2OR9H

The structure of the anti-c-myc antibody 9e10 fab fragment/epitope peptide complex reveals a novel binding mode dominated by the heavy chain hypervariable loops
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
226
structure length
221
Chain Sequence
b'EVHLVESGGDLVKPGGSLKLSCAASGFTFSHYGMSWVRQTPDKRLEWVATIGSRGTYTHYPDSVKGRFTISRDNDKNALYLQMNSLKSEDTAMYYCARRSEFYYYGNTYYYSAMDYWGQGASVTVSSAKTTPPSVYPLAPGSSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Monoclonal anti-c-myc antibody 9E10
publication title The structure of the anti-c-myc antibody 9E10 Fab fragment/epitope peptide complex reveals a novel binding mode dominated by the heavy chain hypervariable loops.
pubmed doi rcsb
molecule tags Immune system
total genus 39
structure length 221
sequence length 226
chains with identical sequence I
ec nomenclature
pdb deposition date 2007-02-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2or9H02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2or9H01
1ULVA 1U92A 3GBML 4BFBD 4RQQB 3OPZL 4WHYG 5IBTL 4G7VL 1HYSC 4HH8A 1NLDH 4KKLD 5KSAA 1SJXA 4GRLB 4LCCC 5FYKL 4Q9BA 3N1FC 5GQBA 3SOBH 4F33A 5IOPB 2EH8L 1NC4B 1A7QL 1YEIL 4I4WA 4DKDC 4KZEL 5E9DA 4AT6B 5CGYC 4YBHA 2Q76B 1PVHA 2C1OA 4ODHH 5LVEA 2OX5A 4QY8A 3S5LB 5ICYB 4JRYD 3HFML 4U3HA 4YUEL 3TH4T 5FCSH 3JV5A 2VLKA 5KAQG 3QDAA 4HCRL 4D9RD 2RCSH 2P7TB 1MH5B 1S9VB 3OZ9L 4APQB 1G7JB 2YMXL 4UTBL 3QA3A 1BFVH 4LLMA 2VDRL 5J6HA 4TPRH 5K9JL 3DRTB 3GMRB 3T2OA 3RVXC 1PKQE 2NTFA 2MQCA 1AO7B 5A3ID 1A1MB 2P49B 3ARUA 1CD8A 5CFHA 1K85A 4HFWA 4NQTA 2LU7A 3PABA 4X7SL 1DLFH 3MNWB 2V17H 4F7CA 3NCBB 2D7QA 12E8H 1WV7T 1D5MB 4G8EB 2B1AH 3LZFL 1PBYA 2LTQC 1MEXH 2F53E 5J9PB 3QFJB 3BEVB 1ACYL 3MLWH 4JFEE 3QXUA 4XNMA 4J4PA 3HE7B 4YGAB 4KROC 3V5KB 2R1WB 3I9GH 1BIIB 3C09B 4PJCB 3Q5OA 3DLQR 4MXVF 3CSPA 2Y23A 5EU7E 1PQZB 4AEFA 3OKLB 2HJFB 1FBIL 3KYOB 4MNQA 4Z8FL 1E27A 2ICCA 4N8VB 1DQDH 3QDJA 1H0DB 4OLXH 1K6QL 4ISVA 1G6RB 2EIZA 4PP2B 1NAML 1FDLH 3I3EA 1IFHH 1F11A 5CCKH 2CDGA 4HUVB 1AGDB 4LRIA 5C6TL 1CFSB 1E4KA 3TBVB 4S0SD 1AKJD 4JRXB 5IMMB 3FB6A 4MDIA 1OT2A 4KKBC 4PRNA 1YEDA 1GGIL 1ZHBB 4G5ZH 4HK0A 5FYLL 3HLAB 3VXRB 5CGYD 4XMPH 1RMFH 3MRCB 2YA1A 5I75C 4HWZA 5E8EA 3DI2B 2QADC 4Y4FA 2DN7A 2VR5A 5CBAA 4LLYB 2ZP0T 3IKKA 3HC0B 4DOHB 5EZLB 4WV1B 1EGJL 5MEND 2X4UA 4M6NH 5A1AA 4P5TA 2Q7YB 1PEZA 3VXSB 5KSBE 4X9FA 1ZWIB 1JPGA 4TVPE 3U7WH 2DQGL 4W6XB 4XX1E 1F97A 3TV3L 2FD6H 3W0WD 2D2OA 4OV5A 1I7ZA 4KI5F 4PJFF 1XFPA 2Y06L 1MHPL 1YEFH 3GRWL 2VQTA 4Q0XH 4ZAKA 1OAYH 3JTTB 2BY0A 2ATPB 5GS1C 4FQXA 1A6WH 2AI0H 2A74B 3HE6D 4LHJB 3V5DB 2R2CA 4KROD 3BKYH 1CBVH 3W9DA 2F8XC 5LKNA 2Q7NA 4OZ4B 1WC7B 3VW3L 2F9BT 2YKLL 3PP3H 3U4EB 2XN9D 2ZCHH 3RI5F 1RUPL 2VZOA 5MERB 3QUMB 3QO1A 2YWZA 3HI1B 1R5IB 1NGQL 5GGTH 4U1LB 4YDJB 5IWLC 4B5EA 2MNUA 3IU3A 1BOYA 2DQJH 4Y4KB 2GJZA 1AQDA 5I8KL 1GZQA 5HVGB 3ZDYF 3VG9B 3JWOL 1YN6A 5IQ9B 4D0DA 4PJIF 2ZOLA 3M17B 4KKBD 1NAMB 3QIUB 2GTZA 4EVNB 2UWEB 1CQKA 2DLIA 3QEQB 2ADGB 2VITB 4H0GA 2R0WL 5CJQH 4MA1B 1FAIH 4P46B 4PJ8B 5JHDD 4YDIH 3DV6B 1AJ7H 4TNWF 1CN4A 3VI4E 4JPIA 2P5EB 1C5CH 4KK6C 3VD3A 4HT1L 1R0AL 2FJFA 3BYYA 3D48R 5CGMA 1IC4L 3CXDH 3L3GA 5EOTA 3VFOA 5I16B 4IDJL 4OFYA 5HYSA 1CLYL 5BCAA 1X5GA 4P4RA 2JJSA 3SE4A 4JM2B 4WEBL 1AGFA 3MLUH 3AROA 4UV7L 1GPOL 3D2UB 1WCBA 1MCLA 5JR1L 3QNYA 3K1DA 3AFLA 3VFTB 2CLZA 1JHTB 5ESVB 1NKRA 5INDA 1G7PB 1NBZB 5DR5H 1I9EA 4P2QE 1RAMA 5GJSH 5KTEL 1TIUA 4JAMA 4IRSC 4JDTL 3RWDB 3SDXA 4EDWL 4WFFE 5HPOA 4MXQC 3UTSD 1CI5A 3MO1A 3MYJB 1HN1A 5DJXB 3Q3GA 4EIZC 4AH2B 1GGCH 5EOCH 3QUXC 3ARXA 1KIUA 2OS7A 3ZKSD 1Z0MA 4YXKH 4JO2H 2ITCA 5IIEB 2HLFC 1A4JB 5L9DH 5I15H 4O4YH 2XZAL 3D87B 2KQNA 1GOGA 4GRLA 4E42B 5F6HI 4P2RE 4QWWC 5IOPA 3KWWA 1NC2B 1NC4A 1KJVA 3SJVE 4JZJB 4AT6A 2A83B 3P4OA 4NN6C 2Q76A 3S5LA 5ICYA 5HGDB 4KTYA 1IE5A 4AL8H 5BRZE 2H45A 3U36B 5I19L 5I8OL 4WENB 1JZ2A 3SKOA 2P7TA 1MH5A 4APQA 4E41E 4HLJA 1G7JA 1XGRA 3LRGA 3MSPA 1FGVH 1I1RA 5EA0H 5HTSA 4HPOH 4DVRL 3S88H 5FCUH 4MVBC 3DRTA 2EDRA 3GMRA 3JXAA 4OIAA 4OFVA 5T5FL 1IM9B 2YPLD 4HG4J 5TDNB 1MJ8H 1EH9A 1AO7A 1ED3B 4ZD3H 1A1MA 2IQ9L 3IXTB 3WDJA 5FKPA 4OB5H 4D94A 4NNYB 4JB9L 1MCFA 4LSQL 4U1GB 5D7JD 4XCEB 1BQLL 2YRLA 4M3KB 3DECA 3MNWA 1LILA 4OCYH 3CMOH 2ERJC 4PJ9B 1AC0A 4TRPH 4Z77B 4PRHD 4G8EA 2DM7A 4PJDF 5TFSH 4HFUL 4NO5A 5JW4R 1EFXD 3BEVA 4LL9A 2V5SA 1QHPA 4HGWB 2CDFB 3SEPA 3HE7A 2E9BA 1IGFH 5SX4I 3V5KA 2XRAH 4QKXB 3BRDA 1BIIA 3ESVF 4PJCA 3MACL 1S7VB 1IT9H 3D0VA 2FX8L 1VESA 4AENA 1OAUL 1I4FB 4Q2ZB 4IRSD 3OKLA 2HJFA 3KYOA 3QCTL 4N8VA 1A64A 4MXQD 3HKFA 1H0DA 4N0RA 5ID0B 3BKMH 4PP2A 2E27H 2GT9B 4NZJA 3K81A 4YK4C 5TDOB 3B43A 3ARYA 1X5LA 3TO2B 2ITDB 2HLFD 1AGDA 3TCXA 3TGXA 15C8H 4JRXA 5IMMA 4RX4D 5TF1H 1U8JB 4QWWD 1ZHBA 4H5SB 2AEPL 4C56E 4UAOB 1OARL 2ADJA 5F7HA 4OI9A 4OGYH 3VXRA 4H25B 4AM0A 4MX7B 3MRCA 1T1ZB 3KYNB 4ZODA 4G3YH 3QQ9D 2Y7QB 1QFWI 2DI8A 1I7TB 1VHPA 3ZYIA 5EORL 4L4VD 3TVMC 4LLYA 2IBGA 2IG2L 2HKHL 3WN5A 5JXEC 1H15A 1PG7H 3LVEA 4LEOA 4M5ZL 5KVFL 3HC0A 4OFDA 2D0FA 4MVBD 2APTA 5EZLA 4WV1A 3WFBL 5KVGH 1Q8MA 1A22B 3VXSA 3WS6A 4JFDE 4R2GB 2ESVB 5LXGH 1ZWIA 1YYLL 4M1GL 1DSFH 2XTJE 3TO4B 5HVFB 5I1HH 3MV7E 2BMKA 3B4NA 3OGOE 4LLAA 4Q6IC 2V5MA 4QYOB 3G6DH 4NWTH 1DANT 4MD4B 43C9A 3RTQD 4M00A 1J8HD 1UH4A 1YEGH 1E0OB 3DYMA 3JTTA 4S0TD 1PKOA 3AVEA 2ATPA 3VE0B 3ARQA 4MB4A 2A74A 4FMKA 1GXEA 3I6GB 4P5MA 3HUJA 4PRIB 2Q86B 3V5DA 4OZ4A 1WC7A 2EDEA 2NY7L 3IFOB 4X5WB 4RGMB 3QUMA 4FS0A 3MGOB 4NN7C 1QBMH 3HI1A 5EU6E 1R5IA 4WIQA 5E2TL 3B5HA 1A14L 2BJML 2CIKB 2AJZB 3MRKB 4YDJA 1WUNT 2FR4A 3MRDB 5I74C 3CVIL 3V79C 1FLTX 4Y4KA 3P73B 2R1XA 4KVNH 5DJ6B 1LE5B 4JPWH 4XXCC 3UC0L 5GIRB 5IQ9A 3SDDC 2GTWB 3M17A 5ELIA 1PG7X 5T3XH 5B39A 1NAMA 1JZ8A 3QIUA 4M1DL 2UWEA 3GJFK 4KUCD 5ANME 3T08A 2ADGA 1IGML 5F1NA 3N50A 1F8TH 4P46A 3DV6A 3WFEH 5HYJD 5GPRA 2AJXH 4M61B 4JPKH 1CIUA 3TVMD 3PWLA 4YIQB 4GRMA 5JOPD 4PTTB 2BRRL 3C8KB 1WAAA 3T0EC 1U93A 3L5XL 1CL7I 5I16A 3RPIB 3NMEA 2AEIT 1ZSDA 5J12B 4DGIH 1AD9B 4PJXB 1MWAL 4ZTOL 4JM2A 1FJ1B 1A4KB 1BMGA 3D2UA 4RZCA 5DQ9B 1KN4H 4OF7A 1YNKH 1JHTA 5ESVA 1G7PA 1NBZA 4C4KO 3DO7B 4GS7B 3MRMB 2XKUA 4YHIA 3RWDA 4DTGL 3Q2CA 4EOWH 1MUJB 1C5BL 1NMAH 5D2NC 4ZUVB 4LHUB 3MYJA 1RZ7L 5DJXA 1LNUB 1MQ8A 4AH2A 1CLOL 1T66C 2DICA 5L88L 3KPSE 2VDOH 2H2PC 1H8NA 1ZLVK 3EOBB 5AZEH 5IIEA 1A4JA 3F7VB 1R5WB 1AFVL 4X4ME 4ELMB 5C71A 5IMOB 1UM5L 2BNUB 4E42A 2BNRA 4NO3B 1NC2A 1OQXA 2AKRB 4JZJA 3TC9A 3WO4B 5E2WL 1JNNH 4YGVB 5HGDA 4YDLB 1FE8H 3BX7C 3U36A 1TXKA 5ICZB 1ZTXL 2X70B 3VXUE 5JIIA 1IGTB 3S96B 3SDDD 3C2AH 2VLKE 3BP6B 4LDLB 2YKLH 4XC1H 3SGDH 3LMJH 3L3KB 1IM9A 5E08H 5TDNA 4GXUN 2DTMH 5F9JB 4DJMA 5GGSB 5J4MA 4NNYA 1NEZB 4UTAH 2F5AL 2VH5H 2XOTA 4XBPA 4I0PA 5T3XD 3EYFB 1NCTA 3E6FA 4PJ9A 3T0ED 4B50A 4Z77A 3LIZL 1TMCB 2MJWA 3IJSB 4P2YA 3PP4L 4PBWD 4ZFFA 4DGVL 4HGWA 1ZEAH 2CDFA 1AE6L 4JY5L 4C55A 3D3VE 3MLXH 3V4UH 2RFXA 1AR2A 2GJ6D 3O3EB 4GW4B 5TQ0L 1S7VA 3SPVB 1SHMA 1NGYB 1I4FA 3OKKB 2Z9TA 5FM5O 1BVLB 5MI0B 2XA3A 5T1DH 3EJZC 4G6FB 4I8DA 5ID0A 4U1IB 2VLME 1DBKH 1T66D 2YZ1A 2GT9A 3AUVA 1IILE 5D2LB 1OAQL 2H2PD 5TDOA 4DEPC 4OSUH 5SWSD 3TO2A 1KB5H 3CXHJ 2ITDA 3VFPA 3E3QE 4GQ9H 3MRJA 2DQCH 5HBBA 4XP9H 3P0VH 4WFED 5HDOA 2YUXA 1FFOB 2F58L 1DBAH 3R1GH 4IRJD 3D18B 4PTUA 4X80H 4L8DA 4H25A 4DQOL 2DQTL 3GSVA 4MX7A 3ZKMD 2HFEB 1T1ZA 1WZ1L 3KYNA 3CSBA 1TFHA 2GSGB 4QOKB 4RNRA 4RFNC 2ARJB 1PJ9A 2Y7QA 1PX4A 2IPTL 3CD4A 3MLZL 5JUEH 4NRYB 1WWCA 4O02H 4NKQB 2HA1A 4UOW0 3RWFB 3SQBA 2FB4L 2QHRL 3U79A 3HPJB 1U2HA 5KSUB 4NZUL 4PLJC 4XGZA 2X1XR 1CFVL 2ESVA 1A47A 3TYFB 4KK9C 4FQ1L 1M4KA 2IC2A 3TO4A 2DKSA 4NQED 4Z7VF 2BSSB 4A6YL 1S9YB 3ARSA 1KJ2A 3UYRH 3QSKB 2EKJA 1EV2E 4QYOA 4MD4A 4MD5B 1KN2L 3HG1B 3GI9L 2D9QB 3TYGH 1TCMA 1XR9B 1T1XB 1D7FA 3VE0A 1NUNB 1GGTA 5A2JH 5IK3B 4YDKH 2YR3A 3I6GA 4KHXH 3QH3B 1HWGB 2Q86A 4LCWA 4PRIA 5FM5M 3IFOA 4CADB 3PGFL 3FRUB 3DX6B 3C5ZB 3MGOA 3ZDZE 1J9CT 3EJYD 4HKBB 3TA3B 5HHMB 2LAGB 2CIKA 2AJZA 3FT3B 3MRKA 5D1QA 3HR5B 3E2HC 1UA6L 4KDTA 3EJZD 1QOKA 3MRDA 2A38A 4L8BA 3ECBB 1T20B 5F93C 1IKFH 1RURH 3P73A 3STBA 1KULA 1JUFB 3V0WL 1KCUL 4PGZA 2X7LB 5DVNA 2UZIL 3DBXB 4JN1L 1LE5A 1UKTA 4LPCA 5GIRA 1YZZA 5EO0B 3WYRA 5F7DB 7FABL 2Y36L 1U3HB 4WW1B 2EDJA 5JA8B 1TZGH 2GTWA 3CGTA 2B4CH 1WT5A 2B7DT 3CLEH 3GMMB 3FQWB 3BHBB 1CU4H 5C0JA 2DBJA 4Y7MA 2V2XB 1RIHH 4WI7A 1CXLA 2WQ8A 5MP6L 4YNYB 1EIBA 1F13A 4MJIB 3VGHA 4F9LC 4M61A 1CR9L 2CD0A 3BRGC 1BM3L 4YIQA 4PTTA 4JANB 2B4CC 2WUBL 3GSOB 4UILH 1OTTC 3C8KA 5B8CB 1RFDL 4PD4K 3X3FL 3QUZB 1JIBA 2AAVA 3BPOC 3RVVC 4O5LH 3OL2A 4NQDB 3RPIA 1IC1A 1U8LB 2ZJSL 1BEYH 4PLJD 2AQ1A 4PJXA 2VLRE 4QRTB 4LRNL 1W0VB 2VC2L 1FJ1A 4FA8A 1A4KA 4KK9D 2AK4B 1LEKB 1ADQL 5DQ9A 3AMLA 1P7HL 3RFZC 3F58H 3TZVC 2PETA 4W4NA 1J0IA 2A1WL 1J12A 3MRMA 4Z95H 2VXUH 2WBKA 4X7TB 1QFPA 4LHUA 2IFFH 2QQKH 1LNUA 2H6PA 4BJLA 2QSCH 3SDXE 1CGSH 5L2KB 5IF0B 1INQB 3MBXH 4UIKL 5GGRA 1BJ8A 2J8HA 3EOBA 4DUVA 1FGNL 3F7VA 4WTXA 1R5WA 4ELMA 3MODL 2XWTB 2BNUA 1MI5B 1WBZB 3MC0A 4NO3A 2AKRA 3WJLA 3SDCB 1T1YB 3BH9B 1IC7H 4YGVA 1F45A 1ZLWH 3P4NB 2V9QA 2X70A 5D96C 2K9UA 3S96A 3MYZA 3QRFM 4XCNB 1FNHA 3PWPA 4M43H 4WUUE 5EFIB 3KHOA 5DURD 1KFAH 3EDFA 5KW9H 1WTLA 4PY7A 3C6LC 1UXWB 1NEZA 5C07E 5GGVH 2NY1C 4DN4H 4U0QB 2Z91B 1OTTD 3GJFB 1EMTL 1MCHA 1ERNA 2BFVH 1E6OH 3EYFA 3SDAB 5IMLB 4DW2H 4N0FB 2NY3C 3G04B 1L9MA 3RVVD 3IU4H 2AGJH 1ORQB 2M26A 4LPYA 1NBYA 2J7LA 3IJSA 4KI1A 5DO2C 4HZLB 2J8OA 5BS0A 2WBWB 1H8SA 2XXMB 4HW6A 3QFJE 2H32B 3RZCD 1F6AB 3O3EA 1QNZH 3VWJC 3TZVD 2OI9C 5JW4Q 3KJ6L 1NGYA 1G7HB 4PJCE 2ENSA 5L6YH 1I3VA 4NZTL 1JPSH 3K0WA 5I0DA 4HIXL 2UZXB 4R96B 3BKJH 5D2LA 4OCXH 1NAKH 2VQ1A 3BN9C 3BGAA 4NJ9L 2YRPA 1BPVA 3MNVB 4QRRD 1ORSB 3QXAB 1IQWL 2XNAB 2QEJA 5BV7C 1FFOA 5GRUL 3D18A 5DYOB 5DFTA 5CKGA 3TH2T 1H3VA 2HFEA 3RGHA 5HHXL 4QOKA 1AC6A 3DX7A 5J11B 1CXHA 3VXRE 2O5XL 4U6VL 4EI6B 1JYWA 3ESUF 3FMGH 4KV5E 1V3KA 1C5DB 3KLSA 4GG8B 3LEYH 5FYKE 1YC7A 1KTDA 3QYCA 3RWFA 1FAKT 3V8OA 2XG4A 1Z5LA 5KSUA 1UWXH 2KZWA 5ALCH 4DOHE 3WFCH 3CH1B 5F9OL 2GFBB 3C6LD 2XY2A 1HSAB 4NBYB 4BQ9A 4DUXA 5EBLB 2BSSA 2XI9A 2NY1D 1S9YA 4OFPA 3K4AA 4UNUA 3ARPA 5IQ7L 3MREB 3OQ3B 4MD5A 2Z4QB 5F1IB 5BRZD 3HG1A 2HLAA 1XR9A 1UJ3C 1FIGL 4E41D 3QG7H 2FGWL 2ZUXA 4RDQF 5IK3A 4KTDL 5FFLA 3QH3A 3OXSB 3WKML 4R0LB 2DKUA 1MCKA 2X9WA 3QEGH 4GAYB 4CADA 3FRUA 5HI3C 3DX6A 1I1AA 3H9SB 4YAQB 2HMIC 4HKBA 4W4OC 3TA3A 5DD3H 1B4JL 1QO3B 3S8WA 3E1F1 3L3OB 1BHGA 3IDIB 3FT3A 3HR5A 3I2CL 3ECBA 1T20A 2EE6A 1WFTA 1I9IH 1I9RH 5BJTB 1JUFA 4GXVH 1TETH 1JRHH 2X7LA 4H26B 3DBXA 3S37H 4XNZC 3NIDF 2W0LA 2X09A 2AERT 5F7DA 1U3HA 5DEFA 5DGRA 4WW1A 1LGVA 2DKMA 5IKCB 2WUCL 3FQWA 3BHBA 5C0RL 1DTUA 3IXAA 3BKCL 4JG0L 3ARDD 2V2XA 4ENEC 2G9HB 4YNYA 1PX3A 2UWEE 4J7RA 3LAFA 2D03H 1EFQA 3QEQE 4MJIA 4U33A 1RJLB 4C57C 5DRZA 4WU5B 3MA9L 1J1PH 1OF2B 1CDYA 2Q8BH 5TDPB 4JANA 3RU8H 3GSOA 5B8CA 1RULL 5IM7A 4CU8A 4R8WH 4M48H 3QUZA 2P5EE 5FYLE 4M7KH 2Q8AH 1NFDB 3QQNA 4PY8J 5ISZB 1WAAE 3TFKC 4QRTA 1CFBA 1W0VA 1J86A 2VXSL 4OKVB 3RP1A 2RHEA 3K8LA 3U6RB 1LEKA 4YX2L 1F3DJ 4ZFGH 2E7MA 1REIA 1YNLH 3L3DB 2EH7L 1EDQA 4ZUTB 3FO2B 4X7TA 3SBWA 1TQBB 3DO3A 3S4SG 4HUNB 4XHJC 5IROC 3QIBD 2WIIB 5KOMC 2M1KA 1NSNH 4HMEA 5L2KA 5IF0A 5D1XC 3VD7A 2ZWLT 4AEIH 3FB5B 3EJJX 2Q87A 3S35L 4YXHH 2AP2A 3S37X 2DD8H 5F7UA 5HI3D 4AG4H 2HMID 3LEXB 4U1KB 4HAGA 1AXTL 2VXTL 1MI5A 1WBZA 2DQHL 4G43B 2FGZA 4KFZC 3QJFB 1CCZA 2WP3O 1T1YA 3BH9A 1UCBH 2P8LB 2B5IB 2VKXA 3BDXA 3P4NA 2EDYA 5EZIH 4GMTH 1V3LA 1SEQL 1EEUA 5JIKA 1DR9A 1Q1JL 3FFCE 1JGLL 3O11B 4KAQH 3TNNA 3FRPA 1HHGB 3LPGA 1NCAL 4XCNA 2CIIB 1S8DB 4O58H 5EFIA 1TCRB 2YD2A 1OGAB 2DLFL 2IH3A 4WTZG 5ID1B 1DL7L 3W5MA 1I3RA 5C0IB 1V3JA 4ENED 5JORB 4EXKA 3WIHA 3O2VL 4M93B 1S5HB 3DMMB 1KC5L 1LQSR 5KSAC 5LCVL 2GITB 5HDBE 1JL8A 2YD6A 3OKNB 4ZOAA 1KB9K 3LRSB 3ZYOA 1NBVH 5TE6H 5ERWB 1YMMD 2B2XH 2Z91A 4RIRB 2I9LB 3GJFA 3SDAA 4F9PA 4UINH 5DD6A 5ACZB 4N0FA 1N6VA 1ORQA 3NGBB 4CNIB 1Q9KB 4QXTB 3GHEL 1GAFL 5GRJH 3O8XB 3T65A 3TFKD 4QGYA 1Z6JT 2J5LC 1JFQL 4M5YL 2EEAA 2H32A 1F6AA 3K4DA 3RHWK 4K7PH 5IW1B 1M05B 3MUGB 2WK2A 3PHQA 5BVPL 1QLEL 2R0KL 4OTXL 4U1MB 4LSTL 1MQKH 3PP3K 4LQFL 1SYVB 4JEGB 2ZG2A 4R7NB 5C09D 4QRQB 4XHJD 1D6VH 3SDXF 1ZVSB 2IANB 1V05A 3OAYH 4R96A 2NXZB 5D1XD 1UKSA 3MR9B 3RVTC 4R26L 3MNVA 2AJUH 3L3HB 1ORSA 1YY9C 4OJFL 4Z7NF 3QXAA 4GLRH 2XNAA 1Q9LB 4PBXA 4Y5VB 3BIBX 4DKEH 2H41A 5DYOA 3V4VL 1J1XL 4J4PC 3BGFC 3LQAH 2VZTA 3JUYA 1D5IH 4MAUH 2IGFH 1FL5B 3MJ8B 4EI6A 2FATL 5D93C 1TVBA 1YPZB 2WSKA 4GXUM 5AYUH 1C5DA 4HPYL 4GG8A 4YBLB 4KHTL 4EUPB 3IDMB 2EEDA 5KANG 1MNUL 3LQAC 4MQ7B 4K3HA 3D9AH 4GO6B 3CH1A 4HAFA 2GFBA 4LRIC 3B6SB 1KGCD 1E4KC 1NGPL 3MGTB 5KSAD 2AK1H 3EOYG 1SEBB 5CINL 1IEAB 4R4BB 3MREA 3W5NA 2Z4QA 2YD8A 4OGZA 3TBYB 5F1IA 1LO0H 5E9DD 4K71B 2X4OB 2IAMB 4E9LA 3F7RA 4JJHA 4PLOB 3FJTA 5MEOB 4Y4FC 2VLKD 4KK8C 5GGVY 4BFGA 4ZNEA 2ICWI 4FQHB 4GAYA 4PJCF 3T3ME 2V6HA 3H9SA 1UZ8B 4YAQA 4G8GE 25C8L 1AGBA 4P5TC 1QO3A 3H8NA 3QHZL 3L3OA 5DK3A 3IDIA 4X9HA 5IR1B 4YDVB 1F4AA 2I27N 4GMSH 2J6EL 4HLZH 4N5EC 3AREB 4PJ5B 1BZ9B 4Y4HC 4NZDA 3IDGB 4H26A 3RVTD 1RUKL 4MB5A 2PW1B 4LP4A 4ZO9A 5I6XB 4NGHL 1DBBH 2B0SH 1KLFA 1YY9D 4Y5XB 3UROR 5J1SC 4P99A 1NCWL 3NVQA 4FQXC 3C5JA 3D69B 5CJOL 3AGVA 1GHFH 1T6VN 1O7SA 1IEBB 3ALXA 3BESR 4I2XB 4J4PD 1X44A 4WU7B 4PJ7B 2G9HA 1EEQA 3ROOB 2X4RB 1KEGL 3MJ6A 1HHHB 1RJLA 4CU6A 1MJ7L 4UOJA 3VXMB 4GAJL 4JFFB 4WU5A 4XPAH 3DSFL 1OF2A 2R69L 5T33L 5SWQA 3FQXB 3DI3B 5TDPA 4AMKL 3L3IA 4NQXB 4K3DH 3RL1B 4MNQD 3GKWL 5ADPL 1A7PH 1KELL 3QDJD 1KCKA 1NFDA 3O4OC 5L0QC 3EOTL 5E99L 1DVFB 1UM4H 4Y88A 5CKAA 2H1PH 4OKVA 4M62H 4NKMB 4TSCH 3GSXB 1KSRA 3BUTA 1FRGL 3L3DA 4MYWB 1HKFA 1AD0B 4ZUTA 4RFEB 1WVZA 3FO2A 1DN0B 4D8PB 3BW9B 1QP1A 3RZWA 4M6OH 1NUFA 2WIIA 4Y4FD 4KK8D 2EDOA 2UVFA 4PGCB 3FB5A 4OQTA 1A6AB 1VEOA 1F4XL 4P57A 3KPRB 3HUJF 3LDBB 4TQEL 1T2QH 1LMKA 1QBBA 4NWUH 2Q1EA 3LEXA 4NFBA 4U1KA 3VXNA 2HWZL 4X7FC 4P5TD 5JA9A 1HEZB 2JJSC 3SE4C 5EOCJ 4ELME 2EDQA 1TJGL 1RI8A 1EVUA 3QJFA 2BSTB 4BK4A 4YE4H 1XGYH 2P8LA 4N5ED 4N5UA 3PJSB 2E6QA 4U6XA 5DJ8B 4Z76B 1OP5K 3JV6B 3O11A 3UBXB 4ZAKD 2R23B 5J89A 1HHGA 2CIIA 1S8DA 1DFBH 4R9HA 1TCRA 4FQXD 1OGAA 3RIAF 3WO3B 5ID1A 4L3EA 5C0IA 4K2UL 5FYJU 2UWEF 5JORA 3F8UB 3H0TB 4MHHG 5D5MB 1U58B 5DK2B 2FDBP 1S5HA 4K94H 2A6KA 3DMMA 2BOBB 4WI2A 3Q6GL 3RQ3A 4W81A 5C2UB 3THMH 2GITA 2D4DA 1OLZA 3OKNA 4GRLC 4XVJH 3DUUB 5ERWA 3OB0K 4RIRA 5F21B 4BKLB 2I9LA 5ACZA 2AEWA 1HSBB 3ARVA 1WAAF 1ES0B 4QXTA 4CNIA 4CN4A 1LP9E 1NDGB 1O5DT 3EIFA 2BVYA 3LH2H 3O8XA 4NT6B 1CF8L 3MZGB 3GSNL 4APQC 4JM2F 5TE7L 4K7FB 3L7FB 3KPQB 5I8CB 1M05A 3MUGA 1MCNA 4TVSa 5D7LE 4X5XB 4NFDA 4OZGF 1AY1L 4XNXH 2A6JA 2ARWA 1LO3L 3U4BL 4R7NA 3U7YL 1DBJH 1EJ6A 4QRQA 5EUOB 5DUPH 2C3WA 4LPVA 1VERA 4RMTA 4QXGL 2IANA 2Y07H 3U46B 1Z9LA 5CLWA 5JTWA 4KJWC 3RAJH 1JRHI 4XCFH 2VXSH 3L3HA 4IOFC 5SX5H 3LN4B 3BH8B 5F8QC 4DCQA 4OIIL 2J4WH 3LPWA 2W60B 5IHBA 3HE7C 5FYJH 1S7QB 1IAIM 1ZK9A 3RX5A 1RZKH 3A67H 1U8IB 3C09C 1FL5A 3L1OH 5HVHB 3MJ8A 4FQ2H 5D72H 4RWYH 1JGEB 4GQPH 2VDPL 5EOQH 5I1JL 4OCWL 4EUPA 5LGKA 3IDMA 1TDQA 1U3ZA 1MF2H 3ARGB 1RZKC 4EDXB 4TUKL 1WZLA 3SDYL 3GSQB 4HF5H 3O2WL 1MIMH 1W2KT 5HDBF 4HULB 1U8OB 1H3UA 4WCYL 1SEBA 1P2CA 4NRZB 4GRLD 2P1YA 4FFZL 4R4BA 1NC4D 1P7QA 2FX9L 1X5YA 5HYIA 3TBYA 1S7XB 2X4OA 2KKQA 2XKNB 5C6WH 3NCCB 4XMKL 3HG1E 1EO8L 5J7CC 5IESL 1PYWB 3AU1B 4APQD 1X4ZA 1IAKB 4IRZL 4XAWL 1S3KL 2Y1VA 4S1QL 1UZ8A 5EN2B 1CQYA 4WV1C 4LLWB 4JG1L 3MCLL 1Z3GL 4GW5A 1AO7D 2CR6A 4X9IA 3WS6C 3C08H 4F7TB 5IR1A 3P40A 4YDVA 4PJEB 4MXWH 1RJYB 3VWKA 4K7PY 5CGTA 4L4TB 4PJ5A 1N8ZB 1BZ9A 3CK0L 5DVLA 3IDGA 3WCYA 4LSDA 1LO4L 4KJWD 3UPRB 3QUMH 1PGRB 3T3PE 1V7NH 1FPTH 4IOFD 4LNRB 1JFQH 4Y5XA 1CDGA 2DL2A 3DJ9A 3D69A 5HHNB 4MZ3A 4DFIA 3NACH 4NZRH 4JZOB 1IEBA 1P4IL 2HFGH 4I2XA 3HE7D 4U0RB 5IW3A 2PUQT 4WU7A 2C4XA 1AHWB 2X4RA 1HHHA 1XH3B 3VXMA 4I13B 4M8QB 4XPHL 3FQXA 3NIFF 4OBSA 1G7IA 1T2JA 4NQXA 5JIHA 2APWA 3RL1A 3VRIB 2FL5B 4LVHB 4CDHA 3WXVL 5FK9A 5A2IH 5FYJD 1DVFA 2V7NA 4G6KL 4Y4KC 4LARH 4CAGA 4ETQA 3BPNB 1QRNB 4NKIL 3VG9C 4NQDE 4NKMA 3BP5B 3N1PC 3QI9B 5DJAB 1CZ8H 5JHLL 3WNKA 4JRXD 3H3BC 3O6FB 1M7IB 4UT9H 4UDUB 2AK4E 5DC0A 3BT2L 3QIUC 3O41B 4PJBE 4RFEA 1DN0A 4D8PA 3VXRD 4M7JL 3JWDH 4MA1C 2GSIA 3O4LE 4P46C 3N85L 2I60L 1NMBL 4DGYH 3DRQB 4PGCA 5F96H 1A6AA 4CW1B 4XVTH 4MZ2A 3KPRA 1YEEH 1P6AB 1PY9A 1ZT4B 1GOHA 5C9JB 1DEEB 3OXRB 1UH3A 1UG9A 5B3JE 3JWDC 3QG6A 4XX1G 1HEZA 3VXSD 3U1SH 4JM2C 1CFTB 3RUGB 2IBZX 3G08B 3MRRB 4ONFH 3T4YB 1MI5E 4XRCA 3QCUH 3PQYB 1T3FB 2BSTA 4J12A 3PJSA 4NHUB 3CNKA 4OD3L 5DJ8A 3STLB 4Z76A 4LEXL 1F58L 3UBXA 4QHNA 3T2NH 2BDNL 2R23A 3EGSB 3HZKB 1FO0B 1DQML 1MFCL 2B1HH 5B38A 3EYSL 5FHAH 5L2JB 4ZXBB 5IVXE 4JM4L 4XPBH 2V5YA 5JPNB 4CN6A 4NO2B 3WIFB 3REVB 5D5MA 1U58A 5DK2A 2BOBA 4I3SL 3LKNB 4X9GA 1T22B 2AJSH 3DUUA 4G9FB 5GRVK 4BKLA 2OK0H 1F90H 1T7YA 1HSBA 4D9QE 4JZJC 4Y1AA 5I8EB 1N7MH 5TE4H 4K3EL 1GGBL 5EBGA 1ES0A 3HA0A 4Y4KD 1OSZB 5IUSA 4NT6A 4GRWE 5IFHL 1N4XH 2E7LA 4PJXF 1NJ9B 1FNFA 4K7FA 3L7FA 2W0PA 3KPQA 5I8CA 4FQJL 1YUHB 5CP3A 3QIUD 4KDVA 3IRZA 4JO4L 4X5XA 1MAML 3B2UC 1T03L 4J23A 3O0RH 4OQ1A 5EUOA 4P46D 1WEJL 4U1GC 4H1LA 3ZKXB 2HRPH 1DUYB 3T77B 4BYHA 3U46A 4HEME 4KPHH 3X11A 4ZFOL 4PJ9C 3CVHB 1QSEB 3U0TA 4JQXC 4U7KA 3BH8A 2DQIL 3SQOH 4KY1L 1T5WA 1J1OH 1IAMA 4XBGB 2W60A 4JM2D 1U6AL 4TOYL 2GI7A 1HHJB 3D2UD 1BJ1H 1PZ5A 2BNQB 4RGOH 1U8IA 5DFWH 4H8WL 3EBAA 1T7XA 4WFGE 4K07A 1JGEA 5KZCB 3I50L 1IGCL 5FGSA 3H7LA 5E6IB 1KBGL 1G0DA 2FH8A 3EYOB 3VG0H 1N59B 2MFNA 2HTLC 1CE6A 3ARGA 4H20H 4EDXA 5BXFB 2XZZA 3NPSB 4HKJB 3RWGB 3GSQA 1BVKB 3I75B 3IAQA 2JJVA 3FQUB 1U8OA 3SGEH 3HZMA 3R8QA 1W72A 4NRZA 4Y8DC 4NSKB 2BNRD 5T1MB 1F4WL 1NC2D 3SKMB 2CO6B 1MJUH 1QYGL 2XKNA 3KVQA 4HIJB 3WFHB 3DVGA 3V5HB 1V3MA 1BVZA 4PGDB 5FV2A 2PXYB 5KN5B 2EECA 4EQ3A 5FDWA 3RWIB 1F00I 1U8PB 4WI3A 5A2KH 1KJ2H 1TLKA 4YLQT 2ZUQB 4HKXB 5EO9B 1JPST 3CZFB 5EN2A 2XZQH 4J6RH 4LLWA 3BWAB 3ILPB 1IM9D 3B2UD 1FH5H 1QSFB 3GO1L 1MCWW 4R2GC 3MJ9A 3N9GH 2E9WA 4PJEA 4XCCL 3TO4C 1RJYA 2Z8RA 1YJDL 4L4TA 5D7IB 1N8ZA 5KS9E 1KCVH 1QBAA 2DQEH 2F8OA 3DX9B 4I0PD 2JCCE 4XPFL 3UPRA 5D2LF 2AQ3A 4PJ9D 1EEYB 4PRBB 5JDJA 3DROB 1KTRL 1MCOL 4LNRA 3H7BB 1DUZB 3BZFB 4YWGL 4P3CH 1ZLWK 3E8UH 1FLRL 4BSWB 3MLVL 9CGTA 1A21A 5E4IA 1RK0A 5HHNA 5JOFB 3PGDB 4FXGB 4JZOA 2MQ3A 4JO3L 1JMZA 2XFXA 1AHWA 1MRFH 4RGMC 1KEML 2VWEE 1B2WL 1U8HB 5C0CB 1WSST 2CGRH 4M8QA 4PV8A 4GUPB 3INUH 1VCAA 4ONGL 4J3WA 2VDKH 3VRIA 2FL5A 3BP7B 3QHFL 4KDTC 1QBLL 2HTLD 1IZKA 3BE1L 2OZ4L 2PN5A 1DEDA 3UP1A 1QRNA 4FMFA 1L7TL 3RBSA 5ISZE 2R4RL 3FOMB 3OHXB 3BP5A 3QI9A 2JB5L 5DJAA 3N0PB 4P3DB 3BQUB 3O3DA 5E7FA 2CR3A 3BDYL 1WT5C 2R15A 2VLJD 1M7IA 3O6FA 4UDUA 1ZKAA 2AXFB 3O41A 3IVKB 5BOPA 2FECL 5DZLA 3UZQA 1CE1H 1FORH 3S3PA 2MWCA 3RGVA 1T6WA 2DDQH 3F12A 3CLFH 1SBSL 1QFUL 2WWKT 1D5ZA 4IJ3B 3P0YH 2NY4B 4CW1A 3QUXA 5EZJB 3GMLB 2D0HA 1BX2B 2DI7A 5C9JA 4K8RH 4YXLH 1DEEA 4BZ1L 4FQIL 3OXRA 3FTGB 4ORGB 5J12C 2Z8WC 1WF5A 1KPRB 4JPVL 2ESVD 4R2GD 4LIQH 3G08A 3MRRA 3RUGA 3T4YA 1R3IL 4JO1L 4JQVC 3TO4D 2ICWJ 3PQYA 1T3FA 5DJ2B 5EU5B 1D9KB 5DD1H 1MFBH 3N1GC 4NHUA 3AB0B 3STLA 4GS7C 1JP5A 3T3PF 5FA3B 3OMZA 2FWOB 5CWSB 4MGXA 3MV8B 1KPVB 3EGSA 3HZKA 4XI5C 1FO0A 1WCQA 4NHCH 3K2UL 4FFVC 3S36L 5L2JA 1HCFX 1QG3A 5E8DL 1FZMB 2VXQL 3OKOB 2VDNH 4LCWD 4PRID 4R7DB 5JPNA 4NO2A 3WIFA 4B53A 1UWXK 3NIGF 2AJYH 3LKNA 1T22A 3ORJA 2WWMC 3OSKA 5CHNA 2IBZY 3V52L 4G9FA 3WDIA 4QTIH 5D1QD 3WJLC 1F4YH 5I8EA 3WO4C 3P9MB 1SY6A 4YDLC 1A6VL 4LCIL 1OSZA 4YZFE 2AEQH 4Z7UA 2P8MB 1MFEL 2FO1A 1O0VA 5EZOH 1AI1H 1Q72H 1NJ9A 4RAUB 1J5OL 1LO2H 1YUHA 4I77H 5IBUG 1UENA 5HYQB 2XKSA 1S7RB 1MFDL 3JSSA 4OIBA 5D9SB 3HNSL 1HHKB 1L9NA 2YUZA 2R2HA 1IC5H 4N1CA 1A3LL 3U83A 3UTPD 3FO9B 1DUYA 2EE3A 1FNEB 3T77A 1TNNA 3TF7C 2PR4L 1DP0A 3CVHA 1HINH 1QSEA 4KUZL 4LPTA 4PRPE 4Y2DB 4D9LL 2F53B 4K9EH 3QP3A 5E2VH 3VRLF 1QSZA 5K59E 5JHLH 4JFEB 3VI3F 2R56L 5LWYL 1OB1B 3T4AB 1TVDA 1JMXA 3MNZB 4XBGA 1WWWX 5DA0B 3GKZA 3RVWD 1HHJA 1KCRL 1NANH 4JHAL 3ILQC 4M7JH 4OLYH 3HNVL 1VB9A 5I76B 4XNYL 3NFSL 5DF0A 4GKNA 4K8RD 1DLHB 1EAPB 2ADIB 1A6UH 3ES6A 4HDIB 4JFXB 5MI0C 1J10A 4XI5D 4LHUD 4FFVD 4AIOA 5JXEA 2NW3A 1YPZE 1N59A 3HPLB 4K3JH 3WFZA 4PB9L 4F7EB 3BO8B 4ODXA 1RU9L 2HKFL 4HKJA 2Z35B 4WEUD 5J6GA 1Z2KA 1BVKA 4LCUB 4LK4A 3FQUA 5I1AB 4HUXB 5DJ0B 4EJ1C 2WWMD 1MIEL 4NSKA 2C4FU 3NCJH 5T1MA 3VMOA 3SKMA 1CYGA 4DZBB 4JGUA 4HIJA 3ZT6A 5I1GL 3V5HA 5FUZL 4YO0A 4PGDA 3QUYB 2PXYA 3X3GL 5KN5A 3FN9A 1II4E 3K80A 1JHKL 1UB6B 4Y5YB 4V1DB 3RWIA 1U8PA 3PWNB 2I5YH 3GI8L 5SWZE 2X6MA 3PWPD 4HKXA 1QVOB 5EO9A 5D71L 5ESAB 4CDGC 3CZFA 5C7XL 4YHNB 2DQDH 2FZ3B 1NLBL 2XWJB 3BWAA 3ILPA 4HWBA 4M1CC 4S1SL 5KSBB 4OLWL 1QSFA 2P45B 4CVZB 1L0XA 4YFLI 3P3YA 1JNJA 1NPUA 1V8HA 5D7IA 2FNBA 4MJ4A 3JV4B 1GZPB 4TUJB 4OT1H 3DX9A 5I2IB 3OF6A 3EO1A 5C2BH 3BFOA 3VFGL 2BZDA 5IFHH 1EEYA 4PJ5E 4HV8B 4PRBA 4RDQG 3DROA 3H7BA 1DUZA 3BZFA 3MXWL 5D6CB 2ZCLH 1VFBB 1JGUH 5J13B 1H3GA 5BS0D 1MJJB 1JWSA 2R2BB 3PGDA 3MLRL 4FXGA 3HRPA 3PDOA 1AP2B 2F54B 2YK1H 1OW0C 4OZFB 1I1AC 3C5ZC 4PJ7E 5DQJB 4NO0B 3FFDB 3CFCL 5BZDB 1U8HA 5C0CA 4GUPA 3TA3C 3ZKQD 1ZLUK 2N1KA 3VXME 4ZNCD 4JFFE 1MHEA 3BP7A 1G0XA 4Z7WF 4FZEH 1EAJA 2MPAL 3OJVC 1U2CA 3MOAH 6FABL 4F58L 5IV2B 1NCDL 2M2DA 1A5FL 2DLHA 4G7YL 4WHTA 1CFNA 4GAGH 3FOMA 3MRIB 3T0BA 4D0CB 1U3HC 4P3DA 3BQUA 4PPTA 4JQIH 4JFZL 4HJ0C 2AV7B 2QSQA 2WBJD 4WTWA 1WFNA 2AXFA 2VAAB 4WGVB 1UQSB 35C8H 3IVKA 4CGTA 1OSPL 5DI8B 2UZYB 4NC2B 2YUVA 4QOKD 2CUMA 2ZG1A 1MPAH 4WNQB 1V5JA 1YEKH 3RA7H 2AXGB 1SJHB 2VKWA 4WVRA 1VADB 2UV3A 4OLVH 5EZJA 4KRMB 5B8CC 5KVDH 1BX2A 3OAYK 1FYTB 4PB0L 3QUZC 4CUCA 4OFIA 2VSCA 4D3CL 3FTGA 4M1CD 5IHZB 4ORGA 1SBBA 4PJHB 1KPRA 4LKXB 3AS1A 3B9KB 5DD0H 1KIQB 3UPAA 5DJ2A 3DVNB 4YHLH 5HGAA 5EU5A 1D9KA 4EEEA 3AS0A 2RGSA 3EYVB 3CFDB 1E6JL 3MBEB 4RA3A 4NJAH 2EEBA 1L6XA 5IGXL 4FZ8H 5FA3A 5CWSA 2FWOA 3SBWC 3MV8A 3HG1D 1S9WB 4HWEH 2GW5A 3OKDB 5F1KC 3QZWA 4N90D 4ZPTB 4JVUA 3BSZL 1JYNA 1A8JH 1SJEA 1NFIB 4URTB 1FZMA 3OKOA 5E2UL 4KTEL 2CUIA 1AQKH 4KKCC 4XNUL 4QT5B 2OLDA 2NY5L 1ZMYA 1T04A 5I1KH 1HQRA 1I1AD 2R0ZL 3B9EA 2J8UB 2OL3B 4P2RB 4WY7L 1A3RL 4WEMB 5D5ME 3TA3D 5HHMD 5LQBL 1ZANL 4NM8L 3SJVB 2B8OT 4P4KB 4PUBH 2E6JA 2W0KA 4LU5L 1JGVL 1YEJH 5ALBH 3P9MA 1TJIL 5GZND 1GGUA 3WIHH 3AM8A 1NFDF 3QCVL 4P5KB 1HZHL 3TM6A 4KQ4L 5IFAH 3HS0B 1BFOB 3L5JA 4ZS6C 1U3HD 1FNAA 3DX8B 1X5ZA 4LSRL 5E5UB 4HK3N 5GRZA 4HJ0D 5I30H 1Y6KR 3A6CH 3GJFH 2ADFH 1S7RA 2EIBA 5BMFL 5SV3A 4QRPB 3F7PC 3R0NA 3ULUF 3WIIL 4XC3L 1VACB 4MJID 1G9NH 5GGQH 4ZTPH 3FO9A 1HIMH 3CX5J 2H32H 3C87A 4OLUH 3LB6C 4EBQL 2ZPKH 1MSPA 2H26B 3SDAC 4F9PC 3MTRA 5DS8B 3QUZD 4Y2DA 2F53A 3GSUB 5CJXA 2MKWA 3NA4A 4PREB 4JFEA 1NEUA 5CUSL 5TPWL 3T4AA 5AD0B 4QXUH 1QZ1A 3PNWB 3WFDL 4HXBH 1PDKA 3S34H 2C3XA 5C08E 4FQLH 1NCBL 1N5AB 3MV9E 3AAZB 1OAKL 1HH6B 2X5PA 2DIBA 2D0GA 1SBSH 2N7AA 1DLHA 1EAPA 2ADIA 4JFXA 2GY5A 3BN3B 3ZTNL 4TSBL 1TQCB 1QFWL 3TIDA 5GGRY 1JPTL 5L2KD 1ZLVH 3KLHC 4IHOB 4Q7DA 2Z35A 2WINB 4LCUA 5I1AA 1MHHB 4KKCD 4HUXA 2YD1A 3ULVF 1MCWM 5DJ0A 1AGEB 3VH8G 1BP3B 3NABH 1B6UA 1MCSA 3VMNA 4KRNA 1MI5D 4C56B 4QNPF 5J8OA 1CDCA 2F5BH 3VFMB 1KCLA 4NKOA 4X6DF 4DZBA 3S5LG 2FYYB 4DWHA 5J11C 3KPPB 2QQLH 5LG1A 2XZCL 1S5IH 1UB5B 3TBWB 4LLQB 3T1FB 3HC3H 1UB6A 4Y5YA 5MHSD 3PWNA 1UT9A 4GT7A 1QVOA 4PJAE 5ESAA 4YHNA 1LK2B 1A0QH 2FZ3A 3O2DA 2XWJA 2X9YA 2PTVA 4AIXA 5KSBA 4JFDB 2E7CA 2GAZB 3ZSTA 4NCC2 3RX7A 2XTJB 3O81A 4CVZA 3MV7B 5FM8A 5JW5B 2BVUA 3MUJA 4ODWB 1N6UA 3OJDB 3TJEH 1NLDL 2ATKB 3MRLB 4M6MH 3JV4A 1GZPA 4D9QD 1CG9B 1HXMA 4TUJA 4FG6C 4PJEE 4XH2B 5I1LA 5I2IA 3LB6D 3OKMB 3SOBL 4ERSH 2VQUA 5DD5H 3SDAD 4HSQA 1TPXB 4HV8A 5DVOA 5D6CA 4ODHL 5KG9B 3DUSB 3MX0A 1V7MH 3QNXB 4DK3A 2EYRB 2R2BA 4FQQB 2DLEA 3B2VH 2RCSL 4HIEB 4NUGH 4R0LC 1K4DB 2XYCA 1X5HA 1LEGB 1BFVL 1AP2A 5MEQB 5IB5B 2X4SB 4OZFA 5EPMB 4C58B 1S78C 4TPRL 5DQJA 4NO0A 3FFDA 5EU6B 5GGUB 1A3LH 5C3TA 2I9TB 1U42A 4WHDA 3ZO0A 4N8VG 3H42H 5E5MB 2FSEA 5C0BB 1OAXH 1BGXH 3KLHD 4ORZC 2L7UA 1DLFL 5IV2A 3WDHA 1DCLA 1JJUA 2V17L 5LAXB 3D5OF 3MRIA 12E8L 4D0CA 4JGJA 2OJZH 1QRNE 3UZVB 2VR9A 2B1AL 2AV7A 1IGJB 1MEXL 3RIFK 8CGTA 2APFA 1G1CA 3MCKB 1UQSA 1YY8B 3MLWL 3TN0A 5BVJB 4I18B 5DI8A 2YS4A 3ARBA 3I9GL 4HS3B 4S1RH 2FRGP 4WNQA 1INDH 3FB8A 2AXGA 4EZMA 1VADA 4XHQA 2H3NB 4L8CB 3A0OA 3WBDA 3FHQA 1FYTA 2NY6D 5CZXC 3ULUH 1DQDL 3HMXA 4X6CE 4OLXL 4JVPA 5J3HC 5GZOC 5D70H 5IHZA 3QDHA 3CC5B 1FDLL 1AKJB 1CXKA 1T89A 4LKXA 4IIQB 5DQDH 3X13B 1IFHL 3DURA 5CCKL 1VGEH 2ORBH 1KIQA 1X3DA 1U8MB 3DVNA 4OQTH 4N8PA 3RWHB 3RUGE 3WUWA 4P2QA 3EYVA 1YDPB 3CFDA 3MBEA 3PQYE 5FHBH 4G5ZL 1IAIH 4KK5C 1I75A 4BH7B 2XQBH 2WW8A 1TQBC 4XMPL 5L8KB 1CK0H 1RMFL 3PHOA 1Q38A 3KPSB 3L9RB 2MQ0A 1A2YB 1NFIA 2VXVH 2W0FB 4F37K 3CSGA 4XB7A 2QLVB 4XBEH 2OTUB 4OLWH 4KRPB 4QT5A 5F89A 4YHYB 2G5RA 3C5SA 1T83C 3CFIC 3GDBA 3GMNA 1S78D 4U2YA 3H9SD 3PWVB 2J8UA 2OL3A 2VSDA 4P2RA 1G9EA 4M6NL 4XP6H 3U7AA 3SJVA 1DBMH 4P4KA 4NCC1 4XT1C 1BF8A 4Z5RB 1VSCA 4DVBB 3U7WL 2B5IC 3ULVH 2FD6L 2YA2A 5EU4B 1YA5A 1T0PB 1IAOB 4XXDB 3HS0A 1BFOA 1YEFL 3TIEA 4Q0XL 3HE6B 4C4KT 1OAYL 1QR4A 1FQ9C 3GNMH 1UACH 3B9DA 5B39G 4C59B 1CIDA 1A6WL 4PRAB 2AI0L 3IF1B 2XN9B 3LV3B 1LE9B 2J3SA 3BKYL 3ULVC 1CBVL 1VACA 2ZUYA 2ZCHL 2MHAA 4M93C 3DMMC 3QXDA 1JHLH 1JPFB 3MRNB 5F7KC 2WNGA 4U4BA 1QLFB 5GGTL 3UJIH 5AWNH 1CGTA 4O2EB 2H26A 4DKFH 2NX5E 5CZXD 5DS8A 1FZOB 5D7KD 3GSUA 3ZE2F 5J3HD 5GZOD 3NGBC 4PREA 2DQJL 2PNDA 5AD0A 3O8XC 3D3VB 1I8IB 3PNWA 1N5AA 3MLYH 1CVRA 2Y5EA 5F7YC 4UMGA 1VFOA 2BVEA 4OZHB 3BVNB 3AAZA 2JIXB 2BNQE 3ULUD 4KK5D 4TSAH 2VZSA 3TEUA 3PE9A 4F80A 1XGPB 2R39A 2H8PA 4UQ2B 3VGDA 3KPNB 1YQ2A 5CJQL 1JNHB 1FAIL 4Y89A 2A77H 3WNPA 3NA9H 4YDIL 1AJ7L 2NXZC 4O9HH 2Y5TB 2YD3A 1I1CA 2DLTA 1YC8A 4UUJB 1C5CL 3UJJH 5KBNC 2WINA 1MHHA 3RWEB 3CXDL 5DHXB 1AGEA 2HJLB 3HCVB 4C56A 4EUPH 5C0EA 4R4NC 3LKRB 4Y5VC 2OCFD 1N5YH 5JIPA 3QDGE 3VFMA 3MLUL 4U3CA 2D31B 3M1BA 4KXZH 3HZVB 2FYYA 5F1OB 1KT2B 3PGCA 5DR5L 1FVCA 3S4SB 5HHPB 1UB5A 5GJSL 1KCSH 1XF1A 3TBWA 2G75B 4LLQA 3T1FA 1C1EH 3T0XA 4YBLC 1QLRB 2DMKA 1I7RB 3T0DA 2APBA 1OGAD 1LK2A 1GGCL 5EOCL 4L3ED 4JFDA 3ULVD 4YXKL 4JO2L 2CH8A 3MV7A 5IB2B 5L9DL 5JW5A 5I15L 4MWFB 2NZ9C 4LU5H 3DMMD 4O4YL 1QSFE 4ODWA 5EUOF 1TTUA 3FAXA 3OJDA 3MRLA 2ATKA 4ODTH 1CG9A 4XH2A 1X4YA 5HSFA 3M45A 5ABDE 5D7IE 5CEZH 4GW1B 4K71C 2IAMC 1RSFA 3QEUB 1OD9A 5E5RB 5EIQA 1KJ3H 5KG9A 3DUSA 3QNXA 3EFFB 4W6WB 3O8XD 4M4RA 4LDOB 4AL8L 2EYRA 1MCCA 5D8JH 3TH3T 4HX1B 2IFGA 3HR6A 4HIEA 1K4DA 4WWKB 4HUMB 1LEGA 2YPLB 1FGVL 5EA0L 3O3AB 4M7LH 5IB5A 2HN7B 4HPOL 1UWGH 3S88L 5FCUL 5EU6A 4RBPK 5GGUA 5ADOL 2IADB 1DQTA 4OD1H 1MJ8L 5E5MA 4ZD3L 4OM0H 5D7JB 5C0BA 4Q74A 4JN2A 4OB5L 2IAND 5TF0A 2ZZUT 4P9HH 2NXZD 3AREC 3MOBH 5LAXA 4JFHD 2GKIA 4OCYL 5I6XC 1B4RA 3CMOL 4TRPL 4FTVE 3WFDH 4Y5XC 1IGJA 5ANMA 5TFSL 4Y19B 4R4ND 1BD2B 4ZUSB 3MCKA 1YY8A 3BXNB 4I18A 4RMUA 4GH7B 1CDIA 1IGFL 5JLZB 2XRAL 1S7SB 4HS3A 1IT9L 4IRSB 2X9XA 4NNPH 1S7TB 5HXMA 1C12B 2JLLA 4MNGB 4EN3B 3NBNA 1JGDB 4L8CA 4PJGE 4TNVF 1UYWH 3QULB 1QD0A 4U6YA 3K74B 2YPVH 1AH1A 3BKML 2E27L 3I84A 1DVFC 3CC5A 1GYAA 2VLRB 2DYPA 5A2FA 1MLCA 3ZE0F 4IIQA 2OR7A 3X13A 1PEWA 3P4MB 2Y4SA 2XA8H 1U8MA 2NZ9D 3Q48A 3LQMA 2VISA 15C8L 4PJEF 4YQXH 5TF1L 3RJQB 5INCB 1P7QD 5IT2H 4YHMH 5HDQH 4BH7A 4CN1A 4OGYL 1OM3H 1KUMA 5DEZA 3QQ4B 4IMKA 1K8DA 3KPSA 1PG7W 4G3YL 3L9RA 4JFQB 3T0AA 1A2YA 2W0FA 4UI2A 3BOVA 2OTUA 1PG7L 3LDBC 4OLEA 4X4MA 4F8QA 3LY6A 2LABA 1CXIA 1KIPB 1LDPH 5CEZD 3PWVA 3STZB 4UT6H 5KVGL 2E9IA 2CKBA 5LXGL 3R0MA 4XNQA 4Z5RA 1BQUA 1DSFL 2YPKB 1KENH 3VWKD 4DVBA 5I1HL 1OAZH 1CICB 3VA6A 4PJ5D 2ED9A 3RTQB 5EU4A 3VXUA 1IAOA 4XXDA 1ZGLM 3G6DL 4NWTL 5FA4B 2VYRE 2R4SH 1YEGL 3GMOB 4WUUB 5HDLA 3HB3C 4ZYKB 4PRAA 4U7SA 2GYSA 3IF1A 3H3PH 3SE8H 5F97E 1QFWM 3TT1H 3KS0J 4PP1C 4XVUC 1I3GH 3O6MH 5C07B 3VXMD 2EYTA 1I9JH 2GEEA 1QBML 1JPFA 3MRNA 1QLFA 1CVSC 2HT2C 4O2EA 5CP3H 1EBAA 4JKPH 5FGCB 2GJJA 2H9GA 3VDCA 1FZOA 1WIOA 3K7UA 4QO1A 5IBLC 4NC1E 1DVFD 2EYSB 1JN6B 3AC0A 4JREB 4ODSH 3D3VA 1DQQA 2DJ4A 4KVNL 1I8IA 3RY6A 8FABB 2E7LC 4JPWL 4H1LH 5ITBH 5T3XL 3G9AB 3TWCH 2JIXA 3ELAT 4G42B 1XGPA 2PYEE 3P4LA 4HQQH 1OHQA 4UQ2A 4F15B 3KPNA 1F8TL 3MLTB 5T3ZH 1BJ1J 2EC9T 2CMRH 3WFEL 2AJXL 4OGXH 4M8VA 1Z9OA 4JPKL 4UUJA 1G7MB 5I1IH 1DQLH 4M4PA 1FZKB 3KPRD 1OP9A 3RWEA 1RZFH 3ROLB 2HJLA 1EHXA 4PJIB 4TTDC 3BZ4B 1HYSD 5GS2H 1KXVC 4DGIL 3LKRA 5CD3B 1O7VA 5C0AB 2D31A 3OJ2C 1J8KA 5T1LB 5DDHB 1KN4L 2ED7A 4LCYB 1KT2A 3TCLB 3C8HA 1YNKL 3HZYB 2PW2B 4MCZB 1G7LB 2G75A 1W72H 4Z7UF 5IVZA 1QLRA 4GAFB 4EOWL 1NMAL 3HB3D 4I9WE 1BOGB 3HRZA 2ZSVA 4V1DE 3ARGC 3QJHB 2VDOL 2A9MH 3RVXD 4PP1D 4HJJH 5AZEL 4XVUD 2CJUH 3X14B 5IB2A 1NEZG 4FQCL 3P11H 4Y8AA 4MWFA 2MOVA 2W9DH 4PGBB 3IGAB 3DSNA 3ZE1F 3QWRA 4RGNE 4Y4HA 4YHKH 4GW1A 5CS7A 4JKWA 5K93A 4Y1AD 4POYA 2XIDA 5EIVA 3QEUA 5IBLD 1CFQB 4XCYB 1JNNL 2XPGB 3MJ9H 5DRNB 1FE8L 3U2SB 5GGTA 2E7HA 4HX1A 3UO1L 5E8OB 3D39E 2VDQH 3HC4H 1IRAY 3U9UA 4WWKA 1IBGH 1G0YR 2CO7B 3C2AL 2EXYC 3O3AA 4KUCF 2HN7A 5E6YA 3GHBH 5GRXG 3TT3H 3U82B 1G9MH 4XC1L 3S6CA 3LMJL 4LSSH 4K23H 1CWVA 5E08L 2F54E 2BSRA 4XP4H 1I8MB 3EW3B 2DTML 1U8QB 3PXHA 4KKNA 4X99B 5F6IB 3V6OA 2EICA 5CBEB 1HOCB 1D3CA 4HIIB 2HTKC 4XVSH 2VZVA 1E4XH 4LGSB 4Y0GA 4UTAL 4KVCH 1R3JB 2VH5L 2FJGB 1L0QA 2J88H 4KZDH 4OF0A 4RISH 1G9MC 3WHXB 4TTDD 2F19H 3QQ3B 3BD4A 3BAEL 4HHAA 4LAJH 4GG6B 3KXFE 4NOFA 1IJ9A 3IFNL 2IEPA 1BD2A 4Y19A 1TNMA 1MCDA 2IJ0C 5T3ZD 1ZEAL 4DKAA 3G9VA 4U0RC 3U30B 3BXNA 3LN9A 4OF8A 4BSVB 3MLXL 3V4UL 1R24B 5JLZA 1S7SA 1AHWC 3E6HB 1TJHH 4HC1A 1S7TA 4XMLH 5JXAH 4EN3A 1JGDA 4NM4H 2L0DA 2QADD 5FECB 1VPOH 4KJPC 4L8SB 4YFDB 5GS2D 3QULA 4LVHC 5T1DL 4FP8H 4HS6B 4NRXB 5FXCH 1DBKL 4MAYB 2YD4A 1FYTE 1MVUB 2VLRA 3ARGD 4PJDB 4XWOC 1A3QA 2E7BA 3BPNC 4OSUL 4BSJA 2DBLH 1J7VR 1KB5L 4R4FH 3QI9C 4GQ9L 4PJHE 4IRJB 2DQCL 2W91A 4XP9L 3P0VL 3O6FC 4R90H 4BQ6A 3O3BB 3R1GL 5INCA 1DBAL 2MKLC 1FL6B 4X80L 4LVEA 3RGVC 5LBSH 4JFQA 3ZYZA 1JZ6A 5TQ2H 1UJTA 4LFHD 5JUEL 5CZKA 1N26A 4O02L 2IH1B 5C0DB 2IPKA 1CGUA 2EXYD 1KIPA 3ARFB 3STZA 1VEMA 4XAKD 4RQQA 3EKCA 3ARWA 1FO0H 3IFLH 2W38A 3OKYA 4NQEB 1R3KB 5ITFB 2J8UE 3T0WA 3LKQB 4D0BB 2Z93B 1HXYB 2YPKA 2HTKD 1BBJB 1CICA 4L4TD 5HI4C 4Q9RH 2ZCKH 5H2BB 3UPCA 2G60H 1RUQH 3FFCB 3WKNA 3UYRL 1PW3A 1Q0YH 3ZLQC 4DFHA 3SGKA 1S9XB 5CZVH 5FA4A 3V0VB 1WBYB 3GMOA 4WUUA 1S9VA 3TYGL 1I8LA 4CVWA 4ZYKA 5DMIL 1UM6H 5F7EH 4CRPA 5I17B 4YDKL 5JZ7C 1LO5B 1SY6H 4KHXL 4PIRF 5EWIH 5ADOH 2WIMA 3DGCR 3DXAE 5C07A 2EE9A 4QRPE 2QTEA 4KJYB 2NY0B 2E3VA 4RWHA 3OWEA 2EDBA 4KJPD 3VXTB 4KK6D 1FVDB 3RPKA 1UCTA 2YXFA 5EDXA 2EYSA 1IKFL 1D5MA 4XWOD 1RURL 3R8BB 1JN6A 5I1CH 2WP3T 3IDNB 5J9PA 3QFJA 1MCBA 8FABA 2HAZA 3QI9D 2D9CA 4DN3H 4GSDH 1NKOA 3CDYA 4ODVH 1TZGL 2B4CL 4ZDHB 2R1WA 3O6FD 3CLEL 4OLZH 3NTCH 1UWEH 3CVHH 1CU4L 3I85A 2R2EB 3O6KH 1KB5B 1XCQB 4G42A 1RIHL 3Q6FB 4UT7H 5HHVH 1PQZA 3RGVD 3MLTA 2OR8A 2O5ZH 1I1YB 3MLSH 3ZKXC 1G6RA 4JR9H 3GK8H 3QUXD 1G7MA 2W9EH 3EHBC 3GMPB 1FZKA 4UILL 5DMGC 1RUAH 5DK0B 3ROLA 2WMPA 1RIUH 4HUVA 3BZ4A 1CFSA 4O5LL 3TBVA 1C16B 1BEYL 1J0HA 1IGYB 5CD3A 4PS4H 1JYVA 5C0AA 3RX8A 5B4MC 3PQYD 5T1LA 5DDHA 3HLAA 3RWJB 4LCYA 3TCLA 3WJJA 5FGBA 1ZT7B 3HZYA 5HI4D 4CVUA 3F58L 1KXQE 5HJ3B 1OP5H 1WZMA 4PY8I 2PW2A 4MCZA 4YR6B 1G7LA 2XV6B 4Z95L 4MQTB 3FRPG 2VXUL 2ENYA 2W92A 1JNLH 5E6IC 3OR6B 2IFFL 2QQKL 1P9MA 4QXWA 4QLRA 2QSCL 2JJTA 4LPXA 3QXVA 1CGSL 5JZ7D 2FIKB 3TPUB 3QJHA 3MBXL 3QRGH 5DRXB 1MRDH 2I25N 3IKCB 3NPSC 2ED8A 3P30H 4HCRA 2Q7YA 2QQNH 1DN2A 2CUHA 1N2RB 3UTTB 3LS4H 3IGAA 3OB0H 1GJIA 3G5YB 4YJZL 4G9FD 4ZMAT 3OGCB 3HAEB 3K2MC 4W6YB 2FEEI 1RZ8B 4HWBH 1YYMH 1CFQA 3K46A 4XCYA 2XPGA 1IC7L 3N1MC 4JRYE 3U2SA 4G6JH 1Y6NR 1MCPH 4ZO7A 2PXYC 2GUOB 1R3HB 4U49A 2ZUQC 3B8SA 4G8GB 4M43L 4OCRH 1KFAL 3U4EA 5KVEH 2ICEB 5KW9L 5MERA 5GS3A 4X99A 5CBEA 1HOCA 4U1LA 4KDWA 4HIIA 5GXBB 1OQOA 4QHKJ 3CH8A 2DQUH 5JDSB 2FJGA 5GGVL 5C0BE 4DN4L 4BQCA 3EHBD 1GGYA 1FFQA 5DMGD 3LS5H 4I0KA 5F9AC 2BFVL 1MCQA 1E6OL 1QSED 1BIHA 3WHXA 4DW2L 4GG6A 3EYUH 3IU4L 2AGJL 2OR9H 4LSPH 3RZCB 3V4PH 5E4EB 4Z18A 3FOLB 4EVNA 4WFHD 4BSVA 3QEQA 1R24A 3SKUD 2VITA 3KLDA 4ALAH 3E6HA 4EI5B 1IKNA 5IVNA 1MREH 1QNZL 3BZEB 4X0KB 4PJ8A 4KWUA 5BO1H 2HYMA 5KZCD 1CGYA 1S9KC 5FECA 5L6YL 4L8SA 2P5EA 2FO4B 4MMZC 1JPSL 5JXED 2AABH 2MTPA 3ZDXE 4EKXA 4MAYA 5FOBB 3BKJL 2Y9RT 1OPGH 3U0WH 4OCXL 4WUKH 2JKXA 1NAKL 3HI6H 4L5FH 5KSBF 2GY7B 3DPBA 1EZVX 3BQUC 1FL3B 3ZL4H 3VFTA 2XT1B 3O3BA 1EGJA 2GK2A 2ICWB 1FL6A 2DJUA 2X44D 3JWNC 1ZLSH 4J3UA 3GSWB 3FMGL 4IJ3C 2DQFB 2NY4C 2PXYD 1DANU 4HXAH 2IH1A 4AQ1B 3LEYL 5C0DA 1NCUA 3GRWA 4YC2B 1NGZB 1Y6MR 4OV6F 3ARFA 4FQCH 5JPMB 5MENE 1EJOH 3VFVB 3V7AG 4BZ2H 2DB8A 2XWBB 1QSFD 1R3KA 5ITFA 5ALCL 2JTDA 3WFCL 3LKQA 1ND0B 2Z93A 1HXYA 1T21B 2O5YH 1RHFA 2X2YA 3W11C 5KJRH 1XF5B 1BBJA 5GRWA 3WUZA 1D9KC 2A83A 2BK8A 3FQRB 5ICXB 5H2BA 5HHOB 3AB0C 4UDTB 3FFCA 3NPZB 2HFTA 3OF6D 4ZUWB 1S9XA 3V0VA 3UO1H 1WBYA 4LAQH 5JOEA 1IMHC 3KR3H 3QG7L 5C0FB 7CGTA 3H6JA 3HHRB 3REWB 3C60B 1CGXA 4OCSH 1LO5A 4U3XA 5FUCE 2A6IB 2AXJA 4XP1H 4P59H 2XN9E 1ED3A 1INEH 3QEGL 3SHSA 3IXTA 1VFAB 4KJYA 4QF1B 5C0CD 1RY7B 1JE6A 3VI4F 5DD3L 3NAAH 3VXTA 4XCEA 4ZS7H 2HFFB 4MDJB 1Z9MA 1LP9B 3BIAX 3WNLA 1YECH 4JQXA 1I9IL 1I9RL 3BAEH 3AM8C 4GXVL 1TETL 1JRHL 3IDNA 5GSVB 3S37L 3IFNH 3W2DH 1NL0H 3KHQA 4PYGA 3BQUD 3ARDB 4NQVB 1T7VA 5D7LB 4ZDHA 1Q9OB 2R2EA 5KOVC 4OZHE 2BVPB 3Q6FA 1MWAB 1JZ5A 4Q2ZA 5E1AB 2R29H 5T5NF 2D03L 4OUOA 5LGHH 2BCKB 1J1PL 2NY4D 2Q8BL 1A1NB 1FFPB 4YH6A 3RU8L 5EBMB 5DK0A 4R8WL 4Y2DC 4M48L 2Q8AL 4M7KL 5CJXC 4R6UA 2ZKHH 5I18H 1MAJA 1C16A 1P84K 2OM5A 43CAB 2Y25A 1IGYA 5D6DA 3SN6N 1U8JA 4YHZH 4H5SA 2P48B 2KDGA 4IOIB 1HKLH 3W11D 3RWJA 4ZFGL 1D9KD 1ZT7A 2EZ0C 5JQHC 5HJ3A 1YNLL 5EU7C 4HBCH 3FN0H 4YR6A 3QIBB 1I7TA 3MV8D 5E03A 3OR6A 4OZIB 3UTSE 4KQ3H 3CAFA 3VFRB 2BSED 1KTLB 2AVGA 2ZUVA 3GJEB 3RBGA 1JV5B 1N0XH 4JDZB 1NSNL 4DAGH 2FIKA 3TPUA 5DTFB 2K3TA 4AEIL 5DRXA 4E5XB 3IKCA 4YXHL 1RPQA 2YBRB 2DD8L 3F5WB 3UTTA 4AG4L 3QEHB 3WEXB 3G5YA 1OLLA 3OGCA 1M71B 3HAEA 3B9VA 3O2DH 5HYFA 5E00B 1RZ8A 1MFAH 4MA7H 1KPUB 4TVPH 1UCBL 4X4ZA 4PR5B 2A2QT 1KLUB 1J0KA 2HH0H 5EZIL 4GMTL 4FABH 5DMIH 3ZT7A 3QUYC 3NFPB 1WIUA 1EEZB 2GUOA 4Y5YC 1R3HA 1KYOK 4KAQL 2G2RB 1MFNA 3M8OH 1BBDH 2WQRA 4G8GA 3SE9H 3UTQB 3BP4B 4O58L 2IBBA 2C26A 4WO4B 4X5WA 2ICEA 4AEHH 2YPLE 3FCTB 1X5JA 1P53A 5IMKB 4FNLH 3V7MA 5JDSA 3V6OE 5K9KB 5KANI 1NBVL 5TE6L 2B2XL 4OZFH 3KLAB 1RZJH 5DJ6A 4UINL 4Y2DD 2F53D 5DJZB 2IF7A 2IPUG 4JDVB 5J13C 4JFED 4UB0H 1UGNA 1QFHA 3RZCA 4P9MH 2H2SC 5GRJL 3FOLA 3HI5H 3IDXH 3A6BH 5IBUB 4Y19E 1BD2E 3AY4C 4EI5A 4K7PL 1Y18B 3BZEA 4X0KA 4P23B 1P69B 1RZJC 1S7UB 5GISL 5DMYA 4IOSD 1MQKL 1XMWA 4EUPG 1RIVH 3KAAA 4MNGE 2F15A 2FO4A 1TTFA 1I1FB 1D6VL 2W9LA 3RVUC 4CJ1A 4TTGA 2DWDB 1VA9A 3GB7B 1AD9A 3WE6B 2AJUL 3IETB 3KPTA 4MJ2A 4JQVA 1FL3A 2JF1A 4PJBB 3HMXH 3TN0C 2ICWA 5C6PB 3QIWB 4DKEL 3DO7A 4ZOEA 4G80B 3A6OA 1WIPA 2CK0H 3FKUS 3LQAL 1MRCH 1D5IL 3O4LB 4MAUL 5ACLA 2IGFL 3ARBC 3GBNH 3D6GA 3QO0B 4KMTH 4RMSA 2BRQA 4MXVE 4RAVB 1MUJA 4IS6B 4ZUVA 1GRWA 3GSWA 3H3KA 1KG0B 2IPUK 1XF3B 4M7LT 5DT1H 5C0GB 4A6YB 4LF3B 2DQFA 4L4VE 2UY6A 4ELKB 5AYUL 2NQCA 1F2XK 2UUDK 3MJ7B 1NGZA 3VFSB 1KIRB 4RMQA 3VFVA 4B7LA 3I6KB 2XWBA 5IMOA 4GBXB 3D9AL 4TVPD 2A9NH 3TNMB 1T89C 4P49A 1EZVY 2PKDA 3B9KC 1ND0A 1T21A 5CSGA 5F9DC 4LGPB 1WISA 1IEHA 1OWWA 1XF5A 4I4WB 2V5RA 3QWOB 2AK1L 3T0VA 5ICXA 5HHOA 4OCNC 4UDTA 3MBEC 1T1WB 2C1OB 4N0YH 4ZUWA 5DMKB 4HGMA 2OL3H 4CVXB 3Q5TA 1LO0L 5ICZA 3GIVB 1SVZA 3RL2B 5DXWA 1QKZH 1IGTA 2AJVH 5IVXB 5C0FA 3REWA 3C60A 5F7MC 2H2SD 3UTOA 2WANA 1L7IH 2HRLA 3BP6A 1XF2B 2OTPA 1BECA 3L3KA 3QPQC 4RA0C 2RR3A 5F9JA 3MZTA 1FG9C 4POUB 5GGSA 4X8JB 1UVQB 1FNGB 1VFAA 2BX5A 4NO0D 5D1ZB 4QF1A 4UV4H 2PF6A 1P4BH 3LN5B 3PABB 3B8YA 4P4KC 2HFFA 4MDJA 3O9WB 3GGWB 3OB8A 2KH2B 1LP9A 4J3TA 4NN5C 4GMSL 2X42A 4KI5E 1ZAGA 4PJFE 3RVUD 4Q9CA 5FGCE 4GRWB 4OGAC 3BJLA 3RJDA 4Z7QE 4NC0B 1RZGB 3V6ZB 4OKDA 5GJTH 3UYOD 3DYPA 1DBBL 2B0SL 4PD4J 4NQVA 2OP4H 5D7LA 4GW4A 3PL6B 1Q9OA 1GHFL 3SPVA 3TN0D 5DJCB 2BVPA 1Z9SA 5JQ6H 3OKKA 1MWAA 4ZO6A 4LASH 3ARBD 1BVLA 3JUZA 5E1AA 4V2CB 4BA8A 5BV7H 5HYJE 4MNQB 1C7TA 3PWJB 2L7JA 4FRWA 4U1IA 1D5XB 4XPAL 1JI1A 4ISVB 1A1NA 2EIZB 1FFPA 4K3DL 4CL7A 1FYTD 5EBMA 1A7PL 1HDMB 4X9BA 3BGMB 4TULH 4MHHI 1F11B 3ZDYE 5DLMH 4S11A 1UM4L 2X10A 4HUWB 4ZSOB 2Z8VC 43CAA 4G8IB 4PJIE 1A9EB 2CPCA 2H1PL 4MJ6B 1YEDB 2GK0B 2IMNA 4M62L 4TSCL 4LSVH 2AV1B 1K5NB 1QR1B 3S97C 2KZ1B 4PG9B 3QHTC 4P2QD 5C0AE 3MBED 1G6VK 1ZS8B 2GSGA 3Q1SH 2ARJA 3UBXG 4WFFD 4Y4FB 2YD7A 4LSUH 4NRYA 5B38G 4OZIA 1TQCC 4M6OL 3VFRA 5TGBB 1KTLA 3MRGB 2E8YA 5I1EH 2HT3C 3HPJA 5DTFA 4E5XA 1AR1C 3WSQH 5A43C 3QPQD 5FUOH 2X4UB 3KJ4B 1T2QL 3TYFA 2ZUUA 4P2RD 3QEHA 4NWUL 5M94B 4IM8A 3SJVD 4P4KD 1TTGA 1M71A 5E95B 4MB3A 1I7ZB 3OR7B 4YE4L 2D7NA 1KPUA 1XGYL 2NY3D 4ZAKB 4OGAD 1KLUA 1T1XA 5DO2D 3F7QA 3NFPA 1EEZA 4G8FB 5SX4H 2KBGA 2NR6C 2JB6B 3UTQA 3BP4A 4DK6A 1DFBL 2R8SH 2WWKO 3L5WB 1GC1H 2BC4B 3VWJD 5GS0H 4WO4A 1OW0A 3VCLB 3C5ZA 3FCTA 2XTJC 5IMKA 5CILH 1WZKA 4H1LG 4K94L 5KS9B 3THML 2JCCB 1JVKA 4XVJL 5K9KA 5F8RC 4R97B 5T3XE 3KLAA 3ZYJA 1TPXC 1AQDB 1GC1C 2E5EA 5GS0C 2VDMH 3VXOB 3BN9D 5DJZA 1Q0XH 1ZA6B 5EO0A 4JDVA 3H9HB 2NTSP 1MY5A 3LH2L 1ACZA 3GMMA 4GG6E 5I9QB 2DOCA 5FDYA 2GTZB 2GJ6E 5H37H 3SGDI 2FBJH 4FFWC 3OV6A 4JJ5B 2VUOA 5FB8B 4G6MH 4P23A 1S7UA 3U9PH 1T80A 2CXKA 4XNXL 4GKOA 5D2NE 1PFCA 1FSKB 1DBJL 1I1FA 2P42B 5DUPL 1F3DH 4Q58C 4Z6AT 2XY1A 3DARA 2Y07L 5DC4B 3NH7H 3KPOB 5L7XH 4JZNB 1AR1D 2DWDA 4NQDA 5SWSE 3GB7A 1U8LA 1ZGLP 5JW4N 3RAJL 4PJDE 2D4FA 5DJDB 4XCFL 3UZEA 3IETA 5JW3H 1E4WH 1YEHH 2AK4A 4NIKB 1AGFB 3FB7B 1HCVA 3LRHA 4C56D 4PJBA 2J4WL 1CGVA 4M6AA 3QIWA 4G80A 2VZ3A 4L9LB 5INDB 4I18C 1P5UA 5FYJL 1HILB 3O4LA 1RZKL 3A67L 3QO0A 4JAMB 1HE7A 4IDLA 5DHYB 2IALB 5K9QG 3L1OL 4RAVA 4IS6A 3K4ZA 4FQ2L 2BY3A 4NKDB 5D72L 1KG0A 4LFHG 4RWYL 3MO1B 5C0GA 5D7SH 4NQUA 1EO7A 4YHOH 1VDGA 4A6YA 3JV0A 1INQA 5EOQL 1CDBA 3MJ7A 3VFSA 3L7EB 1KACB 3GSRB 2EO9A 1KIRA 1HI6B 1MF2L 3ZDZF 2SEBB 3I6KA 4JFDD 5KSVB 2XWTA 4GBXA 4OI8A 3TNMA 2XTJD 4IIQC 3VH8B 3MV7D 4HF5L 1UEMA 1F2QA 1MIML 1XGTB 3KWWB 4NQEE 2NCMA 5CIPB 1KJVB 3JBG7 1JYXA 3SDCA 3QWOA 1WK0A 1J05B 5AUMB 3P4OB 4PG2A 2LU4A 1T1WA 1PLGH 5DMKA 1HQ4B 5GS0D 5EBWB 4CVXA 3GIVA 2X89A 3RL2A 1QFOA 3SKJH 3SKOB 1XGRB 2CKBH 4IMKC 5IVXA 4IEFB 4OCMC 4OF6A 1XF2A 4N68A 1SM3H 2X41A 1N3NB 1H3PH 4KRPC 5FAAA 4FFWD 3L3JB 4YHYC 3EAKA 4HK3J 1X5KA 3TPKA 2VE6B 4X8JA 1UVQA 2CLVB 1FNGA 4P2OB 3QDMB 5D1ZA 5EU6D 1UXWA 4TYUA 5FKPB 1ZLUH 1SMAA 3LN5A 3DVFA 3CUPB 3HNTH 4LMQI 5IJKA 1CGWA 4TNVK 3O9WA 1A7NH 3C08L 3GGWA 1X7QB 5C0BD 1BAFH 3FL7A 2C7UB 5IMLA 1NQBA 4MXWL 1CL7H 3G04A 3MA7B 5D4QA 2LVCA 2QR0B 4K3GA 1RZGA 4HZLA 3V6ZA 4NO5B 2O26U 3QUML 2VOTA 2CRMA 1V7NL 3HE6C 1FPTL 1SVCP 5FUCC 3PL6A 4ZFZB 3OAUH 1PZUB 3D0VB 2VL5B 3NACL 4NZRL 5DJCA 4LVNB 5GISH 5GHWH 1G7HA 2HFGL 4CMMB 4AENB 2IMMA 1ADQA 2KUTA 2VZUA 2YWYA 3PWJA 1D5XA 2QV2A 1RV6X 4PRPB 1JF1B 1HDMA 3F65A 1N6QH 3BGMA 3IRPX 1I8KB 1RQ5A 2UVEA 2DYPD 4RAHA 1FIEA 1FNLA 1RUMH 3NZHH 4HUWA 4G8IA 4LARL 4ZSOA 1A9EA 3RY6C 2EC8A 3WXWH 4JGMA 4MJ6A 2GK0A 2Y72A 1CZ8L 1K5NA 1X5XA 2AV1A 2ZG3A 4HS8H 4XPTH 1QR1A 5IHUH 4PG9A 2ADJB 1GIGH 4UT9L 1A7OH 1ZS8A 2W59A 4AM0B 1UFUA 3F6LA 4BFEA 3JWDL 1RK1B 5TGBA 3KPSD 3WN5B 3MRGA 1H15B 1JTOA 4DGYL 4LEOB 5ETUB 4LMQE 3T8XB 5F96L 3E3QC 4XVTL 4KRPD 3PWUB 1YEEL 3G5ZB 3FQNB 1LK3H 2V9TA 1HSAA 5EBLA 3ET9F 3UAJC 2BMKB 3KYKH 4K7PX 1I7UB 3UTTE 1FNSH 3U1SL 3MFGB 4B0MM 3RIFF 1KNOB 1N64H 4ONFL 3OR7A 3QCUL 3S3JA 4ZOBA 43C9B 4Z7QF 3VXUD 1KB9J 4JCLA 3UCRA 5SWZB 3OXSA 3T2NL 4G8FA 4QHMB 4R0LA 4P5MB 2B1HL 3HUJB 2JB6A 4WHCA 3L5WA 2BC4A 2OQJB 5FHAL 2YD5A 3VCLA 5C70A 3EUUA 4Z0BH 4XPBL 3W9EB 2Q20A 4RCAA 4XP5H 3VD9A 1OP3H 1P5VA 4L29B 3QUKB 5KS9A 3O6LH 3LHPH 5F9WB 3EYQC 2FR4B 2JCCA 2AJSL 5BJTA 1KXTB 5CSZB 1M7XA 2OK0L 2FCBA 1F90L 2R1XB 3VXOA 3BD5A 1QRKA 1N7ML 1ZA6A 5DHVB 5TE4L 3H9HA 4HG4K 3NCFB 5E0QA 2VLLB 3EO9H 3D3VD 4RRPA 3HMWH 5IKCA 1YN7B 3VD5A 1N4XL 4X5LA 1RVFH 3L95B 5B39B 1WTGT 4AQOA 4WWKC 4JJ5A 4F37F 5F1NB 5FB8A 1C7SA 5DRWB 1W0WB 2JIXD 2JELH 4KV5F 4Q9QH 1EVTC 1UKQA 4UNTA 5FF6B 2VLMD 5D7JC 3V6OC 3O0RL 3PWLB 3DTXB 4GRMB 4F3FB 5HY9B 3NCYS 4I3RH 3KPOA 1QA9B 3L5HA 4YPJA 1JWUB 2HRPL 4JZNA 5ISZA 4HMDA 1U93B 4XPGH 5I66B 4HC1H 1VFMA 4JFOB 4KPHL 1ZSDB 3MRFB 4QRRE 5DJDA 3U6RA 3FB7A 4WDIB 3SQOL 3UAJD 3MXVH 4RZCB 1J1OL 3ALPA 1WQVT 4L9LA 4OZGB 1HILA 5FV1L 4RGOL 4YHIB 1LDSA 5DHYA 2IALA 4ACPA 3G6JB 4UZGA 2ARJQ 5DUBB 1IGIH 3G5XB 4NKDA 4EN3C 3LEVH 3MMEB 3L7EA 3VG0L 3GSRA 4U05A 5AZ2H 1X6NA 1HI6A 1T83A 5E8PB 2SEBA 4H20L 5KSVA 1FN4B 3VH8A 4G43A 2BNRB 1XGTA 5CIPA 5FKAB 3EYQD 1J05A 5AUMA 2VDLH 3F62A 3QWRD 4RFOH 4Y4HD 5E6ZA 3UJTH 1HQ4A 3QQ9C 5EBWA 5HHOE 4OM1H 1MJUL 1PSKH 3WD5H 3CMGA 1CLZH 4GG6F 1H3XA 2I26N 4HKZB 3B5GA 1N3NA 4WWKD 3KPLB 1KJ2L 1A6ZB 3L3JA 4F2MB 4NP4H 5BQ7B 3NZ8B 2VE6A 1HYRC 2CLVA 3EO0B 1NBQA 3QDMA 4P2OA 2XZQL 4J6RL 3GIZH 3CUPA 3LKPB 1FH5L 4Z78B 3LRSA 3EFDH 1X7QA 2HT4C 3N9GL 4Z7VE 1FZJB 1OTSC 4XBPB 4I0PB 4YHPB 1FC1A 2C7UA 4OD2B 3GUTB 2R0LH 3BRFA 1CICC 4XWGH 1A7RH 3E6FB 3RTQC 4N8CL 1MOEA 3MA7A 1KCVL 2D7TH 3NN8B 2DQEL 1Q9KA 4LQ1A 2QR0A 5E7BA 3SGKC 4ZFFB 2FX7H 2OTWB 3P9WB 5FYKU 2NW2B 4P3CL 3E8UL 1I8LC 2MCPH 2RFXB 4Y19D 4ZFZA 1BD2D 5IW1A 4QHUB 1OCWH 2VL5A 1U8NB 2QSVA 1BZ7B 1YQVH 4U1MA 4CMMA 1SYVA 1MRFL 4EN3D 1ZVSA 5DGQA 2CGRL 3INUL 1B0WA 4KI5C 4FFYH 1ZVYA 2VDKL 4PRPA 1JF1A 3MR9A 3FO0H 4MA8H 1I8KA 3EDEA 1ZHNB 3VFPB 2VLRD 3MRJB 5ILTH 1NCCH 4JRE