2X53A

Structure of the phage p2 baseplate in its activated conformation with sr
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
263
structure length
263
Chain Sequence
TIKNFTFFSPNSTEFPVGSNNDGKLYMMLTGMDYRTIRRKDWSSPLNTALNVQYTNTSIIAGGRYFELLNETVALKGDSVNYIHANIDLTQTANPVSLSAETANNSNGVDINNGSGVLKVCFDIVTTSGTGVTSTKPIVQTSTLDSISVNDMTVSGSIDVPVQTLTVEAGNGLQLQLTKKNNDLVIVRFFGSVSNIQKGWNMSGTWVDRPFRPAAVQSLVGHFAGRDTSFHIDINPNGSITWWGANIDKTPIATRGNGSYFIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Lactococcal Phage P2 Baseplate and its Mechanism of Activation.
pubmed doi rcsb
source organism Lactococcus phage p2
molecule tags Viral protein
molecule keywords ORF16
total genus 56
structure length 263
sequence length 263
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R
ec nomenclature
pdb deposition date 2010-02-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1830 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2x53A02
2.60.520.10 Mainly Beta Sandwich Triple-stranded beta-helix Phage fibre proteins 2x53A01
3D8MA 2X53A 3DA0A 3U6XA 4L9BA 1ZRUA 3EJCA 2WZPA 2BSEA 4IOSA 4L97A 4HEMA 4L99A 4L92A 2BSDA 4HEPA 3HG0A 4RGGA 2F0CA 4RGAA
chains in the Genus database with same CATH superfamily
4N9OB 3EYUL 4PRHA 3N41B 3ULUH 4NT6B 4Y19D 4GSQA 3S3PA 3VH8A 5AW8B 3T0EE 4RAUA 3NZHL 5FKAA 5TJWK 3JWNC 5JXAL 4JB9L 4WUUD 3CSTA 1Q9OB 1QACA 1NFDB 3PGCB 3FYIB 1UD8A 2W0FA 1U8IA 3VNYA 4W4OC 4AWJC 5B8CC 4F33B 2VABA 1UOWA 3IF1A 2CIIA 4M93B 1NAKH 4MYWB 4XCNA 4YPGA 3U25A 2PO6B 3L9YA 3V0HA 4BFIB 5C3IA 1AZRA 3DYOA 4XHJD 5I0XA 1DANU 2OSWA 1EFQA 1HE8A 4NKIH 2VB5A 1DCEA 1JZHA 4IKIA 3VXSE 5FDYA 3T0ED 1QRNE 3VXUE 3CV5A 4PJ9C 4ELDA 2VN4A 1RP9A 3PWPB 3UZQB 3UBFA 3MN8A 3JV4A 4U3HA 5D7KD 5T1KB 4BSWB 5DS2A 4RFOL 2RMNA 5I18H 3OXSA 2CHXA 3DRQA 4UIKH 3N1QC 3RAJH 3VVVA 3C60A 2HH0H 5BO0D 2AXGA 4X50A 2DQJH 3JYBA 5D6CB 1Z0MA 2CLZA 3RX5A 3SKJL 5GS0D 5D9SA 3JYCA 1RULL 3I84A 4Q9RH 4IBQA 1NEZG 3FCTA 4G42A 2JKXA 2PF6A 2P8MB 4G70B 4PJHB 5CKGA 2YWZA 3GSNB 3O2DL 5GGUB 3QAZC 3MCKA 2GJ6B 4XVTL 3DYPA 3WFCH 1KFAL 4LNRA 4MKMA 4YHLH 2G2RA 1LQSR 4LXFA 5CCGE 5IREA 3MLWL 2P48B 1DQKA 4U3SA 1SRDA 1X5MA 1H3VA 4N1CA 1SJEB 4LLDB 5FO9A 4YHNA 1RK0B 1T5KA 4WW2B 3U9WA 3RUGF 1BP3B 1E9OA 2F18A 1MIEL 1TQWA 4MJ5A 3U1PA 5MEND 1XF3B 2NYYC 5C6TH 5BZDA 3RWIA 3BVTA 1WLHA 1H6TA 3ZHNA 2DI8A 1DJHA 1AG0A 1AZUA 2AJSH 4FYTA 5D6DA 3WHXA 2APVA 3BISA 2VLKB 1U36A 3QNFA 3D09A 4UDTB 2D4FA 4NFDA 5MHSD 1ZWIA 3TA3B 1MXDA 2P49B 3KPSE 4UBDC 4S1SL 4TSAH 5EIIB 4HIHB 2PP7A 2MQCA 4PWKA 1DVUA 3KCWA 2MJWA 3N1MC 1EZUA 2V2WB 1TCRB 3N9GH 4OAWA 4PRBB 4XNMA 2EDFA 1A4BA 4HUXB 3P11L 1BF8A 1G43A 4RGOH 5CWSA 3C9NB 4PWGA 1SXAA 4KKAD 4ZODA 4PG9A 2EDNA 1IC7H 3RZCD 2CGRH 5AVTB 1FGNH 4XNZC 1GY2A 1QHOA 5JOPD 1NICA 2XNAB 1JD9A 1I75A 3C75A 1EXHA 1K6QH 1OE3A 1U8QA 1LILA 1IGCL 3JTTA 4GUQA 3ATAA 1ZEAL 2F58H 4QRPB 1WWCA 1HEHC 5FX3A 5C0ND 4HZLB 2APTA 1AD9A 2XFXB 2NY0B 4RSVA 5E4EC 4WQOA 4ZXBC 5DJAB 2H6UA 5C0CD 2Q7AA 3ZDZE 4JFUA 3UCQA 1T83C 1KB5A 2G3ZA 4A66A 4F7PB 2FBJL 3KLDA 3KWTA 2OMXA 5CJQL 4HV8B 4NIKB 1WTLA 1E5CA 1JTPA 3AFLA 2BVOB 4P4RB 4MCNA 3GUTB 2WCPA 4RA0C 1BOGA 4PJHA 2BRRL 3U0WL 4QRSB 2WVVB 4AGLA 3QJHB 3JT2A 2QKIC 1Z9PA 3MDJA 4KC3B 4F37K 3I02A 1QFWH 5ENWA 3QZWB 4ZG1A 5HYQB 3EDDA 3TGXA 3A67L 2OTUA 2YAFA 2NZ1A 1N5YH 3ZL2A 1SHXA 2CIKB 4HJ1A 4I2XE 2OSYA 1S7TA 3WAKA 2PLTA 4ELMF 2FECL 3TEXA 3U0PB 4PR5A 2HPOA 3P3TA 3MOQA 3B9AA 1RJCA 4KK6D 4K3EL 4UIMA 5I5RA 2PXYD 4XHJC 5DQDH 4F7EA 3S3DB 4XN4A 1CDIA 4R4BA 4P5TA 3DETD 1OW0A 3QQ4B 3BX7C 1Y1UA 4OJAA 3HE6D 4CADA 5JW3H 1DVFA 3U9UA 4NOFA 1ZCRA 2QPFA 1KIPA 4MQXD 3HI1A 1H6EA 4OJCA 4TLUA 1PG7W 4IRJA 3X11B 2Y2YA 2X3CA 3PWJB 4PBWD 5D7JA 4ONHB 3U6XS 2DKMA 4FTVA 2O26U 2IOOA 1LEIB 3F62A 4DZBA 2C1PB 3HRZB 4U33A 5BV7C 3GSOA 3HB3B 3H9SE 3ARDD 1EXGA 2FSEA 4LP5A 5KUKA 1TJIH 5FA3A 2HWZL 3QQ4A 2WUBL 4M48H 4JQIH 3FO2B 3BMVA 3RHWF 5E1QA 5GRWA 1HU8A 2X4SB 4KTEL 1LLAA 3RVUC 2VGLM 1YEGL 5D7JD 3B8SA 4UIMB 1S9XA 4KI5C 5D5ME 4P2OC 1H5BC 3IDUA 3WGVB 1H0DB 2PCPA 1RLBA 1AANA 1BG9A 2XTJB 1IGJA 4AK2A 1RVFL 1TG8A 3TO2B 5T5FH 2GBUA 1BZ8A 3KH3A 1NINA 4PLOB 5AOMA 1N4XL 5EOQL 3WFDL 4TSBL 2X4RB 1MCQA 1S78D 3DA0A 2VCOA 3LQZB 1AQKL 3RPIA 4KZEH 1NCNA 4DUVA 2IGTA 3NUKA 4Z7VA 1JZ7A 1V3KA 3RB7A 3NEXA 4WV1B 5J11C 2EABA 1T1YB 1AE6L 3G6JA 3ARBB 2CRZA 3PGFH 3NABH 3LZFL 3NSJA 4JFPA 4MSWA 4TXVB 5LVEA 2H3XC 2VXQA 4X6DA 4OB5L 2WAHA 5AW0B 1OP3K 3SDDD 1FN4A 3NRPA 3VFTB 2HLEB 2H2SC 5C3TA 2ZKHH 3LRGA 1BJ8A 3ARYA 3M17B 4OZGF 4KK5D 4U4BA 2VLLB 1R75A 3BXNB 1AKJA 2JJSC 1JGLL 1DBBH 1V5JA 3HZ3A 1S9WA 3VRIB 2AC0A 4JFFE 1DBAH 2NY5C 2P46B 2FSEB 2Z93A 4DKAA 4PH8A 2NOYA 2WZPD 4FI7A 4XVSL 1XVSA 5D4IA 1HXMA 3WMQA 1JWSA 5GGTL 3RY6C 4EVNA 1AE6H 1WFJA 1HC1A 3MRKA 2W91A 4QRUA 1ZHNA 5FAAA 3TYGH 1JGEB 3L48A 4QDGA 2BNRA 1IC4H 1CIDA 3QP3A 4U7KA 3HHRB 5FUZH 3NJKA 2NY0D 3K4DA 4MB1A 4HUXA 1OSPH 4HGWB 1TCRA 2JTYA 2WOYA 3V4PB 4ZPVA 3WFDH 2A3TA 3CBJB 3N50A 3FRPB 4LOEA 3EJYC 2X89D 4QRTB 3D69A 4TN9A 1E4XL 3SDAD 1HWWA 4OZFH 3UTTD 1JN6B 4G8EA 3AG3B 4UDTA 5J1AB 1X9UA 2ZUTA 2VN7A 1AAJA 4YL4A 3Q0HA 2FIKB 4U0QB 4AEHH 4NQQA 5F71A 3OKNB 4G8GB 1JK8B 2ISDA 1IAKB 3PGFL 4XXDA 5DQJB 3KGSA 4NWTL 4DK5A 3BVXA 4UU9B 3O8XD 2VOTA 1C9SA 2XA8H 3QJVB 1C16B 1OVZA 1XF3A 3V6FB 4XP5L 2YD0A 5HYQA 2OI9B 4PJXB 2DLGA 1JDCA 4FNPA 4B27A 2P9RA 4OSUL 2XQYA 5MENA 5JXEC 4DP7X 1QYGH 3MV9A 2VAAA 4HH8A 5J12C 2UZYA 4ODVL 2ADYA 2F19H 4NAJA 4KKCD 4FMVA 1A7NH 2VLJB 2OMUB 1TTCA 2VDKH 4UAOB 4HETA 3NG5A 3JVFC 4RGOL 4WGWB 3ZYIA 4PLKD 5F7UA 1SHSA 1M42A 4QHLB 2G5UA 2JKLA 2DIBA 5FA4A 5DVLA 3ZE2E 1S7RA 2GJ6E 1DJYA 6PCYA 4H7VA 3L4CA 2FWLB 1KCRH 1RUAH 4I4WA 4JFDE 3VRLE 1ZEAH 2F58L 3GMLA 2E9GA 3ZTEA 4KMLB 1PD6A 4AEIL 4UAOC 4RISL 4MMZB 4V2CB 4V1DA 1FFPA 5FYJH 2Q9OA 4LLVB 3ABMB 3QCUL 1FPTH 4W9IC 3R4DA 3UACA 1XH3A 5T3ZH 5CSBA 2CM6A 4R7XA 3U4BH 1JGIA 5ESAB 3QWRA 5IHBA 4JG1L 3L8QA 4QGTA 2GFBB 3TT1H 3CLEH 1T20A 1HIMH 1D7DA 1KEGL 3OKEA 3MV9E 3B6SA 3EFOB 1OWRM 4AENA 1G84A 4QMEA 1IEHA 3WN5C 4A38A 2EO1A 3MCYA 4E42A 1MFMA 1MLCB 2O5XL 3K6SA 3NZ8A 1ONQB 3I9AA 1U8IB 3P54A 5CLWA 1UA7A 4LAQH 5EU6D 3O6KH 3E2HB 3BZFB 3RU8L 1U6AH 2ADJA 1Z5LB 5IJVA 2OA9A 2E86A 3P0VH 4JY5L 1AXTL 4MS8D 1BBJA 1MZZA 1W6WA 5J3HC 3QXVA 1FDLH 1U8MB 3MRGB 3QWQB 4FXTA 4YJZL 4G7SB 3AJ7A 3HAEB 4PJAE 2WTPA 3WNLA 3C5ZB 3IVKA 5F89B 1PZCA 2O6EA 3RQ3A 2KQNA 1IAII 3GI9L 4NLHA 4WO4C 1XGQB 1YEIH 4I3RH 1S5HB 3BP4A 2DWTA 4E0RA 2KLTA 2WLJA 3O0RH 1QO3A 1UZ8A 1V05A 3MLVH 5ETUB 1FN4B 3RUGA 4YQXL 3MU3A 3EH1A 3MNDA 4UQDA 2BZ7A 3T0WA 2EVJA 1TETH 2C9SA 4LPTA 1S7QB 3B2UD 3NSCA 1NGYA 4BRJA 3KG5A 4JFQB 3OC8A 3WV0A 1URLA 5LJYH 2LU5A 2UZIH 3BRGC 2ATKB 4L18A 2YOCA 4U2YA 4UQAA 4ZS6D 3DECA 3OJDB 4DESA 5J4MA 1UOVA 5LCVL 3RNQA 1E9PA 3ARWA 2CLZB 3HNSL 4L3CB 2VZTA 5JHBA 4BV1A 4NYLA 1FFNB 1J1OL 4FA7B 2XTJD 4DGUA 3HS0C 3OXSB 3OAYH 5D7LE 4NJ9L 3SY0A 1UD3A 3D0VA 3LIUA 2QGEA 5JTWA 3IPFA 3HZYA 4G9FE 2ZCHH 2QVIA 2OSLA 5D4JA 5GZOC 1A22B 2FX9L 2WHVA 1BMZA 3KL3A 3NCWA 3NACH 1FIGH 2J2ZA 3ARPA 1N59A 4KZDH 4H40A 3SBQA 5BJTA 4LPWA 3F64A 4Z7VE 1EERB 1H3UA 1DVZA 1OK0A 2FT6A 2PUQT 1O6TA 1U8KA 1JERA 1VACB 1A1NA 3GBNL 1ZA6A 4N8CH 5CP3A 4LLUB 4NWUH 5C8JA 3RL2B 1IARB 1DCLA 1BD2E 3GO1L 3NFPB 4XBPB 3WXWL 3X3FH 4GKSA 1ZV5A 1LO0H 3J27A 3CHRA 5F9JA 2EUWA 2F7OA 4MBOA 5E6ID 3KR3H 1T2QL 2V7HA 3X11A 4MNGE 4NKIL 1EH9A 4KKQA 5CUSH 2H32A 4GKOA 2C9QA 4OTXH 2A74C 5IB3A 1N7MH 1P7KB 2H1PH 4WW1A 4M9OA 4WEBL 3EDEA 5I71B 3HE7D 2VW4A 3IU3A 3NJNA 4XP9H 4XPFH 3F7VB 3EBAA 4YSOA 1QEXA 3QCVH 4FFWC 2CG9X 4YOKA 4JM2B 4TTDD 4NZJA 1TFPA 4APQD 1G1CA 3WNIA 1T03L 5DJDB 3KPRA 4IS6A 1D5XA 3J07A 2WLMA 4JL2A 5GGVY 3BI9X 2OYLA 3ULUL 4X6EB 4ETYA 5ADPL 4HK3J 2OXGB 4PV1C 3W82A 3DOIA 4H44C 4AEEA 3L54A 4QXTB 4XWGL 2BCMA 3JWDC 2AK4D 5GQBA 4DEPC 1D2PA 1KJMA 2WWNA 5EBLA 1N64L 3KXFE 4FQIH 1ZGLB 4YC2C 3NA9H 4J6RH 5E7FA 1GGCH 3V0WL 3TURA 3KWUA 3C5ZA 1JCVA 3QQNA 1IAOB 3BZEB 3WTVA 5L2JA 3G6JE 2YMOA 3IVKB 1B4JL 1H15B 1RHHB 3VSQA 3EOBB 3KPMB 4R90H 4IEFA 2MRYA 3JTSB 4G3YH 4PTUA 4YAQB 1SLWA 3QIBC 1ODUA 2IIJA 3LXBA 1A4AA 4R2GD 4F57H 3PHSA 1NCJA 1L9OA 1PYWA 1DJGA 1Y6KR 3K6IA 3LPFA 2YAQA 2NR6D 2PYFA 2WJ7A 3GF8A 1EXUB 1GHFL 2EDJA 3B2XA 5DRZB 1QPKA 4WFHD 2O6PA 5MEQA 1JI2A 1UFUA 3ESUF 1JTOA 1T1ZA 1I3RA 1FG2B 3J7HA 1EVTC 4PGCB 1YYLL 2AK4A 4WUKH 1M6UA 4XPFL 1SVZA 1DJSA 1YPZB 1K85A 1M6OA 2D3NA 5D1XD 5CUSL 5T1JA 2N1TE 4DOHB 3H9SA 3A4EA 4KZ0A 3FTUA 2PO6C 3WUWB 3QO0B 5HDQH 2VW7A 3OX8B 4DIXA 2A7BA 2Y5QA 4H8WL 4GG8A 3R7QA 4G8IB 2UUDH 2YPVA 3BN3B 2VDOH 2WGXA 5EOCH 4TTGA 4EJ1C 5DK3A 1MHEA 4UTAL 2EEAA 1DDHB 1CFVL 2WVUA 1WEJL 3ROLA 5IW6B 4JM4L 1UKSA 4X5WB 4MQTB 2J8OA 3UG4A 4ICXA 4W70A 1DVTA 3QUYC 1A8JH 3OKKB 3PWNA 4NUGL 2D31A 4YHNB 5EC1B 4YL9A 5E6RB 2CO6B 2FEDD 3B43A 4LQFL 4DGYH 2LABA 3AAZB 4PGEB 1O7DE 3PXJA 3BZ5A 4UUJB 1YEGH 3FTZA 3MRJA 2WSPA 4P46B 5IJCC 4UZUA 3EDKA 5T5FA 1UXMA 4BWWA 4PJFB 3MTXA 3ROOA 3RY4A 4X4XB 1M53A 3L5JA 1G7QB 1RZPA 3UAFA 1A5FH 4Y1SA 2HX9A 3TNMB 3CFKB 2WKOF 4PBXA 4UU9A 5EU7E 5CJ5A 2BIOA 1JTTA 1UD6A 2BOBB 1UM5L 2DQFA 4XBMA 4WK4B 1YNTB 4OGQC 1PD1A 3O81A 3QEHA 3VFUB 2BMKB 1E5ZA 4I2XA 2Q7YA 4Q74A 4YBQD 2DQHL 4ODSH 3KD4A 5F0PB 1F3DH 4FP8H 3OWEA 5DK2B 1RD6A 1NLBL 4H1LB 3O11A 1KTRL 1VFMA 3QC6X 1QI5A 5JW3L 3GRGA 3SD5A 4QTFA 4B9CA 3ILQD 5ALBL 5EEUA 3SJVB 3PXLA 1P7QA 3UTQA 3LRMA 4MA7H 1I1CA 5T8IA 2Q87A 1USZA 5EU3B 3X1EA 5E6SB 5DA4A 4PWEA 5F9AC 3D18A 5EEVA 2VN6A 3VFVA 5MEPA 2VXUH 4EDXA 2W0FB 1QFWM 5ERWA 4WCYL 1IC1A 1K3IA 3S36X 4IGBD 1BVOA 1D5MB 5EG6C 3CTTA 2E7LC 5CJXA 2ZAHA 1YEJL 2PW1B 5DLMH 1REIA 4OFYA 3C5XA 1UZ6E 2YKLH 2LOEA 3N0PB 4D8PB 1F4WH 4QXTA 3ZBMA 2JKSA 4Y4FA 5T1MA 4P3CH 4R5VA 5C0DB 4L4TA 2B5IB 1BD2A 4AE1A 4J8QA 3TEYA 4DGVH 4HMCA 3OB0K 1SEQL 5B4MD 3QAQA 1VPOH 4MD5A 4X6EA 3BRFA 2YPLD 1GC1L 1FQ9C 3H6JA 3QQ3B 2F68X 4OCMC 5DJDA 2X6CA 2W0KA 3DGDA 5F1IB 4F8NA 2P80A 3RIAK 3SN6N 3O6FD 3FBKA 4KK6C 5F0LB 3IGFA 2X4SA 1N6QL 1OXYA 1DQML 5FA3B 1BGXL 3KJ6H 4HD9A 3CE1A 1RUMH 5D7KE 1P6WA 2J5LC 3C5ZC 4Q0XH 2ZIDA 4NZUL 4AYFB 4CVUA 3QRGH 4KJWD 2V7HB 3QIWB 1MHPL 4MNGB 3VWKB 4DETA 4KOBA 5HI3C 3VI3E 3BKYL 4ALAL 1D7BA 3KGUA 1QWHA 3BO8B 3TIEB 2FR4B 1GAFL 4HXAH 3WELA 1SHWA 3U30B 3P4MA 1ACXA 1NIAA 3VXMA 2DV6A 3D39D 3IE4A 5H37H 1QVOA 1EGJA 4QI3A 2VDOL 3NIDE 1A25A 1CF8H 1IKNC 3HIZA 3MRDB 5D7EA 4AIEA 3U9PH 5JIPA 4MDIB 4HPYH 4KKCC 3MNMA 4Q9CA 4GP4B 3R19A 2OK0L 3TV3H 2MCPH 2P45B 1ZLUK 3VFNB 3QXAA 1GIGL 1H8LA 3QUHA 1E7VA 1R4XA 1JZ8A 3L7EA 2X4NB 5IWLC 5C6TL 4HBQA 4OCXL 5EIIG 5CHNB 3DLQR 4JM2C 4ZNEA 4ZD3L 4IOFC 3AADB 3UJTH 3IMBA 4HFWA 5JO5B 5HDBE 4Z7UA 1BOGB 3T2LA 2XG4B 2WXLA 4KKBC 1HEZB 1TZOA 3VXRB 4AOFA 4IBTA 3VDCA 4PJ8A 3IDMA 1GHFH 4BK4A 4G6FD 1AZNA 4JO4H 1JXKA 4M4RA 2X0WA 4LCUA 1IC5L 3FT2B 1O0VA 1J9RA 2DQJL 4GO8A 1MRFL 5DT1L 4AYID 5J8OA 4ILDA 4OD1L 2YMXL 3MRPA 4LGSB 2R2EB 4MZ3A 5C08B 1UWXK 2D0FA 4JJ5B 1XCXA 3V9EA 1HJCA 2X89A 3H42L 1JV5A 3ZVVA 2QHLA 3EDJA 3G6DH 3PAYA 4AM0Q 5FGBC 5JHDD 3QHFH 1USQA 3KBEA 2EC8A 3S97C 3PP4H 4BRVA 4EE2A 1MCWW 3BAYA 1AMXA 4GKZA 5DUPL 3STBA 4ANVA 1HYSD 4HZLA 4XWGH 1Z9SA 2F54E 1RUQH 4LLAA 4E41A 4G7YL 3G5YA 1KB3A 3NSDA 3GBMH 3GIZH 1IGFL 3T4AB 2ATPB 3RZCC 2FTAA 5DWUL 3V0EA 1OD7A 3K0WA 3VM7A 1RZQA 3B6SB 3EFOA 2GW5A 4MAYC 4K7PH 2UY7B 5IW1A 1N4XH 4RGNC 5EOQH 3HPJA 2H1XA 4K71C 2CK2A 3KDMB 4YDIH 5INDA 5EU5B 5I1CH 4OZGA 4BA0A 5CBEB 1CDUA 4WEMB 1KC5L 4WU7A 4XCCH 3T4AC 2YIHA 3EFDL 4JM2F 4AM0B 3VA2C 2WLIA 4XNUL 1DSFH 3U83A 1S7VA 5G5DA 1IL1B 1E6JH 1W15A 2BSEA 2IDQA 3ISWA 2GK2A 4JO1H 3EBIA 2JSFA 4K94L 3CDYA 1G7HB 1KTBA 4XVUC 3GPEA 4RWYH 3KPLA 3DTDA 2GI7A 3MXWL 5B22A 3HG1E 3SPIA 4XRCB 3ZUNC 5I1EH 2JB6A 1SJEA 4NPJA 1IEAB 4PGEA 5ILTH 5CXPA 4WV1C 1NGQL 3OPZL 4KAQH 3TZVA 1JPFA 2KLSA 4BUHA 5K9JH 2OMUA 1JIBA 3FSAA 1AS7A 2UWEF 3CZEA 3GSNA 3D6GA 4N1EA 2BXYA 5AVWB 1O75A 5F7EL 3NGBC 2WZ5A 3LHPH 1IJNA 2PPAA 3HI5H 4HSCX 3SY6A 5AVQB 4HZ1A 5FO9B 2XBZA 5TD4A 2VXTH 4QHMB 2VR8A 1E67A 2NTFB 3ILEA 5B4MC 1LNUB 3V0AC 1EEZA 1W0VA 1T6VN 1UVQB 3L3IB 4FADA 1OW0C 2FGZA 3PDOB 3QIUD 4GKNB 3GSWA 3O6FC 3AS1A 1UJTA 3FC8A 3N42F 1YA5A 5DLLA 3ISRA 2EYTB 3MROA 3QPXH 2Z31C 4L1TA 3ARRA 1VFBA 4HUUB 5E2WH 3LH2H 1MAMH 4KXZH 1YEKH 3A6BH 5KG9B 3VI3F 2ENQA 1FVEA 1SLXA 2VDLB 3FUEA 1MW1A 4X8GA 1BA9A 1WFMA 4EAEA 2ZCHL 3KHOA 3VXRD 5BO1L 4BSVA 3FULA 1K2DB 2DF3A 3ME0B 5I8CB 5DQDL 3QT2A 3B34A 3L7FA 4L9BA 1G7LB 2YD7A 5D1XA 4NT6A 1I9JH 2Q2LA 4GUPB 4PJDA 1NGZA 5F7KC 3K81A 5IEKA 3FHEA 3W9EB 2BSRB 1XV8A 2DW5A 2Y7OA 3GBNH 1CYGA 3I75B 4GSDL 4LF3B 2OYKA 3SD2A 4LLYA 1AR2A 3H7LA 4PY7B 1AVAA 1ESOA 4OFDA 4RH4A 3TJHC 1CFBA 1FNEB 2VMDA 3HC4L 5D5MA 1UYWL 3I6KA 4OBRA 2G2NA 4JRYE 2IPKB 2F7RA 3DV6B 2COVD 3R06B 2W0PA 1KCVH 2G75A 2FB4H 5CJOL 4MQXC 4FA8A 1HHJB 5D72H 2D03H 1FG9C 3VA6A 4TV3A 4X4YA 3WFCL 1EO8H 2ENJA 5JA9A 4OV5B 4F24A 4BE6A 3AREA 3LEXA 4TUKH 4LCCA 2QKIB 1RULH 2VERA 3EJTA 4OUUA 1TVDA 1BQSA 1Y6MR 3VD3A 3O41B 1INQB 4JG1H 4MJ6B 4NC1C 4U1JA 4XH2A 1DE4B 1B9ZA 1I85A 2X12A 1NCWH 3UAJD 1F58H 1I53A 5GSRA 3VQMA 2JKJA 3TVMD 3L45A 3L6FA 1MFAH 3HNTL 5K9OB 5GGRY 5D72L 4UM8A 2E9JA 4JO3L 1L0YA 3BWUF 2XWRA 3BLBA 3OKYA 1MFEH 3OMNB 4JZJC 4GRWB 2AJSL 5E6IC 3AXLB 4BQCA 2ICCA 1ACYL 2BVUA 2GITA 2WBKA 2RR3A 4P2QA 3UAEA 1WPCA 2X5PA 3U0TA 4Z0XB 1NAKL 2NY5H 4R5TA 1PZUB 1FDLL 1LEKB 1NEUA 1TJGH 5KBNC 1BVNP 3EAKA 4HC1A 1HQ4A 5FYKD 4LPXA 1T0MA 1T21B 3FQUA 2R1WB 5C8JB 3EZJB 3POCA 1HH9B 3SGJA 4E36A 4PJ5B 3NCJL 1U8KB 3O0RL 1XGYH 5KYXB 1QLFB 5HYSG 1J8HB 2C5DC 5J6SA 3QFJB 4H0IA 1KENL 3EJUA 2R0LH 1CLZH 1DFBH 2DM3A 2RCSL 2VRQA 4CADB 4WWKD 4G8FB 4GW5A 2XIIA 1P9MA 3UZVB 2E3VA 1BV8A 3Q7JA 5HGAA 3HG2A 3A5VA 4G43A 1YYLH 1Q72L 3H3PH 4LVOB 1M71B 4TMPA 3QYMA 5DUBB 3BKCH 1TJXA 1FLRL 1OF0A 2AZUA 4HK0A 4KTDL 4QXUH 3OGCB 3VFNA 1JF1B 3QDME 4R7DA 5I1LA 3RWHA 1JZ5A 4MCYB 3RVTD 4YLCA 1KCWA 3QHZL 3G08A 2H3NA 5DVPA 1DUZA 1UCTA 5GJTL 5H2BA 5ENWB 3I3DA 5E03A 2HKHH 1RUQL 3S4SA 5CEZE 3KCPA 1IFHL 4L1SA 4RGNB 1VGKA 1NGYB 1AD0B 3DOHA 1EJFA 4WHYG 2FLMA 3OAUH 3TV8A 3BE1L 1VZHA 3E8VA 3MFFA 1AGDB 1T2XA 4N6RB 4OH2A 3THMH 1HX0A 2G2PA 3AITA 5GS3A 4JMXA 4C8XA 1UG9A 1KC5H 5GGRA 2Y7LA 4WK0B 1OAUH 4AGQA 3T5WA 2LLNA 3GM0A 3CBRA 1HDMB 2CKBL 4I9XA 2GSGB 1U3NA 3SPVB 4ZO9A 3OMIB 1UJ3B 4S1RL 1YRKA 3HBQA 3GXMA 2Y1AA 5I15H 4QHPA 2X09A 5IHLB 2WYIA 5B1JC 1SJHB 3V0GA 1Z7JA 3B9KA 4OFKA 5HHVL 1U8NA 2B59B 3OB8A 4KV5E 4DSYA 4KQ4H 3GSXA 3L3JA 4CN6A 4M7JH 4KZCA 1YLBB 2XY2A 4LOVA 5LG6A 5IBTL 1CL7H 2WV3A 5FGSA 5FW7A 5KYUB 1DBKH 3BQVA 4APQC 1TPXB 5EEZA 3S7GA 3HVDA 3IGLA 2E59A 3CZFB 3EH5B 3CH1B 1XFPA 4UDUA 2I9LA 4Y19A 2G5RA 4LCIL 4PMFA 1OM3H 2OW6A 5DRWA 2R69H 1Y18A 2BLFA 3HI5L 1YNLL 4HKBA 3T9WA 2YEVB 3GZOA 3B7TA 1XH3B 3QWNA 5F6IC 3RFZB 3MNZB 1L5GA 3RI5K 4PG2A 3T6WA 1S8DA 1BQLH 4K7PL 2UUDK 1N2RB 4JVUA 4WFHE 1BF2A 1AMYA 2K78A 2FX8L 1NC4B 3VJ6B 3VX1A 4ETQB 4G9DB 3E1F1 5JQHC 3I3EA 1O9WA 2D3LA 1MCFA 4XVOA 3KWWA 2OMTB 4G7YH 5DGQA 4MYPA 2Y9RT 1JJUA 3GXIA 5CR1A 2Z9TA 2GSIB 3KLAB 4G8GD 4NNXB 2WVTA 1OZUA 4Z8FL 1CVSC 1XB8A 4JFSA 3L3KB 5DFWH 4TPRL 1N0LB 4NENA 2VXVL 3A6CH 4QRPE 4K5PA 1BLIA 2EIDA 3PHQB 1LE5B 3TV3L 4IW4C 5AD0B 2WPGA 3KL0A 4HC1H 1A7RH 3UPRA 4ELMB 4Q2ZB 3LNEA 5D1QB 1AQKH 2JFCA 5M95B 4KNUA 1I8MA 3B83A 2CDGA 1EIBA 1WIOA 4G6KL 4HKZB 3RTLA 2ZKHL 3NFNB 2YK1L 2AVGA 3NIGB 4L4TE 1I8MB 3DJZA 3HFFA 2J5WA 1G9NL 2Q2EB 5DJ8A 4X4XA 4Q9QH 3NABL 2CJUH 3W37A 1VCBC 2J20A 1MJ7H 3OG4B 3AXHA 4J3OG 5ICXA 1FZKB 3MRJB 3I3BA 3VGHA 5EF1A 3D69B 1CYXA 2YA0A 5DMJB 3JUZA 3TF4A 1HNYA 4ZPVB 5A16B 2AJVL 3CMGA 3PHOB 3K6FA 3MLVL 4WGKA 4XP6H 5E94A 2GB2A 4PJHF 1TQCC 3VQ2C 3CSGA 3RWGB 2NXYB 3S5YA 2VNCA 1FORH 5HP5A 5DFTA 5KSAA 3MC0A 2N7SA 2B1AL 3EFFA 3K91A 5I6PA 4Y16B 5DQ9B 5I6KA 3HPLB 2O93L 2ITCB 2B3IA 4FF9A 1G6VK 1HHHB 4HJ0C 1JPGB 4LL4A 3QJUB 5GJSH 2IAMA 4WDIA 4G72B 2L04A 4GRLD 2D8KA 4X2UA 3DIVA 5EIVA 5KSBF 1QLRB 4BSJA 4KRNA 1H9DA 4PB0L 8CGTA 1D9KC 2WBJB 3WJMB 3MXVL 5I0ZA 1NC2D 1XMWA 2F54B 4Z5RA 3L3GB 1NFIA 4N2AA 3UC0L 3BRDA 5IM7B 1N6QH 4DP6X 4K9EL 4RRPA 1F4XH 2ZKXA 2AERT 5LXVA 2QADC 1EAOA 3OB0H 3UTOA 3MGTB 3W5MA 4EI5A 2IMNA 4MA1C 3UZEA 5G55A 4BZ1H 3D39E 4P07A 2JK5B 5JW5A 4XP4H 1GOGA 1J9TA 4F3FB 5F3HB 4EBQL 2JCCF 2V9RA 2QPEB 1PYWB 2HUHA 3DPBB 3B9KB 3FN0L 3MRFB 4U6XA 3Q6GH 1GTFA 1KENH 4Y5VC 1BAFL 3VQ1C 4NQTA 4QRRB 2DQEH 1RUAL 5ALBH 4M62L 3C08L 1FYHB 4NNPH 1XIWA 4PJ5D 1SVCP 2EDWA 4POZD 4BDVA 5HHME 5KEZA 2GIYA 1FCCA 2IPUG 1PG7H 1TEGA 4FQLH 1M2OA 4HWBA 4J3XA 3MR9B 4Y5XC 3MQIA 1ZGLA 32C2A 4IU2A 4L0PB 3L5WA 5HJ3A 1R5IB 2R1YB 5H35B 1G9HA 3O4LD 2ERJC 4HF5L 5D1XE 3UBXI 4PHXA 4B0MB 4JM4H 3QW9A 4GAJH 4P3CL 4KV5F 4HD5A 4J23A 1IBZA 5EUOE 1NPNA 4N24A 2WWKO 5HYJD 3NAAL 3P30L 1TUPA 3OKMB 4FG2A 4OD2A 4Y7OC 4IOSA 3EYQD 3DWTA 3ETBJ 3BGMA 4FNSA 3VYPA 2GG1A 1L9PA 4Z7OF 3TO4A 1JF1A 1PF3A 3QXUA 3BUYA 2HVJA 3BIBX 4IJTA 4JPWL 4KNSA 1AC6A 4QJ4B 1A9BA 1TVBA 3STLA 2QL1A 3ILDA 4R96A 5DO2C 4IIQA 2NNAA 3CFEB 4Z9KB 4DAGH 4ODWA 3N04A 2ZOTA 4F58L 1NCAL 4GSRA 2Q6WB 2EACA 2XX1A 2P5EB 2Y3NA 2IBZY 4U1IA 2YN5A 5HHNB 1DVQA 1F02I 3ZHFA 1S7TB 4TLKA 5I6NA 4FP8L 3VFPA 5KVGE 1F42A 3FU3A 3QDGA 2D9QB 2O5ZH 5KBKA 3W0WB 1MWAH 3GJEB 1F41A 2C3VB 3L1GA 4MJ2A 1DJIA 4CVZB 3SKOA 1UEMA 5EF3A 5KZCD 1ICTA 4A1RA 3K80A 4ZTPH 4YXLH 2LGNA 1ZHBA 5GZOA 1GZPA 1X9RA 5EFIA 3RAJL 3TCTA 3K8MA 4NC2B 1AQHA 2JF1A 4L4VE 2EXYD 5KSBA 2Y25A 3MLRL 3KZ8A 1UEYA 4AYEC 5EEWA 2GC7C 2BSED 4R8WH 5FYLL 5LBSH 4Z7WB 1R3JA 3N5AA 2BCKB 1VDGA 2YPVH 3RVXD 5ID0A 1UD2A 1B3JA 5HHOB 2NZ9D 2CA3A 1L6PA 4YHLL 1NGXA 3SYAA 4TULH 1JFHA 4KKZA 1QBMH 1OAYL 3DX8A 1MVFA 2ZT9C 4DKEL 4RFEA 2ITEA 1SUHA 3U30C 1BXUA 1KDIA 3GYRA 1P84J 3ARUA 2XQ0A 2EKSA 3ZYOA 3O41A 43C9B 3SE4A 3IB4A 4JB9H 5CIPA 1WH0A 3CUPB 3X1BA 1J0ZA 3HBPA 5AOKA 4FNTA 1MHHA 4IRZL 2R83A 3LS5L 4LVHB 1S7QA 4CL7A 4EF3A 3ZTDC 2MWCA 4UOQA 3T2OA 1P69B 2P8LA 1NGWA 2AJYL 3WCYA 4JHWL 1NOFA 3DX0A 3M1CA 3VW3H 2NNFA 3BPOC 4ZK8A 2OMTA 4RRPG 1NBYB 1FNEA 4IDLA 1ZWIB 2W95A 3TA3A 3SKUD 3VWJC 1XX9C 4G9DA 2ZAGA 5DK0B 5BUAA 2WXPA 4PJ7A 4ONFH 4P59H 3ETBF 3X1GA 2QQNL 1YYML 3MV8B 3CFBA 3WXWH 3X3FL 4N0UB 1VKXB 4KRMB 4H1LH 4QHNB 1CE6A 3RZWA 4LQ1A 2A4ZA 2EAEA 4XMKH 5C09D 4UQ9A 4Z23A 1AHWC 3MXWH 4GIOA 4MQSB 4NIYE 3ZKQD 4ANKA 4A2FA 3ZTNH 2GAZB 1OT2A 3PHAA 4I3GA 1ZHKB 2YZ8A 4POZC 3S35L 3S2CA 1OT4A 4WEBH 2BWDA 2ICES 3PWVA 4MKTA 3HHSA 4E42B 2FEEI 4DUXA 1T80A 2XWZA 2VN3A 4YHOH 1C1EL 2V17H 4XR8C 1W16A 3CN3A 3BFWA 2Z34A 4O02B 3SKNB 3B7RL 2P5WD 1I9RH 2G5BB 5HYIA 2P8LB 5BVPL 4MMYA 2JI3A 1PBYA 2XWJB 3RWJA 4JDEB 4PEEA 1AY1H 5E99L 4DN4H 2DKSA 3O9WD 2UY6B 2R4SH 3QO1A 4DW2L 4X0NA 1UVQA 3L3IA 1KB9K 2K3HA 5F1NA 4A7VA 4N0FA 5E2TH 5SWSE 1GGIH 2R4RH 4GB9A 3QUKB 4JDTH 1QBML 3UJIH 2ZOWA 4W9ZA 5T1KA 3ASNB 1QNIA 1JHKL 5I8KL 2CKBB 5C0BB 1JGDA 5A2FA 3SIKA 5HHQB 3PWPA 2VN5A 1UH2A 2Z1PA 3NA9L 5I1DA 4C56A 1N64H 4POUB 2NX5D 5I9QB 2ZOOA 1IGIH 1T1WB 2C7UA 2EECA 3A4FA 4PVNA 4MMZC 3BDXA 2IANE 1I7RB 1S6NA 4LHUB 4F33A 4X9YA 3HC2A 1NMAH 4Z18A 4FOMA 4I9WE 1A9EB 5L2KB 4RIRB 2ED9A 3B2MA 1TOXA 4WNQB 2VL4A 4HUCA 1FO0B 3BKMH 5EFIB 3WENA 5IJKC 5MERB 4HKXB 2GHZA 4H88H 4MCYA 2XKNB 4FLQA 4PJGA 3FU0A 1V55B 3QDJB 3WD5L 4MJJA 3VXQA 1MLBA 2ADGA 3B56A 2C3VA 4JM0A 3GIVA 1NMBL 5DHMC 3SOBL 3ARGC 3NA4A 4NP9A 3CFEA 2Q3ZA 3F58H 5DMKB 2GVYA 3W11D 3MHZA 1LTXA 4FQXB 4K8RL 3VFGL 3MA9L 3NJJA 2P5EA 4XN2A 3FRPA 1WAAF 1QG3A 3LYRA 3RP1A 4N26A 4D9LH 2UZIL 3GNMH 1AG6A 1OY3B 1J8HA 2WINB 1L9RA 2WLLA 1M7DB 1PDKB 3PUUA 1OLLA 1PLAA 1TEFA 1TETL 2KPNA 2NY1C 3DMMB 3QPQC 2J8UE 3QUXC 5B1CA 3VGAB 4JAMA 1LO0L 1SNRA 2R1WA 3MJWA 3GPSA 3C8HA 2LW3A 3HJ0A 4DP1X 5HYEA 2MIZA 1MKFA 1NCBH 4O9HL 3UTZB 3V5DB 4Y1AD 3TFKC 4APXA 4GG6B 2CALA 4H20H 4JJ5A 2X6BA 4Z0XA 1A7PH 3WNOA 2OZ4H 4XVJH 4YDJB 4DAGL 4FQQA 4HU2A 4APXB 3Q5TA 4GG6A 4XP4L 1QTYT 4X7TB 4J3OF 4PSPA 3E3QC 2CUHA 3BN9D 1M2VA 4FHBD 1KLFB 3L4WA 3M07A 5EZJA 3VCLA 3V4PH 1FNFA 3LKSA 5BPPA 3P2DA 4HUVA 1LP9B 4GBXA 2EDRA 2HN7B 4ZXBD 2XZCL 5E9DE 4UM8B 2F19L 3FQWA 3IKCA 5CGMA 4ZUUA 4IU2B 2DQEL 1JYNA 3R8BB 5C0CA 3NP4A 4X8JA 1F2QA 5BQDA 5KSVA 3PDDA 1DQMH 4GXUN 3CFDB 4DNLA 4OIIL 3QNXB 4JMNA 1INQA 1S3KL 4NZTH 5IHUH 4EBQH 2V2XB 4HWZB 2A0LD 2JJTA 1WFNA 4G59C 2DWEB 2Q3XA 3QA3A 2DLFH 4PLJD 1GCYA 1HHKA 4J2XA 4NQCE 1CJYA 4UIKL 4BQBA 1VF5C 3WNKA 3FU7A 4FFTA 4NOBA 4U49A 1OCWH 3TESA 3EXJA 1ZLEA 4PRIB 1MLBB 3LRHA 1IILE 3ULVD 1IKNA 1SOQA 4J39A 4UOZA 4WNQA 3K7UA 1EDYA 3UEQA 1AQDB 1KTDA 3AS0A 1UKTA 5CCHE 3BW9B 4DHLA 3UTPE 3SZ6A 4NQCD 2IGFL 3QEGH 4UAHA 1YAZA 4OLWH 2PABA 3IM1A 4P9HC 1KYDA 4KNQA 3QI9B 2DY2A 3L9RB 5F44A 5IEHB 1BQUA 3IDGB 4Y0GA 2FE0A 3KGRA 5IWLA 3LNFA 4GAGL 4LEOB 3S8GB 1I9JL 2IPUK 2OL3B 4IRJC 4XCCL 5MP6H 1KB9J 3X1NA 4AEHL 1A6VL 3LV3A 3DX6A 3DXAD 1U6AL 1M7IB 2ITCA 3O6ML 5AW2B 5I71C 4HU8A 1UWGL 3AU1A 4Y4KB 4K9EH 3IMSA 4ODVH 2A6JB 1NA8A 2CKBA 1W72H 4P5RA 3QK0A 3IJ8A 1FNHA 2Q10A 4H26A 3P3RA 2NQCA 5L2KD 3VXTB 4XO8A 5E2VH 1YY9D 3BP5B 3LZFH 2FAUA 2EYTA 3MROB 3QUMH 4KJQC 4L8SA 2VH5H 3LN4A 4A63A 2XC8A 5ICXB 1PZ2A 1RUKL 4BGLA 3APMA 4ODTH 1NL0H 1Z9LA 4YWGH 1G1KA 2EC9U 3HCVB 5EA0L 5HHOD 1DBAL 3UPRB 5JW4R 3BD3A 1XO8A 3EGDB 4OD1H 5AZ2H 1ZVYA 5KN5B 4YBHA 1WQVT 3L2NA 1J5CA 3ARED 4H2AA 5DJYA 2AXJA 4X9HA 3TBSA 3E8UH 3PHQA 1LE5A 1X4YA 2BX5A 3DGGA 1U2HA 4OY9A 5JHLH 5LXGL 2OJEB 1CCZA 1KGWA 4FI8A 3T2NL 2WUBH 1BIIA 3LS4H 4AZUA 2BY2A 4P4KD 4MAYA 4S1QH 2HYMA 5DZAA 1A6ZB 4HCIA 5FUOH 4RZKA 3M7FB 3WO3B 1CFQA 4XO9A 5FC9A 4OFQA 3U82B 2FX7H 1OSPL 2SEBB 3BWSA 4B3VA 4C83A 1KBBA 1M1XB 1D6EA 2Q8BH 4JS7A 4N2GA 5E5UB 5IMMA 1YN7A 3AT8A 3LKOB 1Q9WA 5FOBA 4AM0A 3OGOE 5JR1L 4L4TD 1FCGA 3MRNA 4UQ3B 3TIDA 5IOPA 3EFDH 4WNJA 4LHUD 5FCUL 4Q6KA 3EGSA 1G9ML 2BOCA 3IRCA 2XV0A 4PUBL 5DK0A 3SO3C 3L13A 1AH1A 3T8XA 2BM3A 4TQHA 2Y07L 3ATDA 5HYSB 4F8OA 2UY7A 2VDML 3TVMC 4TUOB 1DUYA 3UABA 3LQAC 4U1NB 3P73B 4K0OA 3A21A 4ZFOA 4LCYA 5I76B 5DTFA 4DFHA 2J21A 4E9RA 4AW7A 12E8L 4XC1H 3U4EA 2ZKYA 3MJ9H 1JNHB 1IB5A 1IO4C 2GY7B 5ANHA 1I8KB 3DX8B 3ABZA 2XWBB 3TYFA 1MREH 4YLQT 2PWEA 1BREA 1XSJA 3BAXA 2YRPA 1PEWA 3MA7B 2X3BA 2X53A 4H25B 2EDQA 2QSTA 3F7YA 3QORC 5C0CE 2DI7A 3GHBL 3D85B 5CNHA 2FNWA 1H8OA 2GJZA 3CZGA 3FOLA 4JY6B 4YBLB 3FQNB 4LSVL 3C6LB 1F3JA 4KX9A 1T7WA 3UP6A 5E4IA 4UTBL 2ED7A 1KBGH 1SBSL 3GS0A 4R97B 2LAGB 2NMSA 2EE3A 4JLRA 1OM9A 4JRXD 3SKOB 3OHXC 5EN2A 1FLTX 1XF4B 3LD8C 1L7IL 1L4IA 1OANA 3B5TA 4Z7WA 3QI9A 4M4RB 3MLPA 4XC3L 3NIFB 3CXFA 5JHLA 2C7FA 3A0OA 3KCPB 3H9HB 5BV7H 3R0MA 2NLJA 2YO3A 3AY4A 1CMOA 1TQVA 1E3ZA 1RU9H 2F08A 2PWDA 3HA0A 3IDGA 1QRNA 4LVNB 4ENED 5I15L 1BEYH 1M6OB 4P3WA 5I28A 1VGKB 1X7SA 3DXAA 1WZAA 3LQAL 2A99A 2NNAB 2QQLH 5CHNA 1K72A 2JWYA 5BRZD 4ZD3H 2KL6A 4B97A 3TU6A 2MHAA 5DUBA 5JMOC 4WGVB 5TTRA 2GUOB 3SODB 5KYNA 3CD4A 3PUCA 3JV4B 4Y19E 3EKCA 4PRPA 3B2DC 3HFMH 2W94A 1SM3L 4YK4C 4BGDA 2NY5L 5AAMA 3JWOL 3BWUC 5FEBA 3PPSA 1FV1A 2RCSH 4U0RB 4CKQA 3VXUD 2L7UA 1WICA 1UA3A 4YHPB 1HHKB 1MNUH 1T66D 3BT2L 3HNVL 4GAFB 4LP4A 5CO1A 1T2QH 2LFEA 2V2XA 3GB7B 3TM6A 4MX7B 3VXMB 3EOBA 2FO4B 2ED6A 2IAMD 5DEGA 3T0BA 3KJ4C 2IDUA 5I5IA 4XOEA 4AQ1B 4BBWA 3IEAA 1PIFA 3FO1A 1KLFA 4U7SA 2WTRB 3TC9A 1HTYA 4Q14A 3BD5A 5HHPA 5JHDA 5IG7A 3DO7A 1T22A 4XCYB 1MHPH 4Z0BL 4RMSA 3CVHL 4ZAKB 2R0WL 4PJBA 1I1YA 3SGKA 2ZICA 3G04B 1U3HC 3QQDA 5KVEL 5BQ7B 4PW9A 4P2RB 2JQAA 4XZUA 5EEYA 3H4HA 1KJVB 1U92A 2ESVB 4LPUA 5DD5L 2JKNA 4P2QB 2F61A 1R5VA 4U1KB 4NLAA 1V10A 5F1IA 4M1CC 3SHSA 4AQ1A 1EDHA 1S9VA 1J1OH 2PTVA 1QSFB 1MDTA 1GA2A 3WFBL 3L6FB 3H2QA 2NY0C 1QOKA 1E6OH 3D25B 3BQUC 1NKOA 4LSDA 1IJ9A 1W0WA 5C0DA 4B9KC 3CZNA 3DPBA 3FCSB 4WWPA 1FV1B 3HI6H 5GXBB 5EWIL 4TNVF 1XQ4A 1J8HE 4MDRA 3TWCL 4X4YB 4N8VA 4XPAL 1M57B 4LGRB 4X98B 3F7RA 4LCCB 4HIEB 3BZ4B 1DQQB 5IMLB 2M8XA 1MW2A 3KPOA 1JVOA 2B16A 3I6KB 3MUHL 3WTYA 4WFEE 2HLFD 4I3RL 2X28A 1YEIL 5DURB 3U6XA 4JE4B 4JW3A 1HL4A 2YAHA 3WGUB 3BKML 2A9NH 4LOUD 3L3HA 3T3MB 1SGKA 2JIXB 5IUCA 4LIQL 5EF2A 1A9EA 1BEXA 4C56B 1CFMA 1HHHA 1DDTA 1BVKA 3F58L 4TQEH 3VMOA 2NW3A 1WITA 2EH8L 1UASA 4XX1E 4ZS7L 3ARFC 3EYFA 4FQ2L 3L1EA 3RGBA 3MLWH 2QZ5A 1KZYA 3HE7B 2CLVA 3HZYB 4PJGF 2DAVA 5HJBA 4M7ZB 2B1HL 4ZOCA 2BMKA 2CGRL 3D0VB 4I2XB 5HDLA 5DC0A 2Y22A 5KVFL 1QX1A 4XTRC 4N0FB 4ZX5A 1MCKA 3C6LA 1ASOA 2V9TA 1ZVSB 3RTQA 1ZKAA 1X5LA 3OKDA 1P4IH 3ZMEA 1MAJA 3L3DA 3CFKA 3OJDA 2C3XA 2CUIA 2Y3AA 1JRHL 1SY6H 2IGLA 2JJTC 4RESB 5D71L 4K4KA 5DO2D 2CCLA 4P46D 5CEYB 1KJ3H 5GRZA 5KBMA 4LFHG 4A7GF 4N68A 4OZHB 3TLRA 2HRHA 2XWBA 3TYFB 4ODBD 3DNKA 5CFAA 2CO6A 4QYAA 1AFVL 2W9LA 2DL2A 3IDJA 3HRPA 2Q7NA 4GUOA 2UZPA 4UQIM 1ZHKA 1FFQA 2ITDB 3OMAB 4JGNA 4L5FE 2EE2A 1IGML 2NTFA 1IEBB 2V8MA 2Y1ZA 4PRPD 4U4IA 4A6YA 4G82A 2FO8A 3FT4B 1JE6A 3EGSB 1J1PH 2ADFH 5I73C 4H5SA 1KIUA 3L3KA 1ZIBA 1U93B 1KULA 3LIZL 1MIMH 2P5WA 2YRLA 4KVCH 5D2NA 4U1MB 3O6LL 5IQOA 2NSQA 3UBXA 4L3FA 3SO5A 1QEWB 4TNVK 3NZUA 3CZJA 4XCFL 3HS8A 2MNUA 3CFBB 1JHTA 2IDTA 3T04D 1VEOA 1X6NA 3FTSA 4QPEA 2PPEA 5DRWB 2OP4H 3M46A 3U7YL 1EQWA 3Q13A 3GTVA 3DGGB 2NY4B 3QIBA 3MNZA 1CI3M 1KCSH 4FFZH 1OPGH 4Y8AA 2OCCB 1MFCL 2A77L 3MZGB 4D94A 2W1NA 4Y9GA 2APFA 2EKSB 5L8JB 4YO0B 4PGZA 4NM4H 3K72A 4QCIA 1N0XL 2BPBA 3QXDB 1F8TH 3CMOL 1OE2A 4I0CC 5C09E 4YS4A 1IBFA 1GKOA 1QQDA 1K8DB 1PSKH 2A1WL 4G5ZH 3AM8A 4HS6B 4QT5B 5JW4N 1AXIB 3QH3B 4LEXL 4MJID 5A2CA 3ZRCC 3GSXB 3BFQG 4E41B 3EO1B 2WWKT 2G30A 1Z9SB 1JDDA 1YECH 3OL2A 4ONGH 4PWJA 2LLGA 4IGBA 1KJVA 3MJ9L 4W93A 1AGDA 4TVUA 2HAZA 2DMBA 1KEML 5DJXB 4Y9EA 5EBWA 3D4YA 1UJ3A 5I8EA 3T0EB 3ZXAC 5KW9L 1HZLA 3GGWA 3H6AA 5DS8B 5DT1H 3OHXB 5TDPA 3RYMA 2R2EA 5C08A 5KJRH 1FZOB 3ZHKA 1KGUA 2OXGA 3GJEA 5BMFL 3EH3B 2ZNXA 2ZX6A 5DURD 5D70H 3P0GB 4XMPL 4HAKA 5DHYA 5I82A 1SMAA 4J3WA 4UV4H 1TJMA 1R9FA 1JXFA 3QZLA 3PP4L 1YQVL 1GPOH 2XWDA 3IJSB 1NUDA 3K8KA 3GZKA 1NAML 4DN3H 1GS8A 2VQ1A 1K8IA 4RA3A 1PZSA 3DX3A 4AXWA 1WZ1L 2G3NA 3SYQA 5LXGH 1P2CB 3D8MA 1OCWL 4CMMA 1UT2A 4KBPA 4PJXE 2YQGA 5K93A 1KN4L 3HR5B 4O2FB 4R96B 5I19H 2DKUA 3ALPA 1SPDA 1AJ7H 3KPQB 4NQEE 4NQDE 4PSRA 2PETA 2UYLA 1X6LA 4PJHE 3GQFA 4CN4A 1PLCA 1MW0A 4IJ3C 1ED3A 3ZHDA 1D5IL 3DXAB 3OF6A 2BK8A 2KHAA 4C47A 1ADWA 2EDBA 4E9XA 2C4XA 2OV0A 1J5OL 1XGTA 4J3SA 1UD5A 4Y16C 5T33H 2ADIA 1D6VL 3CPLA 4P2RD 3MV7B 5DR5H 3A47A 3SE3A 3QFJA 4A7QA 2VLLA 3OD3A 1R5IA 1KACB 2AK1H 3T3PB 3TNNB 2WQSA 4PJ8D 3C2SA 1KXVA 2EDKA 4YPJA 2FX9H 2B4CC 5ESVB 4FTVD 1JS4A 1O7DC 3VFRA 3DUSB 4HCRL 4AQOA 4RGNE 1NGPH 4X7TA 1MELA 2OZ4L 4XVJL 3U7WH 4NX0A 3INUL 4LL9A 5HDBB 4KK8C 3R4RA 2X4UA 4PP1D 3RWEA 4EUPA 1HSBA 4N0YH 4AEIH 1QZ1A 2ZWNA 4Z6AT 3AXLA 3NH7L 2AQQA 2CBPA 3IMWA 3F7YB 4UNIA 3TT3H 3HKZA 2QKIA 1UQSB 4PD4J 4OFYD 2X9YA 3ARSA 1PFCA 1KPVA 4HXAL 4PI0A 4Z3IA 1OAZL 3EJPA 1OTSD 3I6GB 3QCTH 3SEPA 2WINA 3UXFA 4D9LL 5E6IB 3EHBB 3KDPB 1NFIB 1XHHA 1MFBH 4GXUM 4M29A 3ZDXE 2G4GA 1R1CA 3FB6B 3SCMC 4DCQA 4CNIA 4CSPA 2YUXA 3AUVA 1WA1X 1SDDA 5B1AB 2HX8A 3QWRD 4CW1A 1ES0A 2MPAL 3UL4A 5EHFA 4XMLL 2C1PA 5AW5B 4PJDB 5BV7L 1P4BH 1RLWA 1YUHA 3S5LB 2ALAA 2I7OA 1GSMA 1FE8H 2F8VA 3B2VL 5CCJA 1D5MA 1L7IH 4MJIA 3MV01 5DQ9A 1U0QA 1MCEA 2P24A 5C7ZA 4QRPD 3VDAA 5IHUL 1EAQA 5E94B 3ZT5A 2C9VA 4HOZA 3DVFA 1IIIA 3U9UB 3MXVH 1A7RL 5DO8A 3IN0A 5D55A 5IVXF 3QJSB 4W1TA 1P7QB 3UTQB 1OTUC 4XB8A 3VD5A 1JSYA 4EOWH 1LK2B 2VDKB 5E51A 4JKPH 4Y2DB 2J43A 4QO1A 1DL7H 2FSDA 3KPPA 3NSXA 3C87A 4DQOH 3QCTL 1XL4A 2QQQA 1E2ZA 2BNRD 3IFLH 1PX3A 2YC1B 3H0TB 4PCSA 4AGPA 1F1GA 4OI8A 4NCC1 3M8OH 1AO7E 3WEXA 4HSQA 4OZIA 5KUMA 2WXQA 35C8L 3HMXH 4PYGA 1OGAE 3ARQA 3PDGA 4U6VH 2G9KA 1ZLDA 2Q0ZX 1QW8A 4QYOA 3AABA 4AL8L 2Z91A 1R3HA 4D0CA 2J88L 3N1FC 4X9FA 5EZIL 2XIDA 4DZ8B 1I9RL 1BVLA 2XQYK 4F2FA 5DMYA 5F96H 1RSYA 1AZZC 4WU5A 3KH4A 4JGUA 2R69A 3QG7H 4K73A 4OF7A 4P23A 1YNLH 5J0BA 3OJ2C 2Z64C 2D3VA 2UWEB 4S2SB 4PJEF 3HB3C 1ASPA 2UZYB 2VLRA 1KBKA 2DM4A 3SDYL 2D31B 3GD1C 2WMPA 2PXYB 3OXRA 3V7MA 4EQ3A 2P24B 4Y2OB 4HXBH 5DR5L 2AS5M 4J3OC 4N8UA 3DX6B 2X70A 3AXIA 3MGOB 1KZQA 5C0AB 3II3A 2DJ4A 4NDMA 3O9WB 5I16B 1XT5A 4FKKA 4PJ7B 4XRCA 2EP6A 2WQXA 2E75C 3RY6A 4R6UA 4GO9A 5B38A 3RWCB 4CNIB 4F2MA 5IVXB 1AQDA 4XPTH 2HPTA 4UYPA 1MI5B 2PN5A 5E9DD 4R0LB 3ARBD 1IL1A 2IQAA 3MNVB 5AL0A 3WNPA 1RSFA 1LWRA 4HYTB 4MQ7B 1SVBA 1D2OA 1O6SB 5LBVA 4JQIA 3NIDF 2ZYRA 5ACZB 3TFBA 2MOVA 3H54A 3LIZH 1KPVB 1TTGA 4LSRL 4UV4L 4XMPH 2ZG3A 1GS7A 1X4XA 2H41A 3L4YA 5IBUB 3QDGE 1KXVC 4W9HC 4DJMA 3T4AA 4U1HA 4I18C 2W07B 2QDVA 1OAYH 1HESA 1F45A 2PCXA 4PJEA 1MCLA 4LMQE 1JGLH 2DPKA 1FC1A 1TYRA 1NFKA 3QZMA 1N8ZB 1VSCA 1P5UA 4N0CC 5FF6B 4J28A 2IDCA 2B1OA 3GM8A 3DSNA 1KBWA 3RJOA 2X9ZA 1PKQA 2I27N 1E8XA 2CDEA 3V0IA 2QVTA 4QHKJ 4TLTA 1W6LA 2WXMA 2JKIS 1A7QH 1NANI 2OTWB 4KNTA 4QEGA 3ML8A 3TCXA 4PYHA 3AG1B 1ACCA 1BAWA 3T0VA 3PABB 3GSUA 5FYKE 4WVRA 4NZRL 4EIZC 4ZMLA 1PY0A 5DVNA 1FC2D 3TS8A 4JG0L 5AYUH 1F8TL 3CMOH 3UTTB 1RKRA 5H2BB 3R1GH 3US9A 4PJCA 4M6AA 4UILH 3V52H 1M7DA 1PDKA 2WWMC 4RZCA 4JM2A 2YRZA 3MV7E 5D71H 1KTLB 4XAWH 3FUKA 3TWCH 1E4XI 3VSVA 4EXPX 3HI6L 1OAXH 4L4JA 2J1XA 3LKRA 3D06A 4L1HA 3ZRSA 4K8RC 5MEOA 1BCIA 1WA2X 2W5PA 1A65A 4QRQB 3ISYA 4G1EA 4B5EA 5DMKA 3ZGHA 4PS3A 1DBJH 5FLUA 3FSOA 5I1JH 1A14H 3NVQA 4M5ZH 1Y7VA 3CPUA 3CVIL 5I1AA 4Q52A 4I1PA 3KYKH 3TO4B 1A47A 4P5TC 1EJOL 4ENZA 1JZ3A 4ZQTA 5LHDA 1CIUA 4IJ3B 4KTDH 3DV4A 4XGZA 5A2LH 3IBOA 4FTDA 3V4UL 3U2JA 4EI6A 1DEDA 2Z35A 1N18A 1IT9L 4LLUA 5ESQB 1T89A 1T4KA 1DVFB 3CCHB 4KXDA 1HHGA 2V9QA 1A3LH 3RBGA 3GMPA 4TUKL 2C9PA 3BEVB 2E27L 2VSCA 4WWKA 4R4BB 2X4TA 3MFGB 4KKAC 4ES9A 4QF1B 4YE4L 1PG7L 3Q5OA 4FQLL 4S11A 1KSRA 4NJ9H 4YX2H 3VWKA 3FFCA 3V6OC 3F3HA 4XH2B 3QE5A 3JVGC 1XIWB 4JQVA 1NCCH 3DX7A 1HCZA 2VL5B 5K9OA 5EMYA 3SY0B 2WZ6A 1JRHH 1SY6L 2X88A 3BT2H 5L8KB 3EF7A 4CUCA 4A2HA 1CE1L 5HYJE 1A3LL 3KPRE 3I02B 2AF2A 3WNJA 2JJSA 4TUJB 1R19A 5AVRB 3WY1A 4PJEE 4MHHG 5E00B 5SWSB 3DKHA 3QR2A 5AB1A 4Q8BA 4ZI8A 3MGTA 1H6UA 5D96B 4MD5B 3V0DA 4ZMTA 4LPVA 2VDNH 1ERNA 1QWNA 2DBJA 1U8LA 1AP2A 3DVIA 3GI8H 1AQ8A 5J3HD 1YG9A 1P1ZB 1SFHA 4YK4B 1PX4A 3QRFM 4PY7A 5T3ZE 4N87A 3TBTA 2ICEC 2WBJA 1RHFA 4PJ8C 5CZXD 2F1BA 2BC4B 3D48R 1PAMA 3FJTA 4FZEH 4FNLH 4LSSH 2B5IC 3GHEH 3JTTB 4NUMA 3FU9A 4HG4J 3HFML 4FG0A 4GW1A 1J0HA 2O6FA 1E2VA 4FJ6A 2BNQE 5ERWB 5IQ9A 4ECNA 1FORL 5E8PB 4PJDF 1QLEH 2D7QA 4X6BA 3O2WL 3BLPX 4HPOL 4WO4B 4HIIA 4UTBH 3SYCA 3QEHB 3T6QC 4JREB 3RWGA 4OCWL 3EJZC 3FB5B 3MLZL 5I5MA 4XNMB 3LQAH 5GRXG 5J06A 1KGXA 4HUUA 5JPMB 3L95A 2GSMB 5D5MF 3VB8A 3FTVA 2X2IA 4Y2DC 3IWUA 5LGHL 5KVGL 1MI5A 2R2CA 4BHUA 2H6PA 4GXVH 5E2TL 5FDWB 4DTGH 4HIHA 1A2YA 2K45A 1W91A 4GRLA 4L48A 4NQXA 2A74A 2C4FU 3II2A 4UINL 2GTZB 3QPXL 5T3ZL 2IF7A 3HE7C 1FI8C 3IDXH 4LBEB 2EINB 4FCAA 4L4VD 5A2JH 4XBGA 2WLYA 5AW9B 4NJAH 5C92A 1MCRA 2ARWA 2KPWA 2DQFB 1I1AB 1HK6A 4IK6A 3VMNA 1HXYA 5I26A 2CXGA 4HC1L 6CGTA 1BZDA 2VITB 2WYZA 2PW2B 3CLWA 1KCBA 2NY3B 4DKDC 5JZ7C 2HMIC 4LMQI 1MHEB 1XGPB 5F7EH 3CN1A 3ASWA 3KYNB 4MJHA 4OCYH 1DJWA 2VLMD 1BM3L 4MNQD 4OF6A 5LBGA 3WG7B 1C7TA 2FWOB 2VZ3A 5IHZA 1AO7A 2OCFD 3N44F 4X6CB 3S4SG 2FUQA 3E7JA 3QJXA 3DROA 1YN6A 3OPUA 4JZNB 4N0RA 4XX1G 3VYOA 4WI2A 3SQBB 4XPHL 1NM4A 2J6EA 1WC7A 4DZ8A 4YGVB 3BH8B 3BUBA 1ZLSL 2CKNA 2Z91B 2X6MA 1B6UA 2P8PA 2BRQA 2ICWB 3O2DH 5IQNA 5HD8C 5JOPE 1BYNA 4KKLC 1UM6L 1YZZA 4NO2A 1G5GA 1ZVHA 5J89A 4GG8B 3LKPB 4ZOAA 4ZSOE 5IMKA 1E5UI 4XBGB 4HIXH 4KH9A 5F7WC 5T1LA 3SB3A 4FFYA 2GBTA 5C0GB 4JDZB 3IE9A 1A6AB 2B1AH 2PNDA 3PWPD 4ZNEE 2QELA 2G0LA 2VDKL 2B2XL 5MEQB 1R3KA 4K8RD 1IAKA 1MJUL 2F5AH 1A4KB 4ZW6A 5E8NB 1J9CT 2VDRL 1ZSHA 2D7MA 1WZ1H 2DQIH 1BVNT 2OMWB 3FOMA 2Z4QB 3FK3A 4GIPD 4HHAA 4L23A 2NCEA 1IV8A 4UILL 3V52L 4NI3A 2FX7L 1FFRA 5GS0H 1MCNA 3FT0A 2KBGA 1I3UA 3WU1A 4NI6A 3ARGD 3Q3GB 4HUWA 4TVSa 3F2LA 4NHCL 3P3YA 4YUEH 4WO4A 5EUKA 5FUZL 2OR8A 4YDLB 3V4PA 5IQ7L 2BO0A 1MCHA 3OWRA 4JO4L 3ZE0E 3FO0L 3DBSA 2AJ3A 3DHMA 1BMGA 4JVWA 4RAUB 2YUZA 3Q2NA 3WL9A 4ZX3A 3DHPA 4S1RH 3UJTL 2H6OA 2V7NA 2TAAA 3M17A 5HBBA 2IXQA 4YZWA 1W9XA 2GJ6D 3VXNA 4OZIE 3KMDA 3ZT6A 4XN1A 5HHPB 3FMGH 1XTLA 5H8DA 5IGXH 1YECL 3L5WB 2IQ9H 4WKZA 2Z0UA 4LARH 3IBEA 3MRIA 3IDMB 5ISZD 1RPUA 1ANUA 4YHKL 5AKRA 3SE6A 4O00A 1ZOXA 1CQKA 2CO2A 4LCUB 2FO4A 3I6GA 3UTSD 2EVIA 3FF7A 4K3JL 1PGRB 2KI6A 1CBVL 4R7LA 4WI3A 3ES6B 4WTZG 3ARDA 3MCLL 3HJEA 4I13B 1HEZA 4UT9L 4XP1L 3BP7A 1RZ8B 2OI9C 1DQJA 1XCWA 4QHUB 3WI9A 4YH6A 1DO5A 2B77A 4M43H 1JXDA 2EEBA 4R7DB 1D5BA 4DQAA 1CDGA 1OTUD 2DWYA 1ND0B 2YARA 2EYRB 1JZ2A 4LZKA 4U1GC 3QRBA 4UTCA 4FLOA 3NQIA 5FUCC 5IW3A 3WKNA 3MOAH 3FHQA 2MPAH 5FYJD 2XN9B 2CK0H 5IBUG 2QQKH 2PR4L 3UOAB 1ZA6B 1XWVA 4QWWD 3UFIA 4M7KH 3MJ9A 3BUPA 3RNKA 3DHUA 1U41A 4JGMA 1DVFD 2WP3O 4UT6A 4K3EH 1QVOB 1RZKH 1TENA 4FYSA 4KVCL 1ITCA 4GKSB 1BM3H 4OT1L 1E8WA 1VPOL 1I9IL 5GGVL 1DN2A 3DK0A 2HLAB 4NXKA 3O0LA 4JKLA 1EK3A 4F7KA 4YZFE 3PF2A 4LDOB 3U1SL 5IQ7H 5KSAC 1N5YL 5LGJA 1A66A 4HW6A 3IGAA 4U7MA 4I48A 1E8YA 1KLUA 4PJ9A 1WJ3A 5CSZB 4D0DA 3FXIC 1D5BB 4NSKA 1XB6A 3HI1B 5CAYB 5A3IC 2B15A 3GZPA 2ZWZA 1EAJA 1KPUA 5IR1B 1UXSA 1PJWA 4PR5B 3HOGA 1TZGH 2WNWA 4D0BB 1FZKA 4RETB 4GSUA 1MI5E 3WJJA 1BYOA 3MA7A 3L16A 4FFYL 3HAEH 5D7SH 2ENYA 3O2DA 2WCGA 3PWLA 4GAGH 2XZCH 1X7QB 2CMRH 5BUPA 2OTUB 2VH5L 5JIDA 2DWDB 3KBHE 5C71A 5KVGH 3VXOB 1DVXA 2ZG2A 2BIQA 4OZ4B 5ABAA 3NFNA 1NCGA 1XGUB 2DQ6A 3K0YA 3CGTA 4WI5A 5DFAA 1J11A 3LH9A 1R5WA 3APDA 2CR3A 1PU0A 3CU1A 4B9ZA 4F93B 4WHYH 4N3UA 1H19A 1ULVA 5CJQH 1LQBC 2EIKB 4XNBA 1OOWA 1I8LA 1BBJB 5GJSL 3QUGA 4FCHA 3GUTA 3CIAA 4EUPG 2GSIA 3KLAA 4NNXA 1CI5A 2ADJB 5I75C 3OZLA 3EOTH 4UINH 1MF2L 2OMXB 4R5XA 1SEQH 4J3TA 2XVKA 1TVHA 3HN3A 3FBQA 5F9WB 1S5IH 1OK8A 4P5KA 3QH3A 4K23H 3ASOB 1P7BA 3TT3L 1PY9A 3OQRA 4J4PA 3JWNH 2E5EA 4TNGA 3GI8L 3O4LA 4N5ED 2ZUWA 1MHCA 3P9LB 1XGRB 2IV9A 4LSUL 3V7AG 3D3VA 2FJGB 5DJCA 2MKLC 4HHAB 5ACZA 5T1DL 1GPOL 3WLWD 3MACH 4DGIL 3IJEA 1RIUH 2DIEA 2JCCA 3TBYB 4IYKA 4ANWA 1OZTG 3V6OA 3EBGA 2NY3D 1J0IA 1EHLH 3B9KC 3W56A 4F8TA 5E1AA 1IM9D 1TNMA 3ALXA 4J1UA 3U7AA 5KG9A 4NZ8A 1YEHH 1N26A 2BOBA 5IIEB 1JV2B 1MI5D 2RQ8A 4FKHA 2V2WA 3IRPX 2DYPB 1T5XB 1SJVA 5BVJB 1VEPA 1JHTB 2EUVA 2FATL 5HI5D 3CBKB 1BFTA 4BFEA 4QHLA 2NY3C 2NY6C 2ZWSA 4Y4KC 1R3LA 5DD6A 5B39A 5IV2A 4DK6A 2ZSWB 5FFLA 1KIUB 2R0WH 2VAAB 3U36B 1XD1A 4ATTA 4RX4D 5A6MA 1DQLL 1HNGA 1WO2A 3SSGA 1YEFL 4DT2A 1FWXA 4TF4A 5JPMC 4P04A 1IGIL 5GGRB 2CPUA 1IQWL 4NM4L 4K3DH 4JKWA 1HXYB 4RCAA 4AG4L 3SDXF 1BVLB 5FHBH 1N5AA 2BSSB 5DJ2B 4XN5A 1DYZA 5AL8A 3DVNB 1QWUA 1YJDL 4MA8H 1TZHB 2VJ8A 2VM9A 3M7OA 4YE4H 5CZRA 5FKPA 4E2OA 3H1ZA 5I30L 2ZX5A 3W38A 4LQFH 1XGPA 3SBWA 5J6HB 4MXVE 3GKWL 2HVKB 4E9LA 2WGNB 1HZHH 3ECQA 4ZUTA 3ULUE 2PXYC 1RFDL 2VM3A 5EZLB 3ETSA 1MN4A 2P8MA 5BMFH 4NN7C 1PNDA 4EN2A 4MD4A 1S7VB 3WIAA 3V0WH 3N0AA 3L95B 2Y6SD 1O6VA 3RTQB 5J5EA 1EGJH 4FL4C 4FHKA 3IFPA 1LM8V 1VB9A 3L2MA 5IKCA 4N9GA 2FGWH 3FT1A 4G8EB 1VEMA 1MHCB 1E9QA 3FQXA 4M5ZL 4A55A 3IMVA 3KPMA 1ILSA 3LN9A 2Z1KA 3ESOA 5F9OH 2MMXA 1OO2A 1CZ8L 1IAOA 3BPOB 5E2WL 4J6IA 5DHVA 3H2WA 2L7EA 2OFQA 4BFIA 5LLIC 1XIWD 4PJ5A 4IEFB 5KJ4A 1KJMB 2E4FA 1ZHNB 2OMBA 5TE7H 1C12B 1N9PA 4I87A 4K9EC 4QXVA 3SZKC 3T3ME 5K1NA 1K5WA 4DVBB 1EO7A 4UCFA 4TSCL 1CLOL 3LKSB 1ZANH 1L9QA 2DS4A 3ARBA 2VR7A 5ITBL 3EYVB 4A39A 3IN2A 3P77B 4O2CA 3GXTA 4WV1A 4A04A 1DLFL 5FGCE 1UWEH 3S36L 4XNAA 5HVFB 2XPZA 1XSIA 1JK9B 3VFTA 1QHQA 1TFHA 4X4ME 1UWYA 3Q5YA 4MB5A 1P1ZA 3MV8D 3MVSA 1YQ2A 4G9FB 1YEDA 1V7ML 5AWNH 5FB8B 3GT6A 4NN5C 2G3MA 1F0LA 4GH7B 3SCMA 2XTSA 2R2BA 4JX0A 3NZHH 4DP5X 4GG6E 1MW3A 4K71B 4XB7A 3QAZB 4TRPH 4OQTH 2AQNA 3MNWA 5LN4A 5FO7A 1L0QA 4BH7A 3HHMA 4GS7C 2XKUA 4OUUB 3W1ZA 3CXHJ 1HSBB 3ZQ9A 2Z92B 4LOFA 3LEVH 1NCIA 2R0KH 5E1GA 5FYJU 2KQMA 3UBHA 4L0YA 2X2UA 2A9NL 4OI9A 2NY7L 2HRLA 3VMPA 5ALCH 3CCHA 2VO8A 1CVRA 1I1YB 1DO6A 2AABH 4LNVA 2H32B 2PCPB 3OZ9L 1LEGA 4IOIA 4XMZA 4L37B 3ZTJH 3ARGA 2F53A 2XOTA 3UJJH 4Z76B 4ESKA 3GLEA 1OCRB 2IPKA 1H6FA 1HOCB 1TLMA 3V0VA 4U1SA 5IROD 4J4PD 3TF7C 3FO1B 4I3SL 1U2CA 4RIRA 3JSSA 4P0DA 4AC4A 3MLRH 2JJVA 2UV3A 3WY4A 3QUMB 4ZYKA 1RZGB 1DEEB 3BH4A 4MX7A 2Q3AA 3M86A 1RZGA 2RFXB 3CVHA 1ED3B 3QG7L 1BLNB 1TQTA 1M9SA 1MFUA 1XDTT 1KOAA 2XV3A 3PJSA 2NRDA 5FYLD 5JOFB 2NYKA 1I8IA 2ZXGA 3IMUA 3ME0A 1TZIA 4KJYA 5K1JA 5I0VA 3ESNA 2GIMA 2XICA 4JG9A 4LVEA 3ARGB 2F8XC 2V33A 1EPFA 4GEIA 2H26B 6FABL 1ZVNA 4ZFOL 5J13C 4ODXB 1F13A 2IG2H 5IF0A 5IVZB 3GINA 2ATKA 4P5TB 1S7UB 4OU3A 4A6YH 5ABDE 5L9DL 1P4IL 5MEOB 1E9PB 2YS4A 3WFBH 4WENB 1FIGL 1EHLL 1BWWA 5J13B 4FQCL 15C8H 4JFFB 2G5BA 3GMNA 4GMSL 4YXHL 4DPRA 1F3DJ 3PV6B 3WS6A 3ZJAA 3LQMA 4M8QA 4NRXB 4BINA 1CTNA 1H3TA 1UHVA 3B3IA 3PYCA 5GSVB 2EDXA 1BMWA 5DD0L 2XCMC 4L3EE 4R8WL 4KI1A 4ZTOH 5FYLH 4IHBA 4ELKB 4EZMA 2WO3B 4PJIE 2ZSWA 3ML9A 3HC4H 5BRPA 2ZXWB 4JZJA 2IPTH 3WSQH 4NN6C 4MXVF 2WXNA 2EO9A 3TH2T 4N0CD 4OZIB 4BZ1L 1MCJA 4H8HA 5FM5O 4FFYH 4BUGA 2ZXEB 1G4RA 1CQYA 4H25A 3HUJB 4U6HA 3JTBA 4MAZA 2X4QB 3UTSB 1MEXL 1XGZA 5EUKB 1LHZA 3MLTB 1NQBA 4K3DL 2V5RA 2N1KA 4ERSH 1OTSC 2KDYA 4A67A 4JHZA 3B2PA 5GZOD 2OM5A 3FCBA 4CBPA 2F7QA 5E4EB 2YD9A 2Z6FA 3NDYE 1TTAA 5JYLA 5DK2A 5DXWA 3ZOAA 4PG9B 1FHGA 1OARL 2QGCA 4LL1A 3C9NA 4E5XG 2BOLA 3PGDB 2HFFB 3MMEB 2XLLA 5F1KC 4E9TA 4P2YA 4Y5YB 1Q9WB 4WUUB 5DRXB 3WHE0 1LMKA 5IY5B 3TEUA 2VZ1A 3E6FB 2ICWA 2O5XH 4G80A 1BYPA 1FFPB 1OWWA 3LPOA 1D5RA 3INUH 5B1JA 5C0BD 1WC7B 2Z7UA 5I75B 4MJ5B 1S5IL 2QFPA 4QJ3B 3ROOB 3OLIA 2EDLA 4QNPF 3OXRB 3BZDA 2VLKA 4C54A 3TH3T 3D0AA 1TSHA 2VLRB 1NLDL 4KK5C 4NDMB 4UYQA 1V7NL 5TPWL 1MJ7L 5AG8A 3GKZA 2XZAL 1FVCB 1JZDC 1Q0XL 2CLRA 3RLSA 1KBPA 5DDHA 4KI5E 3RWIB 2X70B 3DI3B 3MRPB 4XHQA 43CAB 1VHPA 4ABVA 4NO0A 4QXGL 1JPEA 2WQVA 3MREA 3C08H 4K15A 2YEZA 3Q2WA 3INOA 4EO5A 5LQBL 5D7IF 2PYEB 4H8PA 4NPYA 4N22A 1ET5A 4QYOB 1KXTA 1B0RB 5CD3A 4WHCA 4WI7A 4GG6F 4KJWC 4RWYL 3C2AL 3IDJB 4KMQA 2I9TA 1B6DA 1I1AA 1OSEA 3HBZA 4U3SB 2ZXAA 5HDQL 5IV2B 3QWOB 3SYOA 2BP3A 3O4LE 3TEZA 3QO0A 5SWSD 5F3BA 2A6IA 3QDGB 4WU5B 5C2BH 1LGVA 1G7IB 1OAZH 4Q58C 1CFTA 2XG4A 2A74B 2VMEA 1QBAA 4OKVB 2K1MA 5ELIA 4D0CB 2V5TA 2Q6WA 4PGBA 5BRQA 1CICC 5DHVH 1F56A 2F8IA 4AV5A 5C0AE 4UQ2B 1PX8A 4TVPD 1Z3RA 2R56H 4PRIE 3UC0H 5T3XE 4NN7B 1QSEA 1W2KT 3M6DA 4HFUL 4Q97A 3WEXB 3ZDXB 3V4VH 1LO4L 1RU9L 3IF1B 1F6LL 1YC8A 5I6OA 3GJFH 2XYBA 5EU4B 5FCUH 5IROA 4KDTC 2E7BA 3SDAC 4PJCE 15C8L 5D70L 2MCG1 2NW3B 4BQ6A 2DMCA 5FWRA 5I5JA 1PSKL 1F4HA 2A1WH 1QP1A 1S9WB 3VRIA 5I2IA 5DJCB 1YUHB 2JIXA 3P40A 1SHMA 2WC7A 5B1KA 4GBXC 1XEDA 3MX0A 1E4XH 1K5NA 1W8NA 3QJOA 4OI7A 2CCVA 2QQKL 1CL7I 4W9EC 4CSTA 3IRZA 3PGCA 5I1GH 4JFTA 2WKLA 3CQQA 4AGNA 3MJ8B 2FEEL 1RUKH 2W9DL 4J3BA 2AI0H 1A6TB 2FWUA 3ECVA 2EXWD 4KQ4L 4PRIA 4R0LC 4Z7VB 1UTDA 1I4FB 5DRNA 1Q1PA 3NSFA 4OT1H 1IQDB 1KB5H 2F2HA 3EJRA 3MUZ1 1T04B 5IGXL 3BP7B 2FLRT 3HG4A 3ES6A 4H4NA 4HMEA 4OZGE 1FL5A 2HSIA 1T03H 1NIFA 3W39B 4IDJH 5G2NA 3T2NH 4JHAL 1QA9B 2V8LA 4ZBJA 5CU5A 2E7LA 4PV9A 1NC2B 2A38A 2F54D 2VIRB 3GSNL 4QXWA 2OLDA 3FQWB 3IKCB 3RX9A 2ZWLT 3FU6A 2CAKA 3OR6B 2DWXA 5DZNA 2VLJE 1BHGA 1UXSB 3D52A 4Y4FB 5T1MB 4JO2H 4PJ9D 3WFEH 3BUDA 4AH2B 2LLLA 2P5WE 4LLQA 1O9ZA 5GJTH 2EIZA 3IDYB 4OJFL 3RFZC 4AKOA 4MZIA 4WDIB 4NQSB 3L4UA 4Q6IA 2F15A 3MV7A 2I60L 4YHYC 2EIBA 3LD8B 1MG2C 3F7KA 3WNMA 1TQCB 2MNJB 2WUCL 2ZYHA 4AK1A 4LKCB 2ADFL 1J1PL 1TJGL 1UA6L 1V7NH 4PIBA 3TPUB 4V33A 4P05A 4PFEA 3FB8B 3GB7A 3M1BB 5GGSA 4XVUD 4L8CB 2H1LM 2ZD0A 1FNSL 3T77A 1IBHA 4NZUH 3I50H 5BW7A 2YLKA 2R23B 2YAPA 5ITFA 2AV7A 3CSBA 1S3KH 4NHUB 1KGJA 1X5ZA 3OQ3B 5BNXD 3BEWA 4HS3B 3VTMA 4GLRI 4IOSD 2VAJA 4HH9B 1NL0L 2B2XH 3UYRH 2CIKA 3VXPA 4QAMB 3TH4T 4F7CB 4W9LC 2EH8H 4KO5A 4FA6A 1XF2A 4R3SA 4RGND 2RA1A 5KVDE 4JNXA 3MJ7A 5AKSA 2JCWA 1ND0A 2JQMA 4UBDD 1GC1C 4NKOA 2EQDA 5D1QD 5JHDE 1XBDA 1T0OA 4YSQA 1OGAA 1NWOA 3QRLA 3UX9B 3LRSA 1QRNB 1TEYA 2EDEA 4AXWB 3TNMA 4OCLC 4YUEL 4JJOA 4K5NA 1J18A 3PWPE 2J55A 3UYPB 3U2SA 2QR0B 4F15C 3OHXA 3OAWA 1FNLA 5D7IB 1FSKC 1JBJA 2ESVD 2LFGA 4LT7A 2OMYA 1LWJA 3DVNA 4MVBD 3L3OC 1DVFC 3RA7L 2D0GA 2VXQL 1N8ZA 4IGBB 1AD9B 2K7PA 2ENPA 3QDJE 3AY4C 5LAXB 4HV8A 5HI4D 3THML 2OZ4A 1S5HA 1NCWL 1JGUL 3RVVD 2F53D 2DH3A 2H3KA 5FO8A 1QPXA 5JHMA 4NCDA 2GJZB 4JY6A 2AW2A 2XDHA 1IM9A 2AQ3A 1BPVA 2VSKB 1S8DB 3Q1SL 2EDTA 1B0IA 2HFFA 3MMEA 3MV9D 1OCZB 5T5NF 3WUWA 4ZTOL 4ZQKB 1NBZA 3Q44A 5B38G 3VUAA 1A0QH 1NIEA 1NMBH 4KVNL 2J8HA 2BVQA 3L81A 4GRLB 4F8PA 4Y4KD 5FYKU 1XZWA 2EH7H 1SXSA 3V8CA 4D8OA 2Y7MA 2AJZA 1FRGL 3IGUA 4JPVL 5HDOA 3CC5B 1OF2B 1QFWI 1UC6A 3SKNA 4MA1B 3QEQD 5E8OA 4FNLL 2AK4B 3I9GL 3OKEB 1UM5H 2D4DA 3MYJB 4XOCA 3MJ6A 3ECWA 5E1AB 3D5OF 5L0QB 2I7SA 5C9KA 1GTNA 3V95A 4HIIB 3UTSA 2B08A 2K8QA 2I07B 1RMFH 3SOBH 3QUYD 4X42A 1B4LA 4B9FA 2DM2A 4KVNH 1FPTL 5AG9A 4YHZH 5D1QE 4M5SA 4LK4A 4OLXH 4JG5A 2XQBL 4XB3A 4WHTA 4TQEL 5F88B 1TITA 4V1DB 5T1LB 4PJBF 4YN3A 3W2DL 2P5WB 3WS6C 4DERA 3S9DB 1E9OB 3U6RA 3HZVB 4MA3B 1CDBA 1UATA 5AUMA 2W38A 4H5SB 2FZ3B 1IX2A 4DTGL 1GGIL 4P5KB 3KLKA 3D9AL 3LH2L 3B3IB 3BP6A 3PQYB 4ODUA 1DBMH 3MACL 1ZHLA 4M5TA 1ID5I 1BOYA 3GSRA 1A0QL 2VLJA 4RMRA 4EIUA 3DUUB 2Z8RA 3OR7B 4L4VB 4H8UA 4ZO6A 4OCSH 1BG1A 1PY4A 3ECUA 4JR9H 4G6JL 3WKML 3OKOA 1XR9B 1AKPA 5C0EB 4N28A 3U2SB 4YNYB 3ZR6A 1BQ5A 3GXUB 1QSVA 1ZS8B 3GBEA 3ZN6A 5D6DC 5IBLD 5D9SB 1VZGA 5AVYB 5E23A 5CEZL 1OV8A 4I1RA 5KSBE 4R2GC 4TRPL 3ESPA 5K9JL 1OAQL 4X4MA 1M71A 2WN3A 3LRKA 2IJ0C 2ZKWA 2WP3T 4NRZA 2VDNL 2G9HA 1SBSH 3KYKL 3F7VA 3FRUA 3GS7A 4BZYA 1KCVL 4ZMZA 1F00I 5AKVA 1WP6A 1ZY9A 2CHDA 2L7JA 2W80C 4H26B 3BIKB 3W0WE 2BY3A 5D4QA 5E8EA 4FEMA 4N20A 2ZTBA 1KV7A 2VSDA 2HJKB 3C5JB 2C9AA 3GMQA 3MRMB 3FB5A 4HG4K 5KBLA 2DQGH 2P7TA 4JFED 5EU6E 3ZE1E 5BOZG 5BW7C 2PCFB 2QZQA 3KLHD 4ATWA 5E8PA 3S5LA 4LEOA 4M7LT 1FAIL 4KGJA 2VC2H 4L37A 4PBVC 4QRAA 5SWQA 3RL2A 4U3XA 3VWJD 3DIFB 1PCSA 3D08A 3IJ7A 4EVNB 1VFUA 4I0PB 1LEKA 4OLUL 3WUZA 1II4E 2JB5L 3GRWH 4YX2L 1KCSL 4FFZL 2E6QA 1JPSH 3IFOA 2CNZA 4HS8H 2HXAA 3VU1A 1MFNA 3CHSA 3N43B 3BGFB 4DCQB 1AR1B 2Z92A 1JF6A 1HJBC 3JWDL