2X53A

Structure of the phage p2 baseplate in its activated conformation with sr
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
263
structure length
263
Chain Sequence
TIKNFTFFSPNSTEFPVGSNNDGKLYMMLTGMDYRTIRRKDWSSPLNTALNVQYTNTSIIAGGRYFELLNETVALKGDSVNYIHANIDLTQTANPVSLSAETANNSNGVDINNGSGVLKVCFDIVTTSGTGVTSTKPIVQTSTLDSISVNDMTVSGSIDVPVQTLTVEAGNGLQLQLTKKNNDLVIVRFFGSVSNIQKGWNMSGTWVDRPFRPAAVQSLVGHFAGRDTSFHIDINPNGSITWWGANIDKTPIATRGNGSYFIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ORF16
publication title Structure of Lactococcal Phage P2 Baseplate and its Mechanism of Activation.
pubmed doi rcsb
source organism Lactococcus phage p2
molecule tags Viral protein
total genus 56
structure length 263
sequence length 263
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R
ec nomenclature
pdb deposition date 2010-02-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1830 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2x53A02
2.60.520.10 Mainly Beta Sandwich Triple-stranded beta-helix Phage fibre proteins 2x53A01
4L99A 2X53A 3U6XA 2WZPA 3D8MA 4HEMA 3DA0A 1ZRUA 4L92A 4RGGA 4L97A 3HG0A 2BSEA 4RGAA 2BSDA 4IOSA 2F0CA 4L9BA 3EJCA 4HEPA
chains in the Genus database with same CATH superfamily
3QCVH 4FFZA 4L2LA 1CFTB 2YGVA 4ONGH 5DRWA 4NCC2 4UYQA 2YK1H 5MEQB 2BY2A 2WTRB 4HZ1A 8CGTA 1N70A 3Q9QA 1YC7A 2Q7YB 2SODB 3NCEB 5KSBA 3HHSA 1KYUA 3OJDA 4KHTH 1NC2A 4V2BA 5C0AB 4KXZH 3HHMA 1GC1C 3T2OA 1RZ7H 4O5LH 2XZZA 3JV4A 4OGZA 1WAAA 5EC2A 2JKJA 4JO1H 4U1KA 1MAKA 2GTZB 1DQQA 2AMUA 4GW1A 5IJBC 2P8MB 2ZXAA 4NQSA 4D3CH 2EO9A 3VFNB 3UBXB 2LGNA 1AC0A 1YMHA 2QKIB 1BPVA 2J2ZA 1ASPA 4LSSH 3UTSA 1CICD 3QQ4A 1G7PA 1KIRA 4OGYL 5DHVA 3GHBL 3D33A 3OKKA 2ZAGA 3Q05A 4NBYB 3SOTA 4YSAA 3V2AR 4JPSA 1YJDC 2BDNH 4PIRF 5CILL 4R4NC 4RFOL 1T3FA 3QUZA 4IRZH 3KL5A 3KPPB 4FMFA 5C0CD 3SDAA 4ZTPL 4PTTB 1M7XA 3NABH 4ELME 3EG9A 2YD4A 2E8ZA 4Z23A 2ESVD 1G9NH 1YQ2A 4BCZA 1Y6NR 1NCDH 1D9KA 3IKCB 1AOZA 1TDQA 3DTUB 1RKRA 2R2CA 5GGUA 5TE6H 4LCIH 4XBPA 3C5JB 4PLKC 1PD0A 3G6AA 4H1LH 3DIDA 5B3SB 4X0KB 3F62A 3QQDB 1H0DB 2LFGA 2MEJB 3FH7A 5J13C 2J4WH 3FN3A 4PJGB 4ZSOE 1OP4A 5JQHC 1U30A 4S1SL 3O3EA 4N0CC 4RGMB 1OM3L 2A6IB 3QZMA 2YAOA 1UZ6E 2YPKB 4GXUN 4AQ8A 1JGUH 1KJMA 3SN6N 3H2WA 4QTHA 1J10A 1U6AL 2VUKA 3OAUL 1QFWL 2XLLA 1AVAA 2AGJH 3C09B 4YDIL 1SM3L 5AVTB 2GCYB 4NPYA 5DQDH 5E8NB 2D4FA 2FJHA 4U0RB 1CD1A 5T3XE 1MDTA 4TVPE 1K5NB 1ZGLB 2KC0A 3K2UH 4J3WA 1FE8L 4ERSH 1KJ2B 2OR9H 3IJYA 4KVCL 4DIXA 4M43H 2GBVA 3GSVB 5DHMC 1CYGA 4HZLA 4DP2X 3PUUA 1FYTE 4FLHA 5IT2L 1WGVA 2X3AA 3Q5YA 3W5NA 5F3HB 2FEEI 1TJHH 5E51A 4IK7A 4WCYH 1KENH 4YEEA 1S8DA 5KANG 1LWHA 4RMSA 1KN2L 4M7KL 2X4OA 2G4GA 4XCEA 3SE6A 4FTVE 4N8CL 4E9XA 2YD9A 5A7EA 2OJEB 2ZG1A 4NNPH 4UIKL 1U8MB 1CU4L 3PAVA 3QUXD 3VFPA 1L9RA 1XD1A 3MJ9H 2Y5TA 2SEBA 4F7MB 2APBA 3PLYA 2FT6A 3LHPL 4NKDB 2GJ6A 2Z93B 3EHBD 3OF6A 5DQJB 3U46B 3I3EA 1GYUA 3GLEA 4F7PB 1JNJA 3ZOAA 3RZWA 2P7TA 3CBJB 4ABWA 1AP2A 1GZHA 1V3KA 4ZUSA 1KB9J 1E2ZA 3FU7A 1ETJA 5FDYA 4YZFE 3ASNB 1A14H 2DQJL 5DTFB 1QFWM 3FTGB 4PRHA 5EIQA 4HA1A 3AS3A 4MCYB 4B5EA 1M9WA 1S5IH 1EGJH 1LP9E 2JI1A 4XPFL 4B3EA 3RKDC 3UTTD 4G1EA 1ZLDA 3NK3A 1U3JA 1OCCB 4FXTA 5GRXG 4HUVB 1U3HD 1L7IH 3FQUB 3EH2A 3BO8B 4L5FH 3ZXAC 1FO0H 4HPYH 3DSNB 3TEWA 4Q9QH 3LZFL 4LVHB 3D9AH 1EEZA 2W9LA 4WAFA 1QFUL 3IDUA 3VRIA 1DQLH 3KW7A 4U1HB 1H3GA 3QIWB 3VRLE 4AJWA 1E28B 2A83A 1NIBA 2EABA 3OKDB 4G9FE 4IRSB 1NOFA 3WFZA 4OJYA 5J06A 4AYEC 3BESR 4NN7B 4D0CB 1A4BA 1KTRL 4MQ7B 4QKTA 5F97E 4EVNA 2WYZA 2DYPA 4RGNC 5FW8A 1ZPLA 5J1AB 4HJUA 5FO7A 3V4PL 5E6ID 3KPQB 4HC1L 3MX0A 1WFMA 2OMUB 4KQ3H 2DQTH 3MLRH 1MN4A 4PJAF 5LJYH 3GJFA 3TVMC 3MJ6A 5F1IA 2MOQA 2W38A 3QIBD 2F53E 3JZ7A 1AGBB 1BMZA 2JB6B 1RZJL 1FG9C 1KBGH 4JPKH 4X80H 5DRZB 2VCOA 3ZDZF 5KYWA 3MV11 4TL5A 1Y0LB 2YJLA 4M5ZL 2X28A 3SY0B 3HPLB 1MWAH 1RHHB 2WANA 4JW3A 3I3BA 2CBPA 3OHXA 4OZFA 1FPTL 4EDXA 1XH2A 2QFRA 4PWFA 4X5XB 5L4FA 1JWSA 3B4NA 4HWBH 3OKEA 3UP6A 4JS7A 3TO2B 4LSQL 3SCMB 3GZKA 2AVFA 2R4RL 3C5ZD 2NY3D 2JCCB 5FS5A 1IIKA 4NZUH 1I3UA 3MXVH 3PWJA 1R0AL 1QZ1A 4BEIA 4GW5B 4U1JA 3A6CH 3TN0B 2BZ7A 3NEOA 3RDTB 1U92A 1RZ8A 4K8RL 4I2XA 4OJAA 2HPTA 1NCWH 1A6ZA 3PWVA 1ZT1A 5L2KB 5H37G 3S9DB 1RJYB 3PL6D 1UB5B 1JGLL 3VAEA 3LAFA 3FT4A 5AUMB 4L8SB 1Q72H 3NJMA 3E7JA 4AE1A 4QYOA 5JMOC 4L4VE 2P8PB 1MIML 3CD4A 4NQDA 4A6YH 3K4AA 1KGCE 3AB0C 3KGRA 5CN2A 1ORSA 4DGVH 2HVBA 2WXNA 2CCLA 2WXHA 1CXLA 3OZLA 3QZOA 3V0HA 2FECI 2X4SB 5E99L 3VXNA 1A3ZA 4O02L 5EZLA 5FKPB 1LEIB 2PW2B 3P0VH 3QCUH 4WI7A 5MI0C 3PNWA 5HY9A 1KTCA 1WBXB 1GYVA 3MBXH 1ZLUH 2AI0H 3IK2A 4JO4H 3WMPA 4OCLC 4ODTH 3LNGA 5KVFE 4LLUB 4X98B 2V9UA 2FBJL 1N8ZA 2CO6B 1AXTL 1NC4A 4CGUB 1T7VA 2X4QB 3MSPA 1MJUL 2FX9L 4PD4J 3SKMB 1NEPA 3TASA 1HNGA 3LDBC 3ZE1F 1XD0A 3RA7H 3H9SE 1ZTXE 1ZY9A 3OZ9H 2Q3AA 2EVIA 2H41A 1TU2A 4V33A 1MJ7H 1WJ3A 3IE9A 3L4YA 3RVUC 3DI3B 1SJVA 1X6LA 1ACCA 4QRBA 3A0OA 3P73A 1I1FB 4LSTL 1OB0A 4N0FA 4B7IA 3RGBA 1NCHA 3V0WH 3TBWA 25C8H 5KW9H 4DP1X 1ZOXA 1WCBB 4MS8D 3SE3C 3I9GH 3WEBA 1WFTA 4FE9A 3ROOB 3RWDB 3MRGA 4HU2A 5FB8A 3K6IA 4OZHF 2E8YA 2RTTA 4I77H 4TLUA 4IGBB 4KNUA 3NJLA 4Y9BA 1F90H 4XP1L 1AQ8A 3L5JA 1CGUA 4UAHA 2H3KA 4YHKL 3INOA 3QDMA 5E4AA 1ROWA 5SWZA 5BMFH 4YGAB 2WVUA 4JX0A 1A66A 2ZP8A 5T1LD 4RISL 5AAMA 4QRUB 5G55A 5HGHA 2V33A 4FL4B 5D7JC 4L3EA 2XKNB 1F97A 4PY7B 5KZCD 4P3CL 5HI4C 4KKZA 1R5VA 1PZDA 1WO2A 1PFOA 2EDFA 2Z1PA 4WI4A 4Y9GA 1V7NH 1AC6A 2L8AA 3PP3H 2HKHH 3B3IB 4YDVB 1L6PA 1ONQB 5DS1A 5I19H 2AV1B 4IOSD 3MV9A 4R4BA 1TTFA 4JPIB 3M1OA 3BWZA 3V10A 2HT4C 3LS5L 3WY3A 2J5LB 5K1JA 4PJ7E 2VRAA 5C07A 5TGBA 4X7FC 3WNMA 1MRFL 4BZ2A 1WZAA 5LBSA 1U91A 1WTLA 4Z7NF 5BXFA 4BKLB 4K5PA 2N1TE 2IIJA 5IBTL 4OZHA 5FGBC 3HG3A 2EIDA 5E95B 1CDYA 5AYUL 3MROA 4JEGB 5DR5L 1CIDA 3L16A 1T7ZA 1I4FB 1KF9B 1Z3RA 2F7OA 2ICES 3KXFB 4HJSA 4L4TA 5TK2A 4BRJA 5BQ7A 4AX3A 4XO8A 4YXLL 4Z0XA 1J1OL 1FNHA 2AQSA 4JREC 5IMOB 1M6OB 3BFQG 1ML0A 2Y6TE 4PRNB 3GQFA 3CN2A 4ODBD 5I23A 5D70L 3ESUF 4GQZA 4I4WA 4A04A 2YAEA 3HG4A 4L9BA 3VSTA 3QHFL 2PTTA 1U58A 4NQUA 1VB9A 3ZQWA 2XV2A 4M3KB 5EF0A 1RURL 4B9ZA 3QA3B 4WV1B 1XBRA 4KVNH 1YY8A 3DHMA 2Z31C 4Z76B 5BRQA 2C3VB 5C0RL 2P5WE 4JVWA 4ZDHA 2NX5A 5IGXH 4GSDH 3N44F 3OKOB 1TNMA 2CLZA 2X4RB 2ZXWB 2VQTA 3KGTA 1GC1H 3DMMC 5D96B 1FNLA 4ECNA 5T5NF 1PIGA 1UUSA 5EU6E 1LO5B 1BREA 2WXGA 3K72A 4QOKA 3CVBA 4PEEA 3CMOH 1NGZB 2VLKA 3O2DL 3T4AC 4HWEH 5F7AA 4QO1B 4R7DB 3ULVF 1PKQB 4OVUA 3VX1A 2IJ0C 3UABA 3AS0A 1B0RB 1QHPA 2MCPH 4AGNA 4Z7VE 5J8OA 1ET8A 2Z91B 3C6LA 3QQ3A 1YJDH 4HSCX 2B5IB 3GZQA 2DQEH 3CXHK 2P49B 2B3IA 3LKRA 4Y4HA 3WSQL 3HS8A 3F58H 3MLZL 4GUCA 2EIKB 4ZAKD 2MSPA 1HZHL 5E2UL 4MX7B 5I17A 5JMRA 4BE6A 2UY6A 5MP6H 1NH6A 1UACL 1KG0A 2XV6B 4A63A 3ESPA 3TV3L 2XQYK 4Q8BA 4XNXL 2ALAA 3ZBMA 1RK1A 3T71A 3WTUA 3MREB 4LARL 1UD5A 4DOHE 1PQZA 2DEWX 4PJ9C 4PRPA 4Q58C 5DUPL 1INQB 3GIVB 3O3AA 3P54A 1JYWA 4WFEE 3P30H 2BNRA 2WINA 3R1GH 3OWRA 1UWEL 2VMEA 5AFAA 3DRTB 4HUUB 4OFPA 5GGQL 3UYPB 2ZSWA 2KQNA 3SEPA 3MC0A 3LPGA 4JLRA 1RI8A 3NPSC 2VZTA 1YNLL 3Q8CA 2VMFA 2XN9A 1D5IL 2EUZA 4HBCH 1P4UA 3FFOA 1TJIL 3TYGL 2FLRT 5EWIL 3FPYA 5EUKB 4J12A 3RVVD 3UJJH 3GMOB 3IF1A 5AWNL 4D94A 4E0RB 1CIUA 1L9TA 1W6LA 4UT9L 2IH1B 1LNUB 1KN4L 1TQSA 3KCWA 2WLLA 4KOCA 4Y1AB 1D2PA 4AKQA 1NEZA 1BOYA 4PRBB 2CPUA 4LKXA 4I0PB 3WTSA 5E9DD 2Q20A 4LO9A 4Z7IA 2PO6D 1E67A 1R3HB 1DBMH 1C9SA 2W9DL 2VE6B 1JE6A 3P3UA 2VABA 4RMBA 5E94B 4MGXA 3QXUA 4B96A 5I1IL 4HWZA 2EACA 1KLGB 5ESQB 3VSVA 1COBA 3SSGA 1KPUA 2RFXA 4PS8A 2HG5B 4E9RA 4EI6A 4G5ZH 5K9OA 3VD4A 5IKCA 2WUBH 3KVDD 2WPGA 2J43A 1KJVA 3Q48A 5FWRA 3OV6A 4P2OB 1N26A 3LH8A 3BZ5A 3MNZA 2EEFA 4WO4A 4WUKH 3VFMB 4D7BA 5B8CC 1AD9A 4NBXB 5IVXF 2PYFB 4OLWH 4ISVB 2BOCA 3LY6A 5BRZD 2XZQH 2GPZA 4WW1A 4EIZC 1XF5B 4DEPC 1HILA 3I85A 4L1BA 2KZ1B 1UD8A 2NNAB 2OKMA 4YLBA 4XN2A 3U1PA 4F15C 3WMSA 5CZXC 1RIVL 4MA8H 4HIHB 3ZT5A 1OARH 4EKXA 1E6OH 3HE7D 2DDQL 2DQIL 1QKZH 3NN8B 2Q6WB 3O8XC 4FABL 2VDKL 2VJ0A 1JF1A 4WUUE 2VQ1B 3Q6GH 3U1SL 5HGDB 5MENA 3AM8A 5FCUH 3TBBA 4NZ8A 4M5YH 4UM9A 4JG0H 4M6OH 4PLOB 5GS1A 1KSRA 4J1UB 4Y2DB 4OZGB 5I24A 5I66A 2LV4A 3U6XS 4CW1A 1A1NB 1DFBL 3GSNH 3DSFL 2PF6A 1OGTB 2XZCH 4I85A 4QXGH 4FA8A 2VLJE 1I8IB 2QDVA 4KY2A 1U95B 2G2RA 4XXWC 3OJMB 4Y7MA 1EFXB 2IDUA 3CDFA 3ORJA 2BFVH 1JV2B 3O11B 5ENWA 2X42A 1G9ML 1MKFA 2VW6A 3X12B 3HZKA 3TT3L 2NYZA 5IFAL 3JVGA 5AZEL 3U9UA 2HCZX 3PQYD 4R2GD 3QRGL 3O2WH 2V2WA 3TNNA 4PI2A 3RP1A 4ZTOL 3RKPA 3PU7A 4G70B 1ZLVK 3UJTL 3FS9A 5KBLA 2DYSB 2ADIB 3PGFL 1W15A 3WNJA 4G8GE 2XWCA 4P2RE 2Y4SA 1KB9K 3QFJE 3U25A 3CV5A 4WK4B 4BUQA 4ZT1A 4FNRA 4AMWA 2LT9A 3M8OL 4PJBB 4I1PA 4F7CA 2AQ2A 5I1EH 3L8QA 2V4LA 4Z95L 4RAHA 2OCCB 2IH3A 4M9OA 1FNEA 5ITFA 1D7FA 3QDGE 3EYQC 3OR6A 2R27A 1IAKA 3FU9A 5CP3A 3BH9A 3LKQA 5M94B 1IAOB 4RX4A 4UOW0 1KIUA 4F91B 3W1ZA 3LRSB 4YIQA 4GRWF 5DJ0B 4GG6F 2XACC 3FO0H 3BP7A 1WICA 1W72B 4DKTA 3FT2A 5D7IB 4M7ZB 3OQRA 2EYSA 5TQ0H 4HIEB 5TDOA 3DXAB 4JDEA 4A7GF 4OBRA 4NNXB 3ECQA 3ARED 3KPNA 1ETZB 2A9ML 2XA8L 1QSEA 5E2TH 4N1EA 5A6LA 2QPFA 1J0JA 1G7JA 1N5AA 4XBEH 3LN9A 3TIDB 3BT2H 1W8OA 4HX1B 5JA9A 4A2LA 4L0PB 3VXUE 4OCWL 1FSKC 2J8UF 1M4KA 4KTEL 3MUY1 3T1FA 1QHOA 1MCSA 1RUML 3UAJA 1N12A 2HX9A 2J1KA 4KK8C 1CDCA 4MMXA 4AYSA 4D0BB 4P59L 2BVOB 3FW6A 2BIOA 2DQCH 4PN6A 4HUWA 4WENB 4UTBH 5D1XE 2JQAA 4Y16B 3P69A 3PREA 4KTGA 3FU5A 2CRYA 2B0SL 1BX2B 2XWBB 3IJSB 1G6RB 2R69H 3C9NA 3NFSL 3VDAA 2FATL 3GEWB 2UWEE 4G8IB 5EMYA 3SD2A 4ELKB 4ZMTA 2R8SL 5AD0A 1F45A 4JFDA 2NY1C 4WNQA 1DJIA 3QR0A 1ZT4A 3MR9A 2BNQE 1YUKB 2F2HA 4D8PB 4YHOH 1KCVL 4OLZL 3VH8A 1QNZH 5KJ7E 2WZ5A 4JGNA 4XX1G 4A7GA 3L1EA 3E38A 2FZ3A 3SDYH 3CN0A 1ES0B 4GT0A 2HTKC 3ZN6A 3KPOA 2W9EH 1OLZA 1NAMH 4FHBD 2VAAB 4KROD 4KI5F 4AT6B 5D7LD 4F33A 2XG4A 2UZXB 3QBTB 3B7TA 4LBEB 4PGCB 2VTFA 3GGWA 4EF3A 1GS6X 4MKTA 3VGGA 1WP6A 3C12A 4D3CL 5CJXA 3I6KA 3DROA 5A6IA 4J6RH 1AO7E 1H6UA 2CUMA 2QGDA 2Q8AL 3BMVA 2BP3A 4X99A 4N2LA 2DEYX 2CGRH 2R2BB 4M5SA 4NUGL 4AQAB 1I7TB 3LTVA 1P4IL 3K3QA 5IK3A 3MRQB 4PWKA 3E2HB 3W39B 2X6CA 4TNGA 1CXIA 4AKPA 2G9HA 1FZKB 5GZOC 3ZK0A 1B9KA 4GSUA 3WFDL 2VSCA 4GBXC 5EN3A 5GSRB 3MBED 4QHNB 3ZTJG 5EZIH 1PEZA 2VN6A 4G11A 5TE7H 4ELDA 4G80A 1TR7A 4LIQH 4NQEA 4ZO8A 3VD7A 4DAGH 3T08A 1ZLSH 3VWKA 4LHUG 2MTAA 1QTYT 3F7VB 2VITA 3U36A 3MCYA 2O5XH 1S46A 1M3IA 1X5KA 3IMSA 2OYLA 2Y3NA 3G3LA 1O6SB 4NPKA 5PCYA 3VCLB 1ADWA 2WBJB 1U8QA 5TE6L 4MNQD 4NUMA 3VXRB 1T0NA 3W0WE 4PLJC 2AJVH 2XPZA 2B59B 4EPSA 4H1LA 4Z3EA 5LHDA 2X88A 4H7VA 5LVEA 4XPGH 2BP0B 5EN2B 4HLEA 2ZX8A 3MDJA 4Q6KA 3H56A 4YHIA 5E0FA 1WUZA 4IKKA 3RVXC 3FQWB 4JFHE 3LD8C 2FSEA 4HPHA 4JRWA 4JHVA 4PGDB 2Y7QA 4XVJH 1CFQA 3QWOA 2ARWA 1Q90A 4JN2A 3RWIB 5F9OH 2OXGA 2A6DB 3VI4F 3MLPA 2OK0L 4MJJA 3QH3B 4KNSA 4CMMB 4GXVH 1IGJA 2BSSA 2L7EA 4P57B 3KPRD 5HHNB 3CN3A 3GT6A 3QEQD 1TENA 2GTQA 3CDZB 3PS6A 5FYKE 3V6OC 3K2UL 4R9HA 5IWLC 1ZIBA 3A6BH 3J7HA 1A6PA 5DT1L 3JWOL 1Y18A 2XWTB 3FOMA 3LQZB 3DX8A 2HT3D 4U1SA 4U1MA 3VFTA 4HOXA 3DX7B 1R6VA 3B2DC 4N0UB 3W11D 3FCTA 5C0EA 1XGZA 2EE9A 4Y5YA 4HAGA 2ZUWA 3FQRB 3V4VB 5KBKA 5FO8A 3FRPB 5E4EB 2HJKA 3ES6A 1KENL 2D3LA 4WCYL 3SYAA 3HZVA 4K2UL 4F80A 4P5TD 4PMEA 4KQ0A 3R4RA 2RIKA 1TZOA 4N2AA 2ADFH 1G0DA 3OMIB 3WHXB 2FWUA 2FEDD 3AACA 3O9WC 4Y4FA 3WV0A 5DO2C 3J27A 1C1EL 3ARFB 2EUXA 5HYJB 4LRIA 3WE6B 5HYSA 2VKXA 3MJ9L 5MERB 4PRDB 3H1ZA 4X6EA 4MJID 5ADOH 4U05A 4N8UA 3BJLA 5EUOF 1I1AB 4LZKA 2MNJB 5KUKA 4I18C 4OM0L 1J9RA 2EAEA 4WEEA 1CDUA 1HH9A 3U0PA 1L6XA 3G5YA 1R17A 1U2CA 4QHLB 5DFVC 3ARBA 4AYFB 4OCMC 5DUJA 2WSKA 3EW3B 3MRBB 3QI9C 2RGSA 5C0BA 3E8UL 3VW3L 1XCQA 2HFTA 4FQXC 4XNZB 3FFDA 3BHBB 4MQXD 1CYXA 1E42A 1RFDL 4PJXF 1MW2A 1KFGA 4EXPX 5BZDA 4L5FL 1FO0L 4HPYL 3QXWA 3QC6X 4G3YH 1LQBC 2BWIA 3IBEA 3BAEL 4FI8A 3UL4A 3VU1A 1N68A 1DQLL 1MHHA 4P46C 3VFVA 3CVDA 4DVBB 4UU9A 4YHPB 1A1MB 3FQTB 4WSKA 1WFUA 4TRPH 1KIQA 2AJYL 2GSIB 1HQRB 1VAHA 4H8WL 5I76B 1FVEB 4GIAA 5JHMA 4OQTH 4XXCA 5CEXA 4AG4H 4I5BB 3EJZC 4HK0B 4P2QB 1OW0C 3EYUL 5FOJA 1ZANL 3PUCA 4DK3A 3MLRL 1EXGA 1U42A 4K5LA 3QUYB 5F7BA 3QC5X 5IQNA 3VXMA 1IU1A 3GMQB 3IEAA 4KKNA 4JFYB 2V2XA 3MOAH 5KVDH 3HUJF 1U2YA 1CGWA 4AGLA 1DUZB 4JPKL 4X80L 3P3YA 5D71H 4GSQA 1KTLA 1BQUA 3G5VA 3GBMH 3A4AA 3HG2A 3MCLL 4GW4A 3ZQ9A 1M7IA 1TCRA 5F1OB 3BXNB 1AQDA 1FFTB 4R90H 1MWAL 4L2YA 1B4LA 3KDMA 1SHMA 2AV7B 3CUPB 3LPFA 2CGZA 2LTQC 4U6HA 3D4GA 2YGNA 4YL9A 1QSZA 1PPIA 1HSAA 2B2XL 3HLAB 1FZOB 3L2NA 4KJWC 3VUAA 5IOKA 1IBHA 2YMOA 1F56A 3D3VE 3NEEA 4B27A 3GM0A 4Z6AT 2BFGA 2K6ZA 4AVIA 5FHBL 3HC3L 1TQVA 3O4LD 1H3WM 1LJMA 5KYYA 4DTGH 2A5UA 2WOYA 2XKUA 4TLTA 2Y69B 4I48B 3O3UN 4UIMB 1GXEA 4XCCH 5LGHL 4YFLI 4U1IA 4NYLA 5KANI 1GY1A 4NNYA 4NO0A 3ZY7A 4DCQB 3F2LA 2C3HA 1Y07A 2VL4A 1FCGA 1PJWA 3RIAK 3B1TA 3QJHB 3UTZA 1A7OL 3HUJA 4Y9EA 5DYOA 3RWCB 1CL7H 1MVYA 4LPCA 3P0YL 4XN8A 5TQ2L 4DGVL 2WIMA 2UVEA 2RCSH 1I9IL 3FB7B 3S37H 4YHZH 4P07A 2C9SA 3P0VL 3L9YA 2WJ7A 2VMCA 4L8CA 3MBXL 4PJIE 4PJAE 1ZWIB 2GJPA 4E9YA 2VDMH 2JKXA 3NH7H 4QRRB 2X44D 1EV2E 4B3VA 4F8QA 5MEQA 2WTRA 3GLZA 3B9DA 2Q7YA 5E6RB 1Y7VA 4HFUH 1GGBL 1PYWB 5C0AA 4DVRH 2Y06H 4LEBA 4OD3L 5DJ2B 4L0YA 1N19A 2WHVA 5AOIA 4UQ9A 1FRGH 4CN4A 2GTZA 1R33A 3OZ9L 1TO4A 1ASOA 1YMMA 1WZ1H 2ATPB 5CINL 3VFNA 1U41A 2FJUB 1MJ7L 5F8QC 2QKIA 3RYMA 2NY0B 3BSZH 3QUMB 1A7PL 4HXBH 3TNMA 1MG2C 2YOAA 1P7HL 1EHLH 3DDGA 2AJXH 25C8L 4R83A 4GUOA 2IWFA 1WG3A 1CVSC 3LQAC 3I9GL 3N1MC 3IGAB 1U8OA 1J1XH 4N26A 2M83A 2Z9TA 2GI0A 1E5UI 3BSHA 3KPPA 1CC3A 3TBCA 3FYIB 3CIAA 4PTTA 1I9JH 4X42A 3DIVA 4UQ3B 2UYLB 4IRJB 3M88A 4U6VH 4JVUA 4N5UA 5GPRA 4KV5F 2BSRA 4HU8A 2ZKWA 1MRDH 1HN1A 4AEIH 1XV8A 3IKCA 1E4KA 1PAZA 5BV7C 5IW1A 5BMFL 5T3ZH 3WIHH 1PZ3A 4CC4A 1ANUA 4JQVC 5FHAL 2ZUUA 3ET9F 3IKKA 4X0KA 1QWNA 3QQDA 1EIBA 1H0DA 3KWTA 2IGFH 3WO4C 4DETA 2BX5A 3MLTB 3QDJE 5I15L 3ZE2E 2A6IA 2EINB 3WFEH 1A0QL 1BD2E 2YPKA 4LP8A 5DMGD 1V7NL 2F68X 1KJ3H 4POYA 4HQQH 2FRGP 4P9HC 5KAQF 4XCNB 4GO9A 4KXDA 4F2FA 4P5KA 2GCYA 3MPCA 4KKBD 4NUQA 2EDHA 1T89A 3B2XA 5E8NA 2NXZD 1LDPL 4APXB 1ZGLA 2W8CA 3DV6B 1K5NA 2C8NA 3PWPB 3V8OA 2H32H 3AU1B 4P8QA 2LFEA 4Z7WF 1KJ2A 4P4KD 4HIIB 3ZE1E 2IMNA 3CSPA 2IXQB 1CICB 8FABB 1HL8A 3K8MA 5F3HA 3MRCB 1RUKH 1A6TB 3VXSB 4QRQB 3OPUA 4W4OC 3WS6C 5AOZA 2CNYA 5I1KL 2CO7B 1JJUA 4LVOB 1E43A 1EANA 5C0CB 2KLTA 5HVHB 4W6YB 3G04B 4OLYH 1KBVA 1OWWA 4APQD 4OJFL 3T6WA 3U7WH 1MZYA 4XP4H 4ZUTA 1ECYA 2QTVA 3OLGA 5F0JB 2OJEA 3T6ZA 1JRHH 2YLKA 2LU4A 1U8MA 5ABDE 3GI8H 2W65B 3BW9B 2OCJA 4HJ0D 1CD8A 4F7MA 4NKDA 5DQJA 5C09E 2Z93A 3HZYB 4J3SA 2EIEA 3U46A 3IXTA 4O00A 5T8IA 5DMKB 2WNWA 2YMXH 5TE4H 1S9XB 4GSDL 1LYQA 1TMQA 1NOAA 5LNDA 3D05A 2JJSA 4FQQA 5AB1A 3UAAA 4PRIB 2A6KB 2OJZH 3P3RA 2CUAA 3PGCB 5DTFA 5E4IA 4MCYA 5GS2H 1QI4A 5IBLD 1V3LA 4G6AC 1NPUA 4J3XA 5C7XH 3G08B 5H35B 3VFRB 3SPJA 4HUVA 3FQUA 4WU5B 3QUZD 1KC5H 3BO8A 1L4IA 3DSNA 2FCBA 3AS1A 3U2SB 3G9VA 4OD1H 1IKOP 3SDAD 4U1HA 3QIWA 4UT6H 5A2FA 4S11A 1E28A 3OKDA 4IRSA 4K3EH 2B4CC 3R18A 2WO2B 3PGDB 3NAAH 4FXKA 4DERA 1D9KD 1XSIA 2Q2EB 5IJKC 1QVOB 3H7BB 4PGEB 1MPAL 4MQ7A 4KMQA 1L5GB 3RAJL 4LOFA 1RERA 4DGWC 2WWKO 5ECJE 5J1AA 2VDQH 3KPQA 3VXPA 2ZCKL 1JZ7A 1PY0A 2B1AL 2OMUA 3TH4T 3DV4A 5DEJA 3L5XH 3GRWA 2ARJB 1OZTG 3DTXB 2I25N 4NZDA 1AGBA 2B9BA 3CZSA 2JCWA 2JB6A 3CFCH 2NY2C 3FAXA 2ZZUT 1JZGA 3P30L 5DRZA 4E9WA 1D2OA 4FFTA 3GTTA 3PAZA 2Y1AA 1Y0LA 1Z1WA 2YD1A 4PB9L 3DUUB 2UXFA 1CJYA 4ODVL 4PJDE 3T77B 4U0RC 3SY0A 1E2WA 2APWA 3HPLA 4OCRH 4A7QA 4WI0B 1DBJH 4WVRA 2EZ0D 3TZVC 1FHGA 2ZWNA 3BVDB 4RFNC 4X5XA 3X1BA 2ADYA 1Q9OB 3EZ8A 1MLBB 3B5TA 2IDCA 3WN5B 3TEZA 2D7PA 2AXWA 2L04A 2H8PB 1V8HA 3CX2A 3SCMA 2FT8A 4DUXA 2IPKB 4PG9B 2BNUA 5KTEL 3RFZA 3MV8E 1HEHC 1JL8A 3LKNB 2JCCA 1N18A 3UO1L 3UTTB 4JQIH 4NHCL 4TLKA 1XT5A 3A23A 4IBLT 3KH3A 4ODWB 3TN0A 1LD9B 2WNXA 3RDTA 4M1DH 2MCAA 4M7JL 1B4TA 3ULVE 3C2AH 1VFAA 2G4EA 1RJYA 5DRXB 1UB5A 4PJEB 3BDYH 1M42A 3Q44A 3X14B 2CK0H 4LLMB 2ZCLH 5AUMA 4L8SA 1F8TH 1FGVH 3RJOA 4FFZL 2P8PA 4J3OH 5CKAA 2OSXA 2FWLB 2WZAA 1SYVA 3SDCD 3H0TB 3L3HB 4NGHH 1DVFD 1F86A 3GI9H 3OF6D 1IT9H 3DURA 3EFDH 2XQBH 1QPPA 2X4SA 2K8QA 1BG9A 1LEIA 1TJGH 2DIAA 4CJ0A 5CD5D 3J8F7 1WBXA 2A9BA 2HLAA 1L9SA 4LNRB 2R9HD 5A2IH 2DD8H 1VPOH 4OB5H 3HAEH 4LLUA 3MJ7B 4PRHD 4RA3A 4X98A 4HJEA 1E6OL 2IQAB 2UUDK 2V5SA 1QKZL 4NSKB 5SWSE 2X4QA 3L2MA 1ZGLP 5IW3A 1UOVA 4XT1C 2NSXA 1AKPA 3ILDA 5FPIA 3SKMA 2VXTH 5FV2A 3FCUB 1GPOH 1YY9C 4MWFB 1M3JA 4QJ4B 3BGFC 3MRKB 1O7VA 4JKPL 4IK6A 4MCZB 2WXPA 3G6DH 3GSNL 2ZJSH 5IR1A 2XZCL 4PB0H 1M56B 3QK0A 2MCMA 1I1FA 3DO3A 5C2UB 2DYPD 4BFEA 1R34A 2VRQA 4ZMNA 1OAKL 2HP4A 1I8LA 4H40A 3QRBA 1MCNA 4J8RB 5L4JA 1AJ7L 2CRMA 3ROOA 3U1QA 4HW6A 4NJAH 4AV4A 4NS0A 1EBAA 4ENEC 3D12B 2YPLE 2WXRA 1DL7L 4AIEA 4IBVA 4CC1A 5CZKA 2E6JA 4IOFD 4ONFL 2ZKHL 1CE1L 1KXQA 3Q3GB 3NCYP 2WNGA 2H2SD 1OLLA 1WS7A 1BJ1H 2PCPB 1JFHA 2ITDB 4KY1H 4RGOL 3OKNB 2L4OA 3S3SA 4Y2LA 3QWRA 4QRUA 1KOAA 2QEJA 3GMPA 1QSFD 3NSXA 4P2CG 3MRDB 2XKNA 1UC6A 4UMGA 4M4RB 1JZEA 2NUTB 4PY7A 3SJVE 1ET5A 2OR7A 4ZUUB 5IVXE 5ANME 4AWJC 2FJGB 3MRHB 1NGPL 1NJ9B 5KS9B 1K72A 1ACXA 2OTPA 3UTQB 2F5AL 3B3IA 4YDVA 1A3RL 1PU0A 5GGVH 3V9CA 3FO9B 2G3XA 3SGKC 4F2ME 1NCGA 5JORB 2Y7SA 4H8PA 3MV7B 1T0OA 2V37A 4JPIA 5I5RA 3QE5A 1OAUL 4ZO7A 1MFNA 3V0EA 1CGTA 1ZSHA 1FVDB 2VXQA 3FSWA 5D4HA 4KMTL 3IFLH 1F4YH 3UO8B 4GAJH 3CDCA 4YPJA 4FC3E 4AIXA 4CVXB 4BKLA 3BIKA 5ISZB 4EI0A 3AWGA 1LK2A 3IT8D 4NQDD 1PZSA 5AVYB 3BQVA 1CR9L 1OP3K 4XC1H 2Y25A 4ORGB 1I4FA 3KXFA 3IN2A 4XHQA 3JWNC 2OSWA 3SDXE 3D0AA 2VDNL 1JF5A 2NNXA 1UT2A 1CPUA 3D0LB 2VLRE 2ZOUA 4RDBA 1MQKL 4IBWA 1FH5L 3ZMNA 4B0MM 3FHQA 3FUDA 4N0YH 2HFFB 2LR4A 1UD6A 5I5JA 2X0UA 1NC4D 4FOMA 4RA0C 3D18B 4ZUWB 1E8ZA 2R69L 1HYSD 3QA3A 1UQSB 4WV1A 5T1LB 3CFMA 1FH2A 4LVEA 4Z76A 2C3VA 4U6YB 4UV7H 5DS8B 2UZIL 4LP5A 4OGXL 1QBBA 3GSWB 3ROLB 1Y6KR 2CBTA 2X10A 2A9DA 3OKOA 2WLJA 4E41E 4XNQA 4PH8A 4MAUL 5FYLE 1H15B 2YAHA 1LO5A 1O0VA 1XAKA 1NGZA 1FBIH 3B2UD 1MVUA 4QO1A 2XVGA 1A4KB 4R7DA 2Z65C 1PKQA 1DBBH 5L8LB 2AMGA 4N86A 1CLOL 3T65B 5KBPA 1NAMA 1MFUA 2OM5A 4GKNB 4NDMB 4RMQA 3ZLQC 5TD4A 3GBDA 3NG5A 4IGBC 5H4ZA 1B0RA 1A64A 3G6JF 2EH8L 5F1NA 2Z91A 5GS3A 1JWUB 3NZSA 1SOQA 2Y6SC 3LQAH 5E08L 1TZAA 4J6RL 2EIMB 4JKKA 1VGEH 1USZA 4U1NB 4N2BA 4MX7A 4YX2L 3VACA 1AQKL 1UUNA 1QWUA 1JTOA 3AQZA 1CD0A 2MH4A 2JTDA 5B1AB 2FYYB 3BWSA 2OULB 3I6GB 3KWXA 4L3ED 2OFQA 5BV7H 1UWGL 2ZX7A 4LDOB 3U7YL 1D5MA 4PVMA 3MREA 3VMOA 1QLFA 2VR3A 3ELQA 3L3OA 4AENB 1GIGH 3O3BA 4RLDA 1T1ZB 4NO3B 5EZIL 3FAWA 3ATDA 2WW8A 1UKTA 1BQSA 2BRQA 4ZS6D 1FAIH 3DRTA 3FH5A 4FMKA 4HUUA 5CM1A 3MV9D 2O5XL 1KV7A 5DC2A 1X4ZA 4U2YA 3I74A 1OAYL 4P9HH 4RDQF 1MIEH 5C07D 5TK4A 3IJHB 4G42A 2AJVL 2XETA 1QI3A 5EUKA 3BKJH 5L6YL 4ELMB 2BLFA 1SF5A 4E0RA 3WKPA 4LL4A 1C16B 3TURA 2IH1A 2ZNXA 3VGBA 4A2FA 1LNUA 3W3BA 1NCBL 4Y1AA 2K4AA 5I26A 3T2PA 4PRBA 1RUAH 1MW1A 4X50A 1JPTL 4I0PA 4IS6B 3L7EB 1TIUA 1AYRA 2WVTA 3CNKA 3GBNH 2P52A 4QDGA 1QP1A 1R3HA 4ZSOB 3QHTC 2VE6A 4EN3C 5A7BA 2CJTA 1G0XA 2PP9A 3UIZA 4DK5A 4GXVL 4OCSL 5E94A 4ZPVB 1IAII 2N7SA 4KI5E 1U93B 4JO5A 1T6WA 3O6LL 3UADA 1KLGA 4PJFF 1ZA6B 5ESQA 3DUSA 3SQBA 2HG5A 1DJWA 3NZ8B 3C60B 2LAAA 3RL2B 3VFMA 2CO3A 2CHZA 1K3ZA 1DSFL 5DZPA 2PYFA 5IQ7L 1UT9A 2ZCHL 1PBYA 3UAEA 4M8RA 5D96C 1XF5A 1JZFA 3HZ3A 2NX5D 2NNAA 4ZX3A 4MXWH 5JIHA 1RAMA 5I6MA 4HIHA 2C4FT 1QRNE 3WNNA 3NBNA 2ADFL 2YRBA 3L45A 3NN8A 3V52L 4QOKD 4J2QA 2Q6WA 3WKYA 2VLKD 2QJDA 3W82A 3GSQB 1N6UA 4JRYE 4DGIH 5LXVA 3DX2A 2PNDA 2VQ1A 5HGDA 2KT6A 3BUPA 1SJHB 1CN4A 4K71C 3RY6C 3EDJA 4YVNA 4PW4A 3RNQB 4FTVB 4AW7A 3L3DB 3Q7JA 1EZUA 4OZGA 1BIHA 1UXWB 3C6LD 2PKDA 1KCUL 2HH0L 1A1NA 1YEFL 3NJXA 4Y4HD 4JFFE 5J6GB 4M1GH 3SE4A 2IADB 1K5WA 4PJFA 1QEXA 4YNYA 5D7KE 3T0EC 2XHNA 5E9DB 2B4CH 4DPRA 5D7IF 2F19L 4EDWH 3R0MA 5ADPL 3HJEA 5HDLA 4JKMA 1JV2A 2QGEA 3GK8L 3O11A 4QD2E 4LOUC 2GK0B 4N2MA 1BZOA 1NGXB 4MXVF 3X12A 3VI4E 3ASOB 4PHXA 3W38A 3A4FA 1P84J 3REVB 3CX5K 4GKZB 1W8NA 2BNRD 1NL0H 2YUZA 3EF4A 5E1HB 3ULUC 2F8XC 4LQFH 5I1GL 1N0XH 5F7DB 2ADIA 3C8KB 4DP4X 1A7RH 1JI2A 3WJLC 2XN9D 15C8H 2J55A 3Q2WA 3FU6A 4H25B 4LRNH 3WY1A 2NW2B 3GIZL 1M7DB 1SEBB 4PJBA 3WCYA 2VISB 3EH4B 2K9UA 4Y4KC 4D9QD 1KB5B 2OMYB 1I3RB 4BZ2L 1BQLH 4L5FE 4ONOA 5LBSL 3TEYA 4HCRH 2M1KA 3EBIA 5D6DC 2YO3A 3HE7B 3IYLW 4HXAL 4YBHA 5KVDL 4LCUB 4RAUB 1SZNA 1IAOA 3L13A 3RTLA 2QV4A 1ZHBA 2OZ4H 2WKOA 3LRSA 1RUPH 5DJ0A 4GAGL 2ZQKA 1EEQA 1G7HB 1Q9KB 5D7IA 2RH0A 1I53A 5GS0C 1AZRA 4NO5A 3WUZA 3CFTA 1GJWA 1JZ8A 3RG1C 3DXAA 3S5ZA 2R0ZL 4HMDA 4P2OC 4NNXA 5EUOE 4HH9A 5K59F 3FTXA 4Q56A 4F57H 4KKCC 3SPVB 4EEEA 2V0AA 2NNCA 2RALA 3HNTH 4HX1A 4JVPA 4G6JH 2XG5B 4S1RH 1EAPB 1URZA 4EUPG 4AK2A 1F58H 4OCXL 1JXKA 3NTCH 2X9WA 1DBAH 2DICA 4XMPH 3GDCA 2C9PA 2YD6A 4E5XG 4R2GB 4D0BA 1BYPA 4PJXE 4DN4H 2PTUA 1GY2A 2BHFA 3FT1A 4TNWK 4WHTB 3N0AA 5I1AA 4G43B 4Y16A 5BO1L 1OAQL 1KCRH 5LG6A 2XWBA 3X11A 1BX2A 1P7QB 1NCTA 1G6RA 1HU8A 3GINA 3HVDA 3IJSA 5TFSL 1GOHA 2ENQA 2PP8A 2LU5A 4G8IA 4Y2DC 1OCOB 3B3BA 1A25A 3DX6B 4UM9D 4G6FD 3T8VA 4D9LL 3NJNA 5T5NG 1V05A 3OD3A 4TQ8A 5LLIC 1IX2A 4YHZL 4D8PA 1RPQA 4IW4C 1NGQH 1FGNH 1JNNL 3TGXA 4OGAD 5B7EA 4ZQTA 3HG5A 2DI7A 3E1F1 3EDDA 3FU8A 1ES0A 1SOXA 2WLYA 2UV3A 3U82B 1QBLL 1XIWB 2RMNA 5EOCH 4OZIB 4BM7A 4ANUA 2VAAA 5CBEB 4AT6A 3X3FH 3B9KD 4DVRL 2Y06L 5C2BL 2OTWB 4LBEA 2CZNA 1XTMA 1FDLH 2VMDA 4PGCA 3ILQC 1AGFB 3A67H 2JI2A 3ARDA 2CM6A 3AREB 4ZOBA 1HVXA 2HPOA 4G83A 1WZ1L 4XAKD 1NM9A 5EULV 2B14A 3EJUA 4JMXA 2NY5C 2R2BA 4AQAA 4TQPA 4PM1A 3TBVB 5JUEH 3BSZL 1FV1A 1ACYH 4LB8A 2FD6H 1YQVL 4ZTEA 4WNSA 3CVIH 1HWWA 1S2EA 2QSTA 1BZ7A 2EKSB 1AHWB 1YECH 3MRQA 2AJXL 4K9EC 4LHUB 3FMGH 3W39A 3FT3B 1RZFH 1J88A 4JO3L 1XMWA 4FEMA 2IDQA 3BN3B 3U6RB 1J1XL 5GSRA 3AT9A 5IHUH 3HN3A 4QHNA 3D2UA 5DUMH 2OMWB 3KBEA 3LYRA 4LCWE 2WXIA 2DQHH 4XO3A 4OSUH 1GYAA 4L97A 1FQ9C 2FQFA 3F7VA 4RX4D 3ML8A 3L9RA 2H3XC 1J8HE 1O6SA 1JK9B 1XGRB 3NVQA 2WBJA 4XCFL 3VCLA 1JERA 3MOBL 4AZ8B 5I9QC 2FO1A 4G72B 3WIHL 3TCLB 1BMWA 4OJDH 3U30C 3VXRA 2KPNA 4AOFA 2CIKB 3P4OB 2B59A 2OYKA 2IGFL 3GWJA 2WWKT 2BP0A 1E5AA 2D7QA 3IDYC 1E30A 5EN2A 4Y2NA 3DBXB 1YPZE 5D2NE 1OIOA 5EO0B 3S3BB 2Q5BA 3FQWA 1MEXH 4WHCA 1E2VA 4N3UA 4PGDA 4NM4L 1KIPB 4OT1L 4EIGB 3RWIA 1GGUA 3G5XB 2CA4A 4OM1L 4ZS7H 2OZNA 1YC8A 3O4OB 5AB2A 2A6DA 1K4CB 2ZXEB 4IBQA 3QH3A 1SXZA 4CMMA 3NJFA 4N22A 1U3YA 4MZ3A 2ARJQ 4P57A 3UAJD 5HHNA 3U83A 1ADQA 3JWNH 4X8GA 4NKIL 3HI6H 1RMFL 1J0HA 4C8XA 1KFAH 4BWTA 5BPPA 3LQZA 3AZUA 4ZD3H 5HHMD 1RP8A 4GXFA 1KGXA 4N0UA 2WB1A 2BK8A 3O6FC 2WZPA 4FFYA 1SN2A 5FUOL 5T3XH 3FQRA 3V4VA 4HS3B 2NUPA 3FRPA 3K8KA 4YSRA 2Y2TA 4GAYB 5BS0D 4JFDD 4LGRB 5IQMA 2WWMC 7CGTA 2IAND 2XZAH 5HI3D 3ETTA 3MBEB 2AK4E 3EJYD 4PYGA 3I6LD 2EEBA 3HMXH 4A7SA 5DC0A 2H9GB 3WHXA 5TDNB 2PPEA 4AYBA 2N56A 3ESOA 3ARFA 5HYJA 1AY1L 3WE6A 1AXSB 4KV5E 2G5RA 3RVTC 3K6DA 5DK3A 5MERA 4PRDA 4EJ1C 5JQIB 1LDSA 3AWEA 4RCAA 2A9CA 1D5BB 1I1AA 4ZFFB 3ZUNC 4HALA 2YMXL 2YXMA 2NYYC 1U3NA 4GRMB 3EOTH 4OV6F 4QHLA 3QQ9D 3NRPA 1UOLA 4AYFA 4V2CB 5DUBB 5F72S 3MRBA 1M05B 2VDRH 1NAKH 4F58L 3IPFA 4YS4A 5IB5A 1E7UA 5ID1B 1LO3H 2P5WB 2P3YA 3BHBA 1BLNB 1ZLEA 5BCAA 2IGLA 3KPRB 5SX4H 2ICWJ 3GXPA 3QEQB 4JM4H 1KXHA 3HI5H 5IEKB 1PW3A 5FM8A 5EU6B 5KSUB 2FHBA 2KQMA 5CNHA 4TTDD 2E5EA 4DVBA 1T2QL 5K9KB 2NY6C 1CBJA 4YDZA 3PFQA 5KJRH 2GSIA 1HQRA 2YQGA 2Z7YA 1UWYA 1FVEA 5I76A 5EOQL 3VA2C 1MI5E 4WWPA 2YLHA 4I5BA 3ERXA 4HK0A 4N2FA 4P2QA 4Z7VB 5CHNB 4R26H 4EI5C 2V2TA 3QUYA 1I7UA 3MLXL 1JN6B 5AVVB 4ZMOA 3GMQA 1XCXA 1ETA1 4JFYA 3HS0B 3FFCA 1EEYB 1BEYH 1S9WB 2A1WL 3P11H 4QTIH 4J3OF 3P77A 3SYOA 4BDVB 3AGWA 3CWGA 4QWWC 3HJ0A 4FN0A 1QZNA 1K6QH 5E6UB 4OTXL 2NNFA 3S8WA 4UNVA 1PVHA 3M86A 3BP5B 3BXNA 3S3CB 5GGTA 3LIZH 2JJTA 5IQOA 1EXUB 4F9PA 4RRPA 4XP9L 1F3DH 3TJEL 3BDXA 1R3LB 4JM2C 3CUPA 4ZODA 5ANHA 4S0SD 4G5AA 1TVHB 3U9WA 1FZOA 3MLWL 4F7EB 1TEGA 1BVZA 1DVZA 3FUIA 5DWUH 4PJ8C 1L0PA 3V4UH 3HRPA 4KZEH 4NQTA 4LPYA 1SHXA 1JCKA 1WZLA 2YRLA 2AC0A 3KVPA 4XHJD 4FFWC 2EE0A 5JHBA 3KPSD 4GMSL 5IY5B 5I6XC 1GOFA 2CDEB 4I48A 3B5HA 3S34H 4X5RA 1K85A 3APNA 4UIMA 5JA8B 3LEYH 3ETBJ 5F9DC 2P5EE 4Y4FD 1S3KH 4ZMPA 5I18L 4K07A 3IXAB 1AS8A 1FP5A 2PCYA 2QL1A 3QJHA 2OAAA 3FSAA 2WNKA 2Z8SA 2VR9A 1H5BB 3WFBH 5AW9B 3IS1X 3GC3A 4POZC 2GIMA 1GOGA 1C5BL 1WFJA 2FO8A 2I60L 4JL2A 1IT9L 2WD0A 3QNZB 2DIEA 3PP4L 3TP4A 1FNGB 1REIA 4YSEA 2FR4B 1SJMA 1YO4A 4I3RL 3WKNA 5LGKA 2IG2H 3VD3A 1WRFA 2CNZA 3VI3E 3NFNB 5JHAA 2TSBA 3FN0H 1ZWIA 3KS0H 3ARBD 3I3DA 4NJ9H 4H1LG 5DQ9B 3DETC 3NK4A 5C0BD 4PJ6A 2RACA 5D1XC 2Z4QB 2NOYA 3DK2A 1FLTX 1SDAB 5DJ2A 5EA0L 3ARGB 4TULH 2EDTA 1CO1A 2QADB 2VXTL 1EO7A 2OL3H 3QJVB 3HFMH 5ITBH 4IDLA 2ATPA 4UT7H 4AMKL 5ABAA 1DQDL 4LLVB 2GBUA 1R4XA 2BZCA 3G6DL 1IILE 5I74B 3RI5F 5L0QC 3QUMA 4WUUB 3UJIH 2XJLA 3QPQC 5L4MA 3UTSE 4YLCA 1OF0A 3ULUH 3JWDL 4X5PA 4AVJA 3ZO9A 5K9QG 1UD3A 4MQSB 1KBWA 4BV1A 1BLIA 3CLFL 4AEHL 4ODHL 3C5SB 1DANT 4PJHE 4L8DB 3VXMD 3WUWG 5IROC 5LGJB 3CG8A 1AH1A 1HH6B 1RL1A 2AANA 2VLJB 4U33A 4UQ3A 1GVIA 1BG1A 2UYLA 2WBKA 4XMKH 4H44C 2DJUA 3RTQB 3OC5A 4MD0B 3V0DA 1D6VH 3CZNA 5EORL 3FHEA 5DEGB 3FQNB 1KWGA 4X4XB 5DF0A 2FH6A 4HS8L 4XPAL 4PS3A 4QR7A 4CVUA 3BQUB 5K5YA 1P5VB 1PG7W 3C75A 3Q8BA 4TL4A 3MLTA 4LEEA 3BE1L 3DVNB 3BYYA 4TUJB 4LPTA 3VSQA 4RH4A 4PIBA 5HYSG 2ZE0A 4RGNE 5GS0H 4DO6A 2YUWA 4P2RB 1K4DB 3TA3D 4TSBH 1M57B 3F6LA 3B2PA 3QFJB 5ALCH 1OP5H 3RX7A 3U0TB 5DLMH 35C8H 1LEKB 4TUOB 2O4EA 3VQMA 1P84K 1JF6A 5E03A 1F2QA 5BW7A 3LS4H 4QJ5B 5CBAB 3DV6A 3PWPA 1OK0A 1JXFA 3AU1A 1F4YL 4IQHA 5AW6B 3I9PA 4HIIA 4NO0D 2W0LA 3HS9A 3T8XB 3QVAA 1JZ5A 2ZWYA 3FU3A 1CICA 2VXUH 8FABA 3WXVH 6CGTA 4NQXB 3MRCA 2CAKA 1IBGH 1A6TA 3VXSA 4QRQA 4WW2C 4X6CF 2C9UA 2PPAA 5JOPD 4FYRA 3LEXB 2BVQB 2CO7A 5LBVA 1II4E 1ZEAH 1IB5A 3ENEA 5LB1A 4MQTB 5C0CA 4AJYV 5D1QA 3G04A 1EUUA 1X5GA 2VDOL 4N0YL 4Q4IA 4NWTL 1MCWM 1I1YA 3HIZA 1DN2A 3S8FB 2EDNA 2KZBA 2XU9A 4ZOCA 2YKKA 3MRNB 3P9WB 3BW9A 3VXUB 4BA0A 4CC0A 1G7MA 3UDWA 4AGOA 5C0AD 4DP7X 2R4SH 1PDKB 2WV3A 3HZYA 4YMPA 4TTGA 2DQGL 3CZGA 2FDBP 2XNAA 5DMKA 2XTJC 1BFVL 2GJ6E 1N7ML 4F5CE 5C3IA 1GHFL 1YMMD 4Y1SA 1NBVH 1VEMA 5I2IB 2WJ5A 7PAZA 4TKWA 2BS8A 1JPSL 1OTSC 3EOBB 4PRIA 1IM3A 3K6FA 5FEBA 2A6KA 3K6SB 3PGCA 4UAOB 4ABQA 2UWEB 3KYOB 1PSKL 4CRPA 2O61B 5ID0B 1FBIL 4Y19D 2I5YH 1QLRB 2IPTH 4XMLL 1XF4B 3T0BA 3G08A 5H35A 2NY5H 2NXZB 3N2JA 3VFRA 1HXYA 4WU5A 1FN4A 4IRJC 4X6BB 4YDNA 2VZ3A 3E6FB 3U2SA 4GNKB 4A39A 2EO1A 4K9EH 4UM8B 3LZQA 2AQ1A 4P4KB 4FULA 1EZVX 3D4CA 1OK8A 3IPBA 1QVOA 3H7BA 4PGEA 1L5GA 1QW8A 4IMKA 5F71A 4DGYH 2EJ1A 2PXYC 2AEQH 3GF8A 5D7SL 3RPKA 4OCYH 4PHZA 1F2XK 3RUGB 4K23H 3I50H 1NQBA 1A6WL 1W72H 2IGTA 2YQ3A 6FABH 1U8NB 4ZXBC 3MRIB 4R7NB 1MDAA 3BRDA 4FQ1H 4IIZA 4YH6A 1AO7B 4APQB 4G6MH 4XX5A 1CLVA 1WEJH 3I2CH 5SV4A 4MLSA 1CDHA 3HHSB 3T77A 3DUUA 4FQCL 2N1KA 1O5PA 3NDYE 4HG4J 4NP9A 3JV4B 5KVGL 2DWSA 1BOGB 1MIEL 1QYGL 3BAWA 5JNYB 5ESAB 1Q9OA 3WN5A 1QLEB 1YMHB 4X6DF 2W0KA 1PLGH 2H8PA 3B7YA 3NSYA 4NAQA 3QQ4B 2IPKA 2X2HA 1KIRB 4BZ1A 3VTAA 2EXWD 2G9KA 3LKNA 5DHVB 5H37A 4FADA 1JTPA 1LM8V 4LIQE 4LVOC 1RUAL 1GGTA 4JNXA 3W0WB 1ASQA 4ODWA 4MYPA 1LD9A 1ZLVH 4JJHA 3TEUA 1WZKA 5G2NA 1NFKA 1D3CA 4NQCD 5KN5B 1JFQH 4X8XA 1HS6A 3SDAB 1FC1A 3QSKB 4I2XE 5DRXA 1MFEL 4PJEA 3NIFF 3X14A 4LLMA 3BISA 1IV8A 1Z0MA 2TRYA 1QBMH 1WD8A 1P5UB 1D9KB 3H0TA 5DI8A 3VB9A 1IFHL 3L3HA 5CR8A 2NDFA 4WJG3 2YQ2A 1ZXKA 1A6UH 3VWJA 3N85L 4Y5VC 3BUBA 2R1WB 2WIIB 1RZQA 4IIQC 1B0GB 1IGFL 3QYCA 4HKZB 4MXWL 5E5LA 4XAWL 4PJCF 4LNRA 3SBWC 1YEJL 1ZLWH 3OSVA 1KYOK 3MJ7A 4NCDA 2IQAA 4ODUB 5T1JA 1KGUA 1Q9WB 4NSKA 4X6DA 5FGSA 4DH2A 2K8MA 1KLUB 5DSCB 3UZEA 4W9IC 3KNBB 4TLSA 2FJHB 3LN4A 3N40F 4K7FB 3ECBB 3OKLB 3FT0A 1OPGL 5C08D 3EZJB 3L4CA 4ZMVA 3ZDYF 4MWFA 5AOJA 3QIWD 3MRKA 4IRSD 4MCZA 1CZ8L 4C56E 3QARA 1GMIA 4M6MH 2ZUTA 5EDXA 5IESL 3QPXH 4RZKA 12E8H 3HC0B 2XYCA 2A0LD 1B6UA 4P4RB 4S1QH 4DPAX 4EDWL 4J8RA 4FHKA 3QJOA 3WJJA 3C08H 1TQCB 3O0LA 4JY5L 4ZYKB 3V7AE 4MRBA 1EUTA 1YSOA 1DBKH 1JHLH 3LPWA 2R56H 3QUXC 2WKLA 3BIAX 1CG9B 1RIHH 2WN2A 4IHOB 4PJCA 3Q3GA 1WWBX 3EHBC 4B50A 2ITDA 3SDCB 3OKNA 1DVFB 1A7BA 1NANH 3F12A 1A7RL 1EAJA 3QDME 4OKVB 4MJ6A 5SWZE 4JB9H 3MRJA 4LRNL 4W9GC 4PV9B 2NUTA 4ZUUA 1T6VN 2R39A 1P6FA 1HEJC 2FJGA 3RZCC 2R0LH 3MRHA 5KS9A 3D7PA 1MW0A 5KAQG 2EEDA 1KJ2L 4FZEH 4PRHB 5HVFB 3UTQA 2HSIA 2R23B 2ZUQC 2B16A 4N9GB 5FLUA 2CBMA 1U3HC 4HJJL 3KJ6L 1TQBC 5JORA 5KVEL 2ATKB 2D9CA 3MV7A 3GRGA 4JPWH 2F7RA 4NM8L 4Z3TA 1UWXK 2QSCL 2A77H 4WJKB 2K6YA 3D07A 1WLHA 2X4PA 5HJ3B 5ICUA 3T04D 3HTLX 4WWKC 4KZCA 2V9RA 5FYJL 1FVDA 5T5FA 4QXTA 1MRCH 3QJRB 4FYQA 1IMHC 3B9EA 4G7VH 1RZGB 5I16B 4J39A 2XXFA 4LPUA 1I9RL 3AY2A 4DJMA 3T0DA 5ISZA 1A7QL 1T6BX 5E6IC 1T7WA 3D39D 2DYPB 3DJSA 4JN1H 4P48A 2HN7B 4CMHC 3K80A 5KVDE 4ORGA 2HB0A 1S9VB 3V4PB 4UI2A 3QIBC 4M02A 4GMTH 3CXDH 4RSYA 2ZYRA 4FZ8H 1BZ9B 3ARXA 2D0GA 3D0LA 4L4TE 4WGVB 5F1IB 4AL8C 5ALBH 1KYDA 2CA3A 5LGYA 5F21B 4XMPL 2HFFA 1J9QA 2IDTA 2PCFB 1OO2A 2VZ1A 4KGJA 3D18A 5E00B 3RGVC 5C6WH 4ZUWA 4N90E 3KEHA 2G3ZA 3QPKA 5T1LA 1UQSA 1JV5B 4KTDL 1NUGA 1QSFB 1TPXB 1KBPA 5DS8A 3NCJL 3ROLA 3GSWA 4HVBA 1R5WB 2UZYB 1ZGLM 4JQXA 3C5ZC 1U8IA 2NY3C 3OKEB 2AHIA 3ZKXC 4QEGA 1H15A 3MA7B 1KXVC 3GSUB 1E6JH 2EXYC 4EOWL 4PVNA 1XSOA 4RWHA 5ABZA 4FNQA 4U1JB 1CK0H 3MBWB 1BJ1J 3J07A 2XCMC 5BOPA 1A4KA 3BSGA 3WGVB 3EJQA 3H55A 2GY5A 3PL6C 4D8OA 4GKNA 1N5YL 4NDMA 3DX9B 2VDLB 1MNUL 2NQ3A 3STLB 2Z64C 4L9LC 4QLWA 1LMKA 4PJAB 1BBDL 3GRWL 1HX0A 1RULL 1T2XA 5GSVB 4QYOB 4YBLB 4D9RD 2Y23A 4FI6A 4NUPA 1NMBH 3U2IA 4BFGA 3MUUA 5B22A 1J0IA 4M3JA 4U1NA 5GHWH 1NGYB 4PS4L 3ZDZB 3MJGX 3QWRD 3SYCA 2ADGB 3I6GA 1GMEA 4NOBA 1TSHA 3KR3L 4V1DD 5JPMB 5EEYA 3MRPB 1UZ6F 5CIPB 5AZ2H 3PNWB 3WTWA 2E9BA 5F6HI 2ENSA 4S10A 3KWWB 4A37A 3SODB 4AENA 1T1ZA 4NO3A 1VCAA 4NUJB 4FYSA 2PTVA 4PRPE 4Z3HA 3BFWA 2EVGA 2Y24A 1V3MA 2YMTA 4W70A 4RMRA 1A2YB 3EH5B 5E1QA 2BSEA 3IRCA 2D2OA 3IJHA 2YA2A 1XL4A 1HSBB 3PABB 4FQIL 3X1FA 4ELMA 2H0FA 4IKLA 4WFGE 3PDDA 4J6IA 1C16A 2R29A 5JYMA 4OGYH 3SOBL 3GHBH 2WYHA 1E5CA 3ESVF 4MS8C 4KJQD 4J23A 4IS6A 3L7EA 4F9LC 3FB8A 3HR5B 1XB6A 4WTZG 4RFOH 5CILH 3WLWD 3WIAA 5LAPA 4HP5A 2C3WA 4ZSOA 2IAMA 1ILSA 3AXIA 4MAZA 1RV6X 4ZTPH 4BK4A 5T3ZE 2PYED 2HT2D 4ZPVA 4HSQA 2X0WA 3S3DB 1U93A 1OD9A 4Z3FA 1CT8B 2BIPA 4MMZC 4F27A 5EU5B 3DJ9A 3GLDA 1IGCL 3C60A 3NA9L 3RL2A 3FB5B 5C0ND 3DJZA 2GW5A 1H9DA 1KPRB 3N1QC 3KGUA 4TQEL 1SVCP 3IMWA 4YZFF 1JNHB 3UH8A 4X9FA 1RJLA 3UGUA 4S1SH 4M1CD 3MUZ1 1OM3H 3TWYA 5L7XH 2OS7A 3ZE1B 1L3NA 1LP9F 1WE5A 3UX9B 4B41A 5F7LB 3HMXL 1FYTA 1QFWH 3OAUH 4MAYB 3RWHB 3BKML 3P9MB 3NGBB 5EPMB 4YDIH 4ZW7A 3V8CA 3ABGA 1QWHA 3MV9B 3GSQA 2BHUA 3PHQB 5HPMB 3R4DA 2D03L 4FD0A 4YN3A 4NZRL 3LZOA 1YLBB 4GLRI 2PWHA 1SJHA 5C07B 1MY7A 4HIPA 2IBZX 5IBUG 1B2WL 2EKJA 4FTVA 3ZHFA 1FE8H 4KVCH 3SD5A 5MENE 1UXWA 3OBAA 5BXFB 1PLAA 4G8FA 3ESNA 4OZHB 5IT2H 5J6GA 1F42A 1E4WL 2HRLA 2IADA 3EOTL 4IBZA 3Q1EA 4JKNA 1WIUA 4NZTL 5E9DA 1EK3A 1DVYA 1NAKL 4LGPB 3DYPA 2ZOTA 1KN2H 1RZKL 4M7KH 5GRJL 3F04A 2GK0A 4N8CH 3OGOE 3UGEA 3ZZQA 4XMVA 4I4WB 1HCYA 3REVA 2DN7A 4GKZA 4R96B 4UIKH 5D7JD 4AEEA 1CU4H 4LL9A 1LP9A 4IEFB 4NRZB 5HI4D 1U8LB 3RGHA 5H2BB 3C8KA 3LHPH 5EO9B 1KGWA 3Q1SH 4P5RA 4AC2A 5DFWH 2NW2A 1M7DA 1SEBA 3AT0A 2MJWA 3EO0B 2VISA 2NX5B 1LGVA 3KCPB 3CHPA 4PCKA 2E56A 1KB5A 2VXQL 3V6ZB 3ZDXF 4Z7UF 2OMYA 2DQJH 4XPHL 1XGPB 3VSUA 2VR6A 3HE7A 4X9GA 4Y1AD 4WNJA 4XPFH 3QS2A 3WDJA 4Z7NB 2EECA 4OF3A 4HD9A 5D5MF 4RAUA 2WM0A 5CJ5A 4XOCA 3QZBA 5FM4A 5L8KB 4CSZA 2HRPH 3OL2A 1HXMB 3LZFH 1QFUH 3GTNA 3FTSA 1G7HA 2OI9B 1Q9KA 2HA1A 3LIZL 1TJXA 2FECL 2NQCA 5LG1A 2F53A 3QQ3B 3L3JB 5I1DB 2ZKXA 1MCOH 5EBGA 4ZAKC 1IZJA 3TO4A 4BFBD 4EUPB 1A21A 3KEDA 3L5WB 4KTYA 4TM9A 5FGCE 4FXGC 1G9MC 4PV1C 3SPVA 3ZHNA 4E5XB 5C6TL 5DYFA 2KLSA 1KG0B 1QSEE 2DJSA 1EAPA 2J57A 4P5MB 2V9TA 4Y88A 5SX5H 2I27N 1IEAB 4WFFE 3A4DA 3RX8A 2YD0A 1RZJH 1N64L 3N44B 2YS4A 1YNTF 3CQQA 3LEYL 1AACA 4WHTA 3EF7A 4ZFQA 2UX7A 3PNRB 4G43A 3T2NL 1NCIA 4M5ZH 1P7QA 2X4UB 4XO4A 3FO1B 3AUWB 3DKHA 5B38B 1M9SA 3V6OE 3MXWL 1C8PA 1PCXA 5D8JL 4OLEA 1FPTH 4U1LB 1MHEB 3MRMB 4KK9C 1O6TA 5JR1H 4EBQL 5F89A 3BX7C 1U9KA 1OVZA 1T03L 2NCMA 4Z0BL 2AJZB 4L4VA 5FUZL 2QVTA 1ZCRA 4QRPE 1MCFA 2MMXA 2IBGA 2PO6C 5JDJA 4NENB 2JI3A 4LMQE 1B9ZA 1XIWA 1IC7L 4HK3N 4L4JA 5EU7C 1XR9B 2COVD 1HL9A 2NCEA 5CBEA 4Q9BA 2VABB 1EJFA 2AERT 4LLDB 4MTMA 5DWPA 4JKWA 3F7YB 1JGLH 3RX9A 1AGFA 5DMJB 5IVZB 4AQ1B 1KPUB 1UM6L 1Z9SA 2RFXB 1MIMH 2FBOJ 3MVSA 2A74C 4HEPG 5SWSB 2MHAB 1BYOA 2BP8B 4H88L 2K0RA 4OQ1A 3T0VA 1KCKA 1M2OA 4XNBA 3TBVA 5K1VA 1J1PL 3QAQA 5E99H 2EIBA 4O02H 4HYTB 2CKBB 4LHUA 1OTTD 2RA1A 4JAMB 2Z8WC 2YXFA 3H9SA 3FT3A 1IC1A 4BUGA 1LO4L 5G4NA 3U6RA 1CFNA 1I85C 5FCSH 4ADJA 1WIPA 3LXUX 1SXBA 1AR1D 4UANA 2FBJH 5E8DH 2OMWA 5J3HD 1X5MA 1AXTH 2X89A 3K0YA 3KL3A 3L1OL 4XMKL 2AEPL 4XC3L 5F2FA 3CN1A 4OVVA 4NN5C 3UC0L 1J5OH 1E4XI 3QG7L 4PJ7F 1JCVA 4NQEE 3IM1A 4RDQG 1D6VL 1MJUH 1JK9A 1XGRA 2FX9H 4GAAA 3ZL4L 4AZ8A 1GRWA 5D4JA 1L7TL 2YAMA 4G6FB 3TCLA 5JOEA 1DJYA 4NC1E 2DB8A 5AW5B 2CIKA 1NCCL 2G60L 2YPLB 3DK0A 3ZRFC 4CW1B 3DXAD 4KRNA 3HE6B 3DBXA 3HHRB 4YO0B 4LSTH 5EO0A 2UX6A 1KY7A 1EHAA 4WWID 1AG6A 1T5WA 3F7KA 3V7AG 4AUJA 3KJ4B 1KIPA 4XWOD 3B43A 3G5XA 4GKOA 1N6QL 1X4YA 1K4CA 4ANVA 3SJVB 1MFBL 5IVXB 5D1ZA 4R2GC 4UZUA 3B9KB 4Q6IB 3QIUB 4KXZI 4S1DD 3ZMEA 1E90A 2DWYA 3A4EA 4DP5X 3DX1A 5I73B 5SV3A 5MEPB 4XP1H 1ZDSA 1MJ8L 3O6KL 1AFVL 1TETL 3L7FA 4YDKH 2V2WB 4YHKH 4AL8H 4F2MB 2QVMA 1CS6A 4Y16D 4OIBA 5KSAB 3KLHD 2DH2A 2VXUL 5JZ7D 5CD3B 1R19A 1FLRL 4RISH 4BK5A 1KYFA 5CZXD 3NJVA 5DZAA 4F93B 4PJ7A 3PWUB 1UYWL 3N43F 4P3CH 5I0VA 4F7CB 4UNTA 3TCTA 3CVHB 3OAZK 2BMKB 2X1PA 2BC4A 2ZICA 4ZZFA 1BF8A 1JGVL 4XH2B 5EU3B 4YDJB 4CDGC 2J12B 3CZJA 4F7TB 3FUFA 2H9GA 1XZWA 2J7LA 2ZWSA 2L7QA 3MACL 3D8MA 3OR6B 5TDNA 5BQDA 4ZW6A 1MW3A 1JZ3A 4M93C 1FJ1B 1AXSA 1G4RA 3UC2A 1TEYA 2MQ3A 4B5ZA 4X2UA 5JHDE 2VLRB 4W4NA 2VLLB 1DZBA 1MRFH 3AREC 1D5BA 4B6ZA 1ZV5A 2N59A 3ZTNH 3SZ6A 4ZFFA 1QAWA 1D6EB 3ARDD 5IBTH 2A99A 4BXVA 5AYUH 3IFNL 4GRMA 3CN4A 5KUMA 2XICA 3VGAC 5DUBA 2VR8A 1AHWC 2WAQA 1G7JB 1N5AB 2ZPKL 3MLUL 4WIQA 5B1JA 1Q1JL 3GS4A 4YXLH 5ID1A 4GO8A 2I5YL 1J1OH 2VSMB 3L3IB 2IPTL 3LKSB 1HOCB 4JM0A 3V7MA 2ODIA 2P5WA 3JWOC 3LRMA 4CSTA 1BLNA 3W9DB 5C0BE 3G9AB 4PCTA 5D70H 4ZNEE 4E41B 5C0GB 1E27B 4JK0D 3NZHH 1PCSA 2XPYA 5TDPA 2J5WA 3D2UD 2CIIB 5EU6A 5KSUA 4QI3A 5K9QI 3QHFH 4HF5L 3STZB 1HI6B 5K9KA 1RURH 2FNWA 2OV0A 3P0GB 1W0YT 2EE2A 2WBJD 3QUGA 2UUDH 5C0RH 3AY4C 3VXRD 5CSZB 1YEDB 1ZA3B 5E7BA 5BS0B 3NCBB 4GRWB 4MB5A 1MVFA 4JFDB 1W72L 4Z7VA 4GG6B 1HKLL 5CHNA 3F64A 2IANB 1KT2B 3ARWA 4X6CE 4BSVB 3A5VA 3WD5L 1F18A 2CBOA 2ITCA 4KMLB 1JN6A 4HFWB 2XWRA 3UPCA 3BAXA 2FZ3B 1SGKA 1EEYA 1S9WA 2JF1A 3HS0A 4BDVA 3O2DH 3O4OC 4KROC 1TT6A 5JQ6L 1ND0B 4I9WE 1D5ZA 2N0MA 3VFWB 4UINL 5DVLA 2EVHA 4PUBL 1UEYA 4CBZA 2WXQA 3BP5A 4YR6B 1TQTA 1HHJB 5IG7B 2CWRA 2J8UB 3BH8A 1AR2A 3GGWB 3BZFB 1EXUA 4BELD 1JPGB 4F1SA 1A3LL 1CMOA 5JHLH 1N0LB 1R3LA 2B08A 1B0IA 1M71B 3WSQH 3DROB 1OSZB 5DHXB 5DK0B 1TVHA 3SGJC 3RRQA 2Y5EA 3S35L 3S97C 3MLZH 4QXWA 1HZHH 5E2UH 1CXFA 3UXFA 1ACZA 2CXKA 3D08A 4WHYH 2V8LA 4I87A 1ITCA 1UACH 2BSBA 2ZOLB 2WZPD 2E7LA 1VCBC 1AGEB 1VHPA 1G6RL 5IK3B 3TV3H 2QQNL 2C4FU 4XNXH 3MBEC 3MKKA 2EILB 3TM6A 3KYKL 5KYXA 2CDEA 2XC8A 1JFQL 4LAQH 2R1YB 3BPNB 3CSFA 3MNWB 1AANA 2E47A 5KVGE 5AAWC 3WN6A 4H8WC 4G80B 2DJ4A 3OHMB 1UWEH 3MI6A 2W0FB 3DBSA 5GGQH 3IXAA 1P9MA 4EZLA 3DWTA 5HYJD 1G1KA 1YNLH 1BYNA 1D5IH 1H5BA 1U8QB 1K8DB 2CRZA 2E3VA 2CMRL 2WBWB 1TJIH 2ZOWA 3TYGH 4KX7A 1AI1L 4ZO9A 4IJ3C 3CU1A 4JZJC 4H1LB 3CLEL 3K91A 3QNZA 4KK5D 2WBXA 1I1AD 2HTKD 2I26N 1TTRA 1GJUA 5GIRB 2CXGA 4Y8DC 4UT9H 1I1RA 1KN4H 2B8OT 5DD5H 2W0PA 4LOEA 1ZJAA 2XXGA 3NFNA 1LO2L 3QXAB 2X1WL 2H0PA 4ZMLA 4GRLA 4ZFOA 2YD2A 3E80A 4KDTA 4JN2B 5DQ9A 2XXMB 3LPOA 3VNZA 3T4YB 1OL0A 2HZHA 5JPNC 4R8WL 4N24A 5F1SA 2YWYA 1GR7A 2E9WA 2W9DH 2WQVA 1FUNA 2F8IA 4JFOB 3ARSA 3UPRA 1IGJB 1J86A 1SQMA 3ARGA 1OP3H 1ZHLB 1J0YA 2CR3A 3AC0A 3HC2A 3WEAA 5I1IH 2VC2B 5IHZB 2HT3C 4AQEB 3AMLA 1QRNB 1VKXB 3M1BB 1QPKA 2F61A 4TSCL 1ODUA 3FOMB 1PKOA 5J11B 4KKLD 3PYCA 3MU3A 5GZOD 2O5NA 2JNZA 4WUUA 3WUWB 1CGSL 4TF4A 1SY6A 3P02A 3QPXL 4P5TC 4XNDA 3ZKNC 4U6XA 4YLQT 4ZX4A 2A38A 2YA0A 4P2QD 2EXSA 4UV4L 1MCKA 3KPSB 2NNRA 4OF8A 1A6VL 2YSSA 2DWTA 1N2RB 2FEDC 1RIVH 3QUYD 2AEIT 3QAZC 1F3DJ 2J6EA 3L4XA 3H6AA 4L8DA 5DZLA 5AW8B 5LGJA 1HH6A 2DDQH 2PPCA 2VLJA 2X9YA 5D9SB 3FFCD 5I8CB 1CLYH 2GB2A 3HRZB 3INUL 3DDFA 3RTQA 2VDKH 4OIAA 4MD0A 4FABH 1WH0A 1WV7T 3OXSB 3SQOH 1Q0XL 3U1SH 3SKOA 3MV01 1N6VA 3JYBA 5DEGA 3FQNA 1B88A 4X4XA 4XGZB 3RJDA 3WE1A 1DYZA 1CFSB 3BQUA 2EC9T 1P5VA 2FL5A 2MQGA 2YGOA 3VI4B 4UILL 1DFBH 1NMCB 1FFPB 2H6OA 1ADQL 3DSFH 2EDLA 3DVNA 1S7QB 4TUJA 5J12C 4BFNA 2IVFC 2ZUXA 4PJGE 3FHAA 1JDCA 2VJ8A 3EYFA 4G8GA 4P2RA 1K4DA 4BWWA 4MQXC 3QFJA 3BUIA 3D52A 3U0TA 4QLRA 4WF7A 2VH5L 1XCQB 4FFYL 4TUOA 1LEKA 5JO5A 3FO2B 3VQ2C 3V4VL 5BZDB 1G9MH 2XQ0A 4AXWB 4LGSB 1X5XA 3TT3H 1GSKA 5IFAH 5AZEH 2DM3A 5DD6B 5CBAA 3VFGL 3QRGH 1EWHA 1F4WH 1Z3GL 3QDGA 2ZF8A 4YSPA 4QMEA 3UIYA 3T8XA 3UJTH 2ICEC 4UU9B 5I1JL 5INDB 3PGFH 3QT2A 4Y7OC 1P1VA 4J3OD 4CN6A 4NQXA 5M95B 1S78D 4KPHL 1MFCH 3BAIA 3M8OH 2VXSL 2WO3B 2VLME 1Q0EA 3HA0A 3LEXA 2BVQA 4Z95H 1WUNT 1Y1UA 1ZLUK 4XWGL 5D2LE 1RVFL 1ZKAA 3K6NA 3NPZB 3VXMB 5EUOB 3RWFB 5FYJE 1FNAA 3CHXA 5AKVA 4YXKL 1GGCH 4Y9CA 2V2XB 2OTUA 3KWVA 4P49A 1F6LL 3MLSH 4GP5B 2YQBA 2BVTA 5LNEA 4BKTC 3MRNA 4M4PA 3VXUA 3RBSA 3HN5A 1PD6A 4P23C 1TCRB 3SKNB 2DWEB 2AJUH 3K71B 1PDKA 2C9QA 3GDBA 2A4ZA 2W5PA 2QPDB 4PJXB 1IARB 2F1EA 4KNTA 3GXTA 4ZQKA 3SO3B 1OCWL 3K4ZA 2XA8H 5I2IA 3ZE0F 3AADB 4HUMB 3FCGA 2ZG3A 2FLBT 3EOBA 4GUQA 2NY0D 3EBHA 1JWMB 2H6UA 2OP4L 3TA3B 4ZMAT 2UWEA 1WWAX 2O61A 4OCWH 5ID0A 1IZKA 1QLRA 1CK0L 1YYLL 1XF4A 4KTEH 4QJ3B 4DKFL 5KYYB 1RUMH 3FULA 1INEL 3ABZA 4NWUL 2DIBA 2JB5L 2OBGA 4HKJB 4X6BA 3E6FA 3OPZL 4XOEA 3LEVL 3MGTB 1RUQL 4P59H 1DN0A 2ZWKA 2H1XA 2HLEB 4Y5XC 4UM8A 4P4KA 4K3DL 2DBJA 4TPRL 3EJZD 3QEGL 5GRWA 3NFSH 5CO1A 1IKNC 2FATH 3H2PA 3HUJB 4A6YB 3CXHJ 3RUGA 2R8SH 1IGYA 1BQ5A 1G4MA 4PFEA 5IV2A 3HPJB 5GGTL 2V8MA 1U8NA 1KCVH 2MNWA 3MRIA 4R7NA 4OLZH 4WW2F 4A68A 1PZ2A 1DQML 4WY7L 5KBMA 2DH3A 3MMEA 4J3OG 4APQA 1AO7A 1NIDA 3OAYH 5CCKL 2V6HA 4U4BA 3VG9B 4K7PH 4C58B 1SMOA 2GG1A 2OYPA 4L92A 1VSCA 4WRLA 1JYNA 2O6CA 1KCLA 3LRHA 5I0DA 1O75A 5CEZL 4J4PA 2V7NB 4JZOA 3MUGB 5DMYA 4N4YB 1UCBH 4U2ZA 1BOGA 3IMVA 2X87A 1MFAL 2ETWA 3HAEG 3PWPD 5JNYA 5ESAA 3S96B 4EO5A 1YMMB 5DJZA 2Q8AH 2JJVA 3BPOC 2GC7C 1MXDA 2A2QT 4NUGH 2XVKA 3BKCL 3TNMB 4NZJA 1P4IH 4Y19B 2ZNWA 4HWUA 3S37X 3VXSD 3W0WA 4GOSA 1S5HB 3QORC 3T6QC 4YC2C 3WFDH 1U8OB 5KN5A 4XXDB 1TITA 1EQWA 5D1QD 2Y5QA 1YDPB 1GKEA 5D2NB 5HBBA 5HI5D 4H5SB 1UURA 4CADB 4P5SA 4NPJA 5L2KE 4TUKL 2BSRB 2ED7A 1P5UA 2YSTA 3FF7A 4IBSA 4JGUA 1DP0A 1NIFA 4GI8A 4NRYB 5IW1B 1GYWA 4WEMB 1RZPA 4P3WA 1XX9C 3UTPE 2R1WA 4M8VA 2WIIA 5E6YA 3U48A 4KZ0A 5DJYB 4RRPM 5DMGC 2X6VA 1B0GA 1DTUA 4HKZA 3RHWK 3ZHLA 4XN1A 5L7XL 4PRID 1IM3D 1KCWA 4KKBC 1HEZA 3JWNE 4BFFA 5F9WC 1P7BA 1ERNA 4ODUA 4RZCB 3C6SA 1T1WB 1Q9WA 2NXZC 2X38A 3Q2LA 5J1TC 4P5KB 1KLUA 3JT2A 4KRPD 5DSCA 2OK0H 1XGYL 4URTB 3KNBA 3S3PA 4YEFA 4K7FA 3II1A 3ECBA 3OKLA 4XNYH 3ZKMC 2A9NL 3ATBA 2AQTA 3V5HA 2MKWA 1J5CA 1JGDB 2AK4B 3LKOB 6TAAA 2I9LB 2YBRB 3CXFA 3JWOH 5DT1H 1INDH 5E1AA 3U9PL 5AQ0A 4RNRB 4X9BA 3CFJB 4YSCA 4HJIA 3SDDC 2Y72A 4L37B 1U8PB 3FYEB 3HC0A 2XUWA 1UOWA 4K2UH 4P4RA 1TVDA 1JBJA 2PWEA 4NQCB 1T22B 4X4ZA 3ECVA 3TTSA 3CFBB 2XBZA 4ZYKA 1IE4A 4JPVH 2OMTB 4BFIB 3H3KA 5HHPA 4CNIA 4ZUTB 3B2VL 4B97A 1CG9A 1C1EH 1WD9A 5EF2A 3VVWA 4GP4B 1SJXA 4IHOA 3T9WA 5AVSB 2WSPA 1LILA 3EIFA 1OZUA 3SDCA 2CHXA 1DVFA 4KUZH 4ZMXA 4BYHA 4OKVA 4X4ME 2EDOA 2QELA 3Q1SL 1UA6L 3H4FA 3IXTB 3R19A 4PV9A 4UQ2B 4OM0H 2TSAA 4G1MB 5C97A 2DMKA 5ECGA 3FPXA 1SF3A 2Q3XA 4FQQB 5IBLC 4U7SA 1AZZC 4LK4A 4N5ED 1OF2B 1CD9B 1BFTA 4FG2A 5DEFB 4DEWA 5LBGA 4Z7WB 2R23A 4N9GA 2X3BA 4FQJL 5ACMA 1WT5A 3E8UH 4U3CA 2OW6A 3QUZC 1N3NB 4LU5H 3VW3H 1JIBA 2ATKA 1UM5L 1MI5B 1J18A 3SDAC 1RFDH 3LH2L 3NJHA 2HRPL 5C08B 2WLHA 1PZBA 5HJ3A 2Z92B 3ZT6A 1WFNA 3U4BH 5AAPA 3BAEH 3N42F 2G30A 2PABA 1D9KC 1YUHB 4L3CB 5B3JE 1KGYE 4YDMA 1MCOL 2UXVA 2X12A 5GRYA 1RIUL 1WAPA 1PEWA 1RZGA 4FXKB 3TH3T 5I16A 4QXUL 5I71C 4UOZA 1ID2A 2AJYH 3TA4D 4H8WH 2A4EA 1NOLA 2QSVA 4BZYA 4DQAA 3ZIYA 1V54B 2CU9A 2MTPA 2K3HA 2HN7A 4RMVA 3E6HA 3VXPB 3VWJD 1S9VA 3OVUB 3EYUH 5GZNA 1NSNL 1ZANH 3IN0A 4HC1A 3V4PA 3DV4B 4PJIF 4AQ8C 1E4HA 1BZ9A 3KXFE 3QB7C 1YN7A 2LU3A 3KG5A 2DKUA 5CF3A 2JMRA 4MRCA 5IB2B 2XWEA 2PCFA 4KZDL 3ABKB 1Z2KA 3D3VA 5J13B 1PX4A 2CRIA 43CAA 3MCLH 5J6SA 5E00A 1J8KA 2QBWA 5DZNA 3IB4A 1ZJBA 4WI8A 2EZ0C 3WKML 3CU7A 43C9B 1UCTA 1MCLA 2X2IA 1JV5A 3VG0L 4OLVL 1DE4B 4FERA 1QSFA 3LV3B 3IDMB 4XO5A 2V9QA 1J9SA 1QBAA 1JMXA 1QI5A 1R5WA 2UZYA 2X7LB 5JR1L 2P5EB 4F2EA 2B2XH 4KX8A 4ZNCD 1WBYB 3GUTB 3RFZB 2BNUB 3MA7A 4L8BB 2H0JA 3ZDXE 3GSUA 4X9YA 4Z7UE 3WNIA 4FQLL 4OW6A 2HTLD 3K5SA 2JV6A 4M62L 1DANU 3MBWA 3HC3H 5FHBH 5A2LH 2AAVA 4R0LA 4W9CC 4B7LA 4D7PA 5JXEA 2FX8L 2V5TA 4OZ4B 5D5ME 3BZ4A 4CBPA 2E76C 2VR4A 3DX9A 3STLA 5LGHH 1VFAB 1ECZA 1PKQE 1XF2B 4PJIA 3S6CA 4PJAA 4JFEE 5HYQB 5AOKA 4GSRA 5GSVA 3SGEH 3LPPA 1R3KB 1A7OH 2O6DA 4MDJB 1SYVB 3BVWA 3V0JA 3D39B 1NGYA 5B21A 2RAMA 1U33A 1PZUB 1NLBL 3P0YH 1HINL 5TQ2H 3GLAA 3V5DB 5CD5C 1GZHC 3DURB 4K73A 1I9IH 2ADGA 3Q13A 3ZE2F 1E5BA 5JPMA 2VN4A 2ZX6A 4FG6C 4GFTB 3MRPA 2R9HC 4H4NA 4RBPK 5CIPA 2AKRB 4M7LL 3X3GL 4B9YA 2V7HB 2V3FA 1QX1A 1ZVYA 2N7BA 3UACA 2HLAB 3KWWA 5JW5B 4TNFA 3T0EE 3TESA 4W9FC 2DIJA 3MRRB 2W81C 5E8DL 3OM3B 4NUJA 3TPKA 1EZVY 5HHQB 4BZ1L 4XMUA 3MLYH 1OEZW 3MV7D 1J5OL 3Q5TA 2AXGB 1GGBH 1IBDA 2EQDA 3DVIA 4OD3H