3LZQA

Crystal structure analysis of manganese treated p19 protein from campylobacter jejuni at 1.41 a at ph 9
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
157
structure length
157
Chain Sequence
GEVPIGDPKELNGMEIAAVYLQPIEMEPRGIDLAASLADIHLEADIHALKNNPNGFPEGFWMPYLTIAYELKNTDTGAIKRGTLMPMVADDGPHYGANIAMEKDKKGGFGVGNYELTFYISNPEKQGFGRHVDEETGVGKWFEPFKVDYKFKYTGTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords P19 protein
publication title Structure and Function of P19, a High-Affinity Iron Transporter of the Human Pathogen Campylobacter jejuni.
pubmed doi rcsb
source organism Campylobacter jejuni
total genus 34
structure length 157
sequence length 157
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-03-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2480 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3lzqA00
3LZLA 3LZRA 2O6CA 3PJNA 3LZPA 5I0XA 3LZQA 5I0YA 5I0VA 5I0WA 3LZNA 3LZOA 3NRQA 2O6FA 3PJLA 2O6DA 2O6EA 3NRPA
chains in the Genus database with same CATH superfamily
3IF1B 4PV1C 2EDJA 5B38A 3L7EB 2ZCLH 4PQXA 1SZNA 5T3ZE 2H3NA 1KC5L 3DROB 4QHNB 5T5FL 3BAJA 1QWHA 1T1XA 1YEWA 3BWAB 3FF8A 4M5YL 5GGVY 3SGEI 3MZTA 5DFVD 4WWOA 3TBVB 4C56E 3MGTB 5I1HL 5F9AC 4UDUB 3MRKB 2VZOA 3EO9L 2EXWC 3OKYA 4F2EA 4XMZA 5IVZA 1F8TH 1QW8A 2J6EH 3EYQD 5KSAB 1PKQB 2PETA 5IHUH 1YDPA 3QC6X 3BT0A 3TNNA 4PRIA 4BA0A 2VT0A 1SMOA 4PW4A 5DZOA 2OMTA 3OX8A 4R0LA 4UOJA 1U4FA 1AJ7L 3C6SB 5HYJA 4JY5L 1V5JA 4J3OD 4WGVB 5F0JB 4OLUL 1JGVL 3PXHA 4AIZA 3SKNA 3QQ9C 2VXUH 3QZBA 1OOAA 3U2JA 1FH2A 1OVZA 2DLGA 2AXFB 3T6QC 3L2NA 4RBPH 1LEIB 1XH3B 4JG0H 5JPMA 4P2YA 1QZNA 1FNFA 2OMXB 3QGVA 4LCUB 4NQXA 3QRFM 1FL6B 2Y07H 3OPZH 5C08E 3GMQB 1S7QB 4JQVA 5D5ME 4H0IA 2DKSA 1WVZA 2EYRB 3IT8D 1AZNA 4Y5XB 5ICZB 3IDNB 1WZAA 2VRAA 2XKSA 3MBXH 4JRWA 4ZW5A 4GRWE 3JSSA 1ET5A 2YPKA 5BJTA 5FO8B 1FFNA 4E9XA 4HBCL 2BWDA 5TPWH 1AC6A 1NCAL 1G7PA 4FNRA 2NNFA 2B1HH 5KVEH 4G8GB 1FL5B 3PL6B 5FDWB 3ZZQA 2NQCA 2AJ3B 4PRAA 4P23B 5LKNA 4WJ5B 3MOQA 2N0KA 5D4IA 1JWSA 2E76C 4OIIL 2IQ9H 1E90A 3QXDA 4NQDE 3RGHA 4EI0A 2AJYL 1T04B 4H8QA 3UYPB 3APNA 4AK2A 1AP2A 1KTBA 2F53B 3OKDA 3ZHKA 3GTNA 1R46A 4CN6A 3POHA 5JXED 4N5ED 1SN2A 3NCWA 2XVLA 1NCTA 4HIEA 2XY1A 4KNUA 4I2XB 3O2DA 3TA3D 4U1NB 5C3LD 1VFOA 4S1RL 4MDIA 3F01A 2FNWA 5EIVA 3NG5A 5FK9A 4L8BA 4KDWA 4WEUD 4BH7B 5BQ7A 5C0RL 4C4KO 2XQYG 3FFDB 3MCKB 4ZW7A 3RFRA 2V9TA 1M1XB 4HIHA 3I75B 4WU7A 5FO7A 3SE4A 4U1IB 1FIGH 4AJWA 2VH5H 2YWYA 3WELA 1UGKA 5CGTA 1ZLSH 3D06A 3FBKA 1QRNB 1WFUA 3GSNA 4O9HH 3WFCH 2A4ZA 4Y4FB 5MEOA 5AB1A 1CVRA 1WC7A 3LS4L 2CJ3A 3LEXA 3NCFB 3ZDYE 2YPLB 1ZJAA 3V5KA 1O6VA 1C9SA 5HDQL 3QI9A 4LPYA 3DVGA 4YAQB 3RFZA 4EI5D 3R1GL 4UTBH 3J2PA 3QWQB 3LNEA 1XZ0B 1S7SB 3OG4B 3E9TA 3PWLB 3S96B 3S3PA 4PJ8A 3UTTD 3GSWA 2OL3H 3NZHL 3MLTB 3HB3B 3KNBA 3DV4A 3EDKA 4O58H 3ZE2B 4IBWA 3ETBJ 3ULVH 2NY1B 1AXSB 3MO1B 3TWCL 5F6HI 3QXVA 4P4RA 3PU7A 2JI2A 2ZWSA 4P2QD 4DESA 1NAMB 3T2NL 3G5XA 5E2WH 3UC0H 4WU5B 3LKNA 4GQPH 1RZ7H 2VE6B 4B5EA 1CWVA 1BLNB 5DZAA 3CDFA 2FWSA 4A2GA 1KDJA 2BNRB 4I0CC 2NNAA 3KLHC 4JJHA 1JK8A 4S1SL 2D03L 4WEMB 1F02I 5E8EB 1C7TA 2GBVA 5GGQL 5D7JD 1XCQB 1ZT1A 4FQ2L 4BEIA 4UOZA 1KBGL 5E5LA 1NGQH 2QL1A 4NPYB 3M7OA 3UAFA 1YEHH 5DJXB 1PJWA 4ZW6A 4YJZL 1OM3H 5LLIC 3OD3A 3V6FA 3TESA 2LU4A 3ZXAC 4LE8A 1F3DH 4OFQA 3L3GB 1JUFA 4U3SA 3B37A 3LPWA 1JHTB 5DS1A 1UUNA 4TUJA 1QR4A 5HYSB 1PFCA 4L4VB 3WDHA 5I76A 2O5XL 5I1EL 4EQ2A 1PBYA 3P3TA 3F6LA 3D25B 4FXGB 2NY2D 4JR9L 5IEKB 4IHBA 1TJIH 1G9MC 2YEQA 3FCSA 4PJCE 4XXDB 4JRYD 4OQTA 4FA6A 5CM1A 5E00A 4POZD 3NN8B 3AQDA 3GFUA 4Q2ZA 4HAGA 1ZLVK 5J7CC 4WSJA 4LNVA 5KYWB 1QLEH 4IEFA 1IC7L 3Q8AA 1RU9L 4BM7A 1QBAA 2J57A 4QHPA 1ITCA 2Y06L 3CMOL 2HN7B 4L0YA 4YXHL 3GSOA 3O2WL 4ZUVA 3DGGA 3CFMA 1NC2B 4FQXC 3EFDH 2HJKB 3WN5A 5D2NC 4LCCC 4TSCL 1A7QH 5CWSB 5CIPA 3MRQB 2XVBA 3E3QE 3QORC 3NBNA 5D1XE 4WEBH 1I1YA 1RJYB 3N9GH 5CP7B 1SJMA 5CMAB 3LDBC 4GW1B 3GNMH 4CADB 1D9KD 4F7EB 1HXMA 1U9KA 4HC1H 1I8KB 2AJSH 4Q58C 3EXJA 1CDIA 4PJXE 4LAQH 3MLSH 2N4IA 4OJYA 5IJVA 2YMOA 3NAAH 2EINB 5E1AB 3ZKND 3PF2A 4F1SA 5DJCB 3IJHB 4KMLB 1NM9A 5IZ7A 3W9DB 4AYDC 3X14B 4PREA 4Y16D 1P7QB 1AS6A 4ZODA 5E8DL 3P3RA 2IGFL 1G0XA 4GEJA 5FUOL 3CVBA 3HLAB 4L8DB 5DEFB 5PAZA 2DPKA 4B6ZA 3B9KD 5DURB 1DQJA 4QXGL 3VXRE 4ZUWB 3BXNA 2C3WA 2PTVA 1HSBB 4LL4A 3HFMH 1YLBB 5INCA 3NSFA 2VUKA 2XLLA 5JIKA 3BRFA 3VMPA 5SX5H 4BD4A 1BREA 2ZX9A 4FL4C 3EG9A 3V4UL 4YXKH 2F7RA 5MENB 5F9OL 1LTXA 1HNGA 3GI9L 5H4YA 1KB5L 4PJDE 1FAIL 3NH7H 4G8EB 4B5ZA 5LGJB 2VOTA 1PDKB 3QUXA 2NCMA 3BVUA 3ETBF 4G8FA 4PJBF 4EVNB 3PWJA 5E5MB 1UWXH 2J8UA 1F45A 1KBVA 2D0GA 2HP4A 1F4AA 1KXQA 4FJZA 1BZEA 1N67A 3T6XA 3L4UA 1XF4B 3LIZA 4Y8AA 4A67A 3QQ4B 3BZEB 3JWNC 4DW2L 2WAQA 3K6IA 1F11B 1KC5H 3VVVA 1XIWA 1CYWA 5T5FH 5FW8A 3S3CB 4B53A 2WUBL 4M5YH 3NZSA 4NKDB 1QFWI 4NJ9L 1T80A 4I18A 2X4QB 3EO9H 4DK3A 3IXTA 1QO3B 1AGBA 1KNOB 1RZFL 1QSFD 1Q94B 3ECWA 3A4FA 5FCUL 2R1XB 5D1QA 3UP1A 3HZYB 4NM8L 4PJ9B 4BSVA 3B8SA 4UT6L 1BVOA 4XBMA 4YC2C 1DJIA 2CZNA 2QADD 3DECA 4R3SB 4M4RB 1TZIA 4HWUA 5HI4D 3OXSA 1NMCC 4JY5H 4ATTA 1RP9A 1JGVH 4PCTA 3NJVA 4YDMA 5KBPA 1A9EA 4UAOB 3OR7A 2APVA 1AGDA 3ECVA 4YDVB 2WXNA 2FO4B 3G5YB 4WFFD 5CHNB 5ID1A 1GY2A 1O6SB 1WS7A 2FLRT 3FQYA 1CDJA 4P2OD 3DXAA 4XR8C 4E9VA 5AAPA 4MLSA 3C5JB 5JUEL 3IB4A 1I1RA 4OQ1A 3ARBA 2E56A 4LMQE 4GG6F 4W9LC 3T0WA 4JFQB 4U1SB 5DJ6B 1WYJA 5EF0A 1C5DB 2NQDA 5C9JA 3EJYD 4HBCH 1LO0L 4QRPD 3TVMA 1NCAH 4JM2C 3WLWC 3LPGA 2O5NA 1U92B 3ASWA 2CO3A 1SJVA 2WVVA 4JDEB 5T1LB 2XN9B 5M94B 4OIIH 3IBEA 3O4LB 4IM8A 1ZSDB 2AJYH 1NBZA 3A6CL 2XWCA 3QK0A 3UAJA 4WWNA 4AKQA 3GBML 3N04A 1NAKL 4KRPD 1L6PA 4GS7B 2DQFB 4WUUB 4CSSA 3NA9L 1E43A 2X9XA 2BIIA 3T4AB 5I1JL 1R3KA 3PCYA 3ZTJH 5B4MC 3GK8L 3D4GA 3T3PE 3S2CA 1XTMA 4NO5A 1Z0MA 2JI1A 3BH9A 5DQJA 3IJEA 3JVGA 1A7NH 4S1RH 3WKYA 4Q6YA 1ZDQA 4WFED 1I9EA 3MBEB 1II4E 4O2FA 4U6HA 1E30A 1H3GA 3C8DA 1KGYE 4OVVA 5C0RH 3QCUL 2I9LA 3OHXC 2QV4A 3LRSB 1ZXQA 2NYZA 3QUYD 4WNQA 1ZA6A 2EIBA 3OLGA 3VXSB 2B15A 5IVXA 3SGEH 2HMIC 4L18A 1QFWL 4BWUA 4NPKA 4PBDA 3LNDA 2I25N 4FLHA 3L17A 3U6RA 2CHWA 1YC8A 4NYLB 5GJSL 3K6SB 1HJBC 3MRRB 5JOEA 5BQDA 3LS4H 1FN4B 1F00I 5T1MB 4XP4L 4PYGA 5GRVK 5HDQH 1Z9NA 1RVFH 2PPFA 2GY7B 4R97B 4XC1L 4Y9FA 5LQBL 4KKLD 3MRFA 4ODUA 3F7KA 4GT0A 4WW1B 1ILSA 2PN5A 1U8CB 4TQEL 3NZHH 4DZ8B 4YHYB 4M43H 1OAQL 5CZKA 4KHXL 5G4MA 3FOMA 3FSZA 4AMXA 2VAAB 1P84J 4I1NB 1V55B 4OSUH 3T2NH 4TQ8A 5I74C 4BZYA 5IVOA 4CC4A 4DP4X 1O7SA 3MU3A 1OP3K 5DGRA 4L5FL 3MBWB 2JJTA 5I1AA 3QDJD 3ZKSD 3EDDA 4NFBA 5EC1B 3KPLA 1CLCA 1S9XB 4Z7WE 2DMKA 1J8SA 4DF9A 2DBJA 2ZCHH 4LCWB 4JZNB 3WV0A 3QULB 5JW4Q 1W9XA 4Y5VB 1SOXA 3TU6A 1KBGH 1U8QA 2HRPH 3MVSA 5GS1B 1E27A 2E46A 1HIMH 5CR1A 4L9LA 4AQ1B 1ZXKA 2DOCA 4LHQB 4HHGA 3PIQA 2D31A 2VO5A 3MKKA 2JQMA 4EUPA 1W72B 3O9WC 4HK3N 3EBHA 3ILQD 3BSZA 2A9BA 3QEHA 5IBLD 1A7BA 4R4NC 2AV7B 2DW5A 3O3EA 2NR6D 2LTQB 3ILDA 3NIGE 3C5ZA 2ZYSA 3NIDF 3TTYA 1KCRL 3QIWA 4JR9H 3TYGL 2Z92B 5HHQB 3HG1D 3LZNA 3FO0L 3QAZC 3VQ2C 2A6JA 3Q2WA 4Z76A 3N50A 5IB4A 3DOSB 3KXFB 4I5BB 1U8PB 5GGUB 3I9AA 3L13A 2C1PB 4OZGB 5GHWL 2EZ0C 1JNLH 2BSRA 3PAZA 5ALCL 5LCVL 5LXGL 4UCFA 1IC7H 3HG3A 4XN9A 1RU9H 3IM1A 1M7DA 3SJVE 3CMOH 2Y06H 4LPTA 4TL5A 1KDIA 3ZY7A 3O2WH 4N90D 1QW9A 3RNQA 1RSYA 3DTXB 3HNSL 2NXYC 3KG5A 3DX9B 4JFED 1CU4L 4QRTB 4TSCH 1G6VK 1U93A 5LNGA 3UTSE 1UADC 4XH2B 2WBJA 1P7BA 1QLFA 2YXFA 1JGLL 4ZYKB 3ULVE 2RR3A 3DV6B 5EOCJ 2P43B 1J05B 1EEYA 5E6IA 5I6PA 4BKSC 1JZDC 5K9QI 3E6HA 3REVB 1FNEA 1TVBA 1WAPA 2D2OA 3FCUB 4CVZA 3LKSA 3SPHA 1HCYA 2H1LM 3NQIA 4PCSA 1JZGA 5CZVH 3GM0A 2C4FU 2Z35B 3P4NA 1KJ2A 3UTOA 2V5SA 2OCFD 3ECBB 1IGFH 3EHBB 4HIXL 1A64A 2WQ8A 3Q2NA 4RGMB 4XI5D 4ZDHA 5DZJA 2E75C 1BXVA 5CXPA 1S2EA 4NB7A 1SDDB 4F5CE 4HJTA 1FNHA 3ILPB 4APXA 1OARL 4QXGH 1KPVB 4FCAA 1T20B 1WWAX 4G7SB 1T22A 4DGVL 1BMGA 1D5BA 1DEEA 1FYTA 1GGBL 2X1PA 3QJHA 1IL1A 4NRYB 2GI7A 4PJFF 1MHEB 4OZFH 4QNPE 4GAJL 4AV4A 5DJ2B 1KTDB 1ZV2A 3WIHL 4NQEA 3TNMB 3IK2A 3HR5A 4IK6A 3DBSA 3HE6C 2V3DA 1FZOA 3V4UH 1XAKA 1KEGL 3P0VL 5F9OH 1B0RB 3WIIL 1SBBA 2DF3A 2ZE0A 1KB5H 3WFEL 1FAIH 1AZVA 2G5UA 1YUHA 3VWKB 3BAXA 4G7YH 1F0LA 4PBWD 3DUSA 3JUYA 1WIOA 3I3DA 1CGVA 3DMMA 4FLSA 4J12A 4HUCA 5CLTA 4R7DA 4Y9EA 4MNQE 5H37A 3FUNA 4J27A 4Z7IA 2XTLA 4UNUA 1RY7B 3FC8A 3I2CL 2ZUSA 4DW2H 4HU8A 4CSPA 3U46A 1I3GL 1OHQA 2TRYA 1L9RA 2WUBH 2IWEA 2WQVA 2J1XA 2APFA 3HG2A 3Q6FA 2YA1A 3QXWA 4LHUA 4OCRL 3U1QA 2CGZA 1RZFH 4HKJB 5IV2A 5FYKU 3QIBA 1DJXA 1NCDL 2GVYA 5AZEL 2E3VA 2ZONA 4MXWL 3VCLB 4NM8H 4NO2A 3ROOB 4D0BA 2W92A 4OLWL 5AW9B 3RURA 1UZ6E 2FYVA 3RUGB 1ZRUA 2JCWA 4Q74A 5I71C 1JMXA 2PCXA 2W0PA 3JTSA 3FMGL 1IKOP 1ZKAA 3WNIA 1E4JA 3E80A 5FGSA 5IP4A 3APMA 4NRZA 2H6PB 3CH8A 2NPLX 4ZFFA 3KYOB 4P0DA 2BS71 2DQDL 4MXQC 2HG5A 2BSCA 4X9HA 3TM6A 4PGBB 1KJ3L 5JUEH 2VLMD 4JFXB 5INDA 1C8QA 3KWWA 3O3BB 2JQAA 2NX5E 2YBRA 3QNXA 1ZSHA 5BCAA 3VXRA 3UTQA 5DA0B 1YEDA 3E1F1 5DYFA 1A7PL 3GTVA 3QRLA 2E5EA 1BV8A 1TVHA 4MBRA 4AMKL 4JAMA 2ARWA 3B2VL 3CNKA 1LO0H 3U4EA 4N6RB 2R23A 4X4KA 3T6VA 1VZGA 2APSA 1UD2A 1YNLL 4P4KA 4PRPB 1AZCA 5DHMC 5EF1A 3H6JA 3F04A 4DNLA 3A6CH 4RIRA 4KJYA 4XNYL 1GZPA 1MFDL 3GBMH 2B20A 3AB0B 3VMOA 1R1CA 4GKSA 3NA9H 1JE6A 5K9OA 1BGXH 1ZVNA 5TK2A 2YRZA 3ZIYA 3KPNB 5C8JA 5I1JH 3L4CA 3GK8H 2P52A 2W65B 4J5VA 3DX4A 4K9JA 2Y4SA 3U0PA 4UQAA 3FNKA 3CFUA 1HHJA 1EZSA 4LLUA 1WGOA 2W9DH 4LLVA 1MZZA 1RZ8A 3RL1A 1I8LC 1CBVH 3GSXB 3QCUH 5JW5B 3RRQA 5FR3A 5AAMC 2EICA 3R06A 4QJ3B 1C16B 1KIUB 2NXZD 1AI1L 3SDDA 3WJLA 2VLKE 5DJDA 2M8XA 3UPAA 3I6LD 4DP1X 5JOFB 5GJSH 2MMXA 2NY3C 1F6AB 4Z78B 1MPAL 3CH1A 3F7PC 4PJIE 3TBCA 2AK4E 4XP4H 2ZPKL 3V6ZB 4Z95H 5DF0A 1SXSA 2A83B 3S37L 4XC1H 2HX8A 2V2TA 2C34A 5LQBH 1ORQB 2WLYA 3C09B 3QQNA 3EJJX 4Q56A 4YHIB 5K1NA 2XWEA 1RUML 1ZANL 4TQEH 2EIJB 2F9BT 2E7LC 5EU7C 5L2KD 4KHXH 2VW6A 1RXLA 2L0DA 1GCYA 4TM9A 3SYAA 4QRRB 4XCYB 4M6ML 2R56H 1AAJA 3T4YA 5C09A 1MCKA 3BVTA 4YFLF 4HGKC 4XMLL 4N20A 1EEQA 1JN6B 1I4FB 4YHMH 7FABL 3K8MA 4DP2X 5DSCB 3WXVL 15C8L 2WCPA 4O2CA 3SE3C 4G43A 4L5FH 4WW2C 4J8RB 2NW3B 5ANMB 2GITA 4J3WA 1M3IA 2AZUA 2KQMA 3EOTH 4J3BA 4YO0A 5F89B 1XH2A 3LXBA 1OW0A 1PCXA 4JANA 3SE9H 1CXHA 4Z9KB 3VDCA 4MMXB 3HEIB 4ZPTB 4ZFOB 1QWNA 2DL2A 2ATKB 2J44A 1N19A 2OMWB 4LEBA 5CJXC 1NFAA 4YK4B 2CIKA 4N5EC 1Y18B 3MV8D 4FNQA 4MMZC 4NN7B 4KVPA 4G6KH 4RVBA 4PW3A 4JFDD 3DVIA 1VGKB 5D7HA 1RD6A 3MV9B 4YFEA 4JM0A 4OFYA 4JDVB 2DM7A 5FHAL 1NIFA 2H0JA 5L88L 4PJ5D 1N7ML 3FQUB 5FKAB 1TCMA 3NSJA 1ANUA 4JRXB 5EEWA 1VGEH 2AEIT 5EOQL 3WJMA 2BP5M 4NUMA 4UILL 4FG2A 4X6DF 5E8OB 1DBML 1SHXA 1KCRH 3ARSA 3Q2CA 2CHNA 3TYGH 4A7SA 4PJGE 5FLVA 2OI9C 5BO1L 1GZHA 5E9DB 5IB2A 3FO0H 2J6EA 3M8OL 1FFPB 3KGTA 4RMVA 2R1YA 3B6SB 3Q2VA 2C1OB 4TLTA 1A6ZA 3BP6B 4ADJA 5D7IE 5JHDA 2GFBB 1UKQA 4P5KA 2WXMA 4NOBA 5ALCH 4M1CD 1D7CA 5LXGH 4E68A 3PUCA 2VZ3A 3T77A 3MFGB 2N59A 4OGXL 3HS0B 3QWOA 3DNKA 5DUPL 4BUGA 4O2EB 4POYA 3D9AL 2Y5EA 5H94A 3HNSH 5K39B 2DD8L 1CU4H 4WK0B 5DEGB 3IKCB 1R3IL 5ESAB 2B39A 5AW2B 1EZVX 4F7CA 2D2CC 3NTCH 5H4ZA 2VABB 4PJFE 1JGLH 3K4DA 3ARXA 1OO2A 1F4WL 2IBGA 2MQ0A 4KK6C 1AO7B 2V9RA 2BM3A 2Z8WC 3V52L 5ADOH 1IKNC 1XBRA 3E8VA 4W6YB 5B38B 3UO8B 1Q0EA 4WO4C 3LS5H 2EE3A 2H3NB 3ESMA 4Y4HD 3O6FC 3L1FA 3W9EA 5HVFB 3QS3A 1T1XB 3ARFA 3FRUB 3K80A 2KHAA 3AU1A 1OCOB 4JM2F 4L37A 2P24A 4HIXH 4DKFL 2P45B 4R2GB 2XQBL 5IVZB 1H15A 5K33A 2A74A 5GRVL 2KZWA 3V4VH 5PCYA 3GHBL 1YDPB 3TNNB 4PRIB 4HJEA 3C5SA 1L0XA 1HQ4A 1OARH 2OMTB 3OX8B 4R0LB 2IDSA 4JUSA 3JT2A 1U2CA 3MREA 4H25B 5DJYA 2A3TA 4DGVH 1JV5A 1IJNA 3MJGX 4P5RA 4ONHB 3RTQC 5HHOE 5K9JL 5HYJB 3JT0A 4TSBL 3QR0A 4JPVL 4GAJH 4AIZB 3SKNB 4YZFF 1ADQL 4M7ZC 3WIHH 1MH5A 1OKEA 1BP3B 1EQWA 2JKNA 2XX0A 4LDLB 1G9NH 3N41F 1VFUA 3P0VH 3WIIH 2EDTA 4P5SA 2IGLA 5JPMB 3SD5A 2AITA 5J5EA 3OR6A 4Y4KD 2P8LB 3A4DA 2FTAA 1DQML 3WMQA 4KRNA 2ZG1A 4JFTA 4XCCH 5GGTL 5AENA 1M1SA 5J12C 1UWEL 3MCG1 4G59C 4AW4A 3FQ1A 2YPKB 5DK2A 1LGVA 5HDRA 2F7PA 5BJTB 1FFNB 3TT3H 4M00A 1I3GH 5A7EA 3QIUC 2FHBA 1G7PB 1J88A 4KGJA 4Z3FA 2IH8A 2AQNA 1ZK5A 4PRAB 4LFHD 3SJVA 4P2RE 1JWSB 4OCRH 3QXDB 1F4YL 4AGLA 5HHMB 4UTBA 4N1CA 1KTLA 1AP2B 2P5WD 1NCDH 5AZEH 3OKDB 5DJZA 5DYOB 4R6UA 5DXWA 1DVSA 4G6AC 4XPGL 5HPMA 1UM4L 3M1BB 4PGEA 4LHJB 4OLWH 1AGEA 4HIEB 4HUVA 4DCQA 5E4EC 2D4FA 2MEJB 3NP3A 5FUCC 3HAEB 1J0JA 2Q8BL 4NKQB 5C0CA 3FMGH 1DLHA 4MDIB 4X4YA 1ZLVH 5FK9B 4K71B 2ENYA 2Y6SC 4L8BB 2WTRA 2YAOA 3N1PC 4W81A 4N8UA 2F54E 4PRHD 4ZQKA 2AAVA 1FRGL 1E9PA 1IBDA 2NNCA 2ZKXA 4HIHB 4PJBA 4WU7B 2F68X 3S37X 2DQDH 4R84A 4OF6A 2YFNA 4F7PA 3FQ4A 3FN0L 1KJ3H 3LRHA 4F5CA 1IQWL 4GP4B 5MEOB 4KKQA 4LRNL 4MA8L 3UG4A 3RY6C 2Y1ZA 3LEXB 1A7PH 4LL9A 3RWCA 3AS0A 4MNHA 4MX7A 2JKLA 4AMKH 3V5KB 3B2VH 5SWSB 3KPSD 1TPXB 2DS4A 3QI9B 5ETUA 3RFZB 3HMXL 3MUHL 2DQMA 5E1IA 4RNRA 5CCKH 2VIRA 4MA1B 1J9TA 1YNLH 3PGDB 5DHXB 3WNJA 4PJ8B 3GSWB 3KNBB 4QHKI 3DV4B 4NT6A 5DEJA 2PF6A 4XNYH 1MFDH 3PHSA 5ABZA 5ABDE 4P49A 2YD8A 2D3NA 4P4RB 2ZCZA 5IWLC 1UXSA 1P84K 1J5CA 4DEWA 4N2HA 4ENEC 4N2GA 2PCFA 3B7UX 4MNQA 3AUVA 1F4HA 5C0BA 4HZLA 5JW3L 3GMMA 2VMFA 1L9SA 1T3FA 2CAKA 2NNAB 1O7DC 3CLFL 3EJQA 1JK8B 1HSAA 3AABA 4KROC 3ARYA 1B4TA 2Y9RT 2BSDA 5KEZA 1ZT1B 4GG6A 3L9YA 4HEPG 5F1IA 4PJ7B 1T6BX 4YDZA 1TTBA 4JJ5A 3FYIB 2Z9TA 1L5GA 2KH2B 1JZHA 5KN5B 2ZG3A 2ZNWA 1V05A 1JUFB 1MPAH 1RIUL 3EIFA 4U3SB 5IESL 1AMYA 1RZKH 4KY2A 2ZPKH 3L3HB 1S7RA 4L3EE 4TUJB 3S37H 2AEOA 2D7QA 5HGGS 2Z0BA 5I76B 4PY7A 1C5BL 4N0CC 3VFTA 1T66C 3DOHA 1NWPA 4DZBA 1OSZA 1DUZA 1RUMH 5AW1B 2K6YA 5HDBB 3FCSB 1DBAL 2CK2A 4PRNA 3C6LA 5E00B 2YAEA 3WKMH 4Q2ZB 2E9IA 3QZOA 4M6MH 5IG7A 1BEXA 1TQWA 4LAJH 4OJCA 4IEFB 1FL3A 4XMLH 2NX5A 1HNFA 2NQ3A 7FABH 1MW3A 3QPKA 3WXVH 3GJEB 4YHZL 15C8H 4OV5A 4ZUVB 3DGGB 5F7YC 4EMZA 3P4OA 3VGDA 3WN5B 1LQSR 2WN3A 4GQ9L 3MV7D 1WCQA 3N1GC 5CIPB 2GTWA 3MA7A 3BUPA 3VWJC 2W9EL 1B4RA 1I1YB 2COQA 2D0FA 4GINA 1XGPA 1DUYA 4P04A 4J3OH 1KCSL 2Z7ZA 3K5RA 4DFIA 1T2QH 1HXMB 1WBZA 4U1KA 8FABA 1IBFA 2IANE 4I9XA 4BA8A 5F96L 1PLGH 2P49B 2KZBA 5BRZD 5CBEA 3S8FB 4JY6A 5IJVB 5FHAH 1T6VN 3ZDXF 5L88H 1FLTX 2BIMA 3K2MC 1XCTB 4PREB 3TJHD 4LGSB 3TV8A 1N7MH 2F5BL 4JMNA 1KSRA 4GQQA 5A2LH 5EOQH 1YQVL 3SPCA 4FEIA 3O45A 2PW2B 3GBNL 2VXVH 3NIFB 2WXOA 5K9KA 4NIYE 1DBMH 5L4MA 4JFEA 1DQJB 2UXGA 1AZBA 4WK2B 4MGXA 2R4SL 3EH1A 1RJCA 1PFOA 5FGCB 5BO1H 4QXTA 4IBUA 3BXNB 1AR1D 1IM9A 3M8OH 3TZVC 5E4OA 1SBSL 2FHCA 2L7QA 1OE2A 4HMEA 5INCB 5D1ZA 2VLKA 4PWHA 1E2VA 1J0KA 4PV9A 3T0EE 1AHWA 2BFVL 3PXJA 1NEPA 4Y1AA 3KPRB 2ZAHA 3EG9B 2OR9L 3E2HB 1SPDA 4A63A 3D9AH 5TH2A 4L1HA 2R2BA 1R3IH 5EF2A 3DUHA 3L1OL 2OMNA 2JMRA 1QYGH 4QD2E 3QUXB 4L8CA 1DSFH 4G8FB 2B59A 3PWJB 3THML 2FR4A 1EHNA 1F4WH 2J8UB 3P11H 1IARB 2R39A 3CDCA 1QTYT 3STZA 3V9EA 2VDOB 3ISRA 5B38G 1S9KC 4A2EA 2EEAA 4FP8H 5JHAA 1XIWB 5IQ7H 3W0WE 2K4AA 5D7EA 2PR9A 5A1AA 5AKSA 4CSTA 4L5FE 2KI6A 3MLVL 1D5MA 1A5FL 4I18B 4DHLA 4N2KA 1U6AL 3IXTB 5JO5B 2XQBH 1T1ZA 2DKMA 4XO9A 2QQKL 3I9GL 2HJFA 5IROD 4Q52A 1YAZA 4JPQA 3GHBH 2CO1A 4X5LA 5D1QB 1E9OA 4B0MM 4BSVB 4XMVA 1GAFL 5B39A 4GQZA 3X1NA 4HISA 4E2OA 3KPOA 4R7XA 2W80C 4D7PA 5BS0D 2YA0A 1MNUL 5DD1L 5K9JH 1MKFA 3OXSB 4TSBH 3OGCA 2N1KA 4JPVH 1K2DA 1EIBA 1M6UA 2QLVB 3D1MC 3HE7D 1A9EB 2YEZA 1ZHLB 4WHYH 2Q10A 3OR7B 1QTSA 5EU4A 1AGDB 4QRUA 3VFUA 1RCYA 4BRJA 1OP3H 1I3VA 4JE4B 2YMTA 4IRZL 4XP5L 1IFRA 3X2QB 43CAA 3DXAB 2QFRA 4TNWK 4HHWA 2CCLA 5J13B 4LOUD 3ZTEA 3ARBB 5GGTH 4I7ZC 1JWMA 1UWEH 3ES6A 4NZUL 4G6ML 4FABH 3K72A 5BUPA 2C3GA 2GAZA 1A6PA 5C9JB 4XP1L 1MY5A 5A2CA 4UIKL 1NKGA 1I9IL 2V5TA 1U3HC 2B3RA 3BOVA 5EC2A 2P47B 1XMEB 2WVVB 3NSDA 3DC0A 1OOWA 2ERJB 2PMZA 3BDBA 1F4YH 4IRSC 2CQVA 1NBZB 3SDXF 4ALAC 2LLGA 4NBZB 4PRDA 4KXZI 3O0LA 3RVTC 5C0FA 1SN0A 3OLEA 4XPGH 3LAFA 3ZTNL 2PYEE 3OL2A 4PJFA 2EIEA 4NKOA 1X5IA 1H9VA 1ID2A 1R3KB 2CO2A 4ABUA 5LDSA 1U36A 1FSKC 3G08A 3HAEG 4NO5B 2Q8BH 4AYEC 5DQJB 3IJEB 2GB2A 2AABL 3OQ3B 4BZ1L 3TF4A 3ULAB 2X9ZA 5JORA 2EDMA 5CEXA 4WW2F 4O2FB 1WCBA 1KIRA 3WAJA 3KPMA 2I9LB 1EAPA 3ABZA 4WNQB 1J9CT 1NPUA 1ZA6B 3QNYA 5IVXB 3GHPA 3IDIA 3UYRH 3M17A 3RI5F 3V4PB 3E7JA 1MLCA 3BAKA 3FN0H 1F3JA 1AGCA 3C75A 4TOYL 5I30L 4LRNH 4FTVE 4MA8H 4KY1L 4D9LL 3U0WH 2VERN 2OV0A 2R59A 2IAMC 2ZAGA 3IJSB 2ESVD 1O7VA 3F8UB 3PY9A 3OMNB 4ALAL 2VUOA 4JFFE 3HMXH 4DUVA 4HPOL 3Q9QA 1FVCA 1SLUA 2OMBA 2I9TA 3MRFB 4LSSL 4ODUB 4BV1A 2NSQA 4K3HA 4XBEL 5JOPE 1M3JA 3KBHE 1VFBA 1XB6A 1OSYA 5J1SC 1RLBA 3LHPL 3V9FA 1YN7B 4APQC 3FOMB 2J1WA 3VH8A 4L0ZA 4LSVL 3L5WA 1IGML 1J18A 1FAKT 3KMDA 1E7VA 3BH8B 4RZCA 2FJHA 2BY2A 1O6TA 3IFOA 1F41A 4JW3A 4L9DA 3N43B 5I1AB 1OSEA 3ULSA 5EEYA 4X98B 2XA8L 5JW3H 2M1KA 3KPLB 2BX5A 5HHNA 4PMEA 1FQ9C 3CLFH 1OGAE 2VSCA 3RP1A 3FJTA 4OD2A 4P2RA 3ZKMD 2A6IA 1OWRM 4ANWA 3U6XS 4ZRGA 5F93C 2VM9A 1U8QB 2XTJD 3HA0A 1E27B 5EU6D 4U3CA 3W81A 4L9LB 3H9ZA 3PIQB 2D31B 3KLSA 5ILTL 5HYEA 2PW1A 3CJJA 3K2IA 4KZ0A 1AFVH 4EUPB 4CVWA 4CW1A 2BWIA 1RIUH 5IESH 3V8CA 1YJDC 4R7NA 2VLRD 3QEHB 2JIXA 1M4KA 4G6FD 1UASA 4EN3D 5FS5A 1KCVH 1AKJA 3O3EB 1C5BH 1G7HA 4OLVL 4S0TD 3C5ZB 2SEBA 5SWZE 4IK7A 4H8UA 3QIWB 2F54A 5HI5D 3T8XA 1DYZA 2D3JA 2IALA 3JTTA 4I3GA 4Z76B 3BVXA 2ZP0T 2A6JB 2XG4A 4H20L 5IB4B 4JHZA 4MAUL 3MRHA 1EV2E 2BSRB 2A9ML 4ZXBD 1TZOA 3L9BA 3QUKA 1DO6A 3NJIA 3SQBA 3EYFA 4YHZH 4FQXA 3ZDYB 3B7TA 4LCCA 1RUKH 5D2NA 1S4IA 2JE8A 5LBVA 4GQ9H 3QORA 2OTUA 2WY3B 4K3JL 4H1LA 5ENWA 3CZJA 4A66A 2W9EH 3ZQ9A 2WBJB 4XNUL 3AFLA 3WKQA 3BVVA 5JIQA 2KMWA 1KB5A 1EEYB 1KCSH 2AJZB 5E6IB 4TSAH 4WENB 3HZVA 3E6HB 1YJDL 1FNEB 1TVBB 1PX3A 3D39B 4LVHB 4PD4K 5D72H 3LKSB 4H8VA 3AXLA 4MCYA 4CVZB 4EIBA 2B3IA 4J1UA 4Z7UE 1ZIBA 4D0DA 4HIJA 3GKZA 3P4NB 1KJ2B 4R26L 3VGGA 3TEYA 1TLKA 2C8NA 2F5BH 4FMVA 4YVUA 5IFHH 3MUY1 4ZDHB 1PZ5A 2ZWKA 1XEUA 1YQVH 3NK3A 4RFOL 4EDWL 3CBRA 4JQIL 2VRQA 2XZAL 4APXB 3TBWA 2R4SH 4HIPA 3CFQA 1HZHL 3FTWA 2OXGA 3CQQA 4KMQA 1SBSH 2FJUB 5GRXG 5HJDA 1T22B 1D5BB 1DEEB 3KLAB 4D2NA 1FYTB 2EACA 2NW2A 3K6FA 3QJHB 1IL1B 3B5GA 4RRPG 5CSGA 4F20A 4PJHF 4TNEA 4UT6A 1A22B 1GGIH 2BFVH 4NQEB 2W59A 1YMMD 4KRMB 4JK0D 3HR5B 2VDRL 4F8OA 1FZOB 1TF4A 2OR9H 5CGBA 4B9PA 4D9RD 2XIBA 4DQAA 1X9QA 4XCEA 4L3EA 5CILL 1CQYA 1A8JH 3L1OH 4GAAA 1YUHB 4LF3A 4Y7OC 1OP5K 1DN2A 1P4BL 3HC4L 3GIZL 3DUSB 2V37A 3THMH 3UTPD 3QFJA 2HCZX 4XCFL 4R7DB 1BIHA 5J6HA 1OEZW 5EV7A 2CPCA 2A77L 4P57A 1NOFA 2AV1A 4XMKL 1CF8H 1TVDA 2P28B 2PWGA 2VR3A 4KKBC 1KELL 1N5AA 3U46B 3KLDA 3V7AE 4G83A 1KXHA 1X5XA 2DJMA 1SEBA 3Q6FB 1UTDA 1A7RL 1CB4A 1KYUA 3MLVH 1Q0YL 5E56A 1A5FH 4ZTEA 4LHUB 5EH1A 2V7HA 4X6DA 1U6AH 1QFHA 1XF2B 2PWHA 4QHLA 2QQKH 3I9GH 5IV2B 3QIBB 1BQSA 2DQJH 2XKNA 2ZF8A 4CBZA 3FUKA 2WCSA 3L95A 1FCGA 4G9FD 4J4PD 2P46B 4LPVA 2D4DA 3DJRA 3UGUA 4JPKL 4NO2B 2EIMB 1COBA 1GAFH 4P5MB 4WIQA 4Y4KA 4D0BB 3IVKA 2BIPA 3ATEA 1MNUH 3IS1X 1FO0L 2XXFA 5I1KL 1P4IH 2IANA 6PAZA 3OF6A 1D5ZA 3JTSB 4LU5H 5GZNC 3STBA 3PHQA 2C9VA 1NMBL 1JYWA 2KUTA 4NRZB 1DQVA 1UH4A 2FWOB 5DRWA 1XH1A 2GT9A 2C9UA 4ZFFB 1N70A 4IRZH 4XP5H 2HG5B 2NNRA 3AAZA 5IF0A 4CMMA 2XIIA 1XH0A 2YLHA 5INDB 3KWWB 1G7QA 1RUQL 3P2DA 4G70B 4MWFA 2P5WA 4A6YL 3B9VA 2YBRB 3QNXB 1BFOA 3POCA 3HIZA 5FV2A 3VXRB 4NZUH 3UTQB 5BMFL 4FLRA 1YEDB 4TMPA 5D55A 2QQNL 4BH8A 2EVGA 1TVHB 1CFTA 3VUAA 4JAMB 2W8CA 4JM2A 4OJDH 3ARUA 1N6QH 1E6JH 1V54B 1NCIA 1Y6MR 3QHZL 4GXUN 4UIKH 2R23B 3D3VD 3U4EB 5IW6A 5LGKA 3BW9A 2V7NA 2L7EA 3C9NA 1EWHA 3TA3B 4OW6A 1L6XA 3LZOA 5AAWC 2WKGA 3BX7C 1ZVYA 3Q44A 1D6VL 5EDXA 4JJOA 4RIRB 5KBDA 4KJYB 1GZPB 3L3JA 1I7TA 1QTPA 5B1KA 3P02A 4P2AA 4K73A 4GKSB 4RGNC 3ZTNH 5J8OA 5DUML 5K9OB 5C8JB 5KJRL 4G9DA 1TTFA 4N0RA 2KPWA 3EH4B 4DK6A 1EFXD 4NNXA 2AABH 4XNZB 2A9NL 3U0PB 4BZ1H 2Y7MA 2A6KA 4KI5F 1MFAL 4N2OA 2VDPB 1HHJB 3ZYZA 1TEYA 4LLUB 4NQCE 3W0WA 1RZ8B 2PPDA 3FZUC 3OHXA 3I6KA 3RL1B 1IC5L 2QSCL 2GSIA 4N24A 2QGDA 4MB5A 2VDQL 3WEXA 4C57C 1ET7A 2G5RA 5FAAA 3R06B 3R0MA 1WISA 4FG6D 4RMQA 4K23H 5DJDB 3SDDB 5E0QA 3MGOA 4YBLB 5I30H 4TOYH 1SYVA 3WENA 2I24N 1WZ1L 1DTUA 2APXA 2DYPD 3GWJA 3CH1B 4P48A 5C07A 1MG3C 5TTRA 1IFGA 4ZOCA 3UTTE 4ALAH 2V2TB 3GRGA 3JV4A 4HPOH 5AW0B 2H2SD 4LSSH 3NJGA 5DWUH 4XBEH 1TQBC 3V5DA 1FG2A 4X8CA 1ONQA 2MWCA 3BGAA 4OCSL 3D8MA 4P2QE 3QC5X 2YD7A 3LHPH 2J5LC 4FNSA 2A73A 4LSVH 3BIKA 2EDNA 4LSDA 4Q9RL 5D7JB 3UCQA 1H8OA 3M86A 4ZK8A 1IGMH 3FYEB 1KFGA 2ITDB 4FERA 5C09B 3T4YB 4AGPA 3KBFA 1W80A 4KK8D 3OAWA 3H1ZA 2ZQKA 2YAHA 4O2CB 1OP9A 4G43B 5LCVA 1ZHNB 3C60D 5EIIA 1OAJA 3RKDC 2XA8H 3QS2A 3IMRA 4YO0B 1SEQH 4LPCA 4JANB 2CXKA 2KPNA 3OWRA 1MCLA 3QDMA 4YDIL 3PV7A 4HCIA 1DVUA 3PJLA 2M2DA 2OA9A 3C12A 4HD9A 3ZHFA 2CIKB 1Y6NR 1CG9B 5K9QG 4FAAB 3BUYA 3FUEA 2UZIH 4KI5D 3ZPDA 3BC9A 4X80H 4Q9QL 4JDZB 2WP3O 5ILTH 5IREA 1CLZL 1LDPL 4HIQA 3O9WA 2HUEA 4KXZH 4BELD 2V3FA 3WO3B 5LG1A 5EBGA 4F8QA 2HT3D 3NVQA 2VN5A 3CDZA 3RWHA 1CXFA 3B3BA 3QAQA 4M8UA 2PTTA 4EPSA 4MAYC 4OLVH 4B0MB 1WAEA 1DO5A 1G4MA 1A6VL 2BSEA 4UQBA 3V0AC 4UMGA 5IB2B 2R1YB 3BP7A 4H20H 3V6BR 1LP9E 3KDMA 4IJ3C 4MAUH 4R8WL 4AWJC 4AVHA 5JHDB 2G4GA 2CR3A 4LLDB 4P5KB 4B97A 2A9MH 1BD2D 1WH0A 1J1OH 2OR7A 4PLJC 5AB9A 2BNQA 4W4OC 1HEZA 3T77B 4EEEA 1EO8L 3I9IA 2WWMC 1TKWA 3QWOB 1E8YA 5CF3A 4AYMC 5H94B 4ZD3L 1IAOA 4KTEL 1TR7A 4K3JH 1USQA 1M2OA 4F7CB 2WKOF 3R0NA 4GP8B 4XNUH 3H3PL 1A4KA 3B56A 1P5VA 2KQNA 2PO6D 5FUCE 1QKZL 2BZ7A 4UBDD 5CEZD 5KYYA 3UXFA 1LEGA 1GGYA 4L2LA 4DQOH 3IDGA 2AFNA 5DRXA 2RBLA 1QPXA 2W9LA 4P5TD 5D4QA 4XHJC 3W9EB 1D5IL 3LQAC 3UDWC 3ARFB 1N3NB 2ICEA 4U6XA 3AU1B 2ODHA 4R26H 4F80A 3NFSL 1ODAA 4L37B 2P24B 3SBPA 2X89A 3QPQC 2R2HA 4GLRI 4Z3JA 4OCLC 2YD3A 1J0IA 2A74B 3IAQA 3P2TA 1X9LA 1UKSA 4EDWH 5I28A 2WLLA 3RBSA 4JQIH 1JVLA 2E9BA 2XZAH 1MI5A 5L7XL 5C92A 3C5SB 1F90L 1HQ4B 2CJTA 1HT6A 1HZHH 1R3LA 1PX4A 3MREB 2DWYA 3REWA 5DJYB 4XZ4A 2PPAA 4WCYL 3SDCD 5IJBC 1QNZL 5K59E 2N0MA 3G5WA 5ESVA 3AC0A 2BW4A 3GMPA 2WQXA 4X6FA 4BFFA 1IU1A 1MH5B 4WJKB 4YIQA 3U9WA 3HE6A 2YQGA 2VDRH 3GEWB 2N01B 2H41A 4FQIL 4OVUA 5T1JA 3T0VA 3P54A 5ISZD 1YC7A 3H8NA 3AACA 3K4AA 1UFUA 5CILH 4ELKA 3OR6B 4F33A 1HKFA 2YLKA 3VFSA 3ZR6A 2UZPA 1P4BH 3ZE0E 4RX4A 3HC4H 3GIZH 5CD5C 4HLZG 2BCMA 3BGMA 5IROA 3LQAL 1HL4A 1UHVA 4XCFH 3G5ZA 1JNNL 5DK2B 4LBEA 2A77H 4U49A 3AXHA 4NWUH 5L8LB 3V7MA 1KELH 3CIAA 1I31A 4C8XA 2DJUA 5G4NA 5I6OA 1CTMA 2W1NA 1QSFE 1A7RH 4J3OG 1LMKA 3SDAC 2XT1B 1ZLEA 3SJVB 4RWYH 1CR9H 2FNBA 2BNUA 4N86A 1KTLB 5F7FA 2P80A 2GJ6A 5HDOA 2X2JA 2ZAIA 3UFIA 1DSWA 4ECNA 1UH2A 1OAZL 1U8MA 4PWFA 4V1DA 5F3FA 3RIFF 5IQLA 3SYOA 4JPKH 4IRJD 5IB1A 4PGEB 5IHHA 4Z7VE 1HHKA 1IAIM 5E8NA 4DCQB 2EDOA 3MJ7A 4EBQL 1NDTA 4HUVB 3IMVA 5FC9A 1RAMA 1DVZA 5GJTL 4OLZH 4ACTA 5I1KH 5C0CB 2IPTL 1DLHB 4DVRL 4X4YB 1XWVA 5A2AA 5J56B 2DMCA 4K5PA 4WFFE 4A37A 1NMBH 4JGUA 3QYMA 2WTRB 2QTEA 4WKXA 4ZMTA 1R0AL 4ZQKB 3EO0A 1J9QA 1E9PB 3FPXA 4PJBB 1NGZA 4C59B 2LAAA 1MJ7H 4F7PB 4IBQA 5JTWA 3CMGA 4A7TA 4OU3A 4JFHE 4TN9A 4J3UA 4A6YH 3WY3A 4QRPE 1IGYA 5BMFH 3D2TA 2C9RA 3M45A 2BVEA 4CSZA 4QEGA 3OKKA 1DVFD 2QQNH 3RWCB 4MX7B 2DJSA 2XYCA 1RUPL 5ETUB 4BBWA 3MRMA 1BJ1J 3QHZH 1JYXA 3DRQB 4RNRB 3KD4A 1KYAA 1BAGA 3EOAA 4K55A 3VGHA 4UQ3A 3E1ZA 2ZNXA 1D6VH 3HI6L 4HXAL 4NT6B 4N85A 3D08A 4UV4H 3QUYB 5FYJL 2GEEA 2O4EA 2VLJD 3EGXA 4Q6IB 1UXSB 2NTSP 5DUMH 3VRIA 4IOFD 4GO8A 4RCAA 4WFEE 4P23D 4FNPA 3RA7L 3MTXA 2PCFB 3V5HA 3K3QA 1X7QA 5C0BB 4HZLB 1MFAH 4X7SH 1I8LA 2F53D 3GMMB 3G5VA 1T3FB 4Z7OE 1IC5H 2X9YA 3KPPA 4G3YL 2ITCB 5J06A 1HSAB 3C8KA 4ISVB 5CN3A 2VDQH 2IADB 3IFNL 2QTVA 4HWBL 4MHHG 3MUJA 4OJEH 5AAMA 5KSBF 1XGUA 3ATAA 1CFBA 2KL6A 4ES9A 4GG6B 5F1IB 1MCPL 4X2UA 2ZIDA 5CFAA 3HMWL 4JJ5B 3RQ3A 1NLDL 5E2TL 4W9KC 3PWNB 1VDGA 1ZT4A 1L5GB 1WZ1H 4GRMA 4LSRL 1QFWM 3CZKA 1KB9J 2LR4A 1S7RB 2YD6A 1AOHA 4PY7B 3SDXA 3VFTB 3CFTA 1QRND 1M56B 4DZBB 1OSZB 1DUZB 4OF3A 4UF7C 3L9EA 2E7LA 4Y4FD 4OCSH 3DHPA 2RJMA 4KVNH 5K93A 2CR0A 4DOHE 1NBVL 35C8H 4PRNB 3VFVA 1J5HA 2YPLD 4Q9RH 4PS4L 5IG7B 3QDJE 1YVLA 4MB3A 4Z6AT 3QVAA 2NX5B 3IDYB 1MWAL 2WHVA 4HSQA 1PLAA 2YKKA 2VN4A 4WW2A 3SE3A 1XR8A 1YZZA 4HULB 4RAUA 4I89A 4OV5B 3TJEL 3ZKXB 3HB3D 2F6AA 3P4OB 4Y1SA 5DT1L 3VFGL 1KV7A 4XNXH 4CL7A 3OJDA 3TONA 3TN0C 2C9SA 2GTWB 1XB8A 3MA7B 3N2JA 4F8LA 5LNEA 3FU8A 5FDYA 3IGLA 4JFOA 1XGPB 3BFWA 1DUYB 5CJXA 4YDIH 1INQA 4GKNA 1E4KC 5FKPA 4MMZA 3ZYJA 1CLOH 5CAYB 1WBZB 3KS0J 4U1KB 2LU7A 1ZGLP 2ODIA 4Q9QH 5CBEB 1XF1A 2FEDC 2OP4L 3BSHA 4JY6B 1LDPH 4FQCH 2BNRD 1NMAL 1RV6X 2ADJA 2ATAA 4BHUI 1X5LA 1DLFL 3S3BB 5E0FA 1XB3A 3HG1E 5IQ9A 3EJZC 3EYUH 3O45B 3WSQH 3ZO9A 4B7IA 4JL1A 2RACA 4NQCA 4YSPA 5K9KB 5F1NA 4Y2DD 4JFEB 4NEHB 5F7LB 1A6VH 3BP4A 4QXTB 1WA2X 1IM9B 3GLAA 3WS3A 5FECA 2IDQA 2CBMA 2Y7NA 2EE2A 2OMZA 3D50A 5CLYA 5D1ZB 5I15L 4L4VD 1E65A 2X6VA 4N4YB 1AHWB 4F9LC 1SFDA 1BSIA 4MJIE 4NN6B 4Y1AB 5CEYA 2DL9A 2EEFA 4EXPX 5TH2B 3S4SA 4ZD3H 2XWRA 1ADQA 2R2BB 4KTEH 5HDWA 3V4LA 1KT2A 1XBDA 4MZ2A 1FZKA 3F85A 4L8CB 3M07A 4AQZA 2K3HA 2B59B 3H3PH 1T83C 3BP5B 2A5UA 1IKNA 5EBMA 2Y72A 4PI0A 1QKZH 4JO3L 2FR4B 4GKZA 1GSMA 4UZGA 1JPSL 3STZB 3MV11 3K81A 1U21A 4QDGA 3JQOB 4WO4A 3TYFA 4HT1L 1NC2D 2O6PA 3O6FA 4HCFA 3VGAC 2A9CA 3GLZA 1D5IH 2APWA 1NZRA 1TQUA 3U82B 4EKJA 3NFSH 3RL2A 3NIDB 1T1YA 2V33A 5B21A 5DVMA 1T1ZB 2EXYD 5DHVH 3FRPA 3X1FA 1XDTT 2MCPH 1ZV5A 4YL4A 2XV0A 4KKCD 4L4TE 4S1DD 3RAJL 1KCWA 4BGLA 2K0RA 5L7XH 1E9OB 1F90H 1C1EH 1OB1B 4TLUA 5B39B 4G72B 3RTQA 2PWDA 3QDAA 1G43A 1P7QD 4WCYH 4AGOA 2BZDA 1AHKA 1QNZH 1H0DA 3OGCB 3MOAH 1XHHA 1K2DB 5DMJB 4MB4A 1R17A 2YEZB 1IT9L 1AQKH 4OTXL 4K07A 4QRAA 5DURD 4Y1TA 1EHLL 5EU4B 4FQIH 4QRUB 3FO2A 3VFUB 2EH8L 5DR5L 43CAB 1MCCA 5F6IC 5FW7A 5I18L 2O5ZH 1PY4A 1CYXA 2BRRL 3AQYA 3QZWA 2MJWA 2VDLL 4U2ZA 4HH8A 3MRLA 1EVUA 2K4WA 4DPCX 3HI1A 3LQAH 1CICD 1CPUA 1JWMB 2FT6A 3ES6B 4WK4B 3GBEA 3K72B 3W11C 3ZUNC 4YSTA 2GAZB 3MX0A 1LP9A 1BWMA 5MEND 3QIUA 3T6WA 1ASOA 1TEFA 3ZMEA 4Y2OB 1MVFA 1NL0L 3AU0A 2X3CA 2ICCA 4GKOA 5EC2B 4RFNB 3R7RA 4PB9L 3BDYL 3HMXA 2CBTA 3DJTA 3HZ3A 2H6OA 2Z34A 3MUUA 4PRDB 4WGWB 1HKLH 5C0FB 1IC1A 1YY9D 1OAZH 5D6CB 5HI3D 4C4UA 4HJGA 4FQHA 3BYYA 4PJFB 2MCMA 4NKOB 1DP0A 4PJHA 5JXAL 3RVXD 4KO6A 1QFUH 3G08B 1B88A 3X1EA 4F37K 3HNVH 5CINH 2IPTH 2AGJL 4BKLA 3MXVL 1E6OH 1F1DA 5KYNA 5JORB 2HT4D 3WE6A 5CEXB 1YEJL 2OSXA 1RL1A 1KIRB 1OSPH 1EJFA 3H9YA 3AREC 1R0AH 2VGLM 4PJ9D 1EAPB 2VLME 3BKYL 3D3VA 2Q8AL 5IT2H 4NZRL 3QNYB 2WIIA 3SGJC 1U42A 3H55A 4GW4B 1MLCB 3LNFA 4YBQC 5F44A 2JKXA 4GLRH 1F3JB 1AGCB 3RY6A 1BF2A 4OGAD 2CDEB 1I85C 3ZYIA 2AEPL 1KUMA 3FTSA 3BPOB 3VDAA 3VXOA 3W56A 3GXMA 3WLBA 4IIQC 1GIGL 3JV6B 4GT7A 5E6RB 1CIUA 1PZAA 1BWWA 1RFDL 1RUPH 1SLWA 3LQZA 3N40F 5CBAA 1XD0A 1FVCB 2I9TB 5E2VH 2WB7A 4ADIA 4RAHA 3F62A 1U8OA 3MGAA 1VFBB 3MNMA 4HXAH 1UT9A 3ZMNA 1HWGB 3FUJA 3IMUA 5IWLA 4EOWL 2Q7NA 3ETSA 3EBGA 3GMLB 4BCXA 3CN0A 3CVIL 1PG7W 5DK3A 3RB7A 2HRHA 2I27N 1WUZA 2N7AA 5FUZL 1R9FA 1MJJA 3TTSA 2NY5C 4RZCB 2FJHB 3ZE1E 1RURL 4K0OA 4X6EA 5T1LD 3IFOB 3O4LD 1I82A 3V10A 4QXWA 3ULSB 1CFNA 3B3IB 2ZWYA 2DYPA 3FPYA 2NTFA 4GIPD 4G3YH 4WUUD 4OD2B 4WEEA 4P2RB 2A6IB 3I84A 4HWBH 3I6LE 5DVPA 2EILB 3EJPA 4JPWH 3QHFL 2P4AB 3MKGA 1MCPH 4XZUA 2AW2A 3TO4C 4LLWB 1J5OL 1OP5H 3MBED 2X2YA 1DQDH 4PG2C 1HZKA 3LKPA 5CJBA 4BUHA 1H3TA 1PLCA 4LSRH 3EBAA 4R7NB 2QR0A 3VXSD 3TWYA 2JIXB 2VNCA 1S78D 3L7FA 5L2KE 1AKJB 4RMUA 3KW7A 4ABVA 1G7HB 1MSPA 2PP7A 2SEBB 1BPLB 4XVJL 4HFWA 2F54B 5EWIL 2ZUWA 5DUBA 5I73C 3T8XB 3I85A 4KJWC 2G3MA 2IALB 3JTTB 3U36A 2NY5L 1NSNL 2XG4B 3MACH 4ZMLA 2DICA 1SM3L 3MRHB 1UXWA 2YO3A 4PS4H 3S48A 3QJFA 2DI7A 3BGFC 4HUNB 3QUKB 1MWAH 2LLLA 1MREL 1DANT 4JFDB 2H3XC 3EYFB 4NUJA 5AW6B 1FJ1A 3DJZA 4FQXB 3TJEH 1OPOA 3H9SE 5D2NB 4LCCB 1DDHA 5DT1H 3VFGH 3BPNC 1MHCB 3LN4A 3OVUB 2OTUB 3BD5A 3QORB 3VWJA 4H1LB 5ENWB 1AQMA 1GS7A 1UM5H 2GIXA 4CC1A 4DP0X 3P9MA 2MIZA 4NC1E 3PE9A 3BN9D 1KB5B 4XT1C 1TTAA 4ELME 4KMTL 5EZOL 4Z7NF 2ZUYA 4K7PL 5DRZB 4NAQA 2N56A 3HZVB 2E7BA 4ES8A 1QR1B 4AUYA 4U05A 3AXLB 4MCYB 2ICES 4J1UB 2OP4H 2EYTA 4D0DB 3RIAK 2VC2H 1NMAH 3UJIL 3ZW3A 3BCFA 4HIJB 3CFCL 1DBJH 4LCWD 5LN4A 4XN1A 1SF3A 1B9KA 1DLFH 3SY0A 5L9DL 4XPTL 2WMPB 4EDXA 4X5WA 3HUJE 3MLWL 2VDMH 4HUKB 2ICWI 2NY6C 2JELL 4IJTA 3TBWB 3QEQA 1KTRL 5D7LE 2EVHA 2Z0UA 3TZVA 2OXGB 5JNYB 2NY0C 3H3BC 3N55A 3WI9A 1JTTA 3L8QA 3MLXH 1EBPA 2NW2B 3A47A 3P3SA 5I15H 3IJ7A 1U2HA 1KN4L 2Z3FA 4NI6A 3SZKC 3VSQA 3IGKA 1HL5A 1HX0A 3UMNA 3D69A 4KJQC 2H2SC 1SHSA 2CKBB 4XCEB 4UTAL 4L3EB 3KXFD 1IAKB 4RGNE 2DWEA 4LF3B 3WMSA 3QZNA 4OZ4A 4XTRC 4GFXA 1NTDA 2PABA 2BOBA 3NFNA 4IRZA 4JO3H 2Y3AA 4OIFA 2FT8A 3V2AR 3QFJB 1CE1L 1JPSH 2M83A 3O8XC 1TNNA 5J6HB 4P57B 1PIFA 2AV1B 4HT1H 3ZDZF 4JQXC 1QHOA 5KS9E 3LQMA 3N85L 1N5AB 3BN3B 1SEBB 4Q89A 4RSYA 2RCSH 4ANXA 3NDYE 3DO7A 5CN1A 1A25A 1CN4A 1FVDA 2WLMA 2WTOA 2V7HB 4X6DB 5TGBA 3VRLE 1QEWA 5FYKD 3I6GA 4QHLB 3WN6A 2GQHA 4ZMXA 3RVUC 1OZTG 2XKNB 3A67L 3C2AH 3RAJH 3DRTA 3L95B 3W39A 3PDDA 1ESOA 4Y4KB 5B1CA 3KM1A 4XN4A 3IRCA 4TVPL 5FYLL 1AKPA 3HR6A 4B9JA 3EHBD 4XX1E 1NMCB 1A3LL 5HGHA 3HJEA 4CKVX 2IANB 4MZIA 1D5ZB 1L7TL 2KT6A 2C7UA 3PHQB 2B5IC 2CHDA 1IT9H 3CUPA 2R0WL 4OTXH 3HN5A 1T7ZA 1RZJC 2WKOA 1EAJA 3CIQA 2EIZA 5DRWB 4BZ1A 1K4DA 3MC0A 2GT9B 4E41E 5E51A 5HD8C 2EH8H 2R2EA 4Y2LA 2IH1A 2FGZA 3UPRA 3AAZB 5IF0B 3ESVF 5I18H 1NPNA 3L4TA 3KH3A 4CMMB 4OI7A 1DQIA 2ZCKH 1CTNA 1PD0A 2VJ0A 4N0YL 4QRQA 2VDLH 2VM4A 3ULUD 1G7QB 4MWFB 1MW2A 2P5WB 3FFCA 1BFOB 6FABH 2AQSA 4IRJA 4BH8B 1UG9A 5MEQB 1CFTB 5IM7A 4JM2B 2CK0L 2A38A 5D2LE 4XCNA 1KPRA 1U3HA 2YUVA 3GRBA 2JLLA 5IW6B 3BW9B 1NL0H 2V7NB 3C9NB 3QCVH 1CZ8L 2EVIA 1AYOA 4IRSA 5AOLA 4MJIA 4NOFA 4FHJA 3BDYH 4PB9H 5I2IA 3FU0A 4MXVE 4PRHB 1T5WA 1MCRA 5D93C 1I7TB 4TQPA 2VZSA 4UNIA 3BWUC 1WFNA 1O75A 4UANA 1YEEH 3CGTA 5JXAH 4IGBD 1AQ8A 1G6RL 1I1AC 1S7VB 3NSXA 5SV3A 1RZJL 4G9DB 4ZQTA 4JCLA 5K69A 2AP2A 1P7KA 3L45A 4NNXB 5C0ND 2AGJH 1O9VA 3MXVH 4ONFL 2A6KB 2AQ1A 2R51A 3N41B 3QZPA 4AM0A 5CKAA 2OULB 2PXYC 1W15A 1YEJH 1QBML 5IHLB 5JDJA 1JTPA 3I6KB 3VD9A 3VB9A 3WY1A 3L2LA 4XWGL 1NCCH 2GSIB 3BKYH 4F2FA 1ZWIA 3WEXB 4N0FA 1GMEA 3MMEA 1CGWA 2Y7QA 1SHMA 2WBKA 2XDHA 4LVNC 4OAWA 1ADWA 5DD3L 3MGOB 3CHOA 1SYVB 2IAMA 3GUFA 3KPSE 4FI8A 5I9QC 5TF1L 2AEPH 4DO4A 5AW8B 3WY4A 3AUWB 3OAZK 1BA9A 1NGXA 1DJZA 1GIGH 3QXTA 3HHSA 5L8KB 5C07B 1RFDH 1SRDA 2HTLD 2P48B 2ADFL 4K8RC 3VXMD 3JV4B 4HWEL 1IBYA 4KUCD 5FO9A 5DMYA 3V5DB 1FG2B 4A2MA 4C4BA 1DJGA 1YEIL 5DCCA 5DJAA 4APQA 2CBQA 1P53A 4ZMOA 2A73B 4EOWH 1W0YT 3BIKB 2JKIS 1AY1H 3Q6GL 3GJFB 1U8IA 3QRBA 3WHE0 2YD5A 5I74B 2I69A 3F12A 5FUZH 3QO0A 3EYVA 4HJ1A 2BPBA 4K7PX 5TDOA 5J4MA 4LOVA 1RURH 1N6VA 2DLHA 3ZGIA 1MOEA 5EIIB 4YSQA 3H7LA 4NPJA 4BFIA 1KYDA 3LH2L 2Z91A 3QDMB 3ZZSA 3LY6A 4MS8D 3QHFH 2AJUL 4O51A 1JS4A 4AL8H 1JTOA 5C2BL 4K8RL 2QSQA 4I0KA 1MRFL 1ZIAA 3O9WB 4LDEB 2JJWA 4PWEA 4X7TA 2A9AA 3MSPA 3ME0A 5KSAC 3CDZB 3SD2A 3RWHB 4AY0A 3DURA 3BKMH 1YSOA 2PTTB 2E27H 1QSED 3TPKA 4XVJH 1ML0A 3KWXA 5EOTA 4IIZA 4U6YB 3QP3A 3QAZB 4E36A 2XFXA 2R69L 3O3AA 2NY5H 1NSNH 1OHZA 3DIFA 3BP7B 5EN2A 3UEQA 4JQIA 3KDMB 4M9PA 3WFBL 1RSFA 3MLYL 1J5DA 1IEBA 3GXPA 3ZN6A 2X4RB 4OGQC 2ITFA 4Y5YC 2BNQB 1HEZB 1QZ1A 3D5OF 2MHAA 2UUDK 1TKWB 1QRKA 1Z2KA 2NXYB 5T33L 2R15A 4UOW0 3BKJL 5C6TL 4WWKC 3VI4E 1IAOB 3CDGA 5BVPH 5KSBA 2FUTA 3SBWC 3MRNA 1RJLA 2GJPA 4TNVF 2C5DC 4N8PA 5E6YA 1LM8V 1A4KB 5BRZE 1P5VB 5H35A 1TETL 2Z4QA 2Y25A 1X5YA 2Y7LA 1R3HB 3PGCA 4KMTH 5EZOH 1ZVSA 2DBLL 4K7PH 1LEGB 5KYYB 5HHVL 4NP9A 2ILLA 1FGNH 1JZ5A 3PL6C 1AR1B 2F8IA 5DRXB 5AD0A 3SKOA 1JPST 3N0AA 1DJHA 2E6JA 3MLRL 3VX1A 4LPXA 3UJIH 2ICEB 4XO3A 4ZOBA 4KOCA 5HP5A 5LO7A 4OB5H 3AT8A 4V11A 2K1MA 5L9DH 4XPTH 2G75A 4M03A 2C3VA 1BG9A 3IDMA 2JELH 1MZYA 4X42A 3RTLA 1MI5B 4NO0A 1OGSA 2C3XA 3MV9D 5KOVC 1I3RA 1LVEA 1MRDH 3Q1EA 1R3LB 3NUKA 1HL8A 3REWB 4KU1A 1DE4A 4JRXD 4LIQL 4MJ4A 2V3EA 5ESVB 4AQEA 4X5RA 4PM1A 3Q8CA 3GMPB 4JKMA 2KYIA 4X6FB 1DCEA 3VGEA 1KN4H 3IU4L 2ZUUA 1FO0A 4YIQB 3HE6B 4PGJA 3FW6A 3T65A 1P9MC 2DIJA 3QJUB 2DWXA 3O4OC 3JBG7 3RVVC 2CM5A 5D7SL 5E9DD 5J1AA 3SDYL 1LE9A 2G0KA 1RK7A 4UTAH 4ELKB 4F33B 2NT1A 3R19A 1TYJA 3VFSB 1B2WH 5EZLA 5EUOE 5DMKA 2QFPA 3BGMB 5EZPA 2QKIC 3ARGC 2ZOTA 3IEAA 2OYKA 4N3TA 3A6BL 3G5ZB 1YPZF 3JWNG 4NXSA 4XP6L 4LBEB 1XX9C 2VJ8A 1EXUA 2YAQA 4A6YA 5I75B 3N85H 5EEVA 4MA3A 5HGAA 4EO5A 5BXFA 3VFPA 2WKLA 3LN5A 5CZXD 3G6JE 3HNTL 3W82A 2NY1C 1P6AB 4PMFA 2BNUB 1VFAA 3HBZA 5AVRB 1AO7D 4XX1G 3H9SA 2N3JA 4L1BA 1BVKB 1F97A 1FZJA 2GJ6B 4F8PA 2YD4A 3A67H 4XB8A 5BS0E 4PWKA 3HG0A 4V1DB 5IFAL 3ZT7A 5IB1B 2P7TA 4IQHA 2WN2A 4TVPH 4PJEE 5E8NB 1HHKB 5F7NC 5FYLH 5KTEH 3MJ7B 5I71B 3LXCA 2QPDB 1G87A 5MI0C 1A3LH 4ZS7L 5AUMA 5GZNA 4R2GD 1L7TH 1SQMA 3HRZC 4TUKL 5DHEA 2R0WH 4LZKA 4KKAC 4PRID 3GMOB 5ELIA 4H4NA 4LGRB 3EO0B 3FB6A 3WOVA 1MFEL 1L9QA 1PSKH 3H42L 3RVWC 5C0AE 4LFHG 4OR1A 1NGZB 3SIKA 3HUJA 3SGKC 4R5VA 3B2PA 5HYJD 3SCMC 2ZOOA 1HOCA 3CZGA 3LNHA 2JTDA 1WLHA 3UYOD 2CKNA 1IGYB 1CI5A 4XOCA 2M26A 3OKKB 3GYRA 3P0YL 1EGJL 1RJZA 2XIDA 1OD9A 1GC1C 2CK0H 2D9QB 4QRFA 1ICTA 1WFJA 3MRMB 4FXGC 4YHKH 1IBGL 5AAWA 1CZ8H 2JTYA 4MYPA 3EOAB 1VF5C 3GZPA 4UQ3B 4FS0A 1NCNA 2ZX5A 1N18A 4H2CA 5DHYA 5J3HD 5EFIA 1LO4L 4KZDH 1IV8A 4O4YL 1OT2A 5FM8A 3EGXB 1U3JA 2XWJA 3ZU8A 4FG4A 4HETA 3MJ9A 3VRIB 2ED7A 2NCEA 1G6RH 2A0LD 1E8WA 1RZJH 1OTTD 2JXMA 4XNAA 1UA3A 3V5HB 3WL9A 1U8KA 3UX9B 5A6MA 1BG1A 2VDKH 1T0NA 5HHMD 1X7QB 3QUMA 4ONFH 5KS9A 3FTVA 2VL5A 2QGCA 2YSSB 3WG7B 3KPPB 3S9DB 4XWGH 3GRWL 3C8KB 4G6JL 3KGUA 2NZ9C 2XG5A 3QUZC 3BAWA 1XGUB 3MJ6A 4L23A 3OKNA 4NQSA 4PTUA 5IBUG 4HKZA 5DD3H 4BXVA 2ESVE 5AVTB 4CMHC 3EFOA 4BZ2L 1GC1L 4YMPA 3IMBA 5FX3A 5C0IB 3TCLA 2NY3B 1ZT4B 2XUWA 4OD1L 3P3YA 5GISL 3VFNA 4Z7QE 4GRMB 1JYVA 4GAFB 2J20A 3K6NA 4E5XA 3CZNA 2L3BA 4FOMA 2YR3A 2ADFH 3VXUE 4HWEH 2QGEA 5T5NG 2AXWA 1A1OA 3SDXB 3VD2A 1X5FA 2DEXX 2ZX7A 4DEUA 2GEQA 4JLRA 3ZT6A 2VMDA 4E41A 2KLRA 1YEIH 4XVUC 2ITEA 3Q1SH 1U91B 1GR7A 4OFIA 5AKVA 4YUEL 1ZLUH 2SODB 1H8SA 3VFVB 1VFMA 2FBRA 5FM5O 3Q6GH 2WNKA 3QI9D 3VQLA 1GTFA 1TYEB 2ED6A 2XTJB 4RGOL 4OFPA 2UXFA 4KVCL 4OBRA 4ZZFA 1XGTA 4M61A 3VM7A 1MIMH 4PYHA 4WW2B 3EZ8A 1XR8B 4PJ8D 5D7KE 1FP5A 1FFTB 2UXVA 2WXKA 3GGWA 4ZO6A 3BMWA 3ZBMA 4Q0XH 4I48B 4NKIL 3LH2H 3QWNA 1PMYA 4EN3B 3QJTB 4JFOB 5EU6E 3TX4A 3H85A 3VYOA 1WQVT 4GKNB 3CBJB 4UUJA 5FKPB 4MMZB 2F1BA 2WWNA 2AJUH 1S9YA 2IV8A 4FFVD 5C2BH 1I3UA 1RPUA 4K8RH 1JD9A 4MCNA 1MRFH 2X38A 4JO4H 3K71A 3QUGA 5I8OL 2QHRL 3DYMA 2ADJB 4QIRA 4N2CA 4UQ9A 2W81C 5EZJA 2LHAA 2NT0A 3CFDB 4MAYA 4MJ2A 4DAGL 1GGTA 4YPGA 1HU8A 1TT6A 4J2XA 2VLLA 4NQCB 1JXFA 1PZDA 5F1NB 4G82A 2ZWLT 2OI9B 4U1LA 4ZFZA 3G9AB 1KGXA 3BP4B 3VTTA 1KGCD 4ZG1A 5F3HA 3S34H 2R69H 5FECB 1ZCRA 3WS3B 3RU8L 1RULH 3WFBH 4K4KA 1K5NA 3MLYH 2OMZB 3LYRA 2XPGA 4WTZG 4W4OA 4UAOC 4OCWH 1QATA 5EORL 8CGTA 4X99A 1U3NA 4GFTB 2FWLB 2A9DA 3Q7JA 4LT7A 5CEYB 2Y5TA 3X11A 5GS0C 2EDBA 1WZMA 5T33H 2JJSC 3BKJH 5C6TH 1VADA 3S4SB 1X5KA 3D05A 2AJVL 2UWEE 1KT2B 4N2LA 2BC4A 2CJSA 4JGJA 1FZKB 4PBVC 3MA9L 5EBMB 2WBWB 4GKZB 3KWUA 2DBLH 2QQLL 1J8HA 2NZ1A 3M7FB 1G9HA 3IWVA 3TYFB 3O6FB 4XB7A 3GSQA 1BAFL 2JKSA 3UDWA 3G04B 1HOEA 3MLRH 3B9DA 5F3BA 4AUUA 4WVRA 1A6AA 1EJ8A 2VN6A 4QYOA 3RL2B 4YWGL 5CJ5A 1T1YB 3VU1A 2CHXA 5A3ID 4GS7C 1YMMB 1G1CA 2TSAA 3FRPB 2GTQA 1TJHH 2OMUA 3T4AC 3CWGA 4RAVA 5CD3A 2F74B 1R34A 3T3ME 3QWRA 5ANHA 4KI1A 1XL6A 5G5DA 3RTQB 3BWUF 1A14L 3WKNA 2OSYA 4FQJL 1MW0A 1I75A 4LIQH 1H0DB 3PP3K 4QF1A 4Y19D 5CO1A 3VW3H 1QSZA 4KK5C 4M7ZB 1KMGA 4QHUA 2PR4L 5E03A 2B2XL 4ZUTA 1WRFA 3B1TA 3OZLA 2CDFA 3FO2B 1OV8A 4KJPD 5D7SH 3SDYH 3ZKQD 2X3BA 3O2VL 2H0EA 4X83A 3TFKD 1BEYL 5FB8A 2ZWZA 3QDGA 3SPJA 4J8QA 3QZWB 1DVYA 4NBXB 2IC2A 1TZHA 3MRLB 5J12B 1G9EA 2FX7H 3A6BH 2Z31C 1ZY9A 3RGVC 4YHNA 3MX0B 1LP9B 3D2UD 3L48A 4XPFH 1GXEA 2QELA 3QIUB 5SWQA 3NCMA 1ECYA 3VI3E 4X7FC 2WK2A 4MNGE 2VR4A 1ILUA 4WTQA 3SDAA 1IGJA 4WO0A 4PR5A 4OZIE 1H8LA 3QUXD 3HNTH 4M5ZH 1N0XL 3QFGA 5I8KL 4YXLH 1LD9A 1F8TL 4X7DC 4G9FE 3B2XA 3GPEA 2VXSL 4ZS6D 1JI1A 1UURA 2QVIA 3QARA 2CRMA 3UC2A 1A0QL 3CZEA 4FKKA 3WU1A 2WLKA 3LXAA 1J0ZA 3VE0A 5TE7L 3WUWB 5IFAH 4IOSA 5IW3A 1XIWD 4HJGB 5I8EB 1J8KA 3LB6C 5E4EB 4PJHB 4DWHA 2JCCE 3EADA 3ARDC 4ZS7H 3SE8L 2VXUL 3DK2A 4H7VA 3T6ZA 2BHYA 4BKLB 1A9BA 5HJGA 5ACMA 5KBNC 1Q4NX 4NUQA 4TUKH 3WE6B 4AYGA 5A2JH 2CRZA 4JG0L 4U1MA 4Y5VC 3MRPA 5D1QD 5MHSD 5T3XD 2Y07L 3D3VB 3H4HA 3QW9A 2UX6A 2JWYA 3H42H 2WIIB 3K2UH 1LEKA 4AQ1C 1BF8A 1KCUL 4WJG3 1ACXA 3EXLA 2EUWA 5KZCD 1VKXA 4NFDA 4H8HA 4PV8A 1JGUL 2LLNA 3CX2A 5TPWL 3VXOB 1PD6A 1QQDA 1AZRA 2F8VA 2J55A 4KRLB 2BRQA 2HSIA 1XCXA 2LTQC 3P0YH 4PI2A 3LQZB 2WZ0A 4R5XA 3COOA 4X0NA 5CBAB 1IBGH 3DXAD 5I17A 1NAMH 2IQ9L 1G1KA 4AVIA 1NKOA 1WPCA 1CJYA 4MRBA 4HJSA 5AWNL 1U8OB 3ARBD 4XNBA 4XOEA 5FGRA 4TTDC 3CC5B 3DSFL 1LO4H 3EYOA 4O4YH 4A38A 4YBHA 3WAKA 4F2ME 4AYBA 2HYMA 4FFWD 4HOXA 3TVMD 1PS3A 3MTRA 3ULVC 3CTTA 5D5MF 3GXFA 3O81A 1MJJB 3CVDA 1QHQA 1EEZA 2HT2C 3U0TA 4X6EB 4GEIA 3SBQA 1EAOA 4AMWA 5EO9A 4C54A 1KULA 4GRWF 2Y7SA 3N44F 1CFNB 3UAJD 1MWAA 1WFIA 2DYPB 4WGKA 5GRZA 5B1BB 3TOPA 2WO2B 1W72L 2NTFB 4KROB 3GRWH 3BUDA 3G6JA 2WUCL 4G6JH 4QHMA 5B3SB 2XWZA 1ZLSL 5AOJA 5AOIA 4N2DA 3VM5A 1VESA 3HG5A 4FYSA 4XZUB 2NUTA 2D7TL 2YUZA 4BZ2H 1BZDA 4G7VL 5FYLE 5T3ZD 5DQ9A 3AXIA 4OD1H 5GISH 3LKPB 5F9WB 1Q38A 5DS8A 1BQHG 2OK0H 1DBKH 1H5BC 1OTUC 2GIMA 3L7FB 2H5UA 3GINA 1KZQA 5GIRA 4JGMA 5IBTL 4CAGA 4MSWA 3ASOB 2QPEB 4HFWB 3ULVL 5DUBB 4AW7A 4YEFA 1G0DA 3ASNB 3U36B 4YUEH 3UBXA 4NZFA 4YGVA 1OCZB 4MTMA 1LHZA 4YHLL 1UXWB 4KK9D 3DK0A 3I6SA 3QJFB 3H53A 2APBA 4WUKL 1YYCA 4RGOH 2VMJA 2X6UA 2EDHA 2IBBA 4KVCH 4GUQA 4GBXD 5FYKL 2Y0SA 4MRCA 4NUJB 2E6QA 3EDEA 1FJ1B 1NCHA 3VWKC 1DDHB 3S8GB 3ZDYF 1EERB 4XAWL 3TN0A 3LN4B 4UM9A 4YSDA 3VWJB 1Z9SA 3FOLA 5C08D 4NKIH 2Z7YA 3P9MB 1E4KA 1NGQL 2YRPA 5B1AB 1R24B 5B3JE 1N4XH 5GGRY 4M6AA 3TBTA 4NWTL 2QQQA 3BESR 3LOWA 1M7IA 3VD4A 5EO1A 3N40P 4N8VA 4WNJA 3VDBA 2EYTB 2I07A 3T2OA 1KBWA 1WUNT 2ZXAA 5I8OH 2G60L 2C9QA 3SY0B 4N0UB 2BVQA 3ATFA 1V3MA 4TQIA 4DAGH 4X5WB 4XPAL 2R0ZL 4TUOA 4AITA 4ZSOB 3I50L 4UT7L 5L4FA 3Q5TA 4NXKA 3QEQB 2XVKA 3TZVB 2HLAB 1Z5HA 4HEMA 1URIA 4HS6A 5E4AA 2BZCA 2ZUXA 2VDNB 4IKKA 2KS0A 3RU8H 2WSPA 1QLEL 5FFOA 2YJQA 1A65A 2YKLH 3UZVA 5JHMA 3AMLA 2RQEA 5EORH 2N7BA 1QOKA 2P8MA 4K3GA 3L3DA 4F9LA 2AF2A 3C5ZD 1R33A 3EFDL 5ADPL 3ISWA 4X9BA 1THCA 3QIWD 4KO5A 3D69B 2RB8A 1NIEA 3PG2A 4ILDA 4HGWA 2Q20A 4XWOC 4WEBL 2AJVH 3N9GL 5I6XC 4G8AC 2DWEB 4X6CE 1T83A 2BP0A 4OZ4B 4JE0A 4RMSA 3H4FA 2BOBB 3NFNB 3MA9H 2YARA 1XO8A 3MLSL 4EN2A 4R4FL 4BHUA 2QQLH 3FQNA 3JUZA 4PJCF 4TRPL 4EQ3A 1OTSD 1X5ZA 4PCKA 3HG4A 1Q9KA 2FJGB 1BAFH 4JREB 1FCCA 1MDAA 1CBJA 3DO7B 2VSMB 3VA6A 1FVDB 4WHCA 3HLKA 2WBJD 3WNOA 2O61A 4YWGH 5TGBB 4XXWC 2R29H 1QEWB 3OAZH 1VCAA 4G42A 4NO3A 3I6GB 5E6ID 4Z8FL 1K6QL 1HYRC 1ID5I 2FX9L 5I5RA 4G8IA 3DRTB 3W39B 1NPJA 1JRHH 2XCMC 2VAJA 4HVBA 1HQRA 3HFML 5KVGL 4WTXA 1OALA 4JHWL 1A14H 3FT2A 5C0GB 1XEDA 2WVSA 5HGHB 2UY7A 5B22A 4HJJH 4MLIA 5IGXL 4F58L 4PJXF 4DQOL 5ISZE 2PR4H 4WI5A 2B2XH 1A4BA 1IIIA 5F2FA 2EIZB 3ATBA 3J8F7 1K4DB 5J6GB 3MJ8B 2R2EB 1AXIB 2IH1B 4JY4A 3UPRB 2K8MA 3FAWA 2V9UA 1FYTD 2W88A 5EG6C 4QRQB 4Q9CA 3FFCB 5IK3B 1F5WA 1U0QA 3UBFA 5TDPA 3VTAA 4NQED 2VN3A 3FT9A 4IRJB 1JV2A 1HHIA 3DETD 4ZO7A 2NLJA 5IM7B 2OZ4A 1NIBA 1EZUA 4UMSA 3KVDD 1JZ4A 1LILA 1KPRB 4AKOA 2EUVA 3EGSA 2HZHA 4IRSB 1C08A 1N0XH 5I8KH 4MJIB 4CC0A 1T6WA 2HTKC 1DVXA 2VXSH 2WVUA 3DMMD 3RDTC 2EH7L 3S36H 5I2IB 3MZGB 4JKPL 1T5WB 3TP4A 1A0QH 1R5WA 2H2PD 2WV3A 2VXQA 3BHBA 1KIQA 4PJDF 1HI6B 5L2JA 1JNHB 4LSTL 5TE7H 1EPFA 3WUWG 4X4XA 1UA6L 5I16B 1NLBL 2MPAL 1M05A 1FSKB 2DQTL 3FH8A 3U79A 3ISYA 1PKQE 5TJWK 4XAKE 4LHUD 3MRDB 2P9RA 3SE8H 4WV1C 3FTYA 1CDBA 2OS7A 4AM0B 5KAQF 1DVFB 3QIBD 5HVWA 5LXVA 3AREA 2CHZA 3LIUA 4KXDA 1AE6L 4EZMA 5D1XD 5J6SA 3GPSA 4YK4C 2UUDH 3SGJA 1BM3H 1NCUA 2TRHA 4N0FB 2P42B 2OCCB 3MMEB 1TZAA 1KCUH 2Y7QB 4OAWB 1Z9LA 3HHRB 1T5KA 5AKTA 3V55A 1YPZA 4JPIA 1K8IA 4A39A 2JQZA 2CMRH 4K5LA 4YR6A 1I85A 1G7IA 2IAMB 4FADA 1JGUH 4QWWD 2VLJB 4IIQA 4OKDA 3K5SA 4LIQE 5TD4A 3SSGA 2D8KA 1NGXB 2DAVA 4NC2B 5IQMA 2WM0A 3HHSB 5KUKA 1WWCA 4JFUA 4W9CC 3NMEA 5FO9B 2ADGA 2X4UA 3MHZA 4HW6A 1S7UA 4E9QA 5AWNH 5DVKA 2CCWA 3L3IA 1S9VA 1NH6A 5DJAB 3VXRD 2CLVB 3DSFH 4APQB 5DO2D 4G8GE 3HC3H 2NDGA 4FHKA 3LRGA 1P5UA 1U8IB 1DJYA 1U33A 2R83A 3F12B 3FDWA 3HS0C 1NDMA 3PLYA 3QO0B 1A7NL 2F53E 4P4KD 5TDOB 4MCMA 3VB8A 2E74C 1CGXA 1HS6A 3K6DA 3J07A 3TEUA 3NRFA 4AEEA 3PPSA 4MNGA 3TLRA 3JYBA 4G11A 4I2XE 5AL8A 1W72H 1TQCB 1D5RA 2WUCH 4RQQA 4QOKA 2XRAL 3V6OE 4XB3A 3L6FA 5AVVB 3OKLB 3TO4A 4O51B 2D7TH 1UT1A 2BSSA 4G7VH 3TV3L 2RA1A 4PG2A 3S5LG 2XXGA 2HLFC 4OCNC 4GSDL 2R9HD 4X7TB 1RVFL 2JCCA 2E7MA 2GIYA 1QRNE 1GH7A 2GI0A 3ME0B 4FFZH 3T3PF 2X6AA 2Y69B 4BFEA 1BVLA 3L4YA 3DURB 4ODHL 3WHE1 2VZ1A 4R0LC 5IBTH 5DZVA 4E42A 4M43L 3SDDD 2YPLE 1GOHA 1XFPA 5IOKA 5EOTB 2GY5A 2X53A 3VSVA 2XFXB 3X1GA 3FB7A 4QAMB 3F00A 3O3AB 3DIFB 4UT9L 5KVDL 1NICA 4OSUL 4YHLH 4WI4A 1IEBB 3ETTA 1SOSA 3LZFL 4WUKH 3ZE2E 3TBYB 2XNAA 5FYKH 2MHAB 3RZCC 4EXKA 4H40A 2MNWA 1K3IA 3ENEA 3ABGA 4FMFA 4HFUH 5I6KA 3PRZA 1VEOA 3SQRA 1WA1X 3MRBA 2F5AH 1F3DJ 4XAWH 5TK4A 2ZCHL 1SDAB 3CDGB 4C58B 3IKKA 4QTFA 4X8XA 5KSBB 2VDRB 2X70A 1RJLB 5LWYL 3VMNA 2QDVA 2J1ZA 2HRPL 5C09D 4UTAA 1HIML 5H35B 2Z4QB 3PGCB 3RY4A 2BNRE 4Y2DB 1WZLA 1CLYL 1ZVSB 3SGDI 4NWTH 4WSGA 3RX5A 4D9QD 2ZKYA 3OWEA 3FO9A 5AD0B 3SKOB 3VYNA 2X05A 3LKRA 4U0RC 3ZLQC 2G60H 2P5EA 4BFKA 4ZMNA 3BJ91 2ZP9A 3GS4A 4FJYA 3I74A 4X5XA 3QUHA 2R0ZH 2HKFH 3JYCA 4UINL 2MQCA 4XPAH 3ULUH 3I50H 3IDMB 4OY9A 4UT7H 1INEL 3VD1A 3GD1C 4Z3EA 4NO0B 2MCAA 4PP1C 4OFYD 1I3RB 4Z7WF 4F27A 1OP4A 1E9QA 3JTBA 4L4VE 1BQKA 4WFHE 1JNLL 1SXNA 3RWFA 5EULV