5BS0D

Mage-a3 reactive tcr in complex with titin epitope in hla-a1
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
197
structure length
197
Chain Sequence
AQEVTQIPAALSVPEGENLVLNCSFTDSAIYNLQWFRQDPGKGLTSLLYVRPYQREQTSGRLNASLDKSSGRSTLYIAASQPGDSATYLCAVRPGGAGPFFVVFGKGTKLSVIPNIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords HLA class I histocompatibility antigen, A-1 alpha chain
publication title Direct molecular mimicry enables off-target cardiovascular toxicity by an enhanced affinity TCR designed for cancer immunotherapy.
pubmed doi rcsb
source organism Homo sapiens
total genus 31
structure length 197
sequence length 197
ec nomenclature
pdb deposition date 2015-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5bs0D01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5bs0D02
2EXWC 1SVZA 5C09A 1ADQL 4LAQH 3GMLB 3FAWA 4NZUL 1RZFL 1FIGH 4L4VA 4ZUSB 4U7MA 2R29L 4D9LL 5ID0A 1RK0B 1XCTA 3QCVL 4ZPVB 1IBGL 5B39B 2XPGA 1EJOH 2PXYA 5TGBA 3UZQA 2DLHA 1U8QB 4OIBA 2OR8A 5MEOA 2DI7A 3P0YH 4XCNA 5IBUB 3FJTA 5DWUL 5KS9A 3ECBB 3QUZD 4HH9B 1I3RA 3C5ZD 2FR4B 1TJIL 3HE6D 1AXTH 4MJID 5GJSH 2ZSVB 3OKEA 4ODHH 4MAYA 1K4DA 1NFDF 1VFBA 4U1MB 4EN3D 1HNGA 2JF1A 5HYJE 3Q5OA 2NY6D 1X5IA 3VWJD 3SDDC 2A6KA 3G6JF 2FJFB 4Z7VE 3VXSE 3V0WH 2DKMA 2YPKB 1U8MB 4ZS7H 3VRIB 1OP5K 4OZIB 2DQEL 1RUPL 3CH1A 3KVQA 5GSRB 4H88L 5EU4B 3UJJH 5FYLH 1U3HC 5FYKL 4CMHB 2H32A 5EPMB 4RGMB 3ZT6A 5L7XL 1U2HA 5FO9B 1YNLL 1G7JB 3U46A 1HKLL 4ZNCD 2KQNA 4APQD 5I1EL 4JG0L 4XP6L 5J13B 1G7HA 1ZA3B 3MRKA 3LOWA 2EZ0D 3O4LE 3NVQA 1SMOA 4XHJD 5T33L 2P5ED 3MRPB 3MOAL 4JFFE 3GSRA 4U1HB 5CILH 1M6OB 2PTTB 4MJ4A 5LXGL 1AQDB 2P48B 5KANI 1A7OL 3LKPB 3HG1B 3KPQA 2GKIA 2P5WE 5DQJB 4KJWC 5EO9A 4R0LA 3TIEB 1KPRA 3MOQA 4QXGL 1A1MB 3JWOL 2HT2C 4Y19A 4NBYB 3QIWB 1Y18B 2DD8H 2YUZA 3EJYD 1T7WA 1LQSR 8CGTA 2K9UA 4X9IA 3LS4H 3EYUH 1IAIM 43CAB 2ICWJ 4IHOB 5T3ZH 4Z7WF 3MLUH 3VXRD 3HNVH 5CBAA 4TVPE 1QBBA 1I7TB 2WBJD 1PKQE 1UGNA 4NKMB 4JLRA 3ROLB 5DRWA 4PD4K 4U1GB 4MNQE 1D9KB 3KPPA 4PJ8C 1MCJA 2EEDA 2EXWD 4F7EB 2JCCF 3P4NA 2CDFA 2A73B 3MLWH 1NC4B 1BX2B 4TNVK 4QXWA 2R39A 1YMMA 4P57A 4I4WA 5I6XB 3FFCE 1WZMA 3WN5A 1J1OH 3OPZH 4IRJB 1TZGH 2JJWA 1J0HA 2X10A 1NAMA 1OWWA 3CMGA 4Q6IA 4XP4H 2VXQL 2F19L 2B39A 3LDBB 4YE4H 5KAQF 5GGRY 3V7MA 3KXFA 1JWMB 4PJIA 3SDDD 1E4XL 2GJ6E 1N2RA 2MQ0A 3IF1A 4PLOB 1Q38A 4Y89A 5KOVC 1EPFA 4NHUA 3RZCC 3VFOB 3DXAB 3ARDB 3S3PA 1MCKA 3MV9E 4TUKL 1J05B 4PJXE 4ODUB 1FIEA 1JTTA 1U3HD 3D5OF 4WV1B 2IG2L 4KK5C 4U6YA 5C08E 1XIWA 1VFMA 4ZXBB 4FZ8L 3LD8C 4G9FD 4R4FH 1X5XA 4AMKL 2R69H 1DQDL 4LSRH 4O02H 5DJCA 1J88A 1HSAB 1T80A 4R4ND 5EOTA 1F4XH 2IMNA 5HI3C 4MA1C 1KN2L 4WHTA 4PGDA 5DS8B 3RUGB 1CQKA 2EDHA 3FB8B 2FBOJ 1J0IA 3ARZA 4W4OC 5FUOL 3IGAB 4ZTOH 3KYMB 3NCMA 5MERB 1QBLH 2FSEB 1VFAA 4HUWB 4AEFA 1G1YA 1CU4L 1WT5C 5E0QA 1F8TH 3D3VA 1ZLVK 1IAMA 1HILA 2BSSB 5ACLA 3MJ7B 3IAQA 1DQTA 4AM0A 4D3CL 3MUZ1 3NMEA 3TVMA 3TO4A 1SBBA 4KJWD 3BPNC 3EIFA 2UYLA 3ARPA 4ZAKB 4X9BA 5BS0B 4R7DA 4PV8B 1A6AB 1JGVH 4EI6B 1UACL 4MDJB 2HT2D 3U36B 1FLRH 1D6EA 1SEBB 2VLJD 5CKGA 3TBWB 3DV4A 4NZJA 3MNWA 5DQ9A 1V7MH 4B53A 3IAGC 1DE4A 2NX5A 5DFWH 2E3VA 3SDAB 3OKLA 1U8PB 4PJ7E 4PJDE 3CXHK 5JHDE 4U1NA 4Y5YC 3D39E 3DV6A 1PLGH 2ATKB 1Q9KB 1JK8B 4MHHI 3X12A 5ICZB 5SWZD 2ATPB 1MJUH 3U4AA 1A6WH 1J5OH 1JUFB 3BGMB 4L8BA 3GDBA 4GG6E 5B38G 4JEGB 4PJ8D 3V0AC 4BZ1L 1TENA 4HIEB 2EDKA 3O11A 2XN9B 4YHKH 4GMTL 4H26A 1MAKA 4LLQB 1M7DA 4YBLB 4CVWA 4X6EB 1U8KA 5E4EB 1B3JA 3MLPA 1FBIH 4LQFL 5KN5B 1TXKA 4M93B 2C1OB 2FJHA 3L1OH 1RAMA 3CCHA 4JHBA 5FKPB 1BGXL 4ZD3L 1JGEA 2ARWA 3FFDB 4P2QE 5B3JE 1BVLB 4FQ2H 2X7LA 4WTWA 5B4MC 2DTMH 2B2XH 3OJMB 4QOKE 2AGJL 4YEFA 4M8QB 5CUSH 2GTWA 5IHBA 4OKDA 4GOSA 1DJSA 5E6YA 1C8PA 1EK3A 4ZSOA 4QYOB 4XGZA 4HQQL 1FFQA 3QFJB 1HK6A 5TE6H 3DSFL 1F97A 2Y06H 5L0QC 3GJFH 2Y7QA 2BFVL 3GKZA 1MRFH 3GHEL 1ZGLA 3RZCD 5I1DA 2YZ8A 2DAVA 1BREA 3DVGB 4QRUB 4KVNL 4I77H 1ZVYA 1JN6A 1TTFA 4OTXL 1KYOJ 1OCWH 4WHCA 4FFZH 4KK5D 2AEIT 2V7HA 4DKAA 1HHGA 3WEXA 3DLQR 2EYTA 2CLRB 4X5XB 5E08L 3KPSA 5I8EA 2NTFB 3WNLA 1B90A 3FO0H 3EAKA 3SOBH 3AS2A 3JUYA 1T0NB 3WFEH 5F9JB 1A2YB 5HI3D 2IH3A 3CSPA 3ZL4H 4HGKC 3QH3A 3VXNB 2IBBA 4NQVA 1A4KA 5C0EA 1CL7L 2EC8A 5HHVH 3JTSA 1KCLA 2F74A 1L4IA 2BK8A 4JO1L 1QFWL 4PRHE 4U7SA 4ELMB 5KVGL 1FYTA 2VN7A 3B9AA 5GSVB 3VJ6A 4U4BA 3IETB 2DQIH 4UDTA 5T1MB 4F7MA 1DUZB 1YMHA 1T22B 1E4WH 4OLUH 3TIDA 5MEQA 3MRJA 1BQHA 3O6KH 3FCTA 2IANB 1AGFB 1EGJL 1PX3A 3S98A 3RA7H 1HQ4A 3SKMB 1BQSA 3O0RL 3X17A 3GMQB 1JZ7A 1OWRM 2HLFC 3FT2A 3CFKA 3UC0L 4CN4A 2G2RB 1MCLA 3CZFB 2IQAB 1BBDH 1YC7A 1DSFH 3MYJB 1ED3B 4H5SA 4PRDA 2P8MA 5CJXA 1BP3B 1DANU 4BQ6A 5IIEA 3N06B 4YH6A 3BP4B 5EC2A 1KC5H 1NBQA 2AK4A 3JWDC 3OWEA 1ND0B 1NGQH 4W6WB 1FZOB 3GZKA 3H3KA 1LEIA 1I1YB 3QXAB 4JZNA 2D7TL 3MPCA 4NQEE 1QSED 2VLMD 1F4WH 1KB5H 3WFZA 5TE7L 5KTEH 1FRGH 4U1SA 1R5VB 1R3HA 3S35L 3VG0L 1OY3B 3LS5H 1KXQE 5GGVY 3IJHB 3VE0A 4P2YA 2QEJA 2YWYA 5I17B 3OKMB 1S9VA 5ISZA 2EDYA 1I1FA 4G8GB 4Q9RH 3MRCB 1T83A 2VO5A 2G9HA 1C5DA 3R0NA 2ZWLT 3HUJE 4Y5VA 3WD5H 5TPWH 1K85A 3UTQA 4GQ9H 2VERN 4LLYB 4MNGA 5DJ2A 2DF3A 3MXVH 4JQXA 4OLWL 5DFVC 5I1CL 2OXHA 4NN5B 4X5LA 3RNQB 1AD9A 4GKOA 2XIDA 4YDJA 1PY9A 2G75B 1N64H 5BXFA 4I3SL 3Q1SH 4NNXB 1CLZH 2A9ML 3IDGB 2F54A 2A6IB 4NPYB 2EDOA 4OCLC 3CD4A 1F58L 2CKBA 4WVRA 1E4XI 1YN7A 3FQXB 3GMPA 4PRIB 2X4QB 1RD6A 3MRFB 2D0FA 3L95A 3GBML 4NQDE 2AQ1A 3HNSH 3EYOB 2ZNWA 3DBXA 2PYEA 3LKRB 1QYGH 5IVZB 1AE6L 1FO0H 3O3UN 5MEPA 4AQOA 4ZFFA 1T0MA 5D7JB 1VDGA 1R3LA 1WC7B 4AG4H 2VLRE 1OGAB 4P2RA 5DJZB 1ZLUH 1UKTA 5K9OA 3EZ8A 1BPVA 5CSZA 4JN2B 5IW1B 3NIDF 3ARGC 1ZSDA 4M7KL 5EOCL 2ZJSH 5F96H 3EO9L 4PJFB 3LKNB 2PKDA 4PGCB 3MRRA 3U1SL 3WO4B 4N0YL 4EXKA 2B0SH 1U91A 2WLYA 3EYSH 3B5HA 3U6RA 3O9WB 4MX7B 2UWEA 2ENYA 5JPNA 1LD9B 5DF0A 3T77B 5D8JL 5EU6D 4A6YB 2BVQB 3GKWL 3NABH 1S9XA 1L7TH 1PAMA 2IAMB 1NEZG 2BVYA 2HLFD 4DUWA 1HZHH 3AB0C 3AM8A 4NQSA 3I84A 2VITA 1NEUA 1R0AH 4L5FH 3I6GB 4R2GC 3T0BA 5ANMB 5JW4M 5CD3A 1EAJA 5ACZB 2V5SA 2YA2A 5E9DB 1CF8H 4PLKC 1ES0A 4UDUA 2XQYK 1IKNA 2W9DH 4G7YL 4K9EH 5JA9A 5CKAA 1XCQB 1J8HD 1YUHA 1DBKL 1O5DT 4NQTA 4MCYB 3NPSB 4LLUB 4M5ZL 4NIKB 4GQPH 3T0EC 1ZHBA 5DGQA 4G7VH 2Y9RT 3S5LG 1ZVHA 1FFPA 5DTFA 2HG5B 1OSPH 1NCAL 4WEBL 1J9CT 2DIBA 4N9GA 1JHLL 1OHQA 3LPFA 1MLCA 2CR3A 2V9QA 4AEHL 4LVHB 1DQLL 1JWUB 3R06B 2YS4A 1F6AB 4YHLH 1XF3B 4P46A 5IEKB 5DFVD 4K2UL 3U0TB 1FFNA 4DEPB 5ITBL 3LKQB 1Q9OB 2W1NA 4WI7A 3W39B 4TPRL 3BMVA 3U9PL 1T5WB 3BXNA 1EERB 4AJ0A 1BJ1J 4LPTA 25C8L 3N9GH 4H25A 3H3PH 1CLYL 3SY0B 3TM6A 1DL7L 3QHFL 1CDHA 4DN4L 3QXDA 3OAUL 4EIZC 3U7WL 3SPVB 5IB2B 3PHOA 5IOPA 5IFAL 5GGSB 1WEJH 2OL3B 4M8VA 4G8EA 4OD3L 3PGFL 1KYOK 4YGAB 1ZT4A 4LSTL 4GXVH 3QXUA 5I8KH 1EBPA 5FHAH 1P2CA 4Y4FA 1JVKA 3ARGD 4OI7A 3B6SB 5E2UL 1JYNA 2QSQA 4N5EC 5JQHC 4RQQB 1CE6A 1CL7I 4OF8A 4YK4C 1QFWI 5ESAB 2YD3A 1EVUA 1CBVL 2YWZA 2F5BH 4RFEB 4X6FB 2NMSA 4RMRA 4YHYB 1UXWA 2Q86B 3GK8L 2VUYA 4Y4KA 4JKPL 3FB6B 3VFWB 5HYJA 1WWAX 1KCSL 2ZG2A 5T1LB 1GL4B 3PDOA 1JNJA 1VFOA 5D5MF 4Z7VA 4LHUD 2F5AH 3VXSA 2H32H 4JREC 2EDNA 2EXYC 4HBCH 4Y4HA 5GQBA 5I73B 4L3AA 2HFEB 3RWHB 4R2GD 1BFTA 3CSBA 2DICA 2XZAL 4BJLA 4XPGH 3ABZA 2IPUG 3GSUB 1HNFA 5I1AA 3ZTNH 5B38A 1I8KB 4F33B 3DI2B 4KTEL 3ULVH 5JZ7D 3T0ED 4OCWL 4N8PA 3HFML 4K3JL 4L1HA 3CK0L 1TJHL 2E7MA 2A38A 4XNYH 3WUWG 3O41A 2ADIB 3MJ9L 4L3EE 4NYLA 3O4LA 1T1YA 5BV7H 1U3ZA 2Z92B 4N68A 1ZLSH 1SEQH 4HJGA 3KDMB 4JFFA 2QADB 4FXLA 3O8XA 4YHMH 1SJXA 2ZUUA 3T4AA 4S1DC 5GRZA 3BAEH 1AKJA 4UNTA 4YXHH 4DCQA 4NO2B 4U6XA 5HVWA 3WFDH 5GHWH 5IMKA 1IJ9A 3SE8L 2AK1H 5DJ8A 3MTRA 3D25A 2P5WA 1OOAA 3JSSA 5C0DA 3OSKA 4I0PB 4TSAL 1IARB 5C0GA 4ODVH 5FA3B 3SDXB 4BFEA 2HRPH 2FD6H 4LK4A 1Y6NR 3BN9C 2J6EA 4KI5C 5FDYA 3JVGA 3FZUD 3UYRL 1K5NB 1MJ7L 3P9LA 2C7UB 4KRPB 3I6KA 1BAFH 2X4SA 4HLZG 4WFEE 3SCMA 3NCFB 4D9QE 1BFSA 5JOPE 1Z2KA 2F15A 3W0WE 4XI5D 3V9FA 1UB5B 5K9KA 2NLJA 5HGBA 2B1AL 4CKVX 1MHPL 2IALA 4IRSB 4BK4A 4LFHD 1KELL 5JPMA 5JNYA 1WZ1L 3EYVB 1XR8A 4IOIB 2Z31B 3AUVA 5F6IB 1QR1B 2YK1H 4X9HA 3BH9B 2ESVB 2GITB 4GT7A 5IJVB 4N5ED 4BYHA 1GZQA 2AAVA 5E94B 4E0RA 3FFCA 2E6QA 4RISH 4RAVB 1TZIB 2O5XL 1FZJA 2V2WA 4M7ZC 4N0CC 5IQ9A 5KSAB 1TCRA 4MQ7B 2YC1B 3IJYA 3NCJL 1PSKH 3CFDB 3BH8A 4CVUA 5IROC 4KJQC 4G5ZL 5D1QC 5I1HH 4OIAA 3SGKC 3VFUB 3HC0B 1BFOA 3U48A 2K1MA 3KPOA 4ODTL 1Q9WB 1KJ2B 1MNUH 3BEWB 5IF0B 3CFCL 1P7QD 4F37F 2R0ZL 3RDTA 4PB9H 2RFXA 1FL5B 2EXYD 1JMXA 3VXME 4C57C 5ICXA 4BFIB 4JPVH 4Y2OA 3K46A 5EA0H 3MLYL 3MV9A 4DTGH 3ALPA 3W11C 1IQDB 4PJXA 3QNYB 5IJKC 4ZUTB 1Z9OA 1HI6B 5C08A 4XVTH 4G80B 3OGCB 5LCVH 3SDCA 5FM8A 3DIFA 2VIRB 4LCIH 3C08H 4P2OA 4FP8L 3BHBA 1NGWB 3JZ7A 2EH7H 3MRGB 2VQ1B 3QUXA 5HY9A 1KLGB 4RX4D 1T66C 2O93L 2E7LC 3QI9B 5IHUL 2X70B 1I75A 3QUYB 4TUJA 2L7UA 4UTAL 1ZWIB 2YSSA 3QIWC 5J6HA 1Y6KR 3BUYA 4S1DD 4MQSB 3P11L 2J7LA 1P4BL 2BNRB 4TTDC 1OAUL 3RU8H 1B88A 1CFTA 5D7LE 4JFPA 3ZE1E 4G6ML 4NQXB 1QRNB 3L3DB 1RZ8B 1U8NB 3DX8A 1OQOA 4QHKJ 5LGJB 5HHMD 4BSVA 4OM0L 1FPTL 2P47B 1VGEH 2M1KA 2OI9B 1KUMA 1XH3B 2DL9A 4C56E 3QHTC 5EZLB 3BN9D 1E6JL 4KI5D 1IAOB 4PUBH 2M2DA 4XC3H 4YHOH 4X98A 4UOW0 1OT1A 5F3HB 2C5DC 4DAGH 1A14H 5I6XC 1UM6L 4WO4A 1BBJA 4GAYB 3VW3H 4K23L 3CFBB 3IXTB 4IRJC 4GG6A 4QRPE 4JY4A 5EC1B 2LAAA 4M1DH 4P59H 4LGSB 3K8KA 3SE4A 3L5IA 3D0VB 1A6ZB 2DQFB 1ZXQA 1CTOA 1N5AB 1G1CA 2D7MA 4PPTA 5H94B 3KNBA 1YN6B 1W0YT 1NC2A 3W9DA 1X44A 5F3BA 2DDQL 3AROA 3RX7A 4L4VB 3TZVB 1D5BB 5JW5B 4XAWH 3DJ9A 3UJTL 3U4BL 4D0DA 4N0CD 3UCRA 4NM8L 2D03H 5L6YL 1NFKA 5C6TL 1QQDA 4QOKA 4OLZH 4JFEE 4HEPG 4ZXBC 4ERSH 4KJQD 4Y1AA 5D1QD 4MD5B 5BRZD 3MRBB 1RZKC 1XF1A 4FQ1H 2WP3O 1ZS8B 2AJ3B 4XCNB 2O61B 1XZ0B 1MJJB 3WXVL 4KKAC 4YWGL 3UROR 5INCB 4J2XA 1MCIA 1NEZA 5A3IC 5INDA 3H7BA 4IRZL 3UAJC 4MAYB 1WBXB 3O3BB 3ZYZA 1MFDH 1LO5A 5J12B 3LRSA 1FZMA 4MWFB 3W11D 1V3KA 2A6KB 3ARBA 2R9HC 3K74B 4OQTL 1CXIA 3P4MA 2IPKA 8FABB 1K3IA 4OIIH 1H3GA 2L0DA 1AGEB 1CFBA 1VHPA 5D1XA 2EC9U 4XXCC 2BRRL 1KJMB 2BCKA 1JV5A 4R97B 4L9LA 3C9NA 4NRXB 1INDH 3B8SA 3GMNB 2OK0H 3P73B 3O45B 4M1GH 4OBSA 1T66D 3G5VB 3PWLA 4Z5RB 4ZAKC 4X4XA 2QHLA 2DQGL 4PRHA 2QTEA 2DQTL 1NBYA 5FKAB 2P42B 2HVKB 5DZLA 4ZUUA 1QPPA 1I4FA 5E6ZA 2XZQH 5FGCE 4O2CB 1AGDA 3CSYA 3SDAC 3L3HB 5I9QC 4OFYA 1EHNA 4TTDD 5GZNC 4I18A 3T2PA 2DQHL 1S7RA 4ETQA 4P5TC 3GSRB 3P9MB 4F37K 4N0UB 3FOLA 1R3JA 1KENL 4O2FA 1GGUA 3L5XL 1CDIA 1CFNA 5DD5L 2JTDA 1VEOA 1LDPH 4CVXB 5K9QG 1LK3L 3C6SB 4IDJH 3BYTA 3EFDH 4GW1A 5EO9B 5DMJB 1KPRB 2Q7YA 2Z8SA 4NZUH 1RZFH 4NN6B 2WIIA 3BRDA 4B0MM 3UDWA 2XTJE 2R29H 1SY6H 2W0FB 1LP9F 2A74A 2UY7A 4WUUE 4D9LH 3LQMA 3SGJC 3QCVH 4OCXL 5GIRB 4JFOA 5E00B 1NL0L 3MBEB 2A1WH 4IRJD 1INEH 2CUMA 4YIQA 4JFDE 1TDQA 4OF7A 4XMLH 5DWUH 4K7PY 5AWNL 4DOHB 1TJIH 4NQEA 1MHCA 4PJEF 5DRWB 3U82B 1MUJB 3PP4H 1MI5E 3KPPB 3V6FA 4YEEA 2J8OA 2GT9A 2HH0H 4ONFL 4N0FA 3MRNA 4AEEA 2ORBL 2CDGB 3P4NB 3B2UC 1YEKL 1CDCA 3GMRB 9CGTA 3CLFH 4BSWB 3HUJA 4X6DF 3QDGE 4KRNA 3UTZA 4BK5A 4MXVE 4NHCH 2AJVL 4R3SA 2DQEH 1RUPH 3F7VB 1RK1B 1YMMB 4ZXBD 3MGOA 2BP3A 1A3RL 5FYKH 2CKBH 3CH8A 4QGTA 2Y5TB 3K3QA 4OZIF 5DRXA 2AJYL 5F9WB 3FOMB 1BFVH 3GBNL 5L7XH 3I3EA 1YQVL 2DL2A 3PP3H 1H3XA 5A3ID 3T1WA 1NAMB 3UAJD 4Q6IB 4UINL 3WLBB 3KXFB 5LWYL 1HKLH 2VZSA 4JG0H 1N2RB 2JJUA 5JQ6L 1AY1L 2R9HD 4GAGL 1UZ8B 5MENE 1OQXA 4NQDA 3BPLB 1IGJA 4LBEA 5T33H 3MQIA 4F7PB 5DO2C 1QSVA 32C2A 3KPLB 3MOAH 4PGEA 3DYMA 4MD0A 2AV1B 3UMTA 1XIWB 4LVOB 3MJ9A 1JGDB 1L9NA 3BQUA 5EH1A 4ONHA 1A7OH 3WUWA 1SJHA 4ZAKD 2YD5A 1MLBA 4K8RH 4IMLA 4DGIL 1UXSB 4QXGH 4O2EA 4Z8FL 2CIIB 3SDAD 3WXWH 3DRQA 4WUKL 1SVCP 4OSUH 5GZND 4APQA 1UB6B 1VFAB 2VDOL 5FGSA 4P5TD 5DVOA 5D93B 1PZ5B 2EDWA 1II4E 4FRWA 4PBVC 3HZVB 4GG8B 5EU7E 4M61B 4PJGB 1OAXL 1YEHL 1FHGA 2WMPA 5AG8A 3O6FB 4EOWL 3HAEB 1KIUA 1EHLH 3TC9A 5MP6L 3QNXB 3S37X 1D6EB 3QCUH 4DVRL 1HHKA 4GLRH 1W0VB 1W72B 5EWIH 1FG2A 4KZEH 3L3GB 1BZ9A 1A1NB 2H2SC 4LEXL 3OKLB 4U1NB 1B2WL 4CW1A 4PP1C 2J8UB 4OAWB 5IVNA 3ESVF 4OFVA 4JAMA 2R0LH 4DUXA 4NNPL 5C0AD 3C5JA 3K2UL 2VXQH 2F19H 2QQKL 1EBAA 1QFWM 2OTUA 4HMEA 3O11B 4WJ5A 2NY7L 1LO3L 4WDIB 3B2UD 3STLA 1ZOXA 3ULUE 4RMSA 1U8KB 1MFAL 4E5XA 1ZLWH 2Q6WA 4K3DH 3LRGA 3VXOB 1K6QH 3MUHL 4F15B 5FO7B 4LVNB 5IBTL 1A9EA 4XPAL 4EEEA 2A6JA 4JKWA 1KIPB 1CR9L 4QHMB 1FL3A 1A1OA 5H35B 4FZ8H 2O5YL 4UT6L 3LN9A 1U42A 3LEYL 3J7HA 4AMKH 5D7JC 4U1JB 1DQDH 1LNUA 4QRRD 2IBGA 3KPNB 3BWAB 4QHLA 1KN2H 3ZT7A 3IKCA 1IGCH 1FJ1A 2NY5L 4K3EL 1H5BB 4OF3A 5F7EL 4O9HL 3HE7B 3LY6A 3RUGF 4JDTL 5DO2D 3WO4C 4YXKL 4WWKC 2UZIH 1CU4H 3BGFB 1JN6B 4HGWB 5AAWA 4I2XE 4P4KB 1QFOA 3OTTA 3C60C 3GI9H 1AD0A 5A16B 4L3CB 5IW6A 5K59E 3BZFA 5SX4I 2LABA 3QUML 2FYYA 4WU5A 3GRWL 4LSQL 1VEPA 4D3CH 1ZHKA 2IQ9H 1H3PL 2GCYA 4OCRL 3I6LD 4JQIH 2R2BA 2I9LB 2CLVA 3Q6GL 4S2SB 1JF1A 1P9MC 4NQVB 5ESVB 4XC1L 1UACH 4FQXC 1TNNA 1KLUA 2BHUA 3WS6C 5SX5H 3MR9A 5I19H 4LSVH 3B4NA 3LSOA 3TN0B 4H1LB 2I07A 4LU5L 2XFXB 4W6XB 3SDYH 3VJ6B 1IQWL 3OR7B 4I5BA 1DBAL 2ZCKL 4Q58C 1YMHB 5F97E 4FZEH 1JGUL 3NPSC 5HSFA 2OS7A 3B8YA 3KLAA 3BKCH 4GUPB 4M7LL 1B4RA 3WDIA 2VISB 5JOFA 4HFUH 4MJ5B 5IB1B 5FDWA 2PNDA 1GOGA 3BZ4B 3W2DL 1XGPA 1Q1JH 1U3JA 4AIOA 4J3SA 3TBVB 2VZUA 2HJLA 3G04B 2H2SD 5K9QI 3VGEA 3NTCL 1JF6A 4ZD3H 4PP1D 1NUGA 4UUJA 1MELA 4ZG1A 1R3IL 4OT1L 5CWSB 3QHZH 1A5FL 1I8MA 2AGJH 1IC7H 4PGZA 5E4IA 5HGDA 3ZSSA 1XFPA 3NIGF 4IIQA 5ID1A 4L3EA 3RWDB 4PJ9B 3SGEI 1XR9B 2OTPA 4LSSL 3RL1B 4NDMB 4JGMA 5GS1B 4XP9H 5EFIA 3MRHA 5E5UB 2BFVH 4PJ8A 4YJZL 3GHEH 1NBVH 3RWEA 5I8CB 4PJHF 4HD9A 2ERJB 1HN1A 2FHCA 4KQ3L 4E41D 3QEHA 4X6CB 5GS0L 4HSQA 4OTXH 3KWWA 3MREA 4HK3N 1X3DA 4M5YL 4QEGA 4YPGB 5E2JA 3AS0A 2J6EH 5D7IA 2FB4H 3HKFA 3OJVC 5D7JD 4MNGB 4NCDA 1EVTC 5EG6C 2W38A 3NH7L 1JP5A 3QCTH 3VFGL 1UKQA 4OQTA 3ZT5A 1OGAD 4UI2A 5TDOA 3VD9A 5I1GL 4PY8J 4ZYKB 1EXUB 5J9PA 2BNQD 4JO1H 1T89C 4M62H 4OD2B 1NGYA 3F62A 3QG6A 3QZWG 4OLXH 5EU5A 3ZDYF 4WWKD 1YN7B 4KGLA 3W0WA 1AIFA 4ELMF 4Q74A 3C60D 4XP5L 4U1LB 3I50L 4G9DB 5AYUL 2EKSA 2MCPH 2C4FT 5T3XH 3CX5J 4MMZC 1UM5L 5IMMB 2P8PA 4LLMB 1ACYL 1T5XB 3QR2A 4FFWC 3TGXA 3D9AL 3ZE0F 4PR5B 3ARUA 4FQXD 1XGUB 3AMLA 3UC0H 3QDMB 5C0RH 1G6RA 3HG1E 5L2KB 4OLVL 4P2RB 2XI9A 3VWKA 1PQZA 4ZUVA 1CGWA 3WNNA 2C26A 4FQHB 1RUQH 1A4JA 4PJCF 5FGRA 4IMKC 3ULUL 4W4OA 4NQCB 3MMEB 2Y07H 3BP5B 3MV7B 3U6RB 1BD2D 1BWWA 4BKLA 5J4MA 5J11B 3NZ8A 1FP5A 1T1WB 5C0NC 3KPMA 3MOBL 4H8WC 1D5IH 3M17A 3HNTL 5E8NB 3G5ZB 3WBDA 4YFLI 5BOPA 3BSZL 5TE7H 5F7HA 1RZIB 4KFZC 3OB0H 3S35H 3O3DB 1WAAF 2EIZA 4GKSB 1NPUA 4J4PC 5MI0C 2NY1D 1M1SA 3L3JA 4YAQB 3NIFF 5F44A 3BPOB 1KEML 2PW2A 2FCBA 5DD1H 1SJEA 5F72S 1M4KA 3LRHA 3H0TB 3CUPA 4IDLA 4OLWH 5KJRL 3S4SB 1TCMA 1NCBL 4XNZC 4I0PC 1C7TA 4I48A 4I3SH 2A9MH 5C8JA 1U8JB 2MTPA 5D9SA 2BC4A 3VGFA 2F53B 1BIHA 3D1MC 3PL6C 5GRVK 1T7XA 5IK3B 1UYWH 1MWAB 4JHZA 2XXMB 2OSLB 1C12B 3BT2L 5D7LA 3V6ZB 3A6BH 4PJAB 2QR0B 2IFFH 2XRAL 2C1PA 1UEYA 2SEBA 1DBML 5GGUB 1FORH 1S5HA 5F1OB 1NCWL 3MODH 4KJYA 1GC1C 4UT7H 2FJGA 3PUCA 3CVHA 3MGTB 4I13B 4ODWB 1DVFA 3REVB 5F6IC 4KHTL 5IHZA 2YD1A 1RIUL 1HH6A 5T1KB 1HHJB 4J3OC 1U95B 1KTLA 4BFBD 1CLCA 2VLKE 1C5BL 5C07E 4JRXD 1XMWA 4AZ8A 3EO9H 2E7CA 1RU9L 3JXAA 4NP4H 5ERWA 1YECL 4X5WB 2V5RA 4PREB 5D1ZA 4QRPA 3V95A 4GRLB 3ILPB 4YC2C 4LCWB 4C54A 2HWZL 1UKSA 5B39G 4Z7WE 3MLTB 5IOPB 5T1LD 1G9EA 4O51B 5D8JH 1DQJA 1Z3GL 1T7VA 1LEGB 3ARED 4EUPH 3GKWH 4JFXA 5IBUG 4FFWD 1P4IL 4F2MA 2BZDA 1DN0A 3GMMA 1S7QB 1MHEA 1Z5LB 1UJ3C 4M48L 1YY9C 1LO0L 1TIUA 3W9EB 1YEGH 4EQ2A 3OX8B 5BS0E 3OF6A 1LO4L 4JPWL 3R8BB 4FMKA 1OPGL 4YXLL 1BLNA 4OUUB 3TYGL 1QHPA 3IU3B 1T1ZB 3VFSA 4NKDA 4G7YH 4U7KA 2RAMA 3AMKA 2H8PB 3ZYIA 5C0ND 5CSGA 3D18A 3HI6H 4HPYH 4YZFF 1F45A 4S0TD 4HS6B 3AGVA 1I8IB 3QI9C 4F9LC 3IDXH 3EDDA 3N1PC 3EZJB 3PQYD 4U6HA 4Z7VB 5IMOA 5LAXA 4K9EC 3WKML 5EDXA 4J4PD 4BH7B 2AJSH 3GSNL 5EUOE 3MUY1 4IEFB 2XN9E 4LLDB 5E1HB 3V7AE 4I9WD 2A6DB 1KPUB 2APVA 1HXMB 4R26H 5GXBB 2WINB 3O2WL 5B38B 1CT8B 2V7NA 1QO3B 5DK0A 1FFOA 2AERT 3LAFA 4I0PD 4ZOEA 1MEXL 4NO3A 4DZ8A 5C2UB 3G6AA 2OI9C 3MRLA 4Q2ZB 3WKNA 5ITBH 1MHHA 1KNOB 3HA0A 3TH3T 3G5XB 5CJOH 3PL6D 3V6OE 3DVNA 4LSUL 3O4LB 3KR3H 4X8JB 1XF5A 1AI1L 1EFXB 2IGFH 4EQ3A 4AENA 2I5YH 25C8H 4KPHL 3L6FA 3VMNA 1DL7H 3PNWB 4DN4H 3S37L 1T21A 1QG3A 2BXZA 1LO2L 5IVXE 2XWTA 4ZUWA 4QTHA 1YPZE 2P5WB 2P8LA 2W9EL 2P5EE 3PGFH 2JIXD 3RY6A 3EHBC 3VD4A 4MAUL 2R2CA 5C0GB 3CXDL 4DGYL 2HKHL 4WUUA 3I75B 3P77B 2PR4L 4JFZH 4JRYE 3MGAA 5E2UH 3QUMA 1ETZB 4LL9A 5CP7B 1H3UA 3PWNB 4FG6C 3GRWA 3WS3B 2PXYC 1IM3A 2VXUL 1A6UL 3I6KB 1X5JA 2DYPD 3NFPA 1CBVH 2XA3A 2VABB 12E8H 1PKQB 4PIRF 2AW2A 4PYHA 4MNQB 3GK8H 5K9KB 4RGNC 3LHPL 4P9HL 5HGBB 2ZUQC 3L9RB 1KCSH 4MAYC 4D0BB 5JNYB 1H15B 1XR8B 3LKSB 5J12C 4CVZB 2CR6A 1YY9D 1N7ML 5FUCE 3QDGA 3L7FA 2I9TA 2R23A 4X0KA 2IANE 3CX5K 3RVXD 3WHXB 4NM4H 5E7FA 4G42A 2V2TB 2CUIA 4E0RB 2FL5A 1YYML 2XZAH 3C09B 3P0VL 5HVGB 2ARJQ 3VD3A 2BHZA 5E56A 3IJYB 5IKCB 2HVJA 1ZHLA 2HFFA 2ZP0T 4KKLC 3V8CA 3GMOB 1U2CA 2NY2C 5GGVL 3T08A 5LGHL 1B4JL 4WY7H 2DM2A 2GJ6B 1TJHH 3CK0H 1X5ZA 1S7VA 4NKOA 5KVMC 1NBZB 1ZKAA 2R4SL 3FTGB 1H8OA 3MJ9H 1YJDH 4MXWL 2FH6A 4OF5A 2WQRA 5C9JB 2JK5A 4AK1A 2BNRD 2MHAA 2L7JA 3ULVC 2C3VB 2XV6B 4OCSH 3UZEA 5AD0A 1DEEA 1M05A 1YEIL 2XT1B 4FQPA 1UCBH 1VPOH 3DRTA 4KY1L 4NKQB 4RWHA 5BV7C 1FGNL 4G8GE 3HC4L 1UZ6E 3BO8B 4NZRL 3ZKMC 5BCAA 2YPVH 1TJGL 3IFOA 1TNMA 4TSAH 4R0LC 3OXSB 4BQ8A 3OZ9L 5DVLA 1CLOH 2E5EA 4AT6A 3WIFB 3UTTB 1MOEA 1MIMH 2GJJA 3B2VL 4HKZB 5TF0A 3BUYB 5FCUH 3SDXF 2ADJB 1FL6A 3ARFB 3BIAX 3MBEC 1I1AB 3VXUB 4K71B 4QRQA 1NKOA 5B8CA 2Z91B 2ZUTA 3QDJA 2X1OA 4G43A 3DX8B 4PRIE 2X4RB 2B1AH 4PP2A 3MLXL 3UYPA 1Q94B 4H20H 1KELH 1WZ1H 3SKUD 1JI1A 3EHBD 3QWRA 4FQIH 1J1XL 1S8DA 2FHBA 1ORSB 5C09D 4FMFA 4BZ2L 4L4VD 1TLKA 1PX4A 5MHSD 3QZWA 4HCRL 4YHNA 4KXZI 4NRYA 3MX0A 1UWGH 1R3KB 4FG6D 1NH6A 4PJ7B 4PJDB 1T1XA 2PCPB 5JHDB 3DTXB 5I1LB 3D39B 2PXYD 1TETL 2G60L 1OM3L 2VH5H 5DJYA 1NJ9A 4GRWB 3K0WA 4WO4B 3WN5C 2UZXB 1G9NC 4G5ZH 4PJFE 4RGND 4JY4B 1FC2D 4XCYB 2PW1A 3A67L 3TCLB 4MAYD 4Q6IC 3K8LA 3RX5A 3S34H 2VC2L 1FAIL 4P3DB 1FV1B 2X4PA 5HHQA 2Y72A 3ME0A 4KK9C 2Y4SA 5F3BB 3MLYH 1K8IB 4KRMB 1K2DB 3OKNA 3RQ3A 1GVIA 4P2QB 4XXDB 4ELKB 1BZ7B 2XNAB 4QOKB 5DHYB 3RWCA 3HI5H 1XIWC 4PRBA 3ZE2E 3GJFK 5ANME 4KKLD 3QQ3B 2NY2D 1DDHB 3T2NL 5E9DE 3CNKA 4HF5L 2FGWL 1C08A 4JY6B 5HDQL 3C6LA 4HFWB 1LO5B 5GGRA 3L5WA 4UTAH 5EBWB 3INUL 5HHNB 2E8YA 1YDPA 3ARBB 4I2XA 3ULVD 4X83A 1IEBB 5KSBB 4JM2B 3QIUA 5CZVL 4X4ZA 4G6MH 1JV5B 4LIQE 5KVDH 2BNUB 2XZCL 4KU1A 3ZKXB 3TVMC 3ZKMD 1Q0XL 3UTPD 2G5BA 4UIMA 3S5LB 3TO4C 3BWUC 4LNRB 4OM0H 3SJVA 1FPTH 2VE6A 4HIHA 3U9UB 5HGHB 1PY4A 2KPNA 2EKJA 1MQ8A 3GJEB 4Z7UF 1ZGLP 4Y19D 5C3LD 3GIZH 1YYLL 1OAQL 3G9AB 2ZCLH 4U3CA 4HUUA 2RGSA 2YPLA 3CSYB 3S97C 5J6GB 4XVJL 1EH9A 1UM6H 2QQQA 4K23H 3R4DA 4FNLL 2VL5B 5F88B 3E2HC 2CJUL 2B4CL 3OR6B 5I18L 4L4TB 1NDGA 1I9IH 2VKXA 4KQ4L 1I9JH 4HX1A 5F7LB 1HINH 5D96B 5EZOH 2GFBA 2UV3A 5DD0L 1LP9A 2DDQH 3TNMB 3MNVB 3MZTA 4LKXB 2FIRT 4OGXH 3UJTH 1YMMD 4F15C 4ZUSA 2PO6B 5IESL 4DW2H 1AJ7L 1RK0A 1EEQA 4ZPVA 5B39A 3F58L 1CWVA 2Z35B 1U8QA 5D7KD 1I85C 4XVSL 1EMTL 4YWGH 3IJSB 3ECBA 3KXFD 4NQEB 3LMJL 4HH9A 1MHCB 2FR4A 4IRZH 4Q7DA 2ZSVA 4RWYL 5BMFL 4KK9D 3FQRB 4U1MA 3VCLB 4PLNC 2ILLA 5FYJE 5FYJU 4F8QA 5KOMC 4WCYL 5DMIL 1LK2B 1A7RL 3ZDZF 1CI5A 2FJFA 3IDMB 3HZKA 4U33A 1NDMB 4R3SB 2ZSWB 1XIWD 2VLME 4XMPL 4OZIA 2BRRH 3MGOB 3EOTH 5EU4A 5GSRA 1IRAY 1QOKA 3CIQA 5CEYB 4EDXB 2VDMH 3LB6C 5DRXB 1MCSA 3QAZB 1O7VA 3GSNA 4JO4L 3S9DB 5FO9A 1BM3H 1G7JA 1T2XA 3RHWK 4AEIL 15C8L 1IFHH 3NOIA 4J3VA 3THMH 2VXTL 1PG7X 3VFRB 3D3VD 1TTGA 1G6RH 2DQHH 5IJKA 4HPOL 4HZAA 1XF4B 3MRPA 4WW2B 4WEUD 4LPXA 3RWFB 1M6OA 3ULVF 4S1SL 1ZLUK 1N8ZB 1YNKL 3WIHL 3TVMD 4DK6A 3WLWC 5DD5H 3TO4D 1AQDA 1D5XB 2VLRB 5JR1L 3LKPA 3HG1A 4LLVB 3AU1A 2X4OB 1FNSL 3LN4B 5FO8A 4JB9L 3MV11 5DQJA 4FFYL 3TIEA 4O2EB 2R0KH 1OGTB 3REWB 1A1MA 2NX5D 4A6YL 3MCLL 1UEMA 1L9MA 4NWTH 4X4YB 5CJXC 2NY0D 1CFVL 3QIWA 4OCXH 1Y18A 2BSTA 1VB9A 43CAA 1C1EL 3DUSB 3SGEH 2HLAB 3L3IB 5LJYH 3I9GL 1MFCL 1I7TA 1EEYA 4NKMA 1G9ML 1D9KA 4Z95L 4X7FC 1HHHB 4LRNH 4ONFH 4CGTA 2ORBH 1YEKH 3K2MC 4F7EA 4P5MB 4S1RH 2A73A 2ESVE 3JV0A 4Z77B 1NC4A 2BOBB 1BX2A 3DOSA 4Y5VC 1J1PL 4G8FB 4CW1B 1H3VA 4EDWL 4D9RD 4JQXC 5E2VH 2AJYH 4X4MA 4JAMB 5TH2B 3FKUS 1QKZL 1P69B 5IM7B 4UT9H 1YQVH 4LIQL 1A7NL 3BEVA 4FQJH 1QBML 4DWHA 1CGUA 5LWYH 3X3GH 1EAPB 5JIPA 1IE5A 3CVHH 1JWMA 3NZHL 5KVFH 4JN1L 3ZKSD 5JQ6H 4JDZB 3MBXH 4P48A 5H2BB 4GAGH 4PJIF 1BECA 4N8CL 3DXAA 3ARDA 4PTUA 3OKDB 2V5TA 1A9EB 2RJMA 1GPOL 1J05A 2FEEL 2B8OT 4ODUA 4D8PB 3KPSD 2GTZB 3LB6D 4WV1A 2CUHA 4RFOL 2CGRL 1CN4A 2AXHA 2ICWI 1IAIL 5FF6B 2JB5L 3QIBB 5HBBA 2X05A 1HSAA 4PRNB 3K4DA 1FYTD 5DS8A 3RUGA 1XGTB 1BVKB 3FB8A 5I1KH 4WUKH 3IGAA 3I2CH 4FQCH 3KYMA 2OL3L 4Y7MA 5MERA 2VDOH 2FSEA 4HS8L 4HUWA 4Y2DA 2PUQT 2VKWA 4KK6C 2YN5A 2HN7A 2RQ8A 3BZFB 3EYQC 3WLWD 2BSSA 4WU5B 3JWOC 3MJ7A 4KWUA 2BJMH 3Q3GB 1YEHH 2R2BB 3QA3B 1RIHH 4F9PA 3AM8C 3BYYA 3LIZH 4EOWH 4NO0B 5BS0A 3JUZA 4PV8A 5HVHB 1A6AA 4EI6A 4DVRH 3T3ME 4MDJA 1SEBA 3LQZB 3TBWA 3RGVB 5FYJL 3N0PB 4XCCH 3X13B 4I5BB 1IKNC 5DR5H 5DK2B 3LKOB 4RDQF 2NZ9C 2AI0L 2AK4D 1WIOA 3O3AB 1X5YA 2ATKA 1Q9KA 1DQML 2BOCB 3GHBL 5IEHB 1JK8A 5ICZA 2ATPA 3PHQB 3KLAB 5HHOB 1GHFH 3IS1X 3HR5B 3TBYB 1JUFA 3BGMA 5JOFB 1IEAB 1WBYB 2QQKH 1DP0A 2BMKB 2N7BA 3TFKD 4HIEA 5CP3A 2XN9A 4JY5L 3W82A 4LLQA 4ZFGL 3STBA 4YX2H 1X7QA 5ISZD 4X6EA 5I16B 3KAAA 4V2BA 1V3LA 3PGDB 4KTDL 5KN5A 4CU7A 2C1OA 4TSCL 5FKPA 2H26B 3KYKL 4P46C 3FFDA 1IZJA 1NMCC 1BVLA 3IDUA 1A6TB 5DSCB 2O5YH 4UT6H 4HZLB 1YEEL 3LEYH 4E42B 2WP3T 5GGTL 5HGDB 3QEGL 5KW9L 4M8QA 4M6NL 3V6OA 1CD9B 3T0VA 2F54D 4LCYB 5FEBA 2NY3B 3DROB 4QYOA 1A6PA 2APBA 4MCZB 3QFJA 5FYKD 5EFIB 4NZTL 2NR6D 4M43L 5T1DH 2NY5H 4K3EH 2RR3A 4Z18A 3T0AA 2FBJL 4YUEL 1JPSL 3DVGA 5DEGB 2F8OA 4QRUA 3WO3B 3IKKA 4JPIB 3MLVH 3MREB 2ITDB 2PYED 5ESQB 3T04D 3QUMH 4HK0B 3HMWL 4UIKL 4LF3B 4LSQH 3T65A 4DKFL 2CLRA 3ALXA 4X5XA 1H3PH 1N6UA 3GBLA 4OCRH 2NTFA 4Q9BA 2H3NA 1T0NA 4JRYA 1YEFL 1A2YA 4P2RD 5F9JA 5TDOB 3VXNA 4DQOH 4Y4FC 2XYCA 1HIMH 3GNML 1AFVL 4F80A 4UQ2B 4ELMA 3CLEL 1PJ9A 3HRZB 1YZZA 5GSVA 3W0WB 2V5YA 4DFHA 1DBAH 1H9VA 3IETA 4KK6D 5T1MA 3EYQD 2Q3ZA 5HPMB 2D7OA 1KLFA 4HJ0C 1DUZA 1T22A 1FH5H 4Y4KC 3P3YA 2A9NL 3QYCA 4M7LH 2IFGA 5TF1L 5GZOC 3QXWA 5JHLH 1BJMA 1L0QA 5ADPH 4N0UE 3IFPB 1SYVB 2IANA 1AGFA 3O2DL 3SKMA 1KEGH 5ALCL 3W2DH 5GS2H 5L9DL 4U6VH 3GMQA 2F58L 4K7PL 4TULH 3RBGA 1CVSC 1TQCB 4OB5L 3CZFA 1CGTA 2IQAA 1KJ2L 3MYJA 1ED3A 3IDYC 2BVPB 5IBLC 1CIDA 1IM9B 2NZ9D 4EVNB 5T5NF 5EU3B 1A5FH 2A77H 1I3UA 5J57B 4QRTB 3BP4A 3NZ8B 1GOFA 3VXMB 1MRDH 3DI3B 1ND0A 3PF2A 4LSSH 5I15L 1FZOA 4F7TB 2VXVL 1WAAA 4DOHE 5ICYA 3QXAA 1JHKL 3WSQL 1FGVL 1R5VA 2EIZB 4Z0BH 1WGOA 5IB3B 3TT3L 2H1PL 3IJHA 3L3JB 3OKMA 1T03H 4G8GA 4P46D 1ERNA 3MRCA 1F6LL 1GAFL 4X6CF 4YFEA 5AZEL 4GW4B 4LLYA 4IBLT 3AC0A 4L8DB 4QXUL 5JDSB 3L7EB 3RNQA 2I60H 5DUPL 5TFSL 2G75A 5I1GH 5I74B 1OTUC 3IDGA 1N5YL 2A6IA 4NPYA 3JVGC 1RZGB 4LCWD 3FQXA 3SCMC 2DQCL 4PRIA 1D7FA 2X4QA 3MRFA 4XP5H 4ZNEE 1DUYB 1C5CL 5JXAL 1QPXA 1RSFA 1MFBH 3EYOA 4RIRB 5I76B 4RFNC 3LKRA 1JF5A 5IGXH 3FT3B 5IVZA 1NLDL 3MSPA 2LE9A 4C56B 2VUOA 1ACYH 2PN5A 1HH6B 3I85A 2J12B 1S7XB 4Y4FD 3PXHA 3JV5A 1WC7A 1RFDH 3FN9A 1IAII 4OLVH 1E27B 4UOJA 7FABL 5DJZA 2W92A 3V5KB 1I3VA 4F58H 5D2LE 5LBSL 4JN2A 5C0BB 5IW1A 1TVBB 3WIHA 5BW7A 3ULUH 1U8HB 4PJFA 1EO7A 3QUKB 3LKNA 1MRCH 3P9WB 4PGCA 4PB0L 4HKJB 2W0LA 4KI5E 4Y4KD 4FABH 5HYJD 4HC1L 2WLZA 4XP1L 4CMMB 2MQ3A 3O9WA 1S7TB 2AV7B 4MX7A 5HYFA 3G08B 1DQJB 1LD9A 4PJEE 1RULH 3RDTC 3T77A 4JFXB 4I3GA 3VXSD 4A6YA 4CL7A 2BVQA 4Y4HD 2UWEF 5SWQB 4FTVB 2YRZA 2YZ1A 3BSZH 2IAMA 5DMKB 4HUMB 4PJGE 1P9MA 3M45A 1OTTC 3Q48A 5EORL 1JNLL 4JFEB 2IWGA 3VGBA 1TTUA 3I6GA 1JNNH 3SDCC 1YQ2A 5ANMA 3NCYP 5ACZA 5E9DA 4QY8B 1A3LH 1CICB 1PG7L 4ZFZB 2UVEA 2WSKA 3P0GB 1XCQA 3FO2B 1KTKE 2J8UE 4HWBH 5DURB 3TO2B 4Q9CA 3S36X 4MCYA 4LLUA 4XX1E 3O4LD 5BRZE 4U6HB 1CZ8L 3FQTB 2HG5A 4BUGA 1IGFH 4JFFD 2FNBA 3O8XD 3MUGA 2J1KA 3ARFC 1AKJD 1I1AC 3S88H 2X1WL 1NAKH 1PZUB 1WUNT 4LLAA 1JTPA 1ONQB 4JDVB 3QPXL 4Z7QF 4NQUA 4TVSa 1NCWH 2P5WD 3R06A 4E9LA 1F6AA 3HC3L 5C2BH 2VDPH 2V7NB 2FDBP 2NXZC 3BKML 3NA4A 1RIUH 2N4IA 3CDYA 4YGVB 2DTSA 4J12A 1PDKA 5FGCB 1OTUD 1FVEB 3LKQA 3S7GA 1Q9OA 3W39A 2FATL 1TVHB 3A6OA 1T5WA 5SV3A 4HHAB 1RU9H 3F6IA 3Q6FB 3SCMD 5IR1B 2ZUSA 4L8CB 1WIUA 2WIMA 4WO4C 3L6FB 3MCKB 4HUVB 1SQ2N 2XZZA 1QLFB 2HWZH 3VI4E 3QP3A 2XWBB 1AR1D 1NCCL 3SPVA 3BOVA 2XWTB 5IB2A 1NCDL 4MSWB 4GS7C 3UBXG 5IFJB 2P8LB 4P3WA 4WFFD 1PW3A 2P4AB 3G9VA 2OL3A 2FX7L 4XNQB 3EJZC 3IDIB 1E0OB 5EIIB 1KPVB 4HXBH 4KI1A 5T3XD 3FFCD 1IT9L 1MIEL 3FONB 3B6SA 3RKPA 2VDQL 3ALWA 4JPWH 4RQQA 1CG9B 4JFDB 4YXLH 4MQXD 3E1F1 3KYOB 3NFPB 5ESAA 4L1DA 4RFEA 4X6FA 4Q0XL 2Z9TA 1MI5B 3ETBF 4NO5B 2J4WH 5BVPL 2Q86A 3RDTD 1P7KA 4XB7A 3FB6A 3VFWA 5F70A 3IXAB 3MV9D 3KPRB 4URTB 1UA6H 3WKMH 2I9TB 3ARBC 1OTTD 5SWSB 5C08D 2HFEA 4Z7VF 3A6CH 3RWHA 3SDCD 1TQBC 3KJ6H 2F9BT 5D1XC 5JORB 4P2OD 4WTXA 4L9LC 4GXUN 4YQXL 3QUXD 4OLEA 3P30H 2QV2A 3GSUA 3TCXA 1I8KA 4F33A 1DN2A 2E6PA 3PDDA 1KGCD 5I1IL 3GI8H 4K94L 1IGIH 2MKLC 1T20B 1S7VB 3CFIC 4U0QB 4UU9B 3FRPG 1Q0YL 1I3GL 4I3RH 2AQ3A 5KZCD 5MENB 2ADIA 3GSQB 4MA3B 2Z92A 5K9JL 2MHAB 3DYOA 4I18C 3RX8A 4G3YH 2NW2A 4KUZH 3RTQB 2HFGL 1RUKL 3QXTA 2J5LB 3S37H 4OLYL 4NO2A 5F9OL 1JYVA 1AO7B 3O2VL 3RVUC 5IHLB 2NXZD 2BSRB 2P7TB 4O5LL 3TA3B 4LCCB 3E6FB 2IEPA 2W9EH 4OI9A 3PWVA 1KJVB 4JFYB 5F93C 4TUOB 5D96C 3CZJA 2CKNA 1KCUL 3CXDH 4DGYH 1BEYH 1FAKT 2PR4H 3X11B 3UDWC 3HAEG 5FECB 4GBXB 5ELIA 2P43B 4WO4D 4ODSL 5DT1L 1K5NA 1KJ3L 1P1ZB 2C7UA 5B8CB 5JA8B 4UAOC 1RZJL 5DUBB 1AXSA 1PEZA 4G43B 5HVFB 4P9HH 4JG1H 1UB5A 4G6FB 5E1AB 1W72L 5A1AA 1FVDB 4IRSA 4XX1G 2XOTA 1NC2D 3EYVA 4QXTB 1LDSA 3B9KB 4IOIA 2Z31A 3EJZD 1QR1A 1EO8H 1N7MH 4JCMA 3BH9A 4G6AC 5IB4B 3BDXA 5A43C 2ESVA 2GITA 3QG7H 4NRYB 4YHNB 4YHZH 1OARH 2KQMA 5DA4A 5CFHA 1MCCA 4QOKD 1T1XB 3P0VH 1YYMH 2XG4A 3ARTA 5L2KE 3QDME 5E94A 4Y1AD 4PY7B 1TZIA 4RAVA 3QEUB 1TFHA 4KTYA 4CDGC 5KSAA 3NFNB 1JYXA 4MQ7A 3O2DA 4NKIL 2MPAH 4TQEL 1HXYB 4LSPL 3VFUA 3HC0A 5LGHH 3UO1H 1ZLWK 1Q9WA 1KJ2A 3BEWA 1LE9B 5IF0A 3VXQB 1A21A 2IH1B 2R4SH 3O6MH 1FL5A 2JJTA 3ARBD 3FHQA 35C8L 4BFIA 1RZKH 3QNZB 4CADA 1CDYA 1QBAA 5C0AE 3RY5A 1IQDA 1D3CA 3QNYA 5D1XD 4ZUTA 1I1RA 1YEIH 1MH5A 4GKZB 4PJXF 1JBJA 4G80A 2XTLA 4KY1H 1I1CA 2VIRA 3BQUC 4GH7B 4PJ5B 3UTSE 1IZKA 1FGNH 3ARSA 1TMCB 4M3KB 3WFCH 5EIQA 1NGWA 4PRHD 3MRGA 4LHQB 4X7SH 2VQ1A 2ADGB 5DQDL 1JZ3A 5L8LB 1KLGA 1UH4A 3MO1B 3QFDB 1XGYL 3QI9A 5GGRB 5KBNC 4NBZB 4OGYL 3QUYA 4OFYD 4QRRE 1YDPB 5F1IB 1ZWIA 1U93A 3ARWA 3FO1B 5FYLE 1KT2B 3VFVB 1ODAA 2O5ZH 4P23B 4NQXA 3RVUD 3GUTB 1QRNA 2HJKB 3T0DA 1U8NA 4LQ1A 5SX5K 1GGIL 4O4YL 4V1DE 2Y36H 5C9KA 4HXAL 1LEKB 4R7NB 2AJXL 1MAMH 4HIXL 4N90D 4BH8A 2WW8A 5JLZB 5EZLA 3U30B 4OUOA 4HUUB 3I6LE 1IAOA 4DN3H 2RHEA 1TETH 2G60H 1OM3H 1SYSB 4NCC2 4PLJC 2R1YB 1NMBL 4PJ7F 5DJAB 4PJDF 1MCRA 3BMWA 4GAYA 3CFBA 3IXTA 4NQED 1S5IH 43C9B 3A67H 4NJAL 1U6AH 2XQBH 4M4PA 4TOYL 4GG6F 4YDLC 3D0VA 2VNCA 3KYNB 3ILQC 2DQFA 4KVCH 2DLGA 1N5AA 5H94A 3D2UB 1YN6A 1J0YA 4OCYH 4UV7L 3WMSA 2NQCA 3UBXI 4HC1A 3TZVA 1D5BA 5JW5A 2DOCA 2KBGA 4NOBA 3NIFE 4XNXL 1RIVL 5F1NB 3T4YB 4CJ0A 1NLBL 3QXVA 4PTTA 5T3ZE 2YUXA 5E6IB 4EXPX 5B3JF 4MD5A 4XPBL 3MRBA 4Z0XB 2O61A 1GZPA 1ZS8A 2AJ3A 3TLRA 1XZ0A 4F3FA 2QHRL 1CD8A 1MJJA 3QIBC 3BE1L 2BVOB 3QULB 3H9SB 4W4NA 4HF5H 3H42H 3BD4A 3WE6B 5INCA 2IBZY 5HDQH 1TZHB 2CDEA 2Z4QB 1WBXA 3O3BA 3M1BB 4NQDD 4FXGB 5J1AB 3INUH 1A9BB 4MWFA 3EOYG 2WZPD 4XWOC 3HZKB 1BOGB 5CZVH 8FABA 3BESR 2ZZUT 1AGEA 1CXLA 3BQUD 3MRDB 1GYAA 1KJMA 5HDOA 4E41E 4NRXA 2FO1A 3GMNA 3P73A 3O45A 3GSNB 4F7CB 1OAYH 3QEQB 3G5VA 4Z5RA 4OZFB 5HVHC 1YYLH 5FKAA 2HVKA 3MYZA 1OAQH 3RGVC 5JIKA 2NY4B 3HPJB 4O2CA 2ITCB 1YC8A 3MXWH 3C5SB 4TSBL 1FE8L 3L3HA 5LKNA 1RJYB 3CMOL 2BNQE 3IYLW 1KXVC 5A2JH 2OCFD 3P9MA 4N0UA 4G6JH 5EOQL 3QWQB 5I18H 1FNLA 3PXJA 2CLZA 4WW1A 4KQ4H 2X09A 1D6VL 3AU1B 4CVXA 3C6SA 5FO8B 5DD0H 4XPHL 5F9DC 1I9RL 1FIGL 1U92A 3S36L 3WJJC 4X7TB 2W0FA 5IESH 4PLJD 3LH2H 4EUPB 1AJ7H 1QACA 5HXMA 4M6AA 1WCBB 3HZYA 6FABL 2QQNL 1MJ8L 5GIRA 5E00A 2BSTB 3MBEA 4ZTPH 4C58B 3V2AR 3K4AA 3UBXA 3QO1B 3AY4A 2EO9A 3OB0K 3P0YL 4IIQC 4XVSH 1VESA 1NFDB 2GK0B 4EI5B 1UVQB 3QRFM 4YZFE 1EEYB 1AXTL 3ILQD 5GJSL 4RWYH 1NKRA 4ODHL 5BMFH 1MUJA 3S4SG 2CMRH 1BD2E 2FGZA 4LPVA 4WCYH 5DMIH 4QHUB 1NGZB 2CDGA 2QQLH 1FNFA 1QFPA 2CD0A 3GMRA 5K93A 3V0WL 4BSWA 4MXQC 3RVWC 4WGWB 4ZS7L 3IS0X 4XMPH 1GGCH 3F7VA 1RK1A 3HUJF 3UJJL 4PRPE 5FYLL 1MWAL 1T04B 3MV8B 2Y5TA 4WFHD 3FOMA 4JO4H 5TJWK 3GGWB 3BEVB 5E8PA 1JNHB 1LMKA 1AGCB 1RMFH 2DQJH 3WLBA 2GEEA 2W59A 3RRQA 4AEIH 15C8H 1RUMH 1JTOA 4XWOD 1A7QL 1ZV5A 2B7DT 4QTIH 2DJUA 2VXTH 1UZ8A 3U7YH 3T2OA 2APTA 4F7PA 4PTUB 4PBWD 1R5WA 4HPOH 5F71A 3Q5YA 1VADB 3KPLA 2DMBA 2OLDA 2AV1A 1JWSB 3WIHH 4RAHA 3WFBH 1JGDA 3FRPA 1PEWA 2KH2B 4OZHE 3WJLA 1FNSH 3BN3B 2VLKB 2R15A 5C07B 4JB9H 5D2LA 3IU4L 4FFYH 4M9OA 2QJDA 1DR9A 5ADOH 3VWKC 1UXSA 4QWWC 5F21B 2CIIA 3MCLH 4UV4H 3UTTE 2MWCA 4OFKA 5D6CB 1OF2B 2DD8L 1F13A 4Z7WB 2X4NB 4JO2H 3NPZB 1UB6A 4Y2DB 3VFTA 3QQNA 3LS4L 1C1EH 2HN7B 4JRXE 3BIKB 3HB3C 5T3ZL 3VXUE 3I9GH 4NJ9H 3X3FL 3CDFA 1PZ5A 2APFA 1Z0MA 3MUJA 5B3NA 3HZVA 4GG8A 4M61A 4ALAL 3D0LB 2D31B 4PJGA 4I0CC 5J8OA 3O6FA 2GAZB 3HAEA 2DLIA 3MLZH 2MOVA 3QNXA 1OVZA 3WCYA 1NMAH 3MLWL 1U8OB 5IW3A 1W0VA 1W72A 1QRKA 3L3GA 1J1PH 3MJ8B 1A1NA 2LTQB 3LZFL 4J6RH 3PWUB 4G8IB 4EDWH 2J8UA 4OAWA 2OXGA 4HWEH 4L3ED 1J1OL 1IC5L 5JXEA 4Q6YA 5FA4B 4LIQH 4GRWE 1A7NH 1TZGL 2ZOKB 1JPTH 4Q97A 2EDXA 3QUZB 4ZMAT 4HBQA 4YE4L 3DO3A 4MJIB 1Z0NA 5EUOB 5ETUB 3G6DH 4JN1H 4WDIA 4YR6B 3B9DA 4EN3B 2EDJA 4NN7B 3TH2T 1X7QB 4KV5E 2NY6B 3VWJB 3KYAA 4MXQD 5AEAA 3RVWD 2RCSL 4N8CH 3VXOA 3QBTB 2WUCH 1TITA 3FMGH 5FO7A 4YHIA 1YEJH 2GW5A 2QSVA 1KIPA 1DVFC 5HJ3A 3F7YA 4QHMA 4TRPL 5H35A 1MVUB 3U83A 2YRLA 1IAIH 3EOBB 1I85A 1G0DA 2BVEA 4O02L 3FN3A 2R2HA 4HWUA 4U1JA 4Z76B 3IDNA 5I71C 1F4XL 3KPNA 3BWAA 5DD6B 3PABB 3B5TA 3SQOL 1J86A 5BO1L 4WFED 2BY0A 5JOPD 4HH8A 2ICWB 3W0WD 3NGBB 1H5BA 4ZTOL 5CLWA 4GAJL 2OL3H 3HE7A 4WFGE 5D1ZC 4XCEB 2KZWA 4X99B 1F11B 5IVXB 4HGWA 1F8TL 4NWUH 1YPZB 4P4KA 3TESA 1DFBH 2P5EB 5KSBE 1O7SA 5A16A 4L3CA 3LCYA 3T65B 5KSUB 5HYEA 3BKJH 2H3NB 3VRJB 5J7CC 5F8QC 4JRYB 4TVPL 2I9LA 4ZPTB 3VWKD 1KACB 4S2SA 3DX7B 4QWWD 5ESVA 1JGVL 3M8OH 1J18A 1E4KC 2XA8H 5CD5C 3H8NA 1S3KL 3LN5B 3TN0A 1V7ML 3DX9B 4H1LA 2FX8L 2XFXA 3OR7A 1ORQB 5E03A 2AI0H 1PLGL 4UB0H 4OZ4B 3EO0B 3HB3D 1NSNL 4XMKL 4XHQA 1MJUL 1A6WL 1NUFA 3CX2A 1J5OL 2EH8H 5IT2L 4GUPA 3VXRB 4PJBE 1FSKC 2VISA 2WBJB 4JVUA 4MJ5A 4U2ZA 3WIIL 5IB1A 4YHKL 2EE3A 2ZCHL 4L4TE 1RJZA 3BZ4A 2I27N 3N1QC 3TPUB 5FXCH 2IPUK 4ZO8A 5A2KH 3TBVA 4HG4J 3QPQC 3G04A 4H8WH 3L1OL 5L8KB 3MA9H 4TSCH 1G7IB 4XWGL 3DHJA 4Y5XB 4FQ2L 3AXLB 5CWSA 4NC2B 3DX6B 1YEEH 2NXYC 5KW9H 4HV8B 5AYQA 4TN9A 4GMSL 5CUSL 1ADQA 2VDNH 2ZG1A 3IRZA 2EYRB 1K4CB 1DBJL 1FN4B 3RWDA 4GRMB 4PJ9A 1KULA 1XR9A 3ISWA 1BF8A 2Y06L 4NDMA 3RL1A 5ICYB 5GS1A 5D7LD 4MA7L 2OQJB 2YD2A 5I8CA 3SDDB 4YUEH 3BJ91 4XPTL 2WAHA 4X6CA 1GSMA 1RJLB 5IFHH 4FFZL 1ZTXL 1EEZB 5AG9A 1DVFD 3HMWH 4YPGA 5B4MD 2F8VA 2NY5C 5CHNB 5BZDB 1U3HB 2N7AA 3RY6C 3FO0L 1AC0A 5D7IF 4ACPA 1NUNB 1A47A 2XTJC 2W9LA 3MFFB 4D2NA 4YO0B 4ZOBA 2D7NA 5CIPB 4OFIA 4ZYKA 1EXUA 3DO7B 5HHVL 1GC1H 5C92A 2RIKA 4ORGB 5D1ZD 4OD2A 4QRPD 3CLEH 3QRGL 1MY5A 2D2OA 4ORZC 2DWDB 2DQIL 3MRQB 2X1QA 4MNHB 2X5PA 1X9QA 2IADB 1GH7A 4U1LA 1AQKL 2A9NH 3KLDA 4XNUH 4G9DA 1LHZA 4UMGA 2OP4L 3O6KL 4CAGA 1QUNA 5IMMA 4LLMA 3O2DH 3RA7L 1T5XA 5L9DH 3ROOA 2IPTL 2W07A 4PR5A 2VZ3A 3OKKA 2F58H 4EKXA 1QSFE 1XGUA 4C83B 5L2KA 3OF6D 3QDMA 5CD5D 4OB5H 1BBDL 1KJ2H 1DSFL 1X4YA 5C09E 4FQHA 3E3QC 2VLJB 1U0QA 4NQCA 5MHSE 3T3PE 3T0XA 3MMEA 3SKNB 3V4VH 3QDHA 4OCNC 4NSKB 5GISL 3ZO0A 3U2SB 4FN0A 3BP5A 1TPXC 3MV7A 1KC5L 1QLEL 5ACMA 3EO1B 3CFEB 4LP5A 1T1WA 5SWZB 5C7XH 5KS9E 4KDTA 2EIEA 2HRLA 5E8NA 3G5ZA 3BD5A 3DURB 1WFUA 1PBYA 1F4WL 4CJ1A 1KB5L 1ROWA 3WSQH 5KTEL 3IFLH 1FRGL 1RZIA 1FGVH 4LASH 3ZDZE 4FQLH 3O3DA 4GKSA 3DPBA 3RTQC 1S7UB 3QPQD 3WFHB 4GO6B 1DBBH 2X6MA 2VZ1A 3UTSA 1ZT1B 4YAQA 4Q9RL 4M4RA 3VG9C 1JPGA 5FGBA 2ADFL 2IC2A 2JB6B 3GM0A 5DHVB 4WI3A 4XVUC 4JGJA 4LCCC 2NXYD 4AYFA 3H0TA 1JMZA 4QXUH 3S4SA 1RY7B 5GS0C 1AXIB 5DUPH 5TFSH 1GJIA 4DUVA 4WTZG 1CLZL 5IG7A 4WI8A 1U8JA 1N5YH 2F53A 5CZKA 1IKFL 5IK3A 4R90L 3MUGB 1MWAA 2BVUA 2AXGB 2OSLA 2V5MA 1C12A 1ITBB 3DMMA 3V6ZA 2OJZH 5B8CC 1RHFA 4PJAA 1UWEH 1Q9LB 2QR0A 3RZCB 5JXAH 2XXCB 2WWKO 1XT5A 5GGUA 3ZE1F 5DVKA 4V1DA 3HNSL 1FNHA 4RZCB 1ZA6B 3MGTA 5C0JB 4ODWA 1NLDH 1FO0L 3LD8B 4P99A 3REVA 2XTJD 5JTWA 4WUUD 3RGHA 3NCYS 5T1KA 4P49A 2YUWA 2DN7A 3AAZB 4MA1B 1HHJA 1U95A 1FG9C 4UTBL 5LBSH 5JW3L 4DZBB 1FNGB 2C3HA 1GIGL 3BP7B 4RGOH 2AJZB 4X5WA 1XEDA 4PREA 4PGJA 4PB0H 4GRLA 3PJSB 3ILPA 4LCWA 4GKNB 5GRWA 4XP1H 4C4KO 4HS3B 3MLTA 1UT9A 4O51A 3ULUC 1LEGA 3G5YB 4L29B 3QDGD 5DJ6B 1L7TL 4NRZB 5HGGS 1S7QA 1Z5LA 3BPNB 5JDJA 3VXPA 4JKMA 5EORH 5C0IB 1JNLH 3W9EA 5E8EA 1G7LA 3M07A 2X4TB 1R0AL 3OX8A 4L5FL 3LEVH 3S6CA 3BDYH 3GSVB 4QT5B 4CN6A 5GS2D 4OUUA 1CF8L 3IU3A 1T1ZA 3RAJL 2W9DL 4Y5YB 3BRGC 1I8LA 1PG7H 4YFLF 2BHYA 5J89A 4F57L 1NFIB 1X5LA 1ZANH 2H8PA 3CU7A 2Q76B 1P7KB 5GRUH 1J0ZA 1RHHB 3C6LC 3E8UH 5CGMA 4HS6A 4G7VL 5CINL 1I8IA 1CZ8H 2ZKHH 5DC0A 2W91A 5HHOE 2P44B 3DUUB 3SE9H 2AXJA 1E4JA 3QIUC 5DZOA 1QSEB 3RL2B 1EV2E 4BH7A 1KCRL 4JM4H 1KF9B 2MNUA 3K4ZA 4LLDA 2UZYB 1OB1B 1NGXB 3QPXH 4P23C 4PLKD 3EGSB 1NQBA 3S8WA 4XVUD 3ULSB 2A6DA 1KPUA 1OSZB 1HXMA 4U49A 5E2TH 1ZVSB 3VXTB 3HC3H 4YHLL 2V17L 2WINA 1F6FB 2GSIA 1CT8A 1QO3A 5GS0D 4M03A 1MCPL 4HG4K 1GGBH 2Z8RA 4Q2ZA 1T4KB 1KNOA 3SKJL 3D69A 3G5XA 4M9PA 5DGRA 3U30C 2FATH 3ES6B 4JHWH 4X8JA 1EFXA 1QVOB 2B5IC 4MQTB 3R8QA 4BELD 4KZDH 4ISVA 3H3PL 2NW2B 3LQAH 3QDJD 3TBTB 4OFDA 3PNWA 4G6FD 3O4OC 1RPQA 1NCCH 5K33A 1CXKA 3V5DB 4ONGH 3QWRD 1XGRB 2Z8WC 3V6BR 3PWVB 1WEJL 4O58L 2DIJA 3RVVC 1E28B 4TNWF 2YXMA 1EUUA 4GXVL 1CE1H 5I8KL 2FZ3B 1IT9H 1MIEH 1MREH 3I75A 3P77A 4HIJB 1NANI 1ETZA 5CP7A 3PWNA 1KTDA 3WS3A 4IOSD 1U8IB 4PGBB 4R4BB 1V7NH 3KLHC 5IMLB 2VABA 3DUHA 4M6MH 1PKQA 1AXSB 3VA2C 1N0XH 1WCQA 2V9TA 5BVPH 4MNQA 5EO0B 5D5MB 5JIHA 3ULUD 3C87A 4OD1L 1QSZA 2J88L 3L9RA 4D0BA 1H15A 3LKSA 5EU6B 3ZKNC 4CVZA 4HBCL 1G9NH 3SKOB 4WNQB 1OAZL 1FQ9C 4LMQE 5ENWB 3WHXA 3WL9B 1NAMH 4HAGA 4PRPA 2V2TA 4MXVF 2GUOB 3ARYA 2Q20A 4XPGL 4XAKD 5CEXB 2XKNA 4QNPE 1EGJA 3V8OA 5IKCA 1MVFA 2A83B 3JWNC 4CMHC 1C16B 4RGMC 4NUGL 3ZTNL 3X14B 1FC1A 3TJEH 5CMAB 3GMOA 3Q5TA 5I1IH 2ZUYA 3TJHC 3C6LD 4UQ3B 4K94H 1WBZB 1J8HB 2W60A 2GJ6A 2C4FU 1Q0YH 4XNYL 1NBZA 4HULB 1X6LA 1A0QL 3FTGA 5J13C 2NY4C 4FFVC 2CIKB 3QIUD 3MRIB 3TWCL 1ZLSL 4CADB 4XCFH 4GW5B 5C9JA 1C7SA 4YHML 2VSDA 2R4RL 2C3VA 2NPLX 3IFNH 4XBPB 1G0YR 1RUKH 3BAEL 1MH5B 4YXHL 4OKVB 4OLYH 1RZ7L 5F9OH 5HGAB 5GHWL 3O2VH 3RIAF 4O5LH 4OZHA 2P45B 3SJVD 3EYFA 5DJDB 3PHSA 3T8XB 2AK1L 4QRSB 1FFRA 1CD0A 1D5MA 3BO8A 3KPSE 3OXSA 2WK2A 5IQ7H 3WIFA 5F8RC 2YPLD 1MCHA 3FO9B 2Q1EA 3UTTA 5E95B 1VKXB 4P5KB 1U93B 3C2AH 1GGYA 4HKZA 4PV9A 5DT1H 2ADJA 2QSCL 3ARFA 3VXUA 1I1AA 1BAFL 2W65B 3ARVA 4W70A 4JRWA 2Z91A 1N6QH 1RZJH 5F89B 4X6BB 3OQ3B 3V0VB 1RURH 4ZOAA 1W72H 2X4RA 4U1GC 2VWEE 1D9KC 1Q94A 2Y5EA 4RA3A 2APXA 2YK1L 2XY2A 3BKYH 3MA7B 1IL1B 1ORSA 3EFFB 3VFMA 1S9YB 4BH8B 1OW0A 1ACZA 1JPFB 4P9HC 1R3KA 4RCAA 3MNZB 4PJ7A 5JUEH 4PJDA 2PCPA 5JHDA 3ARGB 3DTXA 5I1LA 3D39A 1DTUA 3KLHD 4JZOA 4OZGE 4NKIH 5C0BE 4TQEH 1I7RB 4XNMB 2DKSA 5CJBA 4XCYA 3HRPA 2M8XA 3TCLA 1H3WM 3LDBC 5E8DH 3ZKND 5JW4N 2AS5M 1CDUA 2AK4E 2E27H 1UQSB 4P3DA 2HT3C 1FV1A 4JPVL 4NNYB 3NCBB 4U05A 3ULUF 1K8IA 4FTVE 1K2DA 3ARDC 1J10A 4P2QA 4R2GB 4S1QL 4XXDA 4ELKA 2VAJA 4XVTL 2AVGA 1BZ7A 5F7NC 2XNAA 4PTTB 2OTWB 4W6YB 4WV1C 5DHYA 1CTNA 3GO1H 4EJ1C 1KB5A 3QQ3A 1GZPB 3V52H 4F3FB 3TJHD 1HDMA 1DDHA 5T5FH 1N3NB 4LGRB 5DQDH 2WQ8A 2FRGP 4RAUB 1N26A 5I75B 1AR2A 1G0XA 1XGYH 2CDEB 4JY6A 5DI8B 2NY4D 2OMBA 4FFVD 4HGMA 5FHBL 3VDBA 4HFWA 1NGPH 4K07A 4Z7OF 2X2YA 5FFLA 2I25N 2JELL 4J8RB 5EBWA 2MMXA 5HHNA 1IEBA 4Y2DC 5KSBA 5I30H 4JM2A 4H0IA 3FQUB 4LDEB 3GB7B 4PD4J 4HDIB 3RU8L 5K59F 1SHMA 2HTKC 1OLZA 2WWMC 5D7SL 3HG1D 3VFPB 2BNUA 4H1LH 4R8WH 4WTZA 4XH2B 4HXAH 4F9PC 3S5LA 4LNRA 2PYEE 3U9UA 5HGHA 1VGEL 4HIXH 4ODBD 3C8DA 3JV4B 3GJEA 4OJFL 4LARH 1YEDB 4B7LA 1RVFH 1BQUA 2ZUVA 3QIWD 4PUBL 4U1KB 4XC3L 4WU7B 4YHOL 1HYSC 1MCFA 5J6GA 4M02A 1NMBH 4ZQKB 1A14L 4NZDA 4CN1A 2FLRT 1JI2A 2C3WA 4YDIL 2VL5A 5F88A 4P2CG 5ILTH 1JHTB 4M1DL 4P59L 1D9KD 3OR6A 2CLZB 4WW1B 4L4TA 3QWOB 2VJXA 3SE3A 4YHPB 1KIRB 3Q0HA 4RRPG 2X1PA 2DLFH 4YBLC 2C4XA 4KMTL 3NFSL 4N8VB 3VWJC 1ADQH 5E4EC 3TNMA 1U92B 3MNVA 1NC4D 4LKXA 4JR9L 3K1DA 4JFHD 4M93C 4XNXH 5E8OB 4S10A 2PO6A 2D03L 1D5ZA 1IBGH 3CC5B 1NLBH 5D70L 4OLZL 4YDKL 3HZYB 3OAYH 4YK4B 2E9JA 4ERSL 2Z35A 3MLSL 3UBXB 4FQ1L 1V5JA 3V6OC 5I66B 1UG9A 3IJSA 4U3XA 1P5UA 4OV6F 2ZUXA 3QQ4B 3L3KB 2HT3D 1MFDL 2MSPA 4MJ6B 4U1IA 1P7QB 1G7MB 3FQRA 2DI9A 5GS3A 4BZYA 3VCLA 4JREB 1CFSB 3ARDD 3DXAD 1U58B 1LK2A 1B9ZA 2X41A 3KPRE 3IDMA 2JLLA 4OIIL 1NDMA 4XHJC 2AXFB 5SWSE 2ZSWA 2UUDH 4H88H 5CEYA 4EDXA 2KUTA 2LU4A 4KKAD 2BDNL 4JANB 2WUBL 1FDLL 5TDNA 5E8PB 3TT1L 1YNLH 1RUAL 3T1FA 5EN2B 1K8DB 4K3HA 4PG2A 4AY0A 4LPYA 4XBGB 5I1EH 4XP6H 2XZQL 2GK2A 3RPIB 4AIXA 4FXKB 4Y2DD 3P4OB 2DJSA 3VFRA 2P24A 4MS8C 1R5WB 2HTKD 1XF4A 5BVJB 4WW2A 3CJJA 2YUVA 3RWFA 5EOQH 5LXGH 3SBWC 1N8ZA 1D6VH 1D5XA 1JZ2A 2VLRA 1AO7E 1LDPL 5BS0D 4B50A 4LLVA 5HHMB 2X4OA 5D2LB 3LN4A 2YR3A 3EFDL 3L3OB 4RBPH 2R56L 3I3BA 1I9RH 1MCQA 2B4CC 3S36H 1OGTA 3OMZA 3JWOH 5DJXB 3REWA 1SY6L 1HYSD 3CPLB 3PWJB 1KIQB 4Q9QL 3VI3E 4X4YA 4Y5XC 6FABH 2QQNH 1MJ8H 1JCKA 4MVBC 3VFTB 2A1WL 1INEL 2COQA 1OP3H 2CO7B 4PJEB 3DUSA 4XMLL 2HLAA 3L3IA 2X89A 5EBMB 2XN9D 3HMXL 3OKOB 3E6HB 3D85B 3PP4L 4MYWB 3TBSB 2EEAA 3RWJB 4JJ5B 1OD9A 2UY6A 2H41A 1PYWA 4X6DB 1HHHA 2HA1A 2HH0L 4JKKA 3PGCB 1I7ZB 4LGPB 3CLFL 1B6DA 3RI5F 4P5MA 4U31A 2YMXL 3FRUB 4NHCL 3ZHDA 1N59B 4Z77A 2BOBA 2CK2A 4M7ZB 4G8FA 1MCNA 1MWAH 6CGTA 2CKBL 1EJ6A 1CXHA 3TH4T 2E9BA 5D1QB 1BFVL 5TH2A 5BRZB 5IM7A 4NN5C 1CDBA 4P4RB 1ULVA 3QFJD 2RB8A 4R4NC 2PTVA 1EAPA 1E4XH 5CGTA 1XGQB 1S7WB 1PG7W 1A7QH 4HW6A 4JDZA 5H2BA 1FCGA 4IJ3B 4TUKH 1QLRB 3OKDA 1EA9C 4WHDA 2NTSP 2PTUA 3OB8A 4EIGB 4YHIB 1QEWB 2IG2H 4D8PA 2GTZA 2DKUA 1QTYT 5HJ3B 3F7YB 3UTOA 1HKFA 3O6LL 4JRYD 2NW3A 3FB7B 4L9DA 4WI9A 2R2HB 4PJ5E 5FF6A 3IDNB 3QIBA 4K8RL 3IU4H 1I7UB 1CCZA 1M7IB 1KCVL 2APWA 5GRJL 2VYRE 4PRNA 1XGTA 1BVKA 5BW7C 5FUOH 3WXWL 5LVEA 3OAZK 4OSUL 2VZOA 4MS8D 4HJJL 5HDBE 2ARJB 4R96B 1N0LA 1A7BA 5HYQB 4XB8A 3JTTB 3O9WC 5BQ7B 3CAFA 5IB5B 2X4UB 3X3FH 2JE8A 1X5FA 4CU6A 1Y0LB 2IAND 3Q3GA 4ALAH 1L7IL 2IAMC 3QA3A 2FECL 4MD4B 4PG9B 1MY7A 1EHLL 4NO0A 2YD4A 4J3UA 2VAAB 4JVPA 1BJ8A 5F7UA 4WFFE 5F7DA 3QCUL 2HJFB 4OGAC 4A2LA 3LQZA 5EWIL 5EBGA 3RGVA 4CNIB 4KZEL 1G9MC 4MVBD 2WM0A 2EE2A 3B3IA 3RNKB 3PWPE 3X13A 3LZFH 4LAJH 2X40A 2Y25A 3EOAB 5T3XE 5DK2A 3LKOA 1G7QB 2ZUWA 3O3AA 1IC5H 1B6UA 2BOCA 5GPRA 4LMQI 2LFGA 4UBDC 5IEHA 5DRNB 4FA8A 2YBRB 2R0LL 4Z7NE 4ZDHB 2R2EB 3PHQA 4WENB 2VOTA 1ZAGA 5HHOA 3QJFB 1FZKB 3HR5A 3TBYA 3DHMA 4BZ1H 1XF2B 2VXSL 1IEAA 1SJVA 1WBYA 3QO0B 2BMKA 4GFTB 4GMTH 1RJZB 1HOCB 5EUOF 4KGJA 2RCSH 4G8GD 3ZDXE 4LQFH 4K3DL 5I16A 1K6QL 4LVHC 3PGDA 4J23A 3WJJA 2OR7A 5M95B 1BGXH 2OJEA 2H26A 4TRPH 5DSCA 1A6TA 3PV6B 2GI7A 4HZLA 4E42A 3MACL 4DEPC 4LCYA 4Y88A 1RQ5A 2CXGA 4HQQH 3DROA 3SQOH 5BO1H 5FB8A 1DLFL 3DSFH 4MCZA 3H9SE 4OCMC 5LQBL 2E7HA 1IGCL 1KGCE 4GAJH 4LHJB 4PRID 2DWEB 2Z93B 4U0RB 4KVNH 5DEGA 2UZIL 4JPIA 3GI9L 2PETA 2ITDA 5ESQA 4FQQB 4HK0A 5IVXF 2X9YA 4LF3A 5E08H 1YPZF 2IQ9L 4RMQA 5I2IB 4JQIL 3JBG7 4TVPH 4YDVB 1VACB 4EBQL 3RI5K 2E9IA 2DMCA 5FOJA 1CL7H 3QEQE 5ITFA 2CXKA 1QFWH 5I19L 1S3KH 4LSVL 5KVGH 4UQ2A 1AGBB 3HRZA 3SDYL 1HCVA 2FX8H 1T6WA 4M00A 5I9QB 3TYFA 3HCVB 3O9WD 4XZUB 3QT2A 2HAZA 3HS0B 4YHYC 5HPMA 3FAXA 4P5TB 1NSNH 4XMKH 4FZEL 2YHGA 1P6FA 3BKCL 5IT2H 5E2WL 2IAMD 4HFUL 3WIIH 3B9VA 1EGJH 3IFPA 1SYVA 2ZCHH 5I73C 3O0RH 3ROOB 3OKKB 4IS6B 3SGDI 1Q1JL 3QJHB 4ZFOB 4OGAD 4P9ML 1CGVA 1HCFX 1SMAA 3IDJB 4AIZB 1P4LB 1T6VN 5E9DD 1BWMA 4QHNB 3OBAA 5F1SA 4XWGH 2BVPA 1IM9A 1JFQL 4UBDD 1YNTB 3QHZL 4EVNA 5EU3A 1F2XK 2B20A 1IC7L 4GMSH 4QRTA 3QISA 4Y1AE 1DBJH 4RSVA 4RRPA 3VXMA 4X80L 4RMUA 1R24B 4PJHB 5D71L 3WDJA 5C0AB 4F7TA 1NFDE 4LPUA 4XP9L 2D7TH 4MA7H 1NBVL 5CBEB 2QADC 3G6JE 3VG0H 2EO1A 2BERA 3QDAA 3ZLQC 4XPTH 2BY3A 5IB3A 1G7PB 3UTSB 1VGKB 1JPGB 4XBEL 1ZTXH 5C0CE 5BJTB 2BVTA 2J6EL 2FB4L 1DQQA 4Y8DC 5FOBB 1J8KA 3IB4A 4GW4A 4UNVA 5I1CH 3QCTL 1UZ6F 3ARXA 4L8DA 3OXRB 5JDSA 3F12B 3MV8E 3L7EA 5IG7B 1NANH 4OV5B 2AEPL 4QRRB 1IGML 5J1SC 1UH3A 2QKIB 4M62L 1F58H 3QRGH 3BPCB 4KAQL 4OLXL 5IUSA 3DMMB 2DS4A 2DLTA 5E7BA 4KRPC 3BD3A 1A7PL 1RZGA 5CEZE 1UWXH 3CU1A 1J12A 5CCKL 4K3GA 3GBMH 1DUYA 4V1DB 1AQKH 3OV6A 2MCPL 2VLLB 4IRSC 5T3XL 2CH8A 4RIRA 5I76A 2OP4H 1AE6H 2Z31C 3FT3A 1PVHA 4GRWH 4C56A 2IPTH 1S7XA 2MQCA 4AQ1B 5C0RL 1XAUA 4PJCB 2X42A 5FM5M 4HWZB 1E27A 5TQ0L 2AKRB 5D2NE 3GSOB 3V5KA 4OZGA 5C0BA 4M7KH 5EOCH 1KTRL 1QFUL 1RUQL 1TVBA 5DZNA 5KSAC 2EDQA 1U8HA 1YY8B 3ARRA 2Q8AL 3U1SH 3HZMA 3QUKA 4N90E 2Y07L 4WEMB 1F00I 3BP6A 4N0YH 5GISH 1Z9SA 4HKJA 4PJFF 2DM3A 3KG5A 1QLEH 4JHAL 4CMMA 2LU7A 5FYJD 1S7TA 2AV7A 1HEZB 2R1WB 1MPAL 3G08A