2X53A

Structure of the phage p2 baseplate in its activated conformation with sr
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
263
structure length
263
Chain Sequence
TIKNFTFFSPNSTEFPVGSNNDGKLYMMLTGMDYRTIRRKDWSSPLNTALNVQYTNTSIIAGGRYFELLNETVALKGDSVNYIHANIDLTQTANPVSLSAETANNSNGVDINNGSGVLKVCFDIVTTSGTGVTSTKPIVQTSTLDSISVNDMTVSGSIDVPVQTLTVEAGNGLQLQLTKKNNDLVIVRFFGSVSNIQKGWNMSGTWVDRPFRPAAVQSLVGHFAGRDTSFHIDINPNGSITWWGANIDKTPIATRGNGSYFIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Lactococcal Phage P2 Baseplate and its Mechanism of Activation.
pubmed doi rcsb
source organism Lactococcus phage p2
molecule tags Viral protein
molecule keywords ORF16
total genus 56
structure length 263
sequence length 263
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R
ec nomenclature
pdb deposition date 2010-02-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1830 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2x53A02
2.60.520.10 Mainly Beta Sandwich Triple-stranded beta-helix Phage fibre proteins 2x53A01
4L92A 4RGGA 2X53A 2BSDA 3D8MA 4L97A 4HEPA 3U6XA 4L99A 3DA0A 4HEMA 4IOSA 4L9BA 2WZPA 4RGAA 2F0CA 3HG0A 2BSEA 1ZRUA 3EJCA
chains in the Genus database with same CATH superfamily
2AABL 3KEDA 4XAKE 1SLXA 4Y4HB 5I19L 4NERA 3F62A 1WZ1H 1OP4A 2DJSA 5KSAC 4X4XA 3V0VA 1Y6KR 2DMHA 3GJFB 3BZ5A 3HN5A 3RVXC 1DQQB 1DBKH 4XB3A 4IK6A 2K7PA 1HXMA 1JNLH 3G6DL 5HP5A 2X0WA 1E65A 5HDQL 2K9UA 2XQBL 1MEXL 1T22B 2ATKB 5GRZA 2WZPA 1BBJA 3D4CA 5I24A 1TJGH 1NKRA 2Q3AA 4U6HB 3O3AA 1LE5A 4JFDD 2R1XA 3DRTA 4OJAA 1EAJA 4OZGE 5EORL 4DW2L 4KRLB 1KT2B 3L95B 1SN2A 3P4NB 1KTBA 3BCDA 3QR0A 2L7QA 4QO1A 2VR6A 4WFGE 4HZAA 4A67A 3SN6N 3KPPB 5FUOH 4ONFL 1RPUA 1X5JA 3FCTA 3QHZH 3I84A 4AE0A 3MLTB 4NPYB 4ZXBB 5C2UB 4DESA 4AL8C 4MD5A 2KBGA 2LT9A 3O4OB 3F8UB 4Z7NE 5IREA 2GBTA 1QFWI 2J6EL 3HR6A 2A7BA 3VGAB 4HS8H 4OGYL 1XGZA 1C16B 3EJYC 3H9HA 4KZ0A 4LU5L 1D5BB 3SD5A 5DLML 5MP6L 2FJSA 3CFKB 5IT2H 5D4JA 2ILLA 4PJAE 2ZF9A 5ID1B 5C08A 3FU7B 4PHZA 2BW4A 2D0GA 1DFBH 3QEHA 3P0VL 5F9JB 4AIXA 1ZLSL 1YQ2A 2O5XL 3OL2A 1RXLA 1AZRA 5D1QE 5EZOH 5EZLB 1MCKA 2QGCA 4JPQA 1M3JA 3O2DA 3QUZC 1F4AA 2VN4A 1R3JA 1EGJA 4LFHD 3RGHA 2YXFA 5JHLL 4L9BA 3DJZA 3GK8L 1RIHL 1MFNA 3IDYC 5E03A 1FHNA 1XGYL 4HW6A 3GEWB 5E08L 1M53A 3ABGA 5GRVK 4CGTA 4KVPA 4Z0XB 5AAWA 5I8OH 4WY7L 1O5PA 2PR9A 3S96A 5L6YL 5ERWB 1S5IL 3CSYA 3E8UH 3QGVA 1IKFH 4PJ7E 2Q2LA 1C12A 4GBXD 2C9VA 4PRBB 1G6RH 2MRYA 3NACL 4WFEE 3UACA 5H35A 1TQBC 4PY8I 3N85L 1JZGA 1UQSB 4AOFA 4QNPE 5BJTA 2VDRL 1R3HA 4WO4D 2MCPL 3ZR5A 5TF0A 3L08A 5HDBE 2HKHH 3WUZA 3P9MB 1ZS2A 3J27A 3V0VB 4XCYA 1QHPA 1YCSA 4ODUB 4QUOA 4X5WB 4TPRH 2VSMB 1FDLH 3NABL 2W0PA 1FFPB 1XB3A 3MQIA 4WNJA 1GKOA 5ABAA 1GMEA 3Q8EA 2GJPA 4OCRH 5BO0D 1U3JA 1T7YA 2BNRA 5GJSL 4AG4L 2WV3A 3AMKA 1J8HE 3QJZA 4PR5B 1E8ZA 4YH6A 3MJGX 2HTKC 1VZGA 2QSCH 3ABLB 3U4AA 4HZLA 4N2LA 4G6AC 5IBLC 3K71A 4RSYA 1ASPA 2GSIA 2WIIB 4LPYA 1ESOA 1VB9A 4Y1AD 2WXLA 3GSQB 1TCRA 2OYMA 3C5XA 4V1DE 3PP3H 4GQ9L 4BH7B 1QBLL 3S2CA 4MXVF 4OZIA 4JDEA 4LL1A 4KBPA 4ZBJA 1BP3B 3B1TA 4UIMB 1KBVA 5AYUH 1P4IL 2HKFL 4W1TA 4DFHA 4BFEA 3QYMA 1B0RA 4FHKA 4QEGA 3IDIB 4N85A 4DGWC 4RGND 1ZWIB 1JHLL 3WJJC 3MV8E 4OQTL 4XNZB 1JDAA 1S7UB 1BJMA 4PV8B 4XBPB 4FEMA 1WCBB 4EAEA 1ZLDA 4PP1D 4LASL 3EFOA 1E8WA 1BMWA 5EZOL 3VXRD 3DRTB 1DQMH 1OB1A 2P9RA 2VRQA 4DP9X 2FCBA 1UUSA 1X5IA 4KNUA 5GHWL 5DRNB 2UY7A 2EILB 3BUDA 4HUWB 1OE3A 3SDCA 4HWZA 2I07B 4HUMB 3W9DB 5E6ID 1FC2D 4WCYL 1T4WA 1FCCA 2CALA 4YK4C 2ISDA 3SKJH 3ARBA 4WFHE 3C6LD 1DSYA 4YGAB 4MMZB 4BRVA 4QTHA 2HN7B 2DJ4A 3P4LA 4HHWA 5FECB 3MLVL 1WRFA 4ZXBC 4HCIA 2ZJSL 5KANI 4OJCA 3T1FA 4N4YB 1DN0B 1FJ1A 4XNUH 5IW1B 1OE2A 3MFGB 3VXRB 1TUPA 2E0PA 4PHXA 6FABL 1S9KC 5DT1L 4WF7A 1HS6A 3B3BA 3DVNA 3PGFL 1E7UA 4DGIL 3CFMA 3VSTA 4EKXA 5FCUL 3KYKL 3V4VL 5B8CB 4BUQA 2OZ4A 4BELD 1A6AA 3T77B 2FYVA 5GS0L 2K8QA 3RZCA 3BPOB 1EMTH 1XR8B 3MKKA 4URTB 5JOEA 2DBLH 4MQXC 4KY1L 5EZLA 4O51A 5F7DA 3EOBA 3TL5A 1ORQA 3FQNA 3G6JA 2R0ZL 4KDWA 2UUDH 3ZDYB 1JZJA 2NW2A 3D0AA 1MCFA 4ZMQA 5T1KA 4GKSA 1IGIL 5FF6B 4N8VB 3FFDB 3DUSA 4C8XA 4LSQL 3KYOB 2B8OT 2R15A 4RAUA 3EGXA 2E47A 4A6YB 4JFZH 4NC1C 1TETH 5DEGA 5JHDD 1PMYA 2IIJA 2RCSH 3CXDL 1U92A 3I2CH 1AE6H 4LQ1A 2QSCL 1X6NA 4ZS6C 1Y0LB 2EYTA 5FYLE 2R2BB 1BVKB 2Y3AA 4F3FA 2YA0A 4X4XB 3S88H 3ESMA 4QRPD 3AS0A 4TNFA 4PCKA 1OGTA 5F2FA 5DD5L 2XDHA 5AALA 3TEYA 2V2XA 2OJZH 2VQUA 4WO0A 1Q1JH 2UUDK 3QH3B 2CPCA 4NQDD 2W65B 3V0EA 3TN0C 2F08A 4KXZI 2HVKB 1CXHA 4A6YH 5BUPA 3H54A 4N9GA 1YY9D 4LP5A 2AQ3A 1C7SA 1R4XA 4PJHE 3RJQB 3MKGA 4HYTB 4PBXA 5GGVL 3SBWA 4RFOH 1KMGA 2WZ6A 3KDPB 1MFBL 4OZHE 2R39A 2VZ3A 5F9AC 1IC4H 3QCTH 3UYOD 1U30A 4JDVB 3VRLE 1QOKA 2WXNA 4N2MA 4NOFA 4BSVB 2X9YA 1BQKA 3ARFC 5F7NC 1A2YA 3LRGA 3SBWC 3QYCA 1SOXA 3IDNB 2G75B 3ME0A 1BEYL 2OMUA 2GHZA 1RKRA 3HKFA 4W6WB 1NIAA 2O6DA 1IFHL 3MV8D 3D07A 4V2BA 4FQIH 4RGNE 1KPUA 2GUYA 4UYPA 2XWDA 3L3GB 3BPNC 3WYRA 1PAMA 1Y18A 4GUQA 3GMLB 3IXAA 2HSIA 2AKRB 4XOCA 1LE9B 3ALWA 4HGKC 4UV7H 3D33A 3QXDB 3KYMA 4HOWA 4M5YH 3T2LA 3REVA 4P23B 3KEHA 4OZHB 5AVSB 3OXSB 4KV5E 1T5WA 1B2WH 2X3AA 4TMPA 4U1MB 5EN2A 5IQ9B 1XH2A 4HIHB 4U4IA 3P0VH 1B2WL 1HOEA 4RWHA 3RDTC 1F6LL 4OCYL 4H1LG 4H2CA 1LVEA 2VCOA 3MCLH 4OKVB 4YHMH 1KB3A 5D6DC 1AR2A 1M6UA 2KT6A 2V5MA 4OB5H 2DQTH 4H0IA 5AWNH 3V0WL 2VR9A 3AUWB 4PLJC 4QGTA 2MNWA 2B1AH 1CLCA 5DDHA 4TVPD 4LRIA 1BFTA 5H37G 2FSDA 3C6SA 4D2NA 1JWSB 1RJCA 1ZIBA 4ABVA 4FP8L 3KWWA 3FZUD 5INCA 2VLJD 4GG6B 2V2TA 1UACL 5GZOD 3U4EB 2XACC 3F83A 4U49A 1TU2B 1PBYA 1SMOA 4UQBA 1LD9A 4KRNA 5AVRB 4EN2A 5IESH 3VFPB 2ZCLH 1ZS8A 2DV6A 2BCMA 4HX1A 1NCCL 3DSNA 1NAMB 3K4ZA 1OAZH 5HHMD 3WKMH 4ELMA 2ZG3A 3P3UA 1CF8L 1XF4B 4OF5A 2XHNA 3T0WA 4LLMB 2PWDA 3KPRA 4R96B 2J73A 3C6LB 4BHUI 1BGXH 5HDQH 3UERA 4W9EC 3EXLA 1GS6X 2CKBB 4D0BA 2L4OA 4N87A 4N25A 4ACPA 5IUCA 2BO0A 2WXMA 4I3RL 5B4MD 1E4WH 1MCIA 4HUXA 5CKGA 4M9OA 2FIRT 1FA4A 3JVFC 3GXFA 2J44A 1A1NB 4ZW6A 4PBDA 4HKJB 3FCSA 4P59L 1I85C 1S7SA 5CMAA 5HY9A 3QSKB 4PB0H 1QRND 1J1PL 3ZJAA 4JFED 4XO5A 3OKOB 3R0NA 5CNHA 3HUJA 3MX0B 1LP9F 4BFIB 1T2QH 1CXLA 4M02A 5I73C 1DVFB 4ZAKD 3ZW3A 2ATAA 1F3JB 2WKOA 3VXUA 1B9ZA 2JMRA 1PNDA 3F5WA 3GIVB 4JJ5B 1F86A 5CF3A 5ESAB 4JPVL 2HH0L 1ZXKA 2CCLA 1RURH 3L3JA 3TA3B 3B2VH 3BIKA 3WY3A 2NY1B 3ARWA 4HALA 3RKDD 6CGTA 1LEIB 1NEUA 2EP6A 3M6DA 3T09A 4ISVA 5IVXE 1BXXA 3DTDA 3ECBB 4P5TA 4HKBA 5EA0L 1I9IH 5EC1B 2H8PA 3DV4B 4I5BB 4QWWC 5EO9A 5C09E 3SGEH 4JL1A 3FN0L 2FX9H 5LBSL 1QUNA 1PPIA 4TYUA 3ASNB 7PAZA 2GEQA 1Y6MR 2YLKA 4UU9B 1P4UA 2YPKA 3FSVA 3QJXA 3G08B 3U2SB 1T2JA 2GW5A 1SQMA 1P1ZA 1KBBA 3EJZD 1SLVA 1W6LA 4HPYH 2ENQA 1LO0L 2NYYD 3QB7C 2ODHA 3BKMH 1ZVSB 4DSYA 3NAAL 2X9ZA 1CLVA 1OCWL 4ZD3L 1U91B 4MZ2A 2XWBA 5EF3A 5SWZB 4F93B 3QUHA 2EH8L 1NCAH 4LSSL 3GZKA 2NZ9D 3BIAX 3HAEG 1N4XH 3ECQA 4H88L 3TO4D 2O61A 4LLUB 2OXGB 3MNWA 2B3IA 4XMLH 2NUTA 3VB8A 4X5LA 4BHUA 1ZA6A 1MRCL 1LHZA 1NMAH 1RZ8A 2YC1B 4MA7L 3QJUB 3HIZA 4NNYB 3L6FA 1ECZA 5CLZA 3VFWB 2GT9A 4KY2A 4NM4H 1MVYA 1NCGA 1DBAH 1W72H 1FFOA 3EGSB 4UM8B 5AAMA 4E2OA 4PGEA 4M4RA 5IVOA 1QEWA 4LHUB 1OPOA 4JDEB 3NCBB 3VW3L 4N0RA 5CUSL 5E23A 4ZFOL 1W8NA 1TJHL 3OLIA 2X9XA 2OCJA 4ONOA 4D0BB 1BLIA 4A2EA 4BE6A 1U6AL 2CDEB 3KXFB 3OKLB 1YC7A 3MCG1 1XFPA 3TVMA 2APXA 4YHOL 1YN7B 5DMKA 3FFCE 4ES9A 2HTKD 3W37A 2VWEC 4RRPG 2VDOL 4LEBA 4LHUG 2J56A 4LVEA 1ZHKA 2OYKA 3IPFA 3GUTB 4BDVB 3FU3A 1PYWA 3ABMB 5EU5A 2GJ6E 2GTZA 2E74C 2VERN 4NM8H 1QSZA 2HTLD 4PWEA 2VB5A 1EA9C 3GSNH 1AFVL 1A9EB 1EGJH 3SO3C 2VLJB 3VD5A 2XG4B 4IYKA 1J9QA 4HSAC 2DEYX 1TJMA 2E56A 3RJOA 4EF3A 4ZFOA 5HYQA 5D1XB 4N2FA 1W15A 4L9LA 2F53E 2GTWA 3IGKA 3UDWC 4H8QA 3MLYH 3DO3A 1NBQA 4YSUA 3FTVA 1FGVH 3PUCA 4NZUH 5CSBA 4KHXL 3UZVB 1A2YB 1W91A 4KMTL 1TVBA 1UWGH 4UM9D 4KAQH 3EJTA 4QJ4B 1OD9A 1T7XA 2FZ3B 3MCYA 4YHNA 4A37A 1LEIA 2Z92A 1OGTB 1CJYA 4KNTA 4RFNC 4Y4KC 3DRQA 4Y5VC 2PO6C 4GQZA 4YAQA 4TLKA 5I8OL 1U8HB 1A6AB 4F7PA 4JKMA 4YLCA 3EFFA 3LKOB 4N9GB 1Q8MA 2PPEA 4P46A 4ZTEA 4O5LH 4WFFE 1QSFD 3STBA 1N8OE 2ZUVA 2BRRL 4HPOH 3BMWA 5ENWB 4IGBB 1CGYA 7TAAA 2XY1A 4GH7B 5ANMA 5DZAA 5JA9A 5JPNC 2YWYA 3KDMA 2NW2B 2JFCA 4CN6A 4D7BA 2AJSL 4X6EA 3NJNA 3OC8A 3ZR6A 1MFVA 4RGOH 5FUCC 5T5NF 4MVBD 3APDA 3ARQA 1QRNA 1W8EA 1JDCA 4NAJA 3OKDB 1OXYA 1FSKC 2OMUB 2G60L 4FYRA 5T3ZH 3WNMA 1ZV9A 1C8PA 1QLRB 1QFWH 4KHTH 4KXDA 4QHLA 2OL3B 3SCMC 5EEXA 3T8MA 5ES4B 2YZ1A 4PD4J 3QIWC 3BC9A 4Y1TA 1GGBL 2FB4L 4GAFB 1BX2A 4WWKA 2JKIS 2EEAA 1VFBB 3MUZ1 3QEQE 3QIUB 3SDAB 2HLAA 3KPSD 4MZRA 4CC4A 3O6KL 1GXEA 1IAIM 3OX8A 2ALWA 3KD4A 1G7LB 4WV1C 1WCBA 2F53B 3PWLB 5I2IA 2FYYA 1KNOB 3S35L 4I3SH 5D1XE 1O5DT 5KTEH 3ZYIA 1SVZA 4NKQB 1DQTA 4IBTA 4UDUB 2H0EA 1A6TB 1KTKE 4AMKL 2ITCA 3UBHA 5E1GA 3SE8L 5E9DB 2YKLL 2QLYA 2IV9A 3RTQD 1DSWA 2FUQA 3SE8H 2GJ6B 4HG4K 5K93A 3FOLA 5C07E 3RL2B 5E4EC 3H42H 4XI5C 3T3ME 4JFFE 2CKBA 1I7UB 5DDHB 5HYSB 3MFFB 4P9HC 3TV3L 1AMXA 2FK9A 4N2GA 4J6RL 5E2VH 2Q87A 4NCDA 5D2NC 4XBGA 5KSAD 3LS4L 3SKMA 1J9SA 1UXWA 4HS3A 2WBKA 4HUUB 2JJTA 5I1EL 3U0WL 5AENA 1MJUH 3T2QA 2CHZA 2BDNH 1AGFB 4HX1B 1IL1A 4GRLC 4YHPB 4Z9KB 1E4KC 2K4WA 1DVXA 5B39G 1G0YR 3QEGL 1T1YB 4GG8A 4PJDA 2YRPA 4DF9A 1F90L 5B39A 3KGSA 1URZA 3BJ91 3OGCA 3GTTA 5J7CC 5DUML 2IV8A 2SODB 4PN6A 3T3PB 5C07A 3VXPA 3B2UD 3S37X 4JCWA 1AMYA 2IAMD 3CFTA 4XB8A 3NCYS 5DS8B 4JRXD 4NC2B 4CC4C 3VG9B 4HDIA 3TTSA 1D9KD 4M3KB 4OD2B 4W81A 4WO4C 3S3DB 1CMOA 4I48B 4Q9QL 3CSPA 1NGYA 2NPLX 1NA8A 2VSKB 1I8MB 3E9TA 4WWID 5G2NA 1EHLL 3MRGB 2LR4A 4PBWD 5GS0D 4NYLB 1QZNA 2B2XH 1UXMA 1JGLH 4WGKA 1FH5L 4J1UA 5J11B 3VI3A 3M7FB 3ZTCC 5L88H 3GMMB 4OIBA 4DP6X 3GRGA 2ETWA 3R1GL 4TLTA 3WUWA 4KU1A 4XPHH 2L04A 4M7KH 5IMKB 1DJIA 1HEHC 5HGGS 4PJ9A 5DHMC 4MD0A 3IWUA 43CAB 3WN5C 1T89A 3N55A 3ZTNL 1EZLA 3MRNA 4MFHA 3VMNA 1AKJB 3BGFC 5E2VL 5GJTL 3VD7A 4QTIL 1ETB1 1ZIAA 3LEYH 2AAVA 4M00A 3WXWL 2VSCA 4G8GE 4NQDA 3TBVA 4M6OL 4Y5XC 5ID1A 4G8EB 4E36A 4PJBE 4NNXB 3WFCL 2TSAA 4LKCB 5E1AB 1KYAA 3GI8L 5A7EA 1V3KA 1XAKA 2NY1C 4HWBA 1ML0A 1X5HA 4JZJC 2VZOA 4XNQB 4P07A 3MACH 4RGNC 4N2KA 4POZD 4BFIA 4AQAB 4OFYD 4L1HA 3LS4H 2CJ3A 4MNGB 4PJ6A 1I1AD 1KJ2A 2WBJC 3O4OC 3MODL 4LCUB 3TWYA 3HOGA 3FPXA 4RMBA 3E38A 2R4SH 4MAYA 2WOYA 4X7SH 4Y2DA 5ICXB 1C16A 1XGQB 5TDOA 3VFRB 2ZCKH 4P2RA 2AK4D 1M9WA 1IGCH 4K3EL 4YQXL 2I69A 3CFJB 3ULUE 1O0VA 4F5CE 3E1F1 5JIPA 2GYSA 3KPQB 1XT5A 1KBPA 4XXWC 2NT1A 2ZXGA 4PG2A 4UQ9A 3JWDL 3BKYL 3HS0C 4RRPA 3TU6A 4AYID 4FABL 1UTDA 1MI5D 4OZIF 2MCG1 3MJ7A 4YDMA 3ALXA 2GBVA 4FADA 3WAJA 2CDGA 1VEMA 3CZEA 4QMEA 1F41A 2ZE0A 1E6OL 1DHKA 4N0UA 4O2FA 1MJ8H 4UOZA 1QPXA 4M1CC 4RMUA 5L9DH 2OK0H 3KLSA 4ZFFA 1PY0A 3NAAH 4IKLA 1BAGA 4K71B 4P05A 3GSUB 2AEIT 5MEOB 1F11B 1KTDB 1JRHL 5GZOC 2FQEA 1V3LA 5G55A 1DL7L 1ACCA 3MRPB 3TPUB 4KPHL 1UD6A 3T04D 1GS8A 4LCIH 3ARGB 3JZYA 1TTGA 2KZ1B 3MR9B 2DJMA 3BO8B 1DBJL 3Q7JA 4K3GA 4PJIA 2CXGA 1ZA6B 3B9AA 4AM0B 2WBWB 1NLBH 2D8KA 1SBBA 3E6HB 3W1ZA 2V17H 4NRXA 4HJSA 2PABA 1F42A 4FQXB 5EU6E 4B97A 2BRRH 4Z7WE 2LGNA 3BP7B 3G6JF 5T1MB 1FL5B 5EOTB 4M8QA 5AVVB 3O6FD 4W9CC 1NGPH 5AZEH 2ICEC 3QJRB 2DD8L 4OGAC 3UTQB 3ZQ9A 1AHMA 2QDVA 3B8SA 4JRYA 3L48A 3HG1E 2AJXL 4D8PA 1TZAA 4XNBA 4XB7A 2Z92B 3LPFA 5DQDL 1O9ZA 4IRJC 1S7UA 4JVWA 2BY0A 4E9WA 5IHUL 3FQ2A 2IQAA 2WVTA 4LNVA 3SGKC 4G80B 2PF6A 1BF8A 3PWNB 1OCOB 3QRLA 2BNRD 4UOQA 2VXQA 4FYSA 2OMTB 4KJPD 4MBOA 3WE1A 4JRYD 1FNFA 3FAXA 4S1SH 1SYSA 2GI0A 3AU1A 5DFTA 4R97B 4PJCF 3RAJH 1YMHA 3WLWD 1XIWA 2ICES 3B3IA 5FPIA 2BINA 1MVUB 2UWEB 2E9BA 3P77B 4G3YH 2QKIB 2Y4SA 4HKZB 4QF1B 2VM4A 4Y19A 3FJTA 1GA2A 3DX4A 5D2LB 2J12B 4DVRH 5IIEB 1YNLL 1UWEH 2GC7C 3S5YA 3PQYB 4PYGA 4GBXB 2EO9A 4HULB 3WS6A 5L2KA 1SLUA 2FECI 3QWRA 1E9PB 5DJ8A 4MWFA 5IW6B 5KSBF 2F54E 3S36X 1O6SA 5JQ6L 1FL3B 3PE9A 1O75A 2X1PA 4RQQB 2W0LA 5DJCA 4DIXA 2V6HA 4XN1A 5IESL 5D5MA 3AXLB 2CHWA 4IIQB 2DPKA 3N50A 4Z7AA 1KGUA 3SDYH 4LIQL 1I8AA 4NQCB 4CBZA 5I1LB 1Z9NA 4TSBH 3JV4A 2BM3A 2CHDA 2NZ9C 3KPSB 1W72A 2YOAA 3PDOA 1HH6B 3QZNA 1CFTB 1SEBA 3MMEA 4WHCA 5AFAA 5HVHB 4F37K 1LWRA 1NCWL 3C6LC 4JZNA 2ROYA 1IT9H 1V3JA 3FUFA 2XWBB 4N26A 3CLFL 1QBAA 1A7PH 4AL8L 1L9OA 2NY0D 5KG9B 3TS8A 4MCYA 5IHWA 2LLNA 5CCKH 1IMHC 3O3BB 5BMFL 3RTQB 3I9GL 2AK4A 5C8JB 1DQDH 4OD2A 1OT2A 2PW1B 1JPEA 4MAYD 1GYVA 2IWKA 4AZ8A 4DUVA 3BE1H 1CDJA 2VYRE 4X8JA 1E5UI 1H8OA 1USZA 1I1AA 2D3LA 4B0MB 4IDJH 4LPXA 4U1SA 2Z6FA 2B3RA 3I9IA 1KCWA 1A3LL 3OGCB 4KO7A 3FHEA 4BQ9A 3V0IA 5F71A 2ESVB 1MI5B 4PRPD 3V6ZB 2EDNA 1JN6B 2XPZA 5JOPE 2NDFA 2KZWA 1GSKA 3IFNH 3A47A 4O2EA 2JKWA 4IOIB 3CXHJ 4KC3B 1PSKH 4RSVA 5C0IA 1MW3A 4RMVA 5IVXA 1QNIA 3TNNA 4I77H 4OM0H 2Q6WB 2GIMA 3O3UN 4GKNB 1U8QB 2WXGA 3GD1C 4NZ8A 1IC4L 3QCTL 4ZFGL 5DD1H 5E6RB 3ULVC 1J87A 1OGPA 3MV8B 3SPVA 4NQSB 4R7XA 5IOPA 3HS9A 4DVRL 3TJEL 1BFVH 1WV7T 3TYGL 2SEBA 4B7LA 4EIBA 4K4KA 4PJ9D 2VN3A 5D7KE 2J21A 3IDIA 3AC0A 1HEZA 3C5SA 3RVXD 4LIQE 4UT7H 3JWNE 1FO0L 4CL7A 5IOKA 4XVSL 4KZCA 5D9SA 4Z95H 2DMBA 5M95B 3BH9B 2KC0A 4R5XA 2M26A 3HPLB 1UKTA 3F6JA 3QJSB 4J3UA 4NNXA 3MUHL 3P1VA 2JV6A 4JFZL 2X4NB 1JWUB 1DEDA 4M93B 3K71B 4JPSA 4AGMA 3CN3A 3LZOA 2OMTA 3TO2B 2X1XR 4O4YH 4LB8A 4YZFE 3U1SH 1Z9MA 4TF4A 4FKKA 4CJ1A 5I75C 5F72S 1IBDA 4JUTA 4YBQC 4FG4A 5A2KH 2I25N 5KVDL 4YSTA 1NOFA 2XN9D 1S6NA 2XKUA 4J4PD 3K7UA 4WDIB 4YUEH 5HJ3A 3FB6A 3ZLQC 4GI9A 4OCSH 1OLLA 4U1GC 4XGZA 4F91B 3TEWA 2BOBA 5E4IA 2P5ED 3IGFA 4ORGB 2XA8H 4Z0BH 2E9WA 2VXUH 1PZCA 3POCA 4HJUA 2B15A 3M07A 5CR8A 3QAQA 3L1OH 4GKOA 4A1RA 5D7KD 4KFZC 3A4EA 3GPSA 2VH5H 2GJZA 2WB7A 4PJ7B 5LXGL 2Y7QB 4KXBA 5EBLA 2VR5A 4CN4A 3LQZA 3PIQB 2J6EA 2JKTM 3MLPA 4GYBA 4LCIL 1YEWA 1P5VA 4GEJA 4TSBL 3CFBA 3RP1A 3S3PA 1IM3B 2XTJE 3O8XC 4BFJA 4PM1A 2BSCA 1IJ9A 1CYGA 3FKUS 2XICA 3P9LA 4PB9L 3FTGB 4WCYH 3GXTA 3PWJA 2VXTL 3QIWB 3AM8A 4P2OC 1WK0A 1NIDA 1NBCA 3H3KA 4F37F 1FFNB 4TQIA 4LOUC 4BJLA 1AQ8A 2EIMB 1S7TA 1K4DA 2CDGB 3BAYA 3IFOA 1E6OH 1N6UA 4LSRL 1H6FA 5C2BL 4QXUH 2DQJL 5DJ6A 4KROB 4AIZA 3G6AA 4GIAA 3RWGA 1G1KA 1OSYA 3K0YA 1RHHB 4ZFFB 1KGJA 1T0NB 3K6DA 3RG1C 2BVPA 2D4FA 4AYBA 3QUZB 4O2FB 4KJYB 1ZGLA 2WNKA 3LRLA 1NCIA 2X2UA 5H94B 1TQSA 4EOWL 1FE8H 1KFAL 5IY5B 3ZSSA 1Q1JL 3FT9A 4P2RB 3VFSB 1JG9A 2X1QA 2PWFA 3GHEL 1BDYA 5EG6C 1BEYH 2YAMA 4XPBH 3DGGB 1NCHA 1R3IL 4N1EA 4IEFA 1MW2A 4GKSB 4LHJB 4PJFE 2X7LA 1C12B 5DZJA 5HDWA 1IBFA 3WNKA 2DM3A 2OTWA 4UNUA 4IRSC 4RIRA 3T9WA 2X4UB 4UT9A 1YEFL 4GI6A 5DHXB 1ORQB 3FQNB 4HJIA 2QR0A 2X4TA 1ORSB 1QLEB 3VFGL 3EBIA 1IBZA 2W81C 4J8RA 1M1SA 2XSKA 4D9QE 3H85A 3CMGA 3U46B 4FNLH 1KIUA 5EF2A 2C9QA 1FFQA 5I1DA 1X5ZA 5AVUB 2B14A 4A7QA 1F2XK 2MKWA 4F3FB 2JTDA 2I24N 1GCYA 1VPOL 4UT6A 4YDLC 2JI2A 2V3DA 5IG7B 4I0PB 1THCA 2BVEA 3MJWA 4NHCL 3ISYA 3O9WA 4U4BA 1HHKB 3VXQA 4GMTH 1A3QA 4K94L 4NO3A 1KBWA 2NUTB 2IAND 5SX5H 4JANA 3QAZC 4R4BA 3UTTA 2JQZA 1TQTA 3F7QA 4X8GA 4NQDB 1IGIH 1Z5YD 1F4YL 1A4CA 3K80A 1ILUA 2WWMD 5D7SL 4N6RA 1WE5A 3AWFA 2E75C 4NP4L 1MWOA 2CJUH 2EZ0D 4OZHA 1VGEH 4ZO8A 5KN5B 2Y7LA 1G6RB 3WSQH 2KKQA 1N67A 4CSPA 1T1XB 4E0RB 3VE0B 1X5AA 2BVYA 4PFEA 4GRLD 2QADB 1USQA 1YA5A 1IE5A 5HHXL 2ZOKA 4XCCH 4R26H 3PIQA 3FS9A 1MELA 1NDMB 2AKRA 1A7PL 4XOAA 1AQDB 4CN1A 3FSWA 4GG6A 4J3XA 1I1YA 1KZYA 1NCWH 3D69A 3LZQA 3VFWA 1UB5B 2CLRA 3BT2H 4PJIE 1AR1C 1KC5L 1PX4A 2M83A 4UTAL 4ZO9A 5AUMB 3IMTA 5F9WB 3J2PA 3FOMB 1CI3M 3JWNH 3Q5TA 4JY6A 4XWOC 1OGAA 1KCVL 3PFQA 1JXDA 1E3FA 2HT2D 3IN2A 4ZFOB 3SDDB 3STZA 4BZ2H 2IH1B 5CILL 4Q89A 3L3DB 3CFCH 1C5DB 4GQ9H 4HFUH 4IU2A 4RX4A 1BG9A 1FNGA 3C5ZB 4KJYA 4WTZG 5I1KL 5EUKA 3CFIC 2YBGA 4WHDA 2F19L 4A63A 2Q20A 2I7SA 4UQDA 5JW3L 4JDZA 1QFWM 2E76C 4Q0XH 12E8L 3BP4A 5DD0L 2IBGA 1GJWA 1LO5B 3MRJB 3S3CB 1AD0A 4NJ9L 1D5ZA 2H41A 3LHPH 5JLZA 3GSOB 2BMKB 5I5MA 2P1YA 2PCPB 3QQ4B 5GRJL 4MRBA 4WJKB 3HUJF 1KCKA 5E8PB 4U3CA 2LW3A 3DIFB 4GRLA 4JB9L 5F7WC 3RU8H 3F7LA 2AQNA 3IFPB 1KYOJ 5BQ7A 5KSUB 1H3XA 3A3YB 1BV8A 1WO2A 2VMJA 1CICD 4OJDH 3SQOL 3Q2LA 5JMRA 1HYSC 2FBOJ 3F01A 4AM0A 5L2JB 2X2JA 3T4AA 1NUDA 3WFBH 2HJFA 3EO9H 3FTZA 1KACB 3JV6A 3D25B 3CQQA 1Z2KA 5KSVB 2N01B 1MI5E 1NAMA 3FMGL 3MACL 1J0KA 1HDMA 2GPZA 3EOAA 2C7UB 1C7TA 4CMMA 3FTXA 4P2QE 4DGYH 4M7LL 1BM3H 2SEBB 3E8UL 5L4JA 1T0OA 1IM3D 3IKKA 1C1EL 5SX5K 3O9WD 4HD9A 3ZT7A 3FT3A 3FCSB 1E9QA 3C60C 1ACYH 3MA9H 4U1IB 3R8QA 3V52L 3Q13A 2OMZB 1K8IA 4HWNA 1OTSD 3CX2A 3S8FB 4OJFH 2BK8A 3GXNA 2EDTA 5DK0B 2VLKB 1Y07A 3WCYA 4R7DA 2QVMA 3QFJE 2WW8A 2Y2TA 3V10A 4I5BA 2VO8A 1NLBL 3OF6D 4G6ML 5CMAB 2LTQC 1JWUA 3O6ML 1ZTMA 4LLAA 3LKNA 4JFEA 3BIKB 3U36B 4W9JC 5D7HA 2COQA 4Q9RL 1J5DA 3RWJB 4OR1A 4EQ2A 4FCHA 5E6SB 5BXFB 5L6YH 1AQDA 4HKBB 5ITFA 3GGWB 3K2UL 5LJYH 4ELDA 4TUKL 5C0BB 4H26A 4TQEH 5K59E 4QHNB 1J1OL 3QXDA 1OK8A 3QAZB 1M9SA 4RGAA 4MA3B 1IFGA 3V7AE 5I5IA 1JL8A 3IPEA 3HS0B 3I6SA 3L7EB 1NKGA 1P1VA 5DQJA 5FFOA 5BRZB 4EUPA 4UQAA 3E8VA 2YA2A 4FQLL 3EADA 4GINA 4QXVA 3C8KA 4ZUWB 1J5CA 2CU9A 2R23B 2CGRL 5EU5B 2UWEE 1HHGA 4GP5B 1EAQA 4ZMPA 3LKQA 4QRBA 1OLZA 1QVOA 3GSRA 4X42A 3ZIMA 1BOGA 1MH5B 4O58H 2VLJA 1D7FA 4JKLA 3C6SB 4XO9A 5DWPA 5DMKB 3R18A 3DYOA 4KKCD 2N7BA 4ZFQA 4F58L 3N42F 3DOIA 5DJ6B 1C5BH 3W0WE 4S0SD 4F57L 2NY2C 1R19A 5AW6B 4Z7IA 4ZW3A 1OHZA 1PKOA 5CLWA 3QULB 5C0FB 1TU2A 1S7TB 5CBAB 3QA3B 1TJHH 2JKXA 5HYQB 3QG6A 1WLHA 1FN4B 2F5BH 4PGEB 3LKPA 3FH5A 3OR6B 4U6YB 3BKJH 1BLNB 3FONB 1XL6A 2ITFA 3ENEA 2XKNA 4P49A 3DO4A 1KB5L 5DA4A 3VXSB 5BZDB 1MIML 4PP2A 3MJ9A 2J72A 2Y7NA 4M6OH 5I18H 4KZDL 2YUWA 1MDTA 4OZIE 2F7PA 5DS8A 3ZTDC 5CGTA 2Y7QA 4K23H 4UILH 1U58B 3HTLX 5E5UB 4TSAH 1A7QH 2VDKH 2P7TA 4LLDB 2W60A 5GGRB 5T3ZD 1YN7A 4R26L 3V9CA 3JTSB 5GS1A 4LCWE 4E41E 3BKML 1HKFA 4P99A 4Z5RA 1U8JB 2EXYC 3QFDB 5K39B 3F2LA 4OQTA 3NJGA 3W11D 3S5LG 1PDKA 4XNXL 3V4UH 3RI5F 1DQIA 2IALA 1RUPH 1SHMA 3FO1B 5C6WH 3I3DA 5ELIA 4BINA 5EEYA 2B1HL 1WUNT 3FT1A 1M7XA 2ZX8A 4F1ZA 4FAAB 1SYVB 5DC0A 3MUUA 3MA7A 4N9OB 3MV9D 4U0RB 4RGOL 3MXWH 1M2VB 4Y4KA 1KXTB 1MY7A 5T33H 2ZWZA 2HPTA 4Z3JA 3BJLA 1CE1H 4KRPC 4PYHA 4BUHA 5DVPA 2FUTA 4JFXB 4NHCH 4JJOA 2AHIA 3L3JB 1HHKA 3TA3A 3VXQB 4P2QA 5DRZA 1W0VB 5AYTA 1G7IA 4JY4A 3MRBA 3SE3C 3FU6A 1EGJL 1T20A 5C92A 3ULVH 4B9ZA 5I30L 1R0AH 3LNGA 1QA9B 1FHGA 1FORH 3D2UD 3L9EA 1HT6A 4U6XB 1G7JA 1OB0A 2BDNL 5CJ5A 1D5IH 2MIZA 5HY9B 3ORJA 5I1EH 5I8KH 2XN2A 5GXBB 2Z4QA 2FYYB 1FLRL 2PWHA 3WIAA 4JFUA 2C7FA 3BP5B 3ETBF 1HQRA 4NKIH 4UANA 4ZUUB 4S11A 3W0WB 1S9XB 4P59H 4UMSA 5K9QI 1JTPA 3VD4A 4PW9A 3BWAB 5B3NA 3BPNB 2QPFA 1A02N 1VKXA 3SQOH 1KFGA 5CU5A 4KZEH 4FNTA 5HSFA 1NOLA 2ERJB 4X4ME 3RZCD 4EQ3A 4AEEA 1YMMB 4QHLB 1G1OA 2ZKHH 4NRYB 3RUGE 4PJEA 1MFAL 3AG3B 3ES6A 3S3BB 2A0LD 3V6OE 1L9NA 1JPST 1P9MC 4HP5A 2R59A 1OARL 1KXQA 3VGGA 1FRGL 4HLJA 1XEUA 2JB5L 1L7IH 3TGXA 3ARVA 5AB9A 3RFZC 1T7VA 4WTQA 4AY0A 2VDNB 3WNOA 4X8XA 1JF6A 4ZK8A 4Z7VF 2EH8H 3V5HA 4KKLC 2ZUYA 2E5EA 3QUKB 2DTSA 3HNTL 4PREB 2CD0A 1DUYB 4P46C 3DTXB 3Q5YA 4GY4A 1QEXA 3BSGA 1K2DA 1KCUH 2EDHA 2VXVH 2IO5A 3I3EA 4NQEE 4JGNA 5EU4A 3TBCA 3ULSB 2Z1PA 1RK0B 3FQWA 3L3DA 3MLWL 5I9QC 4G43B 4F8LA 1MRFH 5C6PB 1XR8A 2BFVH 2HXAA 3HFMH 2O72A 5I74B 1AXSB 3ZZSA 2E7MA 1JK9A 3TFKC 3FUDA 1GGIH 2A2QT 1T03H 3QJTB 4NRZA 1CS6A 1O7DE 4GSUA 4FQHB 3WUWG 2GSIB 2WIIA 2QPSA 1O6TA 4QHKJ 4RDBA 3OM3B 3DDFA 3T3MF 4P3CL 2VT0A 1A47A 3U2JA 3VA6A 3B8YA 4OB5L 3S96B 3U1PA 1BREA 1DVTA 3GYRA 4PWHA 1HL9A 4ZAKC 4ZTOH 4FI8A 4XCCL 1JGVL 3QWNA 1VLXA 3MRKB 1NCTA 1SLWA 2ZPKH 4IOSA 3TX4A 1DTUA 5EIQA 5A6IA 5E2WH 1I31A 2O6EA 3I74A 3PLYA 5B8CC 1IL1B 1FNGB 1MF2H 3MRQA 4TSCH 2ORBL 1BQHG 1IZKA 1U8PB 1WFJA 3EOAB 4JDTL 4Y1AA 4Y4FB 2YRBA 1F4YH 4IJTA 2W60B 3FL7A 2CKNA 2N1TE 2XTJD 3D25A 4H8UA 5FGBA 5GGRA 4C59B 1G7HB 1Q9LB 4MQSB 5ILTH 4ZNEE 4P2QB 1UWGL 1SM3L 4NWTL 5TH2A 3G5XB 2BZ7A 4TLUA 5BO1L 4D94A 3VFMA 4NUJB 5LUMA 4UCFA 2V33A 1FL6B 1RUQL 2D2OA 4V33A 3BEWB 4OLWL 5MEQA 4UDTB 4JG9A 2HTLC 3O9WB 3NZHH 1FO0H 4K8RH 3OKYA 4NQCA 3RA7H 1IUZA 3SE9L 1ZHBB 1G6VK 5KYUB 1NUFA 1OAXL 3RVWC 3OZKA 3FT2A 1E5YA 2OXHB 3N1GC 3NCEB 2IFFH 4JPKL 3NN8B 1XD0A 3KPPA 4X6BB 1JYWA 3WUWB 2QV2A 1XHHA 2X4SA 4ABQA 2J88L 1E9PA 1IGJA 5DJ8B 2F9BT 3U4BH 3U7YL 2G2NA 1Z6JT 2MNJB 3NEXA 1RV6X 4AT6B 1FZMB 1KLGA 3RIAF 3DO7B 2FX7L 3O41A 4EE2A 4JS7A 4EPSA 5DZLA 5FW7A 5HBBA 3IE9A 3LEXA 3BVNA 3MNZB 5LWYL 1TIUA 4U31A 2GIXA 3C8KB 4ZUWA 3J7HA 4MCZB 1KB5A 5IJVA 3S2AA 4Z1PA 1PTZA 1SUHA 3D85D 4LARH 1HXKA 3CK0H 3BE1L 5I5JA 2JJUA 3DK0A 5ABDE 3EKCA 4QJ3B 5E1IA 3HRPA 1U4FA 2WYZA 1P4LA 1OP3H 5EIIA 2G30A 3MCLL 4J3BA 1KYOK 4TM9A 1HKLL 4OCYH 4F8QA 4K07A 4HAFA 4X4YB 1WIUA 4QRSA 5T5FH 3QFJB 4L29A 4DGIH 5EEWA 1J1XL 1DQKA 3ULVE 4O51B 5F7DB 4OLVL 1BZ8A 1AANA 1GVIA 1OAQH 2R2CA 4X9YA 3Q6FA 3RZCB 4PJFB 2XVKA 5EN3A 3RE0A 1DQLH 3QEHB 1BZ9A 5A6LA 1YNKH 4B9JA 2V4LA 2YS4A 5KYXA 4OFYA 5EU3B 1BBDL 1HWHB 4PW3A 5FLUA 4GO6B 1XTLA 4LLYA 4P4RB 4YIQB 3II2A 1EBAA 3MV7D 2DIAA 4PWGA 2Y25A 4RETB 5EA0H 1VENA 5FO7B 1GZPB 2GUOB 3VYPA 1FAKT 4B3EA 4KTYA 3VFTB 4BWTA 4TUOB 5DC2A 3T6XA 3SY0A 2W91A 2EUZA 3AGVA 3G5YA 1JPGB 1MAJA 3T0EB 3QZWA 4AENB 3MGTA 5DSCA 1JXKA 4HD5A 1XGPA 1A7RH 1K8DB 1PIFA 3TA3D 2DQMA 5KVDH 1GC1H 2XXFA 3NA9L 5F9DC 4UQ2A 2R27A 2ADIB 3GSUA 2VLJE 2BVQA 1JVOA 3F64A 3K1DA 2ZUWA 4QT5A 1G9MH 1ET5A 1LXMA 3JT2A 3CNKA 4HUCA 5LO7A 3A22A 2WLJA 1HHHB 1NGYB 1HAUA 3MLZH 3ROOA 4OH2A 3K6IA 3SKOB 2DIBA 3EHBD 4XTRC 2V0AA 3LIUA 4OVVA 5TE4H 1AR1D 4FQCH 5GGQH 3AREC 3HPJB 2YRZA 1J05B 3L5WB 4PIBA 2EDEA 3HPLA 4G71B 4J3OF 4ZODA 3GFUA 3OD3A 4H8VA 2WSKA 4LPVA 3SDCC 4LVNB 4UI2A 4AMWA 1RAMA 3ZKSD 5AQ0A 5B39B 4FFZL 3MRBB 1Q90A 1J11A 4W9HC 4JRYE 4WI2A 2P5EB 4L18A 3IDJA 1JWSA 3D2UA 3LH2L 2CLVB 5DF0A 4A68A 4JRFA 5C7XL 1FL6A 3VGDA 2QBWA 3E0GA 3OQRA 1GTNA 3HZYA 2Q8AL 4APXB 3EYOB 4B6ZA 1CYWA 4FXLA 4HZLB 5F88B 3EDDA 1BZEA 1D9KC 1UA3A 3D39A 2EDKA 2JK5B 1S9XA 2IAMC 4YDVB 3TH2T 1NCBL 2IDFA 2X40A 4WKZB 1NFDE 4AE1A 3C12A 3DSNB 4ELMB 3KYKH 3O6FB 3V4VH 3VQ2C 4OJYA 4Y4KD 2WGNB 2QPEB 3IF1A 2Q9OA 3MV9A 5DT1H 4Z78B 4UTBL 1IKNA 3ZYJA 4TRPL 1LP9E 3BD5A 1NL0L 2EECA 3MGOA 4X83A 3RY4A 1YLBB 1WBYA 3MRCA 1P9MA 3MDJA 3GRWA 5DZOA 8FABA 4L4VA 4KH2A 1JZEA 3NJLA 2B5IB 3CFDB 1AKJA 4NKDA 3NSJA 1JYVA 3EGDA 2R0ZH 2ICEA 2RA1A 4X4ZA 2C8NA 3AY4A 1JWMB 4MX7A 4DTGL 2YO3A 1ODUA 2MWCA 4LHQB 4YL4A 4DKFH 3WHXB 5IEHA 3SPJA 3GBNL 4NPJA 3RTQA 3P4OB 4Y5XB 2CDFA 4ATTA 1I8LA 4K7PX 5IQ9A 4E68A 1MCOH 1NFDB 3X1EA 2YA1A 2BP0B 1YECH 3OZ9L 43C9A 1OPGL 4FG2A 2C26A 4JK0D 4MDIB 2XA3A 3BQUA 4NO0D 4PQXA 2ZUSA 3I50H 5FV2A 3WJLA 5T1DL 2OX5B 4ZDHA 2PXYD 3MGAA 2GHWB 2XJKA 1T0MA 3ZGIA 1OALA 3K1KC 4JM4H 3EYVB 1IAIL 2D7TH 3FK3A 4FA6A 4HEMA 1Z5LB 1A1MB 4OLZL 2BZCA 3KPSA 5AW7B 1JZ2A 4MNHB 3WDJA 1N6QL 5CWSB 2RHEA 1CXIA 1A1NA 1SDDB 2J1YA 1L0YA 4NN6B 3DETC 4EIUA 5CCHE 3AY2A 5F3BB 4YXLL 3GQFA 3AS3A 2GIYA 3BP6A 4E42B 1FV1B 4TNWK 1GCFA 2OAAA 2R4SL 3C5SB 5EU3A 5E1QA 2CRMA 2CUMA 3HPJA 3LJ3A 1CPUA 1T7ZA 5ISZB 1E43A 1GW6A 4TOYH 2J1XA 1BLNA 1BECA 5JUEL 3TURA 2B39A 4QHKI 2H3XC 3E2HB 2Q0ZX 4LSPL 2VZTA 2YPLA 4JRLA 4DCQA 5PAZA 4N0UB 4G7YL 1UYWH 5HPMB 3U46A 4NKOA 1NFDF 3TJHD 1NIFA 4M62L 2UXFA 5F7AA 2XT1B 3KCPA 5AYUL 1ZT7B 1AXTL 1BBJB 2YFOA 1I8KA 3BHBA 3ULAB 4O2EB 5IK3A 1AH1A 3KVDD 2CLVA 3G9AB 1OD7A 4HBQA 4J3WA 3U9PH 4WJ5B 1MY5A 1UT2A 3QW9A 1CE6B 4EDXB 4XWGH 3QNZA 3RVTD 1QUNB 4ERSL 5C0BD 2IOIA 3S4SB 1PF3A 2EIKB 4PG9A 3SYAA 4KNSA 2XTJB 2H7WA 3NSDA 4WUKL 3V7AG 1CU4L 1KOAA 3CH1B 4U3HA 1IAKA 3TBTA 3RPBA 2COVD 4B95C 2D9CA 3BFOA 3M17B 1XXDC 3CIAA 1X9LA 4EEEA 5E00B 2FQGA 5CINL 3WLBB 3V0JA 2ZKMX 3GNML 3GMPB 4OZHF 4JJ5A 5D2LA 5IIEA 1Y1DA 3UTQA 3MREB 3IRCA 5F44A 2BOCA 1MOEA 4LMQE 4FXGB 5KYWA 1Z9SA 2Y36L 1INDH 1XH0A 4JKPH 3REWB 5JXAH 1VHPA 3P9LB 3SODB 5C97A 5KS9A 2QT6A 1MFDH 4PJHF 3WGUB 35C8L 5F1OB 2HKHL 3AB0C 3NEOA 3TYFA 4G1MB 4JQXC 2CRIA 3KJ6H 4OZFB 5HI3D 3S36L 1LM8V 1CN4A 3EOYG 3GMLA 1ADQA 1JPTH 3IXAB 4Y2OB 2DYPB 4D9LL 4R6UA 1T66D 5EIIG 4LEOB 1S9WA 2QSVA 3DX8A 1IM3A 3RNQA 1TEGA 5MEQB 1T0NA 2OW6A 3DETD 4Q6IA 3NPZB 4MD4B 4DNLA 4N3UA 2E6QA 3TONA 2YAQA 5B4MC 3E7JA 1OE1A 1BWWA 2MCMA 3F7KA 2GAZB 2X2IA 4PWIA 1YEGH 1OK0A 1CICB 1IGTA 1W80A 1L7TL 1BM7A 3OAZK 4HJ0D 2AQPA 2DL9A 5A16B 1JGIA 4Y9BA 5FUCE 2GSGA 2Y7SA 1ZT1A 4ODVH 4PRNB 3MJ8B 4R8WL 4JFFA 4M1DH 5IEHB 5TF1H 3ULVF 1JZ5A 2YMXL 3NTCL 3ARUA 4JRXB 1AD9B 5CEYA 1SJHB 3GB7B 4JFFD 1CD1B 3DUUA 4E5XB 2A83A 4WI3A 1QEWB 1BPLB 1TJGL 4OGYH 4YSPA 1P5UC 1EHNA 2BWDA 3NCFB 3MRRA 5GSVA 3HI6H 4MCNA 4BCXA 4HHAA 5D2NA 3WENA 3JWNG 2C5DC 2EDWA 3QFGA 1KZQA 1M7DA 5GGSY 4AV0A 1ET7A 4LSUH 2P45B 3LIZA 1NL0H 3O3DA 4XH2A 3BYTA 4X6CF 4DVBA 5E99L 2OULB 4G11A 4KROD 2VOTA 4LCYB 1OGAD 5LVEA 4IRSB 1RIVL 1HQ4B 3LH8A 3N1PC 3QNYA 3CPLA 3OAYH 4O02H 4OFQA 4YOKA 4D8OA 2AJVH 2RACA 5LDUA 1JHTA 2C9XA 3BPCA 2FBJH 3PHSA 4FQQA 2BVQB 3MRQB 2H45A 3CQFA 2AFNA 4V11A 3M17A 5DK2A 2DN7A 3CH1A 4Y7MA 4IMLA 2RTTA 1OCCB 2ADYA 1H3GA 3ESPA 3AROA 2D03H 5CZXC 5C7XH 3LEYL 4OLUL 3BVDB 3K5RA 1Q72L 1D2OA 4Z7WB 3ERXA 2MCPH 3CFUA 4PJAA 4MJ6A 1ADQL 5AVQB 2NY6B 3T2NH 1NOAA 3B2MA 2C9UA 5I6XC 5L8JB 1BAWA 2NY2D 4PS3A 1BHGA 4B5EA 1O7DC 2EH7H 4MXVE 4CKVX 5IM7A 4Y88A 1ETJA 2QELA 3BUYB 1KGCE 3N5AA 5E08H 2K45A 1SJMA 2Z35B 4Q58C 1NGXB 3KR3H 4TUJA 1XAUA 1BVLA 1A9BA 5K1NA 1MF2L 2OL3A 4QTHB 1CLOH 5E00A 2XWZA 1NQBA 3WBDA 5I66A 3CC1A 4BSWA 2PN5A 2XQYG 4GW1A 4D9QD 5EMYA 5A3ID 3O2VH 1L3WA 1SDAB 4EKJA 3DBSA 4NDMB 1FNSL 32C2B 3MO1A 2EEDA 1JGVH 4WW2B 4XNZC 4XPGH 5AW8B 1IGML 4MB3A 2HKAA 2EDOA 1PG7L 4NN7B 4XGZB 1TMQA 5FYJH 4WEUD 3EYSL 5C08B 1QHQA 3RZWA 4XODA 4OKDA 5I6NA 2CUIA 1F4WL 1MXGA 2HFFA 3D9AH 5KS9B 4L5FH 2WMPA 4FLQA 3LRHA 4GRLB 4U2YA 5AD0A 4YHIB 4U1GB 5FS5A 5MHSE 1Y6NR 2WXQA 1Z5HA 5D93B 4L9LC 4N0FB 2ZX5A 2R7EA 4JG1H 2WLLB 4NUPA 5K9JH 1ZE3C 1I8MA 1FGNH 4OU3A 3MRJA 4JUSA 4F2FA 1P84K 3HE6A 1H15B 5D71H 1EEYB 2AZAA 1NM9A 5F1NB 2A9ML 4YE4L 3WFZA 5C09A 1K4DB 1KN4L 3TF7C 1UWYA 2D73A 2F5AL 2APWA 2YD7A 3HG1B 1YY8B 3IU4L 3TWCL 2A1WH 5FA3A 4N8CH 1TZGH 3BQUD 4OM1L 5A2LH 4LARL 2WYIA 3VXMB 2H0JA 2V8MA 4YPGA 4DP8X 2VDPB 1RJYB 2E7BA 1D5ZB 4XP9H 4M61A 4HEPA 3IJSA 1LWHA 2X09A 4G8GB 1MW1A 1G9EA 5EU6B 1TR7A 2RH0A 3E6FA 1K3ZA 3KLQA 1GS7A 3SOTA 4K5MA 3GS0A 2HZHA 5AZ2H 4LF3A 5I19H 2YHGA 1BQLL 3HZMB 4TVUA 3VDAA 1BZ7A 1NC4B 3SGJA 3DURA 4M8UA 2DMKA 1EUTA 3F7RA 3SEPA 5ICZB 2FRGP 2G3MA 2Y6SC 4N20A 1QFWL 4KVNL 4F9PA 2WB1A 4FQJL 4L4VD 1KJ3L 4P2OB 3UAEA 3EDJA 3WFHA 2WLMA 5MERA 2P24A 5E6YA 4OZFH 4GSRA 1CFSA 5DMGC 5JDSB 1SUJA 3QJHB 4YJZL 3SY0B 5BV7C 3SKNB 1KG0B 3QNZB 2AJSH 4Z3GA 4F2ME 2E9JA 5JYLA 1K4CA 5GSVB 5HHMB 2EABA 5IKCB 3F7YA 3NFPB 2ZXWB 4NWUH 4XP6H 4KKAD 4WI5A 3T0EC 1XQ4A 4OZIB 3E9UA 4G1MA 2VABB 1FAIH 2JSFA 4WI6A 3MTXA 2DIJA 4JO3H 4M5ZL 4OLXL 4RLDA 5AKVA 4UBDD 2CAKA 4GS7C 5AOKA 1XV8A 5ITBL 2A77L 3MXWL 4POYA 1MREH 5IEKA 2R29A 1UWFA 3BDYH 1I7RB 3SGDI 3RY5A 4KXAA 4C56D 5AKRA 4TTGA 3QHFH 1S7QB 4PRPA 4FE9A 4MA3A 2VDRB 4X6CE 4FN0A 2ERJC 4AQ1A 3QPQC 5JIHA 2H1XA 3ZIYA 3ZYZA 5F88A 4TSCL 2YN3A 4KTGA 1DUYA 1JNJA 2CK2A 1M4KA 3BH4A 3ZE0B 4XX1G 1CGTA 1TZHA 2DQEL 4PMFA 2YGVA 3JUZA 3TASA 3CN2A 1B6UA 3WU1A 1A4JA 1DN0A 2AMGA 2WLYA 3MPCA 4FI7A 1U33A 5FYJU 3JTTA 1AP2B 5I75B 3NH7L 1E4KA 1QFUH 2G5RA 2Z64C 4I8DA 5CEZL 3PCYA 4NLHA 3HG0A 3UO1L 4OCNC 1PG7W 1ULVA 3TPKA 1NLDH 4RA0C 3UC0H 4YXHH 3VXUE 4X0NA 4BFNA 2I07A 2ARJQ 1E6JL 3CSFA 4GW5A 2VDNL 4O2CA 1KJ3H 3FU8A 2A1WL 3PWLA 3Q8BA 2K3HA 2J43A 3LKPB 5IHBA 2ZXBA 2B59A 3BVXA 4PJ8C 4UTBA 5BVPL 1WAEA 3ATBA 1XF4A 3T2PA 5C0FA 4C47A 4AQEA 2ZCLL 2Z0BA 3H0TA 4AUYA 3FSZA 1RFDH 4BZ1H 4K7PY 5B8CA 1CGWA 5E6IA 2XCMC 3KJ4B 1KYFA 3RWCB 4XP4L 2H1LM 3CC5B 5AG9A 2Y06L 3RX8A 2QQLH 4JAMA 3VXRA 3BAEH 1HHGB 5T3XD 1L0PA 1TZGL 5DJZA 1JK8A 1ITCA 1I9JH 2WP3T 3EDEA 5DS1A 4F15B 1CD0A 1KGCD 2AXWA 1ED3B 3ZRCC 1HYSD 3IXTB 2UWEF 3ZKXB 3FO0H 2AI0H 2QQKL 4G6JH 4UIKL 1CGSL 2VN5A 2D9QB 2G9HB 3UEQA 2RAMA 1A8JH 1UXSA 1OO2A 1DANT 2J20A 5IBTH 3Q01A 5E24E 5I0DA 3QNYB 1W0YT 1HZLA 4NYLA 3FFCB 2UYLB 1KJVA 5L4FA 4HKZA 4QF1A 1L9SA 4WEMB 3PYCA 3PL6B 1Z5LA 3L2LA 5LBGA 4Y89A 1ZJBA 1L6PA 4JQXA 4HJGA 3VFUB 5A40E 2Q86A 5I8KL 1RUMH 4AW4A 4IBUA 3L3OA 3SGDH 2XFGB 2EXTA 2CQVA 1SXBA 2VE6B 3TOPA 3B37A 3CMOH 5FYKH 5IMOA 4CMMB 4U3SA 3FFOA 2H0FA 1E4HA 4E42A 1Z0MA 2JKRM 3FQXB 3DX6A 4AC2A 1H3TA 5ECGA 1NDGA 5IVXF 3WDHA 4XPAH 4PJEF 4OCLC 3H3BC 1SJHA 3PWUB 2EUVA 3IDNA 3TCTA 5HHOD 3OAUH 3B2VL 4M8VA 1JD7A 4Q2ZA 1SYSB 3KJ6L 1J5IA 4Y19D 5DC9B 3FQTA 3HN8A 3RRQA 3NK3A 4XC1L 3SE6A 1UFUA 1XIWD 2CO4A 4A6YL 3TO2A 3NMEA 4KVNH 1E0OB 4PB0L 3T0VA 4DHLA 1S7VA 4R3SA 5C0AB 4YHZH 4XNXH 3EYQC 5IW6A 2V2XB 1MHPH 4YSRA 4NQDE 3QIBB 4FJZA 2CZNA 2YQ2A 2Z31A 4HSCX 1KEGL 2FTAA 2WLLA 3LXAA 2Q8BH 1TTBA 4R83A 4R0LB 5E56A 1FFOB 4BA8A 4JGMA 2WN3A 4CBPA 4HVBA 4JHUA 3NP3A 4IQHA 2QKIC 2IWFA 3R0MA 1U8KB 1NEZG 5I18L 3T71A 2XWCA 4U33A 4KZDH 2D3VA 2P5PA 1F1GA 4JDVA 4PIRF 3DBXB 1FNEB 5IFAL 2ZIDA 3FUMA 3L3OC 3VMOA 2F5AH 1X4YA 4YE4H 4RAVB 3QDJE 2DL2A 2WZ5A 4UQCA 3QFJA 3MAWA 4L29B 3FU0A 3STLA 3GSVA 4QRTB 3MJ9H 4XAWL 1DJZA 4UQ2B 1BVZA 3MLRH 3A4AA 4P2RD 1AXIB 4XHJC 5FV1L 3RY6C 4F5CA 5HYJE 3S98A 4YSCA 2I32A 4ZI8A 5IFHL 1YEGL 2AJYL 2AK4E 2WANA 3HJEA 2UYLA 3HRZA 2WQUA 4L8SC 2YBRA 3RIAK 4U1SB 4P4RA 2HJLA 4NC1E 5FECA 1J5OH 2XIDA 1A6PA 2PETA 4NQQA 2Y22A 4X8CA 2XIIA 3CVCA 3KYOA 4LEXL 1MJ7H 3GBMH 1WIOA 3G5YB 4AYGA 2H32B 1H5BC 4ALAL 1MSPA 3C8DA 2ZXEB 3L1EA 4XPTL 5KWYC 1KC5H 3L17A 1U8HA 3H4FA 3GS4A 3NCCB 3MBED 4PP1C 1TPXC 4HH9B 3DRQB 3FQXA 3QQNA 2OSLB 2WCPA 1T6WA 2PP8A 4K71C 3LZFL 4H5SB 4N86A 4OLEA 3H4HA 1CT8B 3K5SA 3DECA 2YQBA 2JH2A 1CG9A 5B7EA 1EXGA 4A2GA 1PZAA 3DX2A 3FQYA 4PJ8B 5FB8B 3W2DL 1EEZA 4XX5A 2IPTH 2OXHA 2RR3A 4MMYB 5AAPA 4OF7A 2HUEA 1JHTB 1J7VR 1KY6A 1MCDA 1NGQH 2VAAA 3UABA 2BSBA 4HKJA 3FTWA 5FAAA 4X5XA 1KBGL 1WC7B 2R56H 3DYMA 3SOBL 5IHZB 4Z7OE 3KBHE 4JCMA 4C4KT 3MLSH 5D8JH 4XMPL 1AC6A 3GO1L 1IO4C 4H25A 1NAML 3QJHA 5SX4I 3VRLF 4FG0A 3UJIL 1YMHB 5MERB 1M2VA 4Y4KB 2YXWA 3P30L 4ELKA 1IC5L 5IKCA 4XWGL 3O2DH 1OW0A 4OW6A 5DYOB 2VRAA 1WZAA 2XIBA 3X11A 4ETQA 2ZSVB 2ADJA 3DHUA 5BVJB 5I28A 3F7PC 4R7NA 2CWRA 3NA4A 4LF3B 2IG2H 4PLKC 5AVZB 4P2QD 3WHXA 1C5CH 3IFLL 2IG2L 2AJ3A 3KW7A 4AYDC 1YEJL 2AXHA 2IAMB 3JBG7 5D1ZD 3JWOL 1G7JB 2AJVL 3DLQR 4FL4C 1I4FA 3CJJA 4CNIB 1CGXA 4WW1B 3RWIA 3OMAB 4D0DB 3H7LA 4MYWB 4QAWA 5F6IB 2H47C 4HK0B 5EDSA 5AVWB 5BV7L 4M9PA 5ABZA 4HIJA 3MRIA 2R9HD 1QNZL 3HHRB 4QD2E 1NAKL 1CFSB 5JDSA 2EXWC 4KDVA 3QRBA 4GRWF 4BWUA 1EFXD 4M56A 4YDIH 5IR1B 4R4ND 3IK2A 2X38A 4TL5A 2CIKA 2VUKA 3OJ2C 5L4MA 1LTXA 3DHPA 3HNSH 2FEEL 4IHOA 4UUJB 4Y8AA 1BQSA 2E9IA 3QK0A 5DO2D 2FJFB 4YFLF 2VQTA 1J0HA 1QTSA 4K2UL 3JTTB 4YSAA 5BW7C 4ABWA 1KTLA 2F7RA 1UXWB 3M86A 4X0KB 3G5ZA 1A7NH 1RZ8B 4NNYA 3P0YH 5AOJA 5HHVL 5M7QA 4MNQE 2RALA 1GYCA 1IAIH 2D7TL 5DD3H 1DEEB 3I6KA 2OXGA 3MNWB 1G7PA 3NFNB 5CD3B 5L7XL 4IBSA 5C07D 2K3TA 4K5OA 3QDGB 4FFYA 2JIXB 3IFOB 5JW3H 4DK5A 3K91A 1CDIA 4ODUA 1SF5A 4X5WA 4BUGA 2K6YA 4Q4EA 3ELQA 1Q38A 2Q1EA 3IJEA 4E9YA 2ZJSH 1W0WA 1FH2A 1Q9OA 4BM7A 4PCYA 3GBNH 3OB8A 3AGWA 4F8NA 1K85A 3DVGB 1V3MA 2CBQA 5AW9B 3L54A 2PYEB 3O2WH 4FNSA 1U3YA 3L45A 2WC7A 1INQA 2JCCA 1I8IA 3D4ZA 5JQHC 1J5OL 3H9SD 4LK4A 1F8TL 1GGYA 1JK8B 2DMCA 1RJYA 2ZOLA 1RK1A 5CGBA 4C57C 1SF3A 3QNFA 4EIGB 4YAQB 4F8TA 1NDGB 4K5NA 4OT1H 3BUBA 1OTTD 3HMWH 5JIMA 4LO9A 4AZ8B 4CVWA 2JELL 3QUXC 5FUOL 5GRYA 3ZMEA 4JLRA 3CN1A 2O5ZH 4UT6L 2FQDA 4OQTH 1J0YA 2ZUQC 3JWDC 4G7RB 3TBBA 3ZL1A 5A7BA 3QUKA 4KOCA 3BRFA 4NC0B 4P0DA 1A6UH 2GTWB 3ZSTA 3PL6A 2YAHA 4JCLA 4AQEB 1ZSDB 3MREA 5GRUL 1N9PA 2EEFA 5D1XA 2CJUL 1UM6L 2ADJB 1RL1A 3UPAA 5LGHL 3I75A 1CBJA 1T66C 2QPDB 2WKGA 3KPSE 4KRPD 1D3CA 3FO2A 2YD3A 3EJUA 4NS0A 5ENWA 4H4NA 4ISVB 1QATA 4JANB 5I9QB 4IOIA 4GXVL 4JGUA 4CSSA 4E9LA 1NAKH 1FYHB 4M03A 5TDPA 3D18B 1FZKB 3FRUB 4WWKD 5DRNA 1X44A 4Y9CA 2ZKYA 4IU3B 4PJBA 2J2ZA 4M7ZB 5C3TA 2FHBA 2AABH 4PJDF 2BNUB 4MASA 3LQAL 2LAAA 4H44C 2YXVA 1F5WA 3MUY1 4GLRI 1CL7L 4K73A 1DVUA 2ADGA 3FCTB 1U2CA 4M43L 4WFGD 4XAKD 4L99A 1XGUA 3MSPA 3T0XA 2BY3A 2ED8A 1M7UA 4LESA 2D7MA 2P42B 4K3HA 5D1QA 3WJMB 4JL2A 3VXNA 4XN7A 1AR1B 2A6DB 2DQGH 4RMQA 1RY7B 2V2WB 2K0RA 3NEEA 2KQMA 1UJ3C 2W0FB 1A9VA 4KVCH 3M8OL 4JG0H 1YMME 1J8SA 2O26U 1FSKB 3HNVL 2P5WE 2DEWX 2A74A 2PCXA 3P4OA 5B38G 3CDZB 3RX9A 2F58L 4ONHA 4LAQH 5BOZG 4PJ7F 5IQLA 1KXVA 3H6JA 5AUMA 4F7EA 5C70A 2FD6L 3HMXL 3PWUA 2Q10A 5T3XH 5LHDA 3RILA 3DVFA 5BO1H 3LS5L 2F53D 4NQCE 4U7SA 4UM9A 1IILE 3W2DH 2NXYC 1PFOA 3GK8H 2IXQB 5GS2H 4X7DC 1T1YA 3QR2A 5JZ7D 4HEPG 4Z7VE 5BPPA 2VJ8A 2OTPA 2X6UA 2DQJH 1YEHH 4FQ1H 4TLSA 1GC1L 4OLYH 2CG9X 3KL3A 4HK3J 4J28A 4QRTA 4I9XA 3V4VA 5B1JA 3PFUA 1ZHKB 5IBTL 3G5ZB 4PGJA 3BPLB 3SZKC 2QGDA 5IB2A 2ZOLB 4HUVA 4PJAF 3VX0A 3ZK0A 4HFWB 3BPOC 4IW4C 3DJSA 3RUGF 1IEBA 1UQSA 3PQYD 4WGWB 2DWEA 1EDHA 3HAEH 3PABA 3C08L 3DIDA 1IQWH 1NBZB 2FJGA 1S78D 1TJXA 3GHPA 2NY7L 1HESA 3IFPA 3LVTA 5D2NB 4EDWL 5BQ7B 2O5YH 2J6EH 1NMBL 4YHPA 3VU1A 3PG2A 2K8MA 4ODSH 3IBEA 2KDYA 3IGAA 4KGLA 3T5WA 1RZIA 4C55A 1GZQB 1CFNB 3DDGA 4RX4D 2ATPA 1OSZA 4Z0BL 2BFVL 5CLYA 5GGTA 2X4RB 2G75A 3DV6A 3EYUL 1A1OB 3CAFA 4IBZA 3IJ8A 2I60L 4ZOAA 1A14L 1CBVH 1YUHB 1PYWB 1HKLH 2FX7H 2MPAH 2OSLA 2FE0A 3IYLW 5I5RA 5JTWA 1G7QA 4DZ8A 3U4BL 2XXGA 5KSBE 4GAJL 4ETQB 4NAQA 3O4LD 3PRZA 4HIIB 4OSUL 2FDBP 1DQJB 3TO4A 2BXZA 5E4OA 4GJTB 4KTDH 4UB0H 1IFRA 5GS3A 3L4VA 1CUOA 4D9RE 1A5FH 3UZEC 3GS7A 4X9BA 5GS0C 1MVUA 3IVKA 1L4IA 1DFXA 2EIEA 4FF9A 1T21A 4AUJA 2Q76A 5BJTB 2W92A 3GSWA 3L4WA 3TFKD 3L3IB 2ZKXA 1KCSL 5E9NA 1L9PA 2H26A 3OKMB 3UG4A 2YLHA 2ZCHL 4DN4L 4PJCE 1KYDA 4HWBH 5JOPD 4YSOA 4PRPE 4YBLB 4OTXL 4UINL 4ZPVA 5DHVH 1MCLA 2Y2YA 4Y2LA 1QRNE 4IRZH 5JORA 3O4LB 3KPTA 2AJ3B 2L8AA 2ZX6A 1FO0B 2G2RB 2X2YA 3UTTD 3V4PL 4GQQA 5C0BA 1ASOA 3EFFB 4H5SA 1E5ZA 2Z7UA 4TVPL 5IJKA 3QIUA 3L7EA 2R1XB 3LEVL 1TMCB 5BXFA 5IFJA 3VGFA 1PD0A 2HB0A 2YEZB 3TFBA 2B08A 4NFCA 4FZ8H 1R3LB 2A0LC 2PTUA 2HN7A 3OV6A 2AQTA 2DKMA 4FQPA 3EJYD 3NJFA 2J57A 3X1GA 3G6JE 4GP8B 3BWUC 4DEPB 4Z7WF 3AW5A 4NQVA 3OAZH 2X6VA 4APQC 6PCYA 2X28A 4ZAKA 4BA0A 4EUPH 2YPLD 4JPIB 4NUQA 5EZPA 5SWZD 3N91A 1MCEA 2B4CC 1YJDH 1OHQA 4XBEH 5ILTL 1PG7X 1A3LH 2KLSA 4FQ2H 2CM5A 1XO8A 5DFAA 1S9YA 5IUSA 3K8LA 4M1GH 1ZHLB 3LKRA 4IIQC 4S2SA 4U2ZA 4Y2DB 4PV8A 5DMGD 3RUGA 1R1CA 1XF5A 2A77H 2AK4B 2FT7A 1T6VN 3H9SA 4F33B 2FL5A 2WINB 3LQMA 1A21A 2YSSA 4OCWL 3S3SA 5IQ7L 1RZIB 4Y5YA 1INEL 1U2HA 2QTEA 4YN3A 5L9DL 2VLLA 3OKNA 1CD8A 3CCHA 1YG9A 4KQ4L 4P48A 3HUJB 2NXYB 3MX0A 3DWTA 2F74A 5I73B 4PTUB 4K3DH 3O3DB 5I1GH 3MHZA 1ZOXA 2WAQA 5F9OH 5HVFB 3HE7C 1WBZB 4MJIB 3TBYA 4XMUA 1AGBB 1E7VA 4PH8A 5J6HA 1T03L 5GRWA 1QR1B 1QHOA 3BAEL 1K4CB 1MIMH 4TTDC 3V4LA 5IV2B 4Y0GA 3L2NA 4KJWC 1SDDA 3GMOA 5D7IA 4EZKA 3BQUC 1DR9A 3CFNA 5K59F 3UAAA 1NBZA 5BUGA 1CFVL 3B9VA 4ZOBA 2NTSP 1MHHA 1AGFA 2E7DA 4I87A 2WWMC 2RIKA 4JHAH 2IADA 1M42A 4DZBB 4XCYB 2BP0A 4XN8A 43C9B 1KBKA 1Y0LA 2EYTB 5J13C 2OZ4H 4UQ3B 5J3HD 4X99A 3ME0B 2ZOTA 2IGFH 3P2DA 3UO1H 2F7OA 1QKZL 3IDMA 1EANA 2EKSB 1NUGA 3U1QA 3UJJH 2FIKB 3ARFA 4JMXA 2BNRE 1FG9C 4PJBF 1G7MB 5LBSA 4L8CA 4AEHH 4L1DA 3ZE1B 5T3ZE 1QSFB 2EJ1A 3I6LE 3NPSB 2B4CH 3L4TA 4XMZA 43CAA 1X6LA 2AQRA 3W57A 1WWBX 3N1QC 3VG0L 4NWTH 4BSWB 2IH9A 4DP2X 5AB1A 3ZMNA 5I1AA 3HG1D 3OC5A 2X4OB 3D05A 5JHDA 1HZHL 3F58H 1HIMH 1KLUA 1SJEB 2JJVA 4JHZA 5LAXB 1P7QD 1UD3A 5FYLD 4ODTH 4TUKH 3IJ9A 3JUYA 1SXSA 4M7ZC 5F3HA 4HUKB 3GMPA 1G9NH 2HFEA 5DR5H 4JJHA 2DWDA 4MMXA 3HBZA 1FL5A 5EOTA 4H7VA 2A74C 3C60A 1FIGH 1HOCA 1P5UA 4QOKB 5EUOB 2QZQA 3KLAB 1LE9A 3BYYA 2DICA 3HUJE 2V9RA 2V17L 5HXMA 1ROWA 3FT0A 1KPUB 1KENH 3A6CL 3QXTA 3RGVB 3FRPB 2VDLL 2BP5M 1EHXA 1TFHA 3QZLA 1WQVT 3FUEA 2A6JA 3V52H 1VADA 2FNWA 5JHAA 2PYED 4RWYL 1BJ1J 1P4LB 2Y1ZA 3FQRB 3HE6B 3WDIA 3MV7A 4P5MB 1I75A 3H9YA 3PAYA 1L6ZA 4MCMA 3D4YA 4ANKA 4GRMB 1K2DB 3VAEA 2WJ5A 2A6DA 1MJJB 1H3PH 4GKLA 5EBWB 5T1KD 3FUNA 4JO1H 2R4RH 4B41A 5IVXB 5TDNA 4PJEB 1AQHA 3D2TA 1URIA 2V7HA 2LQRA 3TV3H 3MXVL 4PJIF 1SQ2N 1BG1A 4G8FA 1RUKL 2IEPA 2YD1A 4N2IA 4MJ5A 1LYQA 1R3KB 1VSCA 1LEGB 1U3HC 2V7NA 2XUWA 2A83B 1P4BL 1T7WA 4WW2C 3V5KA 2A9MH 4EI0A 7PCYA 3WY2A 3RWFB 1CIUA 2X4QA 5I1HH 2V5SA 5D7LB 1DSFH 4AQZA 2OP4H 2A9BA 2JI1A 2N1KA 1ZS8B 4I7ZC 3B5TA 4J8RB 1CQYA 3PNWA 3EBGA 3ZUCA 3BLBA 1FUNA 5T1KB 3BXNA 5B22A 3GLDA 1F56A 3L9RB 4J8QA 2KH2B 1WAAF 2OMYB 2XBDA 3D85A 3BVVA 3L3HB 2F19H 4LLMA 4KX9A 3RLSA 3WEXA 1OQOA 1PX3A 3WN5A 5F3FA 1D5IL 5E8NA 2M2DA 2ENSA 3C9NA 2H6OA 4CDGC 2EDYA 1QPPA 5EU6A 4RWYH 1T21B 3SDCD 1R5IA 2Q2EB 2NY4C 2YAOA 2LABA 3QEUB 3WFCH 4DN3H 4X6DA 5LLIC 2ZG1A 4WGVB 1E67A 3KW8A 3KVPA 1NBYA 4HF5H 1O7VA 3CVHB 5EFIB 4YXKH 4DPAX 1UVQA 2NNFA 2VUYA 1I9RH 4X6FB 2P7TB 4BFRA 3V8OA 4DQAA 1EHAA 3MLXH 1B9KA 2ADFL 4HMCA 3IWVA 3E2HC 1AGCB 4AYMC 4AVJA 4LVHC 4JO2H 1VACB 2XVGA 5DJYB 1TYRA 3IDMB 4OF0A 1PDKB 3WFHB 3H6AA 1T1XA 5EHFA 1HOCB 3ETTA 4OKVA 4U0QB 2VM3A 4XPFH 1J8KA 4F8PA 4I0KA 3LZRA 1UWXK 3P2TA 5FW8A 3SKUD 2C3VB 5K9KA 3NSCA 4MAYC 4PEEA 3VM5A 4GBXA 4JFQB 1G9NL 1DJGA 4PJFF 5DR5L 3CPLB 1KPRB 5HHQB 1JXJA 2CXKA 1HL4A 3JVGC 1PEWA 3K6OA 4DAGH 5D2NE 2KQNA 4YHYB 2UV3A 4WDIA 1NH6A 2OR9L 4BQ6A 5HDRA 3KYMB 2W65A 1HCVA 1CC3A 4BEIA 5CN2A 4WUKH 4UU9A 2ICCA 3HI5L 4XXDA 4ZS7H 2JNZA 5HYEA 3AM8C 1QQDA 5EBGA 2FATL 3GMRB 5DA0B 5DMIL 4OBSA 3P0GB 2ADFH 3GF8A 3AT0A 32C2A 4OLUH 5JXAL 4LEEA 4LCCA 4QXTA 5I76B 4OZ4A 3RVTC 3U9UA 5CGYD 1KB5H 3IDXL 4IDLA 4L3CA 4ZQKA 5J06A 3N43B 4BSVA 4DKDC 4P5KB 2NY6C 4M7JH 5ANME 3MYJB 2CO2A 2P80D 1A8ZA 1G9MC 3GUTA 2YPLE 1OAYH 1F6FB 1RK0A 3FQWB 5JUEH 4QKTA 4PGBB 2R7EB 2K6ZA 5F0PB 1VCBC 4GO9A 2G9HA 2HYMA 2QGBA 4GLRH 3KL0A 1DJWA 3I9AA 3NFSH 2HAZA 1XF5B 5FEBA 4NRYA 4AKOA 5DJ0A 4LAJH 1RZJL 3WO4C 4F9PC 4NQUA 2P5WB 5TK2A 2FJHA 3NIDE 1RLBA 4N2EA 3M1OA 4GT7A 4E9TA 3GLEA 4M4RB 1P4BH 5D4HA 5F7BA 3CDCA 4AH2B 1J88A 1TSRA 5C09B 4H8WH 5J6HB 3BFWA 2HRLA 1NMAL 4PREA 5AOIA 4OUUA 3U0TA 4GRWH 2ZCZA 1RD6A 3I50L 4MBRA 3QUYB 4NUGH 5F9WC 1MI5A 1N4XL 3SDXB 2APTA 2FWOB 4Z7QB 4X98B 4XZUA 1DE4B 4YZFF 4L8DA 1UHVA 4GPVA 3DA0A 3VB9A 4N0FA 4ZX6A 2NZIA 4G7QB 4U6HA 5C08D 5I74C 1EWHA 3BFQG 2FLMA 2VMCA 4OCWH 5E1AA 1UM4L 4FEIA 2I9LA 3LHAA 1K8DA 3K2UH 4NFBA 1N6QH 2P28B 5F7MC 5T5NG 3GT6A 4QO1B 4GRWB 3QJOA 1JVLA 2WCSA 3MOAH 2EVIA 2P4AB 1JN6A 1UGKA 1JMZA 4UTAH 3FHAA 2NLJB 1JF1A 2EYSA 1L5GA 1QRNB 2HLFC 2CGYA 2X53A 5FYKD 5TGBA 1UWXH 3OJDB 1GZPA 2GUOA 4P3DA 1WITA 1NANH 2Z1KA 2FX9L 5LBSH 1CE6A 1SXNA 3QS2A 5ALBL 4U3SB 5C3LD 3VNZA 1YECL 3GZPA 4DETA 4ZX3A 4G8IB 3KLAA 4ZUVA 4N2DA 2FLBT 2EADA 3JT0A 4MKTA 1XMWA 3HG3A 5CIPA 2YGQA 3UTSD 3MV01 3UPRA 3WEOA 1T04A 4NKMA 1PNCA 2GJ6D 3MA9L 4R0LA 3EO1B 3ARGD 4WTWA 1ES0B 5GGVY 5KSBB 3F6LA 1CTNA 4GIPD 3D39B 1PL3A 3K2IA 3X12B 1U8NA 1SXCA 1IAII 4O4YL 2OL3H 3L1FA 4U1NA 5KVGE 2AEPH 3P40A 2W38A 3FFCD 2H3NB 1J8HA 3DROB 1RUAH 3CHOA 1CU4H 5DJAA 1D7CA 1BCIA 1IVTA 1OM3L 2E8ZA 4EO5A 3ARPA 2OI9C 4KHXH 4L3CB 4YHLH 4ZQKB 4ERSH 1RZKH 1B3IA 1C5DA 3CFDA 1TO4A 3HC3H 2X6MA 3BDBA 5KYUA 5CZXD 3FRPA 3VJ6A 4Y2OA 3F05A 4L4VB 4AEHL 3DBXA 5GIRB 1IAOA 4FCAA 3MRPA 1MWAH 1RJLA 3VNYA 2ZCHH 4PJGF 1T22A 3S5LB 4FTDA 5GGQL 1KCSH 3D09A 3QDGE 2F1AA 4N2BA 3L5XL 3KMDA 4LLUA 4L4TA 1I82A 1QFPA 3TIDB 2R0WH 3MLZL 3BI9X 1FE8L 1KFAH 3P3TA 3QRFM 3IGLA 5KVDE 4X7TB 3HBQA 3T4YA 2OZ4L 4Y16A 1BFVL 2AVFA 3TYGH 2HLAB 2YK1L 2P47B 4IU2B 3Q9QA 2DI8A 4XBGB 2XJLA 2OQJB 4AK2A 1YYML 2Z91B 5T1MA 1NEZB 3OXRB 4ANVA 1K9TA 1R47A 4J27A 3N44B 1FF5A 3QXUA 4HFUL 4PP2B 3W81A 4AITA 4BKSC 2W59A 5EUKB 1TLMA 1ZVNA 3V6FA 5CEZE 3Q8FA 1F1AA 2DIEA 5DRWA 4H1LA 1UH2A 2M1KA 4NO0B 5E9DA 1YYCA 3HE6D 5FO7A 4JAMB 4Z7UA 2PXYB 3LIZH 1JGEA 4XTRD 3CC5A 1TF4A 3Q1SH 3BLKA 3I3BA 5AOLA 1KB9K 2FL5B 2WINA 1H9DA 2XN0A 5TDNB 3S7GA 5MI0B 4IIZA 5EOCH 3GUFA 4XMLL 4PJGB 2H32H 2PYFA 4DO5A 3C08H 2A6IB 1P7BA 4FXGC 4HQQL 5KANG 1UASA 3IJYB 1U93A 2VZ1A 3MRHB 5FOBB 2AGJL 1TVHB 4K9EH 4EI5C 2OJEB 3FQ4A 5TPWH 3H2PA 2IMMA 4YUEL 4F7MB 3OTTA 3HZ3A 2A9NL 4YL9A 1UM5L 4J3OD 2BCKB 4W9ZA 3TXAA 1OWWA 3WTWA 1NIBA 4HJGB 4CGUB 4ZSOE 1MKFA 4ZW7A 2CO7A 4Z77A 5D7JA 4ATWA 4TUOA 4N6QA 4ALAC 3A67L 2I26N 3IU3B 4KO6A 3V55A 4MKMA 4AJVA 4Y9EA 2AK1H 3SD2A 3UJTH 2IAAC 3W39B 1I9IL 3QORB 2IJ0C 4OLVH 2ATKA 4KUCF 1CG9B 1J1XH 1MG3C 5LWYH 3QJFB 2NX5B 4KK6D 4HU8A 4QOKD 3SYQA 2N56A 2BWQA 4Z7QE 3SKOA 3ZDYE 2KZKA 3KPNB 4R4FH 3QDMD 4MXQD 1RZGB 3BW9B 3JYBA 5CBEB 4KJQC 3U36A 3T4AB 1CGVA 4TULL 3KYNA 2BVUA 4EVNB 1YAIA 1LGVA 4L4TB 4U1JA 4ZSOA 3V4PH 2YKKA 4TNEA 4DEUA 5LGJA 3DVNB 1BJ1H 1QSFA 2VMEA 5EWIL 4RFEA 1ERNA 1Q0EA 2XVLA 3KPQA 4YBQD 5EF0A 1BOGB 5ISZE 3RA7L 2HA1A 5I0XA 3NP4A 4XI5D 1WGVA 2D31A 1ZXQA 1QQDB 2WXPA 5HJDA 4Y5VB 2UZIL 3BQVA 3BAXA 4MMZA 1M6OA 5KOVC 1H3WM 1TCMA 4FG6C 5FF6A 1FIEA 2XZQL 4PG2C 5E1HB 1G43A 3U79A 4NENA 5KW9L 1ZPLA 1T83A 3C60B 4GMSH 1OAUH 1OQXA 3EHBB 3SJVD 3TT3H 3MBWA 5F7FA 1GC1C 2OBGA 4QLWA 2O93L 1CICA 2G2PA 2P46B 3MYJA 1F00I 3QBTB 5E2TL 3FQRA 1OAZL 3SDDA 5C0GB 2Y23A 3DJ9A 3K46A 5DZPA 2G5BA 1LD9B 1MFEL 4ANXA 2D3NA 1KELL 3FC8A 3RL2A 3C5ZA 2W88A 2D2CC 2WUBH 4NRXB 4Q9BA 2DWEB 4TQ8A 5JW4R 5FHAH 2A4CA 5DQ9A 1QWUA 3Q6GL 2G4GA 3ULUF 3UBXG 3FSOA 2HRHA 3LV3B 4FNQA 4LKXA 1RMFL 1KTLB 2JB6B 1L9QA 2O5NA 2VM9A 3GB7A 3GXMA 4UQIM 3BO8A 3HFFA 4JY6B 2QSTA 5C0AD 4Q74A 3U7AA 3VXTA 3KBFA 3A67H 2AEWA 2VDKB 2WD0A 1X4XA 5E95B 1MCWM 3ARDC 3B9KC 2HT4D 2QPUA 4XVOA 1CGUA 1A4KA 4KPHH 4NSKB 1H8LA 4C83A 4ZMXA 1KTDA 3LZPA 4H20H 1WFMA 3MOBH 3HR5B 3LAFA 3CSBA 4YHML 3WEBA 5AL8A 4UAHA 1AIFB 2BNQE 1W0WB 1XGRA 2VXQH 1UOVA 3EG9B 5CO1A 1AAJA 3HG4A 4XVTL 4WAFA 4L37A 1RH8A 3L9RA 2E86A 4JFOA 4AJWA 3FO0L 3DOHA 2D7OA 1OF0A 4FQ1L 4KI5D 2W95A 4MQXD 3EJSA 4JFDB 2UVFA 4KWUA 4XVUD 5GS1B 3SPIA 1H5BA 4NN7C 4OBRA 3WJLC 4KJQD 1AZUA 4L3AA 4YNYB 4ZOCA 3FT2B 2EEXA 4PJAB 1D7BA 2KI6A 1OARH 4ODHL 2Y5QA 4MHHI 5FA4B 4QY8B 5HVGB 3RAJL 4RAUB 2WNXA 4UV4H 2Y1YA 4BZ1L 4DH2A 4FTVE 2PWGA 1WJ3A 1X9UA 4P5SA 1IU1A 1RULH 3QZWG 4UT7L 3WY1A 5D96B 1N8ZB 1YPZA 1XIWC 1Z3RA 3FB5B