2X53A

Structure of the phage p2 baseplate in its activated conformation with sr
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
263
structure length
263
Chain Sequence
b'TIKNFTFFSPNSTEFPVGSNNDGKLYMMLTGMDYRTIRRKDWSSPLNTALNVQYTNTSIIAGGRYFELLNETVALKGDSVNYIHANIDLTQTANPVSLSAETANNSNGVDINNGSGVLKVCFDIVTTSGTGVTSTKPIVQTSTLDSISVNDMTVSGSIDVPVQTLTVEAGNGLQLQLTKKNNDLVIVRFFGSVSNIQKGWNMSGTWVDRPFRPAAVQSLVGHFAGRDTSFHIDINPNGSITWWGANIDKTPIATRGNGSYFIK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ORF16
publication title Structure of Lactococcal Phage P2 Baseplate and its Mechanism of Activation.
pubmed doi rcsb
source organism Lactococcus phage p2
molecule tags Viral protein
total genus 56
structure length 263
sequence length 263
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R
ec nomenclature
pdb deposition date 2010-02-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1830 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2x53A02
2.60.520.10 Mainly Beta Sandwich Triple-stranded beta-helix Phage fibre proteins 2x53A01
4HEPA 4RGAA 4IOSA 3U6XA 3DA0A 4RGGA 2F0CA 3HG0A 2X53A 2WZPA 3D8MA 2BSDA 4HEMA 3EJCA 4L92A 4L99A 4L9BA 1ZRUA 2BSEA 4L97A
chains in the Genus database with same CATH superfamily
5JOPD 5GS3A 5CLTA 3QPQC 3WXVH 1NUGA 2OX5B 4K8RC 1MQKH 3P1VA 1U3YA 4B9ZA 2HRPL 2DH2A 1B0GA 1JMXA 4D9RD 1NIAA 4UINL 3WGVB 4FD0A 1BQLL 1UJ3A 1IBGH 4JO3L 5D96B 4AV5A 3UPRA 1NMAH 2FGWL 3QRGL 4QRQA 3GMNA 2OYPA 1L3NA 5HGBB 4EUPB 1QW9A 4RSYA 3QZWG 5CN2A 5F96H 1LP9B 5KVFE 3OKNB 1CD0A 2E9IA 3LYRA 4RMVA 2GBVA 1YYMH 4YGVA 3HE6C 2KLTA 1G1YA 3G08B 2B14A 4MKMA 3NK3A 3BIKB 4UYPA 3FPYA 3W1ZA 1UZGA 5GGSY 4U7MA 4NRYA 2BFGA 2WQAA 4L0YA 1RUKH 1PZ5B 1TQBC 3ES6A 4U1HA 1MCRA 3F84A 2C3GA 5CD5C 4O9HL 3MI6A 2CSPA 1EAPB 3WFDL 3LS5L 3VRIA 3LKRA 4NT6B 3AITA 3QYMA 2Y06H 2WBJB 3IJ8A 3IJEA 4N6RB 2MOGA 2JCCF 2C3VB 4X5XA 5CD5D 2X2HA 3L13A 2AQ3A 5F7KC 3A67L 1ZHBA 4Z3TA 3BH9B 3JXAA 1X5GA 1GZHC 2PCPB 1Z0MA 3TYFB 3S34H 3VI3A 5IB3B 4WW2C 3LVTA 5AW8B 2QPSA 1T5XB 3GXNA 5GS1C 1A47A 3ZE1F 2DMBA 4JK0D 2FATH 4LCUA 4Y1TA 3WJJA 2VSMB 3HHRB 5DJZB 4N2CA 1ZTXL 4W9KC 5DMKA 3KL3A 1F8TL 3ZL4L 2QDVA 3WS3A 3W9DA 5E1AA 2IWGA 1I7ZA 4Q4EA 3CVBA 1YQVH 4E5XA 2VLRE 5TK2A 5DTFB 1M7XA 2F58H 2W94A 3UZVA 3HFML 4QHLB 5E99L 2V2TA 4FQXA 2VSDA 4N8VA 3U0WH 1SJEA 3BAXA 4WI7A 1ILUA 4HCFA 1RZKL 1VFAB 4KKLC 3WL9A 1R3HA 1A6VH 2WP3O 4L8SA 3ZJAA 1G9NL 3CVIL 1TZIB 3TO4A 3FUJA 1XD1A 1TEGA 2AGJH 4KKLD 4M5ZH 3VFTA 4YE4H 5CHNB 5HDBF 4XCNB 5D70L 3SB3A 4MXVE 2VDPH 3D07A 3O2DL 3QA3B 5DMYA 3QULB 5EBLA 3FKUS 1N5AA 2X4RA 3QQDB 1Y07A 2FQFA 4L99A 1DTUA 1V3MA 2HJFA 1QNIA 2MPAL 5F9WB 4BZYA 4L8SC 4XO4A 2AZAA 4FQXD 5BVPL 4PJIE 4YVUA 1E9OA 4GO9A 4J6RH 1II4E 3TO4C 1N59A 2AW2A 4JVPA 5L2JB 3F7VB 2VMDA 5KVDL 3NCJL 1U8KA 4OF8A 3CSGA 4QJ3B 2VRAA 4N2DA 2IH3A 2AFNA 3VFPB 3QIBB 4YWGL 1WAAE 1X5IA 4KVNL 4NO0A 3QK0A 3TO4D 3GMLA 1FZMA 1M57B 4DP2X 1JN6A 4N26A 5G5DB 2LR4A 5DWPA 1D9KB 2VMCA 4BGLA 1YDPA 3WO4B 3HNSL 5L9DL 1JRHL 4QHMB 3Q06A 2HMIC 1P7QB 3D25A 1NANH 1XB8A 3IN0A 4K9EL 1JPFB 4KDVA 5C0FA 5JW3H 4EVNA 4YHOL 4KHXH 2WPGA 2L7QA 4HEME 4M61A 4CVZA 3TCLB 1FYHB 3L3OC 4QYOB 1XHHA 3PP4H 2HMID 1ETA1 2WLLB 1EFXB 4AYFA 4M1CD 3VXOA 1XCQB 1CVSC 3EHBC 5TQ2H 3ETSA 1S5HA 4KTEH 3MNWB 1BFVL 4NO0D 4MX7A 4OZFA 5EU3B 2VQTA 2Z31B 2YA1A 4HZLA 2QV4A 1VADA 1QWUA 3EGDA 2XI9A 4P3DB 4WWKC 5TE6H 2FJSA 5C09B 5BMFL 3QFDA 1MNUH 5AW6B 1KGWA 2O5YH 5GRJH 4PJAB 3HRZC 1ADQA 3MXWH 4IMLB 4I87A 3RFZA 2O61B 2FYYA 4LCIL 1QD0A 4Z7NE 1J18A 2AEQL 3DUUB 3NJXA 5E5RB 4Y5XC 1ZGLM 2FR4A 3PJNA 1UWXK 4M7LT 5FA4B 3OLIA 4JG1H 1C16B 6FABL 4LNVA 4Q9CA 1QEWB 3RGBA 3KPPA 3LZLA 3MLZL 2VLKB 4YDLC 4JFPA 2VLRA 4FYTA 4JR9H 4YUEH 5E9DE 4TLSA 1AQDA 4TL5A 4BRJA 3GB7B 2Y1VA 5SV4A 4GRLB 4F8TA 3V0VA 1AYOA 2X70B 5L8JB 3TIDA 2XETA 1T3FB 3D05A 4NAJA 3G9AB 3O4LB 3NJJA 4G9FB 5DRZA 1OAKL 4PJFB 3MRLA 1DBJL 5J11C 1FFQA 3WO3B 1IT9L 1YEDA 3P0GB 5TF0A 3H7BA 1Q9OA 1PG7W 3O3DA 4IKKA 4JDVA 4R7VA 2BVOA 4MZ3A 5EMYA 3KW7A 2X4OB 2VLRD 4HSAC 4X8CA 4AUYA 3SOTA 5DDHA 1XGZA 2P47B 4K2UL 5BRZB 2E7MA 3B5TA 2AABL 5FGCB 4YHYC 1F90H 5GRZA 1BMZA 1DQIA 1GAFH 4XI5C 4MSWB 1IVLA 3DTXA 4X8JA 4FADA 2DDQH 4LVEA 5D1XC 1D5XB 4OZHB 1A14H 5DUBB 1NSNH 4TVSa 4XI5D 2EYRA 2NLJB 1PSKH 4Y2LA 3BT2L 5ADOH 2ROYA 4H0IA 1ZLDA 3N44B 2WHVA 3VNZA 1J5HA 4ZMAT 3D06A 4UM9B 4P9ML 3EYOB 4F2MB 3VFSA 5C0CB 2IQ9L 2ATPB 2NW2B 2H5UA 4LHQB 3FN0L 4WGVB 1WK0A 3ZDYF 3MLYL 1YMHB 4K3DH 2P5PA 1BZQK 3RY4A 2JKSA 2IH9A 2FO8A 4MJ6A 1T2QL 3O0RL 1L5GA 2PWHA 2A74B 2L8AA 2O6DA 5C0GA 2DQHL 1ORSB 1HSAB 1NWPA 1URLA 2CPUA 5JUEL 2ICWJ 3B9VA 2ZP0T 1OSYA 1VDGA 5LUMA 2ZWKA 3UDWA 4L4JA 2OCJA 3AWGA 4P4RB 3GZPA 3BFOA 1NFDB 4GPVA 5IG7A 3QUZB 1N3NB 2CIKA 5D72L 1P4LB 3RUGE 4IKLA 1TJIL 5LAPA 5JDJA 5KS9F 2YWYA 2GJRA 3P11H 1E0OB 1QI4A 1LD9A 1UCBL 5E9DA 3OAUL 1IL1A 2DTMH 1CLVA 1WZMA 5K1JA 4XP9H 1DVFB 4CBZA 4Z5RB 1BAWA 2B5IC 5KSAB 1WC7B 5EO1A 4GEJA 2WMPA 4Q56A 3SCMA 4R3SB 4AYSA 5JZ7C 4QRRB 2WINB 3GGWA 4CN1A 1K2DA 3PDOA 1BSIA 2ADGB 2XWDA 2ZF8A 4NQQA 4HYTB 5JZ7D 4GKZA 4W68A 5L7XH 1KCUH 3D18B 5B3NA 2QL1A 2K4WA 5B1AB 5KTEL 4WKXA 5E9DD 3SCMC 3CN1A 1FNFA 2QEJA 2Z6FA 4XCEA 4GRWH 1CLYH 2ZP8A 1SVBA 3DYPA 4U1LB 3KLHC 4QHKI 5L6YL 1I7UA 3SKJH 3TGXA 3SCMD 3D39B 4DEPB 4NYLA 4NRXA 5I1AA 5F93C 4H1LA 2WQUA 5GGVL 2Y2WA 4PREB 1MCQA 3W0WA 3OHXA 4PWIA 2WYZA 3KLHD 4MAYB 2G5BB 4GUQA 1FIEA 4X7SH 4LL4A 3LH8A 5B21A 5I5MA 5D7KE 1G4RA 1KXVC 2ARJB 3EBIA 1OY3B 1AGDA 2DQEL 3QR0A 5EA0L 3VXSE 5HY9B 4C4KT 3DJ9A 1RVFH 3OLDA 4NS0A 3WLBB 1DBKH 1Y1UA 5IVXB 3Q1SL 4XNZC 2EVFA 1RZ7H 4PJCB 2X2IA 2XQYA 3V4VL 1LE5A 1NC4B 2DM7A 1CPUA 4WU7B 5IGXH 3KGRA 1NCDL 3I9GL 5AFAA 4N24A 2VH5H 1QFPA 4HLEA 4PRAB 2VXTL 4HUXB 1E4JA 1U6AL 3NSYA 3W0WD 1QACA 1ICTA 1QA9B 2FBRA 1ZT1A 1RZGB 1WZAA 2ITEA 2WWNA 1SJXA 1ZE3H 2NY5C 3AWEA 5DD5H 2HB0A 2VITB 1QLRA 2GAZA 3DYOA 3AACA 2HVJB 2DLEA 2ZUUA 3II3A 4PQXA 2R83A 3U2SA 3V52H 5I6LA 5L88L 2W07A 2ALWA 4GIAA 5I1GL 3RWGA 4AKOA 4X7FC 2VDNL 1SMDA 1Q9LB 3MGAA 2ZYHA 1N64H 1D5BA 2R15A 1FFOB 4KJPD 4NJAH 1NDGB 2A73A 4JRXB 1BG1A 1OZTG 5HHMD 2NNCA 5E03A 2VC2B 5DMIL 4EI6B 2KUTA 2IWKA 3NJFA 3S35H 3ARBA 3DNKA 3REVA 3IDGA 4JANB 3LKOB 1S7TB 4ODWA 2O4EA 1VPOH 2VW6A 3NZHL 3NZSA 2BSSA 3O81A 3BXNB 3OBAA 4P2CG 2ICCA 1D5ZB 1LNUA 4ODBD 5AWNL 3RL2B 1FFPA 3ARBC 4IS6B 4FQHB 4OIIL 1AS8A 4BQ6A 4Q97A 1CYGA 4RFNC 1MCPL 3ESUF 3UADA 4TVPD 3ARBD 4JO1L 5HVHB 1ED3B 2DIJA 3FN3A 4MMXA 5B3JF 2ZYSA 2DQJH 4WHYG 3KPNA 5E94B 1MFEL 2AKRB 3QT2A 4C8XA 1HSBA 4C56D 3RE0A 2JELL 2P7TB 4UM8A 3V6BR 3CZKA 3HG2A 5BPPA 2VDPB 5FYKH 4KZ0A 1F6LL 5E56A 1AHMA 4F7PB 1RKRA 3QI9C 4ONHA 4LEBA 4XP4H 3IPFA 1CLZL 1MJ7L 1W0WA 1V7ML 4UDTA 4ONOA 3VMPA 2WYHA 4KUCD 2EVGA 3C9NB 3T3PB 3BH8B 3WV0A 1MIMH 1R5WB 2EACA 1E9QA 1WBYA 3NAAH 3CHQA 1Z9MA 1LWRA 4QRPB 1CFSA 3FT2B 4IDJH 5LNEA 4IYKA 4HXBH 4A2MA 3LEXB 4R7NB 2FO1A 4R4BB 2Z1KA 2EKSA 3TJPA 1G7MA 2VLJE 2QGEA 3X1GA 3JUYA 4S1QH 2C3XA 4Z7QE 5JXEA 5D7KD 4HGWA 3HS0B 1KXQE 3MJ6A 1RIHL 3GBNL 1O0VA 4A6YL 2CHDA 1S78C 4G6JH 4U1JA 3AU1A 5A2AA 2WUCL 1KJMB 2PWDA 1CBVH 4WWNA 4XZ4A 1RUML 4JFVA 2A9MH 1GVIA 1JPGA 3ULUL 3UTZA 1S78D 3FZUC 2EDYA 2OS7A 1UWEH 1CDYA 4WTZG 5DEGB 3DK0A 3WEMA 4H20L 5JQ6H 3NN8A 4IGBB 2KZ1B 3EO1A 3VFOB 4CBPA 1A65A 3F7LA 3HVNA 4YQXL 5C0JB 5JXED 2YQBA 2WBWB 1DO6A 4OAWA 4XPGH 2GQHA 4LEOA 4HUKB 1WFTA 3I50H 3NIGF 3SDDB 5TF1H 2XG5A 3L7EB 5I75C 2EYTA 2DQFB 4LXFA 1AQHA 1QOKA 4MDRA 4PJ5A 1AI1L 1YNTF 2GJ6E 5DYFA 5TH2B 4LL1A 1CT8A 5HHXH 4HKXA 1TQCB 2XTSA 2QFPA 3TPUA 3Q7JA 3IFLH 4KQ3L 1NCBL 4TUJA 4GKSB 2N59A 4GG6E 4LRNH 5I19H 3FQWB 4FQCL 1LEIA 1ORQA 3K3QA 3SE3A 3TBSB 2R59A 3VD3A 3TCTA 1LEKA 2NT1A 4FMVA 3SDYL 4AQAA 4AVJA 1E42A 2VXQA 4A2LA 2GFBB 4PJ5D 2GC7C 2PCFB 2V2WA 1DUZB 1AFVL 3QDME 2UY6A 5GGRB 3RB5A 3VUAA 3KLQA 3DETD 3SE3C 2C9VA 1HC1A 5FM5O 2CUAA 1LMKA 3OZ9L 1GMEA 1HXYB 2O5ZH 5IT2H 3RVUD 4F7MB 2Y4SA 1AP2B 5BRPA 3TVMA 1A21A 4JFYB 2W88A 1YEIL 2VUOA 3DBXA 4G8AC 1AG6A 4OB5L 2A6JA 3OAZH 3IJSB 4QRAA 4FXLA 2OCCB 1NCIA 3HBPA 1D5MA 4YEFA 4I1NB 4PCYA 1NBQA 1IJ9A 1TNNA 5I5IA 1CXHA 2LHAA 2NY6B 3FW6A 2L04A 5MENB 3RWJA 1B4JH 3ROLB 5LWYL 1HZHH 2GTWA 3VD5A 3F01A 2WOBA 2W81C 3I02A 43CAA 2KQNA 5KANI 4XB8A 1DQMH 1H0DB 1NGXA 3R06B 4M7JH 3QJSB 4GUOA 3TVMD 5IREA 4XXCA 4Y19B 1DDHA 4OLYH 5E00A 2AZUA 5JIIA 4OD1H 5E8DL 4M6MH 1SN2A 3T2NL 3BWUC 4U3HA 4JO4L 4UZSA 3P2TA 1DQJB 3MYZA 1AACA 4JPVL 1QQDB 2D31B 1FZKA 4F57H 3F12B 5C3TA 3JTSB 1QPKA 2HG5B 4PRPB 2ITCB 2X09A 4YDVB 2I60H 3MN8A 5DGRA 3E9TA 2EIJB 5BV7L 3SPIA 1RAMA 2ADJA 2OW6A 3BP4A 3JQOB 2WN3A 3HTLX 3MRDA 2QKIA 1AS6A 1GIGL 2F9BT 5JIMA 4NHCL 1E40A 3L4CA 3VCLB 2XOTA 3CBKB 3OC8A 1TJGH 1ETZB 4GXFA 3LRLA 3WMSA 1IKNA 4KK6D 4R96B 2Z92B 3MLUH 1PX3A 2GJ6A 5D5MF 3ZDXE 4QTFA 4TULH 2QKIC 1K5WA 1W80A 3HBGA 5SWQB 4PY8I 1AVAA 3HLKA 1UZ6F 4GG6A 1MCDA 3RDJA 3CLFH 1J1XL 1IKNC 1NBYA 2F7OA 2RBLA 7CGTA 3FFDB 4IHBA 2BHZA 3QH3A 1JAEA 2PP7A 4GXVH 1TCRA 2FLBT 3ZY7A 3WBDA 5DSCB 4YPJA 1AC0A 4Z7UE 5ALBH 2GJ6D 2XZQL 2AXFA 4K5OA 4U1SA 1XF1A 1VCBC 3MRIA 4I9WE 4YBLC 1U92B 4BV1A 3QUHA 1A6ZA 1Q90A 2AQTA 1R3JB 1A2YA 1G7JA 3CQQA 1IC5L 4PY7B 4AYMC 3MOQA 1AD9A 4FFYL 1DCLA 5SWSB 4WHYH 1TQUA 3BRFA 5EZLA 4NQCE 5AQ0A 4XX5A 4XBGA 1I8IA 1DJSA 1TO5A 2NCEA 3JYBA 4WTXA 1QNZL 3EOBB 2FQDA 3DJZA 2OMUB 3R4RA 3K6NA 2OP4H 3O8XB 1OCCB 4XCCH 5JPNA 2XWEA 3CMOL 2QADB 2PWGA 3CLEL 5G4OA 4MQ7A 3QNXB 1REIA 5HYQB 3DV4B 1L7IH 2BRQA 4X80L 5ERWA 2Y7QB 4XNMB 1AQKH 5EU7C 3MA9H 2W80C 2YD4A 4EDXA 1C5BH 3EDFA 4XN8A 4OSUH 3OKLB 1A9EB 2HN7B 3MNDA 5JPNC 2OMVA 3K7UA 2CMRH 3SE4C 4P5MA 1IQWL 2FUTA 4G1MA 3TCXA 4XNDA 2DLIA 3HR5A 1T1ZA 3N9GH 4I1RA 2AVFA 1H19A 1KIPA 1LO4L 3DLQR 1I1FA 5KS9B 1B0RB 1J8SA 1I9JH 1T1XB 3GYRA 5CJOH 1L4IA 5D7HA 1KLFA 4B3VA 4UQ3B 4G8FB 5F89A 8FABA 1ZHNA 1LHZA 4JRYA 3PF2A 4WHTB 1NDMA 4XMPL 4XXDB 5IFHH 1Q94A 4YGAB 3QAZC 3MNVA 4YDMA 5T3XH 2ZCLL 2AJYH 4OF0A 1B4TA 3FOLB 2X4QB 4CSTA 2IV8A 1J0YA 4UAOC 2EIEA 2VZSA 2H6UA 4PS7A 4BKLA 1E6JH 4Q2ZA 2DBJA 3QEQE 2BIIA 4YSSA 1N68A 3E2HB 4G9DA 3BGFB 1AGFB 2EEFA 3US1A 2DOCA 2VUKA 3RL1B 4JRYD 2LU5A 3W11D 4HISA 1KEML 2JB6A 2W0PA 1QFWI 3OG4B 5LGHL 5DHVB 1EV2E 4X98A 1SBSL 2EIZB 3O2VL 3FC8A 5EEVA 5EBWA 1KY6A 4XTRD 5D7LB 3GZOA 4ZO6A 1T80A 3DI2B 2LGNA 3OJDB 2G9HB 2YOCA 4PJ9B 1CFVL 1GCYA 5IK3A 4ZFOA 2YUZA 4D7PA 3K0WA 5GJTL 4Z7VA 3QJZA 3TEZA 2YLKA 5AAWA 1GS8A 2CBMA 2DW5A 5DQDH 1UYWH 3DSFL 1RPQA 3DURA 4PM1A 4UYQA 4ZUUB 3VJ6A 5MP6H 2CBOA 3MOAL 2FJHA 3NSFA 4NQCA 3KYMA 3PXJA 1WGVA 3HMWL 3UGEA 4OZIB 5IQOA 2IPKB 2NSMA 5DJYA 1G9ML 3V7MA 2IPUK 4YDJA 3QQ9C 3U1QA 1P69B 5AEAA 4D8PB 3DGGA 1PLGH 3EW3B 3X11B 4JAMB 5HSFA 5ELIA 4J3UA 4MVBC 1DDTA 3CFEA 3C5XA 4KZEH 1EMTH 4I9WD 1SM3L 4L0ZA 2K3HA 2X1WL 4MXWL 1JGLL 1MHCB 3ZHFA 5DZLA 5IBLD 1Q0XL 4L1SA 5HPOA 4LCWB 1IO4C 1JVOA 2JLPA 4KKQA 5KSBF 1XTMA 3CH1B 4IBZA 4PJDE 3H7LA 2RIKA 3K72B 4NQCD 2IC2A 3WXVL 2VXUH 1JK8A 1UA3A 3K2UH 2A4EA 1MQKL 1G7IA 4Y1AE 5KN5B 3DROB 1S8DB 4YVNA 4GIOA 5DJDA 5L4FA 4MD5A 1F3RB 3PNRB 1ZLSH 2QT6A 2YGQA 1PG7X 1AZUA 3S37X 2MMXA 1HCVA 3K74B 1IBGL 5DHMC 2ZUWA 5JIKA 2JQAA 3CDGB 1NMAL 4KTGA 3RIAK 5CGBA 4L05A 3S3DB 4DZBA 4HUUB 2ZXAA 4GQZA 5ICUA 2Q8AH 5F96L 3RWHB 1M7IB 2MHAA 4JGUA 2QMKA 5LGYA 2R1YB 1YYML 4G80A 1H8OA 5CFHA 1YC8A 3O3AA 3NBNA 2HT4C 3RX9A 3RIKA 4QRUA 3FFCA 3APCA 4D0CB 4I7ZC 4N1EA 2AS5M 1RUKL 3QCTH 5DUPH 3EBGA 3NCYP 3B2DC 1HDMA 2HT4D 3FHEA 4ENEC 4P46B 4ZUWB 4NIYE 5H94B 4U4BA 4FTVE 5AOZA 4OCMC 1S7SB 4KO6A 2Y06L 3BUTA 3GMRA 3C6LB 3EJZC 1ND0B 1NCUA 4ENED 3PE9A 4KRLB 1JZ2A 3G5YA 4S2SB 5M7QA 3CH8A 5E2UH 3GSUA 5GSVB 1QUPA 4JGJA 4LNRA 3S34L 1ZT7A 4FNPA 3S5LG 3C8HA 3FFCD 4D0BB 3DRQA 1AKJB 1S9WB 3L5WB 2FATL 4M93C 4JFDA 3KBPA 2IWFA 3OKMB 2GSGA 4YFDB 1P1VA 1FG2B 3MFFB 3UTTA 4NZ8A 1DFBH 1S5IH 1YEHH 1YQVL 3GHPA 1OWWA 3HAEA 4LHUD 4PV9A 2HLAB 3OQRA 4BQBA 3IMSA 4IRJA 5DD3H 2F58L 4R0LB 1BQUA 1OP9A 4HJ1A 3RPKA 3NSXA 1CFNA 4K3HA 3D52A 3U0WL 1ILSA 2AJZB 1FVDB 4FOMA 1WCBB 1FVEB 2ADFH 1U8NA 4LPXA 1A6VL 4JFDD 3UOAB 1ZEAH 3F05A 1JI1A 2Y24A 4BSVA 4BKSC 4F7CB 5TGBB 1S7XA 1BVOA 3DVIA 5IIEB 2OMTA 3O3BA 2AGJL 4M5ZL 3UTTD 3HG4A 4YE4L 5CAYB 3KYKH 5C0IB 2VDPL 4PJDA 4IRJD 3MA7A 2K8QA 3D08A 1HN1A 2G30A 4HH8A 4AGPA 3ZHNA 1AQMA 3B3BA 4GW1A 3KGUA 2YPVH 4Y1AA 4PJ8A 2H1XA 4J6RL 3X1FA 4RGND 1YY8B 2YN5A 5AVSB 2BH0A 2FJGB 2AQ2A 3NIGB 4JKLA 4AI7A 1NQBA 4FA7B 1K8DA 5LNGA 1WD9A 4GH7B 4P2QB 5EPMB 4URKA 4KQ0A 1J1PH 4PJ8C 5IJCC 3NIDE 3FU8A 4NRZA 1YNTB 5KYUA 3AVEA 4Z78A 5JW3L 4WFFD 3DO7A 2GUYA 3V5DA 4KHXL 3H9SE 1FV1A 2ED6A 4HBCH 4PJ8D 1X6NA 4Y1AD 5DMJB 2FIKA 1UVQA 3PP4L 1QLEH 4G5ZH 2MPVA 1BWMA 3X2QB 4CADA 1B3IA 5TQ2L 4KTEL 3MRGB 1RJZA 1N8ZA 1A7QH 1CLOH 1O9VA 1IILE 5JOEA 3B56A 5CBEA 3STLA 4KRMB 2QR0B 4UOW0 3TP4A 4H13C 5E2WH 1CFTB 5TE6L 2EH8H 1MH5B 1S7UA 1RLBA 5DJ2B 1MNUL 3VFVA 3VVVA 2O5YL 3B2MA 4PWKA 4QHNB 5GRJL 1KCKA 3MXWL 4KK8C 1XGRA 1UZ8B 5F1SA 3U0TB 4H88H 1JZHA 2WQVA 3H9YA 2V17H 3BPNB 3HMXA 5IMMA 4XMVA 2WSKA 3OGCA 3CK0H 4JG1L 2XPYA 5IB5A 2FK9A 3WDIA 3WY1A 4KK8D 5CJ8A 3GI8H 4ANVA 5TDPA 2VM3A 5E1GA 3BCDA 3QJHB 4ZOCA 3REWA 4YUEL 2VN6A 4JR9L 2OZ4H 1QFHA 1XZ0A 2Z7ZA 4GP4B 4ZMTA 1E7VA 1FNLA 3QO1B 2D2CC 3VXNB 5I6PA 1O5PA 1DJYA 1SYSB 1VIWA 4FXKB 2XICA 2ZOUA 5SX5K 3D2UA 3QBTB 4GAYB 1JHKH 2BIHA 4K55A 2GKIA 4PVLA 5ACLA 3ULVH 1M05A 1G0DA 4J7RA 3AREC 4JHBA 2W9LA 1A1OB 1QUNB 2QQNH 4HKZB 5I23A 3LHPH 1DFXA 2EP6A 4NFBA 4PRIB 3HB3C 3KM1A 4G8EB 4RGGA 4ABVA 2J1KA 5BS0B 3I6KB 3LRHA 2JQZA 5JLZB 3Q1EA 1NCGA 3DECA 4HVBA 1KIRB 3SDXE 1BG9A 5D7IA 4FLRA 5KOMC 4XOAA 1ANUA 3HB3D 2X7LA 4F3FA 3D2UD 1YO4A 2JE8A 1PFOA 1F90L 4OD2B 3VDAA 1GAFL 5A2JH 5I6MA 2WWOA 2VDQH 3B2XA 3AXLB 3S6CA 2DDQL 1ZTXE 3LN4B 3VXTB 1SOSA 1I82A 1A14L 1S9XA 1HAWA 3HC0B 1NSNL 4CILA 4N8VG 1ZHLB 5EO0B 5ID1B 1PSKL 5ADOL 1U8IA 3EJYC 2OMWA 5D5MB 5HDLA 3K5RA 3PWUB 3QUXA 3FQXB 3BN9C 4B9PA 5I1DA 3ETBJ 5KVMC 3H9SA 1XD0A 2XXGA 1GC1C 4ISVB 4Y16B 3FO2A 1ZSDA 1Y0LA 1SVZA 4K7FB 3EJYD 3M7FB 4HUWA 1WF5A 4GKOA 1VESA 4RGMC 3CV5A 4HDIB 3APDA 4K3DL 3FCUB 5D7JB 1SXSA 4X0KA 3VFGH 1IFHH 3D69B 3TESA 3QUXC 2JKNA 4XNBA 4K15A 2D3LA 2VJXA 2OMBA 4YL9A 5KANG 2ALAA 5FYJH 4PJGB 4YLQT 2WCGA 2XN2A 4WTQA 3HOGA 3QUXD 3IJHA 4N25A 1ZD6A 4ZMVA 5K59E 2BHYA 2V3FA 5DCCA 2F54E 3N6YA 4PGJA 2OCFD 5KVDE 1JFQH 4JPIA 1EPFA 4M6AA 3BPOB 3EJJX 1JNHA 3GXFA 4Y4FB 3MJWA 2QLYA 4R97C 5MI0C 4P2AA 1XO8A 1KG0A 3P11L 4QHPA 3ME0B 2DTML 5GS0H 2PP9A 4BDVA 4XP9L 1EHKB 4PWEA 2IAMA 4MA8H 4GW5A 4AXWB 4A2FA 3VTMA 1U8QB 5DEJA 1QBMH 3B9KB 3DK2A 1I9IH 1IEAA 5LJYH 4A7SA 2C4FT 4B5EA 2OSLB 3QUKA 3RWIA 5LXGH 5EIIA 3ARGA 3BQUB 4X4KA 1XF4A 3DX4A 4IK7A 5CGMA 2IAMC 4KO7A 5L7XL 1KCUL 5IHZA 2H2SD 3Q9PA 3NVQA 5CKGA 3IF1A 3CSFA 3FB8B 3WHE1 1I1CA 4I3RH 4H8VA 1WZLA 4BHUI 4LT7A 3LY6A 1CLYL 4R2GC 2IAMD 4HIHB 2IDFA 5ETUA 3D3VE 4AM0Q 3SKJL 1BAFH 2GW5A 3QIWA 3GSRB 4GG8B 2ODIA 1FGVH 4DKAA 5B4MC 4R90H 1I31A 1NM9A 2FB4H 3L4XA 3MRJA 4KKPA 4QNPF 4XOCA 3MR9A 4X7SL 3CNKA 4Y7OC 4ACPA 3KWVA 3ZRSA 1AD0B 3QFJE 1RVFL 4DP7X 4JN1H 1DBKL 2CA4A 4IMKA 1NJ9B 1HWHB 1RZ7L 2XN9B 1GKOA 1Q9WB 1QSEA 3LMJH 1A4JB 1KLUB 3ML8A 1VACB 5IGXL 3DX0A 2P43B 5L8LB 2VH5L 3QIWD 2B59A 4HH9A 2NXYC 1JTPA 1ZVSB 4GXUN 4IRZH 3ZVVA 3L4YA 1R5VB 4H8WH 3WIHH 1BZOA 4NKIH 3MNZB 3VI3F 2E7DA 2CK2A 1UATA 1P5UA 3ULSB 4OTXH 3O2DA 5DD5L 4IBYA 1S9VA 5AVQB 5GRWA 2DM3A 1YG9A 3EG9A 4K8RH 3KJ4C 4RGOH 3V52L 3ABZA 2F54A 1J9QA 1QSED 2OTWA 3H3PH 3BVUA 3EH3B 4YSOA 1WISA 5IB2B 4GKNB 1N64L 4ADGA 3GI9H 1P5UC 1H15B 2IH8A 2AQSA 1Z9PA 5DJ8B 4NJAL 3EJPA 5AKVA 1FNGA 1OANA 2WD0A 1UENA 3V6OE 3ZUCA 3MGOA 2NRDA 5AAMA 3S35L 2A9DA 3PWNB 4B53A 3ARQA 1OKEA 1VPOL 4ZPTA 4WI3A 4W6YB 1NGWA 3V4LA 3UJIH 3R4DA 2F54D 2J56A 5DO8A 1KCVH 4FG4A 3RIAF 5AAMC 4CW1A 4LLWB 5C9JB 4BZ2A 4YSQA 1KPVA 4JY6B 4F92B 3UBXA 3HUJB 2P80A 4K9EC 2GJJA 4CDGC 4L0PB 1AXSB 4GUPB 3H8NA 3MV8B 5DHDA 1R3KA 2Z35A 3L7FB 4DN3H 1GJIA 3AWFA 2FT8A 4CSSA 2DQJL 1H3PH 4LRIC 3G5ZB 3MRFB 3R19A 3SGKC 4OGZA 3VM5A 4M03A 4PWJA 4NKOB 5B7MA 5C0AA 1O6TA 4J6IA 3WELA 4X6FB 4RLDA 4CC1A 5FYKL 3CVCA 5LKNA 1PU0A 3SO3B 1JERA 1UD8A 1WUNT 3FCGA 2KZKA 2ZUYA 4XP4L 5EULV 1KDIA 3N40P 2JXMA 1YAZA 3GK8H 3TJEH 3WTUA 2E59A 3CPLB 1GYWA 1JL8A 1A6AB 1MIML 2G0KA 4X5QA 1J0IA 1WFUA 3NAAL 4GMTH 4MJ5A 3SBRA 4NXSA 5ICYB 5EDXA 1N6QH 1VB9A 1CDCA 1V3KA 4L1HA 5IFJB 1J0KA 4IDJL 4NNYB 5J12C 4HXBL 3QDJB 4TPRH 5C0AD 1QSFE 2CNYA 2D4FA 2YEZA 1TLMA 5F8RC 3BZEB 4N5UA 1I1YB 1YQ2A 2AQ1A 2K70A 4S1QL 3FB5B 2F8OA 3WKPA 2MCMA 3IGAB 3FQ1A 2APFA 4F37F 3L3JB 4GYBA 4G6JL 4BZ1H 2XRAH 3AC0A 5L4JA 2AEPH 3Q8CA 5EWIH 3RJDA 4Z7OE 3IDMB 5DVLA 2FEEI 2ZKHH 1CBVL 3F7YB 3IXAA 2YQ2A 1W0VB 2A9ML 2RA1A 4P4KC 4ZX3A 5DWUH 3HNVH 4N9GB 4NBYB 2UV3A 3BVXA 1T21B 1UWEL 3FBQA 4HHAB 5D4JA 3S96A 3VE0A 3BUBA 4GAFB 4PPTA 3MRHA 4YXKH 1I1AC 5JQ6L 2G9KA 4XC1H 2IDSA 4G43B 1IFRA 2NZIA 2YWZA 3ZRCC 4WEBH 1SJHB 4IOIA 4IRSA 5F3HB 1OB0A 1RULH 3OR7A 4XPGL 2QQLH 3I6GB 2WAHA 2ZE0A 1QRNB 1SHWA 3I50L 4TNVK 1Z9OA 1FAKT 2RMNA 4G6FD 5TF1L 3PV6A 2MH4A 2ESVE 2HG0A 4ORGB 4OVVA 1QR1B 3VFMA 2VERA 4MXVF 2GTZA 3FFOA 1PAMA 5KSVB 4AQ1A 3WUZA 2ZWNA 4IRSC 1OPOA 2WXIA 3KPSB 3VRJB 1Z9LA 2OSWA 5HHXL 3AROA 4Z76B 5K1NA 4PJIF 2XTJE 1T4KA 1UEYA 3MV7B 2IQAA 4V2CB 3IFLL 2Z93A 2X4NB 2C9UA 4ABWA 3D7PA 4IRSD 4LRNL 4NX0A 4WZ9A 5I19L 4HG4J 3ZPDA 3K1KC 4HWZB 3SYOA 3VDCA 3QXAA 5HHNA 4AQ1C 1IAKB 1EEYB 1WAAF 4ZUTB 2Z64C 3CFBA 5I1LA 1EANA 2WB7A 1RQ5A 3KWTA 5BOPA 3T0EB 3INUH 4YSAA 3X1BA 4NHUB 3V8OA 2JLLA 2MSPA 2Y5QA 1MJ8H 3RP1A 4PCTA 3LD8B 3S4SG 3MC0A 3LNFA 3FUMA 5IT2L 2UZPA 4WO4B 1SNRA 2O5ZL 2XT1B 3TBYA 1AQ8A 3DJTA 3BP5A 5AOLA 1LQSR 3VXRB 1VFBB 2E7CA 3NEXA 4FFWC 3UX9B 2ZT9C 4L8CB 1TU2B 1EQWA 3MACH 2DQTH 1SOKA 3RX7A 2FLRT 1HWGB 1XIWB 2P5ED 4AYID 2DJMA 4Z0XA 2WVTA 2IALB 1B4JL 4XODA 4Z7NF 1HZHL 3U25A 4X6DE 2DWYA 4Z95H 5FO8A 1DQML 1BYPA 4M3HA 4M7JL 2E6QA 1VSCA 4YHPB 4WUKH 5BXFB 2NNFA 1XX9C 4OLYL 5D1QA 2DH3A 5AYUH 1SEBA 4OD1L 5EU4A 2ZUVA 4L4TD 5TFSH 3RGVA 4M6ML 3RY5A 2KH2B 3R1GH 1YN7B 3KYNA 5F1NB 3S48A 3FO0H 4MMYA 5DO2C 5LAXB 4F57L 1F2XK 4PMEA 5E6IB 3UTQB 4G5AA 3NPSC 2I60L 1A9BA 4P23C 4S11A 5D1QC 2O6EA 5FA3B 2NSQA 4HS8H 3EUUA 3RGVC 2NDFA 3GJFH 4CRPA 1ZA6A 1ZY9A 5JHBA 5A1AA 1HINH 2Q7YB 3ASOB 2X42A 3V4VA 5FXCH 3GPEA 1TJGL 5D1QD 2J21A 5ANMB 4I48A 4JZNB 3RGVD 4PP2B 4PJEA 3MLUL 5JIDA 3EADA 1OT2A 5ESVB 2XKNA 1CICA 4TULL 1HH9A 1U3HA 4YFLF 5ANHA 1A8ZA 2BVEA 4ZS6D 5IWLA 5AENA 5DFWH 3O9WB 4AKQA 3C09B 5I17B 4AKPA 4HS3B 3EF4A 4KUZH 3CLFL 2DF3A 5HJ3A 2HRHA 1PDKA 4UZGA 1IBYA 3UJJH 4AQEA 3GMOB 2VN5A 2UUDH 4O5LH 4PJXA 1U3HC 3SDCA 4GXVL 4LLMB 4Q9BA 1OSZA 3PP3H 4TS6A 5AUMA 4L92A 3P4LA 1XTLA 5ALBL 3G6AA 3NP4A 1JZ7A 1U3HD 3U1SH 1AXTH 1CGYA 4HUCA 5AW0B 1S9KC 1QHOA 2A7BA 3LV3A 1RHFA 1TT6A 1WWCA 2XTJD 3VI4E 2VDRH 3H2PA 2P52A 1TZGH 2CH8A 2PMZA 3FRPG 3QNZB 4W9FC 3DMMC 1ZOXA 4KZCA 1AIFB 5IBTH 4JM4H 1MW0A 2BX5A 1GY1A 1QFWH 2UXGA 2VMJA 1JGDB 2UY7A 3FU0A 1PVHA 2ICWI 3KJ6H 4WFHD 3SDCD 4PLNC 5IUCA 3EYVA 4NLAA 4X4ZA 3DMMD 4FS0A 2OP4L 3PU7A 4XCCL 4AIOA 1IC7H 2WBXA 1JCVA 5E4AA 4RA3A 2WYIA 3IJYA 2OYMA 4FC3E 3PG2A 1L7IL 4HJEA 4LMQE 2ZKMX 4LBAA 4WKZA 1AQKL 1CI5A 3EKCA 3MA9L 4J8QA 4Y9EA 5A16B 3S8FB 2EIBA 1C5BL 5D1ZI 3SGJA 4OSUL 1BP3B 2JI3A 4IHOA 1OOAA 4JZOA 2CMRL 3H85A 1FJ1B 3A4EA 3RA7H 3RUGF 1ESOA 4WGWB 1PBYA 3SN6N 3U9PH 2D7PA 2YPKA 1JGUH 3N9GL 4D9QE 2Y5EA 4R7DB 4LHJB 3EH1A 5F7HA 1YAIA 4ZUVA 1I9JL 2AANA 2V37A 3SGJC 5CJOL 2ZPKH 3G6DH 1TZHA 1N0XH 2BP8A 4KMQA 5T1MA 4Z3EA 5IFHL 1E3XA 3MRRA 3NFSH 3QZBA 5I26A 4DO5A 1NINA 3IS0X 4KRNA 5T3XL 1OCZB 2AJYL 2QKSA 3WEXB 1EK3A 1E5ZA 3L5XH 1OTTC 4IBUA 2ZSWA 2G5UA 3US9A 5F71A 4PRBA 5TE7H 2GIMA 1IKFH 3IWVA 1E6JL 1B0GB 1V3JA 2AHIA 3GEWB 5F21B 2CK0H 4MB4A 5CCGE 2DV6A 1UJ3B 3OTTA 2NY5H 4U6HA 2YLHA 3UPRB 4QRQB 4V33A 2ZG3A 4WK0B 4WRLA 4A6YA 3GMNB 4JZJC 4LU5H 4ZODA 1NPUA 2V2XA 3ZBMA 1KC5H 2CZNA 2H0FA 4YGVB 1G84A 1KB5H 5I28A 2NTFA 3PGCA 1F1DA 2YAQA 4YR6A 4NRYB 4HWEH 4F5CE 4X99A 3ZTJG 2Z0BA 3ES6B 4FLSA 4U1HB 1NFIA 3FSWA 3VI4A 1DVSA 1PL3A 4GSXA 5DQDL 1UYWL 1L7TH 3MXVH 2VAAA 5MP6L 1XR9A 2AXJA 2X6BA 3OX8A 5GRVK 2K6ZA 3LKRB 3VRIB 3ET9F 2APXA 3E80A 4P0DA 3WTTA 3IJEB 4HG4K 4X5XB 3A4AA 2PXYA 3ESOA 2A3TA 4ETQA 4FGMA 2NCMA 1CYWA 1ZHBB 3RKPA 3SBWA 1TYRA 1CBJA 1PLGL 3ULUD 4HEPG 4EDWH 3VI3B 3DJRA 4ZZFA 4TVPH 3Q48A 2ETWA 5C09E 5C92A 4LCUB 4QHUA 4DWHA 2I7SA 1EMTL 4PJAE 2NSXA 3U9UA 4KZEL 5GZOA 2AJVH 2FO4A 5E4IA 5DMKB 3WS3B 3W9DB 5E1AB 2RH0A 5JW4M 1I7ZB 2VR9A 3B7UX 4RZCA 3T8MA 4E5XB 2AQRA 3CU7A 3GMMA 2FBJH 3UZVB 2PXYD 2O6CA 4DUVA 2VXUL 4XOBA 5B8CA 1QVOA 2HJLA 1CVRA 4KI5C 5EC2A 3GIZH 3K2UL 4FQXB 2VLKE 4N8VB 2J55A 1GZPA 1SJEB 3FT3A 4CA4A 3WN6A 4UQIM 3VFWA 1JZ8A 2D7OA 3K46A 1CC3A 3NIFE 3U4EA 3WL9B 1R3HB 1ZLSL 3UERA 4L8SB 4KI5D 3VD1A 2J72A 5GZOD 5GGRY 5TK4A 1VFAA 4G9FE 3TO4B 4PJFE 1NMCB 1H8NA 2Y25A 3VFTB 2K9FB 4F8PA 2E56A 4LQFH 3LJ3A 4Q6KA 4U33A 3TT3H 2Q8AL 2LAAA 3ARYA 3C5JA 5EBLB 2Y22A 5F7MC 1N5AB 3FUNA 4MHHI 2X4RB 3GBMH 4ZOEA 3V7AG 2HJFB 5FYLE 5KG9A 3GM8A 1X5YA 3EFDH 1MREH 2CXKA 2E6PA 1E9OB 1IIKA 1GHFH 1N59B 3N42F 1OD9A 1DJZA 1ACZA 3QCTL 1U8KB 5DUPL 2ERJB 2H0JA 1LVEA 2OMNA 5BRZE 2IH3B 1BDYA 3ZW3A 1NKGA 4NO0B 1PW3A 1LWJA 5FGCE 1J9RA 2ZICA 3GMLB 1FZMB 3QYCA 1JN6B 2DQ6A 1YDPB 4NP4H 2BY1A 5ITFA 2X1QA 1J05A 3D25B 5C0FB 5E2UL 1ITCA 1TG8A 1DANT 2EQDA 4EVNB 2YD7A 2R0LH 5KEZA 3LRSA 4M61B 4ZO7A 4R8WH 4N3TA 1B9KA 3X12A 4CVZB 2QFRA 1L9NA 4AYFB 1ZHKA 3KS0J 4B7IA 2B3RA 3VXOB 4DKFH 1K8IA 3PPEA 5C0CE 4QJ4B 1L6XA 2C4XA 1GOHA 1S5HB 1XF3A 3IFPA 4J3OF 3K8MA 5K39A 5AG9A 1DFBL 4MX7B 1S5IL 4OZFB 1YEHL 4HZLB 3QHZH 2N0MA 3PAUA 1VADB 3H6AA 5DD3L 3ETBF 5DHYA 1IX2A 3EGDB 3V8CA 2JKRM 1QBAA 4LSQH 2IF7A 4PG9A 3C5ZA 3QFDB 4Z7QF 4UQDA 2FLMA 2YSTA 5I6XB 4YDLB 1ZJBA 3RFZB 2FYYB 2ADFL 4B0MB 3J7HA 2VR6A 1ZEAL 2FR4B 5DA0B 1URIA 1MJJA 4JFUA 3IRCA 4JJHA 4AYDC 5C0EA 5FLVA 2NY4C 4NQDA 5DK2A 3CBRA 2WZPD 4R9HA 2P46B 3IU4H 3KPPB 1OF0A 4HPYH 1HX0A 2PCXA 2X4UA 3KYKL 1FO0H 5J11B 4JFPB 2VLRB 2B77A 3NSCA 4IIQC 4TSCH 1AQDB 1NFDE 4OI8A 3B2UD 3C5ZD 3V0VB 5E2VH 4WCYH 4DTGH 3TIDB 3BRDA 4JM2F 2YPVL 4UUJA 4KNUA 1F4XH 2RJMA 2IBZX 3FU6A 5DRZB 5KYXA 3MRLB 4QXTA 1MG3C 5KSUA 5EN2A 1YEDB 4TLKA 2YXWA 2X0VA 4NQDD 3H7BB 1Q9OB 3O3DB 1I3RA 4YHYB 4U0RC 4JDVB 1QZ1A 2VJ0A 2BVOB 4FJZA 4FFYA 3M46A 1J1PL 3MLWH 3N3EA 1A64A 3QFGA 1NFKA 1KIQA 1P4UA 3FF8A 2B39A 4EPSA 2CO1A 2G3XA 1MY5A 5DDHB 4E0RA 4GG6F 3PQYE 3TU6A 1AZVA 4HBCL 2AJ3A 1KTJA 2Y1AA 1XAKA 1R24A 3DDFA 3NJMA 4X7EC 1QLEL 4G5ZL 5KAQF 4WLCA 5F1KC 3BYTA 3DTXB 4HMCA 4X8JB 3RVTC 1OALA 4GT0A 1A7QL 3GSVA 1CLOL 1EDQA 4FI7A 4ZTEA 4JREC 4A2GA 5AB1A 3H4FA 3D39E 1JD9A 4KROC 3RNQA 1O6SA 1GYUA 3OAYK 1KN4H 2EYRB 1U8OA 5E2WL 2EH8L 3QARA 4YSTA 4ZK8A 3VTAA 1AIZA 4BFKA 4P5RA 5SWZA 1WT5C 4KROD 3VFSB 2ENSA 1HEZA 5F0PB 4N9OB 1X9QA 1AANA 5GQBA 1X4XA 1S9YA 3P3SA 4H88L 2V17L 5IVXE 4TTGA 2XFXA 3L3IA 2HKFH 2W65A 3PIQA 4HIJA 4YHZH 5FKAA 3CK0L 2LW3A 2WXPA 1JXJA 3GI8L 4A2EA 5CJ5A 4LO9A 6TAAA 4X5WA 4MJ6B 1CYXA 1EEZA 1UKSA 2K45A 2OZ4L 5AOIA 4J3OC 1L5GB 4TQHA 3AAZA 3QQ4A 1F4AA 5C0GB 1JXFA 1M6OA 4GIPD 4I8DA 3MJ7A 5SWZD 3VGAB 2VDRB 2DY2A 4FZ8H 1JHKL 5FO9A 3ZTJH 4Z7NB 1ZA3A 3ULVL 4LHUG 4ZMXA 3NACH 4AWJC 4JY5H 4OGQC 1EHLH 4OLZH 2YQ3A 1WTGT 3LPWA 4UTAH 5IG7B 2Q87A 2CIKB 2QQNL 3GLZA 5DVOA 3LHPL 3SJVA 2AMGA 3WJMA 1MPAH 2WTOA 1LD9B 1AHWC 1XB3A 1B88A 4JRXE 1A3LH 4QXWA 5E9DB 1IL1B 4ADIA 5C1MB 1MXDA 1FE8H 1AR2A 4UT9A 1GW0A 3CBJB 1E67A 2EDTA 5CZVH 1KCSH 3BVTA 4LSPH 2WMPB 4PHXA 5EO1B 5INCA 3SCMB 3DGDA 2H32H 2JKXA 3CVHA 4RQQA 3ARZA 2VDQL 2JFCA 1R75A 3GGWB 5T1LA 3WS6A 1BJ1H 2PYEE 3NYKA 3PDOB 4M29A 3IBOA 4MFHA 2O30A 4JG0H 2V4LA 3ZDXF 4GKZB 4DP1X 3SJVD 4APQA 5CZRA 3KVDD 3BE1H 3RBGA 4S1DC 4XCEB 5BZDA 2XVGA 3WS6C 5EBMA 1YC7A 3JV4A 1TYJA 3PQYA 1ZJAA 2PO6A 4PGDA 3O6LH 3QJTB 5D6DA 1UWXH 2Y6TE 1I7UB 4NYLB 4NRXB 5I1AB 4H1LB 1OAZH 2ZYRA 3FCBA 3FCSA 4APQC 5T1LD 1A1NA 3W0WB 2LVCA 3OHXB 1P6WA 5DEZA 3FT0A 3VFGL 1GSKA 1IFHL 1KF9B 1WSST 3B37A 2DLTA 3AMLA 4Z7UF 4OVUA 1U21A 4BWTA 1AGDB 2JKIS 2PO6C 2WJ7A 3GZQA 4APQD 1HHIA 1WLHA 3KG5A 1UOWA 2F53A 2X1OA 2FRGP 5FYJL 4BWUA 3K6SA 3OWEA 5T3ZH 4NO2A 4JVWA 1BV8A 1K9TA 1L6ZA 2G5RA 2GITA 3PQYD 2PO6D 1LE5B 4U1IA 5C8JA 3MQIA 3TTYA 3T08A 3T3PE 1JFQL 5BW7C 4TLUA 4QRPE 3N1GC 4X7TA 4UQEA 5HYSA 4CGTA 1ZT1B 1UXSA 4MMZC 3GXMA 2WVVA 4G11A 5J9PA 1VJSA 2FIRT 5J8OA 3OJMB 2DEWX 5E23A 5GS0L 1PAZA 3CN2A 1QLRB 2GAZB 2YEVB 1FFRA 2F53D 4OM1H 1PGRB 1VFMA 4K9JA 5IROA 4MA8L 4Z7IA 1XDTT 4GSUA 2DWDA 3U2SB 4NM4H 1QBML 1UB5A 2W07B 1I9IL 3LZNA 3RWGB 3KDMA 4DP9X 3TF7C 4Z7WE 1Q38A 4RCAA 1SMOA 4AM0A 1FC2D 2CIIA 4JL1A 4AY0A 1D5BB 5LXGL 2Y2TA 3SKUD 3V4UH 3MLTA 2IMMA 1IEBA 2A73B 3T1WA 1B0IA 3RU8H 4HWBH 1FP5A 5JIQA 4PI2A 3L4VA 4L9LC 1PJ9A 2HLFC 3ARBB 2Y23A 1HWWA 5DA4A 3VMNA 4I3RL 3C87A 3REVB 3IDGB 1EO5A 1M9SA 3RHWK 4ODWB 4GBXA 4JS7A 5E95B 5IROD 1E4KA 4AUUA 2BSSB 4RFNB 3IPBA 3VQLA 4BM7A 1I1RA 3K6IA 2HLFD 1BAFL 1LNUB 4QEGA 1FGVL 3KLSA 1MCFA 1Q1PA 4MNHA 2OXHA 1FFPB 3ERXA 2PYEA 4R90L 2FB4L 4FE9A 1E2VA 4EAEA 4CC4A 3M07A 3UAAA 2XUWA 2BZDA 3ESMA 3ECVA 3VG0H 1E4KC 4YBHA 3UYPA 3EGXA 1R34A 2YN3A 2HYMA 3D4YA 1Q72H 4JN1L 4MMXB 2JJVA 4MA7H 3T6QC 4XB7A 5G4MA 3MX0A 4GBXD 4JPKH 3KPNB 1U8PA 2C9AA 4AQ8C 1UT1A 2E9GA 1AR1C 1HSBB 2PYFA 1PFCA 3LMJL 3MCKA 4NQXA 4BXVA 3W5MA 1TQTA 3R7QA 2A6IA 4UM8B 5I66A 3E38A 3O4OB 2PUQT 3SYQA 2X44D 1AGBA 4IRZL 4TOYH 2YAOA 2PYED 1AR1D 4H8WL 3WIHL 1CB4A 4NKIL 4TSAH 4W9EC 2XG4A 1UFGA 4Y4HA 4B9GA 1A7PH 3BHBA 1W0WB 4OTXL 2K8MA 1JDAA 4UDTB 2X6AA 2Y72A 3C6EA 4AT6B 2P45B 1IAOA 5T5NF 1E9QB 1WBYB 4K8RL 4RGOL 1HOEA 4ONGH 1NICA 3KR3H 1CFSB 2R8SH 3DX2A 4NO5A 3H3PL 3KPLA 4N20A 3X3GH 2YGOA 4Y4HC 3GI9L 2ZKYA 1TTRA 3UFIA 1U8HA 2BC4A 1TZAA 3IAPA 3MUUA 4X42A 4YFLI 4RAVA 2JF1A 2EKSB 5E6YA 1G7MB 2BO0A 5F3FA 5FM5M 2KDGA 4LAJH 3CQPA 2CDEA 4Y4HD 4HGWB 1ZRUA 5HVWA 1ZLVK 5DZOA 3CZJA 3OKOA 3FU9A 3LB6D 2CBPA 1Z1WA 2A9BA 4U1JB 2Y7LA 2H3NA 2C9SA 4J3TA 3AU1B 4WEMB 4D2NA 2DLFH 3UJIL 3HJ0A 4NKQB 1JPGB 1F4YH 4N86A 4PJDF 4Z7WA 3UTZB 1KCVL 4ANKA 3HZVA 4X5PA 3VM7A 2VMFA 1FNAA 3NN8B 4HGMA 4PS8A 4YO0A 3EO1B 1NKRA 3EDEA 4GS7B 1K6QH 3BOVA 4OAWB 4DN3L 4L5FH 4LEOB 6CGTA 4PRPE 1H3PL 3DX7A 5EZOL 2XG5B 5E4EC 4YOKA 1EA9C 2YJQA 2EYTB 4R83A 4BD4A 5EUOE 1TZ8A 4FXGC 4PJ5B 1M1XA 2MQGA 3DUSA 5TTRA 3MJ8A 1CT8B 3D51A 4HKXB 4V11A 2WZAA 2EH7H 3B4NA 4L4VA 2GEEA 3TPUB 4R5TA 3GK8L 4K3EH 4TUJB 3TJEL 5FOBA 2JTYA 2X5PA 1TKWA 1LEIB 3UAFA 5KJ7E 4MLSA 2ZWZA 4GMTL 4NZRH 1N6QL 1ORQB 3HVDA 1FFNA 3KM2A 1NWOA 3FJTA 2VN3A 3U6RA 1AY1H 4AIZA 1XGPA 4AQAB 1LEKB 2V5TA 1RP8A 4TPRL 4U1MA 3HC3H 4YEEA 3EFOA 1DLHA 2V2WB 4GMSH 3VXPA 4N2IA 2UY6B 2F2HA 1KUMA 1LK3H 4L4VD 4HJ0C 1T1YA 3VFUA 3SE6A 4FQ1H 4BZ1L 1R5IA 2XRAL 2AEPL 5EWIL 2WAQA 4IKJA 3TVMB 4NUMA 4JFHD 2ZKHL 4K5PA 4J3WA 5AYTA 4MJJA 4HJ0D 1F58H 4BYHA 3DBXB 5DWUL 2A6JB 3HNVL 3F7QA 1CS6A 5SWSE 4L18A 3UCQA 3S3CB 1D5MB 2W8CA 4U1NA 2N3JA 4YXKL 1QKZH 4UOZA 4XC1L 3UCRA 4Z7QB 4U05A 4WEBL 4XVOA 2BY0A 3RWJB 1HFUA 3MRCA 1UKQA 2GTWB 2XN1A 3I02B 1DN0A 1RULL 43CAB 3JWDC 2QQLL 1E27A 1NGXB 2AQNA 2R2BA 4XMLH 1AJ7H 3QQ3A 3ZZQA 1ASQA 1BLIA 1DDHB 5E00B 2CDGA 3H2WA 3T0XA 3IFOA 4HV8A 1O7DE 2VDOH 4Q74A 4F24A 1ET8A 3CN3A 3RI5F 4LVOC 2I7OA 5D4IA 3TZVC 4LVHC 1FZKB 4XPTH 1DQVA 2GPZA 4NBZB 4BFIA 1UADC 1JWSA 1RIUH 3QZWA 4H7VA 1FDLH 5HI4C 2ADJB 3BP4B 4P3WA 3MRDB 2QKIB 1PZAA 4FHBD 2PP8A 1GA2A 5E6UB 3TT1H 5HI4D 1XMEB 1ECZA 1KXHA 3B1UA 1KXTA 3INUL 5EUOA 3NIDF 4YIQA 1Y6MR 2GJ6B 4N2EA 4YFEA 1MJ8L 2LFGA 1L0XA 4LOUD 2K4AA 1LLAA 3E3QE 4L3CA 1X7TA 4P59H 4ZOBA 3QRLA 4K5MA 4GG6B 1PZDA 1NBYB 1RP9A 2GY7B 2WVUA 5HI5D 2X0WA 3QH3B 3KH3A 4NN5C 4E9TA 4BIKA 3UBXG 2FEJA 4EZJA 1W15A 3MACL 1TCRB 4N2AA 4TQ8A 2DQTL 3DX6A 2VLMD 3I6LD 1TXKA 4EIGB 2AXFB 1Z3GH 5ABAA 4U1SB 4XWOC 1QFOA 3MRIB 4J5VA 1RK0A 4NKMA 1A6ZB 4Z95L 1A2YB 1G7JB 2DQGH 4J1UA 1AD9B 1DUYA 1KGJA 4XWOD 4R84A 1PZ3A 4WUKL 5EZLB 4XBGB 1I8IB 3PY9A 3RIFK 1MSPA 1G7HA 4ODTH 5AYUL 5A6LA 5TFSL 3KZ8A 4AZ8A 3SO5A 2LQRA 3R1GL 4MQSB 4EE2A 5JPNB 5FYKE 3N0PB 4OZIE 3FO0L 4BXSV 4MQ7B 3MLVH 4OJFH 3QIUA 3T6XA 5ERWB 3UZEA 2CGZA 4GW4A 3BMWA 4ESKA 4HS8L 3QEGH 4Y4KA 4EDXB 3NJIA 3IDUA 4I0PA 2NY1C 5FGBC 4HLZG 1HINL 2OMVB 4JFXA 2ZJSH 3WTVA 2IPUG 1BPVA 4P5MB 1GC1H 4G1MB 1OLZA 1X5LA 2F8VA 1OD7A 1TUPA 4LCWE 1I8LA 1YEGH 3QIUC 3HR5B 1T1ZB 3AXHA 1URZA 1S4IA 3QAZB 4KH9A 4XP6H 3A22A 2DL9A 4CGUB 2QGCA 2QTEA 1KIPB 3JSSA 3Q6FA 5CU5A 1I1FB 3SDXF 4DUXA 2GVYA 1KLFB 4I0PC 4UQ9A 1INEH 3QIUD 2ZCZA 4UAOB 5F89B 5AVTB 3ARUA 8FABB 1BCIA 3VQMA 1ZHNB 5FDWA 3A21A 4JRYB 3MREA 1NDMB 3TEWA 4KUZL 5LBGA 1Q94B 2CO4A 4Y4KD 2J1YA 5FLUA 5BQDA 4I0PD 3MNVB 4XAKD 3UJJL 1VKXA 4YXHH 3V0JA 1U8LA 4O5LL 4FKEA 2XWCA 5DRXA 1RSYA 5GGUA 2FWOA 2ZX9A 5BJTA 1G0YR 1X4ZA 4BKLB 1KZYA 2DEXX 1OAJA 4WO0A 1ZE3C 4Q2ZB 3U1SL 4G9DB 1AXTL 2XXMB 2L7JA 1YPZA 3WXWH 5C71A 1T1WA 2MTPA 3SKOA 1FWXA 2VDRL 2B1AH 3QXUA 43C9A 1TZGL 2EDWA 4MASA 1X5FA 5FR3A 2KHAA 1KJ2H 4OF7A 2JB6B 5IBTL 4JM4L 1QFWL 2YJLA 3IDIA 1CUOA 3K2MC 5IHUH 1X44A 3KJ6L 4YPGA 4X98B 2WXGA 4KKAC 3RZCA 5BO0D 1KPUA 1XGTA 4ZO9A 1IE4A 1IC7L 5EBWB 4A55A 3IGLA 5EEUA 4D0DA 4APXA 3EDJA 4ERSH 2WQRA 4U3CA 2A2QT 3QPXH 5IK3B 4G83A 4ZFOB 3CXHJ 2E46A 5KYNA 5K59F 4KKAD 4Z7VB 2PCYA 1M3JA 3VJ6B 3DURB 3ZMRA 1BXAA 3QUYC 4NOFA 2R23A 1UWYA 3OLGA 5F7BA 4U1KA 2VR3A 2FJHB 2I25N 1AYRA 2G75A 1RPKA 2ARJQ 3KYMB 3P9LA 4NQCB 4XN7A 3RA7L 4AZUA 5IBUB 3L1FA 3ZTDC 2BIOA 3QISA 3RX8A 5DJYB 3U9PL 1TFHA 4YDJB 1JGUL 1ZV2A 3P73A 3DGGB 1T0MA 3FQYA 1IC0A 4N68A 2PTTA 4DETA 1TVHA 5IP4A 1ASPA 1JFHA 4Q6IC 1U95A 2ZPKL 3G6DL 2UWEE 3CFEB 3LQAH 4KDTC 1N0XL 3CPUA 4P2OA 4ETYA 1TPXB 1U8MA 5GJSH 3RHWF 4FP8H 3BWSA 4QO1A 1WIPA 3NFSL 3G6JE 5E0FA 4JCWA 4HIXH 4CMHC 3L5XL 5KBKA 3CTTA 1BQKA 2R27A 4A2HA 1JK8B 5AB0A 5TE7L 3KYAA 1RERA 4P2OC 4OT1H 1G7IB 1IKFL 5DC4B 3OMNB 4LB8A 1I8KA 3N40F 4CVXA 5HVFB 5DJDB 5FYKD 4MD5B 1IE5A 3PRZA 2CK0L 2BVTA 1BD2D 1TCMA 2KLSA 4ZX6A 1BEXA 4P2OD 2NY5L 5IJKA 2J3SA 4DZBB 1N18A 4FERA 1F3JA 4FA8A 2WGXA 3HPJA 4LU5L 4OUUA 5HGAA 4Y5YA 1WE5A 2MHAB 3BAEH 5KBMA 1KC5L 4G80B 1KB5L 2DB8A 5DF0A 4P2QE 3O3AB 3DTDA 4W4OC 1TITA 4ZW8A 5ADPH 4QRUB 3QDAA 5DJCA 3FFCB 1A3RH 5IJKC 3QUMH 4HWEL 1C5DA 4I18A 2VDLH 1YCSA 2JJWA 4C55A 4Y9BA 3KHOA 4PVBA 1HDMB 2K7QA 4HKBA 4P5TC 4AK1A 1L7TL 3MXVL 4HLJA 2ZZUT 4BE6A 4LBEA 2ICEC 3CZEA 5I71C 4M93B 1YEKH 3GMRB 1KT2A 1NCHA 5LN8A 1T7VA 2Z91A 4WNJA 1TOXA 5F70A 2HVKA 2FNBA 1CF1A 1DJXA 3G5YB 4YHIA 2IGLA 3GSUB 4LSRH 2W9EH 3KDPB 5EDSA 4LNRB 3ZE0E 5I18H 4EDWL 1MWOA 3OKKA 1ZT7B 4NUGH 4TVPL 1UUSA 3DRQB 1T5WA 1RZPA 4JFDB 4HPOH 3NDZE 1IEHA 3H1ZA 2GSGB 2AJVL 2OM5A 2EYSA 4ZW5A 2RHEA 3ALWA 3UTTB 2G0LA 3QR1A 2BVUA 3HAEB 4PV9B 1KGXA 2FBJL 4IRJB 4BZ2H 3MCLH 2WW8A 5JW4Q 5DD6A 2V33A 3VXUE 3FTVA 3GIZL 1L6PA 4RAHA 1CFNB 4EBQH 5IV2A 5KJ4A 4YSCA 2F7IA 1PPIA 4RGNB 1AGEA 2BP0A 3LXCA 1U8NB 1S46A 5KYYA 2UWEA 1A6WH 2OL3H 3HG5A 1CD8A 4BSVB 4PBXA 1IIIA 2XIBA 4RMBA 3NH7H 4LLDA 2EUZA 1S7XB 2OMTB 5KVEH 4X0NA 3G6JA 1MAMH 4LQFL 2PPAA 4MNQE 3TT3L 3OC5A 3ZXAC 4PJDB 3FQRA 5C9KA 5CN1A 5CO1A 3MA7B 2EDXA 1YYLH 3GBML 1MCLA 5IMLA 1A7RH 4GW1B 1NUFA 3EFDL 1MREL 4RFOH 2NMSA 4Y1AB 4PJ8B 5BS0E 1GHFL 1BOGA 4WI9A 2QDWA 5EO9A 2BRRH 4AV4A 3L9YA 2VDKH 1OSEA 4OH2A 4YK4C 4WHDA 4EIBA 3ALPA 3WEAA 4NZJA 4ZAKC 2HKHH 2R0KH 1FORH 2WO3B 3A6CH 1K8DB 4MA1C 3EO0A 4HLZH 4S10A 2ZIDA 4NP4L 3LAFA 4HIPA 4A1RA 1JSYA 1CWVA 3KWWA 4UOQA 2DM4A 3WAKA 2X9WA 4NRZB 4JO8A 5KYUB 1JGVH 1NLDH 2B9BA 4Z78B 3DO7B 4TSBH 3V5DB 2R0LL 1J0HA 1FV1B 4YXLH 5JMOC 5JPMA 4R8WL 3V9FA 2FIKB 1UVQB 1NCWH 2QHRH 4DKFL 1KBVA 2WY3B 2MCPH 4CADB 5C97A 1V5JA 1RJZB 3WN5A 1N8ZB 2AEWA 3H54A 4TV3A 3JZYA 3NT0A 3VD7A 3STLB 5CBEB 3QHZL 5T3XE 3T0VA 5CGYC 2J20A 3HI6H 4LSQL 1S7UB 4L97A 3VFVB 1SHMA 1XGRB 3M88A 1QZNA 4PJGE 2NXZD 4Z7OF 4X9YA 2E7LA 2EO9A 5HHOE 1BW8A 5IMMB 3N2JA 3OGCB 5IB5B 1BZ7A 3HG1A 1Q4NX 4U2YA 3B8SA 4HGKC 3IU4L 4N1HB 4XXWA 2YMTA 1GYVA 5TDPB 5J06A 2B1HH 4HPYL 1CFQA 4IEFA 4BEIA 1FO0L 4WUUA 3REWB 4TSCL 4NSKA 1XZ0B 5B22A 3EOTH 3UBFA 3LZQA 1F18A 2X28A 3VXUA 5E2VL 4WCYL 5GGTH 4BFOA 4DTGL 1IMHC 4RIRA 3KPRA 1F4XL 1PKQE 2EC8A 2ZOLA 4XXWC 3D2UB 3V0EA 2FHCA 4LPUA 4UAHA 4TNFA 1M05B 1ZKAA 2BHFA 2EINB 3ELAT 3GXPA 4DP4X 5B38G 1YN6A 3HG1D 3CXHK 1USZA 2ZKWA 1ZIBA 5I1CH 4KNSA 3H3BC 3MLWL 4MNQA 4WUUD 2F74A 3QRBA 4XNQA 1QFUH 3A47A 3DSNA 3NGBB 1ETJA 5GIRA 5D7IB 3VXUD 5AD0A 3EJTA 4WFEE 4HBQA 3D2TA 5H37G 2X7LB 3KPRD 4F3FB 3IMRA 4B5ZA 2WNWA 3A6BH 3C08H 4JPWH 5AKRA 4AG4H 5E1HB 2WLHA 3D87B 4ATWA 9PCYA 4N6QA 2X1XR 3PWJA 4ZMYA 2F8XC 1RZQA 1U33A 1S9XB 3TA3C 3WOVA 1M3IA 2IADA 1KN4L 2Q3AA 3DYMA 1HEHC 5KBDA 4RGMB 4MNQD 4YDKH 3TBCA 4HUMB 1I85A 1U8IB 2BFVH 2OMWB 3IE4A 4XHJC 5IUSA 1IKOP 2NZ9C 1AO7A 5BZXA 4C47A 3QUXB 2JTDA 5I1DB 1H5BA 1GJUA 3H9SB 2DICA 4IJ3C 1NAMH 4Y8DC 3FO2B 1ZSDB 2VWEE 1A7BA 1Y0LB 5JDSA 4XHJD 2HKFL 4HUWB 2RACA 5F44A 4YHZL 2EILB 5C08E 4Y2DA 1CGUA 1T83A 1P2CA 1I85C 4MJIA 4X0KB 3NTCH 1KCRH 1INDH 1F02I 1SN5A 2EE6A 3TH3T 2X4PA 1IGTA 3RIFF 2OI9C 1H5BC 1B2WH 3ZYJA 4FG6D 1ZDQA 4MDIA 4KKCD 5IJVA 4K94C 3AUWB 4KMTH 1WO2A 2GABA 3CFTA 2NW3A 4R97B 1SOQA 2VCOA 2EDJA 1AO7D 3IEAA 4X6DF 4Y2DC 3IJHB 4AT6A 4S0HA 4FZ8L 4WTZA 4LAQH 2RALA 2P42B 4JPIB 4UDUA 4FYQA 5HHOA 3RY6A 3NACL 3W39A 4JY5L 1EHLL 4OLZL 4AEIH 4Y2DD 2NY0D 1JNHB 2Z8SA 4UTAL 3BAWA 4HIQA 4MJID 3WY3A 4ELMA 1TENA 4U49A 3H2QA 5E8EA 4AEHH 1D5IH 1KG0B 1MPAL 5BUPA 4LASH 4B9FA 3S88H 2Y5TA 1A3LL 1MCNA 1UXMA 1FGNH 2M26A 1FE8L 2MKLC 3NJLA 4BDVB 4KTDH 3FTGA 2IAMB 1IGJA 4GW5B 4O2FA 4P57A 5K69A 1PKQA 4MCNA 1KCSL 4LSPL 5CZVL 1IEAB 4M7ZB 1F1GA 1D7BA 2NUTA 3BYYA 5E8OA 4NKDA 4YMPA 1HNFA 5HHOD 4ZFQA 1VA9A 2AEOA 3QUKB 5AW7B 3RWIB 3X1NA 1YEEH 5DRWA 3PDGA 5EIIB 3BUPA 5A2IH 1TQVA 1B3JA 1DE4B 2R1XA 2YD3A 3BO8A 3E1ZA 4JG0L 1TTCA 5F1IA 4JFEE 2AC0A 1XF4B 5DK0A 1CD9B 2B1OA 2CG9X 4LKXA 4DK5A 5IHZB 3VWJA 3NCCB 4DP8X 4X4YA 3B7RL 3IF1B 3HUJE 3BE1L 4JNXA 4LIQE 2KQMA 3EBHA 2WXJA 2BS8A 4MS6A 1NGZA 3MV8E 2DKUA 5E6RB 3O6LL 2BVPA 5ETUB 3SKMA 3WIFA 5CCHE 2FGZA 2NR6A 3QIWB 4QCIA 5J56B 3ZKXB 1OAZL 4NNXA 1VENA 3VWJC 4OR1A 1N10A 3K2KA 4E9QA 2C9PA 2F1EA 4GB9A 3MRJB 1OK8A 3MR9B 4GQQA 4UZUA 1EVUA 3DJSA 4MZ2A 3EYUH 3O6FA 3RTQC 5IKCA 3ABKB 1UB6A 1QR4A 3VWJD 1J8RA 4G6AD 3FQTA 3K4AA 3VI4F 1IM9A 1IQDA 5SX5H 1XSOA 5FM8A 5T3ZL 3UC0H 4JHAH 5F7AA 5H8DA 1LE9A 3QEHA 3PJSA 1J1OH 2VERN 3AUVA 1QSEB 3N1MC 1BEYH 3LIUA 2NR6D 5LQBH 2B59B 2QELA 4HH9B 4A7TA 3CAFA 5GZNA 5C08A 3KJ4B 4R26H 1HU8A 1JXKA 5ECGA 2V9QA 2MCG1 4FJYA 2J8HA 1SGKA 3O6FD 1P5UB 4XO9A 4PS3A 1EBPA 3QAQA 1S9VB 4OM1L 1MCOH 1IM9D 4CMMA 2OK0H 3EG9B 4I1PA 3GPSA 4NM4L 3TFKD 4N5EC 1QPXA 2F54B 2OTWB 2RR3A 1M1SA 4YX2H 3ECUA 2WUBH 3PPSA 2ZCHH 3PHOA 3RPBA 3C8DA 5GZND 5C08D 3V4UL 1WFOA 3EGSA 4AENA 1FNGB 4DKTA 3RU8L 4HWBL 1EIBA 3MGOB 2RTTA 1CE6A 4J3OG 1XAUA 5HD8C 3THMH 5B1JA 4ZX4A 4OY9A 4V2BA 4ZPTB 3ZR6A 1NGWB 2R7EA 1CXEA 4RRPA 5C0ND 1C12A 2ED7A 3ROOA 5DZVA 2DQDH 4L3FA 4RNRA 3ZZ1A 5HP5A 3QR2A 3DOSA 1QYGH 3MYJA 4OGYH 2A83A 3BH4A 4L48A 4CW1B 2D0HA 2DBLH 1KPVB 3UBXB 2K6WA 3FO9A 3V95A 2XA8H 4JO2H 1FZJA 4JFEA 1DVTA 1WDAA 3VG0L 2GT9A 4RX4A 4BK4A 5D2NC 1R3KB 2Z35B 3QZOA 1Q72L 3KGTA 4MA7L 3WKYA 1YNLH 4KO5A 5HHQA 4JPKL 1YY9C 4IBTA 4V1DA 3D4GA 4XOEA 2X2YA 1GCFA 5C0AB 4L9DA 3GBDA 3ULVE 3OF6A 4IBWA 5LGJA 4LOEA 1YY9D 2UZYA 4PUBH 4TOYL 4EN3A 4TSAL 2FVNA 1KYOJ 2GC4C 4MBOA 2OYKA 3DVFA 4ORZC 5DZNA 4JFED 4OLVH 1A7PL 3IXTA 1TTFA 5DURD 1OZUA 1CTNA 5JYMA 2JXMB 3WYRA 3ESPA 1C5CH 1UC6A 4G3YH 4RX4D 1EXGA 2I24N 4MJ5B 1M56B 4MYPA 4NN7C 4ONGL 2YPVA 1JDDA 3KR3L 4GNKB 4KPHH 1DEEA 4V1DD 5H37H 1BIHA 1L9PA 2NYYD 2R8SL 1ID2A 3GSQA 3PCYA 5BOJA 3X3GL 2YEZB 3OF6D 5FX3A 3NSJA 3QXTA 4X83A 1RU9H 1L9RA 3S3PA 4PV1C 4EN3D 1UWGH 1OE3A 2QHLA 4LSUH 5ID0A 1CD1A 4J27A 1KPRA 3UAJC 2H4EA 4PJAF 3W81A 1QLFA 1X3DA 3G5XA 3I2CH 2NQDA 2VISA 4G6FB 2DLFL 1GGBH 2CO2A 1WS7A 3IXAB 3KPOA 2ZD0A 3VFRA 1GS6X 2EXTA 3L4WA 1F4YL 1PIFA 1JK9A 2A0LC 5FGSA 5FB8A 3GKWH 4MRCA 3S96B 2VRQA 3OV6A 4PV8A 3VE0B 1I8UA 2ITFA 3MRHB 4BUGA 4KAQH 3S0PA 25C8H 3NIFF 4HD9A 4IOIB 4IRSB 5HYIA 2P8LB 5FIEA 2LU7A 1K6QL 2C7UA 3OR7B 2HT2D 4L5FL 4UTCA 4E9RA 4MCZA 1XF2A 4LCVA 5FUOH 5DRNA 3WFBH 1RSFA 1S7RA 4PJFF 3PV6B 4BA8A 3VFMB 2GTZB 2F7QA 1PEZA 4B0MM 3D50A 3LPOA 1ZLUK 4XN4A 1Z2KA 4AQ1B 2WGNB 4R5XA 2HT3C 3APNA 2X6CA 3SPGA 4PJ7E 3P2BA 2EH7L 5JTWA 4MDJA 1T4KB 2IQAB 2Z93B 1UT2A 4K3EL 1JIBA 1LJMA 2OZ4A 3BIAX 2YAHA 1MN4A 4XGZA 4M02A 3QXAB 4KNTA 4NZRL 5HHNB 2EXWC 2BOCA 5F9WC 1E28A 2BWIA 1AY1L 3CFBB 4OF6A 1IARB 2NQCA 5I1LB 3FTZA 4N22A 4MXQC 3TA4D 4LFHG 1HNYA 3HC3L 3TNMA 4N0CC 5AW4B 4X6CA 4GMSL 1K72A 1MXGA 2VRKA 2Z65C 5JHDE 3FU3A 3QIBC 2Q86A 1LK3L 3N44F 2AV7A 3MUY1 4FQ1L 2Z9TA 3WO4C 3TBTA 3RZWA 1MOEA 3TBYB 2PN5A 3BP5B 3R8BB 3QWOA 2X9XA 1BYOA 3PDDA 1X9LA 1F58L 2IOOA 2BOBA 3DC0A 1Q8MA 1IGYA 2XJLA 1SQMA 4QWWC 3ULVD 3TBBA 1W72H 3HPLA 3B3IA 3KLKA 1IU1A 5AW3B 2WLZA 2PLTA 1QKZL 4O02H 4Z0XB 4RWHA 1NBZA 1EFQA 5AALA 2Z31C 2ZP9A 5FO8B 2J1WA 3I85A 5BUAA 2ZXGA 3AADB 4KXZH 4XMLL 3T04D 1AJ7L 4PLJC 4HF5H 3NPSB 4L1TA 1XCXA 3UTSA 1GS7A 1RXLA 5D1QB 4BK5C 4ZQTA 1EO7A 1SEBB 1E65A 4MQTB 5EU4B 3RGVB 1NIDA 1NFDF 2VDOL 4JFOA 1CR9H 4F7EA 2J88H 3WNNA 4MMYB 4XPTL 4E9SA 4POUB 1GYCA 5EOTA 4FF9A 1RIUL 1A9BB 3QORA 2DWEA 1FDLL 1OSPH 3SBQA 5E8NA 4BA0A 1ZA6B 1R6VA 3UTQA 1VEPA 4PRNA 3LKSA 1H6TA 4GRLC 3VH8A 1KGYE 4TTDC 3TT1L 3VXMA 2ZOKA 4L8BA 3V4VB 1UT9A 2EE3A 3ARFA 3UTSD 4B41A 4H8QA 5EOQH 2ZUTA 3D0VA 2X4SA 4I48B 3ILQD 4Y5VA 4PJEB 4XWGH 1GXEA 4LQ1A 4NAQA 3AU0A 2FJUB 2XKNB 1CICB 4TTDD 1HH9B 1U3HB 4DK3A 1EZUA 4PJ7A 4W81A 2XTJB 1M6UA 4B3EA 1MHPH 2ZWYA 2IANA 4ODUA 4J3OH 4P59L 3QORD 2ZUQB 5HJ3B 2YKKA 4MS8C 1PDKB 5FYJD 4AQEB 4OCWH 4RVBA 4LLVA 4PJXB 3S5LA 2DKMA 3SDCB 3VXMD 3ARFD 1OSZB 2VDNB 1FL3A 1UA7A 4FNQA 5AUMB 5FHAH 4U3XA 3WIAA 5EIVA 5I5JA 4J2QA 1N0LA 3G6AB 2D7MA 4DGYH 1FN4A 3B1TA 1Z3GL 5GS0C 5JHDA 3FT9A 5DS1A 3H9ZA 3LV3B 2HFGH 1J86A 2ZTBA 4NGHH 4M4RA 2IAND 3H4HA 2ZOTA 4PJHE 3T6WA 1HL4A 5IVXF 4CNIA 2F5BH 2DQGL 5I9QB 4PJCF 2Z4TA 1QW8A 5GS0D 3LKPA 3VVWA 3NEEA 1T6WA 2VR5A 2UY7B 5CZXC 1CXIA 2HZHA 1TSRA 4ODTL 4X7DC 3EYVB 4J23A 4BSJA 2COQA 4RSVA 4PS4H 3ARXA 3IJYB 2C1PA 2WB1A 2PR4H 4UM9D 3MLVL 4OJFL 5CZXD 4UT9H 5JHDD 5LXVA 5ITBH 4CC0A 1J88A 4WKZB 1KYOK 1WUZA 4HPHA 1U41A 3P9MA 5I0VA 4HJGA 3QEGL 2F08A 2BNQA 3CVHH 3FRUA 3MLRH 1F4WH 3C60A 3GS4A 4WNSA 4IHOB 4NPKA 2CHZA 1A3QA 2YKLH 3RGHA 2ZJSL 4JZOB 1EVTC 2FX9H 1NCTA 1GC1L 3D48R 1N7MH 1NIFA 1YEGL 2YPKB 4XP6L 1OIOA 4BFFA 1F41A 2CA3A 4KVPA 3DXAA 4IRZA 4ZUVB 3WIHA 4XBPA 1TZHB 3C60C 1SDAB 1INEL 1PS3A 3NABH 3UP6A 1I8AA 2QVFB 2IIJA 3GMPA 2BOLA 2BP8B 3QUZC 1EUUA 5HPMA 1F6FB 3UG5A 2ATKA 1X5JA 5T1MB 2D8KA 3FSAA 3LDBB 1NL0H 2CCVA 3V0AC 3MRKA 4HOWA 3MRRB 4N8CH 2BNQD 3J8F7 3C60D 4XT1C 1EWHA 4YXHL 1J0ZA 1XV8A 1QATA 3CGTA 5FHBH 4OCLC 2H0PA 1DVFC 2ZSWB 5KSAC 3INOA 1A8JH 1E4XI 4PRBB 1QABA 1E9PA 2R56H 1HL5A 1MF2H 2VZUA 4QDGA 2WKOA 3DXAD 1G0XA 1JPSH 3BVNA 3CN0A 1J8HA 3GDCA 4XH2A 3WXWL 5KSAD 5DZAA 2B1AL 5F9DC 3QB7C 4U6HB 5MEPA 4XC3H 1CGSH 1V10A 3KE0A 2FJFA 4A6YB 1KJ2L 4ECNA 3NFPA 3HE6A 4Y9FA 4EXPX 3QPQD 1YYCA 4UI2A 4QXUH 2V2XB 1YMMA 1CIUA 4K8RD 5IHUL 3BVVA 3QGVA 5FYKU 1I75A 2V7HA 4OZGE 3BX7C 3CXDH 2MQCA 2NTFB 3PGCB 5I82A 3K71A 5EV7A 3CN4A 4YR6B 4ERSL 4X99B 3QPXL 5DLMH 4PRHE 1J8HD 1DJHA 3V0HA 1NFIB 4XO8A 3L4TA 3VI4B 4RFEA 4PJHA 2VAAB 3T3PF 1XR9B 3X13A 5I1KH 5KBLA 2E27H 3OX8B 3KW8A 4TQPA 3HE6D 1GZHA 5HYJE 4JDEA 4BBWA 1J11A 4KJQC 5I30L 4WW2A 5I1JL 1YMMD 2PXYB 5GS1A 5LBSH 2DPKA 4ETQB 4N0UA 5G2NA 3EOYG 4K7PH 1JDCA 1FSKB 4KJQD 3HI1A 2X87A 3P0YH 3LQAL 2BS71 1ZWIA 2P5WA 3BKCH 4QHUB 4M6NH 5FF6A 3U9UB 4CUCA 4M7LH 2FO4B 5GJSL 4Z7WF 3QZPA 2F5AH 3DX9A 4FP8L 1O6VA 3GDBA 1ZK9A 1OW0A 3MV11 4RZCB 4BCYA 3EH5B 3HZMA 3PABA 4HIXL 3ZO0A 2E3VA 3GMMB 3ARPA 4M8UA 5I6KA 3MTXA 4U7KA 4YHKH 4HETA 5B8CB 1QVOB 2HJLB 5EC2B 2W95A 4W4NA 1GZPB 3FT3B 3PV7A 4NPYA 1G43A 2DN7A 4ONFH 4OT1L 2LLLA 3HA0A 2VW7A 5EEZA 3VFWB 2A9CA 3NFNA 3U4EB 1C08A 1OW0C 2NNAA 1ZXQA 3TBWA 2P5WD 5M95B 4S0TD 3SQOH 1D5RA 2RCSH 2R29A 4BZ1A 1U30A 4BE5A 1ZCRA 4AITA 1MFAH 3C5JB 1GGTA 3JVGA 4XCFH 3BAEL 4L2YA 1HCFX 1NA8A 3GS7A 4H44C 3VXQA 4L3EA 4N4YB 1FNEA 5KG9B 3CD4A 3X1EA 5ADPL 5AL0A 1A3RL 2K9UA 1MCHA 5D1XE 3QUML 2VDLL 1J5CA 1NGPH 4D94A 4HOXA 3JTTB 4OUOA 4OW6A 4PI0A 2X0UA 4JDTH 3C5SA 1AOHA 3JVGC 3PGFH 4JDZA 1BQSA 2CAKA 2YC1A 1JPST 4FX5A 1N6VA 1YEKL 3X14A 4AGLA 4DCQA 4GSQA 5ITFB 5CIPA 2BJMH 2CKBH 3NJNA 1CIDA 1J05B 3L3OA 3LZFH 4GEIA 4HP5A 4NUPA 1HK6A 4OZGA 4LSRL 4L3ED 2W9EL 5ICXA 4UWQB 5CEYA 5I18L 3LRSB 4NUGL 3X12B 2X38A 3MPCA 5E6ZA 4G6MH 2WCPA 3SZ6A 1ZHKB 3B2PA 4HPOL 4PRHA 1MWAH 4XRCA 3WTYA 1K8IB 2JWYA 2QVMA 5K39B 1XF3B 5BV7B 3IFPB 2B20A 2J2ZA 4FI8A 4WWOA 4WWKA 2X2UA 3POCA 1PKOA 1I4FA 2IVFC 5IEKA 3UP1A 4P99A 4JRFA 2IOMA 3IDJA 5HYJA 2JCCA 3HRZA 3KPTA 5F0MB 3MCLL 5DHYB 4BZ2L 2ENPA 4PG9B 3C5ZB 3IB4A 2J57A 4Y5XA 4EBQL 4XMKH 1E4WH 4NN6B 1UM6H 4RESB 4OLUH 2LOEA 3EHBD 4G1EA 4Z3HA 1KV3A 2Q7AA 4F9LA 3RKDC 4F2EA 3FYIB 2MFNA 2R51A 1T2JA 2OL3L 4OFDA 4PRHD 4LSDA 2NNRA 1MJJB 4DP6X 5C0EB 3T9WA 3NH7L 4NQDB 5DK2B 2VZ1A 4JKKA 5KVEL 3FO1A 4WWKD 2YHGA 3HS0C 2R9HC 2X4UB 2XDHA 3FULA 3HI5H 5HYJD 2WXOA 3U2IA 4HULB 4F9LC 1W8OA 2AAVA 4ZSOA 1YYLL 2IH1A 3KPQA 1A7RL 4U0RB 4RFOL 2GIXA 2R9HD 4UUJB 3W3BA 2YSSA 2BRRL 3NIFB 3ZIYA 4NAMA 5KYXB 1HZKA 4FNLH 4QXTB 2VDKL 5KSUB 5EN2B 4KGJA 3JTBA 5T1KA 4OGAC 2WO2B 4G7QB 4OKVA 2HKHL 4IGBC 2R0KL 3EYSH 1FORL 2Q2LA 5EUOF 1I3RB 3A6CL 5E70A 5JO5A 2I69A 1HAUA 1S7VA 3P0VH 2BSBA 1TJXA 4FG2A 1KIQB 2XSKA 3G3LA 1WA1X 4JREB 1JGVL 1NLDL 3PFQA 4TSBL 3C6SA 4KROB 3SDDC 4E0RB 2W91A 4NOBA 4XMTA 4N1CA 4YXLL 1RUAH 1SF5A 2AJ3B 2BNUA 5D1XA 3CFDA 1R24B 1FUNA 1OO2A 1NCWL 3QDGA 1HI6A 4NCC1 2QHRL 2XY1A 1EXHA 1MHEA 5JIHA 4NZDA 2QPEB 4ENZA 2MCPL 4L8DA 1TQCC 4KXAA 3GSVB 3DDGA 3PHSA 5T1KD 3WDHA 4JQIA 3JWDH 3RNQB 1O6SB 1P6FA 1XF5A 3GJFA 3LPPA 4GSRA 2GBTA 3BJLA 1U8OB 4M62H 1JZFA 3SODB 1TFPA