2OR9H

The structure of the anti-c-myc antibody 9e10 fab fragment/epitope peptide complex reveals a novel binding mode dominated by the heavy chain hypervariable loops
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
226
structure length
221
Chain Sequence
EVHLVESGGDLVKPGGSLKLSCAASGFTFSHYGMSWVRQTPDKRLEWVATIGSRGTYTHYPDSVKGRFTISRDNDKNALYLQMNSLKSEDTAMYYCARRSEFYYYGNTYYYSAMDYWGQGASVTVSSAKTTPPSVYPLAPGSSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of the anti-c-myc antibody 9E10 Fab fragment/epitope peptide complex reveals a novel binding mode dominated by the heavy chain hypervariable loops.
pubmed doi rcsb
molecule tags Immune system
molecule keywords Monoclonal anti-c-myc antibody 9E10
total genus 39
structure length 221
sequence length 226
chains with identical sequence I
ec nomenclature
pdb deposition date 2007-02-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2or9H02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2or9H01
3MRFB 3B9KC 1RHHB 4TSAL 3LS5L 1HKLH 4R96A 4U1SB 4YDLC 4K9EC 1D9KC 5AZ2H 4NBZB 3HTLX 3SY0B 4XBGB 4WEMB 2I27N 3IETA 1G7QB 3IFOB 1RIVL 1FYTA 1M71A 1TCRB 4G8IA 2NZ9C 5BQ7A 4P5TB 5GRXG 3BRFA 4ZAKC 5LQBL 4RGNB 1VSCA 5IB1A 3HA0A 3CH1A 2V2TB 2Q8BH 4CL7A 4PY7A 5CS7A 3C60D 1FZMB 4YLQT 4CW1B 4R3SA 4WFGD 2WBWB 1LE9A 4HJJL 3SKMA 4QOKE 3WDJA 3N9GH 5IFJB 4POYA 1ACYL 4JRWA 1K4DB 1YNLH 2XN9E 3ULUF 5D7JA 5C6PB 4ORGA 3EO9L 3NFNA 5KSAB 1WICA 2E7LC 3OZ9L 2P8MB 3FQRA 3QFJE 1TNNA 2O5ZH 3IKCA 3MROA 1F6AA 1WIUA 5CJBA 2DS4A 3LSOA 5DQJB 3CK0L 5EU6D 5CLTA 5KTEL 4JRYE 1C16A 4TSCL 2YEZA 4JCMA 5C0BA 1AE6H 5CEZL 3ARGB 2HKHH 4LPXA 3PDOB 4Q0XL 5BV7C 4HXBH 4IOSD 3FKUS 4AIZA 3GO1L 3S36L 2AV7A 2F8VA 1KPVB 1W0VA 5EBGA 5KOMC 1NFDF 5FGCB 2FO4B 2BNUB 4C57C 1T0MA 2CR3A 3QWOB 5E9DB 3F12B 2J8HA 2MCPH 4S1RH 3O2DH 4RX4D 2ITCA 1V3MA 4PBXA 1CDIA 3VXQB 2EYRA 3VXRD 3T3PF 1E4WH 4AT6B 2V5SA 1MRFL 3SE8H 5CKGA 3IVKA 1F4WH 2OTUB 4FXKA 1G7JA 2Z31C 5DWUL 4LRNL 4KI5C 2RBLA 3MRKA 2YS4A 5F1KC 4LAJH 5FCSH 4FFWD 4K3JH 4KTDL 1FZJA 2PTTA 4L29A 1S9KC 4YO0B 3V7AG 1NGXB 3VE0B 1T83C 4LIQH 3QUZD 3ZKMD 5H2BA 2QR0A 4JO1L 3SGEH 5DRNB 3HI5L 2F53B 4JRYD 5E5MB 4XBPB 4DZ8B 4GKSB 4MA7H 1PVHA 3V4UL 4PGEB 2VE6A 3RVVD 1VFBA 3C5SA 2APTA 4JY4B 3IRZA 2OMNA 1Q0XH 1QYGH 4E0RA 1FZOA 2ZG1A 3ARSA 5GRVK 4XCEA 4KK9D 1CGTA 1V7MH 4NQEE 5HDLA 2GITA 3LRHA 4Y4HA 4KUCF 3TO4B 3U6RB 3OZ9H 4F37F 3ZE1F 4Z5RB 2B1HL 1DE4B 1MOEA 2W65A 1LE5A 4UTAH 1DQDH 4K2UL 2I25N 4APQD 1ZSDB 2QQLL 4W68A 5SV3A 2IALB 1JNJA 4E41B 2A9ML 3ULUH 4HT1L 4PRPE 2AKRA 1IMHC 5TGBB 1DEEB 3NCBB 4P46C 3HPLA 4HPOL 4K7PY 3SDXE 2A9MH 3ULUL 2VZTA 5SWZB 1DEDA 3WNNA 3ZKXC 3IDGA 4TTGA 1ZGLA 3F12A 2EO9A 3DX6A 4QXTA 5CJXA 1ITBB 5C6TH 2HKFL 2HLAA 5C6WH 1AGBB 3ZDZE 4F9PA 2FJFA 4U2YA 2AK4D 5D1QB 3AVEA 4Z76A 1A7NH 5IBLC 4Q2ZB 1CICD 1KNOA 1V05A 4GAJH 5B21A 1B0GA 4PJDE 2MQ3A 2FO1A 2ZCKH 4HH9B 3PWVA 1ZT1B 3KAAA 3WIIH 3WKML 2BSRB 2GY7B 2VLRE 1TQBC 4PG9B 3F7VB 2R1YA 1QLEH 1FRGL 1MHPH 3FAWA 3AGVA 4X99A 1I1AC 1BGXL 3G6JF 5INDB 2DIBA 2CDFB 4M62L 3Q6GL 3ES6B 1K8IA 3GB7B 1BMGA 3OKDA 4CDGC 1FDLH 4E42A 1RULH 2W92A 3MNZB 5HVFB 2ZKHL 2XT1B 2F5BL 2PR4H 2G5RA 1TVBB 3P4NB 5ESQA 3JVGA 4H1LB 1T20A 1A6UH 1FNSL 4EI5B 5CIPB 4XWOC 2CMRH 5C3LD 4CN4A 4IRSB 3SGDI 1CTNA 4UTBL 4K8RH 5GS0H 2F53E 3C2AL 2HFFB 4TUJB 2VDQH 4NO3A 5BZDA 3M1BB 1YECH 2A6IA 2XTJC 1OF2A 4H88L 2GK2A 5IB2B 3KXFA 4AY0A 1UVQA 3RVVC 2J4WL 1A14L 3MNWA 3QIWD 2VL5A 5DR5H 3FOLB 3BJ91 5KS9B 1R3JB 4P2OA 4ODBD 1FG2A 1RULL 2A73A 4KJWC 2MWCA 3VWKC 3HB3C 3OX8A 2JLLA 3VGDA 4PJAB 4XI5C 2J8UE 5ID0A 1FQ9C 1ZE3C 4MNQB 1F11B 2DQDL 3TVMC 4OLUL 4V2CB 4OJFH 4GAYA 3RNKA 4U1KA 5F7KC 1BM3L 3P9MA 2VN7A 3U0TA 1KG0A 1PKOA 1R3KA 3KPNB 5GZOD 1CN4A 1RK0B 2D2OA 2R29L 3RBSA 2JJTA 2NY0B 4BZ1L 3D25B 4HFUH 5IESH 2XNAA 5EC1B 3F7VA 3L3HA 3GSQB 3CVHL 1RZIB 4MSWB 3MJ8A 4MXWL 4FXGB 5JOEA 1V3LA 1CF8L 1WEJL 3OKMB 1GOFA 5JW3H 1G9MC 1G0DA 1M7DA 3CSYB 4P46B 2VLKA 4JFEA 4XTRC 4XRCB 4ZAKA 3C09B 2DKUA 5MEOA 2M8XA 1RZKH 2IH1A 6FABH 4N9GB 5BVJB 1W0YT 3ARRA 3TFKC 3UTTB 3TT1L 1RAMA 1UJ3C 5IB5B 5DVMA 3QJFA 1NL0H 2LU3A 4O58L 1FVCA 3QDMB 8FABA 4O2FB 3QHZL 3MRQB 1JPTH 3PL6A 4TNVF 3TNNA 1K3IA 2XA3A 3KPQB 2VLMD 3SQOL 3ROLA 2CK0H 1DBBL 2BOCB 4IEFB 3X12B 2F54D 3HZMB 1ZK9A 3LKRB 4OT1L 2GSGA 2A0LC 3TNMB 4TSBH 3MLRL 5IQ9B 1FO0H 5HD8D 1TZHB 5ISZE 1MWAB 1QSEE 3STLA 2A6JA 5GGQL 4Z7VA 5BS0D 3Q2CA 1P1ZB 4M8QB 5T33L 4PJDB 1FCGA 2DQHL 4X4ME 2J6EL 1FG2B 4GLRH 2VLJE 3QDJD 4MA8H 3U2SA 3O9WC 1INQA 4N9GA 5BVJA 1A14H 1VFBB 4NFCA 1IC5L 3QNYB 1LHZA 4HJ0D 4IJ3C 4PP1C 3FAXA 1OM3H 3O11B 4NNXB 3WXVL 2Y07H 1B2WH 5CJQL 4U33A 3MODL 5TDNA 2DQUL 4MJIB 4UTBH 4NRYA 1TJIL 1XF4A 2OBGA 3TH2T 5ESAB 3GK8L 4ELMF 2BVQA 1Z9OA 2YPVH 4WDIA 3ZTNH 3PQYA 4KDVA 3C9NB 4LSSH 4MHHI 2FX7L 5J4MA 4PS4L 1JE6A 4CNIB 5C0BE 2UY7A 4FN0A 3TWCH 4OZGA 5IMKA 5GSVA 5EU6B 1KF9B 4G80B 3KNBB 5J12B 1NH6A 1TTFA 3VXQA 1XGRB 1AKJD 3EKCA 4OKDA 4L8BA 3AS3A 3P0VH 1JZ7A 1F3JB 12E8H 2R2HA 4OZIE 3N85L 3TNNB 5I1IL 3R1GL 3L5IA 1MRDH 1GXEA 4HH9A 1BVLA 4TN9A 5I1JL 5HHXL 3DVFA 2Y06H 4N5UA 1FBIH 4TOYL 5TQ2H 4K7PX 4AIZB 4DJMA 1WZ1L 3JWDH 1RZJC 5HHMB 4KVNH 1DBBH 3O6FC 1YNTB 5B39G 4YDVB 1D5MA 2P7TA 4FMKA 3IDNB 5ESQB 3UTSD 4M00A 1GC1L 3LB6D 1BFTA 2YPLD 3MCLL 3CFBA 5EA0L 3HRZA 3LQAH 3MNZA 2W38A 1RUQH 3FQRB 3GMLA 1F4XH 4OD2A 3V5KA 4L1HA 1AHWA 3QEQA 4NO5B 5DS8B 4TQEH 1EO8L 2HLFD 4YGVB 2CLRB 2Z91B 3W0WB 4B5EA 4BSJA 2EKSA 1ZXQA 2IALA 2P5WA 1NUFA 3QPQD 3RTQD 5FF6A 4NQDE 4PP2B 3ARBA 3VGAC 3VW3H 2ADFH 4TTDD 1X5IA 2C4FT 3J8F7 4TVPH 1Q9WA 1YYLL 5F89B 1YUHB 2O5XL 3L5JA 2WANA 1ES0A 1ZHNA 5D2LA 4N0UA 4PRPD 5E5UB 3MLSL 4ZAKB 5MEOB 3QRFM 1WISA 1KCUH 1ZLWH 3V8OA 5AAMA 4NQDA 4B7LA 1DLHB 5JMRA 4JY4A 1MFAH 2NY3C 2WIIA 3LKOA 5ANMB 4U1SA 2I24N 4L4TD 1HINL 1N6UA 3LIZL 2ZUQB 4FG6D 4KK8D 3OL2A 3Q5YA 5I15L 3F7RA 3JSSA 3MUGB 1DANT 3PV6A 4IIQA 2EIZA 4NM4H 4J23A 1W0WA 4ERSL 5A3IC 1A7OH 1A7PH 3VH8B 3VFRA 3WSQL 4JHWL 5E9DE 1Z6JT 1NDGB 5DUBB 3MRKB 4MWFB 5C9JA 5BRZA 2HRPL 3AU1A 5HHOB 1A6TA 3KWWB 1WIOA 4X5WA 2DYPB 4P3DB 1LP9A 4U7SA 3MSPA 1H8SA 2W9LA 2UYLB 4LBEA 3ES6A 2V7HA 3RI5K 1BZ9A 1HQ4B 3QUXB 4L3ED 3LPWA 1YY8A 5IT2H 3ARDC 4PLKC 4GXUN 4YX2L 1KB9K 2VXTH 3WV0A 3T0ED 5GSRB 1C5DB 1JWMB 1BFVH 3QH3B 4LEOA 5ILTH 1NCTA 3VXSE 3FRPA 3CVHA 2YUVA 4M1GH 2WIIB 4OLVH 4PJFA 3DBXB 2N56A 3GDBA 4ZUVB 4MZ2A 1MCHA 2FR4A 1KJ2H 2X4OA 4GO6B 2BMKB 4X5LA 3VFGL 2QSCL 2XV6B 4U1MA 1FJ1B 2AEQH 4DCQA 1HXYA 2I5YH 4WY7L 2G75A 5FYJD 4OZFA 1ZWIB 2NY4D 4NN5B 4L3CB 3LQAC 3N0PB 4YIQA 1UWEL 2CLVA 3NCYS 5I75B 5INDA 2NY4B 4WO4C 3TO4D 3ILQC 2J8UF 1A64A 3BRDA 5E9DD 1Z9MA 3CC5B 3L7EA 3EYSH 3O3BA 1TITA 3C09C 1P2CB 1YYMH 4IRJD 4R26H 3RA7L 3D39E 4WVRA 5DUBA 2I07B 3EYUH 2EEAA 4PY8J 4TULH 4AIXA 3WFHA 3VH8A 3FO9B 4KV5E 2OYPA 4U0QB 2X89A 4OAWA 1UJ3A 1XR9A 5F8RC 3TV3L 3RUGE 1ZAGA 3QQ9D 4D9RD 5A2FA 1DUZB 3OV6A 4G5ZL 4ODTH 2EYTA 4P9ML 4OTXL 3D0VB 4OZHB 4OM0H 5C0CB 1CDBA 2ZWLT 2EDEA 5ESVA 2F53A 5BCAA 1C7SA 4S0TD 4LSPH 4DUXA 4AL8H 1KTDA 2AKRB 2L0DA 3RKPA 4M93C 4GKZB 5ITBH 3ZL4H 2JCCE 5INCB 4KJQC 5EU6A 4O02L 4NQVB 3QHFL 5D7JB 2AABL 3U1SL 3BH9A 2W65B 4EBQH 1JNHB 1ZA6A 3GHEH 4J1UB 1AIFB 4APQB 4MCZB 3QCVL 1JNNH 3KPRA 4OKVA 4HBCL 4Y4KB 1C5CL 3ZKND 3RIFK 1G7PA 2CDGA 4AEEA 1QA9B 2XQBL 4YQXL 3ESVF 5KVFL 3NPSC 4YDKH 5FECA 5J1AA 3N1GC 3SO5A 2IH3A 1V8HA 1XF4B 4F57H 1GZQB 1IKFH 4JN1L 3NFPA 2Z0BA 5DRZA 3HI1B 5HBBA 5D7LB 3CSYA 3MOQA 4GT7A 4X4ZA 3V4PH 4LKXB 4C4KT 1HYSC 4JRXB 1OAZH 1D5MB 1ONQA 3SY0A 3QDMD 1IAKB 1JF5A 5JPMA 1KCVL 1V3KA 2VXUH 4TVPE 1U9KA 2ARJQ 4ZTPL 2D0GA 2QADD 1X4XA 4Q9CA 1LO3H 1IGCL 5IJKA 4ODWA 3LEVH 1N0XL 4OIIL 1HYRC 1OLZA 5I1DB 2AXGA 3DXAB 4FZEH 2FECI 3WDIA 4RA3A 4UILL 4P5KB 4OCSL 2DD8H 2LVEA 4Z7WA 5FK9A 2W59A 1ZMYA 2DQDH 4G9DB 4UT7L 1G6RL 3HZMA 4Z6AT 4JFXA 1IGTB 2V6HA 2BOCA 3DOSA 4ZUUB 1L0XA 5A16A 4QKXB 1MCQA 1QFWM 4AEHL 2H3NA 1TTGA 1UB5B 4D0BA 1NSNL 5MENA 5B22A 5LGJA 1MJUL 3MV7E 5CFHA 1BPVA 1VGEL 4KDTA 5IB5A 3UTSE 2VR9A 3RZCA 5DK0A 1RVFL 2YD7A 4OD1H 1AGEB 3QG7L 5CIPA 3EZJB 1H3PL 1C16B 4H5SB 2VLKB 4JFEB 8CGTA 4OT1H 4G8IB 4NZJA 3GSOB 3VI3E 4ZDHA 4FABL 3I6GA 2MKLC 1R5WA 4HZAA 3O3BB 4JHZA 5L8LB 3PUCA 1GZQA 3IDYB 1LO3L 2D9QB 2NNAA 2IH3B 1IEAB 3MRFA 1K8IB 5SV4A 5T3ZL 3VDBA 3WD5H 4QRSA 2PCPA 1PAMA 2DQHH 4GAGL 3B4NA 3P0GB 4DUVA 4LPWA 5CUSL 5J3HC 4WEUD 1LEKA 4Q6YA 2RIKA 4Y4FD 4KJQD 2UWEA 2UYLA 3RVTC 2X40A 3HNVH 1YMHA 2J7LA 5CBEB 4GRWE 1IT9L 1UM5L 3MLRH 1BJMA 1RZKL 3L7FB 3GMMA 3SDCC 3F8UB 2WQRA 2BMKA 3HNTL 4PJ5E 5BQ7B 2JK5A 5FO9B 5EZJA 4BZYA 2XRAL 3RVWD 4JPVH 1N7ML 1CE6B 2A6DA 5HYQA 3QHZH 1R0AL 5JXEC 4X9IA 4LEXH 4OCXL 4OFVA 4JO3L 5D1XB 5DMYA 1RK1B 1N4XL 2Q76A 5D7LE 5I1EL 3TBTA 1BF8A 1OARH 4X5XA 3SN6N 3QCUH 4NQDD 5F6HI 5AYQA 5J13B 3RWJA 5DHVA 4G43A 1CR9H 1LK2B 4JO2H 1CL7H 4PRPA 4FQLH 1A7BA 2VO5A 5FUCE 2DICA 4X6EB 4AM0B 5DD0L 4F7TB 4ENED 3QUKA 2FHFA 4IRJC 5D1QC 1P84J 4XP5H 1UGNA 1HNFA 4PRHE 2IPTL 5DD3H 4KROB 1VFUA 2XWBB 2VSDA 4XPGH 4ZUWB 1XZ0A 1RUPL 3QNXA 2CDFA 4ACPA 1KJ3L 2CO6B 2IG2H 3W0WA 1MHEB 4LVOB 2CLRA 1W72H 2CK2A 1HXMB 3BGFC 4RFOL 1Q72L 5CEYA 4N5ED 1UB6A 1QBLL 1OTUD 1J11A 3VFUA 3SDXB 4CMMB 4UDTB 4L3EE 4ELME 4JY6A 4FQXB 5GZNC 3T4YB 4P4KA 4AG4L 1S8DA 1C1EL 5DURB 2HYMA 3BDYL 5EBMB 3IJYA 3JV6A 4OM1L 2P42B 4OB5L 3G5XA 5SX5K 2YRPA 2NXZB 1IGYB 2NX5A 1CYGA 3BI9X 3BZFB 4ONHB 5C0AD 4YHYB 5C07A 3GM8A 4LSVH 5CSGA 1GVIA 2E7LA 4KTDH 3HE7D 1MELA 2GSIB 1T7ZA 1QSED 1CE1L 2XA8L 4LPVA 1FRGH 1MHPL 1T5XB 5ICXB 4ELMB 4ZFGH 3STZB 1RJYB 3ULSA 3ARXA 3MLXL 4HIXH 3OKKB 3EJJX 5DJ8A 3ZMRA 4R0LC 1YEKL 1QFPA 3GRWH 3OPZH 4J3VA 4PRHD 1P7KA 1IILE 2DQGL 3QUXD 5MP6H 3QDJE 3ARPA 4GBXD 4H20L 5D72H 3EYUL 4TULL 5T3XL 3L5HA 4PJ7E 5GJSL 3KHOA 4TUKH 1T7YA 4YXHL 3V0VA 5FAAA 1DN2A 4YUEL 3GB7A 3V5DA 2DL2A 4FRWA 1D5XA 1MPAL 1FCCA 2ZPKL 1KT2B 3PP4L 3MLTB 5EBMA 1A02N 4GMTL 5BZWA 1GAFH 2CUHA 5L6YL 1MWAL 4QT5B 5KVFH 4RMSA 5F7FA 1UYWL 2BRRH 2B4CH 3CVHB 1EXUA 1HHIA 5FOJA 1U91B 4MQXD 2QKIA 1WFTA 4Z7NF 4PGDA 1DL7L 4D0DB 4Q2ZA 4J4PD 2WINA 1HXMA 1CFTA 1CFVL 2YN5A 2C3VB 2KH2B 1JZ8A 3G6AB 4XVJL 4QYOA 5KSAA 5D1ZD 5C0EA 1FAIH 1H3UA 3VRLF 2YK1H 1AGBA 1HOCB 1N2RB 5BS0A 3BPNC 4ZUSA 1T83A 2HLFC 4FXLA 3O6MH 5TF1L 3VFOA 3L3GB 1EFXA 4OCNC 1VFAB 3MRIA 2AAVA 4IOFD 4TVSa 4LL9A 4O2EA 4ZFFA 4Z0BH 5TE4L 5SX4H 1ZLVK 4N68A 2C3XA 4ELMA 4Z7QF 3TIDB 5ALCH 2K1MA 5HHOD 3WHXA 4LSRH 1IAIH 2FX8H 3CFBB 3UROR 4ZOAA 1I7ZA 1WFNA 2Z4QB 1EUTA 2DLIA 1L7IL 4MLSA 5CAYB 4ZO6A 2OK0H 1RQ5A 3SJVB 1DL7H 3IETB 4NJAL 3CFIC 5DVLA 1YEFH 3E0GA 1RIVH 1DVFA 3NZHH 4WU7A 3QUXC 2YPLE 5GISL 2IPTH 1YPZF 4NJAH 5JHLH 3FB7A 4GMTH 5T5FL 4UBDD 4HUUB 1VCAA 4UU9B 2ZNXA 5GGTL 4Q9RH 5DHXB 1UWXK 2E27H 3W5MA 3KJ4C 4PGBB 3EHBD 5B3JF 5AD0A 5E8PB 5IVZB 5KVEL 1WAAA 2CLZB 3HR5B 3SBWC 3MROB 4OLXL 2JB6A 4NKIH 4R8WL 5KSVA 1NCAL 3VFTA 4KI1A 2WZPD 3UJIH 3V7MA 4JG0L 1R3KB 1NAMH 3MLZH 3EYVB 2R1XB 1YY9D 4P2CG 4QNPE 3BMWA 1ZHLA 3TVMA 1WK0A 4WI5A 1AGFB 3VI4E 4M6ML 1VADA 4RGOH 4F7CA 3UBXI 1E4XH 2IPUG 4WUKH 4ZFZA 4YHML 5MENB 5DVKA 2A1WH 5JHDA 4LSSL 2EE3A 4S1DD 3VXPA 1W0VB 2P49B 2NW2A 4YXLH 3LV3B 4BSVA 4P57B 1QR1A 1UXSA 3MJ8B 5M95B 4LEOB 1RZJH 1FIGH 3HZKA 1K9TA 2VDRL 4PJBA 4LCIH 5IW3A 3UPAA 3WHXB 4JQVC 4HQQL 2OSLB 1OY3B 2AJVL 4YDIH 4OUUA 2HVKA 4LVHC 3JVGC 5L2KA 1AHWC 3FRUB 4GXVH 1UM6L 2YEZB 4Z7WB 4POZC 2BOBB 2P8LA 2EDKA 2FZ3B 4LSRL 4NNYB 5IVXA 2CSPA 1Q9KB 4NFDA 2VXSH 4M8VA 1T22A 1TXKA 4ZD3H 4P5MA 4WDIB 1O5DT 2W0FB 4JFDE 2ZUWA 4PJFE 2Z35B 5KVMC 5I8CB 4L8CA 3BPNB 3BZEA 2JB6B 5CINH 2P8LB 4DUWA 1YZZA 1M6OB 1ONQB 1BREA 2O5YL 4MDJB 5TPWL 5F70A 2HFEA 4HJJH 3T2NH 2BX5A 3ULVD 3NFPB 4HS6A 5FDWB 1QFUL 3QXDA 3TCXA 3LKNB 5D7LD 5LCVH 3SKUD 4WEBH 4X4YB 2H2SD 2VITB 1ORQA 4N0UE 4L4VA 1AXSB 2R1XA 4G9FD 4M1DL 4Y7MA 5ISZB 4ZFZB 4EQ2A 4WTWA 2WK2A 4IDLA 4UDUB 3IAPA 1MCLA 5KANG 2F9BT 3JV4B 1QO3B 5FA3B 3RIAK 4H26B 1L9NA 4HAGA 2Z91A 1F8TL 2CDEB 4R4FL 3VGEA 3V4PL 4LKCA 2NR6D 5E8EA 4D0CB 3I84A 4WW1B 4JFOA 1KULA 4EI5C 3RGVA 4QY8B 5F7EH 2R1YB 4BQ6A 4PG9A 5MP6L 4IJ3B 1U8HB 2X1WL 5JO5A 3RL1A 5J6GB 3BESR 3T3PE 3K2MC 1D5BB 4LMQI 3EJZC 1MRDL 3BPOB 1OARL 4NRXA 4LGSB 4I77L 3FONA 3N50A 4OFYA 1OB1A 5C0EB 2HJLA 5DFTA 2ED8A 3A6CH 3OR7B 2C3VA 1XF5B 4N0YL 4YJZL 3QIUC 3B9EA 5FM5M 3DMMC 4Y2OA 5F1SA 2APBA 4JKMA 5J06A 3RFZC 4P4RB 4OV5B 1MNUL 2VC2H 4S1SH 5H8DA 1LVEA 2NYYD 1D6VH 1GZPB 3FB6B 3BISA 1IM9B 3QCTH 4JREB 4XH2B 1MEXL 3NPZB 5FYJH 1UH4A 3LN4A 1F3JA 2R2HB 4Y2DC 2NPLX 4Y1AE 3ZTNL 1RK0A 2DTSA 5HPMB 1HHHA 4PJ9C 5DTFA 1I3GH 1RV6X 3BKJL 4K71B 2HWZH 2XWBA 3S37X 4KMTH 3MV7B 4I3RH 1RZGA 4NQUA 5IJKC 4OLWL 3ZKSD 3GJFB 4Y5YA 5LG1A 4L4VB 4JR9L 1A21A 4R2GD 2FH8A 2RFXB 2WINB 1FZOB 4JM2C 2E7CA 4D8PA 4LVEA 1XGPB 4MNQD 1PG7X 4P59H 4M7ZB 1I8IA 3VXSD 4XP4H 3VJ6A 2X4SB 1J1XH 3T4AB 4O9HH 3DMMD 4XPHH 1C5BL 4R2GC 4K3GA 3S3PA 3W11C 3K46A 1QSFE 2EEDA 1Q8MA 4X6DE 1D6EA 3TBWA 5TDPB 1J0IA 3FOMA 4YO0A 1KLUB 4LSTH 4PGCA 3FQUA 5EBWA 1C7TA 2R69H 5JMOC 1IAII 2QSCH 2W9EH 4H1LA 2ITDA 3EO1B 3CVIH 2NTFB 3DTXB 3MLUH 4KAQH 1P2CA 1G1CA 1K3ZA 2FZ3A 3STLB 4Y1AD 1I3RA 4L1DA 2VKXA 1P4BL 5EO1B 4Y5XC 3BGMA 4Z0XB 1ODAA 4LLMA 1R3LB 4J3UA 5MERB 3ZT6A 3HG1B 3QEQE 5F1IB 2BCKA 5IT2L 2R4SH 3RX8A 4HLJA 1CGUA 3KPQA 3VRIA 1HSAB 2EYSA 1BAFH 2VLJD 5E00A 4ZUTB 3LKOB 3GMNA 5I9QC 3CLEL 5I18H 1XIWC 3PGCA 1I8MB 2AV7B 4NP4L 1IGJA 3UP1A 4GG6B 1JHTB 3ME0A 43C9A 5F3BA 5KVDL 3QIUB 3G6DH 4BFBD 5E2VH 4G42A 5ADPH 5ABDE 3QXDB 3RWJB 1JPST 2EDHA 4P4KB 5F7DA 5I71B 3IDXH 2FNBA 4WJ5A 2Y6SC 1XH3B 4LP5A 3GSWB 1QLEL 2I9TA 4L5FL 3DX6B 3HN3A 4BELD 3VWJB 5I1LB 4KK5D 4XZUA 5CD3B 1U8IB 3O3EA 1OGAD 2GJZB 3BOVA 5KZCD 4LIQE 4N0RA 4J6RL 5DFVC 3O6LL 1DN0A 3BGAA 1KYOK 2ZSWA 2QSTA 3ARDB 1GGBL 4R7NB 1FHGA 2GKIA 4LCCA 4X6CA 3U46A 2EXWD 4LARH 3WLWC 4PUBH 3VDCA 3F5WB 3BKCL 1KEMH 2GJ6E 1RFDH 1TPXC 1W8OA 2F5AH 1QNZL 1YC8A 4ODUA 5HYSA 2NZIA 2BVPA 2B20A 4ZUWA 1G6RB 5EFIB 2NXYB 1IE5A 2XXMB 4IMLA 5GRVL 2H26A 4OZIB 5ISZA 1TCRA 3PWPD 3MOAH 3EIFA 2VDLL 3I50H 3TV3H 4OIIH 1P7QA 4XNQB 5EIIA 2XZCL 3O6KH 1ORQB 1KB5H 5CKAA 4Q6IC 3WIHA 4P3CL 2E9JA 5ILTL 3SJVA 3EJYC 3ZT5A 5JORA 4G43B 1BVKA 1AI1L 1TLKA 2F5BH 4QRTB 1GGCH 2GJ6B 5HXMA 5DD6A 4GQPH 3EFFA 3RWCA 4IRSA 4R26L 4MD0B 4K7PL 3DVGA 3F7YA 4W81A 5E99L 1YMME 5KANI 1E28B 1OSZB 1HNGA 4JQIL 1V3JA 1FPTH 2YUXA 1GHFL 2OTUA 4KPHL 1U58A 5F88B 1VA9A 3T8XA 3QEGH 4AT6A 4QRSB 2YA0A 4OCWL 1KBGH 4YR6A 1QSEB 2RB8A 3MV9B 2OP4H 5HI4C 4Z7VF 1JMXA 2X7LA 3FL7A 4U4BA 1RIUL 4YE4H 1YMHB 3UC0H 3OJMB 1FFOA 5D7IF 2HT3C 1MRCL 2FSEB 2IGFL 2PW1B 4AQOA 4GBXB 3NCJL 4LK4A 3ZE0F 1T1ZB 5AAWA 3VRJB 4ONFL 4LLDB 2HKFH 1HHIB 3EDEA 3L3OA 4HCRL 2ESVD 5L0QB 3P9WB 1AGEA 3L9RA 4GW5A 3QJHB 2WV3A 4ZMAT 3ULVH 1DUYA 4HX1B 1VDGA 3PDOA 5CD5C 3KYOA 3O6LH 1OTTD 1MVFA 1Y18B 4YXKH 2D03H 4OZ4A 3VRJA 3DRTB 4QHNB 1A9EA 1S7VB 1NKRA 5IIEA 4UOW1 1RHHA 2VQTA 3QFJB 1SVCP 1M7IA 1B6DA 3KG5A 5C92A 1BX2B 3ARFB 4NBYB 3KYAA 4Q9QL 1LEGB 4X7FC 2FX8L 2GJJA 4YBQC 3O9WB 1QRKA 4YHZH 3U36A 3Q3GA 3RWHB 1ZVSA 5FK9B 5HGBB 4IHOB 4EUPH 3OKNB 3IJSA 4XVTH 3ARTA 1HKLL 3LRSA 4FQHB 1ACZA 1BBJB 2EIDA 2NXZC 5D1ZC 1ZWIA 5E6IA 5LWYH 5IQ7L 4WUUB 3I75A 4ODWB 2W60A 4YBQD 1R6VA 1MFDL 3WL9A 1XGUB 4MJIA 3AB0B 1SYSB 3ALWA 2VLRD 1F4YL 4P48A 2G9HB 1VPOL 4RX4A 2IGFH 1Y6MR 4E0RB 4QRQB 4Y5VA 1AR1D 1I9IL 3WHE1 1NUDA 4C56D 2IQ9L 4XBGA 3CFJA 1OTTC 1MLCA 2OZ4A 2VUYA 4MDIB 4HEPG 2H26B 2XKNB 2VXSL 4XXDB 1DVFB 4R8WH 3TCLB 3RHWF 2BVOB 2EDNA 2APVA 3W0WE 2MOVA 3MBEB 2Y9RT 4GAYB 5D2LF 2GEEA 3LDBC 3U4EA 1A6TB 2VWEE 5FHAL 3WNPA 5C0RL 1NGQL 1ZHKA 2MPAH 4G8EB 2X4RB 1CD9B 3MR9A 3GSNL 3DETD 4BK4A 1SEQH 2PO6D 3HMXA 3S37L 1J87A 2L7UA 2UVEA 3MRBA 1Q38A 1DDHB 3MFFB 3GSWA 1L7IH 2OTPA 4HZLB 4A2LA 4G9FA 2EXWC 4GW4A 4DCQB 2A77H 1YEEL 3TA3C 1XGTA 4PJIE 1KIQB 4FNLL 4JAMB 4PTTB 1G7HB 1LO4L 2MNUA 2YXMA 3HC4H 4I48A 3QCTL 2FJGB 4U0RB 3FN0H 1FNAA 5FF6B 4XAWH 5IMMB 3TM6A 1IM3A 5GGRA 3FCTA 4TVPL 2EC9U 2KQNA 1F00I 2VABB 4Q58C 4OZHE 4ODHH 3O2DA 5SWZE 1HHKA 3NN8B 1CGWA 1XZ0B 4G8GD 4FQXC 1X3DA 1P7KB 1QVOA 2CR6A 1NAMA 3EDJA 1K6QL 4G6KH 1INEL 4GSDL 1OGTA 3LOWA 4K8RC 3QDHA 3WFZA 3GMRA 4KDWA 4FMFA 2ZPKH 3LKQA 1ZT7B 4X80L 5EORL 4I5BB 5GZOC 4N5EC 1FE8H 1LGVA 5C0GA 1IC5H 1DQJA 5IGXH 4P5TA 3F7YB 2QV2A 5I73C 4L3EA 2EDRA 1VHPA 3SDAD 3TIEA 3GSXB 4Y19A 2F54E 4XMPL 1DJSA 1VACA 1R5VB 2FRGP 3QDME 1IGIH 5IBUG 1P4BH 3U30C 2DQTH 5ID1B 1I9JL 4GW4B 3U83A 4P2OC 1T04A 5FGBA 3KJ6L 2OQJA 5D2NE 4LNVA 1CD1B 3R1GH 1N7MH 3CJJA 3CSPA 1FAIL 3MCG1 3TBVA 3GMMB 5CP3H 3D48R 3NCJH 3VFNA 1TJGL 1BM3H 2BVTA 2DAVA 5J3HD 2QADB 2OJEA 2NY0C 4RMVA 4OV6F 2H2PC 5DEGA 2DJSA 1SBBA 5DGQA 3VFRB 1TCMA 4RAUA 1T66C 5FYLD 1U8QB 3IS0X 5JXEA 1EHNA 1K2DB 3PGFL 3HMWL 4NM8H 3U82B 3MV7D 5DJYB 43CAB 3TT3H 4QHUB 3LQAL 1LO4H 1S5HA 3DUSA 2P5EE 3MBXL 4I0CC 2JE8A 4BH8A 4I4WA 4U6VH 4MAYB 4L8SC 3RZCD 4Y19B 4PJAE 3NA9H 5FIEA 4ZS7L 3GSRA 3OKEA 3RPIB 1JZ4A 1U3HC 2X05A 3U4BL 5DD5L 5D7IA 3PWPA 4KMTL 3S5LB 5F7DB 4JFFD 2J5LB 1IFHH 3UCRA 1JRHI 4WEBL 4LCWB 4JHBA 1KEGL 4OF6A 4HC1A 2FIKB 4ZFGL 4KH2A 2SEBA 4PREB 3BZ4A 3RWHA 1KV3A 3BEVB 1QRNA 1UZ6F 2BDNL 3QUYC 4HXAH 3OG4B 4YHOH 5GS2D 4NYLA 3HMWH 2W60B 4ZQKA 3E3QE 5C0DA 3TC9A 2HJFA 1WBZB 3FTGB 2X4NB 4XAWL 1CXFA 5DTFB 1VFMA 3S4SB 5C3TA 1EEYB 4WY7H 5EO0B 4RRPA 4KC3B 3O8XB 2DBJA 1ZTXH 1BWMA 1MF2H 3KYMA 3LQZA 4PRDB 4AEIH 5E0QA 3IDIA 3K4ZA 3I6GB 2DQTL 2Y7QB 2IBZX 5BO1H 3GNMH 4LLVB 5EOCH 4WIQA 3E6FB 1A4JB 2MCG1 4WWKB 2FBJH 5ETUA 1F4YH 5EIQA 5DQJA 5FYJU 3QIUD 4Y88A 1CT8A 1TVHA 5A40E 5LJYH 5JA8B 3B2VH 3KPMB 3S96A 1X7QB 4E9LA 2ESVE 1OAKH 3SDYL 2H2SC 5EN2B 1YC7A 3WD5L 4CUCA 3PABA 4JFFE 4YC2C 3RVUD 5I2IB 4XHJD 4D0BB 4CVWA 5E08L 5IMKB 2AEWA 5DJAB 4NM8L 1FORH 3O9WA 3VD7A 1E6OL 5T3XD 3U7YL 1LO5B 3MR9B 5FXCH 1FL6A 4YBLB 1UWGL 2BOBA 4UUJA 5D2LE 5DJDB 4N8VG 1B6UA 3SE9L 4PY7B 3VGGA 1S7WA 3HE6B 4XPBL 1A7OL 4G6FB 1BEYL 2APFA 5L2KB 3KLHC 2X4UB 4QWWC 1PLGL 4ETQA 1T3FA 4DEPC 1EERB 4XT1C 4JLRB 1KELH 1T0MB 2D0HA 4V1DB 5D5MB 1MCPH 3SQOH 3ZE2E 2AABH 4JPIA 3UJTH 1JF1B 4QHMB 4EDXB 1JN6A 3PQYD 4U6XA 4OLXH 3NIFE 4OZIA 1BZ7A 5D6DA 3QEUB 4HHAB 1QFHA 3HNVL 5TJWK 3GBNL 5DRWA 2YA1A 3G5YA 4M4RA 4A2MA 3A67H 2HFEB 1P1ZA 4P4RA 5C0BB 5JW4R 4OV5A 2EH8L 1OQOA 3WS3A 5I19L 2ADIB 1CICB 3QUMB 3U2SB 1CZ8L 1RZ7L 3MV9A 4WFEE 4PRDA 1JZ2A 3T0EE 5FB8A 3W39A 1S78C 4TNVK 2CGRL 2J12B 3VFPB 1CBVH 2YZ8A 2OR7A 3OKOA 5T3ZE 1IGCH 2IMNA 3P77A 1IC4H 4ODVH 2X4QB 4YHKH 4K55A 2D7TL 4LGPB 4OLWH 1DVFC 3BW9A 1ZVSB 1P4LB 2I9LA 2HVKB 2DLGA 3ZHLA 5JPNB 3IAGC 2GTZB 2C1OA 4U3XA 3PP3H 4AENB 4UU9A 4K8RD 4WHYH 3QB7C 1B4RA 1WWBX 4PV8A 1UWXH 4IMKA 3FO0L 1AQKH 1J10A 2DQGH 4Z18A 5KS9A 2X4OB 3HFMH 4UT9L 3NFSL 1WBXB 3LS4H 4UV4H 2IF7A 1X5JA 3VFGH 3B9KB 1UVQB 3SE3C 3QYCA 2LQRA 4OF0A 3PWUB 2Q1EA 1AGFA 3MRDB 3P0VL 1QQDA 2AV1A 2YRZA 2Y4SA 3MO1A 1JI2A 1ZHLB 5C8JA 3HI6H 4JN2B 2WBJA 1C8PA 1N6QL 4U49A 4BFIA 4LQFL 4NO5A 4UNUA 1ERNA 2NZ9D 4ISVA 3REVB 3W9DA 4DN3L 1OL0A 3SDDD 4KWUA 4WFED 4XC1H 3UZEA 1PZ5A 3HS0A 2KPNA 4OM0L 4P2RA 1FC1A 2MMXA 1LILA 1O7VA 2I60H 3FFCA 1YJDC 4ODXA 4JQIH 4QRPE 2VLJA 4N8CH 5BRZB 1VKXA 4PV9B 1FFPB 2QQNL 5L8JB 4YH6A 5LGKA 3D85A 2YMXL 1JP5A 1QBLH 4X7SL 1J86A 4FQQA 2IAMB 1OVZA 1I8KB 4RWYH 5I30H 1D6EB 5HYIA 4NNYA 15C8L 4JHWH 2VZ3A 2XKSA 4WCYL 4FP8H 5T5NG 1AQDA 3P40A 1CVRA 3QIBC 1I3UA 4M6OL 5HHOE 1OM3L 3WXVH 1R24A 1T2QL 2NY1D 3LD8C 5I66A 3G6DL 2VDLH 2BHUA 3I50L 1IC1A 5DRXB 4PJBE 1KLUA 1RZ7H 1I8IB 4X9FA 3H3BC 3WMSA 5J8OA 5E8OB 1IAIL 4EUPB 1X5XA 4GFTB 4U1LB 1WV7T 5FGRA 4X8XA 3KHQA 4KKBC 3RTQC 3V0VB 2D0FA 2UUDH 3T0VA 4BUGA 3EO0B 2VERN 4BQBA 4HCRH 2HVJB 5GGRY 2WWMC 4FFVC 1EHAA 4K9EL 3BGMB 4Z0XA 5LAXB 1RJZB 4WFGE 1N4XH 2ADFL 5HI3D 5HYSB 2DDQL 4FG6C 2Y36L 4MHHG 4WTXA 2FATL 2CO7B 5I8EB 1QBBA 3CZFB 1GZPA 3FB6A 2FJHA 3B3IA 4FFVD 4YHIA 1I8LA 5HPMA 1N26A 2AJYL 1KPVA 1DTUA 2BRRL 4WFHE 4HC1H 3QXVA 5ETUB 5JDSA 1DR9A 3V6BR 1XT5A 1GOGA 1QPXA 5GS1A 4MA1C 4F2MA 1H8OA 4WHTB 1NGQH 4JO2L 3C08H 2MHAA 5DDHB 1OP9A 1XF2A 1MCEA 1I8KA 2AGJH 3OR7A 3VU2A 3QIBD 4I2XB 5CEYB 5SX5H 4ONFH 4PG2C 3V4VH 3FONB 2NY7H 1G9MH 3GSUA 2R2EA 4NUGL 5CGYC 5JOPE 3ZHKA 4OIBA 2E6QA 1SJXA 3CDGB 2BHZA 3VH8G 3BSZH 3HPJA 3MX0A 5DJZB 1OAXL 1QBMH 3DROB 1UKQA 2A74B 1PG7W 4IDJH 1ZOXA 5DS8A 3U6RA 1NSNH 2GITB 4G8FA 4M1GL 4JFHD 3U9PH 3F65A 4K94H 5IJVB 3LZFH 3FFCD 2NY2B 3OB0K 4H26A 1U8PA 3MUHL 4JFDD 2NTFA 4Y19D 1F3DH 2G60L 3JTSB 4HEME 3ARYA 5I16A 2HVJA 3DHMA 1WIPA 3B2UC 4HJGB 2NQCA 1J8HB 1I85C 1RK1A 3BYYA 2XPGA 3G5YB 5J56B 2JB5H 3UTQB 4G9FE 4NIKB 1BIIA 5GS0D 1RZIA 3NABL 4L8CB 4MB4A 5CZXC 4XB8A 5DUPH 5GS1C 4JO4L 3C6LB 3QDAA 1S3KL 2FJHB 3U7YH 1JRHH 5D70L 5JHDE 3WFBH 1TZGH 4DGVL 5HD8C 3C6LD 4PYHA 2UZIH 3X3GH 3QWQB 3OAYK 2PYEB 4XP5L 4OQ1A 1GPOL 4DEPB 1S7UA 1U8QA 4LLWB 1F8TH 3ARQA 3QQ3A 5I8CA 5C7XH 1CL7L 1J12A 3FHQA 3C60B 1ED3B 4XAKE 2BJMH 2EE2A 4LRIA 1FFPA 1R3JA 5IP4A 2J6EH 3PHOB 5FFLA 1S78D 3DGGA 1UA6H 1NDMB 4HJ0C 2AXFA 2ED7A 5E4IA 3MRCA 5BO1L 1OF2B 1YN6A 4JHAL 1HK6A 1K4DA 1UM4H 3RTQB 2F19H 3PJSB 5D1QD 5JW4M 4HUKB 3GMOA 1NEZB 3PIQB 4NCDA 1KENL 5ICXA 5DQ9A 3TH3T 4IS6B 4Y19E 5DEZA 4XH2A 3GSXA 3O4LD 4OSUL 3ZHDA 1U8NB 3MO1B 4YBLC 5LBSH 4NZDA 5E2WH 1H0DB 2ARJB 4JY5L 1JBJA 2C3GA 2J5LC 1BQLL 3MJ7B 1KFAH 2XICA 2XY2A 3MRMB 5JXED 5FKPB 1OB1B 1RUKH 3U0PA 3KLAA 2O61A 3JWOC 4NQSA 3V2AR 4K71C 4PJHF 1OCWL 1RZ8A 2UZYB 1CFBA 2PW2B 3D39D 1JF6A 1A1MB 4XCNA 4M1CD 4CMMA 2NXYC 1LO5A 2QQLH 1EMTL 5DJ0B 1MSPA 2BY1A 1FGVL 3RGVB 1IBGL 1KPRB 4M61B 5D2NB 5I8KL 3L5WA 2X7LB 1BJ1J 4MQSB 3MLYH 2LAGB 4OLZH 1LEIB 4HUUA 4BUHA 4BZ1H 3O6FA 3QAZB 3O3EB 4L8DB 4ALAL 1OAYL 3KXFD 5EH1A 1QKZL 8FABB 3VWJA 4AIOA 5I1LA 1M71B 2FGZA 3RY6A 1A3RL 1XGYH 3O2VL 3LN9A 4MNQE 4M93B 1BLNB 4HF5L 3T08A 1PD6A 3MJ7A 3QIWB 4JRXA 1XF1A 3QUML 1VERA 3UBXA 1RFDL 5IB1B 2F53D 5F1NA 4HHAA 4D3CL 4ETYA 4WFFE 4PJFF 3HPLB 3OKMA 4O9HL 3RTQA 4H88H 1LK3L 4LRNH 4HIHA 5D7SL 4MSWA 3QZWA 4KUZL 3HPJB 4Z7WF 4OLYH 2X4NA 4Y8AA 5EC1A 4X6FA 4NWUH 4OGZA 1A6UL 1G7IB 1T3FB 2UUDK 3OKDB 3SKJH 1I1AD 1P4IH 1NLBL 1UJTA 4KRLB 4UT6L 4HWNA 2N7AA 4KKLC 3RWGB 1OWWA 4X9GA 2FEEL 3C87A 1SEQL 4P9HH 5GS1B 4NC0B 5C0NC 4K3DH 5LXGH 3HCVB 2AEIT 3LEXB 4L9LC 5C08A 2PCPB 3U7WH 4P2OB 1FL3A 4EZMA 3TT3L 3AXLB 1AGCA 2UY6A 2C4FU 3KPLA 4PGCB 5ENWA 5T33H 4QT5A 2GAZB 2EZ0C 4Y89A 3CSBA 4Z7UE 2AK4A 2DBLH 3HG1D 4MD5A 3UTQA 4KVCL 2H32B 2QADC 1MNUH 1QLRB 2AJYH 1JGUH 3IFNL 3VI4F 3EOAB 3WSQH 1TFHA 3WJLC 2VAAB 3F7QA 3CFCL 4QXGL 4A6YH 4PJXF 3KR3H 5EZIH 4HH8A 3VXOB 4LLVA 3CX2A 1S7SA 3RJDA 3OXSB 5SWSA 3O3DA 3OSKA 3T2NL 1DANU 4KAQL 43C9B 2EO1A 3G08B 1MFAL 1T1YB 2BSSB 1I9IH 4G8GE 1X5LA 4JM2F 3VXNA 4LLAA 4POUB 2BY3A 5F44A 1V7NL 5I2IA 2IPUK 2A9NH 4Y2DB 1Y6NR 1EGJL 1YECL 4M9OA 5FYKL 3TEUA 4JFXB 4F33B 1CDGA 5HJ3A 5E7BA 4BFGA 2BNRE 3E3QC 1ZHBA 1S9YA 5JXAH 5C2BL 4AQ1B 4H25A 4YK4B 4HPOH 1FN4A 4CBPA 5IEHB 2CMRL 5L88L 1J1PH 3KPPB 3SKNB 3K7UA 1S8DB 4FTVA 1CLYL 4AMKL 5CCKL 3QUZA 4EI5D 3SDAC 4C55A 4ZXBC 3S34L 3ZE2F 4YXLL 1C5DA 1NQBA 2NY6C 2OM5A 1FNGA 3D0LA 4Z7QE 4MMZC 4GRMA 3ZDXF 1I3GL 2GIYA 2R2BA 3O8XC 1INDH 1F2XK 4ODXB 1FZJB 1I1YA 1MLBA 3ULVL 5L8KB 2HMIC 4GRLC 1QSFB 5I16B 2X4SA 43CAA 4K94L 1J05A 4NN7B 1QRNB 4BFIB 2VABA 4DQOL 5D2NC 2EC9T 5BVPL 4K3HA 3SHSA 3N85H 4GAJL 1WZKA 3L3GA 5L9DH 4LOUD 3ZE0E 3WXWL 5J9PA 3DUUB 4EVNA 2QBWA 2ADJA 4JEGB 5DHVB 4ZUSB 4HFWB 1OSZA 2R0KH 2FJGA 3G9VA 4RFNC 4MCYB 2XG4A 2XWTB 5HYEA 5INCA 1KN2L 1WITA 4I77H 1NLDL 4XBEH 3QUZC 1JMZA 3ZKMC 2F8XC 1MCCA 3WO4C 1IGFH 2BVOA 3QO1A 1DQQA 4KHTL 1CE6A 2XACC 4CJ0A 2GK0A 5IK3A 5T1KB 1FC2D 3FT2A 3QIBB 4A6YB 1S5HB 1U91A 2E7HA 3SGKA 5I66B 1UKSA 5CSZA 5JPNA 3RAJL 4OF3A 1IQWH 2BC4A 4I3SH 4XPFH 4BQ9A 4KK8C 1NANI 5DT1L 5GRUL 3H2WA 3TBSB 1KCSL 3T0EC 1JPFA 3U9UA 3AM8C 3S35H 4JPKL 3MREA 2EDTA 3QNZB 3O45A 5DFWH 2XZCH 3O6KL 4PV9A 3RWFA 4HBCH 5J0BA 3WJLA 4HK3N 4G3YH 3L7FA 5CEZH 5K9JL 4DN4L 1A6AB 1EH9A 4JKPL 4GRWH 4ZPVA 5K9QI 3PNWB 1V5JA 4X7CC 4P2RD 3RWIA 5I19H 3LQMA 4F7PA 3W5NA 3TYFB 1LEGA 4K07A 3GI8H 2DLFL 3MLYL 1BZ7B 3N9GL 4C56E 4JG1H 1GJIA 4OM1H 4XAKD 3SPVA 3I85A 4H1LH 1X6LA 3NGBC 3T3ME 3UJTL 3QEHA 3UYRL 1MFEL 1J5OL 2VAAA 3Q0HA 1J1OH 3LHPL 1CU4L 5F3BB 1U8MB 2X9WA 3C5ZD 1OSPL 4NRZB 3RVXC 1MAML 3BWAB 1MRFH 2BP3A 3UYPA 1I8LC 1REIA 3HE6A 4QF1A 4BQCA 3VXSA 4BH7B 3HAEH 1HSAA 1XGRA 3VGAB 1C12A 3JBG7 1FVDB 2R56L 2JIXB 2D7MA 3KNBA 1OW0A 4R0LA 4XGZA 3BW9B 4J3OC 1PX4A 2AXHA 3IJSB 2V7NB 4ZOEA 5DMKB 3QXTA 1A6WH 1AD9A 5I0DA 4ORGB 3IU4L 3PHOA 2OTWA 1FLRH 4D9LH 5DEFB 2X5PA 3SGJC 5ESAA 1CDJA 3RNQA 4U1NA 1QLFA 1NGZB 3BIKA 1M05A 5L7XL 2W0KA 5IVZA 1N3NB 5B8CA 3P9LB 5IHZB 4R3SB 2PXYD 3K1DA 3C5JA 4OBSA 4QTIL 1K8DB 5MI0B 3MLPA 5EOCL 2HJKB 1ZGLM 1U8OA 2NY2C 2L4OA 3SO3C 1BP3B 5E94B 5B3NA 3C6LA 4KJYB 1Z9SA 5CMAB 5J1AB 1BVLB 1NMCC 2V9QA 4YFLF 4EDXA 3MRBB 2H1PL 2NW2B 3FQWB 2R69L 2Z8WC 2H6PA 2FX9L 4NKIL 2VDKL 3VXUA 2EDFA 5ERWA 4LKXA 3ALXA 3OJDA 5EZJB 3HE6C 2DRUA 2DWDB 3RGVD 4UT6H 1AD0B 3BEWA 2X44D 4O5LL 4PB0L 1I1RA 1TJIH 4XVUC 4NWTL 2C1OB 2BDNH 4HXAL 2JELL 4K3EL 5EOQH 2OZ4L 2PYED 4OLYL 4PB0H 5I1KL 3X11A 1IC4L 2H9GA 4DOHB 2HG5A 1T1XB 2IAMC 2ESVB 3H9SA 3T0DA 2CIIB 4IRZL 2LVCA 1IL1B 5D7IB 4CMHB 1F90H 3DROA 3MGOB 3OKOB 5EN2A 3D2UD 3VFPA 1JGVH 5F9WB 1ZT4A 1OTSC 5JXAL 1EV2E 3GMPA 3BRGC 2DMCA 1EX0A 1ZLSL 1CR9L 1QNZH 4LRIC 3QDGA 5JOFB 1XH3A 1XF5A 3MYJA 3NTCH 5B8CB 1QEWA 4FQCH 1MQKH 4EOWL 4H0HB 5DRWB 3H3PH 3RNQB 4XCFL 3L7EB 1ZLUH 3KPRB 4OKVB 1HWHB 2EEBA 5E6IB 1XIWB 4GW5B 4XC3H 4NT6A 1RURH 1FLRL 4JPIB 2A74A 5F71A 1T2JA 5GS3A 4XVJH 5ALBL 1N8ZA 4RFOH 4P4KC 1I7ZB 2Z4QA 3X11B 4NKDB 4C83A 1A1NA 2RJMA 2ICEB 1FLTX 4BH7A 3E8UH 1UWGH 1SJEB 3MRHB 3TN0A 4BFEA 1MIEH 5EULV 5DD1H 4NJ9H 3QQ3B 3BZ4B 2QQQA 4HWBA 3FO1B 1AO7D 1UT9A 4JM2A 4OZ4B 4GKNA 4UAOC 5DJAA 1MUJB 3I02A 3IDMB 4PJ7A 1WUNT 3RDTD 1UJ3B 1WFOA 1YN7A 4KDTC 2R4SL 5CP3A 3JWOH 1G1YA 3IGAA 1NC4B 3IF1B 5C86A 3GHBL 4ZO8A 4FTVD 5J11B 5E2UH 3GMOB 4WW2C 4FQJL 5H35B 4C58B 2MJWA 5JNYB 4Z7UA 2DQFB 1RY7B 3ILPB 3OPZL 3WKMH 5C0FA 3MGTB 5C0JA 3QIWC 1A5FH 3UEZA 3K4DA 1YYML 5FCUL 2R29H 2VUOA 2Q3ZA 3GJEA 2VLLB 4EBQL 1FSKB 2X70B 2AJZB 3LKPA 1X5YA 4GRLA 4JM4H 1NPUA 1YEGL 3KPNA 2WUCL 4GRLD 4ZNEE 1NCWH 2R4RL 4HIIA 3V6FA 1LWRA 2IFFL 5JUEH 2VC2L 1T2QH 4LCWD 3QUMH 4OB5H 3TWCL 3LEYL 2BK8A 2VLLA 1G6RH 4OF5A 3QHTC 5KOVC 5TH2B 4MWFA 1KJMB 4I0PB 1HHHB 2NY5H 4ZD3L 3QRGL 4LLUA 1BFOB 3SDCD 4HCRA 1XF2B 4K7FA 1W2KT 3VXPB 4GS7B 2ENSA 1HQRA 3VG9C 3VXTA 2LU4A 3RGHA 4MD4A 4PLJD 5I9QB 1CXIA 1Y0LB 1DBJH 4X4XB 4HQQH 5HYSG 3GM0A 3RZWA 1S7XB 7FABH 2ICWA 1XCTA 4KY1L 4GKNB 4KROC 4RGMC 5LGHL 3ZT7A 2Y5TB 1MJ7L 4PV8B 4K23L 4F57L 2JJWA 5D2NA 3EDKA 3KXFE 3GMQA 2JF1A 3W2DH 5F1IA 4MB5A 3DMMB 2B5IC 3O45B 4CRPA 2ZNWA 5ITFA 4RA0C 4X99B 4FQIL 4K3JL 2NMSA 1R0AH 2Z31A 4OZGE 3JWOL 2Z93A 3WIHL 2Z8VC 4WI9A 3W39B 1MFBH 1IKNA 2VDNH 5FO8B 5E4EB 4LPUA 1OP3K 4D9LL 4P46D 1QPPA 3VGFA 4UIKL 4NQCB 5D9SB 3LEVL 5CINL 4ODVL 3MXVL 4LLQB 1FNLA 1LO2H 5CHNB 1KCUL 1JHTA 1BFVL 4X6EA 4AM0A 2XQYK 4DFIA 1NCUA 1YQVH 3L3IA 2F74B 5K9KA 1NCBL 2ZUSA 3PG2A 3M1BA 5BZDB 3R06A 4QXTB 1BBJA 5EORH 4JDZB 1A6PA 3S3SA 1MAMH 4PJ9B 2HG5B 4XVSL 4P23B 3QUXA 3MRCB 3ZKXB 4DKAA 4M1DH 2XQBH 3PWNA 5C07E 4EQ3A 2Y36H 1TZIA 5JW4Q 1IAOB 3M45A 4JREC 4FFZH 3F6IA 1AGDA 3O3DB 1BD2E 4IBLT 1KC5H 4N1HB 3C60A 5GPRA 1BHGA 4RRPG 5KTEH 2JKXA 4G80A 1HYSD 4OD1L 3MV7A 5F6HJ 1S7UB 3QG6A 4NQXB 1MCPL 2VZ1A 5FUZH 3HZVA 1MCOH 4Z7UB 4UQ3A 1E0OB 5B38A 2AJSH 3VXUB 5KSAC 1KGCE 1OT2A 3HI5H 4EUPA 4HX1A 3QDJA 1JGVL 4Y5VC 1MLCB 5TQ2L 5GRUH 4MDIA 2NNAB 1JPSL 1MCRA 4YFEA 3WFEL 1NFIB 4HBQA 5JNYA 4UQ3B 4M5ZH 1UKTA 4G8GA 1NCAH 2RHEA 1MRCH 1W72A 2EDOA 5I74B 3SDYH 3T0BA 3EOTH 2IBGA 4ETQB 1DZBA 2DJ4A 3FQTB 3WFCH 4DW2L 3WBDA 1JK8B 3FZUD 4LVNC 4O51B 1F13A 3HC3H 4PJIA 4U05A 4EN3A 1XEDA 4EN3C 3KYMB 4C83B 1NC2B 4MS8D 4U31A 1DDHA 3GSNH 2FX7H 3GNML 2E5EA 1RJLB 1ZVYA 2CKBA 1HDMB 5HYJA 3TJHD 3Q3GB 4XGZB 1OPGL 3R8QA 4O2FA 5GXBB 5HGBA 5AUMA 4OUUB 2CUMA 3LKRA 3HI6L 4JN2A 4U0RC 1P69B 1SQ2N 4DQOH 3P4OA 2WBKA 1A9BB 2DQUH 1QO3A 3SDDB 1JTPA 3SGEI 1YEIL 3D0VA 2EDJA 3KVQA 5C0CA 3REWB 2MHAB 4PJ8B 2XZQH 3BE1H 5DDHA 2NX5E 5IMLA 3BQUD 4OCWH 3B9KA 4PJ8D 4QGYA 2XZQL 1F4HA 1WT5C 1FFNA 1N59A 4S1DC 3FMGH 3RKDC 3CXHK 4HUMB 3QP3A 5FM8A 1A6WL 5KS9E 2FEEI 3C60C 4NN5C 4WO4D 3RX5A 3T3MF 1KEGH 2YPLB 3BD3A 2VDOH 3UBXG 1WZLA 3FN3A 1YEHH 1KG0B 3U30B 3MV8A 1B0WA 5GGSA 3SJVE 3WLBA 1AI1H 4PJAF 1MH5A 3MZTA 1MCDA 2QR0B 4NHCL 3TIDA 1W8NA 5CEZD 3F62A 1DN0B 4LFHG 5KVGL 1NGZA 3WEXB 5AUMB 1G7PB 2CDGB 4H8WC 4UNTA 4G6MH 3T0WA 1G7IA 4NHUB 1X5KA 3PGDB 1KYOJ 1T1XA 2A9NL 3MXWH 4LHUD 1V7NH 2CRMA 5C0IB 5AD0B 1MFEH 5IB2A 4JZNB 2DKSA 3GIVB 5AZ2L 3UO1H 1K5NA 2A83A 2P8PA 3CFEA 3MZGB 5D93B 4M7KH 4KRMB 5EA0H 3JWNC 3EGSB 1OW0C 1HN1A 2CXGA 4QHLB 5E1AB 5DMIH 3M17B 4I4WB 4HKBB 3IJHB 3H9HB 2FR4B 4BSWB 5I1HL 4YWGH 2D4FA 1FZKA 1BZQK 3F7PC 4JPWH 1VB9A 1JF1A 2R9HD 1E4KC 1RIHH 1CFNA 4NO3B 3KJ6H 3DSNA 4Y16A 1JGDA 2AXFB 1TJHH 5JOPD 1JV5A 1RZKC 2X89D 5LVEA 4FQIH 5DMGD 3TF7C 3PDDA 1NMCB 2XYCA 1HWGB 4RAUB 1CE1H 2XA8H 3SCMD 3V5DB 4QXUL 3VFOB 5EO0A 4YE4L 3DMMA 2DLEA 2FWOB 4X5WB 5D6CB 1M05B 1NJ9A 5DSCA 1FVDA 2E9IA 4GH7B 4U7MA 1EO8H 2OSLA 2B4CL 5KVGH 2V9RA 3MA9H 2UZIL 4MVBD 4PR5B 2VXVL 1EEQA 1MQ8A 1NCBH 1RJYA 1F90L 2AJXH 4TNWF 3U0PB 2O61B 1OD7A 1QG3A 4L3EB 4YGAB 2X1XR 4XXCA 3ABZA 2QTEA 3R06B 1J88A 4PTUB 4CW1A 2ORBH 2Y1VA 4J12A 3PWPB 2B7DT 1NCCL 4I5BA 1G84A 3GKZA 3MNVB 1A3QA 5CJQH 3PWLB 4UOW0 1DQLH 3GSRB 3OKEB 4D8PB 3NIDE 5EUOE 4JZOA 2JCCA 3ULVF 3DO7B 3WO4B 3GI9L 5F6IB 3MCKA 2BVUA 5IW6B 2DQEL 1NFDB 5I1IH 4KZEH 1S9WA 1S7TA 4KKCC 5BMFH 3D2UA 3IFPA 5FO8A 35C8H 2PO6B 4ZPTB 4HV8B 4MCYA 3WUWA 1CFQA 4N9OB 3QA3A 1JI1A 1T89C 2FHBA 2VDMH 4I0PD 3GBNH 2YZ1A 5MEQB 3V6FB 4N0FB 1IM3B 3SE3A 3QCUL 5EO1A 4OLEA 1QTYT 4XCEB 3ZSSA 3GHBH 2W1NA 4WHTA 2DQCH 2PYEA 2WUBL 4KTEH 4MJ5A 4PLOB 5CSZB 3HE7C 2RR3A 1H9VA 1D3CA 2YD8A 3S88L 1O7SA 4PJXA 5F9AC 4XCYA 1S5IL 2JTDA 5JPMB 5D71H 1S9XB 2FYYB 5EOCJ 1FIEA 3UJJH 4B0MM 4S2SA 1ZT4B 1Y0LA 4DAGH 1MCFA 1Z5LB 1NGXA 4M5YH 3O4LE 1KIRB 5J6GA 3RL1B 3MGOA 1FL3B 3CFJB 4KRNA 4WJ5B 3DLQR 2Q3AA 3THML 2DQIL 3GUTA 4GKSA 2YKLL 5GZND 4PJEB 5CILL 4YFLI 4WW1A 5DD1L 4NKOA 5JW3L 3ZDYF 1MI5B 3G5VB 4JLRA 3VE0A 2OMBA 4RIRA 3ARED 5FUZL 4OZFH 2CPCA 4KTEL 2VIRA 5TFSL 3WFDL 1EHXA 1F3RB 2P5WD 3MPCA 5TE7H 4XP9H 4UUJB 3G6JA 5CJOL 4UINH 3PQYE 2OXHA 3FQXB 2Q6WB 3AAZA 4OI8A 4QXGH 1WZ1H 1HHKB 5I76A 1FH5H 1F3DJ 4J7RA 5TE7L 3WNOA 3WS6A 1I9JH 4JKWA 1T04B 1IC7H 4ZXBD 5IHUH 3RKDD 2FECL 4XMPH 3NCFB 4QEGA 3G08A 1QFWL 4S10A 1L6XA 3TPKA 4YHLH 4X83A 2GSIA 4JJ5B 2ZOLA 3V52L 5GJTH 2FCBA 4IMKC 4H0IA 3THMH 5ITBL 1Z5LA 5H35A 3H42H 3D3VB 2PYFA 5EU3A 1KTLA 2AJUL 3CXHJ 2PF6A 1DLFL 3O3AA 2A0LD 4YNYA 1A47A 1OAUH 4JRXD 4OAWB 3D85D 4Q74A 4Q9QH 1LD9B 4Z78B 2XFXB 3DPBA 1YN7B 4L8DA 3D85B 1JWUA 4Y16D 1TIUA 4G5ZH 5EO9B 4ODSL 3TJEL 5IVXE 2AK4B 3R0MA 4X7EC 3OQ3B 4FTVB 5KSUA 5J1SC 1CGSL 2D03L 3D9AH 3AC0A 4NKQB 1WC7B 4PJGE 5BW7A 4HT1H 4J8RB 5IEHA 1CD0A 1CG9B 4Z77B 2ESVA 5FYLH 4Y5YC 1CQYA 4NWTH 4LKCB 5SWSD 2PR4L 1C12B 1IGTA 3K8MA 2G5BA 3HAEA 1T6VN 5SWSB 1YEDB 2G60H 2V17L 3QNXB 2C1PA 3ULUD 4XCFH 1S7VA 2V5RA 2SEBB 2D31B 1U3YA 3QULA 4X6FB 3BPOC 4YPGA 2H1PH 5FKPA 5HVHC 3V6OC 4MXVE 3P11L 4U1JA 4NNPL 4NZTL 4M5ZL 1KCKA 4PJHE 1T89A 2GQHA 3PGFH 1ORSA 5JZ7C 2EH7H 5IMOB 3BKML 2EKJA 3QCVH 3TVMB 3BX7C 4C56A 5IKCA 4GXVL 4NSKB 3PHSA 1WTLA 4WTZG 1G7LB 1ND0A 5C9KA 2HJKA 1U8LA 2Z9TA 4MDJA 4RDQG 1X5FA 4PJ7F 4CADB 5DZLA 4NGHL 1SMOA 5K9QG 4LCYA 5J1TC 1MFCL 5TQ0H 4J3WA 3EO9H 4IMLB 4ODSH 3TJEH 3LVEA 3IFLL 2IFGA 1G7JB 1U3HA 3DHJA 5JO5B 2J8OA 2OL3L 2J8UA 4XHJC 4AEFA 1MH5B 2IFFH 2JJTC 1JYXA 5CBEA 1CU4H 4XMKH 1EAPA 1U36A 1DCLA 4PJAA 1HCFX 1CFSA 3V52H 5E8EB 4D0CA 3WO3B 4E41E 4OSUH 2V2XB 4C4KO 4F8TA 3DX9A 3K74B 2F5AL 3MNWB 1JGEA 1XF3B 2BSTA 3S36H 3IU3B 1EAJA 3QZWB 5J7CC 1OAXH 2EYTB 3UYRH 3O4OC 5EZLA 1V7ML 3FT3A 4CVUA 3L3KA 3NH7L 1IRAY 1UCBL 5I17B 5IUSA 2FB4L 5CBAB 3VFSA 5CJOH 5D1ZA 2CD0A 3QJFB 4DN4H 4WRLA 2IC2A 4S0SD 4MQ7B 3WIHH 1T0NA 4OZHF 1K8DA 5IROA 4HS8L 3EW3B 3GJFH 4L5FH 3S6CA 4MZ3A 3BO8A 3W9EA 3T0AA 4QCIA 2IADA 2YR3A 1NGPL 3A6OA 3BXNB 3ZKNC 3BWUC 1INEH 4CVXA 3A6BH 2YXFA 3GFUA 1A0QH 3ZTJG 4N0CC 3KPOA 4KROD 1XR8A 1G0YR 5KSUB 1A2YB 2HTKC 2XOTA 3ARFA 2NW3A 5DT1H 2P45B 2P5EA 2BNQA 1E4WL 5J6HA 4LVHB 3DRTA 4QHNA 4XMKL 4GRWB 1A7RL 4P4KD 4RGMB 2AXJA 2AJXL 2PW2A 4AYFA 3BKYL 5EU7C 1QSVA 4TPRH 3QQNA 4NHCH 3LQZB 5EBWB 5DI8B 1T0PB 1MQKL 1CIUA 1LD9A 2PTUA 4Y16C 2MPAL 2B39A 1UB5A 1CXHA 3B8SA 4G7VL 1PKQE 1JL8A 4NKMB 4XP1H 1T1ZA 2YPKA 1GGUA 3A6BL 2B2XL 5D5MA 4M6AA 3HG1A 5D7LA 3AAZB 5T1MB 1KB9J 1A7PL 1NCNA 4CU6A 2D7PA 4NN6B 3S9DB 3BZDA 2A2QT 1SEBA 4BYHA 2HAZA 4LGRB 4F7PB 1WCBA 1PEWA 4UV4L 4O2EB 3MRNA 2WUCH 5IJVA 1HINH 3DO3A 1KJ2L 1MHCB 3LIZH 3EYVA 3P4NA 4OFIA 2EDXA 4RFEA 5CZXD 4ZS6C 3C2SA 3PF2A 1Q0YL 4WGWB 4TUKL 3RWCB 4YFDB 4KKAC 1ZS8B 4X8JA 4WHDA 5DLML 5JHDD 4NO0A 4M7KL 1D9KB 4YHKL 1U8IA 3L3IB 3D3VA 4UB0H 5HYFA 1FGVH 3X14B 2HWZL 4FQXA 1A3LH 5D4QA 3QFJD 1EXUB 3AS1A 1NBVL 3RY5A 4XNUH 1PSKH 2WP3O 1MCKA 1D5ZB 4G42B 4LU5H 1IZKA 4U1GC 5F7NC 4Z76B 1B3JA 1CLOH 1WJ3A 4HGWB 5E56A 2ATKA 1Q9LB 3EYFB 2AK1L 3IDJA 5D1XD 1ZHBB 5IMLB 2XWTA 2GT9B 3QULB 4YPGB 1TZHA 3CMOH 2XWJA 4WUUA 3ZSTA 1ADQH 3WUWB 1JPSH 2VDOL 3C6SA 1AJ7L 1GGBH 1YDPA 2PO6A 3SEPA 2KDGA 3LDBB 3RP1A 3X3FH 3GSUB 2UWEF 3HMXL 2J3SA 4JPWL 4O00A 3VXNB 2VLRB 3BD4A 2F19L 2GJZA 5FGBC 3BDXA 1FYTD 3KPSA 1YNLL 1PX3A 3T1FB 5HHNA 1WAAF 1CWVA 4R97B 1IGIL 2CLVB 4H8WL 4KV5F 3C6SB 2YK1L 3GEWB 5DJ6B 4NQCE 4R7DA 4ZOCA 4UNVA 3S34H 5JQHC 4LEXL 4OCXH 3DIFB 1S9XA 2FYYA 2Q86A 4HKJB 5D7IE 4KKCD 5F6IC 2VITA 4LNRA 5CHNA 1J1OL 4MVBC 2YD2A 1MY5A 9CGTA 1Q9WB 5F89A 2JJUA 3MACL 1A3LL 1KXTB 4NQCA 5CGTA 5D9SA 2QKIB 3AS2A 4NZUH 4FQLL 4UDTA 1CD8A 2V5MA 1JHKL 4M48L 1WWCA 5ELIA 2P5WB 4H0GA 4KUZH 2FWOA 1KTKE 1D9KA 5IFAL 4NGHH 1MFBL 4TYUA 2QHRH 2R8SL 1ZTXL 1HH6A 4HIJA 1KLFA 1S5IH 2R15A 1MCJA 4KVNL 2DLHA 4KK6C 2OX5A 4MNHA 1L9MA 1D5IL 1Z3GH 3LEYH 1LQSR 3ZDYE 5SWSE 3QQ4B 2OXGA 4I48B 4JHAH 5I8EA 4LSQL 4MA3B 5FM4A 4Z7OF 4J3SA 5J89A 2YSSB 2LTQC 5HSFA 2DQFA 3ILPA 3IXTA 1S7XA 3EDDA 3V6ZA 3MNVA 1QFWH 4R4BB 4HS6B 5B3JE 5HI3C 3NGBB 3PV7A 1F58L 4CU7A 3FB8A 1EGJA 4Y16B 2FO4A 2IPKA 3MRDA 4UV7H 5E08H 1KEML 5F72S 2VXQL 3OAUH 1UXSB 1QKZH 4NUJA 2ARWA 3MRRB 4AEHH 1P7QB 4XNQA 1BFOA 4ZSOE 2KZ1B 3VG0L 5EU7E 4P3CH 1RPQA 5FYLL 5H37H 4JZJB 2K9UA 2R9HC 2VDRH 1KSRA 1OGTB 2V2XA 5IHBA 1D5IH 1Z3GL 5D6CA 3HCVA 3FFCB 2JELH 4K3EH 2MQCA 5IVXB 3L5WB 4Q6IB 1QZ1A 4NCC2 3RWGA 3CNKA 4MNHB 4YHMH 4I9WD 3L6FA 5FHAH 1L0QA 5J6HB 2J8UB 4OQTA 2K3TA 5F7HA 4U6TA 4FQQB 3KDMA 5IM7A 2P5EB 2XZAL 4GJTB 1RZFH 1YQVL 4Y4FA 4M7LT 3IS1X 5IG7A 2CQVA 3FB5B 4QNPF 5FGCE 1QHPA 3D3VE 4PJBB 1NCDH 4KHXH 1SBSH 2NX5D 2ZKHH 5ALBH 4UIKH 1KXQE 3E2HC 4J6RH 5CD3A 4G6AD 2VYRE 3WJJA 3DV4B 3ALPA 3W9EB 3CVHH 5JR1H 4RGND 4MNGB 3UTSB 3WN5A 4M03A 5DVNA 5D1QA 1SYSA 3UTZB 1IARB 3HZYB 2VJXA 4ZFOA 2WW8A 1H0DA 5IFAH 1FL5B 2VLKE 4JFEE 4KRPC 1PJ9A 4Z7NE 3IDXL 3B9VA 4HDIA 3SJVD 1L4IA 5LGJB 1Q9OA 2ZG2A 4J1UA 5KJRH 1CGXA 5CJ8A 2ATPA 3NAAL 2H3NB 3M8OL 3KPSB 5LWYL 3FFCE 3ARBC 1ROWA 3OXRB 2VXUL 1XMWA 2QJDA 2IJ0C 3K1KC 5LGHH 2Q8AL 1S7QA 4BKLB 2YKLH 4PR5A 5MERA 3GMLB 4DGVH 2PKDA 1S3KH 2VTFA 1MIEL 4M02A 3VXME 1UQSA 5ESVB 1ZSDA 4JFHE 2HTKD 3U4EB 3QUMA 1Q9KA 2H32H 3LD8B 2X4QA 2FIKA 5GS0L 3TN0C 1DUZA 1FAKT 3TJHC 1NC2A 1ITCA 4BA8A 1N2RA 4HGWA 4GRLB 5MHSD 2UWEE 4EN3B 4XC3L 1BD2B 2VDNL 4OZIF 1I1AA 3WKNA 2JB5L 5ECJE 4RMUA 4GKOA 2M26A 3DX8A 4EN3D 5E2TL 2GY5A 1IAKA 3B6SB 4NC1C 4JFQA 5DO2D 1AXTH 4RAHA 5IOPB 5C0FB 1UM4L 1FZKB 5FOBB 4LDOB 2G9HA 4JJ5A 2ILLA 3HI1A 2FLBT 2X4UA 4F7CB 1CDYA 5ICZB 1QD0A 5FA4A 4QLRA 2HA1A 4Y4KA 2OI9C 1GSMA 4GAFB 1I7RB 5BVPH 1T7VA 5B38B 2HMID 5I76B 1ZLSH 3O8XA 4KQ3L 3RNKB 3N1MC 1S9VB 2KL6A 4EI6A 3O8XD 3HFML 3B5HA 1Z2KA 3P73A 2AEQL 3VA2C 4KK5C 5HY9A 3KLHD 2QHLA 4DGIH 4L4TE 5KAQG 1CT8B 1TZIB 1OLLA 4O5LH 2EECA 4G8GB 4MAYD 1ADQA 1Q0YH 3QRGH 5IBTH 3CLFL 1FNHA 3VFWA 3TIEB 1Y18A 3UAJD 2DIJA 5IVNA 1SY6A 1KB5L 3SDAA 5B38G 1XIWD 1MAJA 2VXTL 2EXYD 3MXWL 4RZCA 3O2WL 4HPYL 1HEZB 5BOPA 3H9YA 4HF5H 3BP5A 4P2YA 1A1OB 3AREA 3IXAA 4HMCA 5E8NA 2HLAB 4YHPB 5JZ7D 4LPCA 1N3NA 4MX7A 4LCCB 4X6CB 1WLHA 4KQ4L 1FYTE 3P4OB 1A6AA 5L2KD 4FQ1L 4QTHB 3W81A 3BT2H 1XCQB 1NAKL 3HUJF 5FECB 3T2PA 5DMKA 1AO7B 2J2ZA 3BH8B 1KJVA 4PGJA 1RIHL 5F7EL 7CGTA 4IOIA 2HFTA 1U58B 1IAIM 4JDZA 4U1KB 4YX2H 1U6AL 5LAXA 4J3TA 4PLJC 5JTWA 3CDGA 3O4OB 5E1HB 1HOCA 4WFFD 2VSCA 5EUOA 1U42A 4NQTA 3I3BA 1CXLA 3KR3L 3UTTA 1UACH 5CILH 4RDQF 3O0RH 4EDWH 3VFSB 5C0BD 2GJ6A 1YUHA 2LU7A 2ZSVA 1HILA 4KJPD 3MRRA 5LCVL 3BD5A 4DAGL 3T2OA 1NBVH 3DYMA 4FXGA 4NZRH 5JDSB 4JFFA 3U7WL 4HUVA 4TNWK 4N8CL 4HWUA 3IDGB 4KZDL 3A67L 4KTYA 5BV7H 1I4FA 4GG8B 1D5XB 1U8KA 2PTTB 4G6FD 4L29B 1NLBH 3L6FB 4ZPVB 2C7UA 2QSVA 1MIML 1LP9B 4JFDA 1YDPB 1N5AA 4Q7DA 4EOWH 1HI6A 2ZOKA 4PJHA 3RQ3A 4FQCL 4LDEB 4FQ1H 4LQFH 2ITDB 3QQ4A 3RI5F 5GGVH 1YYLH 3V79C 2XRAH 3V4UH 2AW2A 3FOLA 3MRNB 4YPJA 5GIRA 1VESA 3DJ9A 4GXUM 3HAEG 4APQC 3MV01 4HLZH 4LP4A 5DEGB 4Y4KC 2CJUH 2DOCA 1HSBB 1CS6A 2X70A 1A6ZA 2XQYG 3LKPB 1X5GA 35C8L 3AREC 4NDMB 4GRWF 1B0RB 4KPHH 3V0AC 3BPLC 3T0XA 1I9EA 3BFOA 5IMMA 4NSKA 3WFBL 1JN6B 1L0YA 4U1LA 4U6XB 4JO4H 1UYWH 1G6VK 3VFVB 1S7TB 1S9WB 2E9WA 5L7XH 3FQNA 3CIQA 5DHVH 3UJIL 5IK3B 5T1KA 1XGYL 4JJHA 3NMEA 3QIUA 3V5HA 2CH8A 4OLVL 4R4ND 4HWEH 2QHRL 5AYUH 1S9YB 2CGRH 3OG6B 5EUOB 5DC9B 1E6JH 3ARVA 1CGYA 1FL6B 4CN6A 4JGJA 5GGUA 3JWDL 1CZ8H 4QRPA 3SKJL 5C0IA 1NANH 3VMOA 1HH6B 2W0PA 3VXUE 3QG7H 2FX9H 4UAOB 4EJ1C 5D6DC 3HE7B 5F7YC 4OCYL 3U36B 4AEIL 2FIRT 1NLDH 1OSPH 4XBEL 1AHWB 5F9JB 3R0NA 1T5XA 1FFRA 2BNRD 5F21B 2X4RA 1CXKA 1UG9A 1F6FB 2HN7A 1EPFA 4TVPD 2Z8RA 3I2CL 1PY4A 1MEXH 2EH8H 4CDHA 2VLKD 2OL3B 4JFED 4UIMB 5C07B 2C3HA 4H8WH 5EUKA 3RIAF 1UH2A 2PYEE 5KAQF 2LE9A 3TO4A 2D4DA 3EOAA 4KZDH 1T4KB 4YAQB 1DUYB 3ECBB 4LHUB 1KCRL 4PY8I 5FUCC 4MXQC 3CU1A 3AFLA 4RGNE 3QFDA 2NY3B 1P9MC 4XXDA 1FGNL 5EZIL 1P9MA 1EDQA 3P2TA 2B1AL 1HZHH 5EU5B 5FUOL 4LPTA 4YDLB 4NFBA 1XGTB 1H5BA 2A6KA 3X13A 2E8ZA 3TNMA 1URLA 1N5YH 3SDCA 3TA3D 4ZQKB 5A1AA 4LAQH 3P73B 3GRWA 3RU8L 3JZ7A 3ARFD 1OAKL 3SE4A 2AJUH 1I1FA 2I26N 3HUJB 3BEWB 4K3DL 1MCWM 5J11C 1EAPB 4P5KA 3VWJD 3VXUD 3AY4C 5F88A 4WUUD 1ZLUK 2UWEB 1TMCB 3I9GH 5C1MB 3VXMD 4KKNA 4FTVE 3WIFA 1A4KA 3B2VL 5FYKD 5IVOA 1J8HE 1F42A 2BVQB 1KTRL 3O6ML 3LKNA 1K6QH 4G6KL 5ACMA 1WCQA 3QEQB 4PD4J 1FO0L 5EC2A 1KJ2B 3ARGC 4XB7A 1U93B 5JOFA 3H0TB 3B43A 1N6QH 1EJ6A 2PXYC 4Z9KB 1EEUA 3MJ9H 2LTQB 1CFVH 4JFQB 5E8NB 5JIKA 3UC0L 5E6ZA 2VAJA 5EZLB 3C5JB 4M3JA 5F7UA 4JDTH 1AP2A 4C56B 3IU3A 2XKNA 1XF3A 3DX8B 4TOYH 1GGIL 2DB8A 4HWBL 1WAAE 3EOYG 5L0QC 1EUUA 3NZ8A 5CJXC 5F3HB 4NRXB 5GHWL 4HFUL 3B9KD 2Y23A 1KB5A 4A6YL 4JM4L 2GUOA 3AS0A 1U8HA 2J1KA 4PFEA 1MCWW 5E70A 1B4JL 2FDBP 3RUGF 3CFDA 4HIEA 1SEBB 2A77L 4YHOL 4D9RE 4QOKD 3TBYB 4PRNB 3C5ZC 3RVXD 2VL5B 2JJVA 1AD9B 3ZE1E 3S35X 1ZVHA 4DVRH 3E2HB 4ZS7H 1JHLL 4OGYL 3CDYA 4JQXC 2CKBB 3QPXH 4CADA 3LV3A 2NXZD 2X09A 4BSVB 5CD5D 1IGFL 4U1GB 3QO0A 4UBDC 5B4MC 3QSKB 2AP2A 3NOIA 4NOBA 5ICYA 1CGSH 5F9OL 3S96B 2IANE 1R5IA 1NCCH 3OJVC 5CP7B 5C2BH 1XR9B 4O4YL 3PWLA 1IGYA 2NX5B 5FKAA 4U1MB 4NQEA 4NJ9L 3TGXA 4MAYA 1AR2A 4S1SL 5T1KD 4MNGA 3VXRB 3UTSA 2NY1B 2ZJSH 5DA4A 2IANA 5FYJL 4HGMA 2M2DA 5DHYA 1YEGH 5HI4D 3JUZA 5EUOF 2ZJSL 4HSQA 2P8MA 1LEIA 3BDBA 1RJCA 3MOBL 2BSTB 1NDMA 4OD3H 4HMDA 4JB9H 1NCWL 2R4RH 2DTML 4NDMA 2J88H 3OR6A 2OS7A 1QR4A 3EYQC 1EEZB 2XG5A 4R0LB 3KPSD 4FQJH 2ZP0T 2HTLC 3HZVB 4OGXH 1A6VH 3VD4A 4X4MA 1K4CB 4JRYB 1FFQA 3B9AA 2G75B 1DFBL 1MJ8L 1PG7L 2HT3D 2BJML 4NYLB 1NFDE 4MQ7A 4PRHA 3ZLQC 1IEHA 1RZ8B 3CH1B 1MFDH 1KB5B 1TJHL 4ZSOB 2R0WL 2V2TA 3C08L 5KVDH 4NOFA 3PL6C 4Y0GA 3FQUB 1F2QA 4X80H 2ZUTA 4F7MA 1XAUA 2WBJD 1KCVH 4GG8A 4RQQB 4P57A 4P99A 1QR1B 2ERJB 4PJ9A 1EBAA 3PV6B 2A6IB 4M62H 1Q1JL 4HC1L 4F15B 4MXQD 1RZFL 4HUXB 1HQRB 3VXTB 1DQTA 3DX9B 5TDOA 3U79A 3UO1L 3N06B 2F74A 1CXEA 1YY8B 4JY5H 4QRTA 4HW6A 4RWYL 5I30L 4XHQA 3WIIL 5L2JA 2N1KA 3UTZA 1ORSB 1DQQB 2RFXA 1A4KB 4GG6A 1SY6L 1DBKL 5TE4H 1JNHA 1ZA6B 2VQ1A 2RAMA 1KGCD 3G6JB 5KSAD 3N1QC 2Z8SA 1TJGH 3ULUE 1EHLH 4JRYA 1AJ7H 1ED3A 1U95A 4DN3H 2C9AA 4LSTL 1JZ6A 3IDJB 2MFNA 3GJFK 4HIIB 2XNAB 3ROOA 2GW5A 2O5XH 2GCYB 3SGJA 1BJ1H 3U4AA 3NA4A 4RISH 3G9AB 1MREH 3V9FA 1T7XA 5CZVL 4NNPH 4NZTH 3ARDA 4LU5L 4NN6C 4UQ2B 1ZT1A 4D9QD 4R4NC 4KXZI 3WLWD 4HGKC 5EU5A 5ID0B 3DTXA 4UOJA 5FV2A 1VGKA 3IDNA 4P9HL 4IM8A 1BECA 3B8YA 1KLGB 1KACB 3NFSH 2MTPA 3MLTA 1N59B 2V17H 4YHYC 3QPXL 2HT4D 4JZJA 1KN4L 1NC4A 1YEIH 1NMBH 3QXAA 2WNGA 2D31A 2AEPL 3D39B 3VFVA 5C0CE 4NWUL 4YBHA 3DX7B 3SKNA 4PB9H 2X4TB 5KS9F 2B1AH 4D94A 4XPTH 3T4AA 5SWZA 5EOQL 2VZVA 2YUWA 3WNLA 1I8MA 1XGPA 4H20H 4ZUUA 5DGRA 3PJSA 4M43L 3HE7A 3OHXA 5EU4A 5CLWA 4HUNB 5HY9B 4MAUH 3CFKA 1UWEH 4WNQA 3MYZA 2R2BB 1Q94B 5B39B 4ZNCD 2P7TB 1N5AB 5JIHA 1J0YA 4Y4HD 5HI5C 1QOKA 3C8DA 1Q9LA 3EYFA 1U41A 2BSSA 4Y4HB 1BIHA 4NUGH 1ETZB 1ZLWK 3S36X 5EIVA 3IKKA 3JV6B 3QUYD 4NKOB 3NZ8B 1U92A 1C5CH 3H7BB 1CLZL 3FO2A 3QUYB 3FQNB 4UT9H 5T1DL 1IM9A 4TPRL 3T77B 2P24B 3CD4A 1H3XA 4ZXBA 2Y72A 3HG1E 3VFWB 5EWIL 3NA9L 3CK0H 2AJ3A 4HG4J 1MCOL 5F7MC 2W0LA 1U3HD 4LF3A 4PJEF 4XWGH 1ES0B 4XNXH 3KPOB 1ZS8A 3QR2A 5GS2H 5IWLC 4RBPH 2AQ1A 4R6UA 4EXKA 5F1OB 2EZ0D 5DC0A 5C0RH 5DSCB 1CBVL 15C8H 4ZTOL 4WV1C 5I1CH 1JTTA 1IAOA 5C0AE 4XNUL 4YXKL 3JV0A 3HMXH 1UQSB 1MVUB 1W0WB 2WLZA 1XCQA 1AD0A 2CDEA 5A2JH 1KTDB 1MLBB 2X4TA 1WWWX 1EGJH 5FYKH 1DBML 4ONGH 5FYKE 3JTTA 4TUOA 4I13B 1CDHA 1A9EB 3IFPB 4X0KB 4D2NA 4NKMA 3PHQB 2OI9B 1HIML 2DL9A 2EXYC 4GG6F 1UCBH 3LN4B 4OTXH 1P5VA 4PJ9D 3P3YA 4BSWA 2HT2C 3TZVA 3QFDB 1Z0NA 1TDQA 1T4KA 1R24B 3DV6A 5GRZA 3MLUL 4YAQA 1OHQA 1MF2L 3C5SB 2NYYC 3VW3L 3L3OB 5C70A