2OR9H

The structure of the anti-c-myc antibody 9e10 fab fragment/epitope peptide complex reveals a novel binding mode dominated by the heavy chain hypervariable loops
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
226
structure length
221
Chain Sequence
EVHLVESGGDLVKPGGSLKLSCAASGFTFSHYGMSWVRQTPDKRLEWVATIGSRGTYTHYPDSVKGRFTISRDNDKNALYLQMNSLKSEDTAMYYCARRSEFYYYGNTYYYSAMDYWGQGASVTVSSAKTTPPSVYPLAPGSSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Monoclonal anti-c-myc antibody 9E10
publication title The structure of the anti-c-myc antibody 9E10 Fab fragment/epitope peptide complex reveals a novel binding mode dominated by the heavy chain hypervariable loops.
pubmed doi rcsb
molecule tags Immune system
total genus 39
structure length 221
sequence length 226
chains with identical sequence I
ec nomenclature
pdb deposition date 2007-02-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2or9H02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2or9H01
3QA3B 1B0GA 4NHUB 4EXPX 1K8DB 1YEJL 1M6OB 1QLFB 1ZHLA 3KS0H 3HC3L 4BELD 3QFJD 2KZWA 4X99B 3SJVE 3KDMA 5IM7B 4JQIL 1QUNA 3ZKMC 1T1XA 4F33B 3C5ZD 4GUPB 4KKAC 4QHLA 5IUSA 5L0QC 5LQBH 1IM9A 3SDDD 1QFHA 5EU7E 5GGSB 1CICA 2RQ8A 4UAOB 4ZS6D 1SYVA 3RUGB 5IBTL 5BZDB 3LMJL 4QHNB 2NXYC 2RR3A 5ABDE 3SQBA 4KXZH 3ARVA 5DJ0A 2X89A 3PDOB 5I1LA 3VXSA 1UM6H 1BD2D 4OCRL 4PTUA 1F8TH 4KC3B 2G75B 2MPAH 4TSBL 2NY4C 4LGRB 5D4QA 2GYSA 2EC8A 3PWPE 4HWEL 4M5ZL 4NZRH 4E5XB 5B3JE 4ZTOH 4JHWL 5MERB 1MCHA 1A1MB 3O3UN 1UJ3B 4APQC 1OF2B 5CWSA 2C4FU 4YE4L 1MAMH 1NBYB 4XMPH 1FZOA 4A2LA 3UAJC 4YXLH 15C8L 1T3FA 4HJGB 2I9TA 3DYMA 3I75B 4PRBA 3LKSA 4KK8D 1FNHA 2FHFA 3NPZB 2J12B 2BRQA 3P30L 4S1SH 4NQEE 1U95A 5IW6B 4S1DD 3QUXA 4DOHE 2JF1A 3CMOL 1HI6B 1TJIH 3QQ4B 5IHUL 3O6FA 5TDOB 3UBXA 3ILQC 2P5EB 2EDJA 2X4TB 1G84A 1P7QA 4PJXB 1DDHB 1NAMH 3VFNA 4JFHE 4HFUL 4JFDB 5FM8A 2BOCA 3EOBA 4X5XA 3KR3L 4Z7WB 4DKAA 4YXKL 1N64H 2FB4L 2UVEA 4I18B 2R1XA 3DPBA 4U1SB 1RUMH 3UBXG 5GS0D 4Y1AA 5F6HJ 4N0RA 3FQRB 1ZLUK 2HFFB 3GMMA 5DEFB 4NQCA 4LOUD 2HG5B 1DLFH 3DWTA 4QRTB 2R56L 5FIEA 3RA7L 3KPSE 5DRNB 3MV7B 4UNTA 2QQLL 4CL7A 1G9EA 5E94A 4ONHB 3B6SB 4OUUA 3VXPB 1ACYL 3PWVB 4K8RH 2PXYD 3L3OA 8CGTA 3RWGA 4E41E 3SO3B 1GGIH 2BNQB 3OB0K 1CXEA 5EC1B 1IEBA 2XN9A 3HS0A 1UKQA 2OK0L 4XRCB 5EUOE 5LGJA 2R1YA 1XCQA 2V9TA 3MA9H 2Q8BL 4MJID 2RJMA 1T80A 4LSSH 3T0EC 3VDCA 1XF5B 2KH2B 4H0IA 4UNUA 4MAUL 1YMMB 4Z7UA 5D93B 3GSNA 4PP1C 1KGCE 2HN7A 3BGMB 3M1BB 3MFFA 2DTML 4XH2A 3N1QC 1SVZA 3E6FA 3TT1H 4LVOB 5F7YC 4PRHE 3L3JB 3BO8A 4GT7A 4GG6E 1NFIA 3S36H 1MUJB 3HE6A 2XZQL 4AEEA 1MHCB 1IBGL 1KACB 5D2NC 5GGUA 43CAB 2AAVA 2Q8AL 1FCGA 2YRZA 2GEEA 4GAFB 4FG6C 3PXJA 2HKFH 3WIHA 4NN7C 5EUOF 1T1YA 2FR4B 1HWHB 5I1KL 2EDWA 2H1PL 2JJTC 1I7RB 3DURA 1HH6B 1U91B 1HILA 3FB6A 1QRKA 2JELH 5FGCE 4WEBL 1CS6A 4JN2B 2P43B 4FXGB 1CDCA 5GS1B 1QLEL 4QRUA 4XPHH 3NABH 3SDAA 1AXIB 4L8SA 4B41A 4ZMAT 1PQZB 2WINB 3GRWA 1F4WH 2EIEA 2CKBA 1B4JL 3S35H 3DX9A 4YBQD 4RISH 1A3QA 5IQ9A 3TBVA 2VZOA 4ELKB 1N5YH 3UC0H 1EEZA 4P23A 1CU4H 2AJZA 1I1AB 2KDGA 3I6LD 1OGAD 5GIRB 1I3VA 4UILH 3W39B 5IFJB 2PYEE 4U1KA 4X9GA 4Z0XB 4ZXBC 1A2YB 1UH4A 4S11A 3RGVA 1E4KA 1ZANH 5CSZA 3T1FA 4WI3A 3ARGC 1YYLL 4G6KH 4TULL 4JZOB 3TYGL 1NJ9A 5ALBH 2Z4QA 3GBML 1F4HA 5D8JH 3WFBL 2RGSA 4XP5L 3UPRA 5FO8A 1QPXA 3IF1A 4DN4L 5F3BA 4RAUB 3TLRA 1U8HA 3HI1B 1B9ZA 4P57B 1DJSA 4Q58C 3C60A 3QULB 3C09B 12E8H 2XTJB 4NQXB 4HJJL 5JDSB 5LJYH 4QF1A 1MRDL 5GHWH 5M94B 1Z5LA 4LCWE 4PTTA 1BIIB 3MLZL 3WLBB 1YN7A 3X13B 1NDMB 1U3JA 4IOSD 4KXZI 2YK1L 4ZQKA 2YN5A 5I71B 3OJDA 1J9CT 4MX7A 3KYAA 3SCMC 5H35B 5EBLA 5MEND 1X3DA 35C8H 4LNRB 2MCG1 4WNQA 3LRSB 4YHNA 1OW0C 4MNQE 1EUUA 4O00A 3RQ3A 2EEBA 2N4IA 2CR3A 4HK0A 1U8KB 4K71B 4AENA 4MLIA 4KQ4H 5FOBA 4OZGE 2WP3T 2A73A 3V6OE 3NFSL 1H3GA 2OJZH 3QIBC 5ERWB 1ZMYA 2JJSA 5ICYB 2OTUB 4OJFL 4K3DH 4D2NA 4X4MA 1UXWB 4K8RC 3DUHA 3WSQL 1Q9KB 1CXKA 1WZKA 3HUJA 1J1OH 1YEHH 4LCUA 1T0NB 3DX8A 1LDPL 2VYRE 3UYPA 5IVZA 1RJLA 3P4MB 4JQVC 2BC4A 3QDJD 4NYLB 4F8QA 4YAQA 4QRRD 1HQ4A 1F11A 3EO9H 4K94H 5IHBA 4RGND 3O8XC 4LLDB 4GRLB 5TPWH 3B3IB 1AGBA 2V17H 1QBLH 3JWOC 5KSAC 3K2UL 4YWGL 4Q9BA 1U6AH 4F58H 2XXMB 5K9KB 1VESA 4MYWB 5DD5H 4XPAH 2R29L 4MHHI 2DMKA 2FHCA 2IGFL 5AD0B 2NR6C 2FWOB 4Q2ZB 4WFGD 4XC3L 4CU7A 2KUTA 3U7WH 4CJ1A 3PQYE 3AREB 1E6JH 1T0MB 2AJSL 4Z78A 4H88L 3WDJA 25C8H 5GZOC 3UZQA 1F4AA 1KLUB 4P2QD 1JF1A 3MBED 2FBJL 3ROLA 3VFTB 4RFNC 2FYYA 2IAMC 2EXWC 4HBQA 1SJHB 4XC1H 3EYVA 3SKMB 3HNVL 4RQQB 2QADD 1LK3H 5BJTA 4J8RB 3O11A 4G43A 2FX8H 5FYJD 2VDNH 4AEFA 1IGML 4P4KC 4KY1L 2MQ3A 4X7CC 1TVHB 4F7CB 3K8LA 3S5LB 3WUWB 2J8UA 4MVBC 2GJJA 1CFNB 2OXGA 1NEZB 5CIPB 4JZJA 1Q9OB 3GFUA 3ARFD 1KB5H 4U1MA 4L8BA 4OV6F 3CC5A 4XXDA 3NCJL 5K9QG 1U8MB 1V3LA 1BLNA 2G60L 1JPFA 1PY4A 2BXZA 3CVHL 3V95A 3MLRH 4M9PA 4ODHL 3U0PB 3UPCA 1UB5B 2CUIA 4N1EA 3VWKA 1T7ZA 1PBYA 4BZ1L 4F2MA 1Q9WA 4X80H 4PD4K 5F1IB 3U4EA 1NCBL 1O7SA 4PYHA 3BRDA 1LDSA 2EKSB 2X4PB 1CGYA 2XI9A 3HAEA 3QIUC 4CMMB 2GY7B 1CL7H 5ENWA 2LVEA 4KKLD 3VXMA 1P2CB 3H7BB 1NFDE 2D4FA 1KCRL 3BFOA 2PO6A 4M48H 5BS0D 4OLWL 1A7PL 3JZ7A 5CJQH 2Y9RT 2OZ4H 5E9DB 1BF8A 1CLZL 3QDAA 1U8LA 3KPNB 4P2RD 2V5MA 3EYOA 4JR9H 3HAEG 4JFYA 3AS2A 5MEPB 3MV8B 2VXVL 3VRJB 1MCPH 4V1DE 2ZSWB 3BPNC 5T5NF 1YEDB 4TNVF 4WFFD 1AO7D 3GIZH 1CGTA 2JCCB 2Z0BA 3JVGC 4UDUB 1S7QA 3HA0A 3ZTNL 1R3KA 1UQSA 1FNEB 5AYUL 2VDPL 4PJBE 5FYLD 3BKMH 2CLZA 4Y5XA 4RAVA 3RX8A 4WO4B 2C1OA 3OHXA 1U3HA 1EVUA 1NC4D 2Y5TA 2ZUWA 4QRPB 3DUSA 5B4MD 4E0RA 3O2DH 1EMTL 3RVXD 3V6BR 5T33H 1GHFL 4JG1L 4OD2B 1JI2A 5D1QD 4Q9QL 1PG7L 2W0KA 3S36X 1JGDB 4AL8L 5CD5D 5IMKA 5KJRL 1QRNB 1S8DA 1F13A 3HHRB 1OGAE 5CJOL 4K94C 1M71A 1MFEH 3PDGA 3GMQB 3O9WD 1INDH 4JGUA 3QG6A 4XVSL 2GTZA 4LVHB 4MB5A 3QUYB 3OKEA 4JRYB 5EWIH 1F3JB 3H9SB 2XPGA 4MSWA 4YHML 5T3XH 3C8KA 3BRGC 5C0IA 3PWNB 5I16B 3RBSA 3W9EB 3QI9A 4OD1H 2A0LC 1I1CA 4PJBF 1FZJA 4L8DB 3BD3A 1F3RB 4N0YL 2GSIB 1FN4B 1DP0A 5F72S 4YXHH 4ZUUB 1CD1B 1ZS8B 2CRMA 3BE1L 3CFKA 2P47B 3KPSA 2HKHH 4RNRA 2BSTB 5E56A 1BQHA 1LO5A 4IRJA 4PJ7E 1IFHL 4NUJB 2AK4D 4QTIL 4K7PL 2GT9A 2OMNA 5IKCA 2DM2A 4CNIA 1OP3K 5MENE 4G8GE 4AYFA 3TJHC 3D69B 4DUXA 1BQHG 5E5UB 5JW4N 1FL3A 4MJ6A 4BM7A 4MNHA 5IMMA 3FTGA 1OAXL 1QFUL 4Y5YA 3PNWB 5F93C 1QHPA 4H25B 5L88H 2L0DA 4ZODA 4QWWC 4JRXD 1HQRA 3U0TA 3NH7L 7FABH 2P46B 3A67L 2ZUQB 4YDKH 1QVOA 1IT9L 1NGQH 1CGXA 1X7QA 3BQUD 5I1AA 5DI8A 5L8JB 1DCLA 4YDJA 5GISL 4W6YB 4L4TA 4BFGA 1AJ7L 5D7IB 4X98A 4AH2A 3TVMA 5I8OL 5FV2A 3O0RH 1KJVA 3I3BA 1I8LC 2VWEC 4MAYC 1D9KA 4N90D 5CEYA 3N1GC 1DQQA 4N68A 4H0HB 3UTSE 4Q74A 3LCYA 4WCYH 4ODXA 4FQXC 1OAYL 2VZ1A 4OZIE 4R0LC 1NGPL 4IIQC 1Z6JT 4WFGE 2HYMA 3JWDL 1B2WH 3WJLC 4Y2DC 5BOPA 4H20L 3NCYS 1AIFB 1S5IL 1I8MB 4JJHA 1RJYA 3OTTA 2YA1A 5ISZE 3BP5B 3GMNB 1CGUA 4HKBB 3GZKA 1FPTL 3MYJB 4JGMA 3GUTB 3SE3C 2PYEA 4TNVK 3BIAX 1UWXK 3PL6C 1DTUA 2UV3A 4KGLA 4PV8B 3MRBA 1RVFH 1KB5A 4HS8L 5F88A 4PJDE 4PPTA 1FFPB 3V4VH 4PLKD 3DOSA 3MNZB 4OZIF 2F8VA 3FRUA 5GS3A 3RDTD 3EDFA 2AV1B 4FQ1H 2M8XA 1GOFA 1BVKA 3F7YB 3QO0A 4LMQE 3VXNA 1IAOA 3PJSB 5INCA 1FVEB 5EH1A 2JJVA 2DLIA 1DQJA 2F8XC 1T22B 1NGWB 3FONA 5EPMA 2R0WL 4JJ5B 3IDUA 4I2XB 1MHPH 5E2WH 2ID5A 5LG1A 5ESAB 5INDB 3AFLA 1NMCC 1JGEA 5HYJA 3QHZL 1YEEL 4OCWL 3E6HB 3DI3B 4Z95H 4LQFH 5IK3A 3HG1A 4PJDF 8FABB 1KPVB 3NA9H 3BVNB 3DO7B 2OSLB 3MJ8A 3TO4A 5J1AB 4X4XA 5E8DL 4JFEB 4XPGL 4G9FD 3K46A 2XIDA 3I02B 2LFGA 2LAGB 4JFOA 3E8UL 5FK9B 4MWFA 4H8WL 1W2KT 3ALPA 4MA8H 5FGBC 4IRZL 1F4YL 1AR2A 1RJZA 3KAAA 5J12C 3WKMH 3DXAD 3ZSSA 3RU8L 1MQKL 3KWWA 1TQBC 2I60H 2IALA 4XVUC 1RURL 5GRVL 5K9JH 4ZAKD 1N6QH 4NJAH 1IZJA 4X6FA 2W9EL 4PJFB 3N06B 2A6IA 4XNYH 5KSUA 5ACMA 2BVPB 2YD8A 5I73B 2XQYK 4ZO7A 3GK8L 4PJHE 4FXKA 2VLLA 3P0YH 3VGDA 2NXZB 4M1DL 2IH3B 4NBXB 5I1CH 5FB8B 4XP4H 4HH9B 5I9QC 3OGOE 3RBGA 3SDCB 5KANI 2OR8A 4U1IB 3CAFA 1KXVC 3ULVD 3ME0A 2CMRH 1T0PB 4WU7A 3P9LB 4S2SB 4YDLB 1BM3L 4M43H 4PGBA 3CFIC 1QO3A 4C58B 4XI5C 3SDXB 4BH7A 3UTZB 1G9ML 1J05B 1J0JA 4Z6AT 1D5IH 2NTSP 5I18L 4R90H 2ESVB 5BV7L 4QXUH 5D1XC 3QWOA 5GGRB 4QGTA 5CJBA 3CDGA 3GMRA 4KRPC 3DV4B 3G6JB 2JIXD 5I1JH 3NMEA 5LKNA 3IAQA 3NIFE 4OGYH 1F97A 3ARBC 1BEYL 1SYSA 1V7MH 2GIYA 4ZFOB 1T83C 4PJHF 3KXFA 4X7SH 5CD3B 5GRJL 2CPCA 4EN3B 3LN9A 5EO1B 4Y4KD 4MD0A 4TTGA 4B5EA 3LOWA 1HSAA 3V4UL 3ZKND 2FEEI 1HXYB 4JO1L 3T2PA 3H3PH 2I5YH 1FORL 4X7TA 1LK2A 4K2UL 3RWHA 4R2GC 4MZ2A 2IFFH 4PG9B 2BJML 1QR1B 3GSQA 3L95B 3PWLA 1YNKL 1MCFA 4I48A 1KN4H 5DD3L 5C8JA 1NEUA 3FN3A 3LD8C 3IDNB 1IGIL 4JFPB 1OPGL 4L3EB 2BRRL 3NIFF 1HIMH 4XVTH 5B39B 2R9HC 3RPIA 4DZ8A 5CKAA 2YBRA 4K23L 4N9GB 1QP1A 3QJFB 2RFXB 1XMWA 3VDBA 3VFVA 1NMBL 2VE6A 2E7MA 3SE8H 2IMNA 1ZTXL 5H2BA 1UCBH 4PRPA 1QYGH 4LF3B 3MRRB 3VWJC 3R1GH 1S7RA 5F89B 5L2KB 3U1SH 2CLVA 4ESKA 3HZYB 3O41A 5HTSA 1IGFL 2X4QB 5FYKE 3OWEA 1CFSB 2WLZA 3MX0A 4M61B 4YGVB 1CIDA 3RUGE 3B9KC 1X6LA 1NL0H 2NX5D 4HDIA 1BX2A 2MHAA 2X5PA 2H41A 2L7JA 3IJSA 5L6YH 3L7EB 3ARQA 1AC0A 2ZSVA 3VGFA 3DVGA 4J3SA 5JA9A 2CR6A 1MFDH 1U2CA 2G2RB 3TA3B 3D2UD 4X8JB 1A0QL 4MA7H 1FSKC 4I1NB 3HRPA 3D25A 2IBBA 4QRRB 3NIDF 3OF6A 1DSFL 4IRSB 2Q6WA 5K59E 3BP7B 1J88A 3WIFB 4KKBC 2D03H 2E7LC 5IMOA 2WUCH 4O5LL 5HGBA 1AGDA 3BD4A 4PJ9D 3EFDH 4N8PA 5HI5C 5KVFL 1TPXC 1TXKA 2F54B 3WUZA 4Q9RH 3VFMA 1VFAA 4HIEA 2FX7L 1YPZF 3L9RB 1INQB 5J6HA 3SHSA 1YEKL 4D0DA 3MCKA 5I1DA 4OIIL 5D7SL 4HXBL 1YDPB 4Q6YA 2WIMA 5GJSL 3LKPA 2B1AH 1QD0A 2CIIA 3EFFB 4Y0GA 5EORL 1EGJL 2ZNWA 4G6FB 1LO3L 2ADFH 1PYWA 5TE6L 3TFKC 2JK5B 1KJ2A 1NCAH 4LSRL 2NZ9C 3NVQA 2ARWA 2BCKA 3KJ4C 1PD6A 3UJIH 1PKOA 3RX5A 1T2JA 2ZWLT 4JN1L 1EERB 3EKCA 5EIIA 3DMMC 4JKPL 3U36B 4Y8DC 4EEEA 3DVIA 3MCLL 2P5EE 1AGEB 3SDYL 1J8HD 3HMXH 4PJXE 3TH4T 2A77L 3DV6B 3BGFC 3L6FB 4R26H 1CFBA 4NP4H 4ZFFA 5J06A 4KKCD 3T0AA 2I9LB 2X4NB 4Z7WE 3QHFH 1T89C 1Y18A 2XA8H 1UYWH 4PJ8C 4X6DE 4YHPA 1LHZA 4MXWL 4WV1C 3VGBA 5TJWK 2YUVA 2X9WA 2P4AB 4IHOA 3TC9A 2CDGB 3MV7E 4KZDL 1ONQA 1GYAA 2NY3D 4YDVA 5IW1B 2XZCH 1GH7A 1KPUB 1KTLB 2DMCA 3MLXL 1HHIB 3VFGL 4ODUA 4XBEL 4G7YL 5DFWH 4POZD 5IFAH 2O5XH 3AROA 3I9GH 5HHNB 1X5ZA 4NJ9H 4P46B 1PKQB 2H26B 1MJ8H 2BNQE 4P5TC 2EDXA 5FFLA 1A5FH 2WBJD 2J6EA 5C09D 5IB4B 1DUYA 1F3DJ 1EEUA 3CK0H 2YSSB 1CZ8L 2DYPB 4QY8A 4AT6A 5IB5A 1HXMA 4U6XA 3T04D 3GSRA 4CVXB 1T03H 6CGTA 2EIZA 3JV0A 2NY6C 2XG5A 5AZ2H 4XB8A 3VJ6A 1YMME 4X6DF 4YH6A 3TNNB 1JUFB 2E9JA 2W65B 1NCUA 4FFWC 1R5IB 1C5DA 4KJQC 5E8NA 2CSPA 3OZ9L 4KKNA 1GPOL 4AEHL 1K85A 4H5SA 3C6LD 4XVJL 4XNMB 4R8WL 3QUKB 2A1WL 2NLJA 2A83A 1U8JB 1EAPA 5J13B 3ORJA 2FJFB 1HDMA 1RIVL 3P9MA 2OL3B 3AB0C 2ZOLA 5A43C 1SEQL 1WWCA 1GGUA 5C70A 3HFML 5ILTL 4KWUA 4JREB 1Z2KA 5D6CA 4HZLA 5FDWB 5E2VL 2L7UA 3MOAH 4JFQA 2UWEA 2BHUA 3MV11 2EDEA 3T3PE 1LP9E 3QH3B 1ZEAL 5F1KC 3IU4H 2YN3A 4BSWB 3I6KA 1FYTD 3L3IB 1PZ5A 1UM5H 2AV7B 3ILPA 3MRLB 4K9EL 3S37L 1CD0A 4GXVH 3LDBB 1V5JA 5KSBF 5I0ZA 2EH8H 2CDFB 1ULVA 1JK8A 4I8DA 1HEZB 5TE4L 4GKNA 4TUJA 1KCSH 5DWUH 3SEPA 2IC2A 1ZHBB 3GM0A 3QXVA 4KVNH 1A6ZB 3UXFA 5KSVB 4NUGL 2HTKC 5BRZA 2L4OA 1P7KA 3QJHA 3UJTL 1LP9F 2DJSA 4HBCL 1CF8L 3QZWB 4YX2H 1IGYA 5FKPB 1WZLA 5EZIH 3ET9F 1EO8H 3Q3GB 1TJHL 1JPGB 4D0CB 2XTJE 1C12B 1NGYB 4G6AC 4LLWB 1VADA 4PJIA 1MLBB 2NZIA 4O02H 1RSFA 1YJDC 2GTWB 3FQWB 4IMLB 1DE4A 4L9LA 3I85A 1A7NH 5DA0B 1E27A 3T4AA 1CXLA 5CEZH 2DM7A 2Z31D 3L7FB 1PDKA 1I7UA 4PJ5D 3V79C 5GGVL 1MF2H 1ADQL 1TZGL 2IH1B 4NHCL 4KRLB 4BKLB 3GJFB 2YWYA 1N4XL 1JN6A 3C2AL 1GGBH 1ZVSA 3LKRB 4J3TA 3KYNB 3ZKMD 4M7KH 4HIXH 1HKLH 4KKAD 3NCMA 1L6ZA 2MMXA 1C7SA 5IG7A 1KELH 4AIZA 1FZMB 4LRIA 3CLFH 1YY8B 2GJ6A 2DJUA 1RHHB 2QKIA 4PJAF 4WI8A 2KL6A 3WD5L 3D87B 1XGUB 1T7YA 2ZCKH 1XH3A 4Y16B 5SV4A 5D7JC 3CH1B 3VW3L 2WM0A 4UQ3B 2NXYD 1JFQL 4JLRB 5FUOH 3AXLA 3H8NA 5C1MB 1A3RH 2DIJA 2PR4L 4QXTB 4FFVC 1LVEA 5C08A 1HHJB 1PW3A 2FH8A 1RK1B 2NY4D 2CRYA 3ALWA 4L29A 2DQIL 4JY5L 2J88H 5E5MA 4NRYB 2NY2B 3RL2A 4ONFH 1KC5L 4PLJC 4K7PY 3A6CH 2DQTL 4Z7VA 3HNSH 1JV5A 5F7DA 4N1CA 1N0LA 3IDMB 4FQCH 1W72H 2VDMH 1S7TA 5LBSL 3ZT7A 3KPRA 5GRVK 2ZUYA 3UYOD 4LRNH 3MLVL 2YKLL 4L1DA 5E70A 1XF3B 1ZXQA 3OB0H 5J57B 3UAJD 5DJ6B 4FP8L 4Q6IB 4WY7H 4F7EB 4Q97A 5DK3A 3HE7B 4TRPL 4PGEB 4WW1B 4EOWH 3VGGA 3G08A 4ENEC 4P4RB 1RUKH 4H1LH 1OGTB 4OM1H 1CGSH 3TBYB 4X0KB 3OAUL 4G8IA 4U6YA 2GAZB 5DQJA 5EDXA 1YN6A 4HX1B 4L5FL 5EZOL 2YD7A 1ZSDB 3LHPL 3V0WH 2E7CA 1K6QH 2VO5A 3ILQD 2DS4A 3QDMD 4XNQA 3EO1B 2XWTB 3HPLA 5IHZB 3REVA 1GGCL 4HHAB 3ULUC 2P8MB 4HW6A 4JKLA 1X6NA 5E4EB 1FG2A 4YK4B 3UTOA 1NC2D 3QA3A 3QCVH 1K8DA 1QSFD 1CFQA 4JB9L 3B83A 3SGKC 1CQYA 1WISA 4IEFB 4JVUA 4X99A 32C2A 5FDYA 1FH5H 5IBUG 2OJEB 4GO6B 3VE0B 1FFRA 5BW7C 3OKDB 4XX1E 1NCDH 1X5FA 4GUPA 3NIGF 1PVHA 2WWKO 1DQLH 1IAIH 1V7NL 4PS4H 1AE6H 3GMLB 3BSZH 4G9FB 2P5WD 3OPZL 3NACL 4PJGF 1F58L 5BZDA 4JGJA 2ED7A 3HZVA 3RI5F 1SM3L 4LHUD 5FHAL 1TCMA 2DM3A 4GG8B 3Q6GH 5E9DE 1FLRL 4XAKD 3T0ED 3DXAB 4GRWE 3CX2A 1Z9OA 5AUMA 4PP1D 1BZ7A 5I8KL 3MV8E 4U4BA 5EU6D 3IFPA 3CFBB 3RVUC 4WUKH 4FABL 5JR1L 2UYLB 4JDZA 5IEKB 2HFGH 1RFDL 4OCMC 2JCCE 3VG9B 3WN5B 4E5XA 3MRKA 1T21B 1QHOA 4RA3A 3TN0B 5MERA 5A16B 4JFZL 1A1MA 4FG6D 3J8F7 2VLRB 2DTSA 5IESL 3T3MF 1FVCB 5I8EB 1NCCL 4QRPE 2HJKA 2E6QA 1N59B 4G3YH 4JEGB 5HDBE 5SWSB 4HJGA 5FGRA 3BUTA 3WEXA 3QXDB 2OI9C 1NGXB 2V2WB 2RCSL 4GRWF 2DQEL 4I0PB 1JNHB 5C0AD 1NBZB 1QRNE 1RZJH 4OSUH 1I7ZB 4NO0B 4MB3A 1S3KL 1SJEB 3SO5A 5DA4A 3V7AG 4L3CA 4I77L 5DRZA 2ZOKB 5C07A 5HHOA 5HD8C 1GCFA 1XF1A 1J10A 2Z91B 3BD5A 3H9SE 1JNJA 4BH8A 1Q0XL 3CCHA 3D0LA 3ULSB 2FGWL 4LARH 4YZFF 1DDHA 1NDGB 5DK2B 4LSDA 3MXVL 4JFDA 2NY7L 2F8OA 2EIDA 1RJCA 4Z7WA 3U30B 4ZXBD 4I18A 5SV3A 1MCIA 3ARGD 1PAMA 1WFUA 1A7QL 2VXTL 4FZ8H 3FQRA 1F02I 3B8SA 3NFPB 3QEQB 2A6DA 5DEFA 3OJ2C 2WIIA 1XF2B 4C56A 5JW3H 4CUCA 4ONHA 1ZLSH 5ACLA 1FAIL 2VSCA 5JIHA 3PWVA 4O9HL 4Y19D 4WHTA 1S7VA 3ARDB 3QXAA 2IPKB 2BNQA 1I3GL 5CP7A 5LXGL 5CSGA 4KDTA 1EEQA 4PBWD 1A9EA 3O3DA 3W0WD 3MRMB 1A7RL 4UT7L 3WIIL 4NZDA 3V0VB 3H9HA 4R96A 1XF5A 1C7TA 3GSUB 5ANMA 2VL4A 1BGXH 1OAKH 3SCMD 3BGMA 2DDQH 1WBXB 3QUZC 3V5HA 2EH7L 1ERNA 3TH2T 3MV9B 4WI2A 1WVZA 1YNLL 3CFEB 3TWCH 1KB9K 4N1HB 4XTRC 1I85A 3P9WB 4XHQA 5EA0L 4UT9H 4FQJH 3QIBD 2H32H 3WLWC 3DTXB 4KK9C 1R3IL 3TZVB 4NZTL 1V05A 3X3GL 1PLGL 4JPVL 4K8RD 1WEJL 4GXUN 4U3CA 2W0PA 3WFHA 4UUJA 2RB8A 1OSPL 1FL5B 1JMZA 1W72A 2FECI 3HMWL 1FZKB 2XKNB 1BBDL 1BMGA 3DETC 2NY1C 3BHBA 4UTAH 3OKNB 3QXWA 1ORSA 3O8XD 4FXGA 1LO2H 4ZTPH 5GS1A 5BOZG 3RI5K 3M07A 3L5JA 4I4WA 1EEYB 4XMLL 4N0UA 2VLJA 5KSAD 4Y4FC 4W70A 4KI5E 5DXWA 5F8RC 5HHPA 4H1LA 1IKFL 1VDGA 3QRFM 5EU7C 2NYYD 3IXAA 1VKXB 2ADGB 2VDKH 3FAXA 4M7ZB 4RWHA 2Y07H 4DGVL 5IFJA 2NR6D 4XCEB 4Z0XA 4QRQA 3RL1B 1LE5A 2VC2L 1YMHB 4DZBA 2X70A 2ZUVA 4H1LG 1HHKA 2QTEA 2E9WA 5GZOD 1QSEB 4WW2B 2EYSB 2V6HA 3MBXH 2IAMD 3JV4B 1G9NH 3FT4B 4HUXB 3MRPB 3QAZC 2Q76B 2EXWD 1RZ8A 3JXAA 2VLKB 1WWBX 1RZJC 4O2FB 4KI5F 3FCTA 1AY1H 1KNOB 3QRGL 2F5BL 5IQ7L 2CIKB 2CLRA 1IAII 4GBXB 5D72H 5E6IB 3QULA 2YPVL 3G6DL 4P4KD 4ODWB 2W59A 1UVQA 4I2XE 2IEPA 3HC3H 4MVBD 3ZYJA 1BIIA 3P73A 4JQIH 2P44B 4QHMA 1C08A 3MJ9A 4PJCB 4FHBD 1LEKA 2BSRB 2GY5A 1GIGL 2VAAB 1S5HB 3EJZC 1IC7L 5H35A 2BMKB 3QUMB 5FGSA 3HZMA 5I6XC 4OZHB 4LNRA 2YEZB 1VERA 3LRSA 4JFEE 1G7LA 4WUUB 5IBTH 1QSZA 3LMJH 4IDLA 1NKOA 1KIQB 5JOFB 4XPFH 3RWCA 2OTUA 1RZFL 1WBZB 3LN5B 3WXVL 1JP5A 2H45A 3L3DB 3EYFA 4OCRH 1A6AA 3U82B 3TBSB 3QI9C 2J4WH 4OCLC 4TSBH 4GS7C 5CGMA 4ODSL 1PSKL 3P4MA 2N1KA 3QWRA 5CGYC 4AMKL 4HWEH 4Y5VC 4M5ZH 1D5ZA 2HVKB 3QCTL 3PP3K 4WWKC 4JHWH 4MQSB 4LLDA 4GRLA 4MD5B 4ZUVB 3B3IA 3FB5B 1F3DH 3HI6L 4M8QB 3Q1SL 2GCYA 4QYOB 1TCRB 4D0BA 1X5JA 3BUYB 1A14L 4GQ9H 3ZSTA 3MLPA 3IS1X 5TF0A 5J3HC 15C8H 3SDXE 5KVDL 5GZNC 1PGRB 1ZHLB 3F58H 4Q2ZA 2ESVE 1Y6KR 3P30H 2F58L 4M7JL 2AJUL 3AREA 4Y5YC 5EBGA 3KDMB 3G6JE 3CMOH 1T1XB 1OP3H 2HAZA 4R4BA 5IHUH 1NUDA 3KVQA 1IM9B 3ZO0A 3QDGA 4HFUH 5D7LD 1SYVB 1SJHA 5CLTA 4ODVL 3SKMA 1U36A 3KR3H 3RNQA 4RQQA 4YXKH 4HIIA 2FB4H 5DR5L 4J8RA 1CD9B 1DVFA 2AERT 5DJ0B 5I1LB 2JE8A 3VXSB 2R56H 4PTUB 1CG9B 3KPLA 3RA7H 4IOIA 3R0NA 2A0LD 2QQLH 1H3WM 4ZO8A 2NY0C 4X9BA 1ACYH 2FIKB 4L3EE 3K80A 3CVIL 3S5LG 2ITDA 3WUWG 2OK0H 3FAWA 5F71A 3GHBL 1FRGL 1RU9L 4RIRB 4JO4L 5F9WC 5KOMC 4NO3B 5CWSB 5C0RL 2Z31B 1FZOB 2Q8BH 4U1JB 3M17B 4S1RL 1T3FB 1IZKA 1I3RA 3NZ8B 4MAUH 5F1IA 1UA6H 2QHLA 5L2KE 3TJHD 4FTVD 1P2CA 4JKWA 1U95B 4ZOBA 2XZQH 3IETA 1A6UL 5ECJE 5C0BE 3FOMA 2X2YA 5EC2A 1IBGH 4LCCC 3D1MC 4QWWD 5L0QB 3KPNA 3O6FB 1F6FB 2GUOB 3LS4H 4G8FA 1IGJB 1UWXH 2DOCA 3VFNB 1ZGLM 2BOCB 5I1KH 3EOBB 4KK6C 5KZCB 4X5XB 2H1PH 4M7LL 2R1XB 2YPLE 1DL7L 3QFDA 4NN6C 1KJMB 5DJDA 4WEBH 4RZCB 1FNEA 3DIFB 2RHEA 2PCPB 3GMMB 3GMPA 4NQCB 2R39A 1QLEH 2ATKA 1FFOA 1P1ZA 4MAYD 1MEXL 2IANE 1ETZB 1H3UA 3SGJA 4U1NA 5E94B 1YECL 1B4JH 4OUUB 1MWAL 4CAGA 3F12B 1JJUA 4MLSA 3L3OB 4FQXD 3RWGB 1JRHL 1JGDA 4JDTL 3CXHJ 3TO2A 5GGVY 2E27L 1IEBB 2FNBA 2XN9B 3HS0B 4APQB 1YEFL 4M00A 5LGJB 2R1YB 3GMQA 4LLUA 1XAUA 2CK2A 4Y2DD 3V6OC 3QUYA 4JRYA 1YYLH 1F3JA 3UTTD 4QNPE 4JG0L 4TULH 1IEAA 5ESVB 3TYGH 1NGZB 3STLA 1OTTC 4Z7UB 2W60A 3GSNB 3RTQA 3L3HA 1AHWB 1BQLL 4XAWL 4XH2B 3MFFB 3GBMH 3WFBH 5I16A 4WI4A 1U8IA 4XP5H 3W9EA 4N8CL 3E6FB 3FQUA 4DN4H 1NFIB 3PL6D 3MXWL 3HE6B 5F1NA 2GSIA 5D96C 4OBRA 3QDMB 4ZUUA 3O6LL 1EDQA 1MOEA 3D3VA 3QWQB 2DI8A 3QXUA 4P3CH 5AG9A 1MRDH 2D4DA 4K3HA 3UO1L 1CTNA 3MLZH 1T1YB 3LV3A 4NQTA 4NUJA 2VR9A 4LKCA 2BNRE 3DUUA 2YK1H 5SWZD 2VDRL 3DURB 4QNPF 2A6KB 2O26U 1QSFB 2NMSA 3T8XB 4QRUB 3SDAB 5T3XD 3MUY1 4L8SB 1M7IA 2F53D 3GEWB 3MOBL 5BO1L 4CMHB 3PNWA 3C5ZA 1ZA3B 2CKBB 1UWGL 3FT2A 3DX9B 2OMBA 3NFSH 5IQ9B 2IQ9L 3TBVB 3GGWA 1EEZB 1XR8B 4OJFH 5I1HL 3B9DA 4CU8A 4XWGL 3V6ZA 2VXUH 3WSQH 4X8XA 5FCUH 3FQXA 4F9LA 4HS6A 4U1KB 1LDPH 4LHUB 2Z8WC 3MLWL 3RGVB 5CSZB 5IB3A 1NLBL 1FO0H 4HWBL 5D7IA 3T0EB 3NPSC 3EUUA 3Q5YA 1FVDA 1EUTA 5DZLA 2R0ZL 4UZGA 4JM2F 1BD2A 4QT5A 5DD0L 4ISVA 3HCVB 1NJ9B 2B1HH 2MJWA 3IAPA 4O2CA 4XVUD 4N8VA 3UPRB 2PTTB 5FO8B 4D3CL 3K2UH 4YWGH 3IF1B 3EDDA 3AM8C 5F3BB 3K4ZA 4OT1L 1U41A 3RY6C 1U8HB 3RVTC 3TBWB 1FNGA 2R29H 4X5WA 3C60B 2IGFH 4Q0XL 2LE9A 1R0AL 1ITBB 4D9RE 4X6EA 4AM0A 4OBSA 5C9KA 1Z5LB 4XC3H 4HUNB 4J3XA 3FQTB 4BZ2L 4F7MB 5B8CC 1YN7B 2AJSH 4H88H 2BFVL 5CILL 4CN6A 4ZQKB 3OJVC 4XI5D 2R2BB 5EOCL 2FBJH 4HKBA 2IMMA 3OJDB 4MX7B 5C0AB 2AXGB 2CK0L 1KN2L 1EK3A 4WNQB 4YHNB 4HMDA 4JFFB 5D1XD 1N8ZA 1R24A 4NWTL 4KRPD 5CP3H 4DCQB 1MIEL 3P0GB 3ZHLA 4W4OC 3G5ZA 2A73B 5H94A 3ARBD 1IGMH 4KY1H 1INEL 2WW8A 5E7FA 4ELMF 1JGUL 2AV1A 1MJJA 2I25N 4N0FB 1J5OL 4ZXBB 3HUJB 4LCUB 1V3MA 3F7YA 3NCJH 3BH9A 2G60H 2BC4B 3BMWA 1FVEA 4X7DC 1HQ4B 2UUDK 5E0QA 5DO2C 1MFBL 4R2GD 1F11B 1WLHA 4B50A 1U2HA 4JJ5A 1WQVT 5E2TL 3CVHH 2VH5L 4ODHH 2ZG3A 4MCZA 3VRIA 3P11L 5FYJH 1VENA 1NCNA 2BERA 5IVXF 3PV7A 2XY2A 4JZNB 4BZ1H 5IT2L 2PXYA 5C2UB 5DK0A 2BP3A 4P3WA 3JTTA 1KCLA 8FABA 2DQCL 1NCBH 2R9HD 1VFOA 2VUYA 4RX4D 3W0WB 5J1AA 4CVWA 5T1KD 3QQ3A 1KCRH 4F8TA 5IWLA 5FK9A 4MJIA 1NAMB 4Z78B 1A7PH 3FL7A 2V2XA 2X1QA 1CLZH 3W5MA 3ZTJH 3VWJD 3U83A 4OQTA 1JF1B 4DEPB 5EIVA 1OD9A 3ROLB 2A74A 2YWZA 5L7XL 2FYYB 2VXVH 4PJFA 2QHRL 1IQWL 2BY1A 3EYVB 3B9KD 4F9PC 1OCWL 4NN5B 3O11B 4G43B 1GJIA 4YHLL 3TIDA 3FO9B 3ZTNH 2IH3A 5AYUH 5FB8A 2VDPH 3ESUF 4HH9A 4XP1H 3QBTB 5F7FA 4OAWA 1KENL 4U1IA 3K3QA 2EDNA 4U1MB 4L8BB 5CMAA 5DJCB 5L8KB 5DMGC 3CC5B 4S2SA 4O51B 4EZMA 4XXDB 1HYSC 1EMTH 5CUSL 1GHFH 4JG1H 5KS9F 1BLNB 1JPFB 3SDXA 3UTZA 4Q9QH 4KKBD 4HC1H 1PG7H 4L9DA 4AL8H 5KJRH 4RGMC 2HA1A 3S7GA 1XGTA 5CJOH 5HI5D 4XCFL 5GGRA 4LQ1A 3RKDC 2F5AL 1IAIM 3VWKB 4EJ1C 1CGWA 4FOMA 4CKVX 5FYLH 1JGLL 4Z8FL 4ZFOA 4YHMH 3HR6A 3DVFA 5CD3A 4G6JL 2N7BA 1XZ0B 3E2HB 1XGQA 3C8DA 4YHYB 4HIHA 1I8IA 2LTQC 1T7XA 1HXYA 2EXYC 2NZ9D 4N0YH 1JZ2A 1MLCA 3BT2L 3CFCL 3O6ML 4PG9A 1K2DA 1U8LB 3DMMD 5M7QA 3O4LB 3EYOB 4KROC 4ZUTA 3LN4A 4M9OA 5ITFA 4RFNB 4JFYB 3G9AB 1ED3B 2ZPKL 5DJ2A 4GMTL 4XXCA 4NQDD 4TSAL 1LQSR 1IFHH 3CJJA 3MNVB 3H0TA 4QKXB 4JFPA 4N5UA 1DBBL 3QP3A 2E6PA 3VXUB 4QTIH 4K7PH 4M4RA 4JFXB 3LPFA 4MQXC 1R3KB 4PJ8D 4YHZL 1UQSB 1TDQA 1NCWL 4TOYL 4GSDL 2CLZB 4Y5XB 2RFXA 4XPTL 1BF2A 1QFPA 2C1OB 3SY0A 1CIUA 1OAXH 3OHXB 3ARRA 1U3HB 2CO6B 3X12A 3LZFL 3PHSA 3DUSB 5C6TL 1AP2B 1MI5D 2FJHB 4LPYA 5EBMB 4LF3A 3MRRA 3P3YA 1YYML 4NNYA 1MRCL 1X4YA 1FO0A 3A67H 3HZYA 1GC1L 1IT9H 3D39D 4R4NC 4F3FB 1B90A 4P5TD 4M61A 4YGVA 2Z9TA 4MA1C 1M71B 5GISH 3WFDL 5D2LF 3RFZC 3QG6B 1LO0L 2GTZB 1AJ7H 1S9YB 3OKEB 4PYGA 1B0WA 2XPGB 4UOW1 4MSWB 1R3JA 4LFHD 3FN0L 5I8OH 2NY6D 3BN9C 3BJLA 3QIUB 4CU6A 4WTWA 3C8KB 5C0IB 1FNFA 1XGPA 4WVRA 2ICWA 1RIUL 4FFWD 3C8HA 4WHYG 2AEQL 3VI4F 3EHBC 1CFTA 3MLSH 1RAMA 4KJQD 3QDJA 2W92A 3QUML 2VKWA 2P8PB 4QRRA 4IRSA 3BP7A 4OF3A 2LU4A 1OAYH 1JNNL 1Q8MA 1HCFX 3DROA 3CFKB 1NGPH 4XP9L 4Q7DA 4GJTB 4WFHD 3MUHL 1Z9MA 2F54A 2VLRE 1BQHB 4NIKB 2JB5L 2W9LA 3BPNB 1LO5B 4IRJB 4Z0BH 3VXRE 4H20H 2HTLC 1NQBA 1S5IH 1YDPA 5FA3A 5SWSE 2GT9B 5IKCB 3C5SA 1FPTH 3ZLQC 2C1PB 1AFVL 5EO9A 4YQXL 4S0TD 3DSFL 4MJ6B 5JW4R 2AW2A 2WMPA 2BNUB 4MNHB 1OAZL 5IMMB 3FTGB 5EOTA 4HS8H 4X9FA 1EFXD 4P2QA 1HQRB 3MBEA 3U0TB 4L8CA 2P49B 1B6UA 2BZDA 1QVOB 3EO0B 1X7QB 5I1AB 3L6FA 5DI8B 3V0AC 1DN2A 1WSST 2K7PA 4UU9B 5JZ7C 2I9LA 5AYQA 3AS3A 4L4TB 3SBWA 3CZFA 2HLFC 5BMFL 2R0WH 4LMQI 1L7TL 2HTKD 4IDJL 1JPST 2X89D 1SJVA 3QEQE 3ARFA 2DIBA 1D9KB 5CEYB 3QHZH 1MAJA 1DQQB 1MREL 3NAAL 5CLWA 1KTLA 4KMQA 4ODXB 4J1UB 3ZDZF 4JAMB 4OCSL 1PKQA 2H26A 2WAHA 4G6AD 1NMAL 5E8DH 3ECBA 4XPGH 1DUZA 1Q72H 5DYOB 3IFNL 2AI0L 3E8UH 4Z7OE 4YGAB 4H8WH 1RJYB 4IRZH 1F4YH 4KPHL 2A6JB 1I1FA 3BKYH 3RU8H 2H3NA 4PB0H 1MQKH 1JUFA 2FRGP 2DLEA 1RURH 1D7FA 2W65A 4LSVL 4P2OB 3TT3L 3OGCA 2W9EH 4YFLF 3MV9E 4D8PB 1AKJD 5BS0A 1Q9LA 5C0CE 1SVCP 3MUZ1 1KB5B 3BAEL 5D6DA 4P2RA 5F88B 3KLHC 3TPKA 1H9VA 3QUKA 4M1DH 1YJDL 3K81A 1TVBA 4BUHA 1IILE 2FJFA 4Y8AA 3PGCA 1P7QD 4QTHA 4HC1A 3N85H 1BVKB 1AO7A 2Y06L 1MJUH 3IU3B 1UKTA 3QO0B 5D7JD 3VXNB 1BM3H 1IAOB 2K1MA 4Z7OF 1G9MH 4LPUA 3FONB 5EPMB 1X4ZA 4NOBA 5I18H 1EXUA 5BV7H 4MAYB 2Q7NA 4PLOB 3FMGH 4O2EB 3N1PC 2NW2A 1U8OB 1NC4A 5DURD 5HYJB 4W6WB 2JTDA 4HPYL 4U6TA 5D1QA 1P5VA 1BEYH 1T7VA 2AV7A 4FQXB 4OZFH 3MRLA 2DRUA 4PLJD 4G8EA 2YUXA 5GRJH 3TO4B 1ES0A 2MTPA 3MNWA 4UAOC 4X4XB 3FFCD 3UP1A 3VRLE 1HEZA 4JFOB 4JO1H 2F9BT 4LLQA 4TNWF 1FORH 5GGTL 3UTTB 3VFUB 4K2UH 1ZHBA 5KSVA 2BJMH 1J0ZA 3JWDC 1QSEE 1RJZB 1YNKH 5F7UA 1G7IA 2APVA 3KWWB 5DD3H 4U3HA 2CQVA 3GKZA 4WDIA 1HCVA 4X6FB 3BP4A 3PL6B 2A6IB 3NBNA 1S7SA 2QBWA 2AJVL 1IGIH 2VLKE 1OPGH 4J6RL 3TYFA 2BRRH 5CZVL 2VLLB 1WFOA 3IYLW 2XRAL 2YD3A 4EDXA 1JCKA 1NGYA 5A2IH 3ES6B 1FNSL 1UJ3C 4K23H 4IMLA 3FQWA 2XKUA 1P4BL 4HLZG 1JHLL 1NMBH 3S97C 4WU7B 3LEYL 5SWZB 3ULUD 1OTUC 2AK4A 3GSNL 4M3JA 2MKLC 4PGBB 1QO3B 1EO5A 1TNMA 3L7FA 1DANU 2R0KL 2IH1A 5JHDE 3N50A 1WTLA 1A3LL 1IGFH 1UT9A 4OZHE 3MA7A 4XNXL 4BKLA 3GJFA 3QWOB 3CDGB 3GMRB 4WUUE 4JRXA 1KIUA 4MMZC 4R97B 1SYSB 5FO7B 3WIHL 3KXFB 3BQUA 1YY8A 2J5LB 3ULUL 1YPZA 4MD0B 1ZT4B 5D1ZB 5ID0B 1W0VB 1D6EB 1HSAB 1XGUA 1A0QH 5CJ8A 1DSFH 4X7TB 2BHZA 1RZ7L 1LK2B 4IOFC 3OB8A 5JMOC 3GSQB 3PWLB 4O5LH 3WXWL 1WT5A 4QXTA 3GRWL 2D31B 4OCXL 4HCRA 4X6BA 5C8JB 1Z9LA 2X1XR 2FX7H 1LE9A 1HHJA 3SOBL 1RK1A 3RVUD 4ZYKA 1YEKH 3RVVC 4TVPL 5D7SH 4HXBH 4NZUL 5GJSH 1QNZL 4WTZA 4NC1E 4KHXL 5EORH 1EGJH 3RPIB 3SO3C 3NCFB 1LO3H 2YBRB 4LPVA 4LSQL 3IDMA 3Q6FB 5TE6H 5EIQA 2QSQA 2AVGA 2AP2A 3VFVB 2VE6B 4JN1H 4PRPB 3U0WL 4JKPH 5DJ6A 4Q6IA 4WTZG 4QHUA 1S7RB 3QYCA 1L4IA 3MCLH 5DHVH 5JOPD 3SDYH 2CLVB 2A77H 3O41B 4ZUSA 4IM8A 3HB3C 4P4RA 4C4KT 3MO1B 1ODAA 5BV7C 4HDIB 3MRFA 2DAVA 1BX2B 2MHAB 5HD8D 3IJSB 3WNOA 1VCAA 3LKQA 5JQ6L 2XWTA 3RDTA 1UC6A 4OLVL 3VXSE 1X9QA 5CJXC 3NTCL 2SEBA 4XBPB 5DHXB 4KZDH 2GJZB 3BWAA 3D25B 3MLXH 3VFGH 2Q6WB 3HTLX 5LCVL 4XBEH 1MELA 4G7YH 4RGOL 5H37H 5I17A 4ETQA 2W38A 3BZDA 5IMOB 3QSKB 3RY5A 4DKDC 2LU3A 3BXNA 1AGDB 5HGBB 1RHFA 4XPBL 4KTDH 4M1CC 4TNWK 4L4VD 3VFMB 1VFAB 2OJEA 4HIEB 2C3WA 4OUOA 2G9HB 1CZ8H 4P59L 2DWEA 1IE5A 3WE6A 3GO1L 4Z76B 5J6HB 4DAGL 5I66A 5KN5A 1L0XA 3I2CL 4NC2B 3BZ4B 3LKPB 2CIIB 3LRGA 1JHKL 3CMGA 1H5BB 5TQ0L 4YIQB 4M5YL 1I1AC 3ZE1E 3GMLA 3WS6A 3ARUA 4G9FA 1KJ2B 2Y1VA 3OZ9H 1GPOH 4AEHH 4HLJA 1GGTA 4DVRH 5EO0A 2Z8VC 4XVJH 1DBKL 4GG8A 5EIIB 3DXAA 4R8WH 5IJKA 1KFAL 1AI1L 3D85D 4ZAKA 1RIVH 4NSKA 1WC7A 2JJUA 1DQTA 2C7UB 2D0GA 4ZFFB 3CFBA 1G7HB 4XTRD 1SEQH 1R3LA 3HFMH 5ILTH 5KSBA 4JVWA 1UCTA 3CPLA 1T21A 3WLWD 3QISA 3C09C 4Y1AE 4KK9D 2XTJC 4YHPB 3GSWA 5E2VH 4Y89A 4OZFA 4K3EL 5K9OA 4NQCE 1SJXA 1ZEAH 5TDPB 4IHOB 4PRID 4GRWH 1FSKB 1WZ1L 1ONQB 4YDVB 4GMSH 5FAAA 3EOYG 3O6KH 1FYHB 4LCIL 4PY8I 4WFED 5HHMD 5JXAL 2OR9H 4K9EH 3S37H 5I71C 1KUMA 3T4YA 5F9JB 2V2WA 4K3JH 2DL2A 4OZFG 3DETD 1JNHA 1D5MB 1FE8L 2NY1D 1NBZA 2KZ1B 2XN9E 5DJXA 1I7ZA 4LDEB 1BFOA 1OSZA 2JIXA 3O45B 3SJVD 1DUYB 5TE4H 4NNXB 4AT6B 3KYMA 4QY8B 5IB5B 2PETA 4Y4FD 2ZOKA 1HXMB 4U6XB 2GFBA 3GSRB 2Z91A 4WEMB 4NUGH 3FHQA 5BCAA 2XWJB 4GAYA 4Y4KA 3VJ6B 4Z7UE 3ULSA 4TN9A 3MGAA 4FQLL 4K7FA 1SBSL 2R4SL 3UJTH 4HBCH 1OVZA 1CF8H 3KJ4B 3VXMD 4U33A 4H5SB 4AK1A 3DMMB 1HHHB 2ZP0T 3JSSA 3OV6A 1TJHH 2XXCB 3K74B 3IDGB 1EAPB 1TMCB 4JQXA 1DR9A 4JANA 4CVUA 4ZS7L 2V7NA 1FC1A 2EEDA 1MNUL 2ZOLB 3PWPD 1HOCA 3BPLC 3I84A 1RULL 2WBWB 4X6CB 5GGVH 5D6CB 2IPKA 1ADQH 1TZGH 4HZLB 4PJAA 3SE4A 4NHCH 1I7TB 4JFQB 3G6AB 4Y4HC 3F7RA 1T5WB 4XMKL 1N4XH 3C2AH 3I6KB 3WFCL 2X1PA 5HI3C 1PZ5B 3V0VA 2Q86B 3MJ6A 3CX5J 1N6UA 2ZNXA 4TVPE 2R2EA 2G5BA 4D94A 1GOGA 3WD5H 1JK8B 4NQED 3EYSL 1ZA6A 2NX5A 1UB6B 4TUJB 4RISL 1JFQH 3UDWA 1L9NA 4I0KA 3ULUF 4PGCA 1N5YL 3DTXA 3PWUA 3TZVA 1CXFA 2PR4H 3GB7A 2B5IC 5BRZB 4ZD3L 4UILL 3O3BB 1RZIA 3D2UA 1P7KB 3BJ91 1IARB 3QI9D 4JFHD 4GW4B 1FL5A 5IV2A 1KTDA 1QOKA 5A2KH 2R4RL 2DQIH 3PGDA 5T1LD 3KPMA 3LB6C 5CGYD 2XKNA 1KC5H 3V5DB 4PJ9A 4WWKD 5JUEL 1L7IH 2DQTH 3V6FB 4BSVA 3V2AR 4PJIB 1VADB 1XIWB 4HK3N 2F15A 4DFIA 3KPSD 3LS5L 3AB0B 5DHVA 5LBSH 1EEYA 5E6ZA 1XGRA 3EAKA 4L9LB 4UT6H 1Q94B 3MLVH 1ZLWK 3T4AB 2YRPA 1UADC 4URTB 5HHXL 5J3HD 1I7UB 1MY5A 12E8L 1MCOL 3DX6A 5GZND 2ADGA 4TRPH 5KVEL 5GHWL 3N9GL 5A40E 4JFFE 4LVEA 2EYRA 3RL1A 3OX8A 1JN6B 1K9TA 5DUML 3OAUH 1TZHB 1YMHA 3BDXA 4L5FH 1H3PL 5EZOH 1KG0A 4PJEF 1J8HA 2EYSA 1KGCD 5IG7B 4KMLB 4AIZB 1LEIA 3ZYIA 4X4ME 4K9EC 3JV4A 5DHYA 4HUXA 4XCCL 1MRFL 4PRHD 2Q76A 4V2CB 5E2UH 1GGCH 2IADB 4NFDA 1XH3B 3HUJE 1MFNA 3LKNA 1CR9L 3LQAL 1KNOA 1J0HA 2CIKA 5DGQA 1BIHA 2OQJA 5C2BH 5H37G 4PJGA 2X4OA 4JB9H 5IROA 4KVCL 2BVUA 4WO4C 3QDHA 4DKEL 5C08B 4ZOAA 2NY0D 3AVEA 4UB0L 3KPQA 2DMBA 4L29B 4EKXA 3J7HA 2V5RA 5E5MB 4PJCA 4YBLB 3RL2B 2VAAA 3IDIB 1J0KA 3I50H 4NKIL 2BMKA 3WFZA 1V7NH 5C0NC 4OZHA 2DQDL 4Z7VB 2WBJA 5C09A 1MY7A 3K2MC 3FQNA 2XQBH 1JV5B 5F7DB 4ZUWA 3OPZH 3NACH 1FNLA 1F58H 1S7TB 1A9BA 3UTPE 1NBVL 4MNGA 1SM3H 4LVHC 4F58L 5FHAH 2CRIA 4A2MA 4U1GB 3A0OA 1FLRH 4LP4A 3T2NL 5GRXG 3LN5A 3IRZA 5IGXL 1FG9C 5DGRA 5I8KH 5HJ3A 4BK4A 3G08B 1ZGLB 2PYED 3AC0A 3N0PB 5I19L 1H8NA 3U7WL 3C6LA 4FABH 5JR1H 4FQIL 3IGAA 4YUEL 5CCKL 4G8IB 1RFDH 3GDBA 4U6YB 3GSOB 1YN6B 2C4FT 2HVKA 4J2XA 3G5XA 4XNQB 4JFZH 4WJ5A 2J8UE 3HPLB 1OT1A 5IESH 4M8QA 1LNUA 5D7JB 3REVB 4KK6D 4OFVA 4CW1B 3WNKA 4JVPA 2B4CC 3MGOA 2RCSH 4QOKB 3EOAA 5CGTA 1MIML 4EUPH 2DQEH 1AXTL 4FQQA 1OP5K 1CFQB 4LCWD 32C2B 5F9OL 1S3KH 1FYTA 1AQKL 1TETL 2AEIT 2EICA 4PBVC 4GQPH 4AQOA 1BJ1J 2HH0L 3W9DB 1FIGL 4CBPA 3HG1D 2ZUQC 1Q0XH 3MLRL 1SY6A 4OFYD 3FFCB 1YC8A 2K9UA 4MNQD 2J8UF 2YD2A 1KPRA 2NY7H 3VXME 1LILA 4ZNEA 4U7SA 3HZVB 2AKRB 4UIMB 1JI1A 1BP3B 1XR9A 2VXTH 1A7QH 3MRHB 3O4LE 5MI0B 5EZLA 1OTTD 5AUMB 4UOW0 1CL7L 1BOGA 1BZ7B 1PEWA 2RIKA 1CG9A 3S37X 1ZHNA 3IFPB 1TLKA 4DGIL 1MCSA 1FAIH 4JDZB 5CJQL 2YXMA 4O9HH 2FIKA 4LGPB 2HLAB 4OB5L 3MRKB 2VIRA 3ZE2E 1I3GH 2WLYA 5LXGH 3DRTA 4RIRA 3UCRA 1DZBA 1DEEA 1MCPL 1FLTX 4YPGA 4BFIA 4NO3A 3BX7C 4KI5C 1HSBA 2VQ1A 2VQTA 2Z31A 3WIIH 2HJKB 2PKDA 4U1JA 4HUWA 4PJ5A 3M17A 5IB1B 1WITA 5C0EB 3NZ8A 3WEXB 5E8EA 5D7KE 3OL2A 1QA9A 1F90L 2EH7H 4JPIB 1YNLH 3BN3B 1CVRA 3PQYD 5AAMA 1C5CL 5EA0H 4Z7QE 4L3CB 5DRZB 1JZ7A 5C07B 5HHOB 1FP5A 3FO1A 3O2WL 1R3IH 2GUOA 5DEGB 5B3JF 4BH8B 4NZTH 3MZTA 1IGJA 3CCHB 3D0LB 1ITCA 3X3GH 1PLGH 4JPVH 2YZ8A 1WEJH 3R0MA 1MFEL 3QEGL 1INDL 2NY5C 2XG4A 1OSPH 5JW5B 3HMWH 5EWIL 1KJMA 1E4WL 1BBDH 4RZCA 3DIFA 2PCPA 2PYFB 2A6DB 4OF0A 3SE9L 2YD1A 2WIIB 4Y88A 1Q0YL 3CSGA 5FF6B 4C56B 1ETZA 3PP4L 4XMLH 3QIWC 4U31A 1U58A 3VD5A 2UUDH 4YHOL 1CBVL 4P9ML 4HS3B 3F12A 1IKFH 2BVYA 3RVTD 4WHTB 5KAQF 4LASL 1S7VB 3QXAB 1RK0A 5CP7B 4APQA 1ZT7A 4DGVH 1A9EB 3O3DB 1G7MA 3LPGA 2VC2H 1K3ZA 2FEEL 5DFVC 3CXDL 4OD3L 3H9HB 4PBXA 5ESVA 4R96B 5ANMB 1NGZA 3WDHA 1CYGA 2EE6A 3JWOH 1AHWA 3H9ZA 5JORA 2OX5A 5IR1A 3V5HB 5F7WC 3PIQA 2DQGL 4X4ZA 4YLQT 1VA9A 5TGBA 1CFVL 2DQHL 4L4TE 3QRGH 5IQ7H 2F5BH 3QDMA 2NXZC 3B2UC 1JZ6A 4KRMB 4FFYH 2YPVH 3G6DH 1NGQL 4RRPA 3SDCC 2AQ2A 2HRPL 4OLYL 4R3SB 4V1DD 2KBGA 3WFHB 2W9DL 4G80A 1J18A 3KPTA 4UUJB 4YHKL 4YDLC 2D2OA 1W72B 1NC2A 4OV5A 4HWZB 2A6KA 5DO2D 1IC7H 1QSFA 3T8XA 3BHBB 1KSRA 4RRPG 1ORSB 2WWMC 4L4VB 2CDEA 2EECA 2GK0A 3H2WA 4I4WB 4N0UB 2VLJB 1FFQA 2PTVA 5IB2A 1ZA3A 3ZZ1A 4GG6F 5DJ8A 5HHPB 2DQJL 4H1LB 5FUCE 1XR8A 1HKFA 3P4NA 3WXVH 4EN3C 3IXAB 2P5WA 5F21B 4QHKI 4BQ8A 2Y4SA 2DD8L 1H0DB 1LGVA 4JDVB 1B2WL 4ODSH 4QRQB 4LHUA 2NQCA 1PSKH 1LE5B 1T6VN 4AMKH 4DZBB 2X70B 3T0EA 5DD1H 1HHKB 2RBLA 3QCTH 3LQZB 1FNAA 2Y25A 3HCVA 3QUZB 4LDOB 1ZVHA 1I9JL 3G5VA 5BZWB 3HI6H 5EU6A 4NBZB 2PTTA 5DC4B 3Q1SH 3U9UA 2C26A 4LHUG 1RZ8B 1NLDL 2BK8A 1MVUA 3U48A 4KJWD 1JZ4A 1A14H 5D2NA 3FCTB 3OKKA 3TBWA 2CLRB 5KVDH 3V4VL 1KJ2L 3B2VL 4NNPL 1UVQB 4XCNA 1JWMA 5E99L 4F7MA 3FQTA 2F58H 3P73B 4M7JH 5DMGD 5HYJE 5D5MA 3FN9A 1HYSD 2JJTA 5IBLC 4QHMB 1ORQA 1C08B 1WBYB 4NM4L 2R2BA 5JQHC 2VDQL 1LEKB 3HG1E 5C0AA 4BQBA 3HZMB 2AXGA 4G8GD 1QSVA 4JFFA 5HVHB 1G7LB 3RKDD 3MRJB 4DCQA 4B7IA 5DR5H 3NA4A 3WHE1 3RWCB 3NA9L 5KTEH 2N7AA 3EYFB 4M62L 1A6AB 3ZE0E 3BPCB 4N0FA 4I9WE 3TA3C 4ZXBA 3TV3H 2BVOA 4L3AA 1E0OB 3EYUL 1T1WA 2EXYD 5C7XL 3ARGA 3GSVA 3G04A 3CVIH 1D5ZB 2J6EL 4FZEL 5HYIA 2FSEB 4KMTH 3CH8A 4KROD 3GHBH 4J23A 4WU5A 1FRGH 1RU9H 2XT1B 3E0GA 4RA0C 5FECA 2GCYB 1WWWX 4I0CC 3ABZA 4JZNA 5C0RH 4D0BB 2UY6A 4Y19A 3UTSD 1G1CA 4P9HC 4OZGF 5F7MC 4S1RH 1FJ1A 2VN4A 3A6BL 2NCMA 1X5HA 4D9LL 1VFMA 3VH8B 4MQXD 2NYYC 3ZT5A 3W0WA 3G5YA 3B4NA 2Z35A 2QLVB 3QO1A 1NAMA 1A6UH 3U2SA 4R4BB 5ISZD 5EOQL 4LU5L 2YA2A 1RMFL 3KXFE 4W6XB 1D5IL 4KUZL 1OW0A 4R4ND 5J7CC 3QDGB 3CU1A 4MHHG 4DOHB 2DLGA 3RNQB 4HIIB 4M7LH 3QIBA 1DL7H 2E3VA 3FO9A 1DVFB 3U7AA 4DW2L 3UJJH 3BN9D 3QCUH 1MEXH 3KPLB 4IOIB 4GS7B 5DJCA 2VLME 5GPRA 3EHBD 4O51A 1YECH 4JQVA 1EJOL 5T1LB 1MWAH 5EU5B 5C9JA 3CFJB 4JM2C 1IGTB 3TIEB 3LKOA 4YDIL 3NFNB 1JRHH 2WQ8A 3O8XA 2ITDB 4JDTH 4P46C 2E27H 1BECA 4Z7NE 3NOIA 2EO1A 4PY7A 5KSAA 1DBAL 1UM4L 3GI9L 4I3SL 1CCZA 2HTLD 3QQNA 1PX3A 5GJTL 4LP5A 4JG0H 1X44A 2UZXB 4PRPE 4E41B 2HJFA 1K4CA 1GSMA 4M93B 4OF6A 1I3RB 2ED9A 2LU7A 3QNYA 4NM8L 5HGDB 4XAWH 1XZ0A 5EUOB 2PUQT 2H32B 3MJGX 4N8CH 1AD0B 1HINH 2MWCA 3B5TA 2BHYA 3MXWH 4J4PC 4GKOA 1MFAL 3IETB 4RMTA 3FOMB 5EC2B 1PEZA 2VXQL 4F57L 1ZKAA 1D6VL 3O6LH 3O4LA 4U6VL 4G8FB 1I8KA 2J2ZA 5GXBB 3EW3B 2IAMA 1ED3A 2J8OA 3UO1H 4Z7NF 2G5RA 1U92B 2AJYL 4RFOL 1WUNT 4MJ5A 5JZ7D 1NL0L 1X5YA 3MNVA 2YS4A 2VDRH 2HLFD 3VXUA 1F6AA 3QFDB 4JFXA 4JREC 4XWOC 4P4KA 5DJDB 3VXQB 1XCTB 4XNUL 1N3NA 1RIHL 3GMPB 1MSPA 4PRNA 4TQEL 2ATKB 1FFOB 1P1ZB 4HUVA 4OM0L 5DSCB 3MOBH 4U1NB 5BO1H 1NFDF 1AP2A 2FJHA 4JHBA 5EBMA 4QCIA 3EDJA 4KUCD 2IQ9H 4FXLA 4EIGB 1T2QL 3D18A 1BZQK 1S7WA 5I1HH 2Y36L 3TO2B 4XWGH 3STZA 3S96A 4F3FA 5JXEC 3JTSA 3O2VL 4LLUB 4G42B 5CZKA 1S9YA 1NLBH 3REWA 4HWBH 1IEAB 2EC9U 5DD0H 2JJWA 3STLB 2CD0A 5D9SA 2W60B 1DQML 3QIUA 3L3HB 2YMXL 3RTQB 5KW9L 4HK3J 1U8IB 2OP4L 4D3CH 3FQUB 5J1TC 1CLYL 4OT1H 2P8PA 4E42A 5F1NB 5EN2B 1R5WA 5EUKA 3KLHD 1N0XL 5FKAA 3D3VB 4Q0XH 1R0AH 3B5GA 3AUVA 4P5MA 4BZ2H 3EZ8A 2UVFA 3LV3B 3QT2A 4M3KB 3JVGA 4LKCB 5I1EL 5CILH 3DUUB 4F37F 1H8OA 1V3JA 4XZUA 5EOCH 1E28B 3C2SA 4PUBL 5I1GL 3ELAT 2AJXL 3O3AA 4OF8A 2C1PA 2XWBA 2CK0H 1JZ3A 3QFJB 1JGVL 1KN2H 4LCWB 2ENYA 4LAQL 3IDYB 3R06B 2E8YA 4LDLB 5I15L 1FDLL 1DLHA 2BNUA 4NWTH 1M7IB 1KULA 1MIEH 3C5ZB 3FT2B 2XFXB 3MMEA 4LL9A 3MUGA 2Q3AA 3I9GL 3QPXL 3SDDB 1INEH 3GGWB 3OJMB 1ZVYA 3ZKXC 2DICA 1KEML 4S10A 3SN6N 3EO0A 3V6ZB 5FYKD 5IVXA 5D7LA 1JGUH 4MQ7B 2EDKA 1M7XA 4UU9A 5C0FA 3FQXB 1J5OH 1KYOJ 4HS6B 4Y16C 1YEGL 4PJ7F 5E8PA 5KBNC 5IB3B 4PG2A 4GW5A 3F5WA 1FVDB 1MFBH 5AZ2L 5E2TH 1BD2B 4QT5B 2D7PA 4PLNC 4ISVB 2VH5H 4O2CB 4N8VB 3P11H 3EDKA 4JE4B 1L0YA 4XT1C 2ERJB 2NTFB 4CN1A 2GK2A 4GXUM 5CBAB 3C6SB 5IT2H 1BJ1H 4GRMB 5D96B 3GSXA 5FYKL 4J1UA 1FNGB 4JAMA 4X5WB 1ZT1A 5HY9A 3ZDXE 3K4AA 2D7TH 3B8YA 1L6XA 4X6EB 2UWEE 4AM0B 3IXTA 3K8MA 4J3WA 1KBGL 5DYOA 2BDNL 4DGYL 1X5LA 2NW3B 1LO4L 1OTUD 3RZCC 1HH9A 1UXSA 2YC1A 4OCNC 3K1DA 1HE7A 4R6UA 3F7VB 4UQ2B 2BSED 4Q6IC 5FOJA 2A6JA 3T2OA 4AEIH 2CUHA 1G7JA 1H3TA 1Z3GH 4ACPA 3HE7C 5J6GA 1KOAA 3LEVL 4P2OA 5L7XH 4AIOA 4DTGL 1QACA 5CINL 2QHRH 2PN5A 1IQWH 4LPXA 4D8PA 5KS9A 1N8ZB 1R24B 1U93A 4TSCL 5I30L 4HULB 1VSCA 1KLFA 5CZXC 4IS6A 3CU7A 3G5ZB 1JRHI 4YHLH 5H94B 1IQDA 2MQ0A 4ZPVA 1MWAA 2P5ED 2EE9A 1D5BB 2EH8L 4UOJA 5BRZE 3C9NB 1KENH 4HEPG 1T6WA 4JY4A 1QBML 4WGVB 4KZEL 1MJJB 1H8SA 2UWEF 5GS2D 4JFDD 3IU3A 1K3IA 3BH9B 5DMJB 5CUSH 1JWUB 5E4EC 1QEWB 1SMAA 4YK4C 5JA8B 4IOFD 1A1OB 3MODL 1IKNC 1I8LA 4MAYA 4MCZB 4PJIE 3VRIB 2O93L 4XCFH 4O2EA 3F62A 2HP4A 1U8OA 2F5AH 3MV7D 3EYQC 4OFKA 2D9QB 3KHQA 2BSSB 2OCFD 2PXYB 5CSBA 5DK0B 3RVVD 4FQXA 1JGLH 3JTTB 4Z8FH 3P4OA 2X44D 4R0LA 3HI5H 2J7LA 4F7PA 2OZ4A 4IIQA 1OWWA 4WHCA 4G6JH 2BNQD 2X10A 4NKMA 3L5WB 1EJ6A 5B8CB 3DBXA 2V5YA 3WJLA 4LKXA 4Y2DA 3QQ3B 3MACL 3RZWA 1YUHB 4MJIB 3UTTA 1RZKL 3VFUA 3EGSA 1BFVL 2Y5EA 5FO9B 1EIBA 2V2XB 3BT2H 3CFCH 3O6MH 3PE9A 4HUKB 5DUPL 1YMMD 4GOSA 2A74B 4D9QE 3SE3A 5DJZA 2GJ6E 4GMTH 4KJYB 1N2RB 3HB3D 1KJ3L 3PL6A 4F37K 3ZT6A 4TSAH 3TNMB 5DLML 1LMKA 1DBBH 4HWUA 5T3ZD 4TUOB 3WN5C 3TIDB 3TN0C 5JPNA 3JUYA 3O2DA 4YHZH 2B0SL 5T5FL 2EDQA 1NCWH 1S9WA 3CLFL 4TOYH 4GSDH 3ES6A 1EX0A 4PV9B 5D2LA 4OAWB 5A3IC 4JPWL 4XPTH 3V52L 3K8KA 4ZPTA 1TJGL 5CMAB 5J56B 3LZFH 5C08E 5SWZA 5C6TH 3MPCA 3PWJB 5HDQL 1YYMH 1MRCH 1IAMA 1OB1B 4HWBA 1GC1H 2R69L 4PJBB 4I0PC 1P4LA 2MOVA 4Z7VE 3S8WA 1UG9A 1XGTB 5T3ZL 2OXHA 4M1CD 3WFDH 1B0RB 4EDWL 1QLRA 5F70A 3GI8L 1EHAA 3KPRE 5JLZB 5KANG 1V3KA 4LGSB 1I4FA 5FO7A 1BBJA 1XGYL 3RWFA 3FN0H 5DMKA 1OGAB 2AGJL 4DKFL 1I1AD 1ZT4A 2FL5B 5D1ZA 5ELIA 5JHLL 1RIUH 2VDML 5ID0A 1W0VA 1D6EA 1XGQB 1DEDA 2AEQH 4HIHB 1YA5A 1I8IB 3KYKL 3PV6B 3U30C 4LRNL 3QUMH 3RKPA 4BQCA 4L1HA 2D3VA 4HKXB 1MLCB 1K2DB 4KAQL 1JNNH 4KUCF 4IMKA 5TFSL 4ZUTB 3LN4B 5ITFB 3RPKA 3GKWL 4FNLL 4XP9H 2D31A 1MJ7L 4R7DB 5DJ2B 2JB5H 1RUKL 4XCYB 3RWIA 4GW1A 3H0TB 3EDEA 2OM5A 4LIQH 2X1OA 2YR3A 4U6HB 3U9PL 1A6VL 4NO5A 4KHTL 3ARDC 3V0WL 2VISB 4QOKE 5FUZL 3IDJA 2QQKL 2XTJD 1AFVH 1WAAA 2WK2A 4YFEA 1OL0A 4NQUA 3Q6FA 4YQXH 3DSFH 2P8LA 4HQQL 4K07A 5HXMA 4HT1L 1S9KC 3SY0B 1OAZH 2MQCA 4PFEA 3HC0A 3X12B 5H8DA 3BEWA 1AGCA 4N5EC 3NGBB 5F96L 1CK0L 5MENB 4NNYB 1FO0B 2IJ0C 3UTQA 1J86A 4ERSL 1CDBA 2IPTL 1FH5L 3MO1A 1U8PB 3OR6A 2P48B 5E1HB 1EHNA 3LY6A 4ORZC 1QQDA 1Z0NA 1KV3A 3ARBA 3WHXB 2VNCA 1BJMA 5BMFH 1T83A 1Z9SA 4X4YA 4FQ2L 1L7TH 3CDFA 2VXSL 1R3JB 1WK0A 4IDJH 4M6OL 4S1QL 4X9HA 2KPNA 1XGPB 3OMZA 2ICWB 2YRLA 4NDMA 4XBPA 5TH2B 3MJ9L 2LTQB 3MJ7A 5IVNA 1CFTB 1MREH 2D7MA 2GJZA 3NAAH 3QDJB 5CBEA 1URLA 4YFLI 5DQDL 1I9IL 3KNBA 3T0WA 3Q6GL 1U8NA 4RGNB 3H6JA 2V5SA 2HT3C 3BKCL 4OCSH 4JKKA 3DROB 4LHQB 1NMAH 1Q38A 4LPTA 1AD9B 5J8OA 2GQHA 2AI0H 2G9HA 4PRAA 1T66C 4Z76A 3RUGF 3V7AE 5I8CA 1G6RH 3BZ4A 5FA3B 4OZIB 4KPHH 5CEXA 1H5BA 4YIQA 3C5SB 4OFDA 2VKXA 5EO9B 1O5DT 4M7ZC 4LSVH 4YNYA 4Y4HD 3TT3H 5T1KA 1ZLWH 3NCYP 5TE7L 3LIZL 1PX4A 2H6PA 5I1IH 5KVGL 1A64A 5DJAA 5EOTB 4G3YL 3BAEH 2P7TA 5HI3D 4GKZA 5ISZB 5C07E 4P2QB 5HHOE 3ZL4L 3MBEB 1CGVA 5K59F 4L8CB 2QQQA 1VGEL 1YJDH 4WW2C 2DF3A 1MPAL 3U4BL 3VGEA 2C7UA 4FRWA 5IF0B 3C08H 3CVHB 3B9KA 1GC1C 4EI5C 1G7HA 4JFDE 2QADB 2EYTB 4IJ3B 4PJDB 3CZFB 3ARZA 5HHQA 4GBXC 5E6IC 3QG7L 5I75B 3WNMA 5CEZE 3ARFB 5C6PB 5TDPA 3RAJL 3VI3E 4C56E 5BXFB 2ITCB 5F6HI 2V5TA 4WI5A 4EBQL 4HPYH 3X14A 3OG6B 2E7LA 3LB6D 4Z18A 1DFBL 5F9JA 5JO5A 2VERN 3FKUS 3WS3A 3D9AL 3FB8A 1D5MA 4ZO6A 1T4KA 2ORBL 2ZKHL 4PJXF 3ECBB 3O45A 1DUZB 4NNXA 5GGTH 1JHTB 4Z7WF 1TQCB 4KTYA 1I1FB 4OGXL 2XWJA 4HJ0C 5ANME 3I3EA 5MP6H 1ZV5A 5TF1L 2H3NB 3RWJA 5GSRB 3CNKA 3OGCB 1VFUA 5BS0B 3QEUB 1Q9LB 1YZZA 2AJVH 3GBLA 1MCWW 4J6RH 5T3ZE 5CZVH 3DMMA 3MLUL 1HHHA 4P2RB 4UINH 5E9DD 1F4XL 3OAYK 5CFHA 2XRAH 1TVBB 3IDGA 4NO2B 4DFHA 5IEHA 3PGCB 4QTHB 1FNSH 1CE6B 3MV8D 4NQDA 1RZGA 1IL1A 1M05A 1P4BH 1JHLH 1I1RA 1AO7B 3LEYH 2HT2C 3GSNH 3DSNA 4NWUL 4PJHB 1WJ3A 1T89A 1EPFA 4NC1C 4PJ8A 2R0KH 2WQRA 4WV1A 4X6CA 5L2JA 2DLHA 3TCLB 1I7TA 3P77B 1A3LH 3ZDYE 1P6FA 3G6AA 1EXUB 4XNXH 3LPWA 1T04B 2VAJA 4RSVA 5DRXB 1T5WA 2NW2B 1NC4B 4GKSA 4WO4D 2DKMA 3K1KC 4N0UE 2VLJE 3W2DL 1B3JA 2FLBT 4QRPD 3C87A 3SKOB 1EA9C 2IG2L 5D1QB 2H8PB 1P84J 1OP5H 2Q86A 5IHLB 3WIHH 3MTRA 4G8EB 2YUWA 3HC4L 3D39A 4ZTPL 3ULUH 5C0ND 4XNZB 1QRND 2DM4A 4NKOA 1CICC 1ES0B 2WANA 3MNWB 3O9WB 1OP9A 2Q20A 3MREA 5MHSE 1UB6A 5E8OA 4LLQB 3SKJL 4HUUA 1CE1L 1RZ7H 3QUYD 4JRYD 5C0GA 3H9SD 3ARXA 5A2FA 3WHE0 3WXWH 5HHVL 3FFDB 3CGTA 3GRWH 1G7IB 4OCXH 5ITBL 3O3BA 4WDIB 4NOFA 3MQIA 4P5KA 4GW4A 3T3PF 3VD4A 3BP4B 1ND0B 2X05A 3SOBH 5JNYA 1S7SB 3ARTA 5DUBA 3MRCA 4TVPH 3TYFB 1QNZH 4KHXH 1SEBA 3V5DA 4EDXB 3V6FA 3WL9B 1XIWA 4LSQH 3MBXL 1G9NL 4AJ0A 4DQOL 4HMCA 1Q94A 2EDHA 2AK4B 4UNVA 3U0WH 1NAKL 3LQMA 1VACA 5D72L 3CLEL 4M02A 1GAFH 2HT4C 4CADB 2O5ZL 4LBEA 1WGOA 3MA7B 3RNKA 2H2SC 3QUXC 1TZHA 1EFXA 5I2IB 4JRXB 5DDHB 1BZ9B 2CXKA 3V8OA 3O6FC 4ZG1A 5JQ6H 5GRWA 1BVLA 3CIQA 3BQUB 4OLVH 1UACL 3CZJA 1YPZB 3X3FL 4LSPL 3NTCH 1UZ6E 2IADA 3BW9A 3HPJA 1VHPA 4NBYB 2B4CL 2CGRH 2GW5A 3D0VA 3IRPX 4NFCA 5LCVH 4RGOH 4XPFL 3WO4C 1FGNL 1EZVX 3TGXA 3F7PC 1G6RA 3E1F1 1S78C 4X6BB 4XPBH 2J4WL 3L5HA 2BVTA 4P59H 1LE9B 1KEGL 3GO1H 4ZSOA 4ZYKB 4DAGH 3I2CH 3VFOB 3P40A 4NCDA 4UI2A 3CSYA 3IDIA 4F15B 1JHKH 3U6RA 1VEPA 5TQ0H 1JYWA 4M5YH 1G1YA 1JWSA 2X4RB 4MJ2A 4MS8C 4J12A 5I76A 1WICA 1WFNA 2V9QA 4A6YH 3HMXA 3TBTA 4OGAC 1UZ6F 5IIEA 4KI5D 4GQ9L 5DQ9B 1DBKH 3UYRL 1KFAH 3KLDA 4QHUB 1AI1H 4OI7A 1AHWC 4JY6B 3F58L 4OLZH 3WBDA 2B39A 4ZUSB 1AKJA 1ZGLA 2VABB 3GM8A 3QDGE 3UBXI 4I5BB 3WYRA 1AXSB 3HE6C 4GLRH 5DVOA 3MRFB 5T1DL 3GSOA 3LH2L 3V4PL 6FABH 3GHEL 5ADPH 4O58L 4RMSA 3LKQB 2GITB 3RDTB 3L3GA 4K3EH 4UMGA 2WP3O 3OBAA 4BK5A 4TPRL 3TPUA 3TF7C 2SEBB 1WZ1H 4MXQC 5D7JA 3K7UA 3HZKB 4LCIH 3BWAB 2AEPL 3RRQA 4CW1A 4YO0B 5JXAH 3HR5B 1FV1A 4X6DB 5I17B 3AGVA 4ETQB 4QOKA 5GGTA 5GGSY 3BXNB 1FE8H 5LWYL 4KQ3L 2YD4A 3HKFA 3SDAC 3BPOB 4L8SC 3QIWD 3QR2A 2DWEB 4CMHC 5LVEA 3WE6B 5I66B 1WCBA 1QBBA 5KN5B 1GXEA 1EV2E 3S3PA 2ICEA 2HWZL 3W9DA 5EFIA 2NY5L 4P23C 3FFCA 4FQLH 1SBSH 4CRPA 3BP6A 2R4SH 5GS0L 2BOBB 1IRAY 4JFED 2EDOA 1Q1JL 1GZQB 4I13B 2AKRA 3RGVC 1E4KC 5EO0B 3AMLA 2E7BA 4UIMA 5DFVD 4HGWA 3MRHA 3QB7C 5F1OB 1UA6L 4UTBL 2A9NL 4ZAKB 1LD9A 3CXHK 1WC7B 1FFNB 4KK5C 4NSKB 4ZS7H 3BZFA 4Z77A 1MCWM 1MHHA 2QV2A 3BH8A 1TTGA 1MNUH 5BV7B 2XTLA 3ZKQD 1R3LB 4RDQG 5KSBB 3HAEH 3CPLB 2HLAA 1RULH 2GSGB 2YPKB 1BFSA 3MSPA 3C60C 2NXZD 3B2UD 3LS4L 3GSWB 4OZFB 5EZJB 1JYNA 5K9OB 4NKQB 3WO3B 3SDCD 1YY9D 1KLGA 2VZUA 4XMKH 2Q1EA 3JUZA 5JOEA 5DVMA 3VFSA 2EDFA 1HZHL 4OQTL 3WFCH 4JO3L 5IB1A 5C0EA 3T4YB 2EIBA 2FZ3A 4GAGH 1F42A 1LP9B 3SGKA 4JPIA 4WEUD 2WWMD 3WDIA 4HG4J 5LGKA 2ESVD 5DJXB 3QHTC 4CGTA 1BFOB 1OSZB 2JIXB 1CT8B 3EYSH 3KYOA 3KYMB 5BW7A 3O81A 2XZAL 2FHBA 2WV3A 4GAJL 4JRYE 2GFBB 3TJEL 2JCCF 2JJSC 3QQ9C 3DRQA 1MCBA 3OKOA 5DEGA 5GRUL 4GAYB 4Y4KB 4ZD3H 4C59B 4S0SD 4EN3D 4M03A 3PHOB 4K7FB 2EDTA 4RAHA 2DBJA 2ZZUT 1S7XA 3L5XL 4MZ3A 1BPVA 1E4JA 5HYSB 5J9PA 5JW5A 2OTWB 2R4RH 1J1XL 2YZ1A 2PW1A 3F6IA 1KXTB 3IDXL 5HDBF 3VFPA 2PYFA 5JUEH 3D3VE 1MHEA 4OKVA 1WTGT 5IJVA 4JANB 3LS5H 5FF6A 2V7NB 4LAJH 1OAQL 1J7VR 4ZFOL 2ADIA 1MCJA 4PJEA 5DTFA 2XA3A 5HHXH 1HOCB 4HS3A 4L3ED 1BAFL 2X6MA 1DBJH 1X5KA 4UV7L 3O4OB 1MCOH 4P3CL 4PJAB 5EULV 2ARJA 4CVZA 4X9IA 5KVEH 4NT6A 4DUVA 3N9GH 4RMQA 3QFJE 5HBBA 3KPOA 3A6OA 4HAFA 5DUMH 4MMXC 4EXKA 2IPUK 2R1WA 4I3RH 5IBLD 1H3PH 2MCPL 4DEPC 3GMOA 4U49A 5L2KD 2QR0B 5J11B 1NBQA 3NN8B 2R2EB 4HZAA 2G5BB 2LAAA 1BQSA 4XCCH 1MRFH 3BOVA 2ZUXA 1ZA6B 2NX5B 3HRZB 1MCCA 5C0BD 3VMOA 1CR9H 3LQAH 4NN5C 5EB9A 5ACZB 2WUBH 1H15A 5D7IE 2X41A 4PGCB 3GNML 1AR1C 3E3QE 3PWUB 1A4KA 1BD2E 3GB7B 1N7ML 3MOQA 2VXUL 1G6VK 4KVCH 5FCUL 1RZIB 3D2UB 4R3SA 4JZJC 1A4JB 3PHQB 5E95B 3TA3D 1IC5L 4DKEH 4UB0H 2H9GA 2LQRA 5IV2B 1UWEL 1KTDB 1FO0L 3PGDB 4IRSD 4PR5A 3KPMB 2YPLD 5F6IC 4A6YA 4HWZA 1QFWL 4LLYA 4MGXA 5C86A 5I74B 4N0CC 4NKIH 4PJ9B 3IFLL 4RWYL 2B1HL 2DQDH 4BSVB 3L5IA 4L4VA 1F5WA 4HKZA 2IAND 5DHVB 2F54D 2AABH 1XGRB 4GLRI 2WWKT 4QLRA 2C3XA 3VWKC 1NBVH 3BPLB 5IW3A 2PTUA 3K4DA 3OXSA 3T2NH 5D7IF 1IM3A 1IGCH 4H0GA 3DX6B 5IGXH 4Y4HB 4G6FD 1BWMA 4XB7A 1J8KA 3E2HC 1K5NA 1J1PL 5I19H 4YHYC 1JTPA 1H0DA 1WWAX 4ZFGL 2VB5A 4JDVA 5B38B 2EYRB 4FQIH 3THML 4YUEH 3OX8B 1MQ8A 1YNTB 2PO6C 1I75A 4RMUA 5CCKH 2VITA 2IBGA 2ZUSA 3KPPB 3D85A 1KG0B 4LVNB 3LQZA 4O4YL 1J8HB 4NZJA 3QUZA 3SKNB 5K9QI 1LEIB 5BZWA 3IJYA 4MQTB 3FZUC 5DHYB 4P9HL 1A6WL 4R7NB 3MLYL 1NUNB 3TEUA 3LKNB 3VXOA 1MVFA 2VDLH 2OQJB 2R0LL 4JHAL 3QNZA 1MIMH 1YEJH 2B5IB 2ZJSL 1AXTH 3DYPA 4PJGB 2X4OB 5E24E 2VL5A 4PRIA 2Q87A 2X7LB 4OI8A 4Y5XC 3F6LA 1QPPA 2NY3B 5F9OH 1AQKH 1U3HC 4XP6L 1TETH 3N1MC 1I9RL 3KPQB 2BNRD 3S4SB 3S88L 3V7MA 1WBYA 3I3DA 4JM2D 2HH0H 1FIGH 3BZEB 1A47A 5ICXA 1C16B