5BS0D

Mage-a3 reactive tcr in complex with titin epitope in hla-a1
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
197
structure length
197
Chain Sequence
b'AQEVTQIPAALSVPEGENLVLNCSFTDSAIYNLQWFRQDPGKGLTSLLYVRPYQREQTSGRLNASLDKSSGRSTLYIAASQPGDSATYLCAVRPGGAGPFFVVFGKGTKLSVIPNIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class I histocompatibility antigen, A-1 alpha chain
publication title Direct molecular mimicry enables off-target cardiovascular toxicity by an enhanced affinity TCR designed for cancer immunotherapy.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 31
structure length 197
sequence length 197
ec nomenclature
pdb deposition date 2015-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5bs0D01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5bs0D02
3RTQD 3P30H 5DMGC 1S7QB 2E9BA 4QHNB 3REVA 1IC1A 4NUJA 4YPJA 1C16B 2KUTA 1UJ3C 2KL6A 4OZFH 4WTXA 3UXFA 3P0VL 1KCRL 1FNAA 3WL9B 4G8FB 5F7LB 2CD0A 1LK3H 4F7TA 1MUJB 4DGVH 4F37K 2B4CL 2YUZA 4GS7B 4I18C 5H37G 4RAUB 5EB9A 1A6TA 1AIFB 1HXMA 3AREA 4X6CB 2X4PB 4TRPH 3ZLQC 1E4XH 1P4LB 4NPYB 1LEKA 3MRCB 3O6KH 5D7SH 4FFWD 1IAKB 2ADFH 2F54E 1UQSB 2BRRL 3G6DH 4GKZA 4CU7A 4YHLL 3RPIA 2DQGH 4XC1H 4X99A 5DC0A 5KANI 5DJAB 2VQ1A 3BO8A 4YXHH 2X7LB 1UZ6E 3I9GH 2ADIA 3O3DA 4LEOA 5IB5A 4M5ZL 4NRZA 4YH6A 4UBDD 1M7DB 1R3JB 1F4YH 1ZAGA 3JZ7A 2HWZH 2WIIA 4QXWA 4UDTB 1AHWA 3DUSA 2ADGA 5DVOA 1HEZB 4KK9D 3QWQB 1T1ZA 5EU4A 4Z7UB 5IVXB 1TLKA 4M1GH 2EDEA 5J6GA 4OM0L 2R2HA 4WUUD 1QKZL 2V9RA 3F58L 3GJFB 3P0YL 4OTXH 5ISZD 5DT1L 4JVUA 5ECJE 4HIEA 3ORJA 1KJ3L 5AZEL 3HMXH 5J9PB 5DEGA 3IGAB 1KIPB 1DBJL 3UEZA 2VDKL 2RB8A 2FCBA 3JV5A 4GAGL 4HZAA 2J8UA 5J12B 5IROC 5KS9E 2DYPD 2RCSH 3FQTB 3MFFB 1NCAL 4EEEA 2E6QA 3LKQB 1A8JH 2GAZB 1F8TH 4UT7L 3UP1A 5GGVY 4EVNB 3GHBL 1ZHBA 3X12A 3RA7H 3LEYH 2DQIH 3ARBC 4Q9QL 2K3TA 3FFCE 5TFSH 2E7HA 3D85A 3MOBL 4HIHB 1MH5A 2E27L 1A6ZA 5F89B 3SCMB 1BJ8A 5MEQA 4QXGH 4YFEA 5E56A 1UZ8B 3CK0H 4KJQC 4Z7QF 2VLRB 3RWCB 4FQHA 1WIUA 5SWZE 1BJMA 4OGYL 5DFTA 5GXBB 4Q9RL 1KEGH 35C8H 4L9LA 3SGDH 2NY1B 3RX5A 1TETH 4DKAA 3A6CH 1XCQB 2GK2A 5KN5B 3W81A 1CCZA 4JZOA 4NQVB 3GI9L 2HAZA 4X4XA 2HA1A 2UVEA 4WGVB 3N0PB 4KRNA 1A4KA 4UI2A 4KROC 4KTYA 2HTLD 2NYYD 3DX7A 4LCWB 3HI5H 2JB6B 5KW9L 2I24N 4XPGL 1TCRA 5DHXB 2X05A 2B2XH 4JFDE 3HZKB 5MEPA 3ARDB 3IDUA 4D0CA 1HKLH 3VH8G 5JOPD 3KJ6L 5DVNA 1JZ8A 4N1HB 4I2XB 2EYTA 1H8OA 5LXGH 1MLCB 3CX5K 3S9DB 5IP4A 3BGMA 4N8PA 4P23B 3ZYOA 5CWSB 4A2LA 5C7XL 1EH9A 2A77L 3QDGA 4HPOH 3PXJA 2WBWB 4D0BA 3MLXH 3MGTB 1MAKA 1UB5A 4X5XB 2VISB 3CFIC 4P3WA 1QO3B 4XVTH 5IVZB 1MFDH 5GJTH 1LK2B 3HB3D 4JJ5A 3MRKB 2J3SA 1RZJC 2O5XL 1BIIA 2IFFH 3RHWK 1VADB 2APWA 4NGHH 3FQNA 3V6BR 3ARGB 4Y4FC 3P4NA 1L0YA 3QQ4A 2VDML 4KKBD 5CKGA 1JI2A 2QKIA 3NGBC 1AGBA 5T1DH 3JWDC 3U0PB 3O4LB 5EUOB 4OLVH 1EFXB 4QRPD 4XZUB 1UVQA 3MCG1 1E4JA 4Z5RA 2ZPKL 1W0VB 3O3AA 1OGAD 3ULSB 4U33A 1N0LA 2PUQT 5IJKC 4HKXA 4G6KL 5GGTH 5IBUG 5FYKH 4LIQL 3SGJA 1CVSC 1TJIL 2OR7A 3WFBH 5CGYD 3HG1D 5HYSG 4L4VE 1OY3B 3IXTB 3LPWA 1JTTA 5C6TL 1KC5H 4UTAL 1NCCL 4CNIA 1EAPB 1A1OB 2GJ6D 3LSOA 2QQLH 4PRNA 1OOAA 5ESVA 3RJDA 3IJHB 3BKCL 3IFNL 1FL6A 2WWKO 1JWSA 2APXA 3RAJL 1U3YA 2OTUA 1ROWA 1M7IB 4LLMA 4JGMA 3MJGX 1S7UA 4H5SB 2FL5A 1KGCD 1OSZB 1PG7X 2P8PA 4X5WB 3OAYH 4NHCL 1J9CT 32C2A 3P4MA 1LD9A 1IQDA 4JPKL 1IAIH 5FKPA 2PW2B 5IR1B 1SBBA 3KXFA 3MNVA 3WJJA 1QHPA 3I3EA 1DFBH 2AJZB 1HH6B 1CE1L 3EGSA 4OCWH 3EZJB 5DJYB 3PHSA 3UTTD 2NZIA 4X7TB 3D9AL 2YPLE 4FRWA 5IQ9B 1KPRB 1G0DA 4GXVL 4MJ6A 4YHKH 4PJDB 2QL1A 5GGVL 1RUPL 4YXLH 2FR4B 2EEDA 3U9PH 2F74B 2X4QB 3KS0J 1R3HB 1UH2A 4WIQA 3OAUH 2EKSB 4Y2DA 3TJEH 4JKLA 5HPMA 1L0QA 5KSAD 3FMGL 1VB9A 3NN8A 2AS5M 1CLOH 4JRXE 4PUBH 4L9DA 4M43L 1EEZB 4LSRH 3WIHH 1FL5B 5TE6H 3JUZA 3O3BA 5D8JH 1D6VH 3O9WB 5ICYB 2X1PA 4G9FD 2K1MA 4HLJA 1BD2D 1HI6B 4J12A 3GM0A 2B5IB 3STLA 4JGJA 4TVPH 3QEHB 1F90H 5T33H 5BS0B 4PJ7F 3VXSA 5HGHA 2YPVH 2FX7H 3V0AC 4WU7B 2WK2A 4NKDB 3BIAX 4ONOA 4Z77B 4ZOCA 3DV6A 2IPKB 2AKRB 5BV7L 3SE3C 3VDAA 2BMKA 5CINH 2FJHA 1CXHA 3NAAL 3GI8H 1EFQA 4NQCD 4WFGD 4YQXH 3G9AB 3Q6GL 5H35B 4MAYA 1G7LA 5EBGA 3M07A 4E5XA 2NLJA 4PB0H 1FJ1B 4R26L 2JJSC 4TTDD 3ARTA 2AEWA 3PHOA 4M48H 4X6DF 2HFGL 1D5BA 4ZUWB 1C5CH 2J8OA 5M7QA 5EOTB 4HLZH 1JCKA 3CC5B 5FYKD 1MHHA 1IM9A 4R4BA 2NXYD 5JQ6L 4ENED 3M1BA 3C6SA 4HD9A 1IC4H 2QR0B 2DBJA 4HH8A 2JLLA 3SDXB 1T03H 2XY1A 3T3PE 4JPVH 4PJGB 4QOKD 4OZIA 4LSPL 4FHBD 1EUTA 1MEXL 1OAYH 2X1OA 5LVEA 1AGDB 3JTSA 4JCLA 1CFSA 4IOSD 3KPRD 2RJMA 4M6NH 5FO8A 4IMLB 4L3EB 3QUXB 2R1XB 1AKJA 1ODAA 2IH3B 3AS1A 3QIUA 3O41B 4MA3B 2UZIH 1UXSB 3K81A 3BPNB 1SYSA 3TZVB 1S9VB 4GUPA 4UB0H 2XQYG 3BN3B 3FT4A 5I15H 2GTWB 5CSBA 4G6JH 2D0GA 1HIMH 2DM4A 1X44A 3IFOB 1CFQA 3ECBB 3U36B 3GJEB 5B3JE 3FN3A 4FTVB 1IKFH 4LKCB 3NFSH 1U0QA 1K5NA 4ZS6C 1PX3A 4LDEB 3U9UB 5BOPA 4KI5D 3GUTA 5FYJH 1D9KA 5HI5C 4L8CA 4P2RD 5HYJB 5I74B 1Q9KB 3DGGA 3L3GA 4G43A 4BFEA 1RZKC 1TZHB 3MRGA 4P46D 1K6QL 3S34H 3AS3A 4F2MB 5E2WL 2WLZA 3VI4E 3BKYH 4PGCB 3WE6B 4XPHH 2WBKA 3KYMB 5I9QC 5JNYA 4ZXBD 4NZRH 1N5YL 1XH3A 1XF5A 1F58H 5DA0B 5IHUH 1Q0XL 5C0JB 1EHAA 4HMDA 1D5MA 5CUSL 3VA2C 3ZKQD 5IFAH 3TYGH 4DKEL 3HC3H 5DUBB 4AG4H 3C8HA 1K9TA 3CCHA 3ULUL 3O11B 4JZJC 4KJYB 3MROB 4M7LL 3UJTH 5D2LE 3QZWB 5CEZD 2A83B 3QXDA 1BVKA 1M71A 1JNJA 1U8HA 5I1EL 5CZKA 4X7FC 5IEKA 4M03A 4Z7VB 1LDPH 2BNQA 3EYQD 4HG4K 4P5MA 1IEHA 3LEXA 4ZD3L 1G9NL 4HKJB 1EO7A 4O9HH 3KPPA 3C5ZB 4CKVX 4ZOAA 5TGBB 4YNYA 5CJOH 4GO6B 1YY8A 2ENSA 5C07B 3K4DA 4M62L 5IWLC 4PTUB 2AEIT 1FVDA 3OKYA 5B38B 3PQYA 5SWZA 3PIQA 2VABB 3BGAA 1BGXH 4RDQF 5I8KL 2HVJB 5F8QC 3MLYL 3SPVA 5DZNA 1G9ML 5JOFB 2R8SL 4XI5C 2EO1A 3FT2B 2PO6A 3DRQA 1N4XL 3N9GH 1B6DA 4U1GB 1QLRB 2EDNA 3V7MA 1J1XL 3HHRB 3O8XB 3CX5J 5FK9A 1DUZB 2Y7QA 5EIIB 4OV5B 2VLKE 3EYVB 1B90A 3WO3B 4R7NB 4BZ1L 1N8ZA 4N0FA 4HUWA 1H3GA 3TFKC 2PXYD 3RI5F 2AJXH 1DBBL 2PNDA 1H3TA 1DBKL 5T3XD 4F58H 3P9LB 4XWGL 5HDQH 2B4CC 2JK5B 1YPZE 3MCLL 4C55A 3QRGL 4JB9L 3BT2H 4PJFB 4UNUA 1E6OL 3RUGB 1NL0H 4PP2A 3GSNA 4R8WL 3ZE1F 4J4PC 4U1NB 2FSEB 1DLHA 4Y19E 3GK8H 1DQLH 4M1DL 4UINH 3V95A 4JO1H 5DTFA 3SKNB 1TFHA 1UWXH 1VGKB 4G5ZH 3EOTH 1VFBA 2D3VA 2YXFA 1MJJA 3P40A 2R0WH 2R1WB 1DANT 4R90H 5EOCH 4WI3A 5B3NA 4FMFA 4XCNB 1I1YA 5DR5H 1H3PH 5J13C 2DBLH 1K4CB 2UWEF 4WI9A 1BM3H 3MNWB 4DVRH 1UA6H 2IAMB 2AABL 1ZV5A 3GMNB 2EDQA 3O45B 4LHQB 1QVOA 4JJHA 1OQOA 4HS6B 3VDBA 2YN5A 4K8RL 3MRRA 3TO4C 4F3FA 3RZWA 3JVGC 4N8CH 3QIBA 4J7RA 4HIXH 5JMRA 4AEIH 4O4YH 4FFYL 4MNGB 2NW2A 4L4VA 2MPAL 1JF6A 3D3VA 5ANME 4K71B 3SCMD 2R0KH 1S7RA 5C0AE 3CFDB 3CXHJ 3TESA 4YC2C 1XR9B 1EEUA 2VLRD 3LKNB 3QEQE 5FO9A 1OP5H 3WNKA 3RVVD 1AP2A 4PJXF 2ZUVA 2NY1D 3EHBC 3G5YA 2EDFA 1I8KB 3QG6A 1U41A 2YUWA 3WO4C 3SGKA 4XP1L 1T0NA 2LAGB 1ZHNA 2EO9A 3CZFB 1NC2B 4OI7A 4J1UB 4DKFL 4D9RE 3MLRH 1JHTA 3JUYA 2H3NA 1TZIB 1DZBA 2W65A 5LWYH 5GRJL 2Y5TB 4WY7L 2VQUA 1E28B 4ZPTB 1T83A 1GGIH 1WQVT 5A3ID 3P9MB 4GLRI 4U6YA 1GGBL 3ARDD 5L9DH 2OTWB 5HHOE 1P2CB 2XWTA 1MCEA 1J10A 2HRPH 4G6MH 1T0MB 2BSTA 3BP4B 5EZLB 5EZOL 4P23D 1OTTD 5I75B 2FEEL 3WNLA 1NDGB 1VKXA 3NFPA 5K9OA 3KPNB 4RRPA 5HHNA 1YQVH 5J3HC 4J6RH 3I85A 4YBQD 5FKAA 4OZHA 1F4WL 4XCFH 5DWUH 4P2QA 5KSUA 3BDYH 3VMPA 2YEZA 1CK0H 1J86A 3ARGD 3D5OF 3I3BA 3W2DL 3VD4A 1I7TB 2APBA 3OF6D 4MX7A 4LPYA 4NO3B 1TNNA 2ZZUT 3WUWG 4PJ5B 4X4MA 3TM6A 3O4LD 1NMBL 4QRRE 3WJLA 5KVEL 1D5IH 4GAYB 1F4XL 3RWDB 2FIRT 4JHZA 2F5AL 3CU7A 1GHFH 1EFXD 1A1MA 4MAUL 3TCLB 3ZKXC 4U3XA 4XMLL 3CH1B 3MJ9H 3U2SA 1CF8L 3QI9C 4M6OH 1LO4L 2HN7B 3D1MC 4FQXA 4M9PA 5M94B 2YBRA 1MIEL 3CDFA 1FGNL 1LO3H 3FFDA 5CEXA 1MI5A 3FQRA 3QWRD 2B7DT 3MLZL 4F9PC 3RNQB 4YHNB 3BISA 4EXKA 3KPOB 4YDVA 2IPUG 2X41A 3OKOB 2PYEE 3VXOB 1CICC 4XWOD 5EOQH 2AXJA 2HJLB 3DSFL 5C6WH 5B21A 3FO0L 3D25B 1TQCB 1P84K 1KCVH 3ARFB 1INEH 1OLZA 1DQDH 3L7EA 3T4YB 4AL8L 3OXRB 1T66D 4Q74A 2BSSA 3IDMA 4YDIH 3BJ91 2V9TA 4TQEH 2HKHH 1QA9A 4R4FL 2O26U 1A4JA 1FGVL 4PJCE 2HJFA 1QR1B 1NBQA 5GS1A 1CDIA 3MRNB 4PRIA 2ZG3A 3V4PL 4ELKB 5IUSA 4WHYH 4NKMB 4AMKL 1HNGA 4QTIH 4PFEA 1NANH 3ZYJA 3RZCC 3LKSA 3D39B 3TCXA 3CVHH 3O6LH 3S4SB 4WWKA 4U3CA 1RIUH 1S3KL 1T2QL 5EU3A 2MOVA 4X98A 5J8OA 1XGTA 3HPLB 5I1HH 3QXWA 3VMNA 1BHGA 4JRYE 5JW3H 3LKOB 1IVLA 1J18A 1XGPB 2I9LB 3SY0B 2XTJB 3P30L 3BEWA 3O9WD 1MCLA 4FFVC 4LSQH 3V6FA 4I3RH 3UTPD 5KZCB 3QCTH 3BW9B 1NUFA 1T0PB 4ODUA 1X5XA 4KZEL 3QQ9C 2D7MA 3PE9A 3SE4C 5BS0D 4GRWB 1B3JA 1LK3L 4LGSB 4DGVL 5A2LH 1S9XB 3ARPA 2FEDC 5DD6A 1B0WA 4S1SH 4W81A 1TTUA 3T77B 4TRPL 2OP4H 3L3JB 5C0BA 5I71C 1E4XL 1YJDH 5ID0A 1NGXB 3O6KL 1QLFA 5D7SL 3GMPA 2ADFL 3G6DL 4PJ9C 3H2WA 3K1DA 2Q86A 1AXSB 4TUOB 4WEBH 1S9KC 3FONA 2FDBP 3HZYA 4XRCB 2DQGL 4XC1L 3FN0H 3FB8B 4UNTA 2V5SA 4L29A 4YXHL 2Q7NA 3MV9A 4NJ9H 1I1AC 4PJ7E 5DJDA 5IV2A 5FUOL 3I9GL 2BVOB 2NY6C 4LLWB 2N4IA 5C6PB 3LD8C 2V7HB 3OG6B 1F4YL 5BV7C 2HWZL 3P77B 4K07A 2EIZA 1JWUA 5JTWA 2DQJH 2W0PA 3F7YB 4M1GL 5ACMA 3VFSB 4RGMC 1G7PA 3UPAA 3BP5A 3S3PA 4OTXL 2ZUQC 5E5RB 5EORH 1X5JA 4XP9H 3HMXL 1UM6H 4YR6B 1TENA 4PR5A 2WP3T 1PEWA 4I0KA 4L3ED 4X6DE 1KPVB 3QUXD 4G80A 5EU6E 3WXVH 1JBJA 5E2JA 5LGKA 2V2WB 2DIBA 2ICEA 1ZHKB 4K3HA 3TZVD 2OL3A 4LF3A 2RCSL 3BN9D 1AI1H 3SJVB 3OB0K 1F8TL 2BCKB 5CMAA 3L5JA 3KPMA 3WUZA 4FTVD 3RA7L 3LEYL 2DQIL 4WO4A 1QSEB 3MRQA 5TFSL 5D1ZC 3L3IA 3BRFA 1U93B 4QO1A 1XGRB 4EOWH 1I7UB 1RPQA 1NAMA 4F7EA 2GUOA 1MFEH 1B4RA 1HYRC 4QXGL 3CK0L 4P48A 5HYJD 1T21B 5A16A 2ERJB 2JIXA 1H15A 3B6SB 1CTNA 1EZVX 3G6JA 1KEGL 35C8L 1S7SA 4ERSH 1Z0NA 4J2XA 1TETL 1NCWH 3A6CL 1T1YA 2DLHA 1YPZA 1ZT7B 1T2XA 5IHBA 4MZ2A 4YDJB 3B9EA 4U6HA 3D2UB 5F7KC 3RL2A 3TH3T 2KPNA 5B39A 2Z8RA 1PKQA 5EBWB 4X6BB 2LV4A 2Y9RT 4FQQB 3GMQB 4U1LA 4JZNA 2ZCKH 3HI5L 3PP4H 1U8LA 5ICZA 4F8TA 4LAQH 4U1MA 3U6RB 2B2XL 3OHXA 4PBWD 4FQ2H 4LCYB 1XZ0B 4ZDHB 3CMGA 1G7HA 5ID1A 4S1RH 3ARRA 3LIZH 3QFDA 3DMMA 5LXGL 4PY7B 4PGEB 4AK1A 4RRPG 2WSKA 2DJUA 5HGBA 2HT4D 4PGDB 5ACZB 2CRMA 4NQDB 4HPOL 4YIQA 3MLXL 5ICXB 1F02I 2X9WA 4JKPH 4UU9A 3QAZC 3MLUH 4XVTL 3C5ZD 1MFDL 5GJTL 3RI5K 1E4KA 1BF2A 3G04B 4Z9KB 1MHEA 4N0CD 5E1HB 3ULUC 1WWCA 3L3HB 4HUXA 5C07D 2IFFL 4UIMB 1AC0A 4NGHL 1ZA3B 3MNZA 4HKBB 3RVWC 5T1DL 3TNNA 1CXIA 2YPKB 2PTTB 4NKOB 4OLVL 4X7DC 3QUMA 4OZGE 2DWDA 4YBLC 3GNMH 3CFKB 1SHMA 4AM0A 5GGTL 2Q8BH 3RL1B 3O8XD 5FYKL 4KK6D 4DW2H 1T6WA 3GMMA 3WFBL 1WF5A 2CIKB 3DNKA 4NIKB 5F9AC 1KC5L 4BFIA 4ZUSB 1KUMA 4MVBC 2OSLB 2W0FB 1W8NA 4Y2OA 5DRXA 1CDHA 1G9MC 1YECH 2QQLL 3I6KA 3LH2H 5F7WC 25C8H 1HXYB 4NM8H 3LDBC 1RJLB 4PJIB 1AO7D 4O2EB 3U46A 1U8QB 1MCWM 4BSWB 3TA3C 2ITDA 4DCQB 1F2XK 5GGTA 2B39A 2YWZA 3HPJA 2IGFH 4I77L 1JV5B 2GEEA 3HR5B 2ZSVB 3VFRA 4ODHH 1IAIL 5E8PA 4ZAKB 5DD1H 4GW5B 3RX7A 5GRVK 5EBMB 1U8NA 1DFBL 1DQMH 3LRSB 2AJYH 3QCUH 4OCWL 3L3DA 3GB7B 4XVJH 2KKQA 3KLAB 1CDCA 4YHMH 3W11D 2Z35B 1KLUB 2IAMD 4MA7H 4UTBH 4QRRA 3NTCH 1MY5A 1YEGH 4YHKL 1IC7H 1U2HA 4HJ0D 3OKKB 3DYMA 5MENE 4YXLL 2Y6SC 1T5WB 4NQEE 1A3LH 4D9QE 1PYWB 4RIRB 1Z6JT 4GKSA 3LMJH 3OAUL 1P69B 1VACB 2IANB 3EO0B 3TJEL 3VFWB 4RZCB 2VL5A 1QRNE 1KJVB 3TPKA 2MHAB 3CSYA 1CLOL 4PUBL 4JHWH 3EZ8A 1F5WA 3WS6A 1A1NB 1GC1H 4LSRL 4JVWA 4UMGA 3WIHL 1GL4B 5TE6L 5D8JL 1D6VL 2V7NB 4IIQA 2PYEA 4K8RC 4P9HH 3QDAA 4UQ2A 1HHKB 3LN9A 3T8XA 4TVPL 1F90L 1NC2D 5T33L 1JF1A 4QLRA 1RY7B 4WV1A 2YPVL 2XZZA 1QBBA 2FX7L 5BQ7A 4GOSA 1UJ3B 2YUXA 4E0RA 4CMHB 3F7QA 5GIRB 3RGVB 4HDIA 2G9HB 2MQCA 4JY6B 4YDLC 4P2CG 3WIHA 1ZA6B 5CINL 3GI8L 2NMSA 4I4WB 4PJXE 4YQXL 2NCMA 3HKFA 3IDGA 4GXUN 4WDIB 4PJCA 1UWGH 4PB0L 3HE6B 4TUJB 3MLTB 4M48L 4LLUB 4IDJH 4BELD 3QUKA 4XPAH 3QBTB 1C5CL 1Z5LB 3B5HA 5GRWA 4TSCH 1QSFE 4LMQE 3OB8A 4MJID 1A0QH 3BEVA 2VZOA 2W59A 1IC4L 3NH7H 1LGVA 4JY5L 1ZWIA 1T03L 1R0AH 2X1WL 5HI4C 4JPVL 4B5EA 4EUPA 3CFBA 2VXSH 3OKMB 1JHKH 4IOIA 1BQHB 2CRYA 4JRYA 1PX4A 5DUMH 3HI1A 3HR6A 5HYFA 1Q9OB 1U8MB 4M6NL 1LHZA 5INCA 4PJ5D 2OI9B 2EC8A 5IT2H 3P3YA 5DQ9B 2D0HA 2UZIL 1KXQE 3VFTB 1HN1A 1DQJB 4LDLB 2AEPH 2CO6B 4YHYC 3B2VH 1HHIB 1OW0C 5KJRH 4UB0L 3FQUA 3DYPA 1FVEA 5DYOA 5I15L 1Q38A 2Z31A 4G6JL 5IFHH 1HIML 5IVOA 3EBAA 4PREB 4LBEB 4FQXC 3AM8C 4OKVA 3IKCA 3DO7B 1F00I 4UILH 1WWAX 4N9GB 1IKFL 3VXRE 2ESVE 1AXIB 3NFSL 4L4TB 1S5HB 3HRZA 1KG0A 4HUUB 2J4WH 5DURB 1AFVH 4R0LC 1RV6X 3ARBB 3WFHB 3TC9A 1R5WB 3S36H 1SYVA 4U05A 4U7MA 3S34L 3QNZA 3LRGA 3OJ2C 4D0DB 2HMID 4N8VB 1NMCC 4V1DA 4CU6A 3BKYL 3HAEH 3ARFD 4XPHL 3U0TA 1T2JA 3IETA 4MWFA 4J3TA 4KK9C 4RFEA 3L3KB 1VFAA 4NZRL 5CEYA 1F58L 4CVZB 5IHUL 5D2NA 2FJGA 1OAZH 3TYGL 4E41B 3V7AE 3MR9A 4QYOB 3PWJA 2B1AH 3HC3L 3HN3A 4CJ0A 4HQQH 4AG4L 4L3CB 1DCLA 1JRHI 1Z9LA 4KROB 5DJCB 3EW3B 5B4MD 5EU6A 2BK8A 3T1WA 3MODL 5E8OB 3DX6A 1BECA 4MD0A 5C0CE 3MV11 3D48R 4GW1B 3UJTL 3VXUA 4XH2A 2ED7A 4R7DA 3T2PA 4LLDB 1XCTA 3MUHL 3L5IA 1TIUA 3NMEA 4LCCA 3NZHH 3ZE0E 2C7UB 1RK0B 3BKMH 3D39D 2HVKA 4PRHB 5DI8A 2CDGB 3NZ8A 2HT2D 2AJSH 3S35X 3SKOA 5EH1A 3KWWB 5GPRA 4O9HL 5CAYB 1LVEA 4JQXA 3S6CA 2COQA 2GJZB 5L2KE 4U6TA 5D5MF 1SM3H 4N0UE 5CJOL 2R29H 4M3JA 4JM4H 1XIWA 4XMKH 2XTJD 3MYJB 2CKBB 4KI5F 4DKDC 4W6WB 2ADJB 2H32B 5EOCJ 1SJEA 4ELMB 5C0ND 5JZ7D 5KZCD 3W5MA 4W6YB 1QNZH 1S9WB 3EIFA 5GRXG 5D1XC 4A6YA 2F58H 4Y4FB 4HFUH 1KELH 3TPUB 4KDVA 5DJ0A 4APQB 4MDJA 3N9GL 1CD0A 4N5UA 1A7OH 1ZLUH 5HD8D 4KJPD 2X4UA 3GSRB 3H9HA 4CADA 2V17H 1KYOK 2NY4B 1MCJA 2HTLC 4LPXA 2KZWA 3DIFB 3LQZB 4NNXA 3BZEA 3C2SA 4K9EH 4OLZH 3ARSA 1S5IH 4U6XA 3BP6A 3KYAA 3UTSA 5IB3B 2DWEA 4X8JB 2VN4A 1AGFB 2AJXL 5CP7A 4UT9H 1Z9OA 4ETQA 4F58L 3BGFC 5SWSB 1V7NH 5HDQL 1A2YA 1UKQA 4MD4A 4DZ8A 3BT2L 4PJAB 4NJAH 2OZ4A 2NR6D 1NL0L 3MJ8A 4I0PA 3DI2B 2FWOB 4Y0GA 4OLEA 4ORGB 4OFPA 4PRAB 2X70B 3GK8L 1DQLL 1UH3A 2HFFB 4H20H 3VMOA 5BZWB 3VRIB 4N0YH 1LP9F 4JO1L 3SDAB 4OCXH 1I8MA 3HB3C 2AV7A 5DRZB 3D69B 5JLZA 4G5ZL 3EOTL 1JUFA 1ZVSB 4JFZH 3ZDXE 2R0WL 3HS0A 5T1MA 4R90L 5EOCL 2QEJA 3H9SB 4KKBC 3VFNA 5DR5L 1Y18A 1H3PL 1REIA 3IFPA 4R6UA 2EKJA 2DBLL 1S9YA 1AD9B 5E7FA 5F7UA 4JN2A 3VXMB 4PY8J 3QNXA 4AH2B 1BM3L 4DVRL 2EIEA 1UA6L 3IVKB 4GRLC 5D7KE 4OZGA 4Q6YA 2BOBB 2X44D 5DJXB 5L2JA 1KIRB 3SJVD 3PABA 4PLKD 3QDMB 3NVQA 4N8CL 2F19H 4HIXL 4AEIL 4YX2H 4NQSA 4O4YL 1QSED 5CGYC 5HDOA 3MLWH 4GJTB 1M7XA 1DBAH 4PG9B 4M7KH 1N3NB 2R0KL 2A6JB 3R1GH 3IKKA 4KHXH 4OT1H 1RSFA 1UFUA 2VZ1A 1ZOXA 4M3KB 1XGUA 1PAMA 2VDRH 4JFEB 5IFJA 2D7PA 7FABH 1Q9WB 5T5NF 3U4EA 4F33A 3MRJA 3OKLB 2ZUXA 4YZFE 3C6LA 3D2UD 1DEDA 3EOAA 3QIWB 3CJJA 4QT5B 3MLRL 2H6PA 3E1F1 4LHUB 4K7PH 2P8LB 3QR2A 5LWYL 1WBYA 5J6HB 3OJDB 4Z7UF 5F88B 5IVXF 5KSBA 1KPUA 1GGIL 3TN0A 4NNYA 5BRZE 5EZIH 1JTPA 3BH8A 2GTZA 4WTZA 4NN5B 2LE9A 2VH5H 4HWNA 4PTTB 3B9KA 5L9DL 4H1LB 5LQBH 1FYTD 1QEWA 2HRPL 4G6ML 1T1XA 4N0RA 3TWCH 1QFUH 4YEEA 3Q5TA 1M05B 1GGCH 3INUH 2QHRH 4X6EA 3U48A 3MACH 3DMMC 3NPSC 2V2XA 3QULA 5GGRB 1YMHA 4EUPG 4XXDB 2R4RH 2BNRA 2IG2H 2IADA 1YQVL 5DMKB 4J6RL 1A7BA 4WUUE 3REWB 3TIEA 5IF0A 2ZKHH 5KSAC 4XCFL 1QRNA 5DWUL 3BDYL 2P5EB 3QFJA 4P5TA 5FHAH 3NIGF 1CK0L 4O51B 1WTLA 1JMZA 1YNKH 1ONQA 1Y0LB 1WEJH 2HLFD 2P5WD 1B2WH 1ZEAH 3I6GB 5B8CB 5I16A 5C0IA 3MRBA 4P2OB 3OZ9H 1TVHA 2EECA 1D5IL 1DVFB 1QBLH 2ZCHH 1GHFL 4JO2H 5E94B 3MJ9L 2O5ZH 2O5YH 1HSAB 1OAKH 1JWMB 1HCVA 4LLVA 3STZB 3QO1A 2IQAA 2BVPB 3FZUD 4QY8B 1CZ8H 4NQXA 3MO1A 2NX5A 3DI3B 5HVFB 1A22B 3V4VH 1WT5C 3M17B 2VZ3A 4LPWA 4OD2A 1GGUA 3UC0H 5EOQL 5H94B 4U0RC 4TTDC 4OGZA 1EMTH 3L3OA 3K4ZA 1OB1B 4ZUTB 4X5LA 5F9JA 1NSNH 2WWMD 1QSFA 4ENEC 4NWUH 1INEL 1BVLB 1DQDL 3RP1A 2GKIA 4ODXB 2OTPA 4ZAKD 4MNQB 2WINB 2J12B 4FQJH 3GSWB 4OLXH 3QO0B 4RAVB 4YDIL 5JOPE 1MCBA 2HKHL 4NM4H 3V0VB 3U30C 4P57B 4JDVB 5FM4A 2D31B 5JORB 1YEKH 3F12A 5C9JB 1BBDH 4EI6A 5DLMH 1ZK9A 1U58B 3PHQA 4NC1C 2VDLH 5E6IA 1X4YA 1IEAA 2ID5A 4M1CD 4QTIL 3QEUB 3DRTB 3GIVB 4J3WA 2XG5A 3CVHL 1X7QB 3GSUA 3O6LL 3DVNB 1HINH 1RIUL 3CFEB 3NACH 2Y36H 3QISA 4EJ1C 2VYRE 5I1HL 2ESVA 1CE6A 4PYGA 5JW3L 3WS6C 3MMEA 4KI5C 4F7MA 4JFXA 4LSQL 2JE8A 4PRDA 4IIQC 4I3RL 5KG9A 4G42A 3MA7B 4FFZH 2J5LC 1BX2A 1OGAE 2UY6A 5DMGD 4C4KT 4G8EA 4XNZB 3EJZC 3REVB 4NUJB 1FYHB 4P4RA 3HG1E 1T22A 4L1HA 2OP4L 3RGVD 1YJDL 1Q94A 2GJ6E 5DD3H 3SQOH 4Q6IC 1OM3H 4F7TB 4OV6F 2XI9A 2LVEA 4WEBL 4ZSOA 3AREB 1A6TB 1HXMB 1MQKH 3FN0L 5ITBH 1LEKB 5IBLD 2PETA 1WZMA 1MVFA 1JZ4A 5IVNA 4GBXC 5HPOA 3BKJH 4X80H 2CKBH 3HE6D 1KGCE 4GKZB 4MMZC 4Y5YA 3DUHA 2H32H 2YD5A 2Q76A 4PJDF 3NA9H 3RPIB 5TQ0H 3QG7H 3DVFA 2VITA 2CR3A 1K8IB 2ZUYA 4X99B 3EYQC 5F6IC 5JIIA 2VQ1B 3QDJE 1G6RA 3DVGB 5T1LD 4MHHG 2DQJL 2O61A 3O3DB 4NRZB 1X4ZA 2K7PA 3S3SA 2GSIA 5I1IH 2PW1A 4N0UA 2Y1VA 3UTTE 3O6FC 1FNEB 1MJ8H 2WIIB 1AHWB 1O7VA 3DUSB 2ADGB 5EORL 1RMFH 2ZWLT 1UM6L 1T1ZB 4XP9L 3ULVH 5EU4B 5SWQA 3WXVL 5DGRA 2CLZA 5E1AB 4OCNC 5J6GB 2R2HB 5F93C 4DN3H 2DN7A 2DLFH 1MLBA 2FHFA 4HIEB 4JFQA 5H37H 5JHDB 3PDOA 5DEGB 3FRPA 4GKNB 4ODWB 1AI1L 4GS7C 5MEOB 1FVCA 1MSPA 5LGJA 4Y7MA 3EUUA 2DL2A 2J8UB 5FGSA 3WS3A 1UYWH 15C8L 4KQ3H 5EC1A 4L4TD 3WEXA 3HUJA 3V52H 4EOWL 1QPXA 5ETUA 5DURD 1MFEL 4G9FE 1IGTA 3OKDA 2PXYC 3D87B 1ZHBB 3X12B 1BD2E 3ARBD 1SMOA 3NCFB 5CCKH 4F7PA 2EDWA 3D85B 3B5TA 1NPUA 5JMOC 1NCWL 2H2PC 4IRJA 4HW6A 4KUCF 5MEQB 1FP5A 1IAIM 1LILA 4FQHB 3RY6C 1CFBA 4L9LB 1H3VA 3GSOA 4WTZG 1NAKH 3SDXF 5DXWA 5CHNB 2FZ3A 4KDWA 2EC9T 2ZCKL 4PJGF 5ESAA 2VDOH 2YRZA 4JZOB 4NQCE 3N06B 5D2NC 4X4XB 3PP4L 3U82B 2DMBA 4E41D 4YEFA 4LP4A 3I6LD 4LAQL 1FZOA 4Q58C 4EDXA 3IDXH 1FAKT 4KROD 4TOYH 1A4KB 1I3UA 4FQ2L 3WKMH 2WAHA 4QRSA 1NCDH 3DX7B 4QKXB 3LIZL 5EFIA 1J0YA 4ZNCD 1TCRB 5J12C 5EO1A 2W38A 2X9YA 5FYKE 4W6XB 4LSUH 2D4FA 5MEPB 4YGVB 2D2OA 2FGZA 3WLBA 2RIKA 4P3DA 4PRHD 4D0CB 5TE4H 4TSAH 4IEFB 4MCYA 3GMOA 4O2FA 4ACPA 4QOKE 3MLUL 1GGYA 5AD0A 3BGMB 3AGVA 4OCMC 4QEGA 1OT1A 3RX8A 3QDGB 3KPRE 4AENA 4PG2C 4D0BB 5DRWB 3ARXA 3GGWA 1UB5B 3FAXA 4JJ5B 2GYSA 2NY1C 4NNPH 5MERA 1BIIB 1MWAA 4P99A 4Y4FD 3FQNB 2DL9A 3P4NB 2DDQH 4MA8H 1JNNH 4APQD 3GNML 2QKIB 1AGBB 2ARWA 5D5ME 4PD4K 5IQ7H 3LPGA 2EYSA 3LHPH 4PJHE 2Q8BL 1UG9A 2NY4D 4QNPF 5E5MB 1I9IL 4DW2L 3BPOB 1FNGA 2AEQH 3ULVD 4KI5E 1UVQB 4Z5RB 5A3IC 5BRZA 4P2RE 3O3AB 3CUPA 4RGNC 3QI9B 2G60H 1F3JA 3U7WH 4HKXB 1C5DA 1IGCH 1JPFA 1NGQL 3LH2L 1YECL 8FABB 25C8L 4NM8L 5C09B 5SWSD 3W9EA 3MUY1 4HS8H 3MGOA 3SO3B 4CNIB 4P23C 2FJFA 3LSOB 4BA8A 1MFCH 4LCUA 5FA3A 1NEZA 1OTTC 2IGFL 5T3ZH 4YHPA 4PRNB 4Z7VF 5HHQA 5ESVB 4I0PC 1UC6A 1F3RB 4KXZH 1FL6B 4YBQC 1IQWH 3SDAD 1QLEH 2OTUB 3BIKB 2XACC 4LLMB 4ODHL 2YD7A 1S7UB 2FL5B 4G9DB 3UZEA 2P7TA 5DD1L 5IW6A 4ZFZA 1NLDH 2P8PB 3O3UN 1DQML 1WC7B 2W9DH 2AJYL 3ARGC 3QCUL 4LKXA 2R0ZH 5IB2B 1IGIH 32C2B 3H9SD 4M61A 1Z9MA 4XVJL 2NY7H 1LD9B 1IQDB 1Z9SA 5CEZE 3RWEA 1I3RA 5FKPB 4YHML 3VXMD 1Q9LA 4PJEA 3KXFB 1RZGA 2R1YA 4MA7L 4UTBL 5C0EA 2RGSA 1YEGL 3NTCL 3EGSB 3N1PC 1IC7L 4H0IA 2BC4A 1G1CA 2GT9A 5MP6H 5DVKA 1A3LL 3QDMD 2HT3D 3JSSA 3ISWA 4UOW1 3VRJA 3LMJL 4MJ6B 3V9FA 4HUVA 5BVPH 2Y4SA 1XF4A 4PRPA 1GC1L 3I84A 5HY9B 4MJ5A 3PGDB 4Y2DB 1HHGA 5HPMB 3V6OE 4XWOC 1S8DA 3NN8B 4JFED 3MUGA 1MCRA 4K55A 4P9HL 3VU2A 3VD7A 2YZ1A 3JV6A 4YBHA 3QIWD 4X6CE 3UZVB 3C6LC 3RUGF 1SEBA 3O3BB 1CL7I 3LOWA 2ZJSH 2LU4A 3TBSA 4LHUD 3C09B 4G3YH 3AU1A 3ZKND 1WCBA 4WW1A 1TVBA 3V7AG 3STLB 2C4XA 5EO0A 1T66C 3T0BA 3VXSB 4GMTH 4H0HB 5HGHB 2W0KA 3TO2A 4KKCD 5EA0H 4JKWA 5T3XE 3O6MH 4RSVA 5FYKU 2W60A 3DV6B 3GSQA 4WFED 1UWGL 5DRNB 2BMKB 2XPGA 2FJHB 4JPIB 4MQ7A 2H26A 4IDJL 5D71H 2WW8A 1BP3B 4MAYB 4TSCL 4RA0C 3L5XH 4K3JH 1FH5H 4E5XB 4XC3H 2NLJB 1A0QL 1CG9A 4M4RA 2NY6B 4ZOEA 1R0AL 3PHOB 5EWIH 3BH9A 5GGQH 1N5AA 2UUDH 2VXSL 3ILPA 3K1KC 5BXFA 1JHKL 2KZ1B 2P5ED 2BHYA 1T04A 4P5TC 1MHHB 1IM9B 4R4BB 5DUML 3M1BB 3C6SB 2IH1A 1J0IA 3ET9F 5CILH 4O58H 4EN3A 3O9WC 3RDTA 2A6DA 4OZIB 5IT2L 1CT8A 3FRPG 4P2OD 5D1QA 4XXCC 2B5IC 1DVFD 3JTSB 3ESUF 1MRCH 2AEPL 1CFSB 5IMMA 3B2VL 5KJRL 5CSZA 1AKJB 2X89A 5IFHL 2R2BA 2BNUA 3SKJH 2H41A 4OF0A 5ADPH 2BJMH 3VXNB 3NIGE 1X5LA 4NCC1 4UILL 4HFWA 4GUPB 3TBVA 1A64A 3FT4B 4ODTH 5DO2D 1CFQB 2J4WL 4DOHB 4L1DA 1BQSA 1AFVL 3HNSH 5IJVA 3OKNA 5I19H 5DSCA 3S36L 4ISVA 1NCUA 3ZZ1A 1YEHH 4ZS6D 1K5NB 1UWXK 5H8DA 3DURA 5HI5D 3GUTB 2FH8A 4Y4KA 1D9KB 4L8CB 4RISH 2JB5H 4PS4H 1KT2A 4NO0A 2XXCB 3L3GB 3QDJA 1T7XA 4LCWE 4G43B 2HTKD 3MRGB 4MNQD 3CSPA 2A0LC 4AYFA 3AROA 3TIDA 4YO0B 1CLZH 2FX8H 4K7PY 1OAZL 3LVEA 2B1AL 4PLJC 3PF2A 2XKSA 4HQQL 1DUYA 4I2XE 3L1OH 1I7ZA 2GSGA 3LN5A 1XH3B 1XF5B 3QUXC 3U4AA 5GZOC 2WBJA 5E2UH 1D5MB 3BPNC 3QEGH 1NGWA 3TZVC 4GMSH 2XKNA 3BKML 3CCHB 1HILA 5FGRA 3KLHD 3IRZA 4LRIA 1ZVYA 1NC4A 2KDGA 2WQRA 2ZP0T 2AJSL 1OP5K 4LLQA 1R24A 3QXDB 1BVKB 1M71B 3C60A 3PL6A 1U8HB 4R96A 4KK5C 1EJOH 1EEQA 1SM3L 2R29L 8CGTA 2BNQB 2QHLA 4JM4L 1YEIH 2GFBA 4P5MB 3LEXB 4XMKL 2VE6B 3QAZB 4OFKA 3KPPB 3BZFA 3O4LE 5I74C 4U7KA 5EUOE 1BD2A 2P24A 1R3IH 5FGCB 2Q6WA 1V5JA 4HV8A 2DD8H 2V5YA 3VGDA 4YNYB 4M02A 1HHJA 1QNZL 1YY8B 2F58L 4N68A 2E7CA 4RX4A 4HFUL 1KELL 1ZS8A 1FVDB 4ZFOL 3PQYB 2VIRB 1KCLA 3PIQB 3HC4H 3KDMA 3V8OA 1A7OL 2HLAA 5C3TA 3SPVB 4FP8L 2V17L 1Y6MR 1HWHB 3QQNA 3OJMB 4XCEA 3ARYA 4XNYH 1JZ5A 1ORQA 4ONFH 4K9EL 4OLZL 1TZGH 3ARED 1S5IL 3T0AA 5FHBH 1V3JA 4NYLA 3K80A 5FK9B 5LBSH 4UT9L 4HUKB 1MF2H 4QF1A 1VEOA 4ZFOA 1V7NL 4OF6A 4CN1A 1UH4A 1N8ZB 1I85A 3CSBA 5JIKA 2HT4C 4HUWB 4N0FB 4NJAL 1K3IA 3MZTA 5JIPA 2Z93A 1HK6A 5JW4Q 4QOKA 4H20L 4L5FH 4P4KC 2XXMB 3E8UH 3TA3B 2Z92A 4YLQT 4N0YL 3X3GH 4OCXL 1OLLA 2XZQH 3C2AH 5D93B 2BFVH 1E27B 4N0CC 5LAXA 4JAMB 4JFZL 1FO0A 1T89C 4ODSH 3MREA 1S7VA 2DIJA 4NWTH 5DTFB 4PJDE 4WFFD 4H25A 4Z76B 4FQ1H 1MJJB 5DMIH 2B20A 4R4NC 2BOCA 1KLGA 4K94H 4C57C 1V8HA 5JHDD 4BFBD 1I1YB 2ICWI 4K3EH 4IRSA 1QFWI 2R56H 2FLRT 2XN9A 4U1GC 3F6IA 3OGCA 5CBEA 3O8XC 4PJHA 3UAJD 4KK6C 4YX2L 4I5BA 3MLWL 1QVOB 5DEZA 5EC2A 3BRDA 3MRRB 1DBAL 1I9RH 4M7KL 5CKAA 4F3FB 5J57B 5L6YH 3R1GL 2C3GA 3LEVH 3QIBB 4XAKD 4KHXL 4OT1L 5J1AA 3SBWC 4CUCA 4CVUA 5HYEA 3QPQC 4EZMA 1IM3B 3D85D 2NW2B 4L4VB 2VDRL 5BS0E 3D3VB 4JREB 5EIVA 4HWBA 2LTQC 7FABL 4IRJC 1S7RB 2XRAH 5DQJA 3TJHD 1FRGH 4OSUH 5IG7B 5C2BH 5C08A 5FO9B 4KPHH 2A6KA 4LDOB 1Z3GH 2FLBT 4GG6F 2E7LC 3GRWH 3O2DA 5IK3A 4K7PL 3FQXA 1V3KA 1YQ2A 3QG6B 2CPCA 5JOEA 5I8EA 5IB1A 1T0NB 3WDHA 1YUHA 1ZHNB 5J1SC 4HKZA 1OAQH 5EZIL 3M8OH 1EVTC 4U1JA 1JHTB 4OBRA 4BJLA 5E70A 2VH5L 2H3NB 5F1NA 2W65B 5EPMA 5LQBL 1I3VA 1EA9C 4Z7WA 5I2IA 5ITFA 3TWCL 1QFUL 4KK8D 1GGCL 3INUL 2QHRL 2IAMC 3MACL 1LO0H 4HMEA 4U6YB 1BFOA 5J0BA 3T0DA 2R39A 3OJVC 5A2IH 4HJ0C 2W9LA 3SDXE 2AJVH 2XWTB 4PJGE 1MHCA 2R4RL 3GSVA 1BPVA 4AQOA 4NBYB 2AQ1A 2ZKHL 5E9DB 3VW3H 1ORSA 2AI0H 3QDGD 1VKXB 4TNVK 1JNLH 2NNAA 1FSKB 5FHAL 3NFPB 4NSKA 4NZJA 5HHNB 1ITBB 4KMTH 5KVMC 4Y5VA 1YNKL 3FL7A 5FKAB 4OZHB 1WEJL 3TVMA 2F53E 1B2WL 1ZEAL 3V6OA 4P2QB 3ZE2F 3OZ9L 5KSUB 3DO3A 4G8FA 1U8OA 2YEZB 1QBLL 2ZCHL 4PJBA 2EDOA 5M95B 4JO2L 3Q5OA 4X6CA 4MX7B 2DRUA 2L7JA 4NPYA 4FTVE 2O5ZL 1G0YR 1UQSA 2I60H 1OAKL 1J12A 4WHCA 2D7NA 1T5XA 4YHYB 1CZ8L 3FTGB 5HYJE 3U2SB 1S78D 3V4VL 1U6AH 3QI9D 5C1MB 3MLPA 4FQXB 2YBRB 3FFDB 2X7LA 1MI5B 3FQRB 5C09D 3UC0L 2EE9A 1A7RH 2XZAL 1INQB 1EMTL 5BW7C 3PXHA 1IL1B 4FXLA 3N1QC 4QNPE 1NSNL 3BAEH 2FH6A 4NWUL 4XHJC 1S7WA 3RJQB 5DJ2A 3VXQA 3GJFA 4FG6D 5IHZA 4FQJL 4OLXL 1FFOA 3X17A 7CGTA 3EFFA 4QHUB 4NM4L 1R5IA 3L7EB 4NT6A 1QSVA 3VGHA 5DFWH 5J06A 1YEKL 3S5LG 3W0WE 3FO1A 1FDLH 1BBDL 1V3MA 3KXFD 5JO5A 5DLML 1HZHH 5D6DC 3MFFA 4JO4H 3IDMB 4MCZA 3BDBA 1JRHH 2MMXA 2A73A 1QA9B 2VDLL 5JXEA 1DQQA 5I8OH 4EVNA 4OLWH 2NPLX 1DDHA 5I1GH 2H1PH 5GS1B 1HINL 1U2CA 4PRIB 5FB8A 5HVHC 5DK2A 3AVEA 3UYRH 1CLYH 5C07E 4FXKB 2WM0A 3NACL 2Y36L 1HHHA 1UZ8A 2CXGA 3LKSB 3WD5H 3MXWH 3G08B 4G6AC 3ZHDA 4E42A 4Y2DD 5EU3B 1XCQA 5IW1A 1YNTA 5GGSB 2ED8A 4X98B 4PJIF 1H0DA 1XGTB 3F5WA 5DMYA 2YXMA 4FFZL 4F80A 2HMIC 1I1FA 3GSXA 1DE4A 3BEWB 3ARFC 3MCKA 3QT2A 2VLJA 4N1EA 4LCWA 4XCYA 1XGQB 5D7LA 5D1XB 1BWMA 3ZMRA 4ODUB 3T65A 4M6MH 4TULH 1A6WH 1GC1C 3Q2CA 4UDUA 5DD3L 3LKRA 5GGRY 5DD0H 3ARDA 3SQOL 2V6HA 1RZ7H 1OM3L 2NY5H 3VXSD 2FEDD 3ZHLA 5DD6B 3CDYA 1MQKL 4I2XA 3DECA 4P9HC 5C0BB 2HG5A 5ITBL 5ID0B 5B4MC 1QLFB 1YMME 3GMPB 4Z7WF 2CK0H 1PJ9A 4PJFE 5CWSA 3BKJL 4X80L 2CKBL 3RUGE 5DJZB 5F3HA 3RU8H 2Q86B 2EDLA 3NA9L 3FONB 2FD6H 3HZYB 5TQ0L 3VWKA 5FM5M 1KJMB 3QG7L 4MAYD 4RAHA 2HT2C 4M8QA 4BQCA 1SJHB 4L29B 1CFTA 3WHXA 3IAGC 3MV9B 3UZQA 5IV2B 2NY6D 4S11A 4DEPB 4CVWA 2A9MH 2ZCLH 5GSVA 5I1IL 2XA3A 3D0LA 1IM9D 4ONHA 4J3VA 1MJ8L 2XTJC 1RMFL 1JWUB 2EIZB 3T3MF 2EZ0C 3U4BH 4B50A 4AIOA 3U0PA 3ULVL 3O4LA 4ZPVA 1RFDH 2YD3A 3F7VA 5JZ7C 3RDTC 3SHSA 5JA8B 4MGXA 2J8HA 3AAZA 4DN3L 4XZUA 1G7PB 4DJMA 3BP5B 3A6OA 5FOBA 3V6ZA 2D03H 4PJBF 5MHSD 4PR5B 1UXWA 3MLSH 3OQ3B 4G80B 1AKJD 3ARVA 3ZKMD 4W4NA 4MNGE 5D9SA 5HD8C 3UDWA 4GRLB 4G8GA 2ICEB 1UYWL 1BQUA 4QRPB 1N0XH 2EXWC 4LF3B 3HE7A 1H8NA 4KQ3L 4QHLA 4U1HA 3V52L 2EDJA 3PWVA 1Y6NR 4WW2A 3QXTA 3TNMA 2NZ9D 2YK1H 5CMAB 3B9VA 4J3OC 3GSNH 3MJ7A 2VKWA 3BWAA 3E6HA 5CCKL 4WO4B 2VQTA 3RWGB 2VXVH 4H5SA 2NTFA 3MRQB 2F5BH 3L3IB 2MTPA 4FXGA 2NY2C 4BH7A 3H0TB 1WFNA 1NAMB 2GUOB 4HUNB 2ZG1A 2OK0H 1D9KD 3OBAA 5A16B 2J1KA 2JIXB 4MS8D 3T2QA 1H15B 3TEUA 3G6JB 4G6FB 1CGUA 3W9DA 1IE5A 1W72H 1NAKL 1T1YB 3IXAA 1YPZB 2AJZA 2VDOL 5BCAA 3RL2B 2YA2A 4Z95H 5B39B 2P46B 1PKQB 3IDXL 1KPRA 4U1LB 2WP3O 4TOYL 4JZNB 3WKML 3MOAH 4I3SH 1NCDL 3BOVA 3H9YA 1JI1A 3S3JA 1I4FA 1UACH 1GGTA 1GAFH 2Q20A 4U1MB 4LSUL 3OHXB 2AJ3B 4Q9BA 2F74A 1YEDA 4TN9A 4NKQB 4NN6C 4JFFA 5SX4I 2EKSA 4TSAL 5TE4L 4LRIC 5FGBC 1EEYB 1CS6A 1G7HB 5ID1B 3R8QA 3DMMB 5ESQA 4K23H 1T3FB 3DXAE 2JCCA 3O0RH 1SQ2N 3PL6C 5D7IE 5HGBB 1OD9A 2BNQD 3RKPA 4YIQB 4PJ5E 4UU9B 3GMRA 3VFUA 2ERJC 2QTEA 5B22A 3PV6A 4YK4C 3FHAA 3ULUD 4NNPL 4HUXB 5ABDE 3MUJA 3MNZB 2DDQL 2FRGP 5K59F 4MA8L 1JNNL 3PQYD 4NKIH 5SWZD 4OGXH 1JK8A 4C83B 1N2RA 1M4KA 5IQ7L 3LHPL 4UIKH 1MREH 2D9CA 3QUZA 4JG1L 3QUMB 1P7QA 1I8LA 1UM4H 2AEQL 1F13A 3T0VA 4KZDH 2G60L 3U7WL 4AM0B 1IGCL 1J8HA 1R5VA 1IILE 1EO8H 3GMMB 1KACB 2G5RA 4Y1AB 1L4IA 4BFIB 2XYCA 3BMWA 4HS8L 4U1IA 4LCIH 1MFCL 4EI5A 2FEEI 5EZJA 3HZMA 3P73A 5DRXB 5T3ZL 5F44A 3U7YL 3I6KB 4JPWH 1HE7A 4MSWA 1YA5A 1D5XA 3EFDH 4YPGA 3TA3D 3U46B 1IQWL 1QLEL 2ITDB 3VH8A 4K9EC 1OP3K 4R2GB 4W4OA 3HPJB 5JR1H 4HCRH 1NLDL 1PW3A 4BSJA 2CLRA 2W9DL 2R0ZL 3GIZH 1DP0A 1IGIL 2R1XA 4IHOA 2IH3A 3VFRB 2VR4A 2WZPD 3VGGA 4QHKI 2F53A 4ELMF 4OCYH 3DSNA 4RWYH 1U8NB 3D39E 3KPLA 1KCUH 1G6VK 3L3DB 3U30B 4ZFFA 4DZBB 3FT3A 5MP6L 3U36A 3QWOA 4IRSC 5FYLH 4FTVA 1TJHH 3TBYA 2ATKA 1FC2D 3IFLH 3FZUC 1JGDA 2VXUH 2Y6SD 1XT5A 5H2BA 3SKUD 2OMBA 5BVPL 3ULVF 3QHTC 3EO9H 5HYJA 4GKSB 3QIBD 3A67H 5T1KA 1FBIH 2DLGA 1IZKA 1UM5H 5KVFH 4L4VD 4F2MA 2VL5B 2BVTA 2FHCA 3D3VD 4GRWE 2DQUH 4OKDA 5HYSA 4PJAF 1YY9D 1OTUD 2ZJSL 2FO1A 4IIQB 2PYEB 2J5LB 1MRFH 4UQ2B 4ZAKC 3ZTNH 2E5EA 3T8XB 3NPZB 5F21B 4Y16A 1H5BA 4KTDH 1JF1B 1WUNT 4WV1B 1EJ6A 4GMTL 4XB7A 4W70A 5EA0L 2BSED 5BQ7B 3QDHA 4BUGA 3C9NA 1WZKA 3O6ML 1VPOH 4E0RB 1P4BH 1Q0YH 1QBMH 3ELAT 4OAWB 4XBPA 4HDIB 1ZT1A 1KN4H 1W0WB 4KFZC 3W0WA 3BPCB 4Q6IB 1ZSDA 1BJ1J 2LQRA 1O5DT 1E0OB 1PDKA 5D71L 4UT6H 4M1CC 1IEBA 3C08H 2XWJB 2PTUA 3L5XL 4U1SA 1FH5L 2EEBA 4GBXB 4QHMA 3C5ZA 4KRLB 4XC3L 1C7SA 5JXAH 2ZNXA 5E9DD 5EWIL 5CD5D 3QUKB 1CU4H 4YGAB 3KHOA 5F9WC 3BEVB 4HX1A 3RBGA 3BPLC 3VDCA 5CILL 5HI4D 1ZWIB 5HVWA 1Q72H 4O58L 2L7UA 3VWJA 4EUPB 5HDBE 1ZLUK 3CFBB 3QUYA 4P2QD 2VZVA 4IOIB 3CLEH 4JFYA 2BXYA 3O6FB 3EYFB 5AUMB 4JRYB 1MRCL 3HI1B 2IALA 1HCFX 2P45B 2I25N 3F62A 5GS2H 5EBLA 5C0RH 1QLRA 5INCB 4WUKH 5A2JH 1DUZA 1QSEE 4NFCA 4CMHC 3SKJL 5ADPL 2BJML 3RGVC 2W0LA 1X5AA 4R7NA 2X4TA 3FQUB 4CJ1A 1FVEB 5DYOB 2Z31B 2N7AA 4ODTL 4FQXD 2XA8H 3TV3H 4C56E 1WVZA 5GISH 1TCMA 5KVDH 4OKVB 1OPGH 3HNSL 1MI5D 4WI5A 5IBLC 2JJTC 1YMMA 2VERN 5I19L 3HE6C 4PJFA 4ZO9A 1YEHL 1RJYB 3AY4A 3P4OA 3HRZB 3Q48A 5FYLD 1A6AA 1KG0B 1XGYH 2PXYB 1HWGB 5E03A 4RISL 1I7RA 1DR9A 2JB5L 4PS4L 3SKNA 3PWPE 3VI3F 2EDBA 3VJ6B 3SDCA 1QD0A 5F9DC 3SDDA 2DLTA 1B6UA 4V1DB 1CLZL 2FX8L 1X6LA 5C0GA 2AV1A 2OL3H 3U0TB 3DV4A 3IETB 4MWFB 2A9NH 3L1OL 5CEYB 4MLSA 3AB0B 4JFOB 2OI9C 5D2NB 5E2UL 2FJGB 3QA3A 4WJ5B 4NQDE 1ADQH 5E4IA 3QEGL 3MR9B 2EE2A 3PWJB 2Z8VC 4GMSL 3WIIH 4H0GA 3FB6A 5JDSA 1PZUB 1NAMH 4PRID 4MD0B 4PLOB 1A21A 3VXUB 4XH2B 4R7DB 1XCTB 4KI1A 4EDWH 5DK3A 5DJ8A 3MRLA 1FFRA 5C9KA 4JG0H 5DI8B 2HVKB 3NZ8B 3ROLA 1F11A 1YEIL 3SKOB 1XF3A 1AR2A 1R3IL 1KTKE 3R06A 2EXYC 2FECL 2DD8L 3DBXA 1WICA 1NBZA 1NC2A 3L6FA 5IKCA 4GAJH 1XIWB 2X2YA 5E6YA 1TZIA 4U2ZA 4ZPTA 1E28A 3VG0L 1WAAA 5D1XD 5FOJA 1MCSA 3H7LA 3P9MA 5I73B 2OTWA 3B9AA 4XNYL 5DJ0B 3SE9H 3VXPA 4MDJB 4ONFL 4PJIE 3JWNC 5C0BD 1G9EA 4YXKH 5FHBL 3B8YA 1JGLH 3H9HB 4CADB 5DZOA 2VDNH 5LBSL 1MF2L 3K2MC 2YRPA 1TITA 4NNXB 3BZEB 4RGNB 4U6XB 3BP6B 3UTSB 2DWEB 4B41A 1CQYA 2IBZY 1BREA 4ETQB 3MV9D 1RIHH 4L5FL 5AYQA 1CWVA 3E8UL 1A2YB 3X3GL 3DXAA 4MD4B 2EDTA 2XZQL 5D7IA 4DZ8B 3C2AL 2BFVL 3GBMH 4KRMB 3MBEA 3MJ8B 4NO3A 3UMTA 4I0PB 3QUMH 1UCTA 4ODSL 2NY0B 4PJ5A 4TPRH 2W92A 2YMXH 4OIIH 4NWTL 1I8MB 2AV7B 5JLZB 4PP1D 1IAOA 1BBJB 1BZ7A 1MVUB 4FQ1L 1JUFB 5JQHC 1I1RA 4PV9A 5DMIL 4IOFD 1IFHH 2QQKH 2CLVA 3HS0B 2F9BT 4K94L 1IKNC 2HN7A 4P5KA 3VFNB 4APQC 4K3EL 5DDHA 1Y18B 2IANE 1CBVH 2R56L 1S9YB 4NBZB 5IMLA 4JN2B 4BZ2H 3VXTA 5J11B 4GRLD 2NY4C 2YSSB 4OZGB 2ZUTA 4WI4A 3ULVC 5D96B 4NOFA 5A40E 1I9RL 2QBWA 1AQDA 1CGWA 5L6YL 4WW2C 5LKNA 3LEVL 4QRTA 4WO4D 3JWOH 5J89A 4NQSB 4KVNH 1C1EH 3WFEH 3D25A 4JY4A 2WLYA 1KJ2H 3T4AA 2XRAL 4KH2A 1G7MA 4DUWA 1FRGL 4OSUL 5C2BL 4KY1H 2WMPA 4KPHL 3VD3A 3T4YA 1Z3GL 2JIXD 4L8BA 1XAUA 3UPRA 4G6FD 3GRWL 1I3GH 3AUVA 3MZGB 3SDAC 1HNFA 3U4EB 4F33B 4Y8DC 3C6LB 5ENWA 1OAQL 1A7NH 1A6UH 4WRLA 3UTZA 1HOCA 3BIBX 2BX5A 5F7FA 1NGZA 5I76B 4XNQA 5KSBB 1KPUB 1MPAH 4HGKC 4NKMA 1TQBC 3TLRA 3TN0B 4E9LA 2ARJA 1E4WH 3BH8B 4GW4A 2GTZB 4EKXA 1HH9B 4D9LH 3GRWA 2PN5A 3RKDD 3B9KB 3S4SA 3LQMA 1QEWB 2AJVL 3SGEI 5CP3A 3RWIA 2HT3C 1T1XB 5INDA 3DMMD 4X6EB 1U3ZA 5HJ3A 2WUBH 2FATH 2J8UF 1QQDB 4JQIH 4X6FA 2V2XB 5FCSH 2I9LA 1YMHB 3VW3L 2AI0L 4KV5F 4A2MA 1JNLL 2BNRB 1ACYH 2IADB 4KMTL 3HZVA 3QH3A 5FFLA 3TIEB 1NKRA 5IF0B 2ZUWA 2Q1EA 3RY5A 5E24E 4FN0A 5C8JA 3QFJB 3IT8D 4P5TB 3MPCA 3WN5C 1FNFA 3BUYA 3QIWC 1TXKA 1ONQB 4DK3A 1D6EA 5I16B 5C0IB 3VE0A 3MRBB 3IDJA 2I60L 3ZKNC 5I17B 1DSFH 4L4TE 2B4CH 4Q7DA 3CLFH 1MFNA 3BESR 4H8WH 4GRMB 1KIUA 3BQUC 4NN5C 4D9RD 1X5ZA 3T1FA 1A9BA 4KKCC 1U6AL 2OLDA 1GH7A 3QP3A 3T0EA 1P1ZA 4LLVB 3QO1B 2IQAB 2QADB 4KTEH 4NQXB 3MO1B 2NX5B 4Y1AD 4ZODA 1SY6A 1A7RL 4LSTH 4EUPH 1AD0B 2CDEB 3LKPA 5FA4A 5JIHA 3U1SH 4Z78A 1OGTB 2H45A 5FUZH 2DKSA 4OD2B 5GSRA 1TVDA 3F7YA 4CN6A 3KPSA 3BAEL 4I8DA 1GZQA 2VMFA 5FM5O 1F3DH 2ZOKB 4E41E 5J56B 1RQ5A 1CXEA 3L3OB 4R2GD 2MWCA 2OX5A 1TTFA 3MSPA 2RR3A 1F45A 5F1IA 5F9JB 3U79A 1QSFB 5GJSH 3RVUC 5EUKA 4B53A 5B8CC 2YRLA 1ZHKA 1FDLL 4P2OC 3T0WA 1HZHL 4JO4L 1DVFC 4PRHE 1JRHL 1PD6A 1ND0A 5FXCH 2VLMD 1Y6KR 1J0JA 4YDKH 1BF8A 2VB5A 4CDHA 5I8OL 4OLWL 1FL3B 5CFHA 5CD3A 3F12B 3BZ4A 5I1GL 2H1PL 4HIIA 3U83A 4QRRD 1JPST 5KOVC 3UYRL 2Y07H 1WWWX 5F7DA 3PHQB 1JF5A 3WUWA 4F9LC 5E6IB 2APVA 3HC0A 4Y4HA 1IEAB 4RFNB 4PJ8A 3BFOA 3HNTH 3DX8A 3WD5L 1AC6A 3GSUB 4ELME 5DO2C 3MXWL 4RMQA 5ACLA 3BXNB 4C56A 3KLDA 4AQ1B 2F54A 4RBPH 1ZT7A 3ALPA 1B88A 3ZYIA 2ESVB 1CE6B 2X10A 1WBXA 2BVQA 1EO5A 1QFOA 3MMEB 5CJBA 4F7MB 4TSBH 1ZLVK 4JFXB 2PYED 4NZTH 3PWPA 1D5ZA 4LNRA 3K7UA 1CN4A 1W0YT 2HTKC 4NRYA 3ULVE 4G42B 2HJKA 4CGTA 3CVHB 1ZLSH 4W68A 1BX2B 4TULL 1A6WL 3G5XA 4ZO6A 1YNLH 3EJZD 3W5NA 2UYLA 4L4JA 4PRBA 5DD0L 1H5BC 1T7VA 1RZ7L 2NY5L 2HFEA 4LCYA 4ZDHA 1T22B 2VAAA 5SWSE 4LVNB 5KBNC 1Q94B 4Y5XA 2CK0L 3QJHA 4PGDA 1QTYT 1YC7A 5ACZA 4YFDB 4AY0A 4NQDA 2Y06H 4WI8A 1NFDE 4ZSOB 2FD6L 4HGWB 1KB5H 2SEBA 3KLHC 2RFXA 4TVPD 4GBXD 1EXUA 2Q8AL 3LAFA 4MLIA 4Y5YB 5KS9A 2Q76B 4QRQA 1AR1C 2A9ML 2FBJH 2ZCLL 2VITB 3H9SE 3RNKB 4A6YH 1G6RB 2XIDA 4P4KB 3VXME 2XFXA 4OJFH 1ZHLA 3U4BL 2O61B 4AIXA 1RFDL 4NKOA 1DN0B 3FFCA 43CAA 2AXFA 3BE1H 2GSIB 2C3VA 3O6FD 2LFGA 4JRYD 4C4KO 2D03L 4XNZC 3Q1SH 3P9WB 3MLSL 5IBTH 5I18L 2F8VA 4F57H 4LVOB 1J5OH 4X9HA 1T20A 1X5HA 1MLBB 3RVTD 4JFQB 1QFWH 1N0XL 3PDOB 2Z31D 1BQLH 5DJ6A 1MJUH 1FVCB 3AREC 3ZTJG 1T4KA 5LGJB 2YK1L 4JRWA 2OZ4H 4JFEE 4O2EA 3GSNL 4UTAH 3O3EA 5GZNC 3WS3B 3BJLA 3VFOA 5E08H 2VXVL 3OB0H 4OFYA 2F5BL 5EC1B 3WEXB 3HUJB 4JFDA 5ETUB 4WEUD 4FZEH 1GRWA 3OKDB 2P42B 2OK0L 2ZSVA 1BLNA 5EU5B 3CFJA 4BM7A 3VGBA 3LB6D 4NO5A 1AO7B 4OCSH 1W72L 2H2PD 2UZXB 2LTQB 4D3CH 4IRJB 2E7BA 3MV7E 1EBPA 4IS6A 4V1DD 4KQ4H 4Z95L 1SJXA 1IMHC 1AHWC 2BY0A 4XGZA 3GSOB 3AMLA 2FZ3B 5TDPB 5ESAB 3MOAL 3S4SG 5L8JB 5FYJD 4I3SL 4NRXA 4OQ1A 5EN2A 4OZIF 4EQ3A 1UACL 3AXLA 1FN4A 1GAFL 2BSRA 3VI3E 3MLVH 5IOPB 1FZOB 4RIRA 1W72A 1LQSR 4EDXB 5C70A 2VNCA 3NCBB 2DQEH 1EPFA 1UENA 3EO0A 2IANA 4QRSB 5GGSY 4NC0B 3VFWA 5EFIB 3VXUD 2P5EE 5EO1B 4K23L 4P3CH 2PCPA 3UAJC 2KBGA 3O0RL 3WLBB 3PDDA 4MCYB 3GMOB 2V7NA 4O2FB 3ZHKA 3VGAB 5AD0B 4D8PB 2EDKA 2AERT 4BSVA 3CH8A 3OG4B 3FCTA 4R97C 3E3QC 2VR9A 2EDRA 5J1TC 4AENB 1XIWD 3I2CH 1K2DA 3GGWB 3TJHC 4HEME 4X0KA 1CGSH 4NKIL 1PZ5A 5GIRA 3MJ6A 4OGXL 2BY1A 1X4XA 4L9LC 4U0QB 5MERB 1MWAB 1U8JA 3MRMA 4UIKL 1MREL 4I18A 1U91B 3QB7C 1UM4L 3QQ3A 4HC1A 3NFNA 1VDGA 5EIQA 1A3QA 5IMOA 3IJYB 4KZDL 1WJ3A 5IM7A 5K33A 1U3JA 1EO8L 3MLTA 2VKXA 3T2OA 1FNGB 4LLUA 4Z7QE 1X6NA 4KK8C 4OCRH 5BRZB 1RZ8A 1JGVH 4RGND 2CDFA 2CUIA 2UUDK 2JJUA 2Q3AA 5TPWH 5I1DA 4LCIL 3UTSD 1F3JB 1WZ1H 2XWBA 1JPFB 2XNAA 3OR6A 2YPLA 3DROB 2R9HD 1AY1H 4JPWL 4MNQE 2DQHH 1I9EA 3W9EB 3EFDL 5KTEH 3MGOB 1KIQB 2FJFB 1CIDA 4LCUB 5FA3B 1NEZB 5K9QG 1QYGH 5JR1L 1U8MA 4HCRL 4YHPB 4I0PD 4Q2ZA 2QQNH 4MJIB 5HHQB 2W07A 2NY0D 3GIZL 5HHVH 1A6VH 4MNHA 1MFBH 4F37F 2LAAA 2GI7A 4IMKA 4S2SA 1DQJA 2P7TB 4NFDA 4ZFZB 3ULUF 4OCYL 4JRXA 4RWYL 4O5LL 4JM2A 1RUAH 3TBTA 3MXVH 3HA0A 1KCUL 5CJXA 1A9EA 1FFPA 1MCHA 3RWEB 4DUXA 1I3RB 1RVFH 5IROA 2C26A 4HMCA 5FYLL 1TJHL 1Q9LB 4FZ8H 4HCRA 4PJEB 1RZGB 3OWEA 2R1YB 5C0EB 2ZSWA 2MCG1 1S5HA 3IFLL 3BPOC 2BC4B 3L9RB 2VXUL 3NCYP 1S78C 3EO9L 3CGTA 1PSKH 4HBCH 4Z0XB 5HVHB 1ULVA 3A67L 1RHHB 1FBIL 3SGJC 1UM5L 5KVFL 2PR4H 4K94C 3V5HA 4D0DA 5DK0A 4HUVB 1DEEA 3K8MA 2H8PB 3SO3C 1XEDA 2DQUL 1XF4B 2UVFA 4PRPB 1X5FA 1WSST 1NH6A 5BO1H 4WCYH 3V5KA 4MJ5B 1GPOH 1HHGB 3ROOA 1S8DB 3HFMH 1UJTA 5F7EH 1MJ7H 2GW5A 4FG6C 3JV6B 5C3LD 1MRFL 3ZTNL 3C6LD 4R9HA 4KTDL 4X4YA 1SEBB 1RUKH 3CZJA 3C8DA 4I13B 1VPOL 1P4BL 1Q0YL 1QBML 1G7JA 3AU1B 1TVBB 5EO0B 1KN4L 1NCTA 2Z0BA 3TN0D 4CW1A 3WJJC 1DQTA 2YD4A 5TE7H 2NW3A 2CDGA 3TO2B 1OF2B 1UKTA 3WYRA 4CN4A 3B9KD 5AG9A 1KNOB 1NANI 4UT6L 5F7NC 3C08L 2W60B 3GSQB 1ZGLA 2DIAA 2WV3A 4MQ7B 1GJIA 2H26B 4QRUB 4F15B 3UROR 4HAFA 1G7IA 5JXAL 1QG3A 2AQ2A 1FPTH 4XAWH 1CU4L 3MYJA 1U8KB 4V2CB 3WFDH 4ZFGH 2BNRD 4D9QD 1CXKA 4WFFE 1CG9B 5DHYA 4XP4H 1L6XA 1U8IA 1Q1JH 4Y2DC 1Q72L 1QP1A 3BH9B 2R2CA 4BUHA 4Y4FA 4OUUA 5BXFB 3QFJD 5JHDE 4P5TD 3CLEL 1T04B 3K4AA 2Z8SA 2PKDA 5GHWH 2IH1B 3E6FA 2J8UE 5C0RL 4EN3B 4WUKL 3RDTB 1PQZA 2A6DB 2CXKA 1CT8B 3C09C 5D1QB 3FQWA 5I6XB 2VZTA 4LNVA 5IJKA 4XAKE 1F4AA 5CSZB 4IJ3B 3DUUA 3VRLF 5FEBA 2R2BB 1SBSH 2BNUB 2AVGA 2XA8L 5GISL 5KVDL 1OPGL 2QADD 3E3QE 4G7VH 1G6RH 2NX5D 4HFWB 3TBVB 4NDMA 1A47A 4HG4J 1PY9A 3S97C 1NFDA 1XGYL 3DX9A 2HFFA 4MAYC 5IJVB 1RAMA 3OKNB 4B7LA 1HQRA 2VOTA 5D2LA 2X4OA 4MB5A 4ISVB 3QCVH 5DSCB 4KUCD 2NY2B 2AXGA 5D7JA 4FMKA 4R3SA 3DURB 1FFQA 2CUHA 4XBEH 4GG6B 1GXEA 1QSFD 3NIDF 1KT2B 4NO0B 3QDJB 1CDJA 2OL3L 2A9NL 2AK4E 1FV1B 2XOTA 4U49A 1MIMH 3BWUC 4OZHF 2A0LD 3N1MC 5JDJA 1JPGA 2JELH 3FOLB 5DJXA 4AJ0A 1ADQL 4PLJD 1EVUA 1DUYB 3WIIL 2GSGB 3LN5B 5GZOD 1X5IA 1NAML 2C4FU 2WBJB 3ZKMC 3QIUC 2ILLA 1WIPA 3HAEB 1AQKH 3QDGE 1NGWB 4PG9A 4EDWL 3UBXB 3QXUA 5SX4H 5E6ID 5HYQA 4NN6B 2GHWB 1L9NA 1HILB 4JG0L 4JKKA 2QV2A 5SX5H 4PJ8C 1NC4B 2NZ9C 4LLQB 1ADQA 1RZIA 3C60B 3PL6B 4KK5D 2VLKA 2ESVD 1IGMH 4KAQH 4OGAD 1BMGA 2GFBB 1D9KC 5BMFH 4LHUA 2R69H 3BZFB 2P24B 4YK4B 4DN4H 4MS8C 2Q6WB 1A14H 4HV8B 1J0KA 3RWJA 1HHJB 3CX2A 4JKMA 2LVCA 2PF6A 3MV7A 2RAMA 3KAAA 1ZS8B 4H1LA 3SE9L 5F3BA 4YFLF 3KDMB 4HWZA 4Y19A 5C09E 3SE3A 1GOHA 2HLAB 4YXKL 1JGLL 2FYYA 1BFSA 2VDNL 3T3PF 4YHOH 2P8MA 4Y5XC 5CZVH 1H8SA 4IRZH 2BP3A 4WFHE 1ORQB 4LOUD 5HHPA 3T2NH 3DHMA 1FYTB 2APTA 1BQHG 1HKLL 2P44B 2JJSA 4NYLB 4WU5A 1KBGH 1VFMA 1RIHL 4QF1B 4ZFOB 1JP5A 4LIQE 4BKLA 3S36X 3ZO0A 1MWAH 3GBML 3GBLA 3T08A 3QUML 4RGOH 5HHME 3I6GA 3UYOD 4P4KD 4TPRL 3KXFE 2YMXL 4OIIL 5CIPA 2Z92B 5HGAA 3PJSA 3W2DH 5ANMA 5E94A 2X9XA 4DFIA 4ZUVA 4JVPA 5C0AA 3OKEB 1IFHL 3S37H 2QQKL 3QNYA 3ZSTA 3MREB 1S7VB 3QEQA 1NMBH 1JWMA 5KVEH 2P5WB 5E2TH 1ED3B 1CBVL 4H25B 4QY8A 1M6OA 1LE9A 4BZ2L 5BVJA 4R4ND 1CR9H 1G9NC 1IGFH 4OQTA 5C2UB 2PO6C 4IRSB 4G7YH 4HWUA 2XN9B 3ZDYF 4POZC 3OGCB 5CBEB 3JWOL 4I5BB 5HSFA 4KVNL 1C1EL 3OL2A 1KJ2L 5TF0A 4NHUA 2C1OA 5HHOA 1QPPA 5J1AB 2XG4A 3QPQD 4KY1L 1P5VA 1XMWA 3DHJA 2WINA 1I3GL 3AMKA 3GSWA 5D2LF 1NGPH 4IRJD 4RAVA 2ZUUA 1B0GA 5DQJB 1IAMA 5D93C 4OBSA 5C08B 2A6KB 2CO7B 1A7NL 1A6UL 1K4DA 5IK3B 3F8UB 3FQXB 4KGLA 3LN4A 3UJJH 1KJ2A 5J4MA 5I8EB 1MPAL 1YUHB 3HLAA 4HKZB 6CGTA 1E4WL 5CJ8A 4N9OB 5ADOH 4U1JB 4JZJA 4D9LL 2IPUK 1NDMB 5EPMB 2I07A 4Z7WB 4FS0A 5I2IB 3OAZK 5ITFB 5C0DA 2LU3A 5FO7A 3G6AA 3ZE1E 5CBAA 2CMRH 2WUBL 1BFOB 2FATL 4JQIL 1F3DJ 2FIKB 1V05A 3U9PL 1JMXA 1MHCB 2C1PA 3GSVB 1ACYL 4OZIE 4CRPA 3QIBC 3ZSSA 4MXVF 4OLUH 5I0DA 3LRHA 2Y25A 3MA7A 5IWLA 3KJ4B 3D6GA 3E2HB 1CGXA 3K3QA 2BY2A 4HIJA 3G5VA 1ORSB 2QSVA 4JREC 5D72H 5MHSE 5F9WB 1D7FA 1P84J 4TVSa 2NNAB 4XCCH 4NSKB 2UWEE 5E8OA 4PGZA 3BPLB 5I1AB 4Y5VB 2JTDA 1YY9C 1KEMH 1OTUC 1KXTB 4U1KB 4X9BA 4LK4A 1JZ6A 3TVMB 4KZEH 1NMAH 3G6JF 2DM7A 1R3LA 3VFVA 3SGKC 1U8OB 3PP3H 1DSFL 3CPLA 5AWNH 1CDUA 1YPZF 4ODVH 4PJBB 3CLFL 4DOHE 4H8WL 1FZKB 4XNMA 3LY6A 1WBZA 2V5MA 3THMH 3BHBA 1L7IH 3CDGA 1T5XB 1T83C 1MRDH 4KTEL 1UCBH 3Q3GA 4Z6AT 1IT9H 2EE6A 2OQJB 4OFVA 4TUKH 3TT3H 5BRZD 1KSRA 1K8IA 5D70H 4LSTL 4JN1H 3U1SL 3DVGA 1MCOH 3VFPA 3R0MA 1OP9A 4J3SA 3CVIH 5FUZL 5FUOH 5D4QA 2OR9H 3BI9X 5ERWB 2YD9A 4J4PA 1FNEA 5CD5C 2AGJH 1BVZA 1J1PH 4AEHH 4HJGA 4LQ1A 5F6HI 1FSKC 4XHJD 5GJSL 5E1AA 4CU8A 5T1LB 1S7WB 4JHAH 5E8NB 5DJ2B 3VXQB 4UQ3A 4IMKC 5F7MC 3OX8A 4CMMA 5IHZB 4LSDA 3RVXD 4K7PX 4M7ZC 1OAYL 2BZDA 5JHDA 1FFOB 4GKNA 3CFCH 3AC0A 4ODWA 4JM2C 1EX0A 3EFFB 5MEOA 2DI8A 4HH9A 5CJXC 1R5IB 2VJXA 2EDYA 4YDKL 4NT6B 3DTXA 5GS0H 2R23A 4OF8A 4CAGA 3FO1B 5JO5B 4QGTA 1LNUB 3WJLC 2E9JA 3TO4A 2BNQE 2Y07L 4MCZB 4ZNEE 2A73B 4ZQKA 5F7YC 3JVGA 1DQQB 2J2ZA 1QUNA 3HNTL 5FGCE 1DDHB 2R2EA 4JLRB 5FB8B 4YAQA 3ULUE 1IGJA 5DK2B 5HBBA 4WHTA 2D7QA 4LHUG 4HPYH 3FRUA 1HHHB 3PQYE 4PRPD 3OPZH 3H8NA 4G6AD 2CJUH 4ZYKA 5FYJL 5K9QI 1JNHA 5FDYA 4E42B 4TSBL 2UV3A 5CHNA 5IW1B 1YNTB 4XPTH 3UBXI 4NZTL 4H1LG 3UTQA 1H0DB 4MMXC 4PJ7A 3F5WB 3OXSB 4J8RA 1QRKA 1JN6A 1ZLSL 3LQAH 1R3KB 1I1FB 3PV7A 1YNLL 3GSXB 4AT6A 5GS3A 2ICWJ 2HH0H 1DE4B 3IF1A 3MCKB 1NFKA 3B8SA 5TDOA 1RHFA 2VLJB 2DQFA 4OZ4A 4XCYB 5D7LB 2AK4A 3WNMA 5JPNA 3T65B 3DGCR 5IFAL 4UDUB 3LKRB 4I0CC 4YGVA 2BDNH 4JE4B 1CFNA 3MA9H 2Y06L 4M7LT 2MKLC 5HGDA 1KB5L 2HG5B 4X6DA 5GS1C 4BH8A 5F3HB 4ORZC 5DRWA 2FBJL 1DN2A 3VWKB 1XF1A 1LDPL 2E6PA 1ES0A 4A6YL 4M8QB 3WHXB 1CFTB 4WWKC 1KOAA 2D7TH 3KR3H 4OJFL 1YDPA 1HQ4A 3ALWA 3STBA 3EO1A 4LEXH 1KB5A 5HVGB 3BE1L 5GSVB 4L8SA 3JV4A 3D0LB 2CSPA 4ONHB 3BRGC 1BEYH 1ETZA 4HWEH 5D6CA 5DEFA 2EZ0D 3Q1SL 2EIDA 4EN3D 4ZPVB 3RDTD 3PGCA 5E5MA 1BGXL 5IBTL 3VFGH 3F7VB 4EBQH 2OXGA 4F57L 4HK0A 5D1QD 1J5OL 3AAZB 3ARUA 3FHQA 5FOBB 3V6ZB 1QFWL 3QI9A 4WWID 3H42H 3ZYZA 4KJWC 4MXWH 1UXWB 1BQLL 1MJUL 3MRIB 2A6IA 3MV8E 2X89D 8FABA 1WIOA 5D9SB 4F9PA 1LE5A 5C09A 2OZ4L 3D3VE 4URTB 2X6MA 1ZE3C 1XFPA 4G8GB 3PNWB 2IBBA 2EXWD 4NZDA 2XY2A 3MGAA 2O93L 1JYXA 5E08L 4FNLH 5I1KH 3HE7B 3X13A 4QHLB 5GS0D 4RCAA 4U1HB 3PWVB 4WW2B 4FZEL 3TNMB 2ZOLB 2ARJQ 1CICA 2ICWA 1FO0H 3MJ7B 3QYCA 3BWAB 3BIKA 3E6HB 1JYNA 2XZCH 3HI6H 1X9QA 4PJCF 4OCSL 4G9DA 2NTFB 2NY2D 1T1WA 3VRLE 3IDIA 4FXGB 4I77H 4X9FA 4BH7B 4D3CL 2RHEA 4DEPC 1WC7A 3CXHK 5D7JC 3EAKA 5IB2A 3T0XA 4Y4KD 4RMUA 5L0QB 2CK2A 4LARH 4KQ4L 4NO0D 3QDJD 4DWHA 2V2TB 5IGXH 4GFTB 4UINL 3W9DB 1YN6B 2EH7H 4HJJH 3C8KA 1EV2E 3SOBH 3IXAB 1FQ9C 2EYRA 1KTLA 4PP1C 1ZT4A 3RRQA 3L95A 3IDYC 2F8OA 3RWFB 1DTUA 3PUCA 4IOFC 4LGRB 1PEZA 3MLVL 4MD5A 3LV3A 4ETYA 2DQEL 4WVRA 1B9ZA 1YEJH 4NN7C 3KYNA 4XHQA 4LFHD 3S8WA 2WBJD 5E9DE 5HHXH 1TQBB 4ZTOH 1I4FB 1GSMA 3RZCA 3NIDE 3HNVH 4P3CL 5TDNA 3SGEH 2QSQA 2I9TB 1FFNB 2NXZD 1EGJH 1YEDB 4JFFB 4HWBH 4OZHE 1NC4D 5HY9A 3PGDA 4HZLB 2W1NA 2DI7A 1NGYA 3C60D 4P2QE 5ESQB 5BZDB 1T80A 1G84A 4J23A 3PL6D 2JCCB 4WO4C 4YHIA 3ILQD 1YZZA 3O2DH 2DKUA 3FB5A 1IC5H 3DJ9A 3I2CL 5MI0C 4X4ME 1F4HA 2OXHA 2YWYA 3GMRB 3IJSA 3VFUB 1CGSL 1ZGLM 1MCCA 2FO4B 3PV6B 3D0VA 3SE4A 2DF3A 1LEIA 3MRFA 5CEZH 2VO5A 3WN5B 1CFVH 1EDQA 3KG5A 4RX4D 1RUMH 3CAFA 3ZT5A 1JZ7A 1MI5E 5JW5A 1JK8B 4LQFH 3B2UD 4LSVH 3UPCA 1N2RB 4XP5H 4PJ9A 5DRNA 2YC1A 1J1OH 4JPIA 3QUZB 1NBYB 1P7QB 1KCSH 1J87A 5FYLE 5I1JH 2XTLA 1K8DA 3TBWA 3BQUB 4OCRL 1JGVL 5TPWL 3FB7B 3RKDC 2R4SH 1I1AA 3OR7B 1WZ1L 1J8HB 1R5VB 2VLLA 5K9KB 1AY1L 3I75A 4KMQA 2DQHL 5TF1H 5KTEL 4U1IB 2QSCH 2G5BB 4EI5B 5MENA 4RMRA 1QYGL 2VL4A 4NQEA 3HZMB 3P73B 4JY5H 5EZJB 1EUUA 2QQNL 3A6BH 2HRLA 1NBVH 4EIGB 3V8CA 4MSWB 4UV7H 3BDXA 5HHVL 1A6VL 1D5XB 1MFBL 4S1QH 4YPGB 5GRUH 3PWUB 2DKMA 5ISZE 4UV4H 3VH8B 1E4KC 2YD2A 3DOSA 2KH2B 4Q97A 1J8KA 4UNVA 2CLRB 1RUAL 3MXVL 4MDIB 5FCUH 5I66A 4J3XA 1OCWH 2UWEA 4IHOB 5JUEH 4PRIE 5DF0A 1BIHA 1LO5A 1G0XA 3P2TA 3VXNA 4OI9A 1RVFL 5GRVL 1HDMA 2NQCA 4RA3A 2F53B 5T3XH 4FZ8L 4M8VA 3FO2A 3RQ3A 1S7TA 3KPLB 4ZFFB 1RJZA 3FT3B 4IRSD 3QWOB 2XN9D 4M6OL 1PSKL