2X53A

Structure of the phage p2 baseplate in its activated conformation with sr
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
263
structure length
263
Chain Sequence
TIKNFTFFSPNSTEFPVGSNNDGKLYMMLTGMDYRTIRRKDWSSPLNTALNVQYTNTSIIAGGRYFELLNETVALKGDSVNYIHANIDLTQTANPVSLSAETANNSNGVDINNGSGVLKVCFDIVTTSGTGVTSTKPIVQTSTLDSISVNDMTVSGSIDVPVQTLTVEAGNGLQLQLTKKNNDLVIVRFFGSVSNIQKGWNMSGTWVDRPFRPAAVQSLVGHFAGRDTSFHIDINPNGSITWWGANIDKTPIATRGNGSYFIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords ORF16
publication title Structure of Lactococcal Phage P2 Baseplate and its Mechanism of Activation.
pubmed doi rcsb
source organism Lactococcus phage p2
total genus 56
structure length 263
sequence length 263
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R
ec nomenclature
pdb deposition date 2010-02-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1830 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2x53A02
2.60.520.10 Mainly Beta Sandwich Triple-stranded beta-helix Phage fibre proteins 2x53A01
4HEPA 1ZRUA 3HG0A 3D8MA 4RGGA 4L9BA 3EJCA 2WZPA 4IOSA 4L92A 3DA0A 2X53A 4L99A 4L97A 4HEMA 3U6XA 2BSDA 2BSEA 2F0CA 4RGAA
chains in the Genus database with same CATH superfamily
2Z1KA 4RDQF 3NQIA 4DP5X 4P5RA 2BMKA 4GAYA 2BK8A 3BQUC 3ARFD 2OZ4L 3SE6A 4BH7B 3SKNA 4ZX3A 1KEMH 1BJ1J 2Y7OA 4XN9A 4WQOA 4YBLB 4XPFH 1DLHB 2XWTA 3MRHB 1P5UB 1ZKAA 1YQVH 3BSZL 4R3SA 5JORB 6PAZA 3EDDA 2AXJA 5IFJB 3FUJA 2IAMD 3GI9L 3P2DA 1D5BB 4UQ9A 4Y5YA 4IGBC 1N9PA 2I69A 2VDPH 4E9XA 3WTXA 4ZFOL 2PTTA 2R1YA 2OMTB 3HC0A 4G8GE 4KKBD 1L9OA 5KG9B 1MZZA 2F1EA 1FBIH 2HRPL 4JFOA 2VNCA 3M1BB 1XTLA 5F6IC 3WKQA 4BQ8A 3HI1B 5FYJH 3RAJH 1O6TA 1NMCC 1CVRA 3CLWA 3HR5A 2PO6D 1PG7W 3K8KA 4QYOA 4AYBA 5EO0B 3TZVB 1BIIA 4P2RD 3L54A 1TZAA 4F24A 1FC2D 1IBHA 2BS9A 3T65B 1SLWA 5MHSE 3IFNL 5GRUH 3ZIYA 3MLYL 4HULB 4PGBA 1C1EL 4IBZA 5IMMB 1CDIA 1XGYH 3FRPA 4FQCL 5DD0H 1E5ZA 1I9JH 2DPKA 2P5WD 4H8HA 2D0HA 1I85C 4Y19D 4ZMOA 1EXUB 2XG5A 3OL2A 1QSFA 4LOVA 3CWGA 4J12A 4N20A 3HNVH 3MFFA 1IC4L 3O6KL 3I9GL 3KYMB 3EDKA 4BDVB 3BSGA 4PBDA 1DSFH 1QBBA 4JO8A 3MLXH 3P1VA 3SJVD 5LNDA 4PJFB 3B9KC 4J4PD 4WUUA 1IC7H 3MJ9H 2JKWA 5ESVA 4Y4FC 5HDBE 1QR1A 1AR2A 1MCRA 2WN3A 3LHPH 3QNYB 4I0KA 3S7GA 3SPJA 3FOMA 5L6YH 1MRDL 2XY2A 3C5XA 1AZUA 2FO4A 4PJ5D 2JNZA 4OKVA 4Y8AA 3SDAA 3ZHFA 1RHHB 3BIAX 2PCPB 1GS6X 4Q9QH 4PJXF 2WJ5A 3GSWB 1DHKA 3VXMA 4BZ2H 2E9WA 5F9WC 3BZ4B 5IESL 2DQDH 2V9TA 3E1ZA 4H2AA 3QZBA 4YSSA 5E8PA 5HYFA 2R69A 1OALA 5C0RL 4MA1B 4N0FA 3GSNB 1PSKH 2NYYC 1BX2A 2G75B 3RNKB 2A6JB 5HYSB 4Y2DB 3GZQA 2PWHA 4JQIH 3F7QA 4XMZA 1MHPL 1ZVHA 2E9BA 2X1XR 3HE7B 3E6FB 5DS1A 2DLEA 3RTQC 4YHIA 5GGQH 2YA1A 3FTXA 1QI5A 5CIPA 1EEQA 3QFJB 4DGVL 2B5IC 2FEDC 5ESQB 1MCPL 1Q1JL 3L3IA 1AQ8A 1ZK5A 4KROD 1AE6H 4OH2A 1QWUA 3DVGA 1U0QA 2AJVL 5HTSA 5IB3A 3WEXB 1E6JL 3MCKB 1UADC 5E2TH 3C6LA 3B7TA 4DGYL 1EDHA 2HLFD 3FH7A 3JYBA 4O5LH 3S3JA 5LGHL 3EUUA 1W72L 3LN4A 1I1CA 1WIUA 4LF3A 1P53A 4O58H 2DY2A 1KG0A 2EDRA 1P6FA 3ATEA 3MA9H 5F89A 2L7UA 4JB9L 4ZFGL 1SDDA 2F53B 3I3EA 3M6DA 5AVVB 1X5ZA 2V5TA 4AQAB 4KY2A 1H6EA 3B8SA 4EF3A 3K0WA 2ZWYA 4R26L 3GGWB 3P4MB 4L8DA 1UENA 1DQDH 3FT9A 2ICEB 3AU0A 5BZWA 4A55A 2X0UA 4M5YL 5AG8A 3QRFM 1C16B 1ID2A 1WAAA 1HKFA 3BMVA 3H9SA 4LPCA 1JFQL 3QDAA 2NLJA 5I19H 5D1XE 4Z7AA 4UT6L 3IEAA 1A1OB 5EU6D 1QOKA 3CFQA 4LLDB 3FQRA 5G2NA 1BBDH 2CIIA 5AW9B 3RY6C 1R3LB 2YRPA 3CX2A 4WI5A 1OB0A 2H2PD 3BKML 1VFAB 2LT9A 4JY6B 3VFSB 3EBGA 3JTSB 4NQDD 2BPBA 3U6XA 5I8KL 5MI0B 2FATL 3ZKXC 3ARXA 3BN9C 3GIZH 3IF1A 5E99H 1CMOA 2E86A 3H2QA 1XGTA 3VE0B 3OKDB 2ZX8A 4HUVB 1QWNA 3OWEA 5I6XC 1JERA 2ZXWB 1T2XA 5A1AA 3Q8FA 3NCYP 5CD5D 1ACYH 1Z0NA 3DTDA 3L2MA 3MV8D 2AHIA 1KFAL 5CGBA 1KSRA 3KXFB 2JJSC 4JHBA 2ETWA 2LTQC 5I17B 4HJIA 4HLZH 1T1WA 2WIIB 2DEWX 2EC9U 4HPYH 5JYLA 2XV2A 4BWTA 3OZLA 3BESR 4JY4A 3KGRA 4GI9A 4ANVA 3CHQA 4GW1B 4P04A 3RGVB 1BD2D 1C5CL 2BX5A 2N1KA 2QQKH 1A1NA 2RD0A 1JDDA 3MRNA 5CJOH 4PV8B 4Q14A 5D1ZC 4LBAA 3P40A 1R3KA 3FH8A 3N9GL 1J5CA 2I60L 3NIDF 1V3MA 3ARED 2VDQH 3QH3A 2LVEA 1TO4A 4OLZL 3MDJA 4GMSL 2ZD0A 2WBJB 2CK2A 3BPLC 3MKGA 4DKEH 1KGCD 4NZJA 4R4BB 1L6ZA 2AAVA 3FHAA 3QAZB 1I3GH 1R24A 35C8L 3B56A 4W4OC 4JFDD 2FWOB 2X1OA 1KN2H 4HV8A 1YMHB 2QGEA 2G2NA 1KIUB 4G8GB 3KPMB 2B4CL 5GRJH 3KLAA 3SGJA 4HBCH 1T1YA 1BQHG 3DX6B 4JO1L 5GHWL 3FTYA 3GXNA 3OAUL 4V33A 1AR1B 4U1GC 1RJYB 4OB5L 2IGLA 4LRNH 4NJ9L 2PW1B 1NANH 2FQGA 1DQKA 1MW0A 3DX0A 2PKDA 4FP8L 4OZGA 3NJHA 3TYGL 4EPSA 2CM5A 1SMOA 2VXQA 2X3BA 4LVOC 2GTZB 3BOVA 3OQRA 4F7EA 3GO1H 1KXTB 1BAFH 1MG3C 2GK0B 4NQXA 4YHLH 2IFGA 5DJXA 5LNEA 4QRQA 3LMJL 1SDAB 3T3ME 5CCKL 2WSDA 2BHFA 2UY6A 1NIEA 1L7TL 3F00A 2NQ3A 4K5OA 5AFAA 3DO7B 2I5YH 2ZG1A 3EFFA 5IMLA 1I7ZB 1PNCA 3L9RA 3EKCA 1LNUA 2Y3AA 5INCB 2VDKL 3EOAB 3TO4C 1R3IH 2Z7YA 1KLFB 3PHQA 5DS2A 4DN3H 1J0HA 1U9KA 5FYKD 3IDGB 1SVBA 1JPGA 4OCSL 1SFHA 4PJAF 4R8WL 4W4NA 1ZHBB 3V10A 4KV5F 4RMRA 5HDBB 2KMWA 3HBPA 1DVFA 3WUWB 1ZXQA 3QUZD 5CCHE 1OD7A 3FT2B 1JGEA 4KRLB 4XNAA 4OV5B 1S5HA 2EKSB 5ALBL 3JVFC 4NZTL 2YKKA 3H3BC 3TN0D 4PV9A 1KTLB 1JZFA 2FX8H 1DLFL 3HHRB 3HG3A 3ASOB 4G7YH 4R7LA 1YEIH 1G7LB 1ODUA 2XBDA 3NJVA 3QDMA 4OLVL 1VKXA 1AG0A 3U7YL 1ORQA 2N0KA 3GM0A 4URKA 2J6EA 4MRCA 4B6ZA 5HPMA 2WZ6A 4FNLL 3GLAA 1BVLA 2XZAL 2J73A 5ABAA 2J1YA 4TUKL 4KQ4H 4L29B 1HHIA 2EDQA 4EQ2A 2YAMA 2OR9H 5AW3B 2IDCA 4KK9D 1CBJA 4JM2F 4MVBC 1BBJB 1XCTA 5KVGL 2N0MA 3U1SH 1XZ0A 3U36B 4DGIL 5C8JA 3CH8A 3WO4B 3IFLH 4L8BA 2FUTA 1SF3A 2DB8A 3LV3B 4TUUA 4XMLL 3GSNH 3QQNA 3VQMA 4AC2A 3I6KA 5FO9B 1EAQA 1FSKB 1G43A 3MI6A 3H6JA 1FP5A 1ZT7B 4YSRA 1I9RH 2CDFB 2CXGA 5DWUL 3FU3A 5F6HI 4DVRL 5DRZA 2XXFA 4QF1A 1UA6L 1INDL 2IDFA 4UV4L 3B2UD 4TVPD 2VXUH 1YC8A 2IQAA 4LSVH 5IZ7A 3GRBA 1BVNT 4PJGF 2CUHA 1MHEB 3MHZA 4IU2A 1BAGA 1X4ZA 5KYUB 1MAML 1AYOA 4MB4A 3BEWB 5K1VA 2OMNA 2ZCZA 2SEBA 1NEZG 2VZTA 1CIUA 4FFYA 4PJIA 1AJ7H 5F88B 2BIMA 2ZOKA 3TA3B 1JZ3A 1EV2E 1YNTF 1YEDA 3N1GC 2FJHA 3EOBB 2PWDA 1WS7A 1IEBB 1E4XL 3BVNB 3RPKA 4HK3J 2ODIA 3D33A 3HPJB 4CC4C 4LCWE 1M56B 5D6DA 1NICA 1QW9A 3NCCB 1XGUB 3FYEB 5KBKA 5LGJB 3UXFA 4PWKA 4OBSA 3AITA 4IS6B 3OD3A 3DX7A 4ZO9A 3SE4A 2D3VA 1DSYA 1EBAA 4E9TA 5FW7A 1E2VA 3P2BA 4JKPH 5D1XB 5F9AC 5F9JA 3ASWA 3KZ8A 4X9BA 3EAKA 4I2XA 3CCHA 1LP9E 3S2AA 1AGCB 1QSFD 1ZT1A 1FCCA 3FUHA 3EO1B 3P4OB 4MSWA 1MFDL 2ZCKH 4BUQA 1CR9H 5TE7H 1Y0LB 4LLQB 2W9EL 4X7SL 4WUUD 4QY8A 1NSNH 3QYMA 1MCLA 5DSCB 5CZVL 4NQQA 4BWUA 4LE8A 5AW2B 3BWUC 2WW8A 1JWSB 3N2JA 1YY9D 4K5MA 4KKQA 3HS8A 1SUJA 1G1YA 3N42B 2JK5B 4TL5A 3SDAD 4LKXB 1L9NA 1P2CA 4GP4B 2BNRE 3DYOA 3MRLA 3MAWA 4Z3IA 1MY7A 3VXMD 4BRJA 2PWEA 1HNYA 3OB0K 1T0NB 2DJSA 3JV6A 4OCXH 1M1SA 1QPPA 3H85A 5E1GA 5I1LA 2A6KB 1Z9SB 5F7UA 4GXVL 2YMTA 2Q7AA 2OYPA 3I75B 2AMGA 5ILTL 2NNAB 1S5IL 5C9JB 3RWGB 4P2QA 2CA4A 1MF2L 3O9WC 4KXDA 4TL4A 3RVVD 2MOQA 4M8RA 2YC1A 4PJHA 1SLXA 2Y7SA 1GMIA 1M05B 2CNZA 3T5WA 1QNIA 5CAYB 3BRFA 1OEZW 2W0FB 4HGWB 1QSZA 2WWNA 4ZUWA 2R15A 1HX0A 1K2DA 3L7EA 5I1GL 2BCKA 4ZMVA 4J3OC 5F0PB 2VLLB 5I18L 3H1ZA 4F2EA 4AL8C 2R56H 3KPRE 4YLQT 3HBZA 4XBMA 5TDOA 1ZS8B 5DK0A 1CE1H 4M7LL 2XOTA 2VL4A 5H8DA 3C6LD 1ZIBA 3ZE2E 4R7VA 5IB4A 3VXTB 4PRIA 2EIZB 5ALCL 1CK0H 4RRPA 2QPFA 3GKWH 1A14H 1O0VA 2XLLA 4D9LH 4OJYA 4MMXC 4RDBA 4WFGD 2EEBA 3IJSB 4DO4A 2YAHA 4Y4KC 1ZHLA 3VGDA 4DESA 5IM7A 1P84J 3OMIB 4PJ9B 5E0FA 5DUMH 1GY2A 3QORC 4JPKL 2BNQA 3MOAH 1HSAA 2E5EA 2R4SL 2R7EA 5TF1L 3KL3A 3T3MB 2DQUH 3L3DB 3L4ZA 5F21B 3WD5L 1JMZA 3STZB 3ML9A 3VFOB 4XWGH 4NRZB 3H9SD 3C9NB 1A22B 4ONGH 3T3PE 2WNXA 1QMUA 3DPBA 3LKNA 5T3ZE 4N87A 3E1F1 1MWAB 4YX2L 1MNNA 4F2FA 3UTPE 5C09A 3EGSB 1RLBA 3AT0A 1KLUA 1VEPA 5FKAA 5E2VL 3LPGA 5EOCH 3LRSB 5CBEA 4DQOH 4GJTB 4F7KA 1FNEA 2K1MA 4NM8H 3STLB 4WJ5B 4WDIA 2BWIA 2D0FA 1NLBL 5C9KA 4ODHL 5C2BH 3OGOE 3P9MB 4X2UA 4Y5XA 4XC3H 4KMTL 1T0MA 3GSUB 3F5WA 4WWKB 4A7VA 1NLDH 1GZPA 2GSGB 4XOBA 3UEQA 2GSIB 2H6PA 2AW2A 5FFGA 2BHUA 5DQDL 3ZHNA 2HT3D 4LLMB 4POYA 2J1XA 4G6JH 2I9TB 2NTFA 4IMKA 3WO3B 3JWDL 1PLBA 1KJ2A 1MCBA 4XN2A 3U30B 1I8MA 2J4WL 4GG6E 4GQPH 3US0A 3UO8B 2H8PA 1J9SA 4APXB 2RFXA 2AP2A 5DJ6B 2YGNA 4AWJC 3TCXA 3L3KA 4NWTL 4YDKH 3UJTL 4AE0A 4U1SA 3UBFA 5HGBB 5CLYA 4ETYA 3TT1L 3OR7B 4U6XA 1J11A 4N68A 3L5HA 5IQNA 1DYZA 2E7HA 4LCCA 2XWJB 4OLUL 2XRAH 3BKCL 4WNQB 2LFEA 3MNVA 2EE2A 2ITDA 1CXHA 3AW5A 1SEQL 2F2HA 4JZOB 2VSMB 4TNGA 3TVMA 2EXWD 4IIQA 2QMKA 1HDMA 1HN1A 2BVPA 3WJMB 3GZKA 1WAEA 2FVNA 3EYUH 4Z9KB 4NAJA 2OM5A 2ZOOA 1PLGH 2Y7QA 5EZIL 1UWEL 1IGYA 4HIEA 4NT6B 4QRTB 5B7FA 4XVJH 3L13A 3QJTB 3HC3H 2IANE 2QZ5A 4LLAA 4I9WE 4EI5B 2YPVA 3X1FA 5J9PA 3UG3A 3HZYA 2Z0UA 1KPUB 4E41A 2ZXQA 2ICWJ 4I77L 2A9AA 1RK1B 5D2NA 3MTRA 5AOKA 3LXUX 4TLTA 5SWZE 1MFVA 3UTSA 2Y5EA 1ECZA 4LCWB 3RWHB 4HQQH 1FG2A 4YK4C 5DEGB 2XPGA 1H9VA 5ERWA 3SQBA 5JOPE 5JPNA 4O02A 4I85A 4S1QL 4B5ZA 1Z7JA 1EDYA 5C6TH 5J12C 1ULVA 3QCVL 5E94A 1UA3A 5DJYA 5FLVA 2VLME 4KKNA 1NTDA 3GTVA 2BSBA 1NGYA 4R96A 3AROA 4BGLA 4ZQKB 4DUVA 1LP9B 2FB4L 1HILA 1I4FB 1JVKA 2NR6C 4N1CA 4MB1A 1V7NL 3SE9H 3DX8A 3KGSA 4RIRA 3RRQA 3KD4A 4PJ8A 3SE3C 4MNQA 5DO2D 3T2LA 4IRSB 4A7GA 3GFUA 4YPGA 4CBPA 1C5DA 3QUXA 3MXVH 4NBXB 3HG4A 3ELAT 1DVSA 5IWLC 2D7TL 2K7QA 3BP4B 1DVFD 1VJSA 2Y07H 3NG5A 3GS4A 1E2WA 3WFHB 3V0VB 3HIZA 4N6RB 1CL7H 2BCMA 2VAAB 3GUTB 1FFNA 5EU7E 2Q10A 2BNRB 3QDMD 3D9AH 1URZA 3QISA 4EOWH 2AJ3B 3JWNG 3GB7B 1J1PH 1M2VB 5I1AA 1BQLL 5AALA 2AVFA 2YZ1A 3OJMB 3QT2A 5DMGD 3WXVL 4AJVA 2BOBA 3HFMH 1NCTA 3J2PA 3KW8A 4TVPL 3ESOA 4MA8H 2XX0A 3DRTB 3MLTB 3MUY1 4OCWH 3LQAH 3TXAA 1AHWC 5JOEA 1X5GA 3LEYL 3WGVB 1WZ1H 4ZUTB 2CALA 1JWMB 3MODL 3H2WA 4GQ9H 3KBEA 4AENA 3G5YB 4F1ZA 5HGAA 3A6BH 4K73A 4U1LA 1P7BA 2W91A 4AVHA 4BKSC 1F4YL 5CWSA 4CSTA 2UUDK 4M3HA 3T8VA 3D30A 1H3UA 5DRWA 4P59L 1UZ8A 3B8YA 5AOZA 1AGDA 4UOW0 3Q13A 5CEZE 3KPRB 3VWJC 3CQQA 3ZT6A 3ZR5A 2D2OA 3A4EA 3BP5B 3O3DB 5E95B 3NUKA 4FXKC 5CJ8A 4UILL 2UZYB 3ZE2B 4G8FB 2NY2D 4U0QB 3T6XA 2APVA 3LQZA 1MUJA 4LAQL 4X4KA 2BWDA 2P26A 2ICWA 2DTSA 4YDIH 3V0DA 5I9QC 5I75C 3SPCA 1XSIA 3IJHB 2QSCL 2HTLD 4KQ3H 4ZPVA 4MZ2A 3RL1B 1KPVB 2JELL 2ED9A 3TLRA 4HUMB 4NAMA 4UNTA 25C8H 5DUPL 1Z3GH 3NBNA 1IKFL 3THMH 4RDQG 1BLNB 1AGFB 2DD8H 2DF3A 4LHUG 5EU4A 5EZJB 1PG7H 2GJZB 1E6OH 2A74B 4H8VA 1BJ8A 3T3PB 3CFNA 3FN0H 1P7QB 1SHSA 2MOVA 3MLVL 3SBWA 4YAQB 4ODTH 3PWLA 5GJTL 1OARH 2BJMH 3QCUH 4ONHB 4UQ3A 4XPHH 3ARBC 1UGNA 1PYWA 1SBBA 1UCTA 3S5LB 3BH8A 1MCKA 5C3IA 3RFZB 1ILSA 3G6JE 1CF1A 4QJ3B 3ZRSA 1MWAH 3KLSA 4OGXH 3T6VA 1T89A 2WXLA 1MG2C 2WOBA 4FQXC 4KUCF 3T0WA 4U6HA 3D39E 1BVKB 3GK8L 2PP9A 5ADPH 1RIUH 4P07A 3Q1EA 3F01A 1AZVA 2XWDA 3WAJA 2C9SA 5HGHB 3I6GA 4MHHG 3VXPA 2XDHA 3C8KB 5T1KB 2BSRB 4OFIA 2XA3A 5AKSA 3DYPA 4F57L 1QFWL 2IO5A 3ECVA 4JL2A 1VPOL 1UASA 3ZL1A 1UUSA 1JPFA 3NA9H 4Q6KA 3WTSA 3EJCA 3RBGA 4GG6B 1I7TA 3SGEI 3JYCA 2Z1PA 1JRHI 1SDYA 1S78D 2RGSA 4P9MH 3DX4A 3BWZA 5IEKB 5C71A 4R7DA 1J1XL 5IGXH 3MJ7B 4P2QD 3OMZA 1V3LA 3WY3A 5IT2H 4XI5C 1J1OL 2QADC 1RPUA 4BUGA 4TUOB 2NPLX 3FMGH 3NCMA 4W9FC 4ZMYA 5K9OA 3QQDB 3MREB 4A6YL 2ZUQB 3ZMEA 1A9EA 5B1JC 2JIXA 1KB5L 4AGLA 4GH7B 3EHBC 4LDOB 2AGJL 4LT7A 3GKZA 4UT9H 5HJGA 3NJFA 4HAGA 5FB8A 2VB5A 4B9GA 2YKLL 4U1JB 2W60A 4QNPE 2IANB 2GITA 4GS7C 3GBMH 1EHLH 3TIEB 4URTB 1K6QL 3M17A 4OGAD 5CEXB 5BQ7B 1AO7E 4HEPA 1PL3A 2BOCA 4PRID 5T1MA 3VQ2C 1CPUA 4XAKD 1GGIL 2G5BB 2HTKD 3VRLF 4EUPG 2M1KA 4M93C 2E3VA 1OSPL 4LSQL 5FUZH 4C55A 4U1NB 4ZX5A 5SWZB 2WCSA 2ZWKA 2F9BT 4OM1H 4X80H 4G1MA 3O6LH 4ZTPL 3X3FH 4ZAKC 4QI3A 4WEEA 2OSLA 1KCWA 5CGTA 4EN3C 3HZVB 1YYMH 1RIHL 2XWRA 4JPWL 3PHAA 3GIVA 4NN7C 3VFGH 4WHDA 2G3ZA 1I7RB 3KYKL 5CN3A 1F97A 1DQJB 3HAEG 2BNQD 1AS8A 4L48A 4OGYH 3FQNA 3UTTA 3PHOA 3IDYC 5I1JL 5ACMA 4RGMB 3NJLA 4KDTA 2HJKA 3EYOB 4BSVA 4F15B 1SZNA 4WUKH 5FGBA 4X98A 5C09D 3VSUA 4PVNA 3MRDB 3FQWB 2FT6A 2Q2EB 1UM5L 3MXWL 3CDGA 4X8JA 1RUML 3MLUL 1Q0YH 1TVDA 1FZKB 4Z95H 2JQAA 1S8DB 2P47B 2ZWLT 4DCQB 5L0QC 3KLQA 3POHA 5KSVB 1UM6H 3HMWL 3IFPA 4H4NA 2D8KA 3BT2H 4L3FA 3O4LA 3UZQA 4GB9A 1NL0H 2VUKA 3MRJA 1XGZA 4RMBA 4MCNA 1BQHB 1TFHA 1V7ML 2ADFH 1MNUL 4N8VA 2J5WA 3AXHA 4PW4A 3WKMH 1D9KA 1PEWA 1FGNH 4K9EH 5GISH 4RMUA 3TV3H 1UJ3C 3VFNB 3TFBA 4E42A 7PAZA 3R0NA 5DYOA 1OPGL 1QHPA 4XT1C 5JXAH 3QSKB 3C5JB 3WJJC 2YBGA 3CVHL 5HHNB 3QC5X 4JKWA 4X7TB 4K2UL 2NY6B 1MPAL 4QDGA 1RURL 1EANA 5FF6B 5TD4A 5D7IE 1SY6L 4G6ML 1ERNA 4N5ED 4ELME 4F93B 4LLVB 4Q0XL 5DD5H 3O3BA 4LFHG 2KZKA 2B1OA 1W0VB 3KJ4C 3W9EA 4KHTL 1AS7A 4P4RB 5EIIA 4YR6B 1J88A 3Q8AA 3QEQA 3J7HA 1LEKB 2VXQL 4RISL 5IB5B 2X12A 1GPOL 5HI5C 4OCLC 1IGCH 5GGTL 2KPWA 3PWVA 4YBLC 1CYXA 3ZQ9A 4WSGA 4OW6A 4ZFFB 4X6DF 1IGJB 1P5UC 2CPCA 2VRQA 4FERA 3AJ7A 4G5ZH 3VDCA 4KUZL 5AVXB 3AWFA 5IJVA 4MS8D 2X38A 1BQSA 2KZWA 4XP6H 2V0AA 4E41D 1F6AA 4J39A 2B39A 1OAKH 3GSRB 4NBZB 4AQOA 1CXEA 3UTSD 1RCYA 2Q8AL 1I8LA 3NEEA 2WQ8A 1DVTA 2Q1EA 2ZJSH 3MGOA 1WD8A 1YNLH 1MJ8L 3EW3B 1JHLL 4PFEA 3MYJA 1Y18A 4JFFE 2VDLL 1CXIA 1BQKA 3C60B 2CIKB 4WTZG 1KN4H 3TZVC 5F7EH 1U3JA 1LQBC 4AGPA 4O2CB 3HFFA 5I8EA 1ZLUH 3LEXA 1I75A 2PR4H 3FCTA 1CGSL 5H4ZA 3G6JB 5T3ZH 1HZLA 1UXWB 2XHNA 3UPRA 2YGPA 5F96H 4PJ8D 5JHLL 1BXXA 2OZNA 2PABA 4MNQD 4Y2OB 5FO8A 3TYFB 4X9IA 2VDMB 3WELA 3D39B 4W9DC 2YD7A 3AUVA 4U6VH 1IBDA 5JIMA 2V2TB 4X5RA 2WD0A 3QUXD 2Y1YA 2X2UA 1FH2A 3FU5A 4CMHB 4P4KA 2CGYA 5LN4A 1RULL 3KE0A 3PS6A 2R29L 4E68A 2D03L 4GKZB 2WXMA 1YPZF 2WAHA 1NBVH 1NEZB 4JJ5A 5IVZA 3K6SB 1MJUH 1UUNA 4JDZA 3VXRA 1A6VL 3COOA 3X14B 4AGOA 4OZHE 1DJGA 5DJ2A 4CW1A 3BDXA 1TSRA 5EEXA 5E9NA 3RJDA 5T1DH 3A6CL 4H88L 2AK4E 4YE4L 2R0KH 5EPMA 4P9HL 4L92A 2E7CA 3HKFA 4H7VA 5IB1A 3MJ6A 32C2B 3DIFA 4HD9A 4A2LA 1G0XA 4APQB 1CCZA 1IAOB 3KJ6H 2PWFA 2UWEE 1A65A 4YDVA 4HP5A 1XH1A 1JK9B 1MHCB 1A5FL 3L3GA 3RNQA 5H35A 1YEKH 4MA1C 4NQCE 1JN6B 3VYNA 4KHXL 3CZGA 4HWBH 4POZD 1ES0B 2ZXGA 2IPTL 4Y2DC 4LCYA 4YSTA 5KAQG 3LTVA 2C26A 3PWNB 4P5SA 4LEXH 2PXYB 1EIBA 2OMYB 1JZ8A 1VFMA 4ISVB 2ITCB 3HE7C 5JQ6L 3M8OH 2KZBA 5B22A 3D69A 4HCRA 4L37A 1SF5A 1F8TL 4NZUL 4HKXB 5C08A 3UCRA 2Z92A 1FYTA 1NUFA 3AMKA 3FB8A 4NUGL 1AO7B 2GI0A 1M71A 5DHVB 3S48A 2AJSH 2X1QA 3FU8A 4PUBL 4XNQA 1XMWA 3TEUA 1FLRL 4AMWA 1AFVL 5J0BA 2KQNA 3OHXA 4Y4HA 4GP8B 1QNZL 3SDCB 3B4NA 3HHSA 2AXHA 2W0LA 4QWWC 1IBFA 5J6HA 3OKEA 2DJUA 2HN7A 2X70A 4YLBA 1RUQH 4OIAA 3FSAA 2YEQA 3LNDA 3NABH 5JW4N 4OZIE 4NC1C 3RZCC 1W6LA 5C0EB 3W3BA 4FD0A 3PWJA 1GC1H 4NUQA 1DQLH 3LSOB 1ZLVH 5IHZB 2QHRH 4KMLB 5CEYB 4PLNC 1ADQL 3NJXA 4BBWA 5IFAL 3I3DA 1XDTT 3JVGA 1A9BB 2OYMA 2IF7A 3FTVA 4PLOB 1EEUA 2ROXA 3MFGB 3WY4A 5HHPA 3UP6A 1IVTA 3TO2A 4NZDA 1HEHC 2J20A 4GBXA 2C7UB 3FQUA 4F9LA 4DZBB 4P3CH 4FNQA 2ZTBA 3FT4B 1HHKB 2QQLH 2E76C 2P8PA 2APWA 2YXVA 2CLRB 3C12A 3WFBH 4AH2B 2QVFB 2DEXX 2BFGA 5C0NC 4DP1X 4HFUH 5E70A 1TT6A 3V6OA 1OGAE 4R5VA 3VFRA 3WJLA 2YO3A 1KCKA 4PHZA 2VN4A 4XPGH 1NC4B 4OZGF 2OCJA 2ZYRA 5MI0C 3LNFA 2OP4L 3L3JA 4BIKA 5F70A 1SPDA 2P8MA 4XGZB 4BKLB 3D2UB 3FFDB 5BNXD 3RVXC 5JMOC 5KW9L 4P49A 4JHAL 2NY3B 4NI3A 3QRGH 3K80A 1CN4A 4DHLA 2OXGA 4ZO6A 2EO1A 1WP6A 3FUFA 3BQUA 5HJ3B 2R59A 2R0WL 3APCA 3OV6A 1N7ML 3CLFH 3MGTB 1ETB1 4HIXL 4NS0A 3EGDB 3RUGE 3IKKA 3CXDL 3P69A 3BKYH 3X1GA 5D7IB 1BW8A 1YECH 3GSOA 1FH5H 2WKOA 1HL8A 2DWXA 4HIJB 1QEWA 4ELMB 2DEYX 2XACC 5LAXA 1N67A 4AZ8A 4RMQA 3DXAE 3QHZL 4UDUB 4IGBA 1QQDB 2DRUA 2JIXD 3NESA 4X50A 5GGVY 4HJUA 5ABZA 3BN3B 4AM0B 3IE4A 5IIEB 5CEZH 1DO6A 4UIMA 1WZAA 4N0CD 5CFHA 5B4MD 4MXWL 4P46C 5DHYA 3K6IA 4LVHB 4RFEA 3HZKA 5G4OA 4KC3B 1TCRB 2EC8A 4ZW8A 4KZ0A 5JQHC 1M4KA 4HXAL 3BJLA 5I6MA 5F7AA 3ARGA 4FZ8L 4F7MA 1OWWA 1TZHA 3FO9A 5FC9A 5JOFA 1UD4A 5K39A 1MFNA 3OC5A 2R23B 1SM3L 2QZQA 4YQXL 1X6NA 1D5XB 5E8EB 1I85A 1AANA 2R8SH 1DBBL 4JFFB 1AR1C 1NJ9A 3DETD 3ZSSA 2TAAA 3W38A 1DBKL 5C92A 1BZOA 1YA5A 5EU3A 3W5NA 2G9HA 1VCAA 2X4RB 3GINA 2VR7A 4PRDB 4Q6IA 5E5MB 3S8FB 1J48A 1LEIA 3UTTD 3UDWA 1T20A 3HE6B 5ECGA 4ZXBB 4KK5D 5IG7B 3DGCR 1KLGB 4FQJL 4U3SA 3BIKB 2HX7A 3MRPB 4Y4FA 4PN6A 1FL3B 3P73A 3DGGA 1UCBH 4NOBA 3S98A 1WF5A 4IEFB 3CHPA 1KJ2L 2JCCF 3SCMA 4F8TA 3EJYC 3MRQB 4Y1SA 1E5BA 2LGNA 3LIZA 3QUKB 4IOIA 3N1QC 4HG4J 4MD0A 1D5MB 1FNLA 3D3VE 2AJUH 2A6DA 2GI7A 2XQBH 3N41B 4OSUH 3WN5B 3QS2A 4JM4H 2FWLB 2VDMH 4WFFE 3S8WA 4YHPB 4X0KB 1KBWA 4R0LB 4QTHB 1TTUA 3HI6L 2X9WA 4I4WB 3GJFA 4FTVE 3ZKNC 3FJTA 5BVJA 3O4LD 4OZHB 4G5AA 3TFKD 4PJXE 4AEIH 2ARJQ 1J9QA 3QZMA 5HDQL 3PP4H 1A7NL 5AVYB 2NRDA 2AK4B 1C8QA 1ID5I 2WTPA 1D9KD 2BDNH 5CUSL 1G6RB 3RTQA 1RZIB 3CSGA 3UZVB 2G30A 2UWEB 1GZHC 4BH8B 5ADOL 2ZQKA 1CFTA 4O2EA 1T1ZB 1LTXA 1RU9H 3FQTB 4AJ0A 3ARRA 2V3EA 4NQCB 3CK0L 1U8KA 3A4FA 2H0FA 4HEME 4QRRE 2VR5A 1JZGA 4NT6A 4OZ4B 4O4YH 1J8HE 4DO5A 3SE8H 1PW3A 2YUZA 4E9RA 1JZ4A 3WO4C 5B7EA 2C3VA 4AIOA 2O6DA 1CLVA 4Y9BA 3KYNA 3DSFH 5EFIB 4IQHA 3TESA 1FSKC 3IVKB 4TSCL 4NPYA 2KPNA 4YFLI 3QEQD 5KN5A 3DVNA 5F7DB 4D0BA 3NCWA 5BJTB 1D5RA 1KEML 4NQSA 1A3RH 5HI3C 2VLKA 1O6SB 1YQVL 2P5PA 3KLHC 5MEQA 1OF2A 3BP7B 3D25B 4QHMA 5DHVH 4KJYA 4S0SD 4HS6B 5E4EC 5I1HH 4QXWA 1A1MA 4NDMA 4XCFH 2P1YA 1IGTB 4OZIB 2VR8A 2XG4B 1FBIL 3ARVA 1NCWH 3ETBF 5SV4A 3RAJL 2Y24A 3DYMA 4P5TB 3N43B 4KK6C 2VSCA 4CVZB 4H25B 4TKWA 5DQJA 4B9PA 2VABA 2Y6TE 4AQEA 1J05B 1F42A 4IMLA 2F68X 4Z7VF 3TC9A 5I1IH 1NUGA 2NZ9C 3FS9A 5LLIC 2IDSA 5I0WA 4MNGE 4XO3A 3W11D 3L2LA 5BRZA 1I9JL 1RJZA 5D1XC 5C0CA 2OMBA 2OJEA 4PCSA 3L9YA 2MIZA 3PP3K 4JG9A 4AYDC 1SN2A 1JF1B 2C3WA 2CLZB 1HSBA 4P2CG 2JJSA 4HPOL 2Y7NA 4AGMA 4M3JA 4XC1L 1RZGB 1FVEA 1OGAB 3NRFA 3PWPE 5L4JA 3RP1A 1ONQA 4GAFB 3MLXL 5GGRB 1CYWA 1OZUA 4KX9A 4P06A 1P1ZA 1S9XA 2AFNA 4FA6A 1BM3L 4P4KD 4Z7QF 2FO8A 1WICA 3DMMB 5FK9B 3DJRA 3T1FB 1Q94A 1X5KA 5L6YL 3LHPL 2QEJA 4BZ1A 3VXRD 1E9QB 3RX5A 5E7FA 5LN8A 1X44A 3ULSA 5D1ZA 1OCZB 5EC2A 4BFNA 4B41A 2NW3A 1EAPA 2YEVB 4Y9CA 1V27A 1E9PA 5E6RB 5FEBA 1AY1H 5JHDA 1H3TA 4BZ2L 3D48R 3RUGB 2E75C 1NGWA 3LQAC 2B0SH 1F58L 1I1YA 2ZYHA 4IHBA 2OL3B 3L5XH 4AIEA 5JMRA 3BP6B 4LHUB 2DWYA 4R9HA 3NIDE 3GRWL 4W4OA 4Y7MA 3DXAB 2DWEA 4LPTA 5D96C 4Z78B 3MCG1 5GGUA 1PFCA 1OAUL 5SX5K 5DZVA 4K7FA 3WKPA 4BSJA 4RSVA 4TQIA 1NPUA 3L5WB 1ZHKA 3QG6B 1IKNC 1BQ5A 1TR7A 2IALA 2JB6A 4M9OA 1CFSB 2XJLA 1MHHA 1JXGA 5C08D 4AK2A 4M4PA 4F7CA 3HS0C 2XBTA 2Z4QA 1WIPA 4YXLH 1FYTD 3T77A 5EZOH 5C0JA 4HHAB 4TPRL 4UM8A 2EO9A 4Z3FA 5E2TL 1O9WA 2OI9B 3IAQA 4PCKA 5MP6H 2OYKA 4Y4HD 5KSAB 4XCCL 4G1EB 2CGRH 3DUSA 2HFGL 1KB9J 1EEZB 5HP5A 4QGTA 2AEWA 1TIUA 1VFBA 3D0AA 1BMGA 3ES6B 4JY5H 4KVNL 4C58B 4JFQA 1MFUA 1JPSH 1QBMH 2Z7ZA 3RWJA 3TCTA 3QDJA 3SY0B 3MA9L 3TO4A 1T7XA 4L8CA 3NFPB 5TE4H 4L3CB 4QYAA 4ECNA 3TOPA 4PJ9C 3NPZB 1B0RA 2YUVA 3GHPA 4ZUUB 3FU9A 1DQDL 4WAFA 4NN6B 5H37H 4X9HA 2J8OA 3TBWA 4OD2A 4ZMZA 4F37F 5FO7B 4DVBA 2Y36L 4FQPA 3H2PA 2XPYA 4GBXD 4J1UB 3VFPA 4XPTH 2NUPB 1DUZB 4G3YL 4PJAE 3R1GH 3CGTA 4KV5E 5D8JH 5F9OL 3N0PB 3D3VB 1BBDL 1JVOA 4Q2ZB 3LZOA 3ZHLA 4JS7A 4KRNA 4LSRH 1SJXA 3N85L 1AC0A 2BP5M 4O51B 4XO8A 1BPLB 2OTWB 1A6AA 5AYUL 2E7MA 1WBZA 4FTVB 5I6OA 1T5WB 4PJXB 1VRSA 4ZNEA 4K3GA 1CICB 2C1OB 5E99L 1I1AB 3SO3B 2PYFA 3K74B 1EBPA 5LNGA 5AEAA 4L4VE 4WWKC 5AAWC 2P52A 5HY9B 3OM3B 4G9DA 4CL7A 3C8HA 1M6UA 7TAAA 2WPGA 3QI9B 1V3KA 4S1DC 4K7PX 1D6VL 5JHBA 1RERA 1G6RH 3FUNA 1JXDA 4N2KA 3F7VB 1CXLA 3HAEB 2CBTA 3SYQA 3U30C 4WW1A 4E9LA 1GGUA 3FRUB 4FS0A 4LQFL 4N90E 2HWZL 1EK3A 4QRRB 2ZKHH 1J8HB 1X9RA 4JDTH 2C9RA 2GUOA 2QQKL 4GP5B 1LE9A 1LJMA 4PJBA 2X89A 5J1TC 4XXCC 5CJOL 3MLPA 2QKIB 2KUTA 1NAMB 4W9LC 1P4BL 2GHWB 1CFVL 1G84A 3IWUA 4IGBD 3TTSA 3QGVA 2JSFA 4GAJH 2NW2B 1U58B 5JUEL 4MB5A 2NCEA 4DP0X 5DK2B 1FAIH 3RWFA 5DEFB 2P24B 3TBYA 3TNMB 1JNLH 4DKEL 4PJGE 1JJUA 4D0CA 3Q01A 1Q0XH 5DZPA 4FG4A 4JLRB 1ZGLA 4GO8A 1Y07A 3K4ZA 2DLGA 2AAAA 4OF8A 4Z3GA 1E7UA 1ZPLA 2QL1A 1MVUA 1JDCA 2XETA 2C7FA 1UB5B 1KN2L 5FDWB 1SVZA 2UZIH 3WS6C 4CC4A 4K07A 2R1WB 5LQBH 2EECA 3T4AB 2XN9A 4AYFA 4EIGB 2W07A 3ARGD 3U0WL 3LD8B 1L0QA 5B1BB 1O9ZA 3INOA 2WP3T 3UOAB 1U8IB 5ENWB 3U9UB 4EI5C 3FBKA 3MUGB 3REVA 1SYVA 4F2ME 1O7DC 2OJZL 3A6OA 2YBRA 1MVYA 4WHYG 1YZZA 2ZPKH 5AVZB 2FLRT 3UBGA 5DJ8B 1Q8MA 1UYWH 2BZCA 3ML8A 3N40F 2Y69B 2NX5A 4J3XA 3V4PA 4AUUA 1J0JA 3O11A 1UVQA 1NGZB 2W65B 4YHLL 3V0JA 2WXFA 3EFOA 3PAUA 4MNGB 1UT1A 1QTPA 4Y4FD 3PGCB 5EU5A 3Q5TA 2CBQA 4X9FA 4B27A 2K9UA 3SCMD 1TVHB 2NXZC 2CMRL 5I74B 2PMZA 4YN3A 3PWPB 1S46A 4N0YH 1C12A 1PZ2A 1M7DB 1PY0A 1R3IL 2X28A 3TPKA 3A4AA 5C3LD 1GR7A 2XNAB 4WNJA 4IRSC 5ITFA 1ACZA 4YXKH 2RHEA 3QUMA 4TXVB 4JO3H 1FL5B 3VXOA 2UZXB 3X13B 2BSSA 1KIQA 2Y3NA 2X10A 2YXWA 3NMEA 4BQ9A 3EXLA 4G7YL 1CDUA 4ZFOB 3RHWF 4UUJA 3FUIA 3DRQA 3IN2A 3G5ZA 4K9EC 2LAAA 5JR1H 2P8LB 4L8SB 1JNNL 1K4CA 5E8OA 3RTQD 5HHXH 4P23B 3N40P 5F7BA 4WW2F 2OMUA 4CNIB 2FEDD 5HHME 3NIDB 4XRCA 1G7HB 4YSOA 1PZ5B 5D5MF 4ERSL 4KQ4L 3DTUB 2EVHA 1OB1A 2OL3H 3ULVE 2YA0A 4H5SA 4XMTA 3B6SA 1DEEB 3FQ4A 1EEYA 7CGTA 5IW6B 3E6HA 3II1A 3PJSB 3LHAA 4J8RB 1XIWB 5E8NB 4KO7A 1IBBA 3WEOA 2FJGA 4I9XA 2OFQA 4LK4A 4MMXA 4YSQA 4MTMA 4F58L 4ADIA 2CRMA 2QDVA 3EZ8A 1A4KB 2HKHH 1V10A 2DS4A 1ORSB 1AD0A 1SXBA 2I07B 4LBEA 3H42L 4UQ2A 1U8QB 2VL5B 4YDJA 1P5VA 1G9MH 3FB6B 1BYNA 2VLKD 3GSVA 3QYCA 3U4EB 1MREL 2YQBA 3QNXB 3BEVB 4OLXL 2EXTA 3QORA 3OXRB 3QZPA 1U92A 1A7BA 1DR9A 1TVBA 2X2IA 1SJMA 3S0PA 5D2LA 1HHHA 1NBCA 1AACA 4QHKJ 2C4FU 1ZHNB 4QCIA 1P7KA 1YN6B 2FJFB 5LAPA 2FX9H 3P3YA 4GSDL 1Z5LB 4PD4J 5HYQB 2ADGB 4L9LB 2QTEA 3V6FA 2Y5TB 5HBBA 3MRIA 2ADIB 4R4FL 1SUHA 4KVPA 3WFEH 2AV7B 3CIAA 4XXDB 4WGVB 3C6EA 2R2HB 4N8CL 3F7YA 1FZOB 1JGDB 3EYVA 4NQEA 3I9PA 2V9UA 1ZSDB 3BN9D 3KWWB 5FHBL 1E9OB 1G7JA 1HNGA 2WM0A 3P3TA 4JKPL 4PJAB 3CN1A 2OMWB 5BRZD 2QV4A 3NT0A 3ZMNA 2I32A 2YRLA 5DHXB 2A9MH 5IF0B 2CNYA 1A2YB 3GM8A 2FGZA 3RFZC 3NP3A 4JO2L 5AB9A 4JG0L 2X4UB 1XR8A 3U2IA 4P2RE 1D3CA 4CN1A 1S3KH 2BS8A 2B16A 2NZIA 4OM0H 4JE0A 3WCYA 5MENA 1HK6A 3K6DA 5EC1B 2JTDA 1KPRB 2IXQA 3FU7A 5D72L 4LSSL 2W94A 4L4VB 3CN4A 3CIQA 1NFAA 3E8UH 3H0TB 2EINB 1CS6A 2MCPL 1REIA 1UB6B 2P5WE 5J1AA 5D1ZD 5EIVA 4Y19E 4X5XA 4JM2B 4ZO8A 1W72B 4MWFB 1NCGA 4WKZA 2VW7A 2XU9A 5EOQL 3K5SA 5JHDD 4YXHH 2K6WA 3X11A 4JBSA 4XCNB 3U46A 1N0LA 4WV1B 3SJVE 5T5NF 3OKKA 3DHUA 1LO0H 1HQ4B 1JPST 1P4IH 1G7MA 4Z7NF 3O45A 3VWKB 1SHMA 3CMOH 3ETSA 2GVYA 2WO4A 3HAEH 5LBSA 1FN4A 1A6ZB 3HNTH 2FHFA 5D7EA 4HJJL 4I3GA 4PJ5E 1OQOA 3D08A 5CZXC 1U3HB 1O5PA 4MJ4A 3L5JA 1CFMA 1NAMH 4PJGB 2WNWA 2X9XA 3V5KA 2ZUQC 2XTJE 3D0VB 2VRAA 5J3HC 4UMGA 2XZQH 1KENH 1MJJA 2G60H 4FABL 3PV6B 2F6AA 1N12A 1AKPA 3L3OB 5F71A 5TK2A 4TSBL 1JZ6A 4HJGA 1YNTB 3F83A 1CE1L 4JZNA 4ORGA 4ES9A 1YAIA 2FIKB 2K9FB 2G3XA 1CK0L 3AAZB 4YHMH 1IFGA 2NUTB 1U41A 2KT6A 2GTWB 2MHAB 1LDSA 4RQQA 4F2MB 4Z3HA 3WFCL 2NR6A 1W0WA 1YJDL 1KYDA 5K9KB 2FR4B 4GKOA 1XF2A 5T1LB 1GGCL 3SE3A 1JHTA 3TIDB 4ODSH 2EE0A 3K72B 1Q72H 1WCBA 3QDJD 1GC1C 4PJFF 3TO4D 3RU8H 4BFKA 1MJ7H 5ETUA 1KULA 2OQJA 3BH4A 1A6WL 1CU4H 1N5AB 1F2QA 5EO9B 4C83A 5INDA 1J86A 2QVKA 5IWLA 3MOAL 3LY6A 4LLUA 4PRHA 4X5WB 4KXCA 3WTVA 3PNWB 5B7MA 3FB5A 2FZ3A 1IC5H 4XWGL 4KFMA 2AXFA 4ONGL 4RGMC 4MCMA 5C0GB 5LWYH 2AQNA 3JZ7A 1LHZA 1FFOA 3EGXB 5J11C 2WVSA 3CBKB 4FYSA 5BVPH 1WFJA 1ZTMA 2NTSP 4FMVA 1V54B 1KGIA 2D31A 3OGCA 2ICCA 4UTBL 1RSYA 3WE6A 3QC6X 1FWXA 4HS8L 3GWJA 4PAZA 5GS2D 1QYGL 1UFGA 4XP9L 1R75A 2OZ4H 4HOZA 5L9DH 2VLJA 4NM8L 3F2LA 4Q58C 4Z7WF 1N6UA 1HCVA 1AHWA 4P57A 1WZKA 4LCUB 4MVBD 4XVSH 1I8IB 4XC3L 5EU7C 2OULB 4W93A 5C0FA 3QNZB 1SXAA 1R33A 2VJ8A 3GI9H 5FWRA 5EU6E 5I6LA 2H5UA 1MIMH 1TOXA 1UWYA 5HHMB 3ILQD 3O2DA 2HRPH 2J56A 3OPZH 3VWJA 5HDWA 1YUHA 2IMMA 4FCAA 5TF0A 4YDLB 2Z64C 1U95A 4FXKA 5CP7B 2HVKB 2L04A 2HFEA 3IJEA 1HWHB 3F7RA 3UABA 2NY6C 3OKNA 3PABB 1ZOXA 2X89D 1VEOA 3IFNH 2XY1A 3LS5H 4RGGA 1NFDA 1B3IA 2Q3XA 5CSZB 2RCSH 1G1OA 3MV8E 1VA9A 5EB9A 4L18A 1NOFA 4KRMB 3JTTA 3UBXA 4LGRB 5GSVB 3CBJB 1KY6A 3FTGB 4ZW6A 5DVLA 4F8NA 4PREB 4W6YB 1EDQA 5A6IA 1YN7A 4WVRA 5I8OL 2X87A 5AZUA 3V6ZB 3ULUD 3X12A 1IC4H 1T2JA 2JV6A 1UA7A 3CDFA 3I9GH 3O6KH 4NB7A 4A63A 1PLGL 1GZQA 2X3AA 3L8QA 5M95B 1BD2E 1S7SA 2BINA 3PPEA 2XN9D 4PY7B 1QFWM 1NFIA 2R1XB 3L95B 5GRZA 1K5WA 3HC3L 4H1LA 5DC2A 1BREA 3LKRA 3IGLA 2V37A 1S7UB 1PG7X 5JHAA 2F8VA 5TH2A 2CUIA 3ARFB 1DDHB 3UTQB 1MRDH 2HP4A 4DZ8A 1ZA3B 3ARBA 2OLDA 2WXOA 2WLLA 1WRFA 3FXIC 3SSGA 2Q86B 4K5NA 1H8OA 4N6QA 5C0DA 4JANB 4ENZA 3WIFB 1FF5A 4I5BB 1TETL 1VCBC 3HLAA 4TTDD 5FFLA 4KU1A 3S96A 3W57A 3ORJA 2NX5D 5DQ9A 5I0YA 4JFDE 1VACB 1R3HA 1T3FB 2DKMA 5IESH 4PTUB 4AQ1C 3IU3B 4MA7H 5C6TL 3G5VB 5DMJB 3C60C 2DLFH 3MJ9A 4HU8A 4KKAC 4RH4A 5HVHC 3U2SB 3LPOA 5I66B 5C0RH 2P80A 3VG0L 3MX0A 3VRIB 5D4HA 4CN6A 4X6CF 3ASNB 3V5DB 3SE9L 5B39A 4B7LA 2HKAA 2YPKA 1MHPH 5GSRA 4P2RB 4O2FA 1BFTA 2V7HA 4X9GA 3MXVL 3WHE1 1MCPH 2R0ZL 2R9HC 2F19H 2FYYA 2VLRA 5CJBA 1CDCA 1BCIA 5B38G 5C0BE 5TGBB 2IDUA 4A2EA 4B7IA 2Y07L 3W37A 4CA4A 1ZV2A 2AJVH 3J07A 4CMHC 2P5WB 3S37H 2X1PA 4GQQA 4Y19B 2QLVB 1L9TA 1KXHA 4XX1E 1YHPA 4JQIA 1EAOA 2PPEA 4DGYH 4ALAH 1B0IA 2E6QA 1SLVA 2DQIL 4X6FB 4TQPA 3ZU8A 4EZJA 4TF4A 4L05A 5B1JA 1RD6A 2GAZA 5DS8A 3SJVB 5TFSL 2WVVB 1W72H 4JPSA 3GMQA 4YH6A 4J3OD 2GTQA 3K2IA 3QEHA 4ZS6D 4ZW3A 3IXTA 2VXTL 1NMAH 1WZ1L 3C75A 4XMKL 3TBTA 4APQC 1U8PA 4JB9H 4E9YA 4ZFGH 1F56A 1XL6A 1K8DA 2EILB 3L3HB 4WTXA 1L3NA 2QFPA 3PRZA 3L4WA 4HIQA 4PJ5B 3ZE0F 2FBOJ 5BXFA 3KPQA 4W81A 5E2WH 5FM8A 4BQBA 4XTRC 2MNUA 1SXCA 2QKSA 5IJBC 4ZBJA 2GFBA 5DJDB 3VRJA 2XTJB 3G6AB 1JFQH 1NPJA 3GJEA 2IV9A 1MQ8A 2PYEA 4PB9H 2QVTA 4TOYL 5IJKC 2PXYC 1KCUL 3C6SA 4XZUB 5F6HJ 5T5FH 2K78A 2QV2A 4ZAKA 4TOYH 4H8WC 1LYQA 2MSPA 3VRLE 3IMUA 4OQ1A 2JI1A 4EN3A 5PAZA 1U8JA 3T2QA 3TS8A 1OTSD 1XH3B 2WINA 4MAYB 4OZFA 3PLYA 4NOFA 5IW3A 1GOGA 4TRPH 3QORD 3ZDWA 2HX9A 3VMPA 1A3ZA 2EE3A 1G0DA 1ND0A 5I8KH 1H0DA 4HJTA 3SDCC 2WKOF 2W80C 1EHKB 4NC2B 1LD9A 4YDIL 4OFPA 3AT9A 1BG9A 3ROOB 1HZKA 3QEUB 3JUYA 1F4AA 1KFAH 4KQ3L 3GXMA 5HDBF 2WNGA 4XBGB 4NO5B 2V7NA 3FQXB 3RURA 3D2TA 4TVPE 3NGBB 5CR1A 1E4WL 4FAAB 4ZW7A 1FZMB 2DD8L 1PD0A 2B8OT 5CMAB 4M61A 4PY8I 1GL4B 1D5ZA 1F3DH 2VN3A 5D7KD 1FDLH 3ABLB 4P0DA 4NQED 4PRAA 3FN0L 2Q8BH 4HKBA 4JEGB 1C5CH 3KL0A 1OARL 2BJML 4XPHL 3OBAA 4QHNA 4LGPB 1RV6X 1DQQA 4AT6A 2MWCA 2QPUA 3NZ8B 4NQUA 1MWAL 4OLZH 3SD5A 4GMSH 1KGYE 1K4DB 4OGXL 3IU4L 1JPEA 1UJ3A 3LB6C 3RWEA 4EDXA 4CADB 3SPGA 3ECUA 3QJHB 2AABL 4DKFL 4A04A 1ZY9A 1RIUL 1FNGA 1LO5B 2H0PA 4HK0B 4KGLA 3WJJA 5MEND 5D6CA 35C8H 1QO3A 3L4CA 3EF4A 4JPIB 1QUNA 2QFRA 3X1BA 2CG9X 4XOEA 5EU6B 5A2BA 4Y89A 3L1GA 1F3JA 1KTJA 1SJHA 2HLAA 2B4CH 2H0EA 5H2BA 4ABQA 1JK8A 3H54A 3K5RA 3K2KA 4N2NA 5HHOA 5KOMC 1MOEA 3CPLA 4F37K 1J10A 3ESUF 3CFJB 3OAUH 1C08A 1IM9B 3ZXAC 1WT5C 2F5BL 3MUJA 4OJDH 4G71B 4OB5H 1OSZA 4MCYB 3FZUC 4NJ9H 4P9ML 4UWQB 3W56A 4FP8H 3TYGH 2WLIB 5IGXL 4DPAX 1OAJA 3O2WH 4P5KB 2ATKA 3RJQB 4BKTC 3ULVH 5IT2L 2CCLA 3QDGE 1JZJA 1ZA6B 3MV8B 3MRHA 1P5UA 2GK2A 3HMXA 4YSUA 5E5LA 1B2WH 5ISZA 1M1XB 2IG2H 3U6RB 2G9KA 3LMJH 5CCKH 1N64L 4NNXB 1PX3A 3MLSL 1L7TH 1I7UB 2ORBL 2BNUA 3VXME 1X7SA 4X6DE 3LN5B 4JG5A 4HHWA 1BD2B 5IHWA 4D9RD 4RFNC 5T3XL 4LVHC 2WBXA 2JB5H 1IIIA 3GBML 1EHLL 3SY6A 3TZVA 2NT0A 3AREB 4FG6D 3QR0A 3IDJB 2VUYA 1KTDA 4XOCA 4EBQH 5LBSL 2W0PA 4NZTH 3BHBA 4GXFA 2NR6D 3AABA 4K15A 5IMMA 1NC2A 1MEXH 1KF9B 4OM1L 4OLVH 3O6LL 3SBRA 3A47A 1BWMA 3VTMA 3U7YH 4EI6B 4JFDB 4JFEA 3KPNB 1EXUA 2EDXA 1ZLDA 4P8QA 1JF6A 3L48A 4UF7C 4FNLH 2XZAH 3W9DA 3IDXL 4TUKH 4BDVA 2WHVA 2XTLA 3HKZA 4C56A 3MBXL 4PR5B 1JTPA 3BZEA 2E8YA 3PFUA 4PRHD 1HFUA 5DJ0A 5AW4B 3WNJA 3HE6C 3WNLA 1IQDB 3AG2B 3CU7A 4ZXBC 3GBNH 5C0IA 2EVGA 3TBCA 2DWDB 5KBLA 1QFPA 3UMNA 3V0IA 4WUKL 4WFGE 5EBWB 4XMLH 4L97A 4BGDA 2Z31B 1YEWA 2BSEA 1DVUA 1JZHA 5E6ZA 5IY5B 2J25A 1KEGH 2CJ3A 4MLSA 5C0BB 3ESPA 3NZSA 1UZ6F 3WN5C 3GSWA 2VLJD 2VMCA 3V7AG 3MNZA 2YWZA 4DVRH 4XNUH 1SJEA 1INDH 1UA6H 4R0LC 2CU9A 4G83A 4FQHA 5C86A 4KVCH 3CH1B 1NL0L 1KC5L 3K1KC 4JO5A 2H26A 2R2EB 3VFMB 4ZMLA 3GSNA 5L7XL 2G75A 4M8QB 4ZTOH 3H8NA 3ZTJG 2YZ8A 1FGNL 4XP4L 5KJ4A 5AQ0A 2O30A 5GISL 5JO5B 2ZG3A 1DQMH 3TV3L 3GXDA 3ULUL 4S10A 3HE7A 2WANA 2ADJB 4U33A 1CD1B 3RBSA 5F7NC 1AG6A 2ZF9A 1IVLA 3VWJD 3QFJA 1U21A 1UD5A 4EXKA 5ESQA 1RZKC 1XSJA 1WWBX 1QSEA 3T6ZA 2CM6A 2VIRA 1W16A 1KNOB 4M4RA 3UX9B 1X6LA 3WEXA 3DDFA 2CQVA 3DX9A 4GW4B 4JFXB 5DD5L 3APMA 1WLHA 3B1TA 3EYFB 1LVEA 3MJWA 4KXAA 3AG4B 4DF9A 1II4E 5ICXA 1XGPA 3ZIMA 4KNQA 2RBLA 2HA1A 2BFVH 3QJFA 3U4KA 3RHWK 1E7VA 4JN2A 1TJIL 3RZCA 2ZXCA 4MJIE 1IGCL 1MFDH 1SLUA 3WNMA 1L7IL 1QZ1A 1W8NA 5I73B 5GRYA 2F53A 1S6NA 3CXFA 4G5ZL 2VERN 2W9EH 4X7SH 5B1CA 3RWDA 3TWCL 4AIXA 4MS6A 3EJZC 4GAYB 2FLMA 1FNFA 5CZVH 4XP6L 4DP6X 2FSDA 3SKNB 3ARBD 3F62A 4HALA 1OAKL 3VG9C 4AVJA 1QRNA 4X4ME 1NBZB 2VDOB 5CKAA 4E5XG 3SGDH 2XWTB 2ZJSL 1YNLL 2QPSA 5LG6A 1WZMA 2YEZA 4R3SB 1OCCB 1R3LA 1R6VA 2AXGB 1T5KA 3AC0A 4D7PA 4Y5YB 4GXVH 4JY6A 3OG4B 5LG1A 2PTTB 2R1YB 1S5IH 3JTSA 2P80D 3AY4C 4HC1A 3PCYA 3FW6A 3ATDA 2GJ6A 4RZKA 5HD8C 5I6NA 1F4WH 4N1HB 3S4SG 4OI8A 5T3ZL 2APBA 3VE0A 2NXYB 3JSSA 1S7VB 4X4ZA 5EOTA 1QFHA 1JHKH 3KH4A 4QYOB 4OTXH 1VAHA 1BIIB 4OZGE 5I1GH 2RMNA 5F7WC 4A2DA 1TQCB 2B3IA 1X9QA 2LU5A 1XH0A 2VLRD 2WKLA 2WIIA 3R4DA 4PGBB 5I18H 3HUJF 2X6UA 3FRPB 3AS1A 5EA0L 1E4XI 2KLRA 4G2AA 5DURB 4N24A 1NBVL 4I48B 4M7LH 4GW1A 5EIQA 2Z8WC 3CFMA 3ARSA 1U8HB 1KIRB 2QADD 2ZKWA 4ATTA 2OAAA 5I82A 4CVWA 4K8RC 1EZVX 4PV8A 3U7AA 1IGIL 2JF1A 4MJ5A 5T1DL 3MCYA 4H0IA 2R0KL 3EHBD 2WCGA 4OGZA 4HIHA 3TEZA 4MMYA 2I9LB 3CZKA 4FZEL 2DYRB 4P46A 5CILL 1NIBA 5DR5L 1CWVA 2VDRL 3QDGB 4Z3EA 2ZXAA 1JZEA 3FOMB 3EFDH 1L0YA 3FO0L 3NK4A 1BGXL 1K3IA 2FO4B 3HN3A 2CPUA 4OKVB 5JIIA 1YEKL 3SDAB 2R4SH 4IRZA 1FIEA 4HWBL 1V3JA 1CGVA 5TF1H 3QDME 2AEOA 3IKCA 3MROA 4PGCA 3WD5H 4KZDH 3B7YA 3VXMB 4DTGL 1PJ9A 1KIUA 4G8GA 3ZTCC 3NCJH 4X6DB 2PYED 4PBVC 1DEDA 3EO0B 3IPBA 4YX2H 6CGTA 5E8PB 5KYXB 3DX6A 4FE9A 4ZAKD 2C1PA 3OWRA 1R4XA 4EN3D 1G9MC 3VSTA 3CU1A 1BX2B 1GTFA 2XKNA 1IRAY 1FPTL 2PW1A 2UY7B 1U8LA 2A83A 2AJSL 5DD6B 5GS1C 2A99A 1LP9F 2AV1B 2X42A 4ODHH 4RMWA 5CIPB 5KSAC 3BO8A 1U8MA 2PCYA 3L3IB 5BPPA 4AXWA 4TMPA 3HG1E 3VI3F 2JI2A 2JKLA 3VFWB 3DVGB 2YD2A 5B8CB 4BRVA 5ITBL 1T83A 3Q9PA 4J27A 4OAWA 3WEBA 5IB3B 5GS0D 1I7ZA 3OF6A 2VR4A 2E74C 1L6XA 1RFDL 3KL5A 5INCA 5AAMC 3EOAA 1ZV5A 3QP3A 2J8HA 3MV9E 2A9CA 5IROC 4O9HH 2Q5BA 1SQMA 2I27N 3IDGA 3NK3A 2JCCE 4X5PA 3SKJL 4AMXA 3ULUF 4R2GB 4PW9A 3K81A 1TU2B 3CFUA 3LN4B 1IIKA 1AP2A 3FT2A 4NQVA 4XPAH 4PJIE 3UJTH 4LF3B 3LRMA 4XXWC 5CSBA 3TT1H 1KG0B 5HVFB 4KI5F 1KTLA 4UOQA 5F89B 3V52H 1DO5A 3ALWA 3Q3GB 2VCOA 4OLUH 1KJMA 2XV0A 3WFBL 3LKPB 3HN8A 1OOWA 4AUJA 3QXAA 3FTWA 5CSGA 5MEOA 4JK0D 5IQ9B 1SEQH 4L8DB 5BZWB 1GZHA 5IW1A 1ZRUA 2AVGA 1BZQK 2NQDA 4JN1H 4Z7UF 1VGKA 1ZLSL 4XPGL 4L29A 4NRXA 3BVWA 5EZIH 2Y4SA 1UWEH 2YFOA 4LPWA 2IH3A 3ZL4L 1BBJA 1I1AC 4I2XE 3SO3C 3FQRB 2CIIB 3ZZSA 3BRDA 4KITB 1MLCA 1J8KA 5AVWB 3BH9A 4NO3B 4PIBA 5HHOD 4A39A 1PMYA 3QRGL 3NZHH 4I77H 3BAEH 5FO9A 1R46A 3KWVA 3QI9C 4XNMB 4NHCH 1BYPA 1ROWA 1ZT7A 4HLZG 4WHYH 1FL6A 1XF5B 3CLFL 1NCNA 3IF1B 2CDFA 2EIEA 2WMPB 5HI5D 1ZGLP 5DC0A 2LE9A 4RA0C 1ZS2A 3H53A 2XQYK 2YSTA 3OPUA 2I26N 3QCVH 3OX8A 1P9MC 2ZAGA 1XCXA 2QQQA 3EJUA 5ISZD 2DWTA 2DQMA 1MHEA 4FTDA 2QKIC 2MCMA 5KYUA 1QSVA 1AZNA 4B0MM 2BXZA 4UAOB 3KMDA 1KYOJ 1PVHA 1XGRB 2R27A 3D09A 4IBVA 3O6FC 1XZWA 2NQCA 2C3HA 1F6FB 4I1RA 4MJIB 4U1KA 2XV3A 5G4NA 4NXKA 1U2HA 3AM8C 1UXMA 5L4FA 1A1NB 5LBVA 1Z5YD 4P2QE 4DO6A 3MRNB 3VFTA 3MOBL 4XVUD 2EH7H 3HNSL 4MDJA 3W39B 1R3KB 1TQSA 3AADB 3TZVD 3QH3B 1T1XA 3T4AC 1JYWA 1XGUA 3TF7C 3GZOA 3C5ZC 4PLKD 5LGJA 4NSKA 1GKOA 3LD8C 3GNMH 1R3JA 5I5IA 3OJVC 1GXEA 1NC2D 3KLDA 4IDLA 5D1XA 2OKMA 1QUPA 2XN1A 4G8IA 1R24B 4NO2A 1J5DA 1BQLH 4JFED 2F8XC 4Z7VE 1N3NA 4XNZB 1AGCA 4WK2B 3NCXA 2VDOH 2B9BA 3EO1A 3P4OA 4TVPH 1ETJA 3CVHB 2YQGA 1M7UA 1JOIA 4UTAA 3RL2A 4C56D 1ZLEA 1FNAA 3LEYH 2GCYA 3DIVA 4PRIE 5DZ9A 3KLAB 1T04A 2N7AA 4XAKE 4ZX4A 4D7BA 1T1YB 4YSAA 3WYRA 2EXYC 2YJQA 3S3DB 1UCBL 2VXSH 5DSCA 2IOIA 3NSFA 3O2DL 3QPQC 4QXTB 1JCVA 5IUCA 1F4YH 3GUFA 4W6WB 4KPHL 4OZGB 4V1DE 2JKJA 5F2FA 2BSED 3IS1X 4Q9RH 1XMEB 2V3DA 3UCQA 4P59H 2RH0A 4LKXA 5I74C 4JDEA 1QATA 1AQHA 3HA0A 1LWJA 2XQBL 4K3EL 2NYKA 4JM4L 2VDML 2B9AA 1L9QA 4AYSA 5FUOL 5I30L 1T0NA 5JXEA 2XVBA 5D1QA 5JIPA 2CBPA 4QRQB 3VU1A 4FNTA 1E65A 4FHKA 1Z9SA 3KYOB 1OAZL 4N2HA 3DC0A 2UY6B 4UILH 2FK9A 4FEMA 3EJRA 3GSQB 4AEIL 3EFFB 4FNRA 5HVWA 5IMLB 1DN0A 2DTML 3L9RB 3EBAA 1YUKB 4LAQH 3QULA 2XN0A 4UB0L 3DO3A 3PHQB 5C09E 3QXUA 3T1WA 3ILDA 4TVSa 3H3KA 4K7PY 2DYPA 4N2AA 3C8DA 4GFTB 1OPOA 2BY2A 5KTEH 5KYNA 4GT0A 4BCYA 1JG9A 1DVFB 5DC9B 4P23C 5F7FA 2YAPA 3DK2A 3QFJD 2QSCH 2VDLB 2JELH 2W88A 2EIJB 1IO4C 4WHTA 3HS0A 2VLLA 1OAYL 1I82A 1QSED 4RMVA 4RGNC 1RIVH 1IKFH 4F33B 3QDMB 3VD0A 1UWFA 4O4YL 1IBYA 1ORQB 3SE8L 2AKRB 4JFVA 2XQYG 3KBHE 2Q0ZX 2EIZA 2BP8A 4P3DB 2OMVB 5GJTH 2WOYA 1XIWC 1BVLB 5HYSG 4QWWD 3Q5OA 5DF0A 1CTNA 2DOCA 2EE6A 4FC3E 3G6DL 5F7MC 1YSOA 3RZCD 2X09A 1XCTB 2ROYA 1ADWA 1CT8A 1XZ0B 3IJSA 3VX1A 5A40E 1KYUA 2R69H 1P4UA 1Q9KB 2DM4A 4L8BB 4NNPH 2F53D 4PJ9A 3GK8H 1IV8A 1GRWA 3I6KB 2G5RA 3BPNB 1PY4A 4ZNCD 1RLWA 5I1HL 1H6FA 1S7WA 4XCFL 4TVUA 3HG1B 3L3DA 4FXGC 2X9ZA 5ID0A 4NKMB 4F57H 2ARJB 4M7LT 5CIPH 1IEAA 4J2QA 1IFRA 1QRND 1E8WA 1TENA 3C9NA 1NCWL 1VPOH 4J28A 4QF1B 5DRZB 5IBTH 2QGCA 4OFDA 3OJ2C 1BJ1H 2IQAB 2QQNL 4FDWA 4HF5L 3MV9B 4LZKA 2R51A 4IU2B 2G3NA 2LABA 2JCCB 4M7JH 2PN5A 2SEBB 3LRSA 5KUKA 4QLRA 4PJIB 3WL9A 1J1XH 4IW4C 1THAA 4LEOA 3STLA 4DUXA 5ES4B 2ZOKB 4S11A 2GJ6D 2MTAA 4KQ0A 1PCSA 1J87A 5CHNA 3R06A 4Y1TA 2FJHB 4PJ7A 3GSUA 5D2NE 5AAWA 4F8OA 3J8F7 1TKWB 3CV5A 2Z8RA 2GSIA 3BVDB 3UTSE 3WXWL 2XKSA 5KANG 1EUTA 5AVSB 2AGJH 1YLBB 4YVUA 5AOLA 3DX7B 8CGTA 4G6KH 4LKCA 2YLHA 1F0LA 2DQCH 2YKLH 3BYYA 4TLKA 2WWMC 5J06A 4I2XB 4HUCA 2V2WB 1FO0L 4YZFF 5E6IA 4APXA 3LN9A 4FLSA 5DJ6A 2KHAA 4ZOEA 4XXCA 4AYID 2OSXA 2EACA 1GGIH 2K45A 1BP3B 1GJUA 1HWWA 3OR7A 4MNQE 2F1BA 2CH8A 6FABH 1OSPH 4LSQH 3RFRA 4JM2C 4ILDA 1RKRA 4N2EA 4X4YB 1AY1L 1K5NB 2VISA 2XWJA 4ODXB 4UT9A 2DBLL 3FHQA 4MAUH 3EJQA 4ZTPH 4QY8B 2B0SL 2XTSA 2DIAA 4LVNB 4AYMC 2E8ZA 2NDGA 4P46D 4RESB 2UV3A 1AXSB 4JZOA 1BOGA 4WV1C 4PI2A 4JPWH 1RZ7L 2VSDA 3WS6A 3FCBA 3KYKH 2HRLA 2H3KA 4HK3N 3VWKC 4G6AC 3VD9A 1P2CB 4KTDL 4MXQC 3W0WA 5I1JH 1CFQB 3QPXH 2P5EA 4G8GD 1G7PA 1U3HC 2XWBB 5GS0L 5I1LB 3BDYH 5JTWA 1KPUA 1QFWI 3FHEA 1NIFA 4AC4A 43C9B 1Y6NR 3ARDA 4P2QB 5DEZA 1AR1D 3BZFA 2EVIA 5FXCH 2XYCA 2B7DT 2VDNL 3MXWH 3L3OC 3QUYC 5DFWH 3MLUH 2GEQA 4I18C 8FABA 5IMKA 2WGXA 1KJVA 1JZ7A 3WNOA 3BRGC 5FV2A 4J2XA 1E42A 2V9RA 5IJCC 4ZUWB 1E67A 5JNYB 3HMWH 1K2DB 3LS4H 4Z7IA 1MCJA 5ESAA 3H6AA 4GO6B 1E90A 4QXUH 4Z7VB 1I4FA 1MNUH 3FTSA 3EJYD 1MDAA 5TDOB 5D1ZI 1DFBH 1GKEA 3FT3A 2G3MA 3OF6D 4P48A 1OPGH 4PWFA 4IRSA 5IB4B 4PRIB 4ONOA 2MQ0A 2R4RH 3TJHC 4AGQA 5I1EL 1QZNA 1ZMYA 3CVHH 1UKSA 2IPKA 1YYLL 4W6XB 1WA0X 1B0GB 3ZKND 5I0DA 4V1DB 5DI8B 4G6MH 2VAJA 1ZHLB 4MYPA 4Q0XH 3LKOA 3WEAA 4DGWC 3IPEA 1HH6A 3GB7A 1A6TA 4KHTH 3EH1A 4RWHA 1FGVL 1M2VA 3BLPX 3ENEA 4AOFA 1TJMA 5E2UH 1HSAB 2R7EB 4RISH 2VXQH 4BFOA 1ML0A 1X5YA 3VXNA 1GPOH 1X4YA 3MLTA 5GGTH 4IKKA 5E23A 3DPBB 4DEPB 2GBUA 3MLZH 5IK3A 1JWMA 1F13A 3KPTA 2Z91B 3MGAA 3WUWG 5IFHL 2B4CC 5C09B 5BO0D 1RP8A 1KLUB 3EG9B 1WSST 2C9PA 3V9FA 1QR4A 1FNEB 4NX0A 2B15A 4WDIB 2P7TB 2ZP8A 1XH2A 3QWOA 3OHMB 2Q8AH 1LE5A 4UOZA 5JW5B 1MJ8H 1JHLH 3F5WB 5HI3D 3BP5A 3VGEA 1GZPB 3O3DA 1HOCA 2VDLH 2ZUSA 3X1EA 2P49B 2X0WA 4FQ2L 3WDJA 2UZYA 4XN4A 4G8FA 2FBRA 3VVVA 4DERA 1OAQL 2NTFB 1FJ1B 1R9FA 4KRPB 5J13B 5E03A 3RB5A 1KJ2B 1CGSH 2UX6A 1I8MB 5EH1A 2XN2A 4X8GA 2RACA 2R2BB 4JMNA 3ZN6A 1JNLL 2X4PA 5D9SB 2H8PB 2W0KA 1Q0XL 3BWAA 1TCMA 3IJHA 5C6WH 3VTTA 2YUXA 4U1SB 4KK6D 2UZIL 2VO5A 1F86A 2WXHA 3K3QA 3KBFA 1MCHA 2BRQA 2JKRM 4NIYE 3VD5A 3HB3B 1AGFA 1KDIA 1HIML 1RULH 3QCTL 2R29H 3VDAA 1F2XK 2H9GB 2GJZA 2D03H 2LLLA 3MNVB 2NZ9D 4IOFD 1CLCA 1P7QA 1WGVA 2TSBA 1BVOA 2CGZA 1A6VH 3AS3A 5D1XD 4IIQB 1XFPA 4ONHA 2B59A 1TJXA 2BVPB 1I8UA 4JRXE 3QQXA 1ETA1 4ZOAA 2ZPKL 4OIBA 4AQ8C 4HFWA 3A6CH 2CR0A 3RFZA 2FNBA 3UYPB 4I1PA 1IGYB 4HIEB 4JRLA 2X3CA 4JAMB 4JDVB 4MRBA 1T80A 4XMXA 3IJYB 3VACA 4FA8A 2YJLA 4LEEA 5CBAA 5J9PB 2X41A 4G43A 3HZYB 2EZ0D 3PL6A 1JF5A 2VOTA 4GEJA 1UOKA 1A5FH 5D2NB 5HGHA 4KKBC 4FFYH 3C8KA 4YUEL 2BSRA 1H5BB 3UTSB 4KHXH 3FULA 4MX7B 4JZJB 4PIRF 1SXSA 2IPTH 2WQUA 2XPGB 4OCRL 1T2QL 2NCMA 3CN2A 3SQBB 4O02B 5JPNB 3OVUB 1Q9WB 2IEPA 8PAZA 1EH9A 5EUOA 3VXUE 4OF5A 1EX0A 2VQUA 5DJYB 5JXED 4NZUH 1D7DA 2P43B 5D1QD 3UTTE 1NGYB 3GYRA 5L9DL 1VFUA 2O5YL 4YNYA 1HILB 1MW1A 2CO1A 3RDTD 3PJNA 5IEKA 2WY3B 2Y1AA 3DX8B 3BVTA 4PUBH 1JP5A 2W38A 4PJ8B 2CXKA 4MNQB 1AAJA 5IHUL 3L1OL 4HYTB 1QNZH 1AQMA 4E0RB 5IR1A 1BZDA 1C5DB 4RBPH 1ZV9A 3SGKC 4E5XB 2DYPD 3Q48A 3QUXB 5HHXL 4EJ1C 3QQDA 4Z7NE 5E5RB 3IDMB 4UBDD 1TG8A 3IGAB 1B0WA 2HCZX 2M26A 3IMWA 2H6OA 4PGDB 4J4PC 1OD9A 1MCQA 2IGFL 1XBRA 3KS0H 5E00A 2ZOUA 3S36X 3AACA 4U1JA 1Y6MR 3O4LE 5JDSA 4CU8A 2JJUA 2J71A 1ADQH 5IV2A 2Z35B 1HZHL 2BOBB 5IQ7L 1ESOA 2FJUB 5GXBB 1UWGH 2IPUK 4HS3B 4WI8A 2XTJC 2APFA 4B0MB 1XF3A 5K93A 5E51A 2J1ZA 5SWZA 2HKHL 1USQA 3KWUA 5C70A 2F8IA 3UC0L 2Q6WA 3H7BA 3ZVVA 5HGAB 2IIJA 4QPEA 2W1NA 4U1LB 4HC1L 1NDMA 5CWSB 4PJ9D 3SQRA 4MAYC 1BV8A 3U83A 1I7RA 3MRMA 1IZJA 2AQ3A 2EH8L 5DRWB 1DQJA 1UZ8B 2UYLB 4GLRI 1AGDB 1D2OA 1MKFA 5EEYA 2OP4H 1CB4A 5HDOA 4OD1H 7FABL 1H8SA 1KY7A 4WU7A 3FU0A 2VZ1A 3EYOA 2HFFA 1BSIA 4XAWL 2MCG1 5KW9H 3QA3A 4JHAH 4P5MB 1GTNA 1RL1A 3ERXA 2WJ7A 2E46A 1UXSB 4GAGH 2DQEL 3WFEL 5SX4H 2R0WH 4HH9A 1MUJB 1PPIA 1UOVA 5DO8A 1N7MH 1M57B 4HIXH 1DJZA 3NGBC 2YK1L 3CXDH 3VA2C 1FZKA 1ZIAA 2ICWB 4DPBX 5JA9A 1LWRA 2WXNA 5AKRA 1G9NL 5KSVA 4ZD3L 1WV7T 4RVBA 2JKXA 3V9CA 4U6TA 3A21A 3FAXA 1FHGA 1MFEL 1WPCA 4NERA 3IAPA 3QHZH 3ZO0A 4PRNB 4Z7WE 4M7ZB 1BQHA 2Y25A 4FA7B 1CIDA 3H4FA 4LP5A 1PAZA 5I26A 5EU4B 2F08A 3GLEA 1Z1WA 3U0TB 2OYLA 3CZFA 3IS0X 2E6JA 4MDRA 4OM0L 1ZE3H 4HOWA 2Z93B 1ZK9A 3AS0A 3TBVA 3PWLB 4TUJB 4IK6A 4UQ3B 5E1AA 3L16A 4WW2B 1JV5B 5E6ID 5ABDE 3NQKA 3BH8B 2DQTL 5IP4A 1HEZA 4TNFA 5ICYB 4FZ8H 5FF6A 3FF7A 4PBXA 3MR9B 4NZ8A 3D85B 3BJ91 1J5HA 3B7RL 4LLVA 1SM3H 4DAGH 4U6HB 4YQXH 4YXHL 3EUDA 1W0VA 4OUUA 5I5MA 4G82A 1WBYA 4M1GH 2ITFA 4P4RA 4ABUA 1DBBH 1B88A 1U4FA 2FE0A 2NY4C 1P4IL 3CZNA 1LEKA 1IT9H 1KB9K 1N2RB 2X5PA 4TNWF 1VFOA 2GIXA 4ODUA 4PG9A 3I9IA 2BIQA 3W0WD 1JPFB 1OK0A 3T8XA 1TPXB 4FQJH 3LNGA 4ZFFA 1IGJA 1XEUA 2OMZA 2DMGA 2P5ED 1Y1UA 1MH5B 1NAML 2C3GA 1MW3A 1R19A 2JKNA 1KJ2H 2IPUG 3SOBL 1U8CB 3TJEL 3ARDD 3BQVA 3B83A 2OBGA 1CDJA 3ALPA 2EIMB 3D8MA 2A77L 3R7RA 2QTVA 4AQ1A 2EYRA 2H1LM 5K9OB 3VH8G 3C60A 3K6FA 5DRNA 1A9EB 3CFBA 2JIXB 3HI6H 2Y2YA 4YHML 4QRPE 4O2CA 3CC1A 3VA6A 3KNBA 1R0AL 4JRXB 5HDQH 2A3TA 5C7ZA 1Q9OA 1A7NH 4KH2A 3MRCA 3ZK0A 4AK1A 3G6JA 5FB8B 4PCTA 3B2PA 1ED3B 2NXZD 3ZMRA 2W60B 4ODSL 5C08E 3MNWA 3JWDC 2GITB 2FSEA 2YD8A 4Y2OA 2EIDA 1BQUA 3M17B 1FYTE 3RU8L 3TYFA 1L0PA 4IRSD 2BOCB 2ZF8A 3LZFH 5T1MB 2D7OA 3D39A 3JWOL 4X6CE 4MNHA 1BYOA 2EDLA 4HIIA 1TUPA 3I2CH 5E8DL 3FFCE 5DJAA 3CK0H 2YPVH 3B7SA 2H2SC 3V0FA 1EXHA 1K85A 4NN5C 3MUZ1 1WHPA 4GKZA 4PCYA 4OKDA 1NEZA 1BZ7A 4U1HA 5D71H 3RUGF 4A67A 5BVPL 4G8EA 1PY9A 4NC0B 1CTMA 3LH8A 5ID1B 3VXUB 3GIVB 2Z31C 4YSCA 5FHAL 4KNSA 3WNNA 2M83A 4HETA 2WXKA 1VERA 3UYRL 4TSCH 1G0YR 1H8NA 3FQNB 4O02H 2Z7WA 4WO4A 2EYSA 3L4TA 3PHOB 2XFXB 3SYOA 3V4UL 1TZGH 3W5MA 1CGXA 4ANXA 2FT8A 3BFOA 4LESA 4APQA 4BSVB 5DUJA 2WXGA 1TEYA 4XVSL 4AJYV 4HWUA 4L2YA 1INEL 1T4KB 1JK9A 1MHCA 4KKLC 3NPSC 5F3HB 1EXGA 3S9DB 3SPHA 4QRAA 4Z7NB 4FJ6A 1CFNB 3LZRA 4JR9H 2ENPA 2X4NA 1MIML 3FKUS 4GEIA 2VR3A 3X3GL 4BFFA 3MBWA 4DP4X 1I1FB 4QHKI 4X42A 5IJKA 3ZE0E 3C5SA 1ZT4A 3OPZL 2OMYA 3MLWL 4G7VH 4ISVA 5EO1A 1KCLA 3V55A 3NFSH 5KVFL 2F7QA 4MKTA 3WN6A 3O4LB 4KKZA 2QLYA 3MRJB 5TQ0H 4HKXA 3KCPA 1WA1X 1JZDC 3RVTD 2ZOLA 5C07A 1AO7A 2ZUVA 4WFED 5GQBA 1D9KB 3LS5L 2A73A 3ABGA 2RCSL 4E42B 3PY9A 2BVOA 4WI3A 2CHWA 5DYOB 3UAAA 4ETQB 1JI2A 1H19A 2JWYA 1G7IB 3SDCA 1BFOB 1FI8C 4NZRL 3OJDB 2BZDA 4MCZB 1MCFA 4KK8D 1KCVH 5CLXA 1KELL 5J4MA 1IGML 4F7PB 4UTAL 2JJVA 1Q9LA 2EDJA 2FYVA 1TQBC 2CDGB 4HPOH 4K71B 4XC1H 5FYLD 2Q3AA 5C0EA 1T03H 5E6UB 2WZPA 1KWGA 3LSOA 5I73C 1BM3H 5IHZA 4NPKA 2COVD 5CINL 4OQTA 1X5HA 3L1EA 5EIIB 3QO0A 3SZKC 1S9YA 4ZMAT 1P7QD 3EO9H 2GJPA 1PKOA 2OR7A 3L9BA 4KDWA 1IAKB 3NCEB 3D1MC 3UTPD 4FYRA 3EDFA 2CKBL 4XN7A 5E4OA 3A0OA 4OBRA 4M9PA 3WIHA 1ZLVK 2ZX7A 1MAKA 5IJVB 4NJAL 4NRYB 1F58H 1OE1A 4MA7L 2DLFL 3UJIL 4F9PC 1NCOA 1BZ8A 3PL6D 2H7WA 3GRWH 2ZCHL 2IFFL 2XA8H 1NDGA 3T0DA 3F05A 4L1SA 4Z7WB 5CCGE 1OAUH 1CLOH 3MGOB 1JRHL 1BXVA 4XGZA 4FQLL 2NXYC 4BKLA 3MYJB 3DJ9A 1Y18B 3S34L 4TQ8A 1FG9C 2WXRA 4RAHA 3S5LG 1P4LA 3LXAA 4LPXA 2GPZA 4HUXA 4QRSB 3UBXI 4JG1L 1JSYA 3GBDA 2F19L 1WT5A 5HJ3A 3LEXB 3LKQB 2IBBA 3FCTB 1XQ4A 4S2SB 4YFDB 3S37L 5E9DA 4TULH 4TPRH 5D7IA 3QHFL 3UPRB 3WTTA 5FO8B 4HIJA 4DEWA 4ELMA 4XCCH 5GPRA 4ALAL 5CZXD 5HSFA 5KJ7E 2HFGH 3APNA 2GKIA 4KOCA 3CSFA 2YN5A 4UDUA 1E27B 5HYIA 4N2GA 1QQDA 5BV7L 5J3HD 4KVNH 4P4KB 4CDHA 1F4XL 1Z9LA 5E5UB 2A4EA 4JREC 4LSPL 1SBSL 3V0WH 1NMAL 2FJSA 1F02I 4EEEA 3T6QC 5TDPA 1YQ2A 4JDZB 5DJ2B 1VHPA 5E2WL 2DL9A 1DFXA 3WLWC 4YZWA 3W82A 2F7RA 2HVJA 4OJFL 5KUMA 2E7LC 3NP4A 1IAIH 5J6GB 2Y36H 3FONA 3S3BB 5D70L 3U82B 5IB1B 4JRYE 4QO1A 5DEJA 5LCVA 4IDJL 4PB9L 4FFZA 2R23A 4G3YH 5SWZD 5T5FL 1QEXA 5F9OH 3L2NA 4ZUVA 1HL4A 1D5XA 2CO4A 5K9QI 3WTYA 3RNQB 3QARA 5H35B 4JFFA 4WLCA 2LOEA 3N85H 1IUZA 4NP4L 3RVVC 4YFEA 4TRPL 5AYUH 1Q38A 2ED7A 4LCYB 4QRPB 3TEYA 5E5MA 2V9QA 1JV2B 1E4KA 4GRLC 5GGVH 3HE6A 1KWKA 4ZXBA 1UKQA 3JUZA 1KLGA 3BD5A 1RPKA 4L37B 3OC8A 1F90L 2Z0BA 5KS9A 3MRPA 3ATBA 4UYPA 3CSYA 5C08B 2QSVA 2Z92B 1NUNB 4E9SA 1FYTB 3FB8B 9PCYA 4OCMC 2J2ZA 5B8CC 4X6CB 4XNQB 4PJ6A 3DX1A 1D6VH 3GEWB 4MASA 2VLKE 1AIFB 4N0UE 3SHSA 4GUQA 5IVOA 3DSNA 1IQWH 1GJWA 2HX8A 2PNDA 3FFCB 4FCHA 4Y4HB