA 4HU2A 4Y4HC 5KYWA 1J0JA 3ZYOA 5EU5B 3MBEA 4ISVB 2EO7A 3LOWA 3JZYA 2Z7ZA 1T1YB 5ELIA 1N19A 5IFHH 4DH2A 3ALWA 4KKLC 5E9DD 5JHDA 1A21A 3C08L 3RZCC 3KPRA 2OJZH 3LCYA 4Y19A 1WUNT 5D1QD 3PL6B 5T5FA 3T6QC 5DRZA 4F9PC 3PCYA 5L4IA 3PQYD 4JREB 2BNRB 2JXMA 1K5NA 3IDJA 3L2LA 3PJLA 4FG0A 4UT9L 5EBMB 1REIA 3LH9A 4Q9CA 1U91A 2IJ0C 1ZT7A 5HI4C 4UTBA 3NFPA 2D0GA 4APQC 1AQMA 5IY5B 5IIEB 1JZGA 1PSKH 2Q5BA 4TKWA 1XSJA 3F7YB 2OXHB 3V7MA 1JCVA 2VIRB 3DDFA 3UZVA 1MWAL 2B7DT 2H6PA 4YXHL 3V4VH 1OK8A 4F7CA 4OCRH 4Y16D 3KVQA 1FC2D 3H0TA 2XRAH 4EZMA 4Y16A 5D7IF 5DHDA 2Z8WC 1ZXQA 2B9BA 1YEJL 3TOPA 4AXWA 5DTFA 2W0KA 4HD5A 4A6YB 4JKKA 1QVOB 5JHDD 2HA1A 5JIPA 2NY0D 1A2YB 1FNEA 1WE5A 2KQMA 3FRPA 4MCNA 1HHIA 3F7VB 4U33A 1PLGL 2H2PC 3QCTH 5D7IA 1L9QA 2VUYA 1JDDA 2H2SD 4L3FA 2PYFB 1WHOA 1FNFA 5I6NA 4FP8H 2I9TA 4BSJA 4S0SD 1WT5C 1OW0A 3AW5A 3MUY1 3TURA 1O7DE 1S6NA 3FUNA 1OAZH 3IMUA 4P59L 3RHWF 3TBYA 4Z77B 2X4RA 3NQKA 4HUWB 1DLHB 4K3EL 1TZOA 2WSPA 5K1NA 2P3YA 1G7HA 4LQ1A 2HP4A 3UDWA 3WJJC 4JQIA 1MF2H 2DQIL 4AWJC 4OLWH 3A47A 3B2VL 3KDPB 4QY8B 4DP7X 3TZVB 3MRQA 3NCFB 3D0LA 4WU5B 2E7LA 5B22A 4B0MM 1XIWC 2ESVA 3I9AA 5D7KE 3T0EE 3UAAA 5FYKD 2EABA 3FHEA 4MSWB 2BRRH 1BVNT 5JXED 1FLTX 5KVEE 1E42A 4XP4H 2W59A 2EIZA 2HFTA 3IDMA 5FUOH 3PS6A 4CKVX 4IBVA 5E9DE 3VMNA 3BPLC 4JJ5A 1G87A 3HS0B 1MFBH 3TBWB 3O8XC 2TRHA 3MNWA 5CM1A 3LH2L 3OKKA 2DQCH 1UA6L 2N01B 3BDXA 2VMEA 1T89A 1YNKL 4OZHF 5B7EA 2VSCA 1EJOL 5K9JL 3MROA 4P46D 1QUNB 1N0LA 3S3DB 5JHMA 5GS1C 2HLEB 4U1SB 4IHOB 4EJ1C 1R3LA 4RA3A 1WFOA 3P77A 1QO3A 3GMQB 3N1FC 4BZ1L 1JZ6A 1JYXA 1AC6A 1AC0A 3WMSA 4P5MA 1CDCA 3D6GA 3FTGB 2YBGA 3CZUB 1TPXC 4DO5A 1F4WL 1MFDL 2ZCLH 4YPGA 1QFWM 2XQBH 3PDOB 4WUUD 1EO8L 1XF5B 4HUMB 4EZKA 1UKQA 1JE6A 4X4YB 1F3JA 4QRPE 2IPTH 4XXCC 3C60C 1WFUA 3RIFK 3W39A 3SDAD 2GTWB 3ASNB 5M95B 2HT2C 1ULVA 4F2FA 4Y4KB 4HOZA 4GRLB 3MRCA 1T66D 1CDYA 1LDSA 2DI9A 3D06A 5C0AE 3RJQB 3WEXB 5KYXA 2OXGA 3WFDH 4PLNC 2IDQA 3ARXA 1JRHI 2Z31B 1G7JA 2PXYA 3CDYA 3BUDA 3QFJE 3MRDA 2E8ZA 5BXFB 3CFNA 3O3DB 2X3CA 4OV5A 4Y19D 1BJ8A 3ZPDA 1EVTC 1GA2A 2UVEA 3POCA 5TTRA 1A14L 1E2ZA 1YEHL 1I8MA 3BQUB 3T0VA 3Q6GH 3LD8B 1MCOL 2YRBA 4L1DA 4WGVB 5DJ8B 3SQOL 1WK0A 3L9YA 1ZHNA 5EC1A 4KTDH 1S8DA 1WS7A 4AW7A 2HH0L 4PJHE 2ARJQ 2YO3A 3LPWA 4H40A 4WNSA 3IDYB 4HUCA 2BSTB 1D7CA 2RJMA 3RPIB 4KVPA 3RGHA 1CIDA 1RU9L 3E6FA 1P4IL 1ZGLM 1T21A 2J3SA 5GS0D 3IWVA 1HH9B 4PP1C 5EHFA 4LPTA 4K8RH 3U7WH 3MR9B 4N0CC 4B60A 3QYMA 3BZEB 1SFDA 4FADA 1PZCA 3O6ML 2K1MA 4P2AA 4X5WA 4EAEA 4WK0B 1BVLA 1ETZB 5JIIA 5IVXE 4ZQKB 4S0HA 5DFWH 1R5VB 3MZTA 3RVXD 1MHHA 3KNBA 3CVHA 4FQCL 4X6DA 3ELAT 5FF6B 2H8PB 2MTAA 3WNPA 3GRWH 2P47B 3QORA 4F2MB 4KY1L 1HI6B 1F8TH 2DQHL 4QJ3B 3BQUD 7FABL 1R19A 3TF4A 1NGWB 2G5RA 4ABWA 4UV7H 3SPJA 1MCWM 4XMLH 4D7PA 5GGSB 4HIIB 1Y6MR 3D09A 5AB1A 3MRIB 1DSFH 3ZT6A 2R0WH 1CN4A 2XLLA 4F8NA 4JRYA 2YC1B 2R7EB 5HDLA 5IV2A 1PU0A 2EH8H 4MA7L 1GZPA 1Q9WB 3L4CA 5EBWB 4HXBL 2ROYA 1IAIH 4IK7A 1TJIH 4RAUA 5D7LB 4G70B 8CGTA 3HNVL 2H4EA 4G5ZH 3LX9A 4UQ9A 4WO0A 3FT1A 4E36A 1HWWA 4PB9L 2J25A 4JVPA 4XCCH 5D96C 1WFJA 2XN9E 2YSTA 3OZ9H 2Q7AA 5C0AD 2BSCA 4IRSB 4RBPK 4UBDC 4F15C 4O2EB 2H3XC 2JI1A 3VWKA 3L8QA 3QUMB 1UYWH 2LU3A 3FH5A 4NN6C 3GIZH 3L9RB 4GRMA 5E9NA 1JBJA 2DWEA 3MRFA 2APSA 3CN3A 2R69L 1CD1B 5CZRA 2IWFA 1ICTA 4GMTL 1VJSA 4PG2A 5D7KD 3T0ED 2VN4A 1K3ZA 1ITCA 2CG9X 4DCQA 1UXWB 2AQNA 2IWEA 2ZKMX 3BP5A 3KL3A 3L1EA 4PUBH 4OZFA 3SDCB 3LZLA 5J7CC 3K0WA 5EEZA 1YQVL 3LEXA 3FH7A 1E43A 2FJGA 2HZHA 4KNSA 1JUFA 2VR8A 4Y9EA 4JFOA 2B4CL 3BGMA 5DVMA 1SYVA 4X7TA 4QRAA 4NXSA 3ARBD 1BGXL 1IFHL 3CVHB 5ALBL 1AS7A 3QI9B 2A4EA 2NTFA 2F54E 3PJSA 2BRQA 1SOKA 1K8IA 3ESVF 2JTYA 1U93A 1CF8L 5ESQA 4FTVE 3O3EA 1MAMH 1S5IH 5L9DL 4Z95H 3QUKB 3MA9L 4XNUH 2IMNA 1K5WA 3T2OA 1J9QA 2OMZB 3IETA 1JNHA 1HEHC 3NPSC 3EDKA 2VERN 1YEEH 5BV7L 4JFOB 4L2LA 3FRPG 1XCWA 5EOCJ 5IQOA 2QGEA 2I24N 3ZU8A 32C2B 2A9BA 3FUJA 1L6PA 3QT2A 5H35B 2C9SA 4O2EA 4U2YA 4WHYH 2JJVA 2QVFB 1Q0YL 3X13B 1SHWA 5C6WH 1CD1A 2EQDA 2ZOOA 2EKSA 2DWEB 4QAMB 4BSWB 5GSVA 5HYJA 2YR3A 5GZOD 4ZG1A 1A1MA 2R1WA 3CN4A 4PBWD 4RMRA 5KSBE 6FABL 2ENSA 3HFMH 3MLVL 3PWNB 2IFFL 2M26A 4XH2A 3I9GL 4U3CA 2QTEA 5DJAB 5CR1A 3HKFA 1OQOA 1D9KC 2G4GA 3F5WB 3HI6H 5E8EA 5AL8A 4BRJA 2QELA 1VGEH 4OW6A 3MHZA 4WJ5B 4V1DD 4KBPA 4FQQB 5BCAA 1OHZA 2UVFA 4PLJC 5HJ3B 5KYUB 5DZOA 2X9YA 1JJUA 1MFMA 4MD4A 2DWYA 3CHQA 4LCWD 4NC2B 3IJEB 4ZNCD 3W5MA 3H9HB 5L8KB 3GXMA 2P4AB 1WZ1L 3SPHA 2V7NA 1JG9A 2YARA 4HIIA 5E1IA 3PDOA 3QIBC 2EEAA 4OT1H 1PSKL 4I1NB 2HN7A 3D39A 3HPLA 5F88B 3MLWH 4GG6B 3L13A 1FNGA 4UAOC 3VH8B 4D0DB 1HI6A 5CIPB 3AM8C 2KYIA 4Y5VA 4N5EC 2YXWA 3TYGH 4M1GL 3T3PB 5FM5O 3N41B 5FF6A 3OAYH 4NSKB 4X98B 1XEUA 2EEXA 5EPMB 1MHHB 3CU7A 3CBJB 1MAML 4JLRB 4R90H 3W82A 1DJIA 3BKMH 1A02N 1ZGLP 3WKMH 1ZMYA 4NYLB 1FIEA 5BNXD 1L0XA 1Y18A 1C9SA 5IK3B 3AITA 2ITEA 2Q87A 1K4DB 2X2UA 1UCBL 1LWRA 3X1BA 1NLBH 3BVUA 3PP3H 2NNFA 3BAKA 4I2XE 5JPNA 4LCVA 4PGZA 3LKRB 4GO6B 1IT9H 2Y06H 5I1CL 1MCNA 2LT9A 1I8MB 4ALAC 4HIHB 3G7TA 3EGDA 2EEFA 1OTUD 4B9YA 4OLUH 2HFEA 3FSVA 4QXWA 4OD3L 3UOAB 2RAMA 3ILPB 5KSBF 3JV6B 2PCFB 5DJDB 3BAIA 5I6XB 1MRCH 3GQFA 3QGVA 1J12A 1OSPL 3HG2A 2DV6A 4PJAA 2XKNB 3LXUX 5EDXA 3RWFA 3INOA 2EYRA 2AI0L 1QABA 2E76C 1I9JL 2NZ1A 1EDHA 4H7VA 4R7NA 2TRYA 3VXRB 3F6LA 1W8EA 3ZKSD 2PCXA 1HC1A 4KKPA 1CICA 1A4KB 1WAEA 3EADA 1QSEE 3NN8A 3MV9B 3UAJC 3S8FB 3T77B 2CE6A 2IH8A 4XNYH 1Z5HA 2EILB 3CIQA 4YPGB 2VGLM 3TWCL 3W0WA 1ZPUA 4FF9A 3FB8A 3QG7L 5HXMA 3RP1A 4BH7A 2I9TB 1L9PA 2K8MA 2L7UA 3DI3B 4TNVF 3UBHA 3W39B 1ZDQA 1QLFA 4XMWA 1KXTB 4RETB 4I88A 3LH8A 4QGTA 3ZDWA 3X12A 1PG7H 2YAPA 1VGEL 3UYOD 1TMQA 1PY0A 4GAGL 2CIIA 1QUNA 3O3AA 3RZCD 3CFBB 4JANB 1AKJB 1F3DJ 2VR5A 2YHGA 3S35H 4LOVA 3FT9A 4M6MH 1QVOA 1LILA 5KOMC 3AXLB 3BKJH 4LL9A 3ETTA 2NR6A 4Y5VC 4L0YA 2H6PB 1BZ9A 4AVIA 5L0QB 3B3IA 5DK2B 4I18C 2XQ0A 4L3CA 4PJXF 5AYQA 1W8NA 5F89A 5JIHA 1RK0A 2VDML 1QTPA 1FYHB 4J23A 5E23A 2F8XC 35C8L 2NSXA 4P4KD 3BXNB 1K6QH 1TU2A 2FQDA 4NRXA 3D8MA 2VWEC 1BXVA 5DMIH 5EUOA 4L5FE 4FFYA 1OE2A 3NCYS 3U0WH 4WU5A 4M7JL 4FL4C 2F58H 1KPVA 4IKKA 3H7BA 1ZE3H 2EIJB 3MLYL 5JHDB 2H2PD 1MFEH 1OANA 3EYVB 4OH2A 4PRNA 4W6YB 2BVPB 4IRZL 5SWQA 5EBGA 1JERA 1CGSH 4PV8B 3UH8A 4ZX5A 2HX7A 2ENPA 4IJ3C 3ZE0E 5FO8A 1YNTF 2Q0ZX 3ZZQA 5L8LB 4MYPA 2WUBH 5FB8B 4LB8A 3NDYE 1JGEA 5DVNA 3O4LD 4GW4B 3EGSA 1KPVB 4FLOA 1HYRC 5A3IC 2E56A 5E99H 5T3ZH 5LNEA 1URZA 1INDL 3SZKC 3CLFL 5F8RC 3DECA 2X1XR 1PX4A 2FX7H 4A6YA 1YYLH 1OOWA 4HC1A 3PNWB 2HT3C 4W9CC 1RK0B 2BP8A 2NDFA 1UZ8A 1UOKA 4LP5A 4G42B 4UIKH 1AOZA 4M7LT 2VH5L 2WGXA 4OUUB 5H37A 3L4XA 2HRPH 3FT0A 2WWMC 3QDAA 2ZKYA 4GB9A 2HLAA 3QH3A 5AL0A 1C7SA 2FWOB 1X6LA 2CALA 3HG4A 2VO5A 3EF7A 3JWOC 4YLQT 1LK2B 2DOCA 2GJ6A 3SOBH 4XGZA 2UY6A 3FT4B 5F1IB 1H8LA 2GSIB 3PWVB 4N2HA 3GSVB 2JKWA 4HWBL 4TVPL 3RWIA 1R0AH 3TBVB 1B6DA 3K72A 5E2VH 2ATKA 5H8DA 3QDMD 5EOCL 3F04A 1Z9SB 3MJ9L 2ZP9A 1YNKH 4PSPA 3J27A 4UV7L 2DI8A 2UY7B 3EF4A 3MV7A 1SJEA 4KUCD 5C6TH 1YEGH 3ZDZE 2AABH 4B9ZA 2BC4B 4OFYA 4AG4H 4G11A 2HX9A 5T3XE 2KLSA 1S9WB 4NRZB 4HZ1A 1FLRH 3E1ZA 2MCAA 5FWQA 2KKQA 3B2DC 5B1AB 4MA8L 3PU7A 1RP9A 4CMMB 3OJ2C 3MV9A 4GW1B 2WZ6A 5AW0B 4WW1A 1MFCH 5F2FA 9PCYA 3NJGA 1YEFL 3V4PA 1R3HB 4I3RL 3PL6C 3EGXA 4I18B 4U6YA 2P5PA 2VRKA 2HFFB 4MJ5A 4HLJA 3WTSA 1CXKA 2X6CA 5KJRL 1KJ3H 1HXMB 3P73A 1JTTA 4OCSH 4R4BB 5DMKB 5B1KA 3VRLE 4WV1C 1P4BH 1OGSA 3ELQA 3QHTC 4H0LC 1A47A 1IAIL 3GSNA 3G08A 5CCGE 4KK9C 3NUKA 3EGDB 5C0RH 2ZOKB 4KKRA 1BOGB 1N0XH 4FQIL 4RGNE 3VTTA 5CILL 4B95C 2DBJA 1G7PA 4AJ0A 1RUMH 1T22B 4PUBL 5C9JB 4XMTA 1QRNE 3N06B 1SXCA 3QQDA 4PCKA 1X5ZA 2A6JA 4EI6B 1G7MA 1QR1B 1FGVH 1A6TB 2CDEA 1INQA 3MCYA 3S7GA 2R9HD 4WW2B 1SY6A 5MEQB 1JZJA 3SGKC 3A24A 1P7KB 4AY0A 4UYPA 5EO1B 1S7UA 4IDLA 3R18A 2X28A 1NFIA 1UQSA 5DU7A 1S3RA 3RWDB 1E4JA 4X98A 4A2LA 1PJWA 4OCXH 1UUSA 4QHKJ 2BP5M 3ZT7A 3INUH 5JDSA 2HJLA 5T3ZD 3ESOA 1B0GA 3TZVC 1TITA 4RSVA 3IE4A 4F80A 2FT6A 3KYMB 4PRID 4R96A 2CDEB 1S7VB 2HCZX 1MWAB 3KGUA 2XZAL 4GT7A 4JN1L 1BJ1J 3OAUL 2NW2B 4XVUC 4NGHH 5MEPB 6PCYA 1EUTA 3ARBB 4TOYH 3QFGA 2XNAB 4KX8A 1P6WA 4P8QA 4CC4A 5D2NE 3CVBA 4TS6A 3VXRD 1F4XH 1S5HA 4WW2A 4KKAD 4WO4C 1QG3A 3ZE1F 4JRWA 1J10A 3BQUC 5DZJA 4YN3A 3FB6B 2G60L 4EVNA 1H9DA 1MFCL 4MX7A 1JGUH 1U8KA 2DJUA 5DEGA 2BY0A 1T22A 2WWKO 3CXFA 3UACA 4A2FA 5HYIA 4HUVA 5KVDH 3PGDB 4AYID 1NPJA 3EOBA 1CR9H 3PWNA 4XH2B 1RZGB 1BLNA 2PXYC 3L6FA 1FO0H 2CLZB 1JI2A 1UHVA 4A7GF 4ANKA 2CDFB 2E86A 5TDPA 3FN9A 2BWQA 1BD2A 3M86A 4XBPA 1AQKL 3VJ6B 4AYMC 2VABA 3I6LD 3QJFB 4Z0BH 2B39A 1F4YL 1NMAH 4XVTH 1QTSA 5BUPA 4AL8H 2F54D 5E51A 4S1DD 4YDIL 3IJSB 3QDJB 4GXVL 1TXKA 3UCRA 1UH4A 3V6BR 4TL4A 3SDDB 3BP6A 2R15A 4K73A 5D7LD 3TIDB 2H32A 1BIIB 1PF3A 2OPCA 3DPBB 3T4AA 2IAND 4Z5RB 2UY7A 4YDJA 3QG7H 3X14B 2WNGA 3CVDA 1T7ZA 5LAXB 1ORQB 1XGYH 2AEOA 2I07A 3VRJB 2OMZA 3MUUA 5C7XH 2ZUSA 4TV3A 3DK2A 3GSVA 4JG1L 4XOEA 1QZNA 4P2OD 1KTLA 1FH2A 3V5KA 1NCDL 3G5WA 1NGZB 5HHOE 5AAMC 1E6JL 3SE8H 3QFJB 5DO2C 4NN5C 3GHPA 3U2JA 2DM2A 1A5FH 5T1DL 1AZRA 4GP8B 4LBEA 1OPGL 1CB4A 4HISA 3FMGL 4N28A 3MV7D 1IQDB 1BFVH 2ZX8A 5DQDL 2PO6B 4WY7L 1HOEA 3WNKA 2FEEL 3NOIA 4GRLC 4UDTB 1AQHA 1L9RA 4FTDA 1KBKA 2WVUA 5ADOH 4AV5A 3APCA 3MRHA 1A6UL 2A1WH 2X4SB 1Z5LA 2YFOA 3MJ7A 3C6SB 1XAUA 2OBGA 2R29L 4Q9RH 2ETWA 3QI9D 4Q58C 3BO8A 3ILEA 2DIEA 2C7UB 1EGJH 4JM4L 4NB7A 3QUZD 4OZIE 3CHPA 4YHPB 1CE1L 1LP9B 4MS6A 5HGDA 1JGEB 1YY8B 5JR1H 1KIPB 4DN4H 1KN2H 3K71A 2H26B 2F8IA 4PRAB 1HHHB 1ZY9A 3ZTCC 2DW5A 2BDNL 4P2CG 5FW6A 1MHEA 4BXSV 2Z93B 4WTQA 2SODB 3HKZA 1DANT 3OXSB 4AEFA 4G8IB 4KV5F 4E68A 5GGTA 4IDJH 1E4XH 1ZE3C 2QDWA 2E5EA 4P2QD 2V8MA 1OE1A 1WITA 3CSTA 4K3EH 3K0YA 5HYJE 1XB3A 4L4TB 2VDLB 1U58B 3G5VB 4CVZB 3C9NA 1X7QA 2VR9A 5IHUL 3VFNA 5KG9A 2ADGA 3WBDA 1YEDA 3MRGA 4D9RD 4L8SC 1JWSA 4OLZL 4HCGA 4JM2F 2J8UB 4LAQL 3BRGC 4AIZA 2AP2A 4YGVA 3F6IA 4ZUVA 1MCPH 2YQ3A 2NLJB 2VUKA 1F97A 5D7LE 5EUOB 1NEPA 2WBJA 3L5WA 4Z9KB 1KGXA 1TZIA 1GC1H 1WA0X 1B4JL 4JDZA 4JN2B 4W9DC 1NFDF 3E9UA 4AJYV 4FMKA 4JVUA 3U7YL 3Q01A 4KJPC 3GMRB 4ODUA 1IGCH 1QSEA 2G75A 3KW7A 3VFMB 3SBQA 1T3FA 4PBXA 1QOKA 1KTKE 1MRFH 4ZUSB 2GAZA 4LMQE 4UQ2B 2R0KH 1ZWIA 1WICA 2APTA 3HLAA 3QJOA 4G1MB 3NCJH 5G2NA 5F7MC 4PJXB 1ZV2A 4MAUH 4ALAH 4M61A 3QUXB 4TSAH 4H5SB 3GXIA 4YZWA 4RQQA 1AO7D 1A7PH 2IPKA 1YLBB 3VD3A 1X5HA 5IHHA 2F15A 3QJQB 4YHIA 3S37H 3I6SA 1X7SA 2YBRA 2Y5TB 5LDSA 5ITBH 1KBPA 4L3AA 3PG2A 1DUYB 2D73A 2NY1C 2VISB 2WMPB 3RYMA 5SWSE 1O7SA 2GAZB 3WN6A 4NP9A 1XL6A 3FB5A 3CZLA 4U1HA 5CEZE 5EBLB 3QCUL 3UYRL 3VAEA 1FYTD 4FQXD 4FXGC 4JRXA 1MREL 3V6FA 3TBTA 4OQTH 5IQ7H 1JVKA 2EDRA 1YEKH 2J57A 2XV3A 3KDMB 4JDZB 3WIIL 1JXGA 1OEZW 1Q72H 4GRLA 3GSWA 4TQHA 1FJ1A 4Z7NF 4Y4KA 3L5WB 3PGFL 2YA2A 3S35X 5IBLC 3KYAA 3RBSA 2YPLB 2XKSA 1VZIA 4UT6A 4DZBB 1JWSB 2P9RA 5C2BH 1EFXB 2XZCH 4HS6B 4KDTC 2CCWA 2CO3A 5SWZB 4EEEA 4M93C 3MRMA 1RXLA 4YHIB 5MEOB 1YPZA 2D8KA 2DL9A 3DK0A 1RUML 1COBA 4TPRL 2C8NA 1K4DA 4L05A 5HI5D 5IK3A 4JO5A 4NDMB 5HP5A 3O2WH 2W5PA 3OC5A 2BP3A 1OW0C 2OL3A 3P4MA 4R7LA 4NZUH 3LQZB 3R19A 1FAKT 3X3FL 5TF1L 3MROB 4X5QA 4OCYL 4MKTA 4K3DL 4XHJC 3I75B 4U1NA 3RKPA 3IU3B 3JZ7A 4JQVA 1BGXH 3QXAB 5AB9A 4XODA 2VQ1B 2EE9A 4CVXA 3QDGD 1O5DT 2WY3B 4AKPA 1BPLB 1CFNB 4C58B 2NCMA 1KIPA 3OV6A 2E7BA 2KZBA 2WWKT 4JFEE 2OYLA 3P0VL 1SFHA 1QRND 3CGTA 4YHPA 4XHQA 2WUCH 1UA6H 2W88A 1RSFA 5F7FA 5IUCA 3D30A 4HWBH 4TVPH 3VFNB 4OFPA 2ZPKH 4WQOA 4DGIH 5IOKA 4CVZA 2EUWA 2QBWA 1Z9PA 1Z9LA 2FTAA 2R1YB 3PWUB 4OZHB 1MHPH 3U30C 2B2XL 4P4KC 2Y9RT 5IKCA 4I3SL 4ZZKA 1MN4A 2WPGA 1ASOA 1RZKH 4NM8H 3RB5A 4JEGB 4P2YA 3FTSA 5F7HA 2Q9OA 1PZBA 5LCVL 5I6KA 4KNUA 5GS1B 4QLWA 1DEEA 1JV2A 3TEXA 1NANH 5E9DB 2CNZA 2C1OB 3HMWH 4C54A 4Z3HA 1UD3A 3LKQB 2WXJA 5DUPH 3MKGA 3EYSH 1QRNA 4HDIA 2ZUXA 3Q2CA 2DH3A 5FGBA 3TVMB 3QR1A 4EDWL 1D5XA 2EDHA 4PW4A 4J39A 4NKQB 3ZDXE 5I1IH 2NY2D 2VR3A 4PRPE 1ONQB 1Q9OA 3C60B 2DJSA 3LPOA 1RJYB 1PY4A 3F7VA 3QXDA 1P7BA 2Y3AA 3QZNA 4HKXB 2CCLA 3PXJA 1EPFA 1JF1B 3QUKA 4Z8FL 2HT4C 5G4OA 3UABA 1IKFH 4YDNA 4GSRA 4KX9A 2FJFA 4ODSL 3GYRA 3U82B 3MV8E 4XZ4A 1FNSH 2QVMA 2VSKB 1MOEA 2IQAA 2VC2H 2OZ4L 4MNQE 5BOZG 4PRPA 4NJAL 4YBLC 3VGDA 2XPZA 2AXFA 4IRZA 4UILH 2V5SA 1JUFB 2W60A 4N8CH 4AVHA 1I3VA 2DM4A 1EGJA 1K5NB 1G6VK 3RLSA 4JX0A 3DOIA 4WW2F 3LAFA 1W0WB 3KHQA 3OSVA 1NDGB 2VLRD 1RMFH 3BH9A 5LAXA 1AYRA 4GG8B 2IGLA 1OGAD 1RZ8A 5A2JH 4UWQB 4LASL 1IC1A 1N64L 2PW1B 1SOSA 3GS7A 1EDQA 3S5ZA 5JQIB 2Q8BL 3MQIA 4JB9L 4OD2B 4M3KB 3IFOA 4Y2DB 3AG4B 3NVQA 4PW9A 2D3JA 3NCYP 4XMZA 3UBXI 5I1JH 1ECYA 1CS6A 3RNQB 4M62L 1JRHH 3O9WC 4KK6C 4A6YL 1BOYA 2VABB 2ZIDA 4ENZA 4JBSA 4LKXA 3UTQA 5KBKA 3IEAA 1LE5B 4WEBH 3JWNH 5I73C 4PJHB 1J05A 1PAZA 1ILUA 5E6ZA 5SV3A 3PHQB 1OAQL 4C4UA 5A16A 3ZTEA 5FGRA 4ONOA 5D1ZI 2YC1A 2CKBL 3QJHA 4HFWB 1JGVL 3S5YA 3U1PA 4Z7VB 1N0XL 2B59B 3GUFA 4FQIH 4MX7B 4LSRH 2BJMH 4QPEA 2NUTA 3VD9A 2W9LA 4DK5A 4AJVA 5CBAA 2MIZA 1AGCA 4JDEB 3WOVA 5IV2B 4RDQF 1SVBA 3FOMB 2I26N 2YD1A 1SOQA 3AY2A 4CVWA 4Q6KA 4KVNL 4N6RA 2VL4A 4TPRH 4BZ1H 4HXAH 2A6KA 2YN3A 2DQIH 4I0CC 4F7PB 9CGTA 3TBCA 1YUHA 3ZE0B 5HVHC 4LSTH 5EC2B 3O9WA 2WLJA 2BNUB 2R9HC 5D96B 3KLHD 3OVUB 1EZSA 2WXKA 1MCWW 2ZWNA 5C08E 3LNFA 2JJTA 3HZVB 1IM9A 3F3HA 3E8UH 3QWRA 3VGBA 2VKWA 1E9OB 3MKKA 3STLB 3OKOB 3MUHL 5I9QB 5TE4H 3ZR5A 3O45B 1HNYA 4LCYB 2EE0A 1QMUA 2WGNB 2IDCA 3ESPA 4PJHF 2TSAA 4MQ7A 3TZVD 2OZ4H 2VN5A 1L0QA 1THCA 2DQGL 4FMVA 2X6UA 4AMXA 2HXAA 3UIZA 4PWEA 3WFCH 1SJEB 1OZUA 1PAMA 4PG2C 5E2TH 3FFDA 5E7BA 4TQEL 2X1WL 4FNLL 4KJWC 5FM4A 5CD5D 1E28A 1UEMA 1VF5C 3SDYL 4WEEA 4KY2A 1G6RH 3PWVA 1T04A 4R2GB 4PRHE 1U8LA 2JELL 5HYFA 1UM5H 5IWLA 3TX4A 4FZ8L 3N5AA 5IB4A 5F70A 5LWYL 1SJMA 4KKAC 4NPYB 3KPQB 4QNPF 2VXSH 2DQUH 3UGXA 4OV6F 3C2AL 3L4WA 5CLXA 4ERSL 1O9VA 4NP4L 4LBAA 4I13B 4XCNA 3R0MA 4TLKA 3WDHA 3BEWA 4FJYA 4Q56A 3BKCH 3T2PA 3T0WA 2QPFA 5HGBB 2ZP8A 1NBZA 3WFEH 4H0GA 2L7QA 3K6SB 4GKZB 5ACZB 4G6KL 3V0WL 4P5MB 3MTRA 4PJFE 3RFRA 1FAIH 1I1AC 1Q1JL 2A6DA 1IGYB 4CC0A 2BZ7A 1BYOA 3TH4T 4GW4A 4S2SB 5F93C 3ZGIA 3R8BB 5IHUH 2OTWA 4K55A 4WENB 1N0LB 5AZUA 4PWKA 5CJ8A 4C4BA 4ECNA 2HVJB 1WD8A 2M2DA 3FT4A 3KLLA 4RVBA 4XGZB 1NCOA 3U1SH 5DHYA 1QAWA 3G04B 3DX6A 2TAAA 4TSBL 1YMHA 3P40A 3JXAA 4E5XA 1O75A 1A4AA 3ML8A 1QBLH 4IBSA 4MMYA 4YHYC 3U4EB 1AHMA 2J43A 1TSHA 5DO2D 1JZIA 2E7MA 4F8OA 4IMLA 3WS3A 4ZFOL 1IGIL 3MGAA 3BAWA 5F3FA 2FD6L 5J6GB 3ILDA 3FQXA 4J6RH 1OD7A 4PJEB 4WFGD 4LSTL 4CNIB 1U4FA 4UV4H 1UM6H 4U1JB 1MH5B 3P0YH 4PB9H 2X89D 3SGDH 4LARL 4IOSD 3WXWH 4N5UA 2E74C 2X1OA 1FZOB 2SEBB 3CFCH 3QEQA 2QQNH 5CWSB 2OLDA 5KVGH 5IF0A 1F00I 4H8QA 3VG0H 2NOYA 1GSKA 4HMDA 2VZ1A 4PGEB 3SCMD 3BGFB 5C0CD 2EDLA 2V2XA 3CU1A 3NIGB 3WKQA 2AJXL 4B96A 1N6QH 4PJDB 4UQ3A 1VEOA 1XR9A 4XTRC 3GLZA 4BFIB 1CLZL 3QYNA 1BVKB 2HYMA 4JDVA 4FXGA 5H37G 5SWQB 2OR7A 3MRMB 5JHLL 4LHUA 4ORGA 3PJNA 5I74C 4NZRL 1KT2B 3T6ZA 1S7WB 2Z7WA 3CG8A 3QUZA 2ADYA 2YQBA 4X6CB 3WIIH 4P5RA 1KLFA 4FFZA 4RGMB 4PP2A 4G7SB 1FV1B 3KZ8A 3PP4L 3IDGB 4JJOA 4HCFA 4LLQA 1DBKL 4HGWB 1E2VA 4KJQC 5HBBA 3HFFA 4YHLL 3LN9A 3V0HA 5I23A 2YMXL 4A2GA 4OBSA 3TBTB 1TVHB 3VSQA 5DRWA 2VC2B 3WNMA 4XX1E 3B3IB 3BPOB 2YGNA 2VITB 5JW3L 3GJFB 3ISRA 3RY4A 1DUYA 3A4EA 4JPVL 1JF6A 1R34A 4U6VL 1G94A 1GW6A 3NFPB 5IB4B 4K15A 2ERJB 3US9A 1DE4A 5IR1A 4QD2E 4GUOA 1IGIH 4CDGC 2WVSA 2VM3A 3JYCA 4U1GC 5AVYB 4KJPD 3HN3A 3DUHA 5AKVA 3MUGB 5CF3A 5I2IA 2EJ1A 4PTUA 3U2SA 3P02A 3DX8B 3AWEA 1VCAA 5DSCB 3VFSB 4OIFA 4OGZA 5J11C 2FBJL 5TQ0L 3V5DA 2QPDB 5HHOB 1G1CA 2RCSH 1UJ3B 3LPPA 1RLWA 1KACB 4PBVC 4APXA 2DQHH 2RFXA 5I76B 3Q2WA 2X4TB 2VDPB 3OWEA 1N64H 3EO0B 3QIUB 3V5HA 2WLMA 1ZGLA 2HKHH 5BZDA 3DO3A 3S37L 2MJWA 3WD5H 3H42H 2X40A 5K9OA 4QRPA 2NY1D 1UM6L 4C56B 4YDMA 1J88A 4JPSA 3V6ZB 1T5WA 2BNUA 2O6EA 3CSPA 5DYOB 3SDAA 4X4XB 4NM8L 3RWJB 2OKMA 4IGBB 1KSRA 3ARWA 4JFSA 1QYGH 1XGTA 5ABDE 2FAUA 1Y0LA 1ETJA 3GBDA 1IIKA 1OB1A 4G9FB 3REVA 2OI9B 2LE9A 4J7RA 4OJFL 2FUTA 1LP9E 1D6VL 1FL5B 1NFDB 2QSCL 4Q9BA 3RTQA 1AZNA 2CSPA 3GDBA 5IBLD 1KN4H 1MSPA 4J12A 1S7QA 3D48R 4JFXA 5L88H 2ZYIA 2WUBL 1T20B 4JFFB 3BUPA 3DGGB 3HFML 4NQUA 4OGQC 1SXBA 2L0DA 3G6DL 4G6FB 5DZVA 4KH9A 3CMOH 3WIFA 4GUQA 2O5ZL 3VUAA 1I8KB 3AXHA 3OB0H 3BWUF 1SBSL 3BAJA 5D1QB 1ZVNA 5K33A 4WGKA 2HJFB 5HI5C 3BWUC 3WTUA 4NSKA 2WAHA 4LHUG 4N0YH 5I8EB 2FZ3A 1MQKL 3HBGA 4ELMB 2R4SL 1KG0B 5EA0H 3CK0L 5ERWA 1LNUA 5GSVB 5HYJB 1BQRA 2OR9L 3BPCA 2N7AA 3BO8B 4NO5B 4XX5A 3PDDA 1OY3B 2D4FA 3T0EA 4F3FB 3LS4L 2J73A 3IFPA 2CJUL 1Z32X 3DNKA 2X1QA 4TTDD 2CIKA 4XP5L 3VQMA 7PCYA 2O61B 4CW1A 1PEZA 5J13B 3FULA 3KYOA 3IDNB 2NXYD 3GMPB 4XX1G 3ZT5A 3SKMB 4CBPA 2FNBA 4UDTA 2HRLA 4QOKD 3HRZB 4UT6L 1OAUH 2GUOA 5A2BA 5I0WA 1HAUA 2VLMD 4NKOA 1BXXA 1G4MA 1Q9LB 1V7NL 1A7QH 3OG4B 5CGMA 3GSUA 3H4FA 3O2DH 4X0KA 5AW3B 4ZD3L 4ZO6A 3ME0A 3HI1B 1SBBA 1T4KA 4G80A 3PV6A 2FJHA 4JFHE 4JM0A 4XN4A 5T33L 1I7UB 4U1GB 5DD1L 1DQMH 4V33A 3ZX1A 3D34A 3MLUH 2OYMA 4PJXE 1E2WA 3QIWA 4HV8A 1SVZA 4GAJH 1MW2A 2ITFA 2J4WL 5GGVL 5LNDA 2FL5A 4YUEL 5HTSA 3MXWH 3T2NH 1YPZE 3W1ZA 1HINL 1L9MA 3HG5A 3FFCB 5ANMA 3P2TA 1D5ZB 1DR9A 1TPXB 2JKTM 4Q52A 2GITB 2P8MB 2V2TA 5J1TC 1KZQA 4P5KA 3NACH 2NY2C 3O4LE 1N7MH 3KCPA 4PJDF 5HGAB 3VGHA 4YSCA 5I0ZA 5C09A 3ZRSA 4RMBA 3IXAA 1KXHA 4KX7A 1RUAH 3HE7A 4HLZG 2DMCA 4L5FL 2EDKA 1OT4A 1BCIA 4W9KC 1QW8A 5JIKA 1B2WH 1MFNA 3WTTA 2VDNL 2PR4L 3A6BL 3C09B 2XTJE 2OCCB 1BQKA 5F6IC 4XN1A 1LDPL 2VMCA 1H3WM 2CM6A 3BGMB 3HI1A 4TSBH 3R7RA 4B27A 4M7LH 5L8JB 4N1EA 2YN5A 4RFOH 2QKIB 2Z0BA 3RFZC 3I6GB 1A9BB 2UUDH 1KYDA 1J8HA 4BFNA 2ZE0A 3BP5B 5A43C 3ZJAA 2R1YA 3PWUA 4FNLH 4Z1PA 3R7QA 5LHDA 5AVVB 3ZBMA 2Y25A 5FCUL 3FUFA 4HS3B 2XTJC 3M46A 2D7NA 4QRPD 4WHTB 2VWEE 3UC0H 4A6YH 3EH4B 3FU8A 2F7IA 4WWPA 5DRXB 1YVLA 5AVXB 4J4PD 1OAYH 4PFEA 1R5VA 3T1WA 3TV3L 1L5GA 2V5RA 3ALPA 4QRQB 5C0JB 3VWJB 3S88H 5BRZD 2ZG3A 3S37X 4FG6C 4KHTH 4ODBD 2Q7NA 3RA7L 2NRDA 5JXAH 3S4SG 4PCTA 3FU6A 1YG9A 3UJIL 4WI7A 2WJ7A 4FQ1H 4KK6D 4TVSa 3TT3L 2XFXB 4OFQA 4Y4KD 1OWWA 1GRWA 3IPBA 5IUSA 1X5MA 4TRPH 4OZFG 4K8RD 3C08H 2VLRE 4W4OC 5ANHA 1P4BL 1QSVA 1MZZA 2ZOKA 2QQQA 3L2NA 5CUSH 2R0LL 3M45A 5J6HB 3HHRB 1QPPA 2IOOA 4BBWA 1LMIA 1DBML 3VE0A 2YPVA 1ZV9A 3SE9L 1RVFH 2D3LA 3D3VE 3MO1B 5KTEL 4WKXA 1UM4H 2CUAA 2E4TA 4QRRA 3W9EA 5GZOA 4G1EB 4UOW0 1MW1A 3AREB 4J3OH 4U1IB 4K2UH 5E6RB 2IDTA 3EGXB 4TVPE 5DD3L 1BF5A 4RZCA 4DP6X 5F3BB 5D4JA 5FYKU 5C09D 1P2CB 2Y7LA 2Y7SA 3RL2B 2AQRA 2IBZX 4DUXA 3ECUA 2VQ4A 2Z35B 2Y6TE 2ICEB 4NZJA 2CLVB 4TNFA 5I1DB 3ZKXB 1UJ3A 3WS6A 3QZWG 1XQ4A 1A6PA 1B0RB 1A4JB 4LE8A 4LCUA 2J88H 5F6HI 4PRPD 4ZS6C 2WQWA 3ULAB 5DSCA 5E1QA 1ZGLB 3V5HB 2VLKA 3SKMA 3KD4A 4HWUA 1YN7B 3B9DA 3KBEA 3MV8A 1I7RB 4NO3B 4NQSA 5IBUG 2Y5TA 3ROLB 1RD6A 4PY7B 4JG0H 5K9JH 5G4MA 5JIDA 3S0PA 4RQQB 3VWKD 1KCVH 1RZKC 3BSZH 1LK2A 2Y7MA 3QUXA 1NCUA 4AMWA 5CEZD 4Z6AT 4JKPL 1USQA 1EEUA 2XJLA 4O9HL 1IFHH 5ALBH 3DOSB 3W11C 2GBUA 1E9PB 5TFSH 2ZNWA 3ZE0F 5GJSL 1RZIA 1C08B 4IRJA 3D3VA 3GJEB 3FUMA 2BP8B 1TCRB 1XH1A 4D0CA 2NXZD 4I48A 4C59B 3MODL 3I3DA 4JFZL 2XN9B 3CDGB 2GTZA 4TUOB 4PRIA 5KS9A 4YFEA 3APNA 1N6VA 3ZR6A 1JI1A 4UNTA 1I3UA 1LO5B 5FO9A 3FZUD 2GW5A 3T1FA 1JZHA 4OUOA 4LLUB 1I9RH 2ZONA 5FO8B 3VA2C 4L4TA 3VWJC 3O0RH 4B97A 1X44A 4LLWB 1A7NL 3EBAA 1SHMA 1QWUA 3R06B 1J8HE 1R3LB 4YSEA 3HI5L 1KBBA 2BVPA 1XHHA 3N43B 4WFHD 2X53A 3ARRA 4NWUH 3OAUH 3RGVA 4GQ9L 3AU0A 3M7FB 1KCLA 4G7VH 3CZSA 1BMZA 4AX3A 4WFHE 3NK4A 4G5AA 1P5UB 5F7AA 4FJ6A 2OJZL 5H4ZA 2NYZA 3CZFA 1MH5A 1H8OA 5DC2A 3T65A 3OPZH 4FFYH 4XP6H 5IJDC 2DLHA 2DQJH 4PU2A 3BZFA 4JR9L 2WHVA 2I5YL 4HBCH 4GUPA 3OWRA 2PYFA 2CGZA 4LEXL 3KPMA 4HALA 4PJEA 5F89B 1B88A 3U2SB 4XN9A 4YL9A 1ZRUA 1B9ZA 5AVWB 3ZUCA 3QUML 2AXWA 3KJ6L 2G9KA 4G6MH 1NGXB 5L7XL 3NAAL 1Z5LB 4FYSA 4BK4A 4PJCF 4U0RB 1SXNA 5C86A 3CN2A 2GBTA 1CICC 5J1AA 2LLNA 2VKXA 3HB3C 4M5YH 3TJHC 2WO2B 3M1CA 5I0XA 1K6QL 4RFEB 1OO2A 4XCFL 4YE4L 2OAAA 4WDIA 3BSZL 3Q3GB 3NCBB 4YEFA 2M1KA 4JFFD 4Z7QB 3EYFB 1I8AA 4MJIA 5D1ZC 4GKZA 4KDVA 5D55A 5HDRA 3TCTA 4L1SA 5BVJA 1DBAL 1O6SB 2AVFA 4JKMA 2BCKA 4NQXB 1ZIBA 3T2NL 4ZUTA 5HDWA 3WO3B 2E27H 2NY1B 3MXVH 4HIJB 3T4AB 2J1KA 3Q1SH 3L3DA 4MA3B 4G3YL 1J0ZA 3L4TA 4YSDA 3P3YA 4P3DB 4AJWA 1D5IH 2HWZH 1S9XA 5HHMD 3MCLH 3MUZ1 3Q2LA 1P7QD 3FONA 3QJFA 3GIVA 4O02L 3S36L 4KJQD 4Y16B 5FGCB 4X2UA 1M9WA 2CDFA 5J3HC 3U46A 3BN3B 4Z0BL 3VJ6A 5A2FA 2AQQA 1TMCB 2PPEA 4U1MB 1DZ0A 1P9MC 1U8CA 5JXEC 4HSQA 3RDTB 1OTSC 4HIHA 5FLVA 2ICCA 3QNFA 4ELMF 3WN5B 3Q5YA 1N68A 4AE1A 3OPZL 3SODB 1CT8B 3VXPA 5K1JA 5FDWB 3M8OL 3MRLA 5JW3H 2CZNA 4B9JA 5CLYA 4NC0B 4WY7H 2W95A 4M7JH 4XOAA 3TA3C 2EE6A 1E50A 3NSCA 1GH7A 3HC4L 2B5IC 5JXEA 5KW9H 5DUBB 2OJEB 1B9KA 3SGJC 1IBHA 4JY6A 4IU2A 5D5ME 4N8CL 2IFGA 3UTTE 1IM9B 2YPLE 1Z66A 5I74B 3NK3A 1LO4H 2AJZA 1U3YA 2BHYA 4LNVA 5HDBE 3KYMA 2FX8L 5E5UB 1BX2B 2IG2H 2AABL 4HIQA 4BHUA 3HN5A 4WSJA 4A7SA 5AG8A 2DS4A 1BBDL 4NPJA 3BIKA 4GSQA 4HIEA 5L2JB 5I17B 2E59A 3EH1A 2EYTA 3KGTA 4HT1L 4UTAA 3V0JA 3WUZA 5T1JA 4PRDB 5B3SB 3NCMA 3B8YA 1SXZA 1FBIH 3VFGL 1PLGH 3QCTL 1LEKB 5BMFL 4AMKL 5IVXA 1D6VH 2XVLA 1ZTMA 1T5XA 4FABH 3PPSA 4MNHB 1PYWA 1ED3B 1M7IB 2HVBA 4JFVA 4NQVA 4XRCB 3EUUA 3MLVH 3NZ8A 3NFSH 5AAPA 4HUKB 5HGHA 2R0LH 4MLIA 3U30B 2P42B 3E3QC 3MV9D 5D8JL 5F7DA 3WJLA 1GZHA 2NX5B 2VE6B 3B5TA 2GBVA 3VVVA 4AC4A 3BWSA 3NIGE 3H2QA 3VXSB 4IBWA 1UEYA 3DUSA 3A6BH 2PR4H 4BEIA 4MAUL 1L9OA 2CO4A 1J1XH 4G9DB 4A2DA 2MQ3A 3WUWA 2EKSB 3MYZA 1USZA 3BUBA 4NJ9L 3EKCA 1DVTA 1WBYB 5IMMA 4R5TA 3BVWA 4IIQA 1XO8A 4PVBA 4X6CE 3LB6D 4YAQB 4NHCL 3RTQD 1U3HB 3NSJA 1E28B 4RDQG 1EAPA 2AW2A 5LQBL 3PF2A 4OSUH