5BS0D

Mage-a3 reactive tcr in complex with titin epitope in hla-a1
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
197
structure length
197
Chain Sequence
AQEVTQIPAALSVPEGENLVLNCSFTDSAIYNLQWFRQDPGKGLTSLLYVRPYQREQTSGRLNASLDKSSGRSTLYIAASQPGDSATYLCAVRPGGAGPFFVVFGKGTKLSVIPNIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Direct molecular mimicry enables off-target cardiovascular toxicity by an enhanced affinity TCR designed for cancer immunotherapy.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords HLA class I histocompatibility antigen, A-1 alpha chain
total genus 31
structure length 197
sequence length 197
ec nomenclature
pdb deposition date 2015-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5bs0D01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5bs0D02
2XA3A 3F7PC 1AH1A 4PY7A 3RNQB 5D7IB 5CLTA 4YXKL 1FV1B 5D70L 4Z95L 4F9PC 1MJ7L 3DMMB 1JYXA 1M05B 5F8QC 3G5ZA 3P9LB 1S7UA 3BFOA 5F7HA 4N0UB 4QNPE 2MKWA 1ERNA 1KCVH 2ICWI 1EHLL 4PJCF 2XKNA 4MHHI 3VFNB 1AD9A 1JYVA 4MGXA 3NCYS 3DO7B 4XCEA 5IR1A 4NQXA 4N5EC 2GQHA 4MCZA 4JB9L 1XCTB 3MBEA 3PWLA 3TBYA 1IC1A 4GRLA 4BELD 1BFTA 1GOGA 3AMKA 3RWEB 2GSIB 3LH2H 3TVMD 1LP9B 4RQQB 1CLCA 3MRKA 2GJZA 3O3BB 5HGGS 5E8DL 5C07B 4GXUM 1QUNA 2EZ0D 3OTTA 4LCYA 2EC9T 4OZIB 3IGAA 1HSAA 3P3YA 3TPUA 3FFCE 1NCBH 4PJ7A 3VRIB 1FAKT 1OQXA 1NAML 1A4JB 2RHEA 4UILH 1LP9E 1KGCE 4DTGL 1QKZL 1MRFL 4WU7B 3D85D 1MEXL 1BIIA 3MR9A 1FFQA 5FO9A 4PGJA 5C0IA 5C3LD 5DC4B 1I1RA 4EUPG 3T0AA 5CJ8A 5J13C 4OD3H 1FC1A 1HHKA 1RZIA 3WCYA 5HVHB 5E8NA 3S88L 5JW5A 2I5YH 2C4XA 2FATL 3MJ9A 3S37X 4PLKC 4NZUH 1VGKB 1S8DA 5ENWB 3T2NH 4AEHH 2B39A 1X5XA 4LSVH 4OQ1A 1EUTA 4YNYB 2HAZA 4NN6C 5DUPL 2H26A 2EEDA 2H2PD 1GGUA 1QZ1A 5C0EB 5MEND 1U8HA 5FO7A 3VI3F 5ISZD 5JIHA 4F33A 4UI2A 1G7LB 1H9VA 5FKPB 1FFPA 4PJEF 4NC1C 1A3RL 1CLOL 5D7IE 5B3NA 5F1IA 1BEYL 4MNGA 4MCZB 2B0SL 3JVGC 2FL5B 3GMQB 2NXZC 4G5ZL 4HJ0C 5AD0A 4YHPA 4YHLH 2DQIH 5EC2A 3NFNA 4UT9H 2HFTA 1UT9A 2W60B 3ZKMD 1MH5B 5EUOF 4ZUWB 5FV2A 2CUHA 1KCVL 4PIRF 4PLNC 3L6FA 3EYFB 4O51A 4HPYH 4CVWA 3QQNA 3GNMH 4MCYA 4NO2A 4DZ8B 4OAWB 1IZKA 2HVKA 2XFXB 4NDMB 4YLQT 1NDMB 1TVBB 3N06B 5F3BB 5I1AA 2VLME 1S7WA 3I9GH 3X3GL 4D9RD 5MI0B 5DD6B 3MNVA 5IM7B 1S7QB 2F54D 4H88H 2PW2B 4H20H 1A6TB 4LGPB 3BQUD 1FRGH 4Z7WF 4RGMC 3P9MB 3U4AA 1TJHL 3H9SD 1S9KC 4AM0B 2EDBA 5IKCB 4LLVB 1DP0A 5TGBB 1YNTB 3GHEL 4M9OA 4U31A 5ALBL 4W4OC 4J3XA 4J4PA 3VXRE 1S9YB 2GITA 5TDPA 1FYTD 5C6TL 2UYLA 2AXGA 2QHRL 2HLAA 2XQYG 1C5CH 5GQBA 5AZEL 1AO7B 5JDSA 2BY2A 4R97B 4DVRL 4X6BB 4UMGA 3D9AH 3VWKA 2OMNA 3KPPB 4J3OC 3HFML 4NRZB 3RVUC 1A1NB 5BOZG 1CLYL 2EKSB 1MIEL 4KKBD 5L0QC 4F7CB 4P3DB 2Y9RT 1YEGH 2ZSWA 5DUPH 3QXVA 3PDOA 4M4RA 4APQD 4GMTH 5FYKE 1ROWA 3HZYA 3IDNA 1SBBA 1BFSA 1MF2L 3PIQB 1JPTH 2JIXA 4I9WE 3UJJH 2AJXL 3BZDA 4ZUUA 2DQJH 5ESVA 5TDOB 1S78D 3WHXB 2OZ4H 3D39A 2HH0L 1I7RA 3N1QC 2VDKL 3FQNB 3WBDA 3QH3A 3IJHA 4MJ5A 4XNZC 1KEGL 2JLLA 1VSCA 5IB4B 3FJTA 4WHYG 4M48H 4P4RA 4UILL 3RL1A 4M8VA 1UM5H 4E41A 4WW2C 2E6PA 2IH1A 3BPLC 3Q5TA 4NUGL 1FBIL 2XV6B 2P8LB 1UG9A 1CI5A 3O4OB 2XTJC 3HKFA 5MHSE 1QRND 3TBVA 3VFSB 1IAOB 3QT2A 2EXWC 3K74B 3PV6A 1HH9B 3RWIB 1DANU 4G8IA 1KCSH 5I8EA 3VE0A 3ARSA 3JV6A 1I1AB 1U8PA 4JFQB 3HI5H 2EIZB 1XF1A 4N90E 5D1XA 2WUCH 4HK0A 5HGBA 3ZE2F 2XZCH 3S8WA 4LIQL 1OAQH 5C0AB 1HINL 5DRWB 1VB9A 3ZHLA 3LRSA 3DGGB 1IKFH 4FTVD 1N6QL 4WDIB 1OAXH 4MD5B 2QQQA 3D0VA 3IAGC 4TVPE 3IKKA 2OXGA 5TQ0L 3A6CL 5KVDH 5GJSL 1R3HB 2LABA 4LKCB 5GGTH 4YFEA 3NPSB 1AJ7H 1MWAB 3RWGA 3BKYL 5IB3A 8CGTA 3L5XH 2AJYL 3T04D 2IFGA 1KCLA 1HYSC 5F9WC 3O3EA 5E70A 5FV1L 4JKPL 4NQUA 4JHBA 5JDJA 1JTTA 1MAML 3FB6B 4XCEB 3X14A 4NPYB 15C8L 3SCMD 1V7NH 4E41B 5DRNA 1N64L 4NQDB 1R0AH 1N6UA 4XPHH 3RL1B 5IV2B 5D1XC 4QYOB 4FQLL 1KCUL 3KYAA 4FA8A 3UBXI 1KYOK 2D4FA 3OKKB 1SJXA 4IRSC 4P9MH 5FGBA 4WCYH 2EE6A 1PYWA 4X0KA 3CD4A 4O58H 4YK4B 1OPGL 4FFWC 4W68A 3SJVB 1BQLH 4MJIB 3LEYH 3S6CA 5EU3A 3VXOA 2HTKC 1TTFA 1AXTH 3B8YA 5C0FB 5IQ7H 3JV5A 4WWKC 4ZYKB 1A8JH 3M1BB 3EOAA 1T89C 5TPWL 3BEWA 1YNLH 4KHXL 5EIIB 3WN5B 3N9GH 4WRLA 1A5FH 3D1MC 3MLUH 4X6DE 1ZT4A 4QRRD 1FAIH 3I50H 3GEWB 1LILA 4OI8A 1CQYA 4PB9H 5DD1H 5CINL 4OZ4A 3S37H 1LNUB 2BMKB 1INEL 3P4OB 4P57B 1R3HA 1A7QL 5ABDE 3MLWL 3UDWA 3L3OB 5GS0D 1BF2A 4O2FA 2PYEB 4LFHG 5K9KA 1BQHA 5DQ9B 3V52H 5F88B 5JW4N 3NACL 2C1PB 3JV4B 1H8NA 5ALCH 1DFBH 3U9PH 4K23L 1F8TL 2B8OT 2VXUL 3RWCA 1S7VB 3CAFA 5HPOA 1ZANL 2NW3A 1FLTX 1MVUA 3GSQA 2ZOKB 4AZ8A 1YEJL 1J05A 4OLXH 1JFQL 1NMCC 5HI4C 2IPKB 3F12B 2JJUA 4B7LA 3DVGB 3JV6B 2IALB 3ARQA 4FXKA 5GS0L 1FZMA 1G6VK 1M7XA 4ZFFA 5I9QC 3BKYH 2ORBH 1H3UA 1T4KB 5I6XB 1DBKH 2FSEB 3P77A 5C3TA 4Y19B 4ERSH 2DQTH 2BHZA 4X6CE 2QQLH 3OKEB 5ESQA 4S10A 4PRBA 4MXQD 2J5LB 3IDXL 4MA8H 2BNRB 5GZOC 5L6YH 5L9DL 5DK3A 3QULA 4UV4H 4AYFA 2B5IC 2XACC 5GJTL 2AJSL 3QI9B 4TUKH 3LS5H 5DFVD 2I26N 2FGZA 1BQLL 3IF1B 5F9JA 5HYFA 1IEBB 5KANG 4LSSL 1QG3A 1A6WL 3DVNA 4M61A 5DJ8A 3ULVH 3AFLA 3D3VA 3OMZA 4LOUD 2XWTA 2X4RB 4MAYC 5E8EA 5CJOH 4G80A 2XIDA 2EYTB 1RUAL 2UY6A 3WE6A 1I8MB 2JCCF 2CLVB 2R8SH 4EQ3A 2DIJA 4WI8A 2WP3T 5DGQA 4AK1A 4M61B 1J05B 4P5MB 1ACZA 2AK4D 1INEH 3ULUD 4OAWA 3ZKND 2JK5B 3UYOD 3RIFF 1QSFE 1JZ4A 4OTXL 3MRMA 2BOBA 2PO6B 5KAQG 1XF3B 1NGZB 5E94B 5FHBL 1V3MA 3W2DH 4H5SA 5HVWA 4DOHE 2JK5A 1IL1A 2CIIB 4YBLB 4UDUA 5E03A 2M26A 2B4CC 4TNWK 3GMRA 3P9MA 1DBJL 1Z5LB 4UIMB 4YNYA 2IH3A 4XPFL 3IT8D 1G7LA 5FKPA 2KPNA 2L0DA 4JPVH 4OGYL 5HYSG 1CGUA 2NX5D 3JBG7 4P9HL 4FABL 4FQCL 3ZTNL 4P3CL 4M6ML 1ZLVK 3BP6B 1ZLSH 1I3GL 3HMWH 4XNYH 4ZOBA 1CGTA 4OBRA 3LOWA 1CFBA 1PLGH 3K4AA 4YHPB 2RCSL 3WSQH 3T77A 1AFVL 2HJFA 5DMJB 3A6BH 1YEDA 1MVUB 4XP5L 4RFOH 3RVVD 3ILPA 3QUZA 4C83A 1T0MA 1C1EH 3L3DB 2Z92B 1ZKAA 3QDGB 4CUCA 2D0GA 5LQBH 1L6ZA 3H9SA 1A9EA 3K8KA 1XZ0B 3QIWD 1M7IA 4F9PA 3ZE0F 3QWOA 2W9EL 5HI3C 2A0LD 4YZFF 3VRIA 4ZAKC 3X3GH 4HUXA 2NNAA 5GRWA 4MAYA 2AABH 5I17B 1I1CA 4Z8FL 1DR9A 3I6KB 5BZWA 3OF6A 5E6IB 1A6UL 1OP3H 2ZCKH 3CFIC 4OD1H 1P9MA 3BW9A 1KPUB 2YC1B 3GJEA 3GKWH 2DWDA 1A1MA 5JW5B 4BH8B 2ESVD 3SPVA 1F6LL 5I19L 2DL9A 2B0SH 3AS2A 4WJ5A 5DEGB 4NO5A 1JWUB 4QRUA 3GBNH 1BAFH 1EGJA 5AWNL 3I02A 5FYJE 3Q5OA 4XBEH 5IK3A 3CLEH 1IAKB 1B2WH 3RAJH 2WIIA 1RHFA 2YZ8A 2XRAH 3CMOH 3GM0A 1RFDL 2ZCKL 3UTSB 4YDKH 5LGHH 1ONQB 5FYJH 3IAQA 3NIFE 3BEWB 5EIIA 1NBZB 2IPTL 4J8RB 5DJ6A 1YMMA 4N9GA 3GSOB 1NMCB 3B5HA 3FT4B 4LHUA 1F4XL 4F7PB 1Q72L 1CFTB 4QCIB 3BDYH 5DRZA 4S1DC 1G7QB 5DVLA 2AK4A 2EH7H 2VL5A 4J8RA 5DJ6B 5EFIA 2B1AL 2BHUA 4Q7DA 2FRGP 4YGVB 5DD0L 4FZ8L 4ENED 4UNUA 1VFBA 2KDGA 1RUPH 4MA3A 3MA7A 4GRMA 4PJDA 1MI5A 1PSKH 1FNSL 3B3IB 3MBXH 1F2XK 3VI3E 1WISA 3O41A 1QSFD 4XC1L 4Q97A 3H3KA 1CGSL 1Q8MA 1UXSB 4P5TB 4JM2A 2R4SL 4MZ2A 5T1MB 4O4YL 4KGJA 5D1ZC 1ZLSL 3BP6A 4DCQA 4GH7B 3H9HA 4HK0B 5IFHL 4XNXH 3N1FC 1F4WL 4JB9H 5D5MA 1JWUA 4QRUB 1E4XL 4KMTL 2FGWH 1EFQA 2VAAB 5KTEH 4G9DA 1FORL 1KJMB 5L8LB 4KJYB 4CN6A 3P30L 1C5BL 3KXFA 3RTQC 2EE9A 4PR5B 1QRNB 1F2QA 2UVFA 3QQ9C 4NCC1 2XWJB 3KHQA 3STLB 2GSGB 1QR4A 3RY6A 1EXUB 1VFMA 3WIFA 5C0BA 1HHHB 3HN3A 3QWRD 3HS0B 4MD4A 1NBZA 5C0NC 1HOCB 3FB7A 3TC9A 3IDYC 4C54A 3IDNB 5IT2L 1AR1C 4OZHE 3VWKC 1A7OH 4FFYH 4PRDB 3WS6A 3IJSA 5CBEA 1QFHA 3CVIL 5GGSY 5FDYA 4O2EA 4F7EA 2DI7A 4HBQA 3FT3B 1MFDH 3WS3B 2E8YA 5DWUL 3G04B 3I6GA 4JFZH 3D0LB 5DJ2B 2FB4H 2R56L 4ZNEE 3TO4B 5EZOL 3AM8A 1LEKB 4GRLC 2R15A 3U6RB 1IQWH 4P23D 4LDOB 3CSYA 4LQ1A 4JZJC 1MOEA 4O2CA 5I1DB 2Z4QA 1RURL 5E4IA 1PEWA 5LBSH 3FQXB 1QOKA 1QO3A 3PV6B 4F2MA 3VFSA 1CF8H 3QUXB 4MMZC 4NIKB 2YN5A 4X4YA 5I19H 1KPUA 2WLZA 2OL3A 1XR9B 5T3ZE 3QDHA 1SEBA 3U4BH 3ARFC 4ONOA 2IQ9H 4JFPA 1J0KA 1Q9KA 1EHNA 3MCG1 3HHRB 5A2IH 3ULVE 3O3DA 1EEZA 4MX7A 5IB5B 5IGXH 5MEOB 4U4BA 1NFIA 2VITB 4LHJB 3FO9B 4R0LA 2D9QB 1DQMH 3KPSB 4YO0B 3KPNA 2PXYC 4IRZH 2O5ZH 3ZL4L 4LLMB 3D0VB 2XTJD 3MX0A 4HHAA 4EN3A 5C71A 1JUFB 1S3KL 4Y4FC 5DLML 1JYNA 4ZXBD 3C9NA 4GUPB 1HDMB 4HH9B 4OF6A 4ZUWA 4E41E 5I73C 4LSQL 1F90L 1IEBA 1S7VA 2D7MA 3P73A 2YA0A 3MACH 3C09C 5ALCL 4QWWD 1Z0NA 3NFSL 3T0DA 4JQIL 4O02H 3WLBB 5E6IC 2B4CH 3KJ6L 2XQBH 1HE7A 3GIZL 2AQ2A 1QFOA 1AFVH 1IGTA 3WEXA 3CXDL 2O5YL 4R2GD 2QTEA 3CFKA 4Z7WB 1F00I 3VWJD 3B9AA 4Z7NF 2B20A 3KPLA 4TSBH 3V79C 4PP2A 3MJ6A 2XZAL 2VQ1A 5A2LH 4X6DF 5D93C 2YMXH 4U7MA 4YHKH 4ELMF 5GIRB 2I9TA 1FHGA 5CHNB 5F7DA 4PRHD 3BVNA 4N90D 3O2DA 4HZLB 1C08B 4NT6A 4XPGH 4S2SB 2X6MA 2XTLA 4HS6B 3DVIA 4X4YB 2BNQA 4EDWH 1UYWH 4X5WA 1E4WL 3IDMA 5TGBA 2QL1A 2DQDH 4K71B 1MUJA 5I74C 2CIIA 3BAEH 4C57C 4L8SA 4ZSOA 2FX9L 3OXRA 4J2XA 5EU4A 1JK8B 4NRXB 3CFEB 3CLFL 5DR5L 4ENEC 1J11A 4PJ9D 2PW1A 4JY4A 4QGTA 5C0RL 4LPUA 3O8XC 3KJ4C 1IC7H 3OXRB 2A74A 4QWWC 1PBYA 4NM8L 4W4OA 1OPGH 5GGSB 1EERB 1DQTA 1LGVA 4YDJA 3D6GA 4F7CA 4EN3B 4U49A 5IG7A 8FABB 1JGEB 1KTDA 5IJKA 4LPTA 3E6FB 4OCXL 1UQSB 4MAUL 2OLDA 2WBKA 1JHTA 4CVXA 5C0AE 1T89A 2V2TA 3DTXA 1BVLB 1I85A 2Y36L 2BRRH 1KEMH 3VFTB 5FB8B 3OG6B 2ARJQ 5DVMA 3ZT5A 5GGUA 4PBWD 2BOBB 1L7TH 3KR3L 5DJAB 3QUXA 4HMEA 3DBXA 5EU6D 3W9DA 5B4MD 1MI5D 1DLHB 4XZUA 4PB9L 4WFGD 1IM9B 4QKXB 1LE5B 3JWOH 1TCMA 4UTBH 4DKAA 3HE7D 4WTWA 4ORZC 1A6ZA 5ICZA 2CKNA 4JJ5A 3T3MF 1VGKA 3JWOL 5DD6A 4YJZL 4R26H 1NC4D 3BPNC 4L4VA 1T7ZA 2JJTA 1S5HB 5BJTB 1NCNA 5F7EH 1P7QB 2RR3A 1CTOA 2VTFA 1VADA 3HNSH 5AUMB 4ELMB 3ARFB 1I1FA 1XGRA 2AERT 4U1LA 5E24E 2DM3A 2ITDB 1TTUA 4AENA 5T1LD 5IWLA 5EOTA 1DQJA 3OPZH 5T1MA 1IQWL 3ROLA 2EECA 2BVQB 4ZODA 2HJKA 4UT7L 1KELH 1K8IA 3G9AB 2AJUH 2IMNA 4N0YH 3ZSSA 5L2KA 5L7XH 4WENB 4QHLB 3TV3L 1JPFA 5DC9B 2ESVA 3ARBB 3BP7B 1UKSA 2V7NA 3PHSA 3MPCA 3MXWL 1Q9LA 4LEOA 4GRLB 1QRNA 2UWEF 1ONQA 2N56A 1PKQA 4H1LB 1RIHL 5HVGB 5I9QB 3MLWH 4ZUVA 2XA8H 5F7WC 3VJ6A 3O3EB 5I76A 2EDWA 1CCZA 1YMMB 5B3JE 3M07A 4NYLA 1F6AA 3TJEL 2IG2H 4GXVL 3QJHB 1HHIB 3B9KA 1X6NA 4ZUVB 3QWQB 2I27N 3IU4H 4KHXH 1DLFH 3V4UH 5CIPH 2ZOLA 1YPZE 1KLGB 4HC1A 3D69A 4HD9A 1T5XA 5L2KE 4LLDA 4YFLI 3QCVH 3PWNA 2V2WB 1YEGL 1ZT1B 2VSCA 4QRTA 1BZ7A 5BJTA 12E8L 1PY4A 5SWSE 4FNLH 4KTEH 3ECBA 1SMAA 4HMCA 1BP3B 4GLRI 2X9XA 3WNMA 5IFAL 2YSSA 3DYOA 1R5VA 3EYSH 5FYKU 4AL8L 2A9ML 2BDNL 4FQLH 4JRXE 4ZFGH 3MV7A 2Y06L 4BM7A 2OTUB 1OSZA 3GIZH 3ULVD 4OCYH 5E08L 3PP3H 3BT2L 4Q6YA 1DVFC 4RAHA 5TH2B 1PG7H 3D48R 1KPRA 3MBXL 1G9ML 4UUJA 3QQ4A 3W0WE 4FQ2L 3I6LD 5IB1B 2JELL 4WI3A 5HHOD 3VH8G 3VXUE 4OQTA 1CFNB 1LO3L 5FB8A 4HQQL 5C0CA 2NY2C 5CD5C 5HYSB 5DEFB 2AK1L 3Q48A 1XGPA 4R7DB 5BQ7B 4AIZB 5DK0A 2Q8BL 5BMFL 1RVFH 3QUZB 1EMTH 1OGAB 1PVHA 2IFFH 5EUOE 1I3UA 3TYGH 4F8TA 1A9EB 1TZHB 2D03H 1UA6H 3OAUL 4Z18A 1ZLUK 5ICZB 3DV6B 3IFLH 3BHBA 4XPTH 2VLKE 5EU6A 2V2XB 1NCWH 2GJ6E 4PJ8C 5BVPH 4BZ1L 1JNJA 3FO1A 3UYPA 1MAJA 3OX8B 5CWSA 5INCA 2DLTA 3QPQD 5BVJB 3N85H 1FSKB 4Y2DA 1JHLH 1HKLL 4JRYE 5C9JB 3MRRA 5B4MC 2XG4A 3ALPA 1W0VA 3U2SB 5CP3H 4YGAB 1KCKA 1NPUA 2DI9A 1ETZB 2DMBA 3WNOA 1HKLH 3IJHB 3HAEG 4EOWL 1NAKH 1UACL 2BFVL 3B5TA 5IMKB 4WY7H 4XRCA 3VFUB 3QCTH 5EZOH 2Y7QB 4UIMA 1BQUA 4LEXH 4I2XA 1VEMA 4OV5B 1R5IA 1E6JL 2P8MA 1WBXA 1H5BA 4RMSA 1NC2B 4PLJC 5J57B 1A6VL 4G6FB 3BH8A 2YWYA 3SHSA 4HWZA 2WUBH 4WU5B 4H20L 3KWWA 1A6AB 2Y6SD 4AT6A 4I2XB 2X41A 2EYSA 1A6VH 3QZWA 4JRYA 1MEXH 3EDKA 3N1GC 1K5NA 4LLMA 3H2WA 2DI8A 3TZVC 4KVNL 5C09D 5IHBA 2YUZA 4GKOA 3RIAF 3OZ9L 5EWIL 4K3HA 2FCBA 1NEUA 4X7EC 3BZEA 4RFOL 4ODHL 1AXIB 4WTXA 4G8FB 2A1WL 5D2LF 4D3CH 5E8DH 1PG7L 1UXWB 4MLSA 4K55A 5I2IB 1IGIH 5JUEH 1T21B 4TUOB 3KPTA 1JGLL 1HXYA 5CLWA 1ZS8B 2EDTA 2VDMH 5IVNA 2X4SB 4KKAD 1U92B 2F54B 4HKBB 4KK6C 4M8QA 1GRWA 3C6LC 4LASH 3SGJA 4G6MH 3VW3H 1EGJH 3D18B 4HT1L 4HDIB 5DXWA 2BOCA 3Q6FA 5CEXB 4XNUL 2CLZB 1WSST 2DM4A 5TFSL 3P77B 2EH7L 1S9VB 3FAWA 3OG4B 5FHBH 3W2DL 2VMFA 2YD5A 4WI2A 3MUJA 5EOQH 5HJ3A 1Y6KR 3MZGB 4A6YB 2DQGH 1OB1A 3C2AH 3MRDA 1PQZB 3BH8B 5TDNA 3WXWH 5D1QB 4JFFD 4CU8A 3BO8A 5KSUA 2BNRA 3U7YH 4I1NB 2OXHA 1HHHA 1G7MB 4X6EA 5FUCC 1UH3A 1A1OA 5IQ9A 3QQ4B 5IB1A 3LN5A 4DGVH 2OJEB 1E4KC 1IAIM 3BSZH 3TO2B 3O6FA 1NCWL 1AGEA 2DS4A 3QQ3A 4P59L 3NMEA 1LO0L 1CLZL 4M1CC 3WN5C 4RGNC 4DFIA 2DTSA 2PTTA 3RDTA 5IEKB 1EO7A 1SBSH 1YZZA 2BSTA 3QO1B 5IVXF 4B50A 3TBSB 2F8VA 4LVHC 5C9JA 1IE5A 3G04A 3I6GB 5K59F 4RA3A 2V7HA 5EO0B 3RWHA 3GBNL 1UCTA 2EYTA 4HLJA 3P4OA 3UPRA 3GSNB 5D9SA 4LNVA 3HNVH 3V95A 4LCUA 3ISWA 4Z0XA 1JPSH 3JWOC 5J6HB 1BJ8A 1B9ZA 3PG2A 1DBAH 1FH5H 3RI5F 2VR9A 2H2PC 2JE8A 1JK8A 3TJEH 5I75B 5LGJB 4L4TA 3GSQB 4WHTB 1HHIA 4KDVA 4RX4D 2RCSH 3G6AB 3V6ZB 3MZTA 1TJGL 4J4PC 4ZFOA 4D0CB 1N2RA 1XF5A 3SDDB 4KKCC 2XOTA 4MSWA 1Y18B 3GSUB 1QBMH 4N8CH 3Q1SH 2GK0B 3L3GA 4PG9A 5HHOA 1I1YB 5F1NA 1J86A 2NMSA 3EO1A 3H3PH 2NY4B 4FQ2H 2MNUA 1OVZA 5LQBL 1U8IA 4U3XA 4A2MA 3MRLA 2H26B 2DB8A 3GSUA 3UMTA 4OLYH 4Q9CA 3CC5A 1EO8H 5DD3H 4JFOB 5KSAC 2NY6B 3UTTE 2IBZY 3HC3H 2F19L 3OB0K 4HAFA 1WCBB 5MI0C 2RQ8A 3AVEA 4Z7VF 3U30B 4GBXD 4I0PC 2V9TA 2P42B 4M5YH 4JPVL 4OGYH 3X12B 3WJJA 5FM4A 1DANT 4U6HB 3HPJA 2R0KL 3INUL 2NXZB 4JFXB 3PNWB 4BZ1H 3RUGE 5TE6L 1CVSC 4JM2D 2B2XL 4M02A 3KYOA 3MA7B 3GSNA 5D9SB 4MB3A 2WP3O 3RX8A 4AMKH 1QLEH 4ZXBC 1KENH 2R0ZH 3PNWA 2ATPB 2CGRL 2FD6H 2Q3ZA 3CH8A 1N5AA 4JFED 3FQWA 5BV7C 1XIWB 1IQDB 5DQDH 1U8KA 5B38G 5E5RB 4OCRL 3FQTA 1RIHH 4K8RC 3SQOL 3H8NA 1A1MB 2GIYA 4YBHA 5JXAH 4M7ZB 3SKMA 4JFQA 3RKPA 3GMPA 5KS9E 3TIEB 1R5VB 2YSSB 1FL6B 4G6JH 5J06A 5D4QA 1DQQB 5C7XH 5MEPB 5IROC 4OF5A 4APQA 4RBPK 3QWRA 2DWEA 4JFDB 3EYQC 3MRLB 2YD8A 3QI9D 3QQ3B 4HGKC 4PGDA 3G5ZB 3ULUF 1YECL 2APVA 2QQLL 3TYGL 1ZHNA 1TQCB 4GG6E 3ZKMC 2R9HD 1AE6L 4HKXA 2F53B 4L8DA 3VGAC 4PP1D 4NYLB 4UTAH 4Q0XL 5KSUB 5HHVH 4PV9A 4PRDA 3VXUB 4YHZH 4YDVB 3O9WC 5E99L 4OI9A 4D9LH 4R26L 3V4PH 1CFSB 1VGEH 2FBJL 2B1HL 3AU1B 5DVNA 2GT9B 5CSBA 2EDJA 2DLEA 2XPGB 4ZS6C 3QAZB 1NBVL 1OAXL 1VACB 5F7KC 4XBGB 1IMHC 4RRPA 2C3GA 1CFTA 4LKXA 4UNTA 5CGYC 4XZUB 1B0GA 2W65B 3RVUD 1LE5A 2ATPA 2QQKL 3L3DA 3PQYD 1WVZA 1Q94B 5EO0A 3RWHB 3OGOE 4V1DD 4ERSL 2BP3A 2NTFB 3MCKB 2ILLA 1NGWB 3RWJA 5A3IC 3SDCB 1NAMA 3VGAB 4AH2B 3KLSA 1KYOJ 5LAXB 2HFGH 1H8SA 2XI9A 3RVXC 3ARDB 4N0CC 4LVOC 4Y5XA 1HXYB 4ALAL 1UB6B 3QUXC 4KUZL 4P5KA 2H3NB 4HUNB 3MACL 4CU7A 5IFJB 4DCQB 5IMLA 2FX9H 2ITDA 3CDGB 3LMJL 4YHNB 1T7YA 3H0TA 4HX1A 4M5ZH 5D7LD 1RU9L 1W0YT 4OV5A 3RGVC 2K1MA 5GS3A 5D7JB 5HHMB 1P5UA 2YMXL 4YHKL 5JA8B 5C86A 3EO1B 5DJZB 4L5FL 3VXRD 2FJHA 5I30L 2EYSB 1P1ZA 4HWUA 2J88L 2GFBA 5DUBA 4KC3B 5LCVH 5JPMB 3MLUL 1L0YA 3BIKB 4M7LL 2N7BA 1CD1B 2AEWA 2YPLB 5E56A 3DRQA 2PYFA 4DK3A 1KT2B 4JQIH 1XR8B 15C8H 5D2NE 2ZJSH 4JZOA 1BD2E 3GO1L 1JGUH 3VRLF 3SKJH 5FK9B 3GDBA 3QISA 2XTJE 5CIPB 3SE4C 2F9BT 5DLMH 2XZAH 4TUOA 4WCYL 2CR6A 4ZPVA 4LGSB 3U2SA 3DI3B 3ESUF 2HT2C 5B39A 1KB5A 2WANA 4PJCA 1EDQA 5F7EL 4OZFH 2AJ3A 1TETL 4RGNB 4MNHA 5ID0B 2E6JA 2XQBL 3KPQB 1R5WB 5IFJA 2GJ6A 3JWDC 4M7ZC 4FFWD 2EC9U 4TTGA 2NW3B 5ISZE 3HB3D 3OXSA 4PJBF 3V5HB 2P8MB 1YPZF 2PW1B 1S9YA 2J12B 3WIFB 5CJXC 3QFJB 1KPRB 5HHVL 5IEHB 4G6AD 2UVEA 2PXYB 2G2RB 5JXEC 4MX7B 2R0ZL 4PJHF 5BQ7A 1W72A 1SBSL 2RFXA 4HPYL 3MJ7B 2BRQA 5TQ0H 2YUXA 1JZ3A 4HJJH 1FO0L 1NC4B 5E4EB 3BE1L 5GGVY 4G80B 5F44A 4RMWA 4H8WH 1A6PA 4PRIA 3WDIA 4XP4L 1UB5B 4N1HB 4HJGA 4M5YL 4DVRH 3TCXA 5I6XC 3U0TA 4FTVE 4P46C 2DICA 2DYPD 5IFHH 1I9RL 4IBLT 1IC5L 5CJQH 5D6DC 1GHFH 1G0XA 3G5YB 4JFEA 4YHYC 3MOBH 4MA3B 1K8DB 1WWAX 4GFTB 4MQ7A 5DO2D 3EYVA 1CDIA 3MLYL 3U7WH 5MEQB 1YDPA 1PG7W 1RK0A 4PJHE 1HQ4A 2B5IB 1G9NC 2H6PB 3NGBC 4M7LT 4ZOEA 4MLIA 1CN4A 3WUWB 2I9TB 1D5XB 3DX6B 4N0RA 2ZUVA 1IGMH 4IHOA 3CVHA 4Y19A 4EN3D 1ZAGA 2DYPB 2CQVA 1IZJA 2A73A 4ONGL 2VR5A 2VN4A 3RUGF 2QSVA 5F96L 1XIWA 2GFBB 4MNQD 5ESQB 3ZE1F 3GSRA 4YIQA 4DJMA 1I8LC 2YD1A 1MCEA 1UH2A 1HHKB 3DXAE 4TQEL 4YPJA 3W0WA 4G42B 1JNNL 2PN5A 1KTKE 3KNBA 5F97E 4HJ0D 5ESAA 2I60H 1T1WB 3MRGB 1UEMA 4TSAL 1B4JH 5EOCH 2DWEB 3NGBB 3OKDB 1CLYH 3LHPL 2KZWA 3UJTL 1GZPA 3HNTL 1CXFA 1FIEA 2BCKA 3FMGH 3T0VA 4LSUL 4KDWA 4PYHA 4CVZB 5DVOA 3DRTB 1QSVA 3SGDI 5JW3H 1TNMA 2O5XH 3QJHA 4N8PA 5MP6L 4XTRC 1MFBL 5J6HA 3O3BA 4XP9H 3A67H 4L3CA 2ZOLB 4UBDC 5HGAB 4XC1H 4BZ2L 4GKNB 4FHBD 1NBQA 5DQ9A 1U8QA 5D96B 4XP9L 3AM8C 4FZ8H 4P46A 1BHGA 5CZXD 4NWTL 2EDYA 2R0WL 3QUKA 5I8EB 2FH8A 3KPRE 2W0FA 1CIUA 4Y16D 4WGVB 3SDDA 2X4QA 3WLWD 4HXAL 1KB5L 1VACA 1KOAA 3BXNB 1QSEE 1J0YA 3NPSC 4IHOB 1DZBA 2D7PA 3EGSA 3CUPA 1M05A 3HNTH 4EQ2A 4BSWB 2EXYD 2E8ZA 4WTZG 2VLLA 1BBDH 4LSDA 3GIVB 1KN4H 4Y7MA 3RY6C 1WQVT 1EGJL 2IBZX 3BKJH 5DRXB 3BP4A 2N7AA 2PXYD 3ARGD 4ODTL 1MCOL 1T66C 1DQJB 3BE1H 4Y8AA 4JRXB 3UP1A 4NRXA 4IIQC 4LSSH 5DEGA 2D7NA 5E7FA 4EBQL 2WMPA 1WZKA 5T1KA 3LEXA 5ELIA 1ZGLB 3WUZA 3KAAA 1XGUB 1CE6A 1KB5H 4HXAH 2LQRA 4L4JA 1NQBA 2DQHH 3EW3B 2AK1H 5A16B 5FOBB 2BFVH 4ODHH 3GKWL 1UACH 3T2NL 3CFJB 5EC1B 3WS6C 4C56B 5IMMB 3PWPB 4CMMA 4Z7UF 3WFBL 1C5BH 3NAAL 1BFOA 3KPLB 1MCDA 3CJJA 3T2QA 4N0FA 3GBLA 4G6ML 1OP5H 4OTXH 3N85L 4GG6F 3BVNB 2CRZA 2VLJE 3V5KB 4OD3L 3MV9A 3PIQA 1XGRB 3MNVB 2FIKA 3O6MH 2VOTA 2DTMH 2VLKD 5FYLE 2R69L 5SX4H 5JNYA 1U3HB 1C1EL 4E42A 1A6TA 4K7PY 4YHIA 4G42A 3T1WA 3VXRA 4JO2H 4U6XA 4LHUG 3F7YA 5C09A 1KJ2H 3L3JA 3VG9B 1Q9OA 4P4RB 3LH2L 2F15A 4JRYD 5KG9A 1FGVL 2Q8BH 3VXNB 2EIBA 4NNYA 3KYKL 4Z78A 3NIGE 4OM1L 2KQMA 3SE9L 4OZIF 4PLOB 5ETUA 3T1FB 5CP3A 4URTB 1J0ZA 1IAIH 2FJHB 5T5FH 4BZ2H 2BVUA 1A64A 1FYTB 3QDJD 3MOAL 3BIKA 5FYKD 5H35B 1AHWA 2BC4B 3TV3H 3DX9A 3B2UD 3PDOB 2IANB 1TZGL 2R9HC 3BPOB 2YEZA 2HVKB 2XFXA 2AQ1A 3LIZL 5IW1B 1L7IL 5J11C 4GKSB 1ND0A 3SE8L 3IU4L 4HIEA 4MD5A 4NM4H 4OKDA 1EEQA 2ZKHL 3TNMA 5JMRA 1D7FA 2N1KA 4ZSOB 2OI9B 3NCBB 5KBNC 4HJGB 1YEJH 4BH8A 4XB7A 4FRWA 4YDIL 2OK0H 5CBEB 5IMLB 2FYYB 3QEQA 2I07B 2NY4C 4HWNA 3KYNA 4OI7A 4BQ9A 1RZIB 1SJEA 3FFCB 3VMPA 3FRPA 3QUZC 3DIFA 2VJXA 2HVJB 3AS0A 5CEZL 1EAPA 4LCWE 1ZGLP 3IFLL 4KJWC 1X4XA 2VWEC 4UTBL 3IAPA 4JCMA 5D1ZB 3E6FA 4JQVC 2Z31C 1WV7T 1IGML 3VD3A 1T03H 5E2VL 3WFCH 3QQ9D 2L7UA 2H41A 1CE6B 2EDLA 2E9IA 4ISVA 3FO0L 3LKNB 2NX5A 4GW4A 4OZFG 4OZGF 4F3FB 4KJYA 2PXYA 4WGWB 2ZNXA 5DHVA 5E9DD 4O9HH 5SX5K 1YEKL 1NGPL 3MNWB 2F53A 1XR9A 1RHHB 4KXZH 4RRPG 4LSRL 1WWBX 5IHUH 1QFUL 3UC0L 2VXVH 1MQ8A 4PRPA 2ID5A 4AEFA 4ZYKA 4K7FA 3BESR 5JQHC 4G6KH 5FO8A 2X40A 1ZHKB 3KDMA 5E9DE 1DQLL 3V52L 1TZIA 1KBGL 4I3SH 5ID1B 5FYLL 5DVKA 4ZTOL 5D93B 4AIZA 1SYSB 4IRSD 4ELKB 5A2JH 2O5YH 4QHKJ 4ACPA 4I3SL 2OJZH 4KK8C 2COQA 4D0DA 1G9MC 4J6RH 5L7XL 1LEKA 4X8JA 4DVBA 5ITFB 1LNUA 1Z5LA 2BMKA 3RNKB 1ETZA 1M7DB 5DMKA 1JTPA 5DRZB 3DROB 4PRHB 2R1WA 5EU6E 1ZS8A 3W5MA 1N7MH 3IDJA 3IB4A 4IOIA 1NAMB 1FVDA 3O3AB 4G7VH 1MREH 5CSZB 3BN3B 1OW0A 2W0LA 3FQWB 4WV1A 3RPIB 4JO1L 2R2HA 4GXUN 4QXGL 2R39A 5FUZL 5TF1H 1F5WA 2BRRL 2F5AH 4JRXD 1I8IA 2X2YA 1LO4H 3X17A 4WW1A 4APQC 3CIQA 3DGGA 3MXWH 3HG1A 1T80A 5GGRY 4BKLB 2UWEE 2AJZB 2B1HH 4IS6A 3QUYC 4ZO8A 1GAFH 5D1QD 4OUUA 1CICB 3GIVA 2NY6C 3MV8B 4FOMA 1FLRH 4HBCH 4W6YB 5C0RH 5F1KC 4CJ1A 1MJUH 4YDLC 1OGTA 4FQ1H 4PJAE 3R8QA 5B39G 4D0BA 5GZND 3MGOA 5E6IA 3FN9A 5J11B 3IGAB 3T0EC 1HK6A 3QO1A 3LEVL 4QRTB 5F88A 3RDTB 1JHKL 5IEKA 5IV2A 2EE3A 5DRNB 3BD3A 5CEZD 5KW9H 1WGOA 3QH3B 4D0BB 3SPVB 3ZDYE 5IVZA 1MFDL 4NKDA 1MI5E 4XPHL 4Y16A 2OZ4A 1TMCB 3QUYA 3GHEH 3R0NA 3EZJB 1I4FA 1ZWIA 2CKBA 1MAMH 2W0FB 4GRWB 1MHPH 2D31A 4WO4D 2P8PB 5H2BB 1S7SB 1JZ8A 4HIJB 5HYIA 1UJ3B 5I71B 3NCFB 1OAUL 1NCAH 3I02B 4PJFB 4A6YA 1YYLL 3T2PA 3VFWA 4AENB 2GUOA 2HLFC 3CUPB 1SYVA 4KK6D 4HIJA 3F65A 1D5BB 3QA3B 2R2BA 3OKYA 4XMLH 4PY7B 1MCJA 1DQDL 4OCXH 4TPRL 2R69H 5DWUH 2E9WA 1GZPB 5A43C 1X6LA 3UXFA 1AGEB 3QDME 1S7RB 2X5PA 4OJFL 4ZTOH 3IXAB 4G6JL 1ZXQA 2F58L 4FN0A 4LP5A 5E9DB 5ANMB 4PV8B 1MHHA 5DHVB 3TP4A 3O3UN 4JN1L 1RURH 4WWKB 5DJDA 3KPMB 3SN6N 1H8OA 5I1KL 2P43B 4CVXB 1R3LA 2MTPA 1FNSH 1NFDA 1N8ZB 5H94B 2FD6L 1RUPL 3GSXA 3HRPA 1RZ7L 4ZS7L 5I16A 1FBIH 4PRHE 1R3JB 3CH1A 2ICWB 3VMNA 3PWNB 1HIML 2C3XA 1MHCB 5DF0A 2HT3D 4QTIL 1PGRB 4FFYL 4NBZB 1QQDA 4LARH 4OFVA 5IT2H 1SQ2N 2EDFA 1ADQL 3GRWL 2ZCLL 1F6AB 3O11B 3DWTA 2R4SH 4EDXA 4IEFB 2HTLD 3R06A 4GMTL 3ZHDA 4JGJA 3ORJA 2O61A 1RY7B 2Y5TB 3KPQA 4U3CA 4S1DD 2MHAB 4WV1B 5GRVL 3U4EB 1I8KB 1FE8H 4ZO6A 4JPWL 4NO0D 2PR4L 2X89D 4YXLH 4RDQF 3LSOB 5EO9A 3TH4T 1OSPH 1KJVB 4Q9BA 5EWIH 5D1XD 4WO4C 2R29L 4GRWH 3Q1SL 4FTVA 3VH8B 4MJIE 1QPPA 2GYSA 2BVOB 4KY1L 5C0AD 5T3XD 4HWEH 3LQZB 2ED8A 1DE4B 4LCWB 3RZCC 1OWRM 3FQRB 5ETUB 1U58B 2HKFH 1IGYB 3I2CH 4NO5B 2HJFB 2WLYA 5FYJL 1WJ3A 2X44D 5GGSA 1CFQB 1UZ6E 4KKLD 5IB2A 2AW2A 1ITCA 1A0QH 2D03L 5EBLA 4P5MA 4Z8FH 1ZGLM 2G5BA 1U8MA 4PBXA 3REVA 3WXWL 5KVEL 4M93B 4L3EE 3RDTC 2DQHL 4HIEB 5ICXA 4GKSA 4FQIH 1KUMA 3BD4A 3T0WA 2DJ4A 5CEZE 4OZGE 2AXFB 3QUYD 4K7PX 1B4JL 3ZMRA 5J12B 2NNAB 5I1HH 2R29H 2YK1L 1RJYB 2YN3A 1JHLL 4ZFFB 1QEWA 2V9RA 5TFSH 1NCBL 1NLDH 5EZJA 5SWSA 3VFGL 3ZYIA 4RFEA 4LVOB 1VESA 3ZKXC 5F1OB 3RKDD 4U2YA 1KNOB 3QDMD 4LPYA 4DN3H 5JR1H 4AM0A 2WBJA 1N5YL 4CN1A 1QHPA 2WBWB 5E9DA 1NFDE 4XPAL 3TN0A 4LHQB 2YPKB 5HI4D 3UJTH 1OP3K 1RFDH 1X4ZA 1BOYA 1XGQB 3I75B 4KRPB 4JLRB 4U0QB 2VDPH 1TVHA 1UGNA 3QCVL 2BK8A 2IQAA 1AO7D 2DQCL 2D2OA 4TQEH 3VFPB 4YPGA 1FG9C 4K3JL 5F9JB 4NQTA 5D96C 3KPRA 2PYEE 3C08L 4DAGH 1XGYL 3FHAA 4NCDA 3PWVA 4FQXA 2VQ1B 1KF9B 3ARFD 1AO7E 2G9HA 3ES6B 2JCCE 4POUB 5JW3L 3L3HB 2IBBA 4MNGB 4OQTL 2J8UF 1F11A 3HC4L 2X4SA 1AC0A 2QQNH 4MA1B 2YUVA 3RPKA 2O61B 4YGVA 2BVPA 3H6JA 3MYJA 2J8UB 4XP4H 4WWKD 3JV4A 4NUJB 5CZVL 1HSBB 4PJ7E 3SGJC 3T0XA 4UT7H 1KN4L 3CFKB 4EI5D 3J8F7 4M43L 3C5JB 3QUKB 3L3IB 3S3JA 1EEYA 1CU4L 1B88A 3MMEA 1EA9C 3G08B 4K07A 1J10A 5C08D 3D69B 4KZDH 5IMOA 1Q72H 1YUHB 4OKVB 1T4KA 3C5SB 1UWGL 1I9EA 3PWUB 4Z7VA 4M1DH 4HV8B 4XB8A 4UV4L 1QD0A 3ILQC 3MRIB 1Z9OA 1G9MH 5HGDA 4LGRB 3E6HB 3V6OC 4R3SB 5BZDB 2CUMA 3MRCA 4Q9RL 5ITBH 3VW3L 2KL6A 5DDHB 2EIZA 1MJ7H 1JHKH 1N6VA 3BT2H 1RUAH 3S5LB 3T2OA 1SM3L 5DURB 5J9PA 5GSVA 3ULVL 1I3RB 1IRAY 1NGXB 3B9VA 3TNNB 4JFPB 4Z7NE 2DM2A 4P3CH 1IGIL 5JUEL 5L8JB 3F7QA 5EFIB 4NZTH 4KPHL 4QY8B 4LCIL 1SY6A 1T22B 3FO1B 3TZVB 2APBA 1TCRA 3MV8E 5IB4A 4YHYB 4N5ED 3BN9D 4XVUD 3BGMA 3RWEA 3FT3A 1WWCA 1MLBA 2D7QA 4P46D 3PGCB 3WSQL 1X5GA 1U36A 3D85A 3WFDH 1MCPL 3JVGA 1A7BA 1N0LA 5F96H 2EYRB 3JSSA 3PQYA 1OCWL 1QLFA 1KULA 3BXNA 4F15B 1YMHA 2ZPKL 2CMRL 5MEQA 1G7JB 4R2GB 4D0CA 1F6FB 2XA8L 4OV6F 5DD5L 3H9YA 4GS7B 1A7RL 4S1RL 3V7MA 1JGDB 3O6FD 4KTDH 4MHHG 3QCTL 3OKKA 4PJFA 3S4SG 5I0DA 3L3KA 2FX8H 3LD8C 1UM6L 1FFNB 4Y4KC 4B7IA 4JKKA 1MRCL 1DLFL 1GOHA 2C1OB 3V4UL 2PYED 3IVKA 3Q6GL 3E2HB 5C8JB 5FM8A 2AJUL 2A73B 2BVYA 1E0OB 4XPGL 4JN1H 2DQUH 1PKQB 3OPZL 2VDQH 1X5IA 2NLJA 5EOCJ 4J6RL 4KRPD 5C2BH 4J12A 3DMMD 3IFNL 5DK2B 2XKNB 7FABH 5J4MA 3LN4B 3VFOB 4JKWA 4P2OC 3GSVA 3ULSB 5D2LB 5FM5M 3HPJB 3KLAB 4P99A 3ILQD 5ECJE 1LEIB 5F89B 2FDBP 4M5ZL 4TYUA 3B6SB 5FA4B 3KPRB 3TYFA 3OWEA 1AHWC 1JFQH 3OHXA 4WO4B 2YD9A 1SYSA 4RX4A 4ESKA 2J8UE 2DBLH 3QRFM 3MV7E 1YNLL 2AAVA 4X9FA 5FUOH 2CIKB 1GXEA 2G9HB 3ES6A 5C07D 1YMME 3CVHB 2IEPA 4YE4H 3WFHB 1L7TL 3D2UD 3EJYD 2R2CA 5CP7B 3W5NA 5ERWA 1B90A 1WC7B 3M45A 3S37L 1S7WB 5F7DB 4CDHA 3S4SB 3I6KA 3ZT7A 3GJFB 4JG0L 3VD4A 5I17A 5HHNA 1XGTB 4N8VA 1RU9H 3QEHA 4UDTA 3EYVB 3BD5A 2BSSB 1JP5A 5CEZH 1QPXA 4XP1H 1EEYB 3QNXB 4WI6A 4NQCB 1I8KA 4ONHB 3WJJC 2NZ9C 4G3YH 1MCSA 3J7HA 2BJMH 2OQJB 3AY4A 4UU9B 4NGHH 2YPLA 3U9UA 1CE1H 4LCIH 2OJEA 5JXAL 4RAVA 4MD0A 1R3KB 2P5WE 1PW3A 3E6HA 2HRPH 3BHBB 3LKQB 5JPNB 5M94B 1KTDB 1J87A 3GO1H 3BO8B 4H1LG 3DLQR 2CGRH 3GSWB 2YZ1A 3VFRB 2CKBL 1CFQA 2OS7A 3L1OL 4AMKL 1G7PA 2EO1A 1FDLH 3BUYA 3VGEA 4LRNL 2I24N 1IKFL 3F6LA 2AJ3B 4O58L 1X5ZA 1U8MB 1LO5B 4FQXC 4Y0GA 4KUCD 4NN7C 1P6AB 2IAND 3LZFL 2EDEA 5TF1L 3FQUB 3L5IA 2X9YA 4U33A 4TRPL 4M6NH 4DEPC 4X5WB 3QB7C 4IRSB 2GTWA 4FZEH 4J23A 2UZYB 5I1EH 1FGVH 3FQXA 4HKBA 2Y7QA 4Y5VB 1N7ML 5KN5A 1T1YB 2ADFH 4WHDA 3BRGC 1D9KC 2D4DA 3P9WB 5C08E 1AGFB 4TULH 2DDQL 1IBGH 3FT2B 4M7KH 5JW4M 4OZHA 4KUZH 3MA9L 4WW2F 2AEPL 2V5SA 2X1WL 5HHME 5FYLH 1HINH 2A6DA 4BFIA 3EYQD 1S7XB 3F7YB 4DUXA 3S36L 5IG7B 4NM8H 4KRNA 5D7JA 4NBXB 1PFCA 1H3XA 3WN5A 5HHXL 4OCSH 2B4CL 1P69B 1LDPL 5KS9A 5JO5B 2YBRA 5DI8A 5DR5H 4JDTH 1MPAH 4U1MA 2NY0B 3RNQA 5FGCB 3OJ2C 3HPLA 2FBJH 4NQCE 4QRRE 3VRLE 3RHWK 2IQ9L 2MPAL 3DSFH 3TVMC 4BA8A 4QO1A 3T1FA 1NFKA 2HMIC 4JZOB 1S7UB 5M95B 1R3LB 3STLA 1A7RH 3QULB 4NJAH 4E41D 5AD0B 1NANI 1ZOXA 2C9AA 1OLLA 1QSFA 3GMQA 4WI5A 3HFMH 1AHWB 2BC4A 4GW5A 2Z91B 3GSVB 5GGTL 1RQ5A 3ULSA 4D2NA 4KMTH 1ZT7B 3STBA 1VDGA 4JFEE 5IGXL 1LO5A 1AIFB 5IBTL 5I1IL 1AY1H 1A4JA 2Y72A 2NY3B 3MGOB 2OZ4L 2EXYC 5IJVA 5EU7E 3TIDB 1MCPH 1MQKH 3C6LA 3EIFA 4K3EH 4ZUTB 1KCUH 2W65A 1OCWH 3K4ZA 3UTSE 1TVBA 1FNGB 5C07A 4ODTH 3IFOB 3VFMA 3NFSH 4PUBL 2Q6WB 4LLDB 4XH2B 2EDRA 3L3JB 2NY7L 1NGWA 3RWJB 3QIUD 5LBSL 1SJHB 4UOW1 5KAQF 3U83A 5DTFB 2HFFB 4U6TA 4Y5XB 4PJ7F 3QDGD 3SE8H 3G5VA 1HHJB 1RK1A 2AJYH 5AEAA 5CEYB 1MCRA 3FB5A 4NM4L 4WJ5B 5SX4I 3P40A 4KK5D 1TIUA 3MRRB 4CMHB 4AEIH 3DMMA 4YDKL 1P7HL 5TE6H 2Z8SA 3QI9A 2YRPA 3ARBA 4UUJB 3SO5A 5H35A 4CRPA 5HGHA 5L2JA 1N4XH 1P7KA 1WF5A 4KI5C 2Q1EA 4UV7L 1MFBH 3ZT6A 1NEZA 4YDVA 3U7YL 1AKJA 3IDGB 1IJ9A 3A67L 4HIHA 4LASL 2NCMA 5IK3B 4DGIL 1CR9H 1L9MA 2DQJL 3SE9H 2FO1A 1MWAA 2QJDA 1I3VA 1FJ1A 1UWGH 4Z76A 2ICWJ 9CGTA 3PP3K 3V5DA 4H25B 2VXSL 3FZUD 3FMGL 1N3NA 1ORSB 1QLRA 3T4AB 1PSKL 4HXBH 1Q0YL 5GGRA 1T22A 5E5UB 4KVCH 4BZYA 1WBYA 3DV6A 1ZTXL 5AAMA 5J3HD 5DJCB 4IRJB 1XH3B 2V5YA 4RGMB 4IM8A 4GO6B 1Q0YH 1WCQA 3ILPB 4NZRH 1FVEA 4GSDH 3UTPD 3WHXA 4CW1B 3O2DL 1CIDA 1U3JA 3RWDA 3SBWC 1QBML 1XMWA 2W1NA 4KRMB 3B9KD 1ZLUH 1RD6A 2HFFA 4LAJH 4D9QE 1G1CA 1BEYH 5JIKA 3MJ8A 3UTPE 1P53A 2G60L 4MAYB 4PLKD 4S0TD 4ISVB 1K6QH 4NFDA 3RVTD 3UZEA 3EOAB 4NJ9L 4G8IB 3U7WL 3QXAB 1KIQB 3SY0A 3ZKNC 5AWNH 1H3TA 4NKIL 4ODBD 5FGCE 4DGYL 1I3RA 3IVKB 6CGTA 3MCLH 2VAAA 1N2RB 4ZS6D 1T0NA 2UY7A 1EZVY 1KCRH 4PR5A 3VGHA 2HG5A 1T1ZA 4Q9QL 1WT5A 4L3ED 1OLZA 1I9RH 4XMPH 5D6DA 2YD2A 5E8OA 4TSAH 4JFXA 5EOCL 5ID1A 3MV11 3AY4C 5K9QG 3IXTA 4ORGA 4YFDB 2ENYA 4M6OL 3MLVH 3P73B 1ORQA 1JWSA 4XAKE 1CLZH 1B2WL 1BX2B 3RAJL 4H26A 4H25A 1QVOA 5TDOA 5DFVC 1GOFA 3RTQA 1UQSA 4DK6A 3ZKXB 4DGVL 4XH2A 2YK1H 4P4KB 2XWTB 5CFHA 3O2VH 5CS7A 1B4RA 1ZVSB 4HS3A 4PGEB 4FP8L 1JJUA 1IKNA 1A3RH 2GCYA 5FO8B 4KTYA 1E6OH 4ZNEA 2CLRA 1TITA 4YEFA 5EOQL 1WZMA 4NKDB 5DJAA 3LS5L 3QCUL 5CIPA 2J6EL 3BN9C 1EO5A 3OKMA 1RUKL 5KSBE 5CGTA 4I4WB 3S98A 2V17L 1PAMA 4G7YH 4L8SB 4L8CA 5GZNC 1CL7L 4X6DB 3MRFA 4H5SB 1I8LA 1ZLVH 5C0BE 2WNGA 5CJOL 4LFHD 1Y0LA 1T6VN 1F4WH 1XFPA 2ARJA 2BNUA 2OSLA 1RZGB 1WTGT 2V6HA 5D1QC 1J5OL 1VADB 4Y19E 3S96A 1OB1B 5CILL 5BRZE 3OR6A 4WEBH 4Y4KD 4PREB 3MA9H 4X7DC 3IYLW 4XP6H 2X7LA 1X7QA 3SE4A 3IF1A 5K59E 1ND0B 4HBCL 1A1NA 4JM4H 5HGBB 4WW1B 4YO0A 4R97C 3VFGH 3FOLB 4X5XA 3MRGA 3D3VB 3MRQB 4PJEE 4Z7QE 4Y19D 3U9PL 4NDMA 3QPQC 4OGZA 1GIGH 1ZHBB 2G75A 4FZEL 4YXKH 3V7AG 3VFRA 4JZNA 1T2QH 2HT4C 1D5MB 3QHFL 4H0GA 4NBYB 1U8JB 4LBEA 3O6FB 1HDMA 1BFOB 1LQSR 1NUNB 4KVNH 4WTZA 2FATH 2F54E 3QIBB 1U92A 4R0LC 2J8HA 1Y6MR 3PP4H 4P9HH 4FABH 1XZ0A 4XVUC 1DBKL 1X5KA 1BFVH 2W9EH 1BJ1H 2CLRB 4PJGE 4WUKL 4MB5A 1WFUA 1FAIL 4MJ5B 5EU7C 2OR9L 3DX6A 1IL1B 2CLZA 3PGFH 3WLWC 1KLFA 3ZO0A 2IALA 4K8RH 4U6VH 3WDHA 3VXRB 1MFEH 3P0YL 5IVXA 5I1KH 4PYGA 4ZMAT 3U6RA 1T1XB 3EFFB 3EJZC 2GY5A 4LPXA 2FSEA 1W72L 4MA7H 3T65B 5FF6A 4JAMA 2OR8A 4JDTL 2R2EB 3NACH 1D9KB 3IETA 4LLUA 5EZLB 2ARJB 2BNUB 2A9MH 2BDNH 3FO2A 1KFAL 3OJMB 4B0MM 3ETBF 4WU7A 2EH8L 4UINH 3NBNA 4J3VA 5EU4B 5DURD 5F6IC 4X0KB 1YNTA 5IIEB 1LD9B 3QNZB 3GUTA 1DQLH 2O93L 2FBOJ 5FECA 4K94C 3D87B 4HEME 4GKZB 4Y2DC 2VZOA 5EBWB 4R96A 1RZKL 1IEAA 1T66D 3KS0J 5I1IH 1P6FA 1UA6L 3E8UL 5GISH 3RUGB 3FN0H 1K4DB 1ZT4B 5IB5A 5MEOA 4LQFL 5T33H 2YR3A 5K9QI 35C8H 5C6WH 3X3FL 5IR1B 2VZ1A 2OI9C 3LKOB 1BZ9A 1ZA6A 1NDGA 1ZMYA 4LU5L 4PV8A 4Q0XH 1LP9A 3CX2A 2YA1A 4RQQA 3QPXL 1J1PH 1UM4H 2UUDK 4X4XA 1UVQB 3CFJA 4LLQB 3VDCA 1JTOA 4U1GB 3L9RA 3NA9L 1KJ2B 3AB0B 3IKCB 1A7PL 3PL6C 3D2UB 4Z77A 4PPTA 5C0ND 4ZD3L 1KIPB 5IHLB 4CNIB 2VISA 1EFXA 4QYOA 4U1HA 4ODXA 5GGRB 3SDAD 4BSWA 2WUCL 4XPBL 4WEUD 4BFIB 3QJFB 5B39B 4XWOD 4LCWD 4E42B 4F7MA 4HIXL 1U91B 4UB0L 2QQKH 2LVCA 5KSVB 3BP4B 1AGDA 1JN6B 1W0VB 1JGUL 3MRNB 3OKNB 1Q9KB 1SEQH 5MEPA 3NABH 3GGWA 1RIVL 5ENWA 3Q6GH 2EC8A 5FUCE 4MXWH 3OKEA 4XX1E 1S7RA 1YYLH 3MJ8B 3DO7A 1VFUA 3REWB 2Q76B 2JCCB 3MLSH 5ANMA 3MLZH 1X5HA 3B5GA 2D7TL 2IMMA 1XIWD 2D0HA 2GSGA 3T8XA 2CJUH 5CKGA 2OX5A 1TJIH 1JBJA 2P5EB 3HC0B 3BUYB 2SEBA 4KK9C 3BWAA 4YQXH 5C08A 3RL2B 2F19H 4PJ7B 4M62L 5JLZB 4YHOH 3TPUB 4X4MA 5E00A 1Q9WB 3MRPB 2AV7B 5IW6A 1BZQK 3B9DA 3N50A 1R3JA 3CH1B 5D8JH 3WMSA 2A0LC 1N64H 1KJ2A 4DKDC 3PQYB 4HGMA 32C2A 3QXDA 2Z31B 2ZOKA 1YEIH 3CDFA 1FVEB 4PBVC 4RCAA 4OGXH 5DJ0A 3OBAA 3LVEA 4PTUB 3SDCC 4LU5H 5KZCD 5BZWB 1BBJA 3ZSTA 4XC3H 4G3YL 3HZKA 5BXFA 4PJAA 2X4QB 1W8NA 4DZBB 2NTFA 1IAOA 3HE6C 3QG6B 4ODWA 4APQB 4I18A 1DEEA 5ICYB 1N59A 4KJPC 4FXLA 5GJSH 2Y5EA 1KN2L 3K46A 2A6JB 4NHCL 3ECBB 2F53D 1FL5A 2H6PA 1NGZA 5IP4A 1XGTA 4XWGH 4ODWB 3WHE1 4C58B 4N9OB 4HSQA 4ZFZB 1FH5L 1AI1L 4PRPD 3IDGA 4PRIE 3U4BL 1U8OA 3LRSB 1NEZB 4KUCF 3WO4B 4U1MB 4MXQC 5BZDA 1AE6H 3AROA 2MSPA 5HJ3B 4KROB 5B3JF 3UAJD 1FZOB 3RQ3A 2M8XA 4WWID 5E2UL 2PO6C 3T8XB 2ZP0T 2F8XC 1X4YA 1FSKC 4GKZA 1WAAA 4KRLB 4HIIB 3WHE0 4R8WL 4HUMB 2P45B 1JE6A 1UADC 1N6QH 1G7HA 4LVNB 5DS8B 3TWCL 4NUGH 1EJOH 1AIFA 1IEHA 1MCWW 1FVCB 2DQIL 4PJIF 1OAYH 2UZXB 5ADPH 4UINL 2PTTB 3STZB 2ITCA 2LAAA 1WIPA 4PG2C 3V6BR 3C2AL 2DQGL 1FN4A 2DD8H 1I7RB 5KSVA 3UTQB 3C09B 3GZKA 4N5UA 1VHPA 3ABZA 3TO4D 2HFEB 4LKCA 3QSKB 1FCGA 3MRMB 4IRZL 4LSRH 1HZHL 2CXGA 4QNPF 4KROC 1HQRB 4JVUA 1FVDB 1CYGA 1MFEL 3P0YH 4I48A 5SV4A 1DBAL 4PGBA 1YQVH 1RSFA 4K3JH 5BW7A 2NZIA 4LCUB 2Q7YB 3G6JE 3AS1A 5CEYA 1XF2B 3G5VB 2NY6D 4WHTA 2A77L 1VFAB 3HMXA 4M4PA 1K4CB 1RIUL 4L8SC 4Q9RH 4NZDA 4PJXE 4EBQH 1I7UA 1HQ4B 3VDBA 1I7TA 3PV7A 1U8PB 2BY0A 3CXDH 1D6EA 5GSRB 2NTSP 4OD2A 4PJBE 4PJGF 3C9NB 4I3RL 2ZSWB 4POZC 1G84A 3EOTL 5EZLA 4PG2A 4XWOC 2X09A 3KPOA 3U48A 1C16B 4QOKB 5LG1A 5HHQA 3F7VB 5EZIH 3BGFB 5I1HL 4AEHL 4PJDF 2K7PA 1FRGL 4XBGA 3SGKA 5IW1A 1S3KH 3CFCL 5SWSB 4G8GD 2X42A 1F11B 3GBML 4Y2DB 5DA4A 3RVXD 1U0QA 1TPXB 4Y5XC 1EBPA 4HKJB 3QUXD 5FGBC 5F3BA 2BY3A 1TZIB 1FN4B 5E6YA 2FWOA 2XNAA 1HYSD 2ARWA 1K8DA 3GFUA 2W07A 2GJ6B 1BD2B 1LWRA 1X44A 3K8MA 3CK0H 2VERN 2I07A 2KZ1B 4XBEL 4NN6B 4UT9L 3TM6A 4DQOL 3HE6B 3GHBL 2IAMB 2ZUYA 4PJGA 3VXMD 1TFHA 5BCAA 3RWCB 2Z9TA 3C5SA 1H5BB 3T65A 3EFFA 3W39B 5KTEL 3KPSE 3KYKH 4EXPX 3OQ3B 6FABH 4E5XA 3ARDC 5D7IA 1LE9B 2ZG1A 3U36A 5HHPA 1X7QB 2DQFA 2Y07H 6FABL 1LO0H 5LWYH 4L9LB 5KJRH 4M1GH 1U6AL 3LB6C 3FCTA 1J12A 3O3DB 1NGQH 4RNRB 1QR1B 1G9NH 2GY7B 1D5IL 3LKRA 3ZYOA 5IVXE 2BXYA 5ALBH 5GRYA 5DHYA 2BVTA 4BYHA 5D5MF 3BKJL 3DNKA 5FGRA 1UXWA 1JUFA 3RIAK 4HHAB 3WE6B 1T20A 4PB0H 3HZMB 3GJFH 4RMTA 1EJ6A 2Z0BA 3W81A 1EFXD 4L8DB 4OT1L 1ZVSA 4HS3B 2P46B 4JN2B 3WIHL 4PGBB 4I9WD 5CP7A 3H7LA 1UJTA 2FJFB 4OGAD 4X7FC 4NQDE 2YEZB 3MLYH 3WXVL 5IBLD 5DJCA 5J6GA 1PD6A 3CMOL 3ZHKA 3PDDA 3MRBA 3DUSA 4HT1H 2AABL 3RFZC 1U42A 4PJFE 3RU8H 2DLGA 5HHXH 2P5ED 3WNPA 5A2FA 3F12A 3VWJA 1JGVL 2OL3B 4LSUH 4Y5VA 3GMPB 5KN5B 2HFEA 4Y5YC 2AI0L 1RZ8A 4HWEL 4QRPB 1ZHLA 1FFOA 3U9UB 4RZCB 4MVBD 5LAXA 4H8WL 2QKIB 3CU1A 4MB4A 1IT9H 2UWEB 4XCCL 4TPRH 1MNUH 5GGQH 3O2WL 5BXFB 4HS8H 4D3CL 4ZDHB 2H1PH 5I73B 4JFYB 5FO7B 3DVFA 4UDTB 3QNYA 5JIPA 4PREA 5CUSL 1J18A 4NZUL 1PLGL 1RVFL 3W0WD 1F4XH 5JMOC 3B2VL 1HZHH 4LLAA 1CWVA 2Q8AH 3QEGH 1XCQA 2P24B 3UPCA 5EA0H 4NKOA 5IBLC 3HS0A 4M6MH 4MD4B 1CG9B 4QHMB 3U82B 4R4FH 3SDAB 3TT3H 4XNZB 3I3DA 5K9OA 4BSJA 1WICA 2CD0A 3F5WB 4UV7H 4RWHA 5FA4A 3TYFB 3UPRB 2FZ3A 1Q1JH 3K3QA 3NN8B 4K3DL 4Y2OA 3O41B 5I8KL 5E00B 4Z95H 3SKNB 1KIPA 5JHLL 2O5XL 2J8OA 3DYMA 5CJBA 5I74B 2OTWB 4TTDC 1CVRA 3TIDA 3TBWA 1NJ9B 2YXMA 4EOWH 3L7EA 2VLMD 4F80A 5LJYH 1B6DA 2GCYB 1CE1L 4ZNCD 1A9BA 1BZ7B 2VLRE 5FYKL 1GPOH 4LVNC 1I3GH 2H32H 1IQDA 1OAYL 2CRIA 2F58H 3DROA 1XAUA 3MV7B 4RNRA 2J1KA 2OP4L 1HWGB 1XF4A 3VXME 2AJZA 4DKEH 3T0EB 4JM2B 2CSPA 3OAUH 5DMIH 4ELMA 4CMHC 1LK2B 5GRXG 4ZG1A 5AUMA 3MV01 4L9LC 4ZFZA 1MPAL 2MCPL 4M1CD 2ADIB 5FECB 4QHUB 2D7OA 1P7QD 4D9QD 1XGQA 3I75A 4D9LL 1MRFH 2GI7A 5I1GL 5E5MA 1NMAH 3VWJC 4GRWF 4JN2A 2DN7A 5DMGC 1I1AC 1BVZA 3VGBA 4NNPL 5FUOL 3GI8H 4HK3J 5GRJH 4ZAKA 3M17A 3GSOA 3VFVB 5J89A 4JFDE 3MFFA 3LKRB 1TCRB 2YBRB 1L0XA 5C09E 2XY1A 1IBGL 2NX5B 3LRHA 4GW4B 4K71C 4F3FA 2B7DT 1WWWX 3MOBL 4LPVA 4MAUH 2DKUA 1TVDA 3RY5A 5CCKH 3L5WB 2NPLX 2GJ6D 3U0TB 1FNLA 4JKMA 1NGXA 4LPWA 3NH7H 4NSKB 2WZPD 2UZIL 4AL8H 1BBJB 4FNLL 4KTEL 3JTSA 4X6FA 4G9FD 3QFDB 2EKJA 3L7EB 3ET9F 5IFAH 2BVPB 5KVMC 5FDWB 5CINH 2FJFA 2W92A 4XI5C 1YMMD 3G5YA 5TE4H 2ZJSL 4XMLL 4K94H 1FDLL 1I75A 3PHOB 3BW9B 1MFAL 4JQVA 2VXUH 1L9NA 3ARFA 1IM9A 3C6SA 1CK0H 4R4NC 1VA9A 5MHSD 2X70B 1SJEB 1O5DT 5IQ7L 3VXQB 4FMFA 4TRPH 3UROR 1T1XA 3PHOA 4HF5H 1KGCD 2PNDA 5IMOB 3LKQA 1MJJA 4LNRB 5LCVL 3NCMA 4NKOB 3L5HA 4MYWB 5JHDA 5T3ZH 1PZ5B 1KEML 3MLTA 3BGAA 2R0KH 3P4LA 2I9LB 1NGYA 4KHTH 2VDNH 2UWEA 2FL5A 1DBML 3LV3B 2UZIH 4XPBH 5DQJA 4YHML 5K33A 2CDEB 4PGCB 1LD9A 3QNZA 1R0AL 1JMXA 3KLDA 4JQXA 1MWAL 3E3QE 5ILTL 3UBXG 3K4DA 1KELL 3H9SB 3X11B 2EICA 5F6HJ 1H15B 5KANI 3QDGA 3K2UH 4EN3C 1G7MA 4NQXB 3V0VA 5FCSH 4WFFD 5D7KE 3DTXB 4OFKA 1T83A 3WFZA 1QR1A 4K7FB 3TN0C 1HHGB 3VXMA 1VENA 4GUPA 3ULVC 2W59A 3PWVB 4K9EC 3HNSL 4ZPTB 1JL8A 4NQDD 4OUUB 1NMAL 5B38A 2AV1A 1BOGB 3DGCR 1JI1A 2KH2B 1FNGA 1XF2A 1SJVA 4JRWA 1E4WH 1CGWA 1J9CT 2ADJB 4Q2ZA 3V6OE 1WEJL 5KS9F 2GHWB 3IS1X 2J88H 5LKNA 4HDIA 2VXVL 3UTZA 4R9HA 5F8RC 1JMZA 2DLFH 1R24A 4JKPH 5D1ZA 1JWMB 3BKCH 1BMGA 2X4TB 2DLHA 4BQCA 1O7SA 2NW2B 3VRJB 4LIQH 2QEJA 4OCWH 4UOJA 1OGAD 3LKNA 1KFAH 5ISZA 4HS6A 3MCKA 1IGYA 3HC3L 3A6CH 5KVDL 3BDBA 4Z7UB 5I75C 5IMKA 1DBBL 1M1SA 4C4KO 3VWKD 1AP2B 3OB0H 5J0BA 2V2TB 4N8VB 1T7XA 3AGVA 4Y1AB 43C9B 2A38A 1N0XH 3F7VA 4HH9A 3S96B 1PKOA 4TNVF 5MENA 3VD5A 2P47B 4XNQA 4PLJD 3C5ZA 5CGYD 4F7TA 2XKSA 4M62H 4LVEA 3PABA 4Y16C 1RUMH 4YDJB 1KBGH 5JHDD 1VPOH 4KI5F 1BFVL 2LVEA 4G6FD 3AAZB 3EJYC 3OAZH 4K9EH 1KCSL 5E7BA 4ZAKB 5A3ID 1VEPA 5B38B 3EYUH 3CLFH 3I50L 3C08H 4QRSB 4U6VL 3QIBA 3I84A 1HCFX 3BIBX 4H26B 3LDBC 1OTUD 1PZUB 3UTQA 5B8CA 1NUDA 2RAMA 4WWKA 5DJDB 5E99H 4M48L 1CF8L 2CIKA 3B9KC 1ZLWH 2VLRD 5SWZB 3FO0H 4Y89A 4DW2L 2BNQB 3EO9H 4OF3A 3SCMB 4NQEA 4NQDA 4O2CB 5I1DA 2XXCB 2NQCA 1DEDA 1LDSA 4P48A 3VD7A 3PL6A 2P5WB 1T3FA 5FXCH 5BVJA 4O5LH 3CSPA 3IU3B 5HHMD 3PDGA 3DECA 4DN3L 4GRLD 2WWMC 1RMFL 3QXAA 5TQ2L 4P49A 4JFZL 1PKQE 5F6IB 1INQB 3DSNA 2OTUA 5GPRA 4YR6B 5CCKL 2DMKA 3MUZ1 5F9WB 2YPLE 3GMLB 1EAJA 1NUFA 3Q5YA 4X5XB 1P7QA 4X7SL 4YDIH 4KQ4H 5DDHA 1U8NA 3RBGA 2Z35A 4YH6A 3MJ9L 3M1BA 4EDXB 1F90H 4R4BA 3LCYA 1F4YL 3O6LL 3EDEA 1G0YR 3QI9C 1LEIA 5BO1L 3BPCB 5GSVB 3IXTB 5I1CH 1WBYB 3O4LE 3TT1L 2A83A 3ARGB 3QCUH 3KNBB 5B8CC 1OARH 3BP5A 1MAKA 4LDLB 4WW2B 1L7IH 2QHRH 2GJZB 4HUWA 5HDQH 2GSIA 4V1DB 3GNML 2J3SA 5E8PB 3FB6A 4ODVH 3BH9A 3O2WH 2OYPA 5EUKB 1PEZA 4EI6B 3GSXB 4L4VE 2OTPA 2HWZH 2CKBB 2GT9A 4GAJL 2EDOA 3ULVF 2HT4D 3BH9B 4TOYL 3P4NA 5D7JC 3HI5L 1ACYH 1WITA 5INCB 2CXKA 4KKBC 1U6AH 5HGAA 4F2MB 4LF3A 1NH6A 5JOFA 1P84J 3U1SL 5I1JH 3QYCA 4G43A 4FQQB 2NYYC 2AGJH 1G7JA 3O2VL 4YXLL 4U3HA 3G6JF 1FZKB 3O45B 3PXJA 3QA3A 1D5BA 2FEDD 3JUYA 4WNQA 2CDGA 1C7SA 3JTTB 4KDTC 4U6XB 1RV6X 3K7UA 4PJHB 1S9XA 1JV5A 4NPYA 5LXGL 3T0EA 4TSCH 3OZ9H 1QA9B 4CDGC 4G6AC 5TF0A 3JUZA 3GSNL 5DT1H 4ZAKD 1MFCH 5JQ6H 5JXED 1IGFH 4JO3H 4OQTH 2QHLA 3EJZD 3CVIH 1HH6B 4JHWL 2I5YL 4FFZL 1IGCH 5KS9B 1RJZA 4X6CB 4HWBL 2ICES 4EZMA 4QRRA 1FIGH 5HGDB 5LGHL 3LPWA 1MF2H 1EMTL 2IFFL 1QYGL 1QFWI 1QP1A 1OD9A 4FFZH 3GBMH 2R23B 4LLWA 5HVHC 3HB3C 3QUMB 4DAGL 5EIQA 3CC5B 3CLEL 3RP1A 4PJXA 1OAKL 2Z92A 2ZUWA 4Z7WA 1FORH 3O8XD 3RZWA 4WEMB 2VDPL 4AY0A 5HXMA 2FR4B 3SCMA 1H0DB 3A6BL 3MREB 2FO4B 5HI5D 4JANA 2VLRA 4LLYA 4KKAC 4AQ1B 2FEEL 5AZEH 1EK3A 3MUGB 4U1NB 3LS4L 5JR1L 3QG7L 3QXDB 1NEZG 4FQCH 3ZTNH 2ICEB 5CJ5A 2AEIT 5AZ2L 1ZEAL 3GI9H 2Z93B 2W38A 4KK9D 3QHTC 3PWPE 1MJ8L 2I60L 3F58H 3ZDXE 1MI5B 4MMXC 3MYZA 1I9IL 2ERJB 4P2RD 2QKIA 2FJGB 2IAMA 4PJGB 4RFNC 5BRZB 5L8KB 2MFNA 3ULUC 5C0GA 3MODH 2ZZUT 4LVHB 1T04A 2R1XA 2ZUQC 3O6LH 2HKHL 4DGIH 4AG4L 4N1EA 5F7NC 3LQAL 5D72H 2HMID 1E6JH 1U8JA 4LBEB 1JN6A 1OSPL 3VCLA 3ARUA 4NNYB 5HI3D 3TEUA 5ACZA 4X6EB 2XRAL 5ISZB 4K8RD 3DRQB 1I8MA 1A6WH 2FEEI 1Z3GH 5CZXC 3FOMB 1AGBB 1BAFL 3GMNA 5IF0A 1G7PB 1OHQA 1J88A 4PGEA 1DCLA 4J3TA 1URLA 2X4UB 1XIWC 4PJ9B 3EKCA 4HH8A 2YD7A 1QEWB 1JRHL 2VXQH 3C5ZB 4ZPTA 3PL6D 2DRUA 3BZEB 3DX7A 1FE8L 5B21A 2Q6WA 3ZLQC 2Z91A 3V6OA 1BOGA 4TOYH 1D5ZB 1JZ6A 3DPBA 2HYMA 3H9ZA 3C8KB 4EI5B 1A14L 2YS4A 5BVPL 1OT1A 3C6LB 1FO0H 3Q3GB 3O9WD 4HJJL 4XPTL 3TO4C 1INDH 1R24B 3NCYP 1JYWA 2YD3A 3C8KA 2H9GB 1G6RA 4KK5C 1HEZB 4Z78B 3W11D 2CUIA 5EBWA 2Q7YA 4Z5RB 4JFFB 1FG2B 5ADPL 1IVLA 4UT6L 1KJMA 4HQQH 2LU7A 3OKMB 4N0CD 4HX1B 4A6YL 1ITBB 1RZFL 1V7ML 5KVFH 3FRUA 2R1YA 1BVKA 3VFPA 2Y4SA 1S9VA 5BRZD 2QSCH 2EDNA 5EZIL 3MUHL 5I15H 1YJDL 1GSMA 1GC1C 1J1OH 4TULL 2NY4D 1ZVHA 3HLAA 2DL2A 4HUUB 4LSTH 5I1JL 1CDJA 5I0ZA 1MCCA 5TQ2H 1Y0LB 5TE7H 4NNXA 1W0WB 2VXSH 3MNWA 5JHDE 2SEBB 5FM5O 1OAUH 3KPSA 4JR9L 5DD1L 3MO1A 2NY5L 4IDJL 1CD1A 1P5VA 1A7QH 1E28A 1H3PL 3ARED 2GTZA 2PO6D 2L7JA 1EHLH 2WQ8A 2DDQH 5K9KB 1HQRA 4PS4L 3UCRA 5DUML 4KI5E 1M4KA 2YWZA 4KU1A 5FOJA 1U3YA 1RJCA 4XI5D 2HTKD 5H94A 4HGWB 4JM2C 1RJYA 3PGCA 3V2AR 3W9EB 2LTQC 5HI5C 4GXVH 2NY1D 3RY4A 1OQOA 2VQUA 1FO0A 2DQDL 3WEXB 3NABL 3B9EA 3Q3GA 4FG6D 2DBJA 3V7AE 4P2YA 1H5BC 1UCBH 1WIOA 4G8GA 1MRDL 4XCFL 3T3ME 4I2XE 1I7ZB 2CDFA 4R6UA 4MJIA 4L29A 3P9LA 1OSZB 1JGDA 1EUUA 1JF5A 4KROD 4KGLA 5BOPA 5C0FA 5E08H 2IWGA 1ULVA 4R7NA 1FFNA 1F3JA 1U2CA 5J9PB 1P4IL 4JFDA 3TWCH 3BQUC 25C8H 1RZGA 4BK4A 4UQ3A 5HDBE 1CBVH 3HC0A 2X1QA 2DKMA 4R0LB 4HLZH 2XN9E 2WIMA 2V5MA 3NA9H 3QXTA 2CDGB 2WWKT 2Z35B 3QEHB 4K7PL 2XICA 1CG9A 1CD8A 4CKVX 5D7LA 5DK2A 4HCRA 1JF6A 3LKOA 5C0BB 4MJ6B 4P2RB 2XN9D 4H1LA 4Z7QF 3KYMB 3UO1L 43CAB 1CGVA 3BAEL 3FB7B 1MLBB 3BKCL 5TPWH 5CZKA 1QHOA 3VG9C 3OAYK 1OP5K 5C1MB 4XVSH 1P9MC 1XGUA 1X9QA 3BQUA 1IAKA 4HZAA 5D7SH 4IOFC 1MFAH 5GGTA 1EX0A 4YBQD 5DSCB 1OTTC 4LAQL 1RPQA 1LDPH 2LV4A 4OCSL 1V3KA 3MV9D 4GQPH 3KVQA 3K1DA 1Q0XL 4JFEB 2NY3D 5LGJA 4I5BB 1EVTC 4ZUUB 3OKLB 4OZFB 4G8GE 4WFHE 1YDPB 3M8OL 4Y5YB 1DTUA 4FQQA 4G43B 4O02L 1LMKA 2P8PA 5EULV 3FKUS 3RNKA 5ITFA 4RAUA 3OKLA 4OZFA 4NC2B 4DUVA 1QFUH 1JV5B 4NOBA 4PJHA 5DRXA 2E27H 1DN0A 2ADFL 2IC2A 3AXLB 3DJ9A 3VXPA 2ZUTA 1JCKA 4HIHB 1EFXB 4RIRB 4MNQE 1MCHA 2RBLA 5KVGL 4OLEA 4TVPL 1U3HC 4D8PA 3LN4A 4PJIA 1AO7A 3IFNH 4LQFH 5JDSB 3VGDA 1T0NB 3DXAD 5E1AA 5GHWL 1T20B 4CADA 4LAQH 2HH0H 2P5WD 2YPKA 4PJBA 4D8PB 4OLWH 2J4WH 2QV2A 5EOTB 4F58H 1ZGLA 3ARWA 1RJLB 4H1LH 3ZKQD 1INDL 4ZQKA 2H32A 2VDRL 4FXGA 4MVBC 5EUKA 1J1XL 2VC2L 1BVLA 1YQ2A 1JPSL 4NCC2 1U95A 3SDDD 4DFHA 1K4DA 1AXTL 3MRQA 1VKXB 2YKLH 4S1QL 2JIXB 1N26A 1G6RH 1CFVH 2JJWA 4RGOH 4JDZA 3TBTA 5J1AA 2D31B 5H2BA 4P2OB 1EBAA 1AQKL 4X8JB 4POYA 2EXWD 1MVFA 1T0PB 1YECH 2F5BH 5FCUH 1GYAA 5ADOL 3HE6D 2FH6A 2C3VA 4ZTPH 1XH3A 2Y23A 2ZSVA 3BSZL 4OGAC 2VISB 1T1YA 4MJ2A 3TH2T 3RZCB 1GGIH 4U1JB 4NUJA 3TVMA 4HUKB 5CAYB 1EO8L 2BVEA 3S97C 4OCLC 4JFHD 4K3DH 4UU9A 3PGDB 1FNFA 1T7WA 2VZUA 3FONA 5TDNB 4GBXA 4Q6IC 4G8GB 4GLRH 3R1GH 5DD0H 3SKUD 2P5EE 4O00A 5EPMA 1AJ7L 4OCMC 5SWQB 5SX5H 5C0GB 5T1LB 3ZDXF 4LRIA 1C8PA 3PJSA 1NBYB 4NO0B 1DQML 4Z7VB 5I1LA 4IS6B 4XVTH 2LE9A 1LO2H 2ZUQB 3GSWA 2BNRD 4OZHF 4NQCD 1MCNA 3VGFA 5BV7H 4UQ3B 4WW2A 3G6DH 1QSEA 4JZJB 1QBLL 3BP5B 4JO4H 5T5FL 1QFWL 1Z0MA 2A9NH 2J6EA 4HMDA 1E4XH 1T0MB 4DKEL 1J8KA 2HJLB 3EYOB 1HHGA 3UJIH 3FOMA 5H8DA 1OAQL 5IB2B 1J5OH 4MCYB 4NO2B 3WUWG 1M71A 7FABL 5F7FA 5I2IA 4JG1H 2RGSA 4I18C 1CLOH 2GTWB 3DUUB 4GQ9L 2PYFB 5JOEA 3L3OA 3WNLA 1CL7H 3SDAC 3ZYJA 4OLYL 4CGTA 1MIMH 3SDCA 4ZUTA 3QIBD 1RZFH 1V7MH 2AXFA 5IHZB 2HVJA 3GJFA 3O9WB 3WIHH 4H88L 2DQFB 3V5KA 4MSWB 2NY2D 3TGXA 4K3GA 3HMXL 3ME0A 4CBPA 2F53E 1CXHA 5F9AC 1D6EB 4TVSa 4FXKB 5DYOA 3C5ZD 2HP4A 4EUPH 5BS0A 3UJJL 1OTSC 4N0UA 1HI6A 5C09B 1U58A 4IDLA 3HPLB 4PD4K 3V5HA 3R06B 3TJHD 3PWJB 4QXWA 4LIQE 3FO9A 3S9DB 5KG9B 3OKOB 4MA1C 3LEXB 1R5IB 5JZ7D 2E9JA 4HCRL 4JLRA 1QBBA 4XNUH 5DK0B 5JORB 3NIFF 3PABB 1KPVA 1K4CA 2NY2B 1FZOA 1OP9A 1F3DH 3RA7H 4BH7B 3V4VL 3PE9A 1X5JA 5E2WL 4HFWA 4MJID 4XNXL 4NQED 5EC2B 1KTLA 1FP5A 3UYRH 1HOCA 4PP1C 5D1ZD 2NY0C 4FXGB 1RAMA 2WINA 1JGVH 2NXYD 4IRJC 4MQTB 4WHYH 4Z7OE 1TTGA 1H3WM 5F6HI 3HE7B 1P1ZB 1K6QL 4RFEB 1XCTA 1FCCA 3PWLB 3TBYB 4PJ8B 5BV7L 2X4OA 1P2CA 4YUEL 4Y4HC 3DETC 2ATKA 2X70A 2AEQL 1CXIA 5IMMA 2FHFA 1ZA3B 3IJYA 5HYJE 3C8DA 2CK0L 3TT1H 2WV3A 4UZGA 4J3UA 4QHNA 4U1SB 4Z7WE 3R0MA 3KLHD 2CK0H 4HWBH 3KPSD 1I9JH 1BREA 1UB6A 4P5KB 3S35X 4RA0C 4BQBA 5ESAB 1MCBA 4PJEA 1AR2A 2BOCB 3Q6FB 1XCQB 1ZEAH 4XCNB 3UTTB 1KJVA 4OCNC 4YHNA 4L1HA 4P2QA 1QFWM 1SYVB 4YZFE 3PWUA 2XN9A 4BQ8A 1QA9A 2OBGA 1ZHNB 4Q74A 3NA4A 3HRZB 5AZ2H 1G9NL 2BCKB 3CFBB 4QTHA 4EIGB 1AGCB 3VCLB 4HC1H 2P8LA 4Y4KA 5EUOA 3RJDA 4FG6C 2OQJA 3U30C 2W0PA 3QRGL 3RU8L 3VJ6B 12E8H 3PHQB 1FL3A 1QLRB 3T4AA 4J1UA 2EE2A 2WM0A 4JCLA 3TBWB 1NKOA 5DQJB 3MBEB 4JY6A 1OGAA 3RTQB 3LRGA 2C7UA 5L2KB 5AYUH 1GC1H 5GS1B 3RGVD 3QHZH 3RWDB 4P2RE 1UWXH 4F7MB 1IGCL 3QEUB 3RJQB 3P0VH 1IC5H 1BQSA 3MGAA 4U1SA 2P1YA 4HV8A 5C0IB 3VXSA 1BIHA 3B3IA 3O2DH 1OD7A 3ARBC 2XWBB 2BSRB 4WI4A 1YEIL 3REWA 2V5TA 5H37G 4TSCL 4ZDHA 2R2HB 5L2KD 2F5BL 1E4XI 1LP9F 2YC1A 3GJEB 3VXUD 2IAMC 1OTTD 3TF7C 4OZGB 2HTLC 3DX8B 1C7TA 2A6KB 2AGJL 5C8JA 1NKRA 3E3QC 4OLVL 2Y06H 4NJAL 4X99A