2OR9H

The structure of the anti-c-myc antibody 9e10 fab fragment/epitope peptide complex reveals a novel binding mode dominated by the heavy chain hypervariable loops
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
226
structure length
221
Chain Sequence
EVHLVESGGDLVKPGGSLKLSCAASGFTFSHYGMSWVRQTPDKRLEWVATIGSRGTYTHYPDSVKGRFTISRDNDKNALYLQMNSLKSEDTAMYYCARRSEFYYYGNTYYYSAMDYWGQGASVTVSSAKTTPPSVYPLAPGSSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Monoclonal anti-c-myc antibody 9E10
publication title The structure of the anti-c-myc antibody 9E10 Fab fragment/epitope peptide complex reveals a novel binding mode dominated by the heavy chain hypervariable loops.
pubmed doi rcsb
total genus 39
structure length 221
sequence length 226
chains with identical sequence I
ec nomenclature
pdb deposition date 2007-02-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2or9H02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2or9H01
1KEGH 4JPVH 4KK9C 5EUOA 3VWKB 4CDHA 4N90D 1DQJB 1BIIA 1D6VH 1I85C 3LKSA 4WW1A 4BQ8A 1UZ8B 1IAMA 4PUBL 2FX7H 1MCOL 2G60L 4I8DA 3P4MA 3HZMA 3MJGX 3NAAL 3JVGA 1IVLA 3R06A 2DQTH 4NO3A 3VCLB 1TLKA 2E7MA 1CXFA 1WFNA 2UY6A 5T3XH 3MYJB 4I9WD 1YEGL 4ZAKD 2CLVA 1OAQL 1VFBB 3OMZA 1HIML 1WVZA 1S9YA 1OGTA 1TJHH 4N90E 5I1DB 2VL5A 2ENSA 2ICCA 1GSMA 2CIIA 5C09A 3T0EB 5HY9B 3FHAA 2RCSL 3CFDB 1AXIB 5KSAB 5KN5A 5B39G 1OAKL 1VGKA 3VFVB 5L9DH 2X4NA 4LKCA 1JGUL 3PWUB 4L5FL 1ZANL 1ED3A 2W38A 3RVTC 2AABH 2VO5A 2Q6WB 3TH2T 5DJZA 1MCSA 4M6OH 2QR0B 4I9WE 5BVPH 3U83A 3GIVA 4MS8D 4YEFA 3DUSA 1Q9KB 1FZMB 2APVA 4YDKH 4YHML 3EOYG 5CP3A 3H9YA 2R15A 3VFRA 2VE6B 2FJFB 1NMAL 3RKPA 3NIDE 5FGBA 5AYUH 3TO4C 3ZKQD 4G7VH 4JJHA 1WITA 3CDFA 3NVQA 3CXDL 3HUJF 2MPAL 1OHQA 4ONGH 4RNRB 1L7TL 4NO0B 3ARVA 1MLCA 2JB6B 5AUMA 3PHQB 4PJXE 4N0YH 5IFHL 5EZOL 2DYPB 3BGMB 4HUXB 3WMSA 4PGDA 3QFDB 3AVEA 4W6WB 3T2NL 3B9KC 1A4KA 3OG4B 1TZHB 3TIDA 2IALA 2CH8A 4Y19B 2EDRA 4MA1B 2VDRH 5K9QG 5E5MB 2OJZL 4UQ2B 5DGRA 5IVNA 2NMSA 1EHNA 3DECA 3ZTJH 5IW6A 3CIQA 3K1KC 1A1NA 3C87A 2AJVL 4HIJB 5J9PB 4LDEB 4ZUUA 4NQDB 3HMXL 3RPIB 3HE6A 1RK0A 5DJCB 5I8CB 4X7CC 1MPAL 1P5UA 3S5LG 2OTWA 4XP4H 3X14A 1Q72H 2F15A 3QQ3B 1WWWX 2EH8H 4YX2L 2HLAB 3P73B 5CD5C 3QDGD 4CL7A 1FC1A 1YJDL 2H32A 5F6HJ 1AFVL 3QIBC 5LGHH 2BNRD 4MCYA 4MJ4A 2R2CA 3T3PF 2BCKA 5DHVH 5AG9A 4JFOB 4J8RB 2GFBA 5D5MB 4BFIB 5F9JB 3WIHH 1S7RA 3LN5A 5E2VH 4Z18A 1UVQB 3AXLB 3IDJB 2J12B 3QUKB 4MA7L 1E4XH 3WFHA 2R29L 4JM2D 5IB3A 4X9IA 5DD5H 1C08B 1L9NA 1SYVA 4IRJC 5D7IF 3BPCA 2CQVA 4WUKL 3VRLF 2DRUA 2CXKA 4U1GC 5I71C 4J3SA 3QDAA 2VXQH 4HMCA 4X4ZA 4F15B 2ZCKL 3C2AL 4MQXC 4QCIB 1YQVL 1JBJA 3QDGE 4LU5L 4ZPVA 1XR9B 4UU9B 4NO2A 5I1CL 2BNRE 3CFCH 5TH2A 1KLGA 3QBTB 2KH2B 1JWUA 2PO6A 4XXDA 3X3GH 3RGVD 3L3DB 2AJ3A 3P4NA 4MDJB 4KI5D 5FKAB 3ARDB 1BWMA 4UTAH 2FEDC 4ORGB 4Z0BL 2WQ8A 1UJTA 3Q6FB 1KV3A 1H5BC 3HB3D 4KHXH 4LRNL 2CO6B 4KTEL 4XNZB 1EV2E 2CDEA 4YHLL 2V2WA 2DLHA 1DP0A 3AUVA 1DVFD 4W4OC 4PREA 1IQWL 4ESKA 3I3EA 5HI3D 2OYPA 4I3SH 3RWFB 1R6VA 4DGVL 3RDTC 1VPOH 3FB5A 4MAUH 4U33A 4WI8A 4YHZH 5ISZB 5EU7C 4B0MM 4WTZG 3QUYA 1MREL 3MACH 4G6MH 1CD1B 1BVKB 1LEGA 1CR9H 4KI5E 4RRPG 3PWNA 4XCNA 4JDZA 1IGML 4R4NC 4ZFGL 4D0CB 1FNSH 1CFQB 1KUMA 4LEXH 5C07A 4M03A 4WV1B 1BECA 1U8JB 4N0FA 3O4LA 4NQVB 5KVFL 4JQXC 5C8JA 8FABB 2X2YA 3L3OB 1SVCP 4HJJH 3GSUB 1Q9LA 2NX5D 1XZ0B 4OTXH 2I9LA 4K7PY 4TRPL 2IAND 2WM0A 5EN2B 1EHLL 1TFHA 1U91A 4FNLH 4JFFB 4M93C 4NWUH 3B3IA 4XCFL 5ERWB 2HVJA 3OXRB 5DK0B 4MJIB 4R2GD 3RY4A 3AAZB 5HDBF 4L3CA 3EFDH 4FQHA 1KJ3L 4PTTB 5DQDL 2G2RA 2G75A 1MJ7L 4X0KB 3KJ4B 1UJ3C 4MD5B 3O6KH 5CEZL 4ZAKB 1G6RA 1ZK9A 2EIEA 1YEDA 2NY2D 1CI5A 2PETA 5DLMH 5CMAB 2A9ML 1J1XL 4L3EA 2Z91B 3T77A 5DA0B 3VXMB 2BVOA 3QO0A 2ZCLL 3RNKA 4IRZH 4YGVA 3JV6A 4YGAB 3MFFB 4NQXA 4XNXL 2NX5E 2ADGA 2DQJL 4PBVC 4RGMB 5TDOA 3OR6B 3PL6C 4CVZA 1CZ8H 4JAMB 3NCMA 4ZOEA 2OMBA 3VI4E 1NFDB 4Z7UB 4E42B 3NFPB 1JZ8A 2Y07H 1HYSD 4OIIH 2W92A 3EFFA 5C0AD 3OF6A 3MLXH 5KAQG 5FO7B 3VWJB 4L8BA 1NPUA 1A7RH 1DUYB 4ZNEE 5J1TC 4S1SL 5HDOA 2XRAL 4FFYL 1J0IA 4RISH 4ZUWA 2JJUA 4JPKH 4M7KL 3GJEA 4Z8FL 4JG1H 4POZD 2XZCH 3L7EB 5DEFA 4TVPH 5ANMB 1FH5L 3QNYB 5TF1L 2Q7NA 3AS0A 3FN9A 2W1NA 4E5XA 1JZ7A 1G9ML 3CXHK 2EDOA 4KVCL 2B20A 4HUUA 3QDMA 4OFYA 4PY8I 4AENB 3S9DB 3C60A 5KVDL 2ICWJ 3BZFA 4PY7B 3BFOA 1Q1JL 4P2QD 1DLFL 5D1ZD 5DJXB 3ULVC 3SDCD 4NCC1 1P7KB 1JNJA 1FYTA 4CADA 5FIEA 1AXSB 5HGAB 3WCYA 1AGDB 2E7HA 4JN2A 5H35A 5C0AE 1UA6L 2EH7L 5EOCL 4F7EA 4K3DL 4Z7VF 1P1ZA 4J3OC 3TYFB 5BS0B 3VD4A 1T83A 5JXEC 4HXBH 2FO1A 5ESQB 4QRRA 5GRJH 5SX5K 3C6SA 1HOCB 4IS6A 4ODBD 5E8DH 2QSCL 1B4JL 4KH2A 5D70H 3REVB 3OAZK 1U92B 1NC2B 2ZKHL 1TCRA 4P2QE 5F1NA 3ULVF 2Q8BL 5JZ7C 4YHIB 1S3KL 4HGKC 3C5JA 3RWCA 3T2OA 4JVWA 4LP4A 1FG2B 2NXZC 2Q86A 5D2NA 5I6XC 3QDGB 4HWZA 4PJCF 3GSNL 4BSWB 5IW1A 5CLWA 3MX0A 1YMMA 1I1YA 2B39A 4DVBA 4FXLA 5CD3B 1J0KA 1WBYA 1OCWL 3F7YA 4HS6A 5H94A 3P4OB 3RIAF 4KHTL 2R0LH 3T2PA 3KYMB 4Y5YA 4KKCC 1NMBH 5I30H 4JY6A 4IIQA 1LWRA 4JM2B 2BNUA 1RJLB 3MRIB 1KCUH 1XR8A 4O9HL 3KDMA 3CFEA 2XIDA 3OJ2C 4HAGA 5FEBA 3MLTA 4QRPA 4AEIL 3K81A 2VZ3A 1EJ6A 1A0QH 4GAJH 3ZDZF 4RMWA 3QIBD 4KJWC 4H1LG 5E7BA 5IHLB 3UTSA 1CE6A 5HVWA 4DKEL 1I1AA 3D85A 4GQPH 2KPNA 4M9OA 3ARPA 2ZOKB 5FUOH 1OSZA 2CDGB 4LCYB 4P2YA 5E2TL 3RGVB 4KVNH 1LP9B 3EYQD 3V4PH 1RI8A 1KENL 3CFJA 5GS0L 1EO8H 1W72A 3QO1A 4X7EC 5CINL 5EU3B 3SKNB 4ZQKA 2YBRA 5DDHA 5T33L 3RAJL 2Z8RA 3GBMH 1F90H 1UWEH 4JFEA 4BZYA 3EYFB 4WI2A 3FMGL 2D0GA 4DUWA 4JZOB 4ZO6A 1ZWIA 5F3HA 3ZZ1A 3ZYJA 3WFEL 4X5WA 4QF1A 4OM0L 3NCYP 1IGJB 4XPBH 5GGTH 5T5NG 3ZL4H 4F7CB 4M5YH 5HGDB 4K7FA 4XBEL 1ZGLM 3U7WH 1SMOA 1R5IB 3C5ZA 1DBMH 3VDBA 1N8ZB 2YD3A 1U8OB 3V0WH 5KVEH 3G9AB 5F1IB 1CLYH 2UZIH 1J88A 3HRZA 5C0IA 1AIFA 5I1HH 2QJDA 1JE6A 4OT1H 5GRXG 1RZ7L 1S7WB 1UXWA 3P0GB 4Y4FC 2RFXB 3B6SA 5JIHA 1U8NB 4KJYA 4OZHA 5H2BA 2HT4D 5EUKA 1NFIB 4U7SA 1RZ8A 4M7JH 3FTGB 1XGTB 2DTMH 3MJ9A 1RZGA 2PXYC 3UJIH 3M1BB 4Y0GA 5T1DH 2IANB 4HEME 3MOAH 2IFFH 1BQHA 4JR9H 2EYTA 3IS1X 5GGRA 3OAYH 3U9PH 2Y5TB 1GZQB 3T65A 4Q9QH 1FZOA 1IEBB 4I48A 2A1WL 4LLDA 4R4ND 3H9ZA 4YUEH 1MCRA 1GAFL 3OV6A 4PRPB 5I19H 4PG2C 5GRUL 1M7IA 5C2UB 4XAWL 2FLBT 2ZNXA 4HF5H 4TUOA 3QIUA 5DS8A 15C8H 1WTLA 4MJ6A 4WU5B 1FL3B 3S3PA 2D7OA 5EG6C 1I7UB 3QQ4A 3TN0D 1A6VH 4LOUD 3QA3A 4GW4B 5ID1A 4GSDH 4MNGA 3PWJB 4POYA 1GGIH 2Q20A 4M43L 1JCKA 5C0AB 2O5ZH 1CGTA 2R1YB 4N1EA 4XP6L 2ORBL 1UM5L 4DFHA 2ZOLB 3O3DA 2NYYD 2J88H 1TNNA 1RV6X 4K3HA 4L9LC 3KJ6L 5FYJL 4IOFC 4MZ3A 5IQ9B 1D5MA 1IGYA 2F74A 4UMGA 3W11C 3U46A 4U1SA 1L9MA 4HWNA 1RQ5A 3IDMA 4WO4A 3RY5A 3G6JB 5DJ8B 1QPXA 3SCMB 1XF4A 2DBLL 4X7DC 3IGAB 1ES0A 3LN9A 4LLVA 3MRDB 4DGYL 4FQXB 2YHGA 3AB0B 3JWDL 4LSVL 4LCCB 1OAYL 4N0UA 3QQNA 4RQQB 1H3TA 3HC0B 1U95A 4GKOA 1J1OL 2V17L 2DF3A 2C4FT 5J4MA 3QQ9D 2ED7A 2L4OA 4WTXA 1D9KC 1D5BA 2KL6A 4KUCD 1QO3A 1A7QH 1QFPA 3JWNC 1LEKA 5A2FA 4MNQB 4U6VL 5JXAH 1F6AA 2VDPH 4O2EA 1E28B 1A9EA 3EJYC 4PR5A 3MV7A 2VRAA 1WTGT 4X6FB 1D6EB 1QYGH 4AYFA 1YYLL 3FQNA 4ZS6C 2CRZA 4U1JB 3MODL 2HRPH 3BN9D 1GHFL 2C3VB 5BRZB 3EUUA 2EDTA 1MF2L 1NCCH 5L2KB 1G9NH 4C83A 4DAGH 1FVEB 2AV7A 4UDUB 2NW2B 4HS3A 5DJYA 1C7SA 1KJVA 1DSFH 2C26A 3ORJA 3QCVH 3UC0H 5KTEL 5CEXB 3OL2A 2FWOA 4XRCA 3N1PC 1IKFL 4HDIA 2ZSVB 2C1PB 1FPTL 4HIIA 3I6KA 1JF5A 3GB7A 4DQOH 1B2WL 1K8DB 3PJSB 3GBNH 3KNBB 3AMKA 4U0RC 3D69B 4Z95H 1R0AH 5CLTA 6FABH 1CBVL 1MJ8L 4U1HB 4Y5VA 1YNTA 4YIQA 1ZT4B 1ZTXH 2W9EL 4JRXA 4I4WA 5IK3B 4RGOL 4GRWE 5DVMA 2ESVA 3FT4B 3HC3H 5FFLA 3MLPA 4IOSD 4Z5RA 4MMXC 5FCUL 3O3AB 1NEZG 2CLZB 5LAXB 1HHKB 1FNAA 4BFGA 3ZO0A 4NCC2 3OKLA 2F53A 1NGPH 3DMMA 5FO8B 1NCWH 5F89A 3RVVC 4FOMA 3NZHL 3A6CH 5EOQL 3CVIL 4PJGB 4HCRH 3DO7A 4Z7WB 3ZKXB 1ACYH 4HJ0D 3SDAA 3O6FD 4NJAH 3NCBB 3X13A 2UYLA 1G7LA 1PBYA 1A6TB 4IOIA 2ITDA 5HJ3A 2ZJSH 3VH8G 4LHUB 3K2UH 5ACMA 4UT9H 1JGVL 3IRZA 4TN9A 2I9TB 4M8VA 4JFQA 4CKVX 1AY1L 3EYOA 1G7IB 4JDVB 2XTJC 3TO2A 4CJ1A 1XCQA 4FQ2L 1ODAA 2VXTL 2DOCA 4HUKB 2NY5H 5CILH 4PB0H 1EXUB 3GHBL 1MHPH 1U3HD 1MI5D 2Y25A 3LV3A 2W9LA 3O2VH 1GIGH 5EU4A 5GGQH 4MB5A 3ILQD 1G7PB 2Z0BA 3NZ8B 1KG0B 2XWBB 2WV3A 1LO0H 4LAQL 1QSED 5J6HB 1FAIL 2Y1VA 2EC9T 2FR4B 3RBSA 5HVHC 2YSSA 3P40A 4UT6L 4Q97A 4MA3A 5HHOA 2G9HA 4DUVA 4P46A 5KG9A 4NQEA 1BQLL 4PJBB 1JPFB 1RZIB 3MRKA 4PJHB 3KYNB 2FIKB 4HGMA 5FHBL 3TJHD 1FO0B 3SDXF 5IOPB 5KVGL 1MJJB 1INQA 2P5WB 2VABB 1CDIA 2YUZA 3CZFA 1MI5E 2APXA 3MV9D 4F7TB 1YUHA 2IPTL 2YMXL 5TE4L 4QY8A 1JI1A 4CVXA 4GS7C 5GIRB 3UP1A 5IM7A 4JZJB 1QSEE 5DJ0B 4G43B 5E1HB 3BMWA 2KZ1B 3EOAB 1CK0L 3HE7A 3PXJA 5DZOA 3TN0B 5DK2A 3H3PL 4JFHD 3AM8C 1IZJA 1PYWB 3GKWL 1KCRL 3GMLB 4QKXB 3AY4C 4MXQC 5ITFB 3BRFA 3DVIA 5HYIA 3IU4H 2WBWB 1U8MB 4PRDA 3UPAA 5LGJB 1HE7A 3ETBF 3UYPA 4XB7A 2P8MA 1SEQH 1OAKH 5D7JA 3UX9B 1DCLA 1MIMH 3TM6A 2MWCA 4PRID 5I74B 3NN8A 1GC1L 3SGJA 3WNLA 4TYUA 3HS0A 5CZKA 5INDA 4LMQI 4U6HB 3T8XB 5DK3A 2PW2A 3GBLA 4YZFE 3IT8D 3CD4A 4MSWA 1E6OH 4GBXC 1IM3A 4ELKA 1CLZH 1I3GL 4JFHE 2IQAB 5M95B 4YHMH 3BKYH 3ISWA 3MUGA 1O5DT 4V1DD 1T66D 5JW3L 4YWGL 2ADIA 3MBEB 5ICZA 4YFLI 1NMAH 4NRYB 1YDPB 1J9CT 2F58L 4HMDA 2Z31D 3GHEL 4H26B 4I5BB 2DQEH 5DR5L 2Z92B 1FNLA 3RA7H 2R9HC 1MRDH 4H8WC 1EFXD 3CXDH 3H7LA 5CP7B 3WIHA 3BP5B 5IMKB 4TOYL 2X05A 3W11D 2AV1B 5JW4M 1UCTA 3DUHA 1AKJD 2WLYA 3LS5L 4X7FC 5IFHH 2OMNA 5I0ZA 1V7NH 4PRIE 4LQFL 4OQTH 4PGBB 3VWKA 3CFKB 3PWLB 1DQJA 4UB0L 3ZYOA 3WIIH 4NRXB 5JDSB 4R96B 3BPLC 2AK1H 4KKAD 4OUUB 5LWYL 4W70A 5HHQB 1V7MH 3DGGB 1UZ8A 4YDLC 2HMIC 4AEHL 1YEFL 3SE4A 2OJZH 1INEH 1WBXB 4HWBL 3QI9D 4TUKL 5D7SH 4HW6A 4I0PB 4V1DE 4ZXBC 4PJDF 5E95B 1XGPB 5CCKH 6CGTA 1HZHH 3VCLA 4RGND 4G8FB 2YR3A 3VG9C 3EO9L 5DD6B 4QYOA 1CGVA 2W65B 4OLUL 1VFBA 1OAUL 4WDIB 5CHNB 1MPAH 1X6LA 4JGUA 2EDDA 4YXKL 1GPOL 4OZFG 3Q0HA 4YPJA 5B3JE 4NC2B 1KACB 4XWOC 2YPVL 3V6BR 5D96B 4M6NH 3C09C 5IGXH 4TTDD 5C08B 3RU8H 5I1DA 3KPMB 3GMPB 4YX2H 3EJYD 3RRQA 2YK1H 1KB9K 3U2SB 4U1MA 2DDQH 5HY9A 1QEWB 3CFDA 4JO3H 1PSKL 5KSAA 5FV2A 4RMVA 4O2CB 4F33B 4PYHA 1EPFA 4MVBC 4UIMB 2VZUA 2Y9RT 3QUXB 1PX3A 2CJUL 3QHZH 1XIWC 3PWUA 1FN4A 4YDJB 3RZWA 4FQPA 2Q6WA 3AROA 5D1XA 4NIKB 4RGNE 4ONHB 1FBIH 4XMPL 1FZMA 1FO0H 3ALXA 1OY3B 5B39B 5GS2H 3QNZB 2VE6A 5D6DA 3I3BA 2FJFA 5DD0H 1OL0A 1AHWC 1MCCA 1ZMYA 1YQVH 3KLSA 3MOQA 1TVDA 1WJ3A 2BNQB 5DJDB 4ELMB 3VG0L 4RNRA 4NO0A 4Y2DB 2JB6A 3PHQA 1X5KA 3HAEG 2OL3B 4KTDL 1RZKL 2DYPA 3BGMA 3GMOB 3N1FC 1P84K 3AFLA 4HUXA 5EU6D 4KFZC 4X98B 2X7LA 3BYTA 3DVGB 3QFDA 4P3CH 2OJEB 4QHLB 4HPOL 5D4QA 3UZEA 4AH2B 3WJJA 4Y19A 4LLMB 4GMSH 5F44A 5C3LD 3W0WD 5I1IL 1CXLA 4BQ6A 4P4KC 1T2QH 3QCUH 4KV5F 4KTEH 4PTUA 4BA8A 1X5ZA 5IROA 2FBJL 2ICEB 1IQWH 2XWTB 4Q74A 2AI0L 1IL1B 1LNUB 4HIJA 1EZVX 3U0PB 4Q9CA 5J9PA 1UEYA 1F3RB 3WFCH 4NQDA 1LD9B 3RPIA 5FOBB 1XF3B 1Y6MR 5DJCA 3HNTL 4DK3A 1PZ5B 2H8PB 1UH4A 4X4XA 2ZCHH 1QLFB 2E7LA 1RZFL 3OWEA 5EU6E 3QQ3A 1IGMH 2HLAA 3P73A 4NNYB 1H3WM 1GZPB 4AIOA 3BRGC 3W0WE 2DQCH 3VXUD 2R0ZL 4JFOA 5TPWH 4EXPX 2ENYA 4G80A 5D5MA 4BFIA 5F9JA 4GKNB 4TVSa 3S5LB 4TRPH 1UVQA 4U2YA 2VAJA 3AXLA 3IDJA 4PJ9C 3TVMD 4LBEB 5HGGS 5L88L 1C08A 3MV9B 4XI5C 3SO3C 2B5IB 5DQDH 5GS1C 5DMIL 1B6DA 5GGSA 2DL9A 5MEPB 5FGCE 4FQLL 5CEZH 5AAMA 4QCIA 2A9MH 1F00I 1XR9A 1T1ZB 1KCVL 2BJML 4UU9A 2I5YL 4GG6E 1RFDL 2C1OB 4TSCH 4G5ZL 5LJYH 3VXUE 2DD8L 4XPHL 5LKNA 4HKXB 2EDLA 4NC1E 4UV7H 3L3DA 2DQJH 2AAVA 4XPAL 1MNUH 3K46A 1T2XA 3GMQB 4PJ5B 4OV6F 1B6UA 4ORGA 2HKHH 3Q6FA 2W07A 1T04B 5FO9B 1F2QA 3QISA 3K7UA 3U36B 4JN1H 1IC1A 2AJSH 1VADB 2E6QA 1QSFB 3RHWK 3WJLC 4ZTPL 4UNUA 3FB6B 4M4PA 1CICD 1PGRB 3V6FB 2XKUA 2PW1B 4KI1A 5DEGA 5I75C 3PGDA 1MUJB 1ADQL 3B8SA 3RWFA 1VEOA 3QXAB 4RFOL 1G9MH 5I0DA 3O2DA 5ISZA 1TPXB 4LSQH 3EO0B 3S88L 3HPJB 2H3NB 1CD1A 1BVKA 4H25B 3CX5K 4OGXL 5DMGC 2AXGB 3VI3E 3QUZD 4LVOC 4RX4A 4D0CA 1CFQA 2EXWC 2VLKB 4YHYC 4NP4L 3JV0A 3ARUA 1U8JA 4X8JB 3U4EA 4NQVA 5IJKC 4KMTL 5EOCH 1A3RL 4J12A 3L3OA 4K3DH 3ULUC 1L0QA 4FZ8H 4GAGL 2XZQH 3LQZB 4XHJC 1GGBL 1TETH 4XVSH 1Y0LB 5EN2A 1WAAF 3BQUB 4JFFA 3TBTB 3SKUD 3MRBB 4D0DB 5ERWA 5DVLA 3OXRA 1WC7A 5DK0A 4NT6B 4MJIA 4NN7C 5C0BD 1PKQB 2Z4QB 5FF6B 3AAZA 2IAMD 1YEIL 5EULV 4J3XA 4X0KA 3RZCD 4GKZA 4RGNB 4MD5A 2V7HB 3O9WB 4OFDA 4HQQL 2ZKHH 3CSYB 2Q8BH 1G9EA 3ARED 4KY1L 5CMAA 2CK0H 5CSBA 3HG1D 2Z91A 3GSOB 3VXMA 1OW0C 2FJHB 3FZUC 3FFCD 3DI3B 4ZOBA 5KANI 1B0WA 1YN6B 1ERNA 4LSTL 3ULUF 3H9SD 3MFFA 4NHUB 4YFEA 2XN9A 5CZXC 3WNKA 1XT5A 3GSNH 3OR6A 5FYKD 3ESVF 1IRAY 5I76B 2X4UB 2J8UF 4JAMA 4ZOAA 1T22B 5C0BE 1NFDA 4Z7UA 1YY9D 3NFPA 5GGTA 3SDDB 4E42A 4QNPE 5BV7C 4P5TD 4PY8J 1L0YA 1EUTA 1B0RB 3KPRD 5FO7A 3VWJA 5C0RH 1DUYA 1A6UH 5I15L 1I8KB 4XNUL 4WI3A 2XICA 5KJRL 4O9HH 3IKKA 3MBXH 3RVWD 3HG1E 3L7EA 3N0PB 4AEIH 5ANMA 1UKSA 3QNYA 4X6DB 3FFCE 2DS4A 1D5IH 2R2HA 4XP9H 4APQD 5JOFB 3QIWB 1UG9A 3H9SE 1KN2L 1BOGB 3E8UH 4AENA 4H0HB 1WEJH 3OX8B 1SJHB 3VJ6B 4PY7A 4DKEH 1JYVA 1CLCA 4P9MH 3UYRH 1X7QB 5DJXA 5JQ6L 5IQ7L 3PWPD 5J3HC 3CH1B 3JV5A 1P7KA 5IKCB 1WWBX 4KK8C 1BZ9B 5HGAA 3ARBC 1KENH 1AGDA 5E2UL 2LE9A 5ADPL 2E6JA 3BGFC 3QNXB 3KPRE 4K07A 1JHTB 4R97B 1MLBA 3PGFL 4LPCA 4XCCH 4ODTH 3HNVL 4P3DB 3TYFA 1XGUB 5BS0A 3T0DA 4JFPB 3RAJH 4L1HA 2NY1D 1OOAA 1RHHB 5ESQA 1KIPA 4K9EH 3OXSA 2WW8A 2D7MA 4Y4HA 4I1NB 1PKOA 3W39A 5HYJB 1HOCA 3NMEA 2YKLL 3S6CA 4U05A 3QRGH 1JPSH 3U48A 3WFEH 1IGTB 1LO4H 1F42A 4GRMB 2X9WA 4XBEH 1JZ2A 2EE6A 1EGJA 3REVA 1U92A 3LKNB 3MLYH 1NC2A 1NCUA 1WIOA 4PS4H 1CLOL 5C9JB 3VXQB 3PWPE 4YHIA 3BYYA 3DOSA 3VFNB 2DMCA 4JFYB 1BWWA 4KPHH 3UJTL 5LXGH 3QEUB 5HDQL 3NGBB 3C6LB 4IDJL 4OLYL 2NY4B 1DQDH 4G6KH 4MA8H 2X1PA 1RZ7H 1YPZB 5DRWB 4P4KD 4BSWA 3UTTB 1J0YA 3DROA 4ODSL 5EPMB 4NOBA 3GRWH 1DTUA 3BIBX 5CD3A 2X4PB 4R90H 3U7YL 1PG7W 3P4OA 4EN3B 3GI8H 4MXVF 2P5ED 2HAZA 4OZIB 4KDVA 5C0DB 2VQ1B 3VFMB 5ID0B 1RJLA 3GUTB 3MRIA 2GCYA 5J12B 3T4YB 4LARL 2GI7A 1RURL 1JV5B 4PRHB 5IBLD 5DFWH 5CS7A 2I26N 4JO2H 2A1WH 3ARTA 1WT5A 3FAXA 2IF7A 1OTTC 5GRUH 1WK0A 4MB3A 3B5GA 2VQUA 3LHPH 4D0BB 2VXUH 4X7SH 4FG6D 2ZOKA 1D5ZB 2CDGA 4J3UA 4LCYA 2WK2A 1JZ5A 4GRLC 1LP9A 1TQCC 2P5EE 4WWKC 4KRPD 3ZDYF 3G5VB 3LQAC 3KPSD 3SKNA 1RU9L 4I2XE 5EC1B 4P9HL 3UTOA 1Z5LA 3JUYA 2IPKB 4XP6H 2ICES 3EYFA 4M1CC 2ORBH 4KQ3L 4UDTB 1WZMA 1ZXQA 4JZOA 1IGJA 4F7CA 5HGDA 4BQ9A 1LILA 4M5ZL 1T4KB 1R5IA 3FQWB 4UI2A 5ICYB 4PB9H 1TVBB 1N8ZA 1TJIL 3QUMH 3QB7C 1U8OA 1OWWA 3HI6L 2OSLB 1FC2D 1P9MA 3S37X 3VFTB 1HKLH 2F19H 1AI1L 3U6RB 2BVTA 3DXAD 1F4HA 4NM8H 4EDWL 3KPSE 5JW4N 1S7WA 3TZVB 2WBJA 1BVZA 1U8LB 2RFXA 3JWDH 4U7MA 4LSVH 1FLTX 4ZDHB 3SDYH 12E8L 1U8NA 2R0KL 5MEND 3GSVB 5DYOB 3SJVD 4JGMA 1U93B 3I9GH 1OD7A 3BPOC 1NFIA 2X1WL 4UTBH 4QHKI 3FTGA 1XGTA 3M1BA 5JR1L 4F8QA 1WV7T 4L4VD 4M1DL 3S37H 4NOFA 4WRLA 3ILPB 1TQBC 2Y5TA 1IAIH 2UUDK 1N4XH 1EMTL 3BUYB 1FFPB 2FX8H 3NCFB 4D8PB 1KJMB 1K3IA 1P7QA 4G6JL 1RZJH 2EDWA 4P0DA 5J56B 1A21A 3OHXB 4PRPA 4JKWA 1Q0YL 2HLFC 3TIEA 3RI5F 5HDLA 4K8RH 3DXAE 2FGWH 3ARYA 3QAZB 3CDYA 1GHFH 1P4BL 4S1RL 5DO2D 4DK6A 3C08H 4HKZB 5MENE 3SJVE 4WU5A 1FL3A 1IGIH 4PJAE 5B3NA 5IB4B 2D3VA 3MUZ1 1L7IL 2OL3L 7CGTA 2HN7B 2DWDB 1I7UA 1N64H 4JFXB 4L4VE 5TQ0L 4LIQH 2EE3A 4O4YL 3VMPA 2Y6SD 4GW4A 2J4WL 3W82A 3G6AA 3DX8B 5T3ZH 5BMFH 1RK1B 1NCAL 4P5TB 5I8EA 3VXPB 5INCA 5ITBL 2R1YA 3MC0A 1V05A 1SVZA 1NKOA 5F1KC 4IRSC 3MRGB 4U1IB 3S7GA 3RTQD 1BPVA 5T1KD 4KUZH 3U82B 1U42A 2J5LC 4ENED 4Y5XC 2X4OB 5E24E 5DUPL 1XGRB 5KSBE 4JZNA 5HYQB 4Z7OE 4WI6A 5HVGB 1KXQE 4FFZH 4HC1L 4ODUB 3V5DA 3G6JA 5DJ8A 2C7UB 2GT9B 3SCMA 1QG3A 1BJ1J 2Q87A 1A7NH 3IGAA 3BH8B 2Y36H 3MRDA 4U1KA 4B7LA 1IQDB 4FQXA 3IDUA 1LE5A 5DVKA 5D2LE 4MHHG 4H88L 1FP5A 2BRRL 1A6WH 3HC0A 3Q1SL 1BEYL 1T5WB 3DI2B 3IJYB 4XXCC 1OAXL 1FGNL 4Y16B 1RJYB 2AP2A 4TSAL 2NTSP 3ZT6A 4L8DB 4PJ7E 3NABL 3TA3D 4WHTB 3QCTL 4MNQA 2L0DA 4WFGD 1G6VK 3PHSA 3ZE0F 1SBSL 3DNKA 3UEZA 1YEHL 1E28A 1YNKH 3FB7B 2A6DB 4MNHB 3G6DH 1DBJH 3ARFC 1D6EA 3CSBA 4R7DB 2X9XA 3KPQB 3HPLB 5CJ5A 4U1JA 4FQ2H 5C6TL 4XPTH 3QUYC 4K71C 2A0LD 2C3VA 3T0WA 5BRZA 4FHBD 3CXHJ 3VGEA 1B3JA 3GHBH 2XA8L 5D8JL 1MEXL 1AXTH 1KPRB 2J6EA 2JCCB 1FVEA 5I73B 1Q38A 5JW4Q 4UDUA 3L1OH 1OSPH 4XBPB 1F6LL 2FATH 4ZUVB 4JY5L 3WS6A 5IB5B 5LGKA 3BHBB 5CEXA 2A73B 1A9BB 2F5BH 4WFGE 3DURB 1A7PL 2UWEF 2ZSVA 2C1PA 3RJDA 4HUWB 3CUPB 3MV8B 2RBLA 1LQSR 1K8DA 3PJSA 4XMKL 3KNBA 3D69A 2FCBA 5DMJB 2IADB 3QFJD 1MFNA 2EEDA 4OF5A 2NR6C 1NMCC 4ZUTB 5K9JL 1KTKE 5DT1L 4OZGB 5IK3A 2AERT 2YUWA 4PJEF 1OP3H 5IB1B 3EO1B 5C92A 2RQ8A 3FT4A 1AO7B 1KLUB 3FO2B 5CJQH 5GRZA 3D1MC 4LPUA 4QGTA 5IVXF 1G9NC 3O3AA 5JHLL 1JUFB 2CLZA 5LAXA 4R4FL 1HHKA 4PJFE 1FL6B 1QBAA 1FVCB 3H3PH 5FO8A 4F9PA 4YBHA 1AP2B 3ES6B 3B4NA 2N4IA 1UM6H 4PJGA 1HINH 3QFJE 4Z7WA 4YNYB 3C5SB 2GITB 1XGYH 2DKSA 2PYFB 5EBLB 1M4KA 5DRXA 2QHRH 4H5SB 3L5XH 1A6TA 2VIRB 1MCPL 1A7OL 5FYLD 3KYOB 1NEZB 2WAHA 2YWZA 3K4ZA 5FM4A 1T89C 5EUOE 2OP4H 3HRPA 4LHUA 4XTRD 3TV3L 4NHCH 3K4DA 4RZCB 3CSPA 5C09D 1G7IA 4JDVA 2C3XA 1UM4L 2OK0H 1J8KA 1EXUA 4XX1G 4RFEB 2JIXB 5E9DB 5E8NB 4RWYL 2D7QA 1IC4H 3LD8C 1G7PA 3NZ8A 3RWIB 3SE8H 5E08L 1KG0A 2XWBA 2AVGA 2F58H 5J6HA 1BZ7B 1U3ZA 4PJAB 1JPTH 1Q8MA 4GXUM 2M2DA 5FCSH 3SE9H 3QXTA 4LASL 5CIPB 5FYLE 2UZXB 3MCLH 5I16B 1S7XB 1WISA 2BOCB 4PJBA 3RL1B 1I1CA 5E94B 2ZUSA 4HK3N 1JPFA 3LS5H 4UIKL 5BJTB 1RZIA 4NFCA 4LQFH 4Z7QF 4ODXA 5C09E 3OKDB 4PJHA 1OPGL 2FIKA 3KYNA 4JLRB 4UB0H 3HUJB 1FO0A 4U4BA 5IOPA 1REIA 3BH9B 1BX2B 5LWYH 1MJJA 2P5WA 2VABA 1WWCA 4ACPA 5E70A 4ZD3H 2D7PA 1Z3GL 3FO0H 4F7TA 2QEJA 5L7XL 3QHFL 5F7DB 2NTFB 1WZ1L 5GIRA 4JZJA 5DJ0A 4G43A 4WCYL 4FQCH 3IFPB 1GOGA 1RIHH 1TXKA 1UACH 2YD5A 5BOZG 3MLUL 3V0VB 3EOAA 4OFPA 4GAYB 2V9TA 4JVUA 5DURD 4YXKH 1GPOH 4G6AD 3THML 4LP5A 1PYWA 3TO4B 4PJIF 2ZP0T 4J4PA 3GMLA 4UBDD 1RUPL 5GZOD 4Y5YC 3HE6D 5LGJA 1J7VR 2HG5B 2FIRT 4U2ZA 3T0AA 3B9KB 1UB6B 4UNVA 3QPQC 2WUBH 4TNVK 5A2KH 3DHMA 4UQ3B 2VDQL 4HK0B 4L3AA 3LIZL 4QLRA 3MXWL 5IMMB 3T8XA 2VN7A 4J1UA 3ZT7A 2IBZY 2VAAB 5EWIL 4S1QL 4KKNA 2IQAA 1NL0H 4YHNB 5B4MD 3IFNL 2DIBA 3BAEH 5DC9B 5BZDB 2MFNA 1PLGL 4NRYA 2ED8A 1AQKH 1YDPA 4NZTH 4RBPH 4H26A 4I5BA 5D7IB 2Z92A 3CVHL 4BYHA 2BFVH 4RMQA 5LCVL 1N0XH 5CP7A 3P0VH 2Q7YB 3TC9A 1A3QA 5IMKA 3INUH 2AV1A 3K4AA 1OM3L 3ZTJG 4TUJB 1ORQB 4PGBA 4J6RH 3CFKA 3PWLA 4EI6B 4MLSA 4LSPH 4NRXA 5JDSA 1A3LL 4HPOH 4R96A 1C12B 4OUUA 4LSRL 5GHWL 4MQSB 4XCEB 3IJHB 4K94H 2PO6D 3DGGA 5E6IC 1K2DB 2QADD 3L3HB 1WBXA 3D0LB 5FDYA 4I0PA 4UUJA 4R3SB 1XGPA 4IRJB 4HT1L 4HH8A 4FQIL 3VGHA 2AI0H 4G8FA 5I71B 2L7JA 4U1GB 4QTIH 5GRVL 2YPKB 5DD6A 3NA9L 3BPNC 2W65A 3JUZA 1KT2A 3HNTH 4KZDH 3SQOH 2DM7A 1DFBL 5HYFA 1RMFL 4ZMAT 3LAFA 2K9UA 4LVNB 5C08A 5F9OH 3KPMA 3GMPA 4IMKA 3VGFA 3VXTB 2R23B 1Q0XH 3P4LA 1PY9A 1QEWA 2P1YA 4LRIA 4XVTH 1Z9OA 2VSCA 3B9VA 4O2CA 2PTUA 4F33A 5HI4C 4UIMA 5IFAL 1MCEA 3QUYD 3A6OA 3CDGB 1ZS8B 3IDIA 4WEBH 3QUXA 4MD4B 3R8BB 4MXWL 2VR9A 4YDJA 3VGGA 4JFZL 1H5BB 5C07D 2HH0H 1PW3A 3OB0H 5HGBB 5L88H 1MVFA 3O4LD 4ONHA 5EDXA 3NOIA 1YEJL 2AJZB 3TJEL 3FOMB 3SGKA 2APFA 1BJMA 4NZJA 3I2CL 5B39A 3QNZA 3MGTB 1G0XA 2BNQA 3V7AG 4ELMA 1S5IL 1HH9B 1AE6H 2I5YH 3OBAA 3SE3A 2DM3A 4FA8A 5A1AA 4Y2DA 4HS8L 4WY7H 5FM5O 5GPRA 4XPHH 5GISH 3K2MC 3PP3K 1YJDC 2GJ6B 3GMOA 4X98A 4MZ2A 3EDFA 3EJJX 3DVGA 5GRVK 2NY0C 1YECL 2OJEA 4L3ED 4QHLA 2YA0A 5C07E 4AH2A 3L3IB 4UT7L 3O4LE 4YXHL 1QFUH 3S3SA 1F3JB 2Y4SA 4LLMA 1LEIA 1C8PA 4ERSL 3W81A 3L3GB 1CF8L 3VGBA 2CIIB 5MI0C 3U0WL 3GI9H 4XPFL 3ARGC 3WYRA 3EYVA 2HJLB 1VB9A 5F21B 3HAEB 1EEYA 3UAJD 2XWTA 2IH3B 1IL1A 1LNUA 2EIZB 1HQ4A 3U0PA 3OG6B 1U2HA 5K9QI 1UJ3B 1ED3B 3OF6D 5FOBA 4EBQH 1XF3A 3WO4B 1FNHA 5FYKL 4AY0A 3IF1B 3IFLL 2H8PA 1QLFA 2DLFL 3VRJA 4YDIL 1AGCB 3EOTH 4J2XA 4M8QB 4OGXH 4L3EE 4IJ3C 3DSFL 2Y5EA 4NNYA 1J1PH 1X6NA 1EAJA 1I3RB 4TQEL 1SM3L 2CIKB 1GZPA 1BJ8A 1FNEB 3MUHL 2BMKA 3PL6B 3QDMD 4OFYD 3C60D 4BSVB 4WNQB 4GKNA 3S5LA 5FA3B 5L2JB 3PP4L 3R1GH 2M26A 2HT3C 2WLZA 1FYTD 4LBEA 3ZYIA 1X5YA 3LS4L 4Z7VB 1SY6L 2EYSA 1OP3K 1A14L 4LGRB 3RUGA 3TIDB 5MEPA 3WFZA 5FHAH 1K4CB 3IAQA 5T5FH 3QHTC 4PRNB 2DM4A 4QRRD 1VSCA 3C8KB 4XP5H 2OBGA 1T1ZA 1ZLVH 3CMOH 3WLBB 4Z7QE 2LAAA 2C1OA 3UTQB 3QDME 1FV1B 4GXVL 2VR4A 4L4TB 5E5RB 4NWTH 5CZVH 1RK0B 2CUHA 3LKRB 3NH7H 3MXVL 3WKNA 1FYTE 3GMQA 1LO3L 4PJ5A 4KZEH 3KVQA 1I7TB 1YEKH 2BSSB 4CRPA 2YA1A 2OTWB 4NBYB 3LKOB 2WMPA 5GJSH 1IEAB 1LO2L 3O8XC 5B8CC 1UENA 1T04A 1ZGLP 5FO9A 4PJCB 4N9GB 5AZEH 3U36A 1ITBB 1ZVHA 1R3KB 1VADA 1QSFA 1RUML 1YMMD 5IT2H 4MCYB 2FGZA 3UJJL 3FB6A 4QRRE 4HIHA 4I3RH 3V6FA 2HWZH 2PW1A 4BKLB 5IWLA 2NLJB 2BVPA 3CMGA 2WINB 4JHZA 1S7RB 3LN5B 3S34H 1CIUA 1IM9B 3LZFL 1GRWA 3QXAA 4RDQG 3MFGB 1HILB 1KN2H 5IP4A 3EO0A 5EBWB 4AQOA 3HPJA 3GRWA 2IFGA 2H3NA 5D9SB 5F6HI 5GS3A 1DBKL 3X3FL 5E2WL 4LSUL 3C8DA 3S8WA 4QRPD 2AXGA 2NXZB 1R5WB 3MRRB 4UILL 1OAZH 4KK5D 5I6XB 2VLKA 1VFAB 2HTKD 1T3FB 4X8JA 4GKSB 5ADPH 1NANH 3V6OA 1CGYA 1IGFL 4KJQC 1VFOA 5D2NE 5TE6L 3UTSD 2DQUL 4WU7A 1O7SA 4Y1AB 1I1AD 3D85D 2FZ3B 2I07B 3MQIA 1YMME 4EKXA 3LQZA 4CU8A 1Y0LA 1QFWM 5TH2B 1TJGL 3U1SL 3BQUA 2PO6B 3TBTA 5JMOC 2B0SL 3MRBA 4D0DA 3BO8B 2JELH 4NT6A 2AJ3B 2Z4QA 5FF6A 4UOW0 3KYAA 4M6ML 1E6JH 1YZZA 2NY7H 4M4RA 1RUKH 2V7HA 3O9WA 4HKJB 2VUOA 4LLQB 1INDH 3CSYA 1CT8B 1BAFL 2W0LA 4JFED 1G9MC 4QRPE 1MCNA 1AGEB 1HHGB 1RIVL 2CKBH 2EDJA 3GSOA 4PGCB 2FJHA 5HDQH 2CDEB 2NY3C 1YN6A 5C0FA 3UTSE 1K6QL 5A16A 1ZEAH 4IDJH 4NHUA 3G5XB 3RQ3A 4NNPL 5F7EH 3C5ZD 1MWAB 3V52H 4NUJB 1PG7H 5I76A 2X4UA 4YEEA 1W0VB 1T22A 5EA0L 1RULL 5C0CB 3SDDA 1FFOB 1O0VA 2R69L 1VFUA 1UCBL 1B0RA 2APWA 1NAMB 4XC3L 5L6YH 2OX5A 1I8KA 3QUMA 3VXSB 5CWSB 1NCDH 4JFEE 4Q6IC 1BVLB 1RVFH 4RA0C 2DJSA 4X6DA 2IH1B 3QIWA 4OFVA 3HE7C 1MQ8A 4YBLC 1BOGA 3OX8A 3VJ6A 1SJHA 4JM4H 2HKFL 4KKBD 5B21A 1DQMH 1X7QA 5HPOA 4KXZI 3G04B 3CH1A 5IKCA 1BZ9A 35C8L 5F3BB 2HFFB 3QNXA 4KRMB 1JHTA 1BGXL 4G8GB 4L3EB 3VW3H 1KB9J 3QIUD 3HFMH 2BVOB 4P3DA 4OZHE 1NBVL 4JFPA 5F9DC 3ULVH 4PJ8C 3SGJC 1RHHA 2ZWLT 4N8PA 5EU5B 5C71A 4ZFOB 4P2OC 2AK4B 3PDOB 5HYJA 4CU6A 5ADOL 4CVZB 1UH3A 4GRMA 3U4AA 3L9RB 1MFDL 2MTPA 4LVEA 4GRWH 4JRYA 2X40A 3LKNA 3EFFB 5C9JA 1U2CA 3VXQA 3U4BL 1TJIH 4A6YL 3VFNA 4JFYA 4LCWB 3HI6H 3QEUA 2NY0D 4GXUN 2OZ4L 4ZUWB 3C6LA 2XXMB 1EK3A 1ZHKB 5EIQA 1YPZA 3QG6B 3UTTA 4E5XB 3PUCA 5EPMA 3F58H 3O6LL 4NRZB 5F96L 3VFGH 5GS0C 4YE4H 3C60B 4WO4D 1QFWL 4OLZL 2X70B 5FUZL 2VLJB 4OM1L 4EN3A 2X4TB 2QKIB 1P84J 3IVKB 3SKJL 3KHOA 1WF5A 4MNGE 4OZIA 1C1EL 2PN5A 5LBSL 5C0DA 2VQ1A 3VFMA 3GUTA 2IC2A 3CFIC 3T4YA 3Q5YA 1J8HB 1JV5A 1T1WB 3T1FB 4PRHA 3G5ZB 4XVJL 3RVUD 1QKZL 1MCFA 4YFLF 3LEXB 4FP8L 2ICWI 1I9IH 1G7MB 1FE8L 3TH4T 3MV11 3MGOB 4D0BA 3PHOB 4S11A 2AJUL 1BQUA 2NCMA 4YJZL 1D5ZA 1WBZA 1HHJB 3GJFH 5ENWB 3NACH 4CN1A 4ZO7A 1URLA 2AEPH 3BSZL 3MV7D 3T0EC 2HT3D 5F1NB 4ODVH 2IQ9H 4BH8B 4X6BB 3WNNA 4ZO9A 3F8UB 3IJSB 3G5VA 2WUCL 1ZVYA 3LB6D 1FL5B 4Y4KC 5EC1A 4R7NA 4YAQB 4FXKA 3ZDXF 2QSQA 5TDPB 1D9KB 4UDTA 4X6CF 3BI9X 2Y23A 4D2NA 5E8PB 2P45B 2E27H 2OR9H 2H2PD 5EFIB 3DRTB 5DUPH 1T4KA 2H26B 1JHLL 4NZRL 3FQWA 5ILTH 5ICYA 1TVBA 4QHKJ 3QWOB 5J11C 4LK4A 1V5JA 3MV7E 3VFTA 1DLHB 5E8OB 3RY6C 3KDMB 3CFEB 2FX9H 1IKNA 3U6RA 4YC2B 3WDJA 3K8LA 2R4SL 3TZVA 1U8LA 2P48B 4ZDHA 4F3FB 3KPTA 1JYNA 3GSVA 5DYOA 1U93A 2ESVD 4R26L 2HFEB 4C4KT 3O3EB 1BEYH 2W0FB 1I8LC 2WIIB 2VDNL 5AWNL 5DUML 4RAHA 1FCGA 4MA1C 1NCTA 3NABH 3P30L 2GHWB 3ILPA 2F53D 4C4KO 5IMLB 2X6MA 3DMMD 4U0RB 3CFJB 5BW7A 3LN4B 3BUYA 1FFPA 4D8PA 1MAMH 2YD9A 3TCXA 3TCLB 5HHVH 1S7TB 5C3TA 1LGVA 5GZNC 4U1NB 3OHXA 5DDHB 3D2UA 3SDAD 5EORH 2NY6D 5TFSL 5E0QA 5A3ID 2RR3A 2WQRA 2R1WB 4FFVD 4QT5B 4DW2L 4HKZA 1KC5H 3WD5L 3Q5OA 2BXZA 3CGTA 4QGYA 5IB4A 2ESVE 3ROOB 2Q3AA 1S5HB 1MEXH 5T3XD 1FNFA 4HZAA 2DWDA 2HFGH 2CMRH 4YXLL 1QD0A 3JWDC 4G3YH 4K2UL 3QR2A 3CX5J 4JFXA 1HHHA 1EFQA 5FYLL 3C9NB 4XX1E 5EH1A 3HRZB 3KPOA 2F53E 3DX8A 1TZGL 4CUCA 2W0KA 1RK1A 1FORL 5FKPB 3VXPA 4P23C 25C8L 3D6GA 3HI1B 5EZIL 4P5KB 3MRCB 1WIUA 4U1IA 3MRGA 4MDIB 3GMMA 5KS9F 1BMGA 2C9AA 2PR4H 4OKDA 1XCTB 2X4OA 1XGRA 1RZGB 3OPZH 5HHOD 4RMSA 2ID5A 4P46D 2I60H 4AMKL 2ZUVA 4NQED 2EKSB 3RX8A 1T7ZA 2DIAA 1YEEH 4QXUH 5GGRB 5T3XE 2XTJB 4ODUA 5CBAB 2FJGB 2A6KB 2C7UA 5TJWK 2GJZB 2GT9A 3SDXB 2DQHL 4NQUA 4X83A 4TSBH 1NLDL 3BH8A 1IQDA 1UGNA 1X44A 1FGVH 2ATPB 3CLEL 4YHOH 3JWOL 4MX7A 1IC7H 3ARDC 1IT9H 1T5WA 3IJYA 2Q1EA 4Y16A 5HVHB 1RJYA 2VLRB 4L8DA 1CXIA 3T4AB 5DVOA 3WNMA 4JO1L 4WHTA 3MLWL 3HE7D 5HHOE 5HHXH 1U3JA 4NQEE 3PV6B 3FB7A 3BW9B 2A6DA 4MNHA 3VD7A 1JJUA 2X10A 3KG5A 4R7DA 1WQVT 3UYOD 1MRFL 3HPLA 3K0WA 3QXVA 1R3HB 5A2IH 1UM4H 4NGHL 5D7JD 5JORB 2VLMD 4KRLB 4GS7B 5ALBL 3D39B 4MQTB 1C5DB 3DRQB 4MYWB 1KPRA 2X41A 2EDXA 2JCCA 3BJLA 5E08H 2I27N 4WV1C 4XBPA 4D94A 1FSKC 2EXYD 4U1SB 4ZUVA 4EI5A 4OB5L 5DQ9B 2YD6A 3BHBA 2A73A 4HFUL 2CO7B 4OCXL 3DURA 4HUWA 1KBGH 1ES0B 3CUPA 3MV8A 4ZO8A 4M7LH 3LCYA 5CJXA 1F4WL 4N0UB 3WXVH 2IADA 2HJFB 3J8F7 4F9LA 3Q48A 1J05B 4ZUTA 1TENA 3OJMB 3RKDD 4CN4A 3S3JA 4OZGA 1T7WA 4ZAKC 3S35X 3SN6N 2VLME 5IB1A 3EO1A 1C5CL 3D9AH 3STBA 1MQKH 1AO7A 1KLUA 3OQ3B 3FO2A 4OD3H 3VWKD 3T0XA 2VJXA 4M9PA 4J3WA 4WCYH 2DLTA 1JUFA 4JHAH 4RGMC 3D0VB 4KXZH 1FL6A 1FVCA 2BHYA 3STZB 3TFKD 3QEHA 1AP2A 3ES6A 3MRFB 3IYLW 3S35H 1F4AA 5FUCC 1RIUL 3Q6GL 4YNYA 3C5SA 2GITA 2PYFA 5EBLA 3T0VA 1RUPH 4C83B 5I8KH 3RBGA 4TPRL 1EJOL 4H5SA 2VIRA 2AV7B 2E9BA 1ZOXA 4HS3B 3KYOA 4GO6B 1KJVB 1NEZA 3EIFA 4MS8C 3BPLB 1AQDA 4RZCA 1I85A 1FIEA 1VGEH 4J23A 4HDIB 2EEBA 3T0ED 3NIDF 4YDLB 3CLFH 3MJ7B 5KSAD 1IC5L 3JV4B 4ZUSB 4ZXBB 1S9WB 4XMLL 4S1QH 5CJ8A 4RFEA 2JIXA 3MLVL 5E9DA 5GJTH 4HIXL 4Z7UF 5E8NA 4PJXF 3EJZD 3R8QA 4JRXB 3RWIA 5D1XD 4YHKL 3LRSB 1BZ7A 1WGOA 2W9DH 2FSEB 2CLRB 2BRQA 2R0WL 4FQ1L 4N0RA 3C09B 5CIPA 1NCBH 1U8QB 4Z5RB 4LEOA 1QBLL 5IEKB 4EOWH 2AEQL 2BOCA 3RL1A 1OM3H 5KZCB 4JKPH 1WZKA 4FABH 5BJTA 5MERB 2F53B 3F12B 2E9WA 4LHUG 4JRWA 3OKDA 3T0EE 4JLRA 4WHDA 2CXGA 3HUJA 4RFNB 5F89B 2IG2H 3BH9A 1UC6A 1BX2A 3H3KA 3PXHA 4NO0D 3TEUA 4CNIB 1GC1C 4XC1L 3ZE2E 1CQKA 3IDXH 2DYPD 2UVEA 2RIKA 2BZDA 1F4XL 1Z0NA 1R3IH 3BOVA 5F7DA 2NTFA 1CL7L 3KGRA 1FLRL 3E6HB 3M07A 3IFPA 4Y19D 3MJ8B 2JE8A 4HK3J 3NA9H 1G6RL 1HHIB 3MROB 3V0VA 3KHQA 1ZKAA 4GAYA 3OKNB 3QEQB 1AHWB 3EYOB 5JW5B 5SWZB 2A77H 3TO4A 4LSSH 5IB2B 5F7NC 4NKDB 4G6FB 5FYJD 5DC0A 1LDPH 3WUWB 3LDBC 4NQDD 4LCIL 1QFWI 1DL7L 4JM2C 4F57H 2HG5A 4OCLC 5K9OA 1KB5B 3D87B 3UBXB 1CWVA 4OCYL 5IFAH 2ARWA 2XWJB 1OWRM 4JPIB 2MMXA 3B9KA 1UB6A 3W2DL 5SV3A 4UQ3A 3EGSB 4HK0A 2VKXA 4OIBA 1WT5C 4KQ4H 2ZNWA 1I3VA 3ZTNH 2O5XL 4O58L 5HGHB 5IMMA 3WLWD 4Y19E 4OF3A 1MCWM 5E99H 2VAAA 3MRKB 1DQLH 2GEEA 4YHNA 5AZ2L 5J8OA 3RGVC 3TH3T 4TVPD 4ODHL 5BZDA 2D9CA 3K1DA 2R8SL 5FYJE 4NUGL 3JTTB 4ONFL 4O02L 4KI5C 5D7IA 4NQDE 4JM2F 4K3EL 1YUHB 4DTGL 2AJYH 3VD3A 5FOJA 4EVNA 2Q7YA 3I50H 5IM7B 5HYSB 3OB8A 4AL8H 1U6AH 2NW3B 3HB3C 5I1JL 1ORQA 1NDMB 2X4SB 3GMRA 4BK5A 4EI6A 1RJZB 2C4XA 1X3DA 3DV6B 5FGSA 4H8WH 5F7WC 1C12A 3AGVA 1T0NB 5F7KC 1YNLL 4JFDB 4XCEA 3IJHA 4D3CL 5ABDE 1DBAL 1K2DA 5D5ME 1XF2B 4QRUB 1CF8H 4PJ9B 1R3JB 3BT2L 1I1RA 3L3HA 2RJMA 1AJ7H 1JGEA 2VC2H 3D0LA 4LPXA 5EZJB 5HHMB 4R3SA 3MLZH 4IRJA 4KI5F 4BZ2L 4P4RB 3SO3B 1MFAH 1ZA6B 4N8CH 5IJVB 2BXYA 2AJXL 5GS1B 3DYOA 2YPKA 4WW2B 4E41B 2MCG1 1NLBH 3CPLB 4OLVH 4OCSL 5GQBA 2DLFH 3TPKA 4UV4L 4X7TB 4RCAA 2R4RH 2FRGP 3A67H 3DSFH 2R23A 4NJ9L 3VMNA 3VXTA 4EUPB 7FABL 4Z6AT 1N7MH 3HC4L 3M8OH 1RZKC 5ISZD 4OD2B 3OKOB 4R2GC 2QQKL 3M17B 2X89A 5CFHA 3CDGA 4TTGA 1ZS8A 3KYKL 5DHVB 4OSUL 4MD4A 5DWUL 3UZQA 2E7CA 4FZEL 2JKXA 3KXFB 3PP4H 2XYCA 4RX4D 1H5BA 5KW9L 2V5SA 5HGBA 2NY2C 3EYUL 1JHKL 2AJZA 3FOMA 2Q3ZA 1A64A 1LK3H 5FK9B 4W4OA 4H20H 4WI5A 2A2QT 2APTA 3OZ9L 4HWEH 1NGZB 1KCSL 1NGQL 3BE1L 4QOKB 5FGRA 3WBDA 3MGTA 4JFFD 4RIRB 5FM5M 3RDTA 4MJID 1QHPA 3VI4F 1H8SA 4X4MA 1HH9A 3LEYH 4XPGL 5DJ2B 5ISZE 1T03L 1MFBH 3TBYB 1HYSC 2B2XL 3MLRL 4Y89A 3ZKMD 3BDXA 1DANT 3QULB 2GJ6A 4QYOB 1SJXA 2A6JB 4YHYB 2LTQC 3TNMB 1K8IB 2VOTA 1LO3H 3VXMD 1W72L 2LVEA 2XPGB 1CE1L 3EYSH 3L3IA 1CU4L 1F3JA 4POZC 3QJFB 3L3GA 4V2CB 4NZUH 3DVNB 4U1MB 5ALCL 4YPGB 1KB5H 2J8UB 1NSNH 4NN7B 2CKBA 1PVHA 2HJLA 3NFSL 1I4FB 4JFFE 3HAEA 1CFNB 4MJIE 2IH3A 4O5LL 2EIZA 5JIKA 5D1ZC 2YUXA 2BOBB 1UJ3A 3SDCC 2DQDH 1FN4B 4ZTOL 4FQXC 5DUBB 1DN0B 1FDLL 4JDTL 1QACA 3BVNB 4LCCC 3IF1A 5D1XB 3VWJD 5KSVB 2MCPH 5TE7H 1NUGA 4NQCB 3OR7B 1I7ZA 1AGCA 4HPYH 1UT9A 5D71H 3VGAC 4M8QA 4U6YB 4GMTH 3ZSSA 1F02I 3VXME 1KELL 3D3VB 4CVUA 1EO7A 4UILH 1I3RA 1WLHA 3DIFB 2CIKA 1ULVA 3T09A 1FNEA 1ZSDB 2V5YA 4S2SB 3PL6A 5SWSB 4BSVA 4WNQA 1B88A 5C0JB 3MJ9L 5BV7B 5FA3A 5L2JA 3NCYS 2VISB 3WN5B 2PTTB 1NFDE 4Z7UE 1QRNB 4U6XB 5FUCE 1ZLSH 2XKNB 2H45A 3G08B 4Z7VA 2X7LB 3SQBA 2Q8AL 2ED9A 3P77A 2R1XB 1QLEH 4NQTA 2ITCA 5BS0D 3GIZH 1CTOA 1K4CA 5I8OH 2V6HA 4PRNA 3FQRB 5HD8D 2ZUQB 4LVHC 3C8KA 5ANME 1RIVH 4Y4HD 4PTUB 4NKOB 3WS6C 4LLYB 3WLBA 3NTCH 1NC4B 3UTQA 1CXEA 5I1AB 3P0YL 1FV1A 2YD1A 3KPPB 4L4TA 1NC2D 4Y2OA 1QUNA 4LLUB 4PLJD 2AGJH 5FM8A 3LKRA 1LMKA 4X4XB 1I7TA 3BGFB 2BSSA 3GM8A 3EZ8A 3LKOA 1IEAA 3PWVB 1IGCL 4PJCA 4N9GA 4DGIL 4EUPH 2VN4A 5JXEA 1LDSA 1R3KA 3TYGL 5BS0E 4N1HB 2VDOH 4ZYKB 1J18A 1GVIA 1PEZA 1V3MA 4D9QD 5GGVY 4BKLA 2NLJA 4G80B 3VXRA 2WINA 1J5OH 1IM9A 4BM7A 3V4UH 5JTWA 3EYQC 3TT1L 2VXVL 5I1KH 1HILA 1M71B 1C5BL 1U41A 4ZS7L 1PD6A 5EBWA 2B4CL 4HLZH 2GYSA 2ZUUA 2P47B 5D9SA 3BDYL 3ZKND 3RNQA 3MNWB 1QQDB 5GSRA 1R5WA 1UYWL 3MRRA 4LFHG 5GGSB 5B38B 1VFAA 4GG8A 1T3FA 4MQ7B 4GKSA 2ZUYA 1G1CA 5D7LB 1YN7B 4Y1AA 1OGAB 2FZ3A 2I07A 4HH9B 1T7VA 1UB5B 5DJAB 1U8PB 3UO1L 4D9QE 2A83B 2YN5A 3BO8A 1YC7A 3T2QA 2F54B 1QP1A 5ADOH 1OARL 3AU1B 3ULUH 3LH2L 1CFVL 2R56L 1JI2A 4HKJA 4LLQA 3TWCL 4KAQL 1P4IL 1CT8A 4FN0A 1Q94A 3U4BH 5IV2B 1AGEA 1HHGA 4QRTB 4A6YH 5HHNB 4PGCA 4JVPA 2HT4C 3RWEB 2DICA 1CFTB 5DEGB 3PGDB 1MIEH 3G5XA 3UTZB 4GRLB 2ZUTA 3IKCB 1MWAA 4OD1L 4NUJA 1QBML 4M62L 2DB8A 5F96H 1LP9E 1W0VA 4PV9B 4WWKB 1KJ2H 1Z0MA 5GSVB 5C0CA 1KIUA 1FFOA 4HFWB 5DQJA 3NCJL 2P44B 5JHDB 3SKJH 4KKLD 1NAMA 4KK6D 2WBJD 3TLRA 3RP1A 3CCHB 4X9BA 5LBSH 5D72H 3VXSA 5CWSA 3U4EB 4KJPC 4JQIL 2A9NH 1PY4A 1OP5H 1BVLA 4ALAH 5BV7H 4XVJH 1UWGL 3WKMH 2IH1A 1X5GA 5DD3L 3KLAA 1B90A 5LVEA 1RUQL 3DPBA 1CL7I 1WC7B 3TN0C 2PCPB 4LOUC 1GGCH 2A6IB 2CUMA 2QHLA 3G04A 1P7QD 4GKZB 3F7PC 4PRPD 1E4JA 5F3BA 2M1KA 2Y06L 4Y4FA 2HFFA 5IIEB 1KEGL 2MKWA 2NYYC 4G8GA 1D6VL 3BPOB 1FFRA 3WXWL 3QYCA 1CDBA 3CX2A 3LQMA 1W0WB 2PXYA 4PV8B 1G0DA 1MCBA 2XN9B 3BP7B 5FYJU 2FX7L 5EU5A 4K7PX 5HYEA 4ZFOA 2IANE 1TQBB 2AK4A 3PDOA 3QEGL 3PABB 2P7TA 1JTTA 2DQTL 3L9RA 1IEHA 5T3XL 5IR1B 1UH2A 4PG2A 3MBEC 3ZE1E 1S7UB 1I7RB 4LCWA 4PRPE 4DKFH 3QXWA 1YY8B 3DX6B 2P49B 1ZHKA 3QQ9C 4FFWD 4K7PH 2UZYB 3PDGA 3ZMRA 3QG6A 2R2HB 3IXTB 4NRZA 5C2BL 4L8SC 4WFHD 4EQ3A 5L9DL 2X70A 2VLJA 4HLJA 1ZLWH 1PDKA 1T80A 3D5OF 2X4TA 5AWNH 2QKIA 2YWYA 5DUMH 4P9HC 3SCMD 2D0FA 3IVKA 3N9GH 2AABL 5C7XH 1S7QB 4FQXD 4OZ4A 1HSBB 3QH3B 5J6GB 4JPWH 4M6OL 2DJ4A 4IRSB 5BVPL 1RPQA 3BN9C 1J8HA 1PJ9A 1T1WA 3FN3A 3T1FA 3EKCA 1MLBB 4LL9A 3G5ZA 4L9LA 4P48A 4Y5XB 3DTXB 4YDKL 4KDTC 4OCWL 3LEXA 2P43B 1R3LB 1G7MA 5JPNB 2VH5H 1KLFA 2VZVA 1KIPB 3MGOA 3OXSB 3OAUH 3PHOA 4Y4HB 3JZ7A 5AYUL 4KUCF 4MNQD 3W39B 5TFSH 2XG5A 1J0ZA 4G7VL 1I9JH 1HHJA 3WD5H 5ENWA 2XNAB 3VD9A 2EDYA 3QDHA 4ONGL 5JOEA 1JPGB 4WFHE 3WSQH 3G6JE 1NJ9B 4OGAD 4F7MB 1IBGH 3FT3B 4BH8A 4X6BA 3P3YA 5IHUL 5HTSA 3IJSA 4M7ZB 2WWMC 3H0TA 5FYLH 2DBJA 1FL5A 5BRZD 1IE5A 2J8OA 1YQ2A 2B7DT 4YAQA 4AIZB 1TZGH 5L2KD 1ZAGA 4S0SD 1EIBA 4FMFA 2F8OA 2VDRL 1KF9B 4CGTA 4GRWF 5TDPA 3VA2C 5DMKA 1D9KA 5EZIH 2CUIA 4Y7MA 3DROB 2FEEL 3HCVB 3WHXB 1IARB 5E8PA 3LQAH 5EFIA 5KBNC 1NBQA 3DRTA 4MNQE 1V8HA 2UWEB 2H26A 3IDYC 3ARFB 3GK8H 3QWOA 1U3YA 3CH8A 3DWTA 5IG7A 2OI9B 4YR6B 3SOBH 1DLHA 1I8IB 2GCYB 5K33A 5E8OA 4XP4L 1Q72L 1T1XB 2EH8L 2EKJA 5BRZE 4PJEB 4HJ0C 4KGLA 2YPLB 3O6FC 5L2KE 4YFDB 4F3FA 1F8TH 5LGHL 2G5RA 1SMAA 3FB8B 2HFEA 2AXJA 1OB1A 3O3EA 1MCJA 5F7LB 2W0FA 3HR6A 5IVXB 2WIIA 3WIHL 2D7TH 5DTFB 3EW3B 4P5MB 1N6QH 5IBTH 2XI9A 4JO1H 1E4XL 5IMLA 5D1QB 5DD5L 2VL4A 3LN4A 4FMKA 4YHPB 3TCLA 1NMCB 2VDLH 1S7TA 3QPXL 1U3HC 4U1NA 2VXQL 1Z5LB 1DZBA 3ILQC 5DD1H 3WL9B 2EZ0C 4Z78A 2ERJB 1MRFH 3BKMH 1N5AB 32C2B 4XP1H 2DMKA 2MNUA 2KZWA 2R1WA 3DUUB 4NGHH 4QT5A 1T21B 4JG0H 3CFCL 3ROOA 4LHUD 1S5HA 5IUSA 3OGCA 2RHEA 3V0AC 1T20B 3KLDA 3C9NA 1DQQB 4OB5H 1FFQA 4FXGB 2F5AH 1QFOA 4WUUB 3TJHC 1T0PB 4OCXH 4EIGB 1F4YH 5FKPA 3HI1A 2WBJB 4KHXL 3MRCA 3N85H 2QQNH 4P5KA 4MDIA 2OM5A 4PJGE 3TBVB 5ESVB 4Z7WE 1MRCH 4YK4C 1XCTA 4X9GA 2GSIB 3FHQA 1YYMH 2O61B 2RB8A 3X12B 1JPST 4I3SL 4BZ1H 2EKSA 3VFPB 2DKMA 5F93C 1VPOL 1CFBA 4MAUL 1RJCA 4YHZL 1CG9B 5DJ6B 5CBAA 4Z7NE 2FJGA 1QSVA 1MHEB 2A6KA 4DEPB 4NC0B 1J0HA 2GJZA 3MACL 4G6ML 3SDXA 2WZPD 1CR9L 1CDGA 1P7QB 3PDDA 4RSVA 2P5WD 1NQBA 3LD8B 4B50A 1FNSL 5GS2D 5HBBA 4ISVA 4LEXL 3TIEB 5EO9B 2ATPA 1KXVC 2CRIA 3QSKB 1OQOA 4KJPD 2Q76B 4A2LA 5I1GH 4HJJL 2VLRA 5KOMC 3TT3H 4OTXL 4S1DD 3T4AA 5C0ND 2GTZB 4FNLL 4NWUL 3HMWL 3V6ZA 4YZFF 2VZ1A 4PJIB 3LSOB 4M61A 4PJBE 2Z8VC 5BO1H 4G8EB 4J4PD 3EFDL 3PV6A 1R24A 4OLXL 1Q9WB 3BW9A 2VXSH 3G6AB 2JJSC 4NKIH 2D03H 4PJHE 2FL5B 5I8EB 2XTLA 4Z76B 1T66C 4NPYB 5INCB 1TPXC 2JJWA 1R3HA 2P5WE 5DLML 2Z31C 4NCDA 5H37H 5JORA 1H8OA 2GIYA 3BP4B 4HXAH 3KS0J 3D39A 4IRZL 1C5DA 3DRQA 5FXCH 4L8CB 4WHYH 1DQTA 2YEZB 2NZ9D 4JZNB 5K59E 4F58H 2JB5H 5E8EB 1FQ9C 2YRZA 1MCDA 1FHGA 3VD5A 1KN4H 2E3VA 1CZ8L 5DQ9A 4YQXH 2Y7QA 3V5DB 4J3VA 3Q3GA 4X6EB 3AY4A 1TITA 4KKAC 2Y07L 1OLLA 4OIIL 3BWAA 5HI5D 4X5XB 3MLXL 4U1KB 4MAYB 1HI6A 1LE5B 3MBED 3REWB 1A7RL 3VXOB 1H9VA 3QI9C 2HJFA 3BKCH 4EEEA 4JPKL 1J05A 4JO4H 4RGNC 4JG1L 2XZCL 3A6BH 2EYRB 2K1MA 4TVPL 5IESH 1YA5A 4IHOB 1OP5K 4P59H 1ZHLB 1IAOB 5B3JF 1UQSB 2DQFB 2ATKA 1CL7H 2QQLL 4GBXA 4TTDC 1MH5A 2BSTB 1A6PA 3RL2A 3D0VA 3B2VH 3STZA 2VDMH 4PJDA 2CR3A 1J11A 4I0PD 4FTVA 3MRFA 1TTGA 3SDDC 1A6ZB 4F7PB 3E3QC 3B2UC 3QXDB 3KLHD 1O7VA 1UWXH 3PGCB 3V8OA 1HYRC 4YO0A 4OCRH 5GRJL 3MNZB 4K3JH 5F6IB 5J13C 2XA3A 4LF3B 3F6IA 5E8DL 1MJUH 1P2CB 1J86A 5C08D 5HVFB 3V7MA 4MJ2A 1A02N 5E6IB 2O5XH 4O58H 2V2XB 3P11L 1BM3H 3MJ7A 5JLZB 2WWMD 3JV4A 1DDHB 4ZUSA 4ZXBA 1S9WA 4PLKD 3LOWA 3QUXD 1J87A 2C3GA 5J06A 5JUEH 4ODHH 1U0QA 4X80H 4OI7A 3MRLB 3O2DL 1IFHH 3JTSA 1NAKH 1D5XA 3UDWA 3LRSA 2VDKH 1MAJA 2FSEA 4R97C 2CLRA 4DTGH 4Q9RH 3VFOA 3FO9B 4EXKA 1U8QA 5IEKA 3LKPB 4R8WL 1H15A 1K9TA 3QG7H 2R0LL 3SPVB 2VITB 5C08E 1ZLWK 5MERA 1NMBL 5I30L 1BBDH 2BNQD 2BY2A 3F12A 1KCUL 3W5NA 1FZJB 1JNNH 5KAQF 2CRMA 5I18L 4Q58C 1XIWA 2GAZB 4Y2DD 4CNIA 3IETB 3BDBA 3DSNA 1QVOA 1A0QL 4GAJL 5DRXB 1NKRA 3ARZA 2P24B 4DCQB 3JBG7 4R0LC 2P46B 4Q0XH 1FFNB 4XVUD 2E9JA 3E6HA 3IB4A 5FUOL 3P2TA 3MJ8A 2XQBH 4O51B 1HHIA 4P99A 4KVNL 3MROA 3OSKA 3V4PL 3OKNA 3QEQA 1AHWA 5JW5A 5SWZA 4OCSH 3DETD 1EO8L 5IB2A 4NC1C 2BNQE 4ELME 4NKDA 3QRFM 4XNYH 4NJ9H 3WUWA 3GBML 4K23H 1F90L 1UWEL 3B43A 3TVMC 7FABH 1RUAH 2EZ0D 1KB5A 3LY6A 3UBXA 2QQKH 2XWJA 4JPIA 3KYKH 1S9VB 4XPBL 1KPUB 5GGTL 3ZL4L 4CMHB 3EGSA 1TVHB 3MSPA 3U7WL 4C56B 5HGHA 1DBML 1YPZF 2BY0A 5KW9H 5MI0B 4M3JA 3ET9F 4DUXA 3ARGB 4GG6F 3V0WL 1DUZB 3BP6B 1CLYL 4ODXB 3DO3A 4JGJA 2X44D 4N1CA 5I1HL 2XG4A 1X5HA 1VERA 3DBXB 3RIFF 1TZIB 1J10A 4OT1L 2FO4B 1RAMA 4PUBH 2E8YA 3JTTA 1MCOH 4JB9L 1XF5B 2G60H 3NAAH 4M7JL 1GOHA 3RFZC 5HYSA 3QDJB 3UJIL 1HK6A 4IJ3B 2BVEA 2NW3A 1YEGH 4EIZC 3MOAL 4HWUA 2IFFL 5TDNB 1OAQH 4JR9L 1E0OB 5GGRY 1NDMA 3U9PL 2X4SA 3PV7A 1RJZA 4Q9QL 4G42B 3DV6A 1HIMH 4LNRB 1CICC 1T0NA 4FQJL 4ZPTB 1CE1H 1X9QA 1CU4H 4UNTA 2FLRT 4JFDA 2FEEI 4BUGA 2YD2A 4YUEL 1XF2A 4QRUA 5I19L 4PJ9A 1R3JA 1QHOA 1CD8A 4NYLB 4FRWA 3RWJB 2RCSH 5EZJA 4CU7A 4PJ5D 1BF2A 4OLWL 4P4RA 5CAYB 1ZA6A 1OT2A 5IJVA 15C8L 3MV9E 3VI3F 1IAKB 5GS1A 2DJUA 1EGJL 1JGUH 4L5FH 4WW2A 4E41A 3QUZC 1ZANH 5IEHB 3CPLA 4OF0A 2KQMA 1ZHBB 3RUGE 5IHZB 1QSFD 4JY4B 4J1UB 1A22B 4NFBA 4X7TA 1YMHB 2SEBB 5DMYA 4PP1D 1VACB 3R0MA 1GGIL 4XAKD 4EUPA 5A43C 2XQYG 4OD2A 3BIAX 4O2FB 3OKOA 2J88L 3M17A 2F8XC 2BERA 3DJ9A 2IAMC 3TBWB 5DHVA 4GUPA 3RZCC 2MPAH 3KXFA 4PJ5E 1L7TH 4HSQA 3O8XB 5B8CB 5I9QC 4X4YB 2VLKD 3AREC 5EZOH 5I1EL 5T5NF 2BY3A 3WJLA 2Q8AH 3T2NH 1I9RL 5MEOA 5FK9A 3H2WA 4KRNA 1Y6NR 1QSFE 3OAYK 5F70A 1NGZA 1WAAA 4QOKA 3BQUD 4RIRA 3BZ4B 1BQSA 4CBPA 2Z93B 4XAKE 4QNPF 4UUJB 3H8NA 3L3KA 5DJ2A 1YY9C 3TBYA 1GL4B 4P5TC 2AJVH 3O9WD 3QULA 3UTPD 3HMXH 1U8KB 2A6JA 1U36A 4PBXA 3TNMA 1KT2B 1K8IA 1A7QL 4DZ8B 2CDFB 5IJKA 5K93A 5JXAL 2VLKE 3OGOE 2XPGA 5BCAA 1H3GA 3V6OE 1JZ3A 2VDPL 3RVWC 3QJFA 5F9AC 2WBKA 3DVNA 1YJDH 1CTNA 4OUOA 4APQC 1AFVH 1H0DB 5F1SA 4YPGA 2J8UA 4RA3A 1I4FA 2HRPL 2VTFA 1LK2B 1CFNA 3IDIB 3SDDD 1PKQE 3LKQB 1NCCL 2BOBA 3B2UD 4OAWB 4DAGL 5DUBA 1DN0A 4MA7H 5IHBA 3BVNA 5KSVA 2VXVH 4CAGA 2X5PA 2R29H 3UTPE 4NQCA 3OR7A 3L5WB 2KUTA 1OW0A 1KJ2A 4NO5B 3VFSB 4U6YA 4WUKH 2NY3B 4OGYL 1Z9MA 3ECBB 2P8PB 3D3VA 3T3MF 3WV0A 1UYWH 2NY1C 3MRJA 3DIFA 2ZCKH 4CW1B 3QIWD 4B7IA 3C2AH 4DQOL 1ZSDA 4S2SA 3GSQB 1AC6A 3GBNL 4LU5H 5SWSA 3VFUB 5DZNA 4Z95L 1R0AL 6FABL 5I1CH 3OJVC 5C0JA 4QXTB 2VISA 1ZTXL 3WN5A 3ZHLA 2PTTA 1FIGL 1QRNA 2NXYB 4U6XA 4ONOA 1E4KC 3E3QE 2XKNA 3G08A 4NQSB 5IVZB 3HC3L 2J2ZA 2R1XA 5J1SC 1CFVH 5D93B 4Z0BH 1BJ1H 3PQYB 4Q6IB 4UAOB 1LEIB 4R9HA 5E2JA 3FQRA 4WHCA 4K8RD 4LRNH 1MVUA 4X6DE 4YBLB 1NGPL 5HYJD 3EYVB 4NKOA 3V2AR 4LLYA 4YHLH 1NC4A 3AMLA 1NCWL 3PF2A 1EEYB 1FRGL 5I1AA 4I0CC 4I18C 3A6CL 1HQ4B 4TNWK 3KPPA 4ETQB 5F9WB 1QR4A 4LLUA 4HEPG 3VXNB 1F3DH 4NJAL 4DGVH 3GSNB 3ARBA 5BXFB 3SBWC 1MREH 3VRJB 1T1YB 4F9LC 1UWXK 1KYOK 5IBLC 2ZJSL 3C6LD 3PWVA 2NY4D 4MGXA 5T3ZD 3ALWA 3NIGE 3ROLB 2MHAB 3K2UL 4UT9L 4PJ8B 4ZFGH 2OS7A 3UTTD 4ZYKA 2BMKB 5KVFH 4P2OB 2EDQA 4FG6C 4JQIH 1EH9A 5CILL 2NY5L 1XAUA 4PB0L 1S8DB 1UWGH 5CKGA 4EN3D 5HYJE 1MHPL 4ZSOB 5DD3H 3O2VL 1JMZA 1GIGL 5GGQL 1EHLH 1DR9A 2NZIA 1M71A 1NUNB 4LDOB 4XCFH 4NM4L 4K55A 5E1AB 1PQZB 1F2XK 4KRPC 4G8IA 1XH3B 1KJ3H 2EYSB 4PRHD 3MNWA 1MJ7H 1QQDA 3BEVB 2D31B 3RUGB 4LIQE 1CGWA 5MEQA 5B38A 4M6AA 4MQ7A 5T3ZE 5D7LA 1YN7A 1YPZE 1J1XH 3W9EB 3UTTE 1OGAA 4HH9A 3CU1A 3IAGC 2QBWA 4NN5B 3WXWH 2B8OT 2ZCLH 3F5WB 1UB5A 5DJAA 1U8PA 1BOYA 1PZUB 5SX5H 2A83A 3QZWB 4XNXH 4G9FB 4W68A 1N59B 2HJKB 2F54A 2W59A 4PLNC 3KPLB 4OZIE 3QEGH 3OAZH 1BFVL 3AU1A 3V5KB 4ZFFB 5CGYD 5JPMB 4PRHE 4X6CB 5IV2A 1KPVB 2QQQA 4QRTA 5HHNA 2KDGA 4S1SH 3I75B 5E5UB 2XRAH 4FFYH 5FV1L 2DI8A 3RWEA 4HIHB 1CFTA 4M7KH 4Z8FH 3WDIA 2BVPB 3EDEA 2PYEB 2BK8A 3UTZA 2J6EL 3IU4L 1FH5H 4GRLA 5TF1H 2DL2A 3IKCA 4AZ8A 4RAVB 1BD2A 3DYPA 4KVCH 5C2BH 4PV9A 4WWKA 2HTLD 1SEQL 3RVXD 2YZ1A 5KVDH 5GSVA 1Q1JH 5LQBL 4HFWA 1DEEB 1DLFH 4Y4KB 1MIML 5JHDA 2JJVA 3TZVD 3NPSC 4KROD 3CCHA 1WFOA 1UA6H 1H3XA 2EH7H 4WU7B 1JL8A 5DO2C 1E6OL 2VWEE 2CR6A 3DHJA 2LU4A 5F7FA 4PJAF 1CLZL 1E27A 5SWQB 4OCWH 4L9DA 3BKYL 5ELIA 2J3SA 1S78C 5J11B 2BHUA 1JYXA 2PCPA 2BY1A 2DQEL 3RA7L 2Y6SC 2A6IA 1MRDL 1MFCL 2QSCH 1B4JH 2YUVA 5DZLA 3D2UD 1LE9B 5IIEA 1FJ1B 5IHUH 3RTQC 1V7NL 2JJTC 1HN1A 4OQTL 1S3KH 3J7HA 3DV4B 3WIIL 2HT2D 4ENEC 5KSBF 5C0FB 1ZT7B 2AK1L 5A16B 3RX5A 1W0WA 4N8VA 4Z7OF 4PV8A 1V7ML 4HD9A 3BP7A 4LPTA 5DSCB 4X5LA 1ETZA 3P9MA 1INEL 5D7SL 3PABA 5CCKL 1OCWH 1HZHL 3UMTA 5BQ7B 1FAKT 4KHTH 5IR1A 1JNLL 1NBZA 2J7LA 5D2LF 1S7UA 5KS9B 1I7RA 4WENB 3QUMB 5ECJE 5KVMC 3GZKA 3KAAA 3O6ML 3OKMB 4M6NL 5CSGA 1YY8A 3S96B 5IGXL 3DX6A 4PJ7F 2H1PL 3RU8L 3B8YA 2YK1L 2YN3A 5DA4A 2DDQL 1WIPA 3TA3C 4GLRI 3IXTA 3L6FB 4JO3L 1U58B 4LCUB 1SJVA 4QHMB 3MA9L 4OQ1A 5FYKE 4NNXA 1AH1A 3WS3B 5JW4R 2E6PA 3QHZL 2XFXB 3S4SB 4OBRA 4P23B 1S7QA 5E2TH 1HSBA 3QH3A 5E6ZA 5J6GA 5BZWB 1OTSD 4IRSA 4PGEB 1FBIL 2A0LC 5GS0H 5CINH 1ZGLB 4Y5XA 3DTXA 3KPNB 1FO0L 4Y16D 1PX4A 1J12A 3QPXH 4QHUB 5T33H 3AS1A 1R3LA 5JPNA 3T3ME 4N0CD 1SJEB 5DD0L 4QWWD 1GGYA 4L1DA 3FMGH 4P2RB 3BD3A 4XNMA 4F37K 1EHXA 2YRLA 1K5NB 3QJHB 4C55A 4D9LL 4Z77B 4OM0H 4LVNC 2XNAA 4HZLB 1JPGA 2F8VA 2IBGA 4BQCA 4JRYB 1NJ9A 4F7MA 4YBQC 3FT3A 4LNVA 4WGVB 4FS0A 2PF6A 4P3CL 3VFWA 2C3HA 4AIZA 4NN6C 4XXCA 4QO1A 3B9DA 5F8RC 4GMSL 4LPWA 1T2QL 3HCVA 3QCUL 5DHYB 4WIQA 3WHXA 5DFVD 1HXMB 1MCIA 1C16B 3RWGB 4EI5D 4JHWL 4N5ED 3H9HB 2UWEA 4HHAB 4PJFF 3WFCL 4B41A 3ARFA 3MV8D 1L0XA 4YR6A 2IGFL 4EDXB 1I8IA 2ZCHL 3JVGC 2APBA 5TF0A 1MY7A 1T1XA 4PJEA 1GAFH 2YPLA 2ZG2A 4HX1B 1I1FB 2JCCE 1AO7D 1FSKB 3FB8A 2DQCL 4XAWH 1EUUA 5EUOF 5TPWL 3B83A 5IVXA 1WBZB 4XTRC 5DTFA 3M45A 4P5MA 4R6UA 4JQVA 3HMWH 3RPKA 3NFNB 2WSKA 2XV6B 5D1QA 3L5IA 3MV8E 4YHPA 4OLXH 5E4IA 4R7NB 5DI8A 4FXKB 5GGSY 5GRYA 5C0EB 3B5HA 4M43H 2R2EB 3WO4C 3WL9A 4BFBD 1OP9A 1N5AA 1UM5H 32C2A 4KK9D 4OZGE 5TQ2L 4NBZB 3DUUA 3OKEB 1T21A 5D7KD 4TSCL 2C4FU 1AO7E 3KJ6H 5FYJH 2J8HA 2B1HL 4ZFZB 4UV7L 5T1MA 4HUNB 1T20A 1MNUL 3UPRA 5FGBC 1DQQA 3JWOC 4FXGA 4WUUA 3BUTA 4PYGA 1II4E 2JIXD 4PJXB 2HKHL 5E9DD 2DBLH 4DGYH 4KROB 2E7BA 4JN1L 4JKKA 3TBVA 2IPUK 5ESVA 5IBUB 1OAYH 2AJSL 2WP3T 4J3TA 1EEZB 5C86A 2GSIA 4KC3B 5F71A 2O61A 1T89A 1G84A 1J1OH 2V17H 1B0GB 3X12A 2O93L 5D7KE 2WP3O 3VFPA 3V5HB 4LSQL 5D6CB 1CG9A 3PNWB 5DJ6A 4B53A 4G6AC 3DYMA 1MHEA 4U6VH 4U1LB 2XY2A 2QQLH 5EIVA 2LQRA 4CMMB 3VMOA 1IZKA 4JJ5B 4UBDC 5GZOC 3FONB 3RVTD 3D2UB 3FFDB 3HE6C 5EO9A 1A1OA 3V8CA 5E9DE 1YYLH 2DTSA 1P5VA 1T5XB 4HKBA 2Q76A 3MODH 5FDWB 4FZ8L 1XFPA 1MF2H 2XZQL 4XVSL 1TETL 4HCRA 2FDBP 2GTZA 2OXGA 1D3CA 1JVKA 5L8JB 3C2SA 2HVKB 4BH7B 3MCKB 3ZHKA 1S78D 2HA1A 4PJIA 1HHHB 3LSOA 3TO4D 1CCZA 4G8EA 3KPOB 1Q9WA 5KTEH 2Z8SA 3SKOB 3BZEB 5B4MC 4QEGA 3QWRA 2FL5A 4OF8A 4Z76A 3DX9B 1IKFH 3HUJE 4PP2B 4NPYA 1FPTH 3P11H 4IEFB 1B2WH 3GMMB 2JTDA 2CK0L 3BP4A 1CBVH 1MJ8H 3B9KD 3P9LA 4L8CA 2YEZA 4E0RB 2W9EH 4RGOH 1T7XA 3O2DH 5E8EA 2CSPA 1IJ9A 3ARRA 3U9UB 2ZZUT 2GW5A 2BNRB 1HEZB 1T0MB 4DZBB 3LVEA 4X6EA 4R8WH 5FCUH 3TESA 2PO6C 4X5XA 3O81A 4MAYA 2QADC 5KOVC 2DWEA 3LDBB 3N1GC 3REWA