3LTVA

Mouse-human sod1 chimera
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
153
structure length
153
Chain Sequence
AMKAVCVLKGDGPVQGTIHFEQKASGEPVVLSGQITGLTEGQHGFHVHQYGDNTQGCTSAGPHFNPHSKKHGGPADEERHVGDLGNVTADKDGVADVSIEDSVISLSGDHCIIGRTLVVHEKADDLGKGGNEESTKTGNAGSRLACGVIGIAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superoxide dismutase [Cu-Zn],Superoxide dismutase [Cu-Zn]
publication title Structures of mouse SOD1 and human/mouse SOD1 chimeras.
pubmed doi rcsb
source organism Mus musculus
molecule tags Oxidoreductase
total genus 41
structure length 153
sequence length 153
chains with identical sequence B, C, D, E, F
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2010-02-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 3ltvA00
3H2PA 2JLPA 1SXBA 2WZ5A 1JCVA 1F18A 2AQSA 3HFFA 3F7LA 1YAIA 2GBUA 3HOGA 3KM2A 1MFMA 2WYZA 1P1VA 2GBTA 1RK7A 1SXSA 1XTLA 1OZUA 3MKGA 3KBFA 1SPDA 2E47A 1EQWA 1COBA 3PU7A 1PTZA 2Z7ZA 1L3NA 2JCWA 2WZ6A 4A7TA 1E9PB 1OAJA 2Q2LA 4N3UA 4OH2A 2V0AA 1SXCA 1F1AA 2APSA 3K91A 2E46A 4MCMA 1SOSA 4A7VA 3CE1A 1ESOA 1E9OB 3KM1A 1HL4A 1IBHA 1JK9A 1N18A 2Z7UA 4MCNA 1IBBA 3GTVA 2WKOA 3QQDA 1SRDA 2AEOA 4BCZA 2AQPA 1HL5A 1JK9B 3HW7A 2AQNA 2C9VA 2VR7A 4A7UA 1F1DA 3H2QA 2WZ0A 1E9QA 1FUNA 5KBMA 3GQFA 3CQPA 4BCYA 1F1GA 1N19A 3LTVA 4A7GA 1U3NA 2XJKA 1CBJA 1KMGA 2ZOWA 5KBKA 3GZOA 3F7KA 3T5WA 2WKOF 1OEZW 1SXNA 1S4IA 2AQQA 1UXMA 1DSWA 2LU5A 1B4TA 2K4WA 1CB4A 4L05A 1EJ8A 2AQRA 2Z7YA 2WWNA 1QUPA 3RE0A 1OALA 1Z9NA 2NNXA 3L9EA 3S0PA 1PU0A 2ZKXA 1BA9A 1IB5A 3L9YA 4OJAA 1TO5A 4A7GF 2C9SA 4FF9A 1XTMA 1SXZA 2AQTA 3QQDB 4B3EA 4A7SA 1AZVA 4U4IA 2R27A 3ECVA 3KH4A 3GZPA 3GZQA 3KH3A 4BD4A 2AF2A 2ZKYA 1E9QB 1Q0EA 1B4LA 1SXAA 1DO5A 3ECUA 3MNDA 1TO4A 4A7QA 3KBEA 1E9PA 2VR6A 5KBLA 1BZOA 1XSOA 3CQQA 1Z9PA 2GBVA 2C9UA 2WWOA 3GTTA 1YSOA 1IBDA 1UXLA 5CU9A 2VR8A 1OZTG 2XJLA 2ZKWA 1YAZA 1PZSA 1SDAB 1E9OA 2WYTA 2Z7WA 1SDYA 2SODB 1IBFA 4N3TA 3SODB 3ECWA
chains in the Genus database with same CATH superfamily
5H4YA 1V54B 1XGYL 1JYWA 3L8QA 3U25A 4AJYV 5D7EA 4AQZA 4P2RE 3OXRB 4X9BA 2FGWH 3L81A 4KRPD 4PS7A 1NTDA 3ZLQC 3ZE2B 3FFCE 5IEHA 2APVA 1QD0A 4FABL 1F4YL 1XR8B 3DPBA 4ZW5A 3AAZB 4NQEE 2DJUA 2BCKA 3EG9A 3EHBD 3F5WB 3QUXC 5CR1A 4Y16D 3CK0H 5E2WH 1DBJH 3II1A 2JKNA 3IGUA 1YEGH 3FT3B 2W0PA 2OXHA 4FGMA 4E9TA 1KJ3H 1E7VA 4W9CC 2MCG1 3DVIA 4O5LH 4YZFF 4ETQA 3CC5A 1K2DA 5BV7C 4FJYA 4P2OA 4C56E 3K2UH 1AO7E 5D7IA 5IMOB 1FSKC 3QRLA 5ITFB 5C08B 1RK0B 3CFIC 4IMLA 2JLLA 3NCBB 1KB5H 3TZVC 4B9GA 4G3YL 2GYSA 4AM0B 3VWJB 2VR7A 3L7EB 4JFDD 2WNKA 2Y06H 3H4HA 4BFKA 1U8MA 3VI3B 2VB5A 4UIKH 5E99L 1KBKA 1KCVH 3AQDA 5I24A 3ILPB 1A6TA 4XNAA 5H37H 2Q8AH 4WI5A 2XWDA 5GS0H 4LAQL 4Q9BA 5AQ0A 1RZKC 8PAZA 3OGCB 5J6GA 1MW0A 1NCBH 1KGCE 2BY3A 2DWDB 2N59A 2NTFB 3DUSB 3H6JA 3UYOD 3WBDA 5EOTB 4JPVH 4CNIA 4PBVC 2I32A 1BQHB 4KRLB 5IR1A 3C6EA 3WELA 2OR9H 2M83A 2OQJB 3LNFA 5F7NC 1SF3A 1JOIA 4P2QA 3V0DA 4LLDA 3BKCL 2R2HB 3B7RL 3GTNA 4ANUA 3LKPA 4UNUA 4MA1C 1NGQH 1MFEL 1PQZA 1TMCB 3WNJA 4JRYB 3G7TA 1XZ0B 1MCLA 2YGOA 1P6AB 1OT4A 5DJ2B 1B6UA 5AW1B 2QZ5A 1Z9MA 1Z32X 3ZT6A 1QO3A 3DHJA 4RFEB 3BQVA 2RGSA 3UTTD 2ETWA 1B0RA 1NANI 4FCHA 2J1YA 3SDCB 3ULVE 1Z9PA 3FOMA 3IDXL 5CEYB 4YS4A 1NCAL 2WB7A 5FO7A 1CC3A 3WKMH 3T08A 2CLVB 2H8PA 2NY1C 4RQQA 4DF9A 2WYTA 1P5VB 3L4CA 4ZQKA 3V6FA 1Q72L 4QRPB 4KXZH 4Z78B 1YEFL 4HWBH 3CVHH 5DO8A 4YHML 5A7BA 4MAYB 3MOQA 2YD0A 1FL3B 4R7DB 3PWUA 3CDZB 4BSVB 4YXLL 3FFDB 4NIYE 2W8CA 3INOA 1QLRA 3WLWD 2VDKB 5G4NA 5ID0B 5KSBE 2FEEL 5KBPA 2B20A 3N44F 4Z8FH 2E0PA 3KPLA 4TQIA 1NFIB 1TU2A 2RJMA 2EO7A 1BD2A 2J44A 4ZZKA 4TQ8A 3BH8B 4YIQA 1N0LA 1O5DT 2MQGA 1S9YA 1MG3C 2WVUA 4TSBL 4ICWA 4JQVC 3TCLA 2OKMA 3UOAB 1ZLVK 2HRLA 4UT9H 4F57L 5AVVB 1H3TA 1I8KA 1CF8L 4XX1E 3UTSA 1J9SA 4J8RA 3BCFA 2VL5B 3PPEA 3OVUB 2DLFL 4XCEB 1AQDB 1U3HD 3OKNA 1FVDB 4M4PA 3PHAA 4LCYA 4DOHE 5C0DA 2EC8A 5IK3A 2QADB 3VRLF 2YJLA 3ZT5A 3R7QA 2KLTA 4M48H 3A6CH 4GBXC 4Q6IA 4N24A 4QKTA 5K59F 2EVIA 3KLAB 1LO3H 5SWSB 3BP6B 3H8NA 5JPNC 3LRKA 1LK3L 4D0BA 3R8BB 1LEGA 1H3WM 3SIKA 1E8WA 1N70A 1XCTA 2XN9D 1KB3A 5KW9H 3CNKA 3W0WA 3AS2A 3GBNH 2WYHA 3QI9D 5GS1A 1MWAH 1HX0A 4K8RL 3RKPA 2VO5A 5E56A 2EZ0C 2YPKA 2HLAB 3TBTB 4EVNA 4Y5VA 1B88A 3MRGA 5EU6E 3BVNA 1HESA 1NAMH 1NCTA 3VCLA 1TZIB 1XB6A 4MGXA 4ZS7L 5F0JB 5INCA 4U05A 2NR6C 2OX5B 4L4VA 2HJKA 4AW7A 1PAMA 2GKIA 2H26A 3BGMB 2QKIB 2CK0L 3LKSA 1NLDL 1FFRA 3ECVA 3GZPA 3PNRB 3SE3C 4HKXB 1VPOL 1IKFH 1T89C 2DMKA 3W11C 4G9FD 4WWID 4Q4EA 4OJFH 2DIJA 4R7NB 3EXLA 3K6FA 1UG9A 4PTTB 5FK9B 1DDHB 1O7DC 4J2QA 2E8YA 3CFCL 4Z7VE 4AK2A 3OZKA 4KVNL 5EO1B 2IBBA 3L3KB 3QPQC 1LO0H 2W59A 1WFTA 1M9WA 4HD9A 4YDIH 5EZJB 4A63A 2AJYL 4NIKB 5ACZA 3HZYA 1FC1A 2ZUSA 5IHBA 1CBVH 4XHJD 5LG1A 3QDMA 1Z9SB 3EH5B 4OVUA 4RGND 5HDOA 1ZLWK 3TIEB 4XWOD 3L3IB 4ENEC 2E7DA 2FGWL 1KJ2B 3L9RB 4TNEA 2PPEA 1E8YA 1AIZA 4MNHA 1EO5A 5FDWB 3E9UA 4NQXA 2L4OA 4KXCA 2SEBB 1VFBB 3QIBB 4ONFH 1VRSA 2AANA 4RMUA 5E2WL 2Y7QA 1HHIA 4GP4B 1R5WA 4NP4L 3NFNB 3H9HA 5B21A 1JZ3A 3BPLC 4O5LL 1MHHA 4KKCC 3LHPH 3IPBA 3SJVD 2F54D 3CHRA 5C92A 5IFJB 2EDOA 3KL5A 5EULV 3L4UA 2HKHL 4MCMA 1QTPA 1YQVL 4OFIA 4F15B 3AU0A 3FS9A 4P3CH 5HHXL 1RZPA 4NX0A 3KPTA 2ZT9C 4CMHB 1XF5A 5BVJA 1FFTB 1O9VA 2E6QA 1RURL 5DJCB 4YUEH 2DYPB 1X44A 3R0NA 1J9RA 4I48A 2NY0C 2L7JA 2XYCA 3WFBH 2Y06L 3N50A 4KNUA 1EANA 2MCAA 3WLBB 2VM9A 3SBWC 5KANI 4B27A 1FZKB 2WLJA 1KCVL 1PX8A 4XC1H 5J3HC 1IC0A 3FT0A 5L8LB 4UZUA 2DQGL 2CKBA 2Q5BA 4LRIA 4HWEH 3LV3B 3BISA 4AKOA 3FO9B 4UQ3A 2BRRL 4ALAH 3CFMA 3PIQA 5FDYA 1YY8A 4ZMWA 1TJGL 4I89A 3S35L 4OBSA 1BX2A 2VSDA 2EEXA 2ZOUA 4QO1A 3TNMB 1IFHL 4JPVL 1RSFA 3G5YA 2IPKB 4HIIA 1XZWA 4ZG1A 1NCJA 1XIWB 5C0JB 4TQPA 2IOIA 2K3HA 2QQNH 4JO2H 4AH2B 4XP6H 4B3EA 2A6DA 2R23B 3V0HA 2EIZA 5HYQA 3MTXA 2Q6WB 3C5SB 4PRBB 1SMOA 3O2DH 4G70B 4HPHA 4NZDA 3Q2VA 5B1KA 2IH3B 2G2RB 4GRMA 5EO0B 4ZO6A 3ARFA 2HMID 3ARXA 1Z2KA 2EDBA 2YC1A 2YUVA 3D85A 4KOBA 3IGLA 3FQNA 4LVNC 3BP7A 4LOEA 3ZKXC 4ZFFA 2H0EA 3SDYH 3AT0A 2ROXA 3WKML 5IF0A 1LM8V 1QEWA 3V9FA 5EIIA 4IIQA 4ZO9A 4F3FB 2PABA 2V7HA 3VXUD 4M7LH 1FE8H 4JO1L 3AUVA 4QRTA 4PCTA 5LXVA 5DGQA 4MJIA 5D72H 2R1WA 4LMQI 3LZPA 1KFAH 1XF2B 3V4UH 2GJ6E 4G7VH 5F71A 4WUUE 5FYKU 3MSPA 3HR6A 3RNKB 3B8SA 2IH1B 1LE5B 3T3ME 5IMMB 2PW2B 3FO0H 1G1KA 1J1PL 3GLEA 5K9QG 4PP1C 1A14L 3LRGA 4UAOB 3C9NB 3IMSA 3V0FA 3MRHB 4UT9L 3CX5J 4WCYH 5BMFH 4WHYH 5CSZB 4HP5A 5HHOD 3TEYA 2ICEA 3DVNB 2FT6A 3CSTA 3GGWB 3ZBMA 3W5NA 9PCYA 1I3GH 4PRPB 2UX7A 4P2CG 1DTUA 4ZUWB 1BZ7B 2WB1A 3A0OA 4XOCA 3FH5A 1YJDH 4EUPB 1EVTC 3TOPA 3D39B 4WTWA 2LLLA 4HPYH 4GIAA 2G5UA 4LSUH 1HKLL 4NNXB 2G0KA 5FM5M 3PWVA 1KENH 4QF1A 4PJXE 3QZPA 3BXNB 1ITCA 5EPMB 1G94A 4PBDA 1MFNA 4NUJB 4PBWD 4U1LA 2DQDH 3BGFB 3EYSL 5HDLA 5C0AB 1AQHA 2VLRB 4KNQA 3PNWA 2V17L 2WD0A 1HSBA 1QKZH 3RY5A 3ARDB 4PP2B 4A1RA 5JQ6H 3IJYA 4GRWB 3FTVA 4X2UA 3RWCA 2BNUB 4WWKD 5DC0A 5FUCE 1TXKA 4DO4A 1LHZA 1NAML 5CLTA 1S9KC 1LWJA 5AWNL 1CTNA 1E40A 1WA1X 5H94B 1HIMH 4XH2A 4F9LC 5T1KD 4AKQA 3O4LA 5CJXA 3LS5H 4HK3J 1IIKA 3GIZH 3PQYB 5DD6A 1BLIA 4MYWB 2DD8L 1WH0A 4JFYB 5J1TC 5HYSB 3H9ZA 2YEQA 4ZODA 1DVZA 3C60A 1BMGA 4PQXA 2C3GA 4LHUD 2G9HB 1NMCB 4P4RA 3HE7A 4XOBA 5D1ZC 3DOHA 5TGBA 3P77A 2BIHA 4P2RD 3PDOA 5C0GA 1AGCB 4DN4H 1ADWA 2VDOL 3FFCD 4FEIA 1QR1A 3MZGB 1PCSA 1AMXA 4NQED 2Y69B 5SWZA 4FMKA 4YDIL 3DUUB 4A6YA 3ESMA 5J9PA 2XIDA 1PZSA 1CBVL 1M1XB 3REWB 3VD3A 1QRNE 3ZDZF 2VMCA 4OZ4A 4H1LA 4V1DB 4D0DA 4CKQA 5I75C 2PYEE 4P3WA 4FTVE 3QR2A 3OJDA 1EJOH 3NJMA 4C56D 4PIBA 3HI5H 1AO7D 4QRAA 3UG4A 2VUKA 3MRCB 1E5YA 1KN4L 3O45A 2J7LA 3INUL 5BO1H 1WFUA 5CLYA 3QO1B 2JCCA 3DX9B 2XG5A 2XFXA 5DHMC 3MLYH 1XO8A 3D3VB 4WJG3 1QSEB 2C9PA 5T1LD 4OCMC 4F7CB 4POZC 1J8SA 1RUMH 2OZNA 2E46A 2B3IA 3LHAA 1EEUA 1QI3A 2XTJE 4GB9A 4OLZL 1UYWL 1WBXA 1U36A 4HIEA 4HT1H 4I1RA 2BLFA 5F7DA 3FSVA 1U91B 4ANKA 2AQ1A 5HI3C 2BOBA 4S10A 3WFBL 2X38A 4JPIB 3LXBA 1KGCD 1G6RB 3BZFA 2XSKA 4ABUA 3TYGH 1MRCH 1XGTA 2RB8A 3FTGB 3HC3L 5CP3A 5ABAA 1VA9A 5BS0E 4G6KL 2YAHA 5HDBB 5DDHB 3BKML 1JNJA 4HWEL 4Q58C 3RWIA 3SO3C 2CA4A 1LJMA 4ALAL 3GI8H 5DYFA 2UZXB 1N64H 2LLGA 2Y1AA 1P4BH 4XXCA 4KPHH 2CK2A 4U1MB 4ELMB 1JNHB 2UUDH 2WLIA 3EO9L 2XN9A 4UNTA 1T4WA 1PKOA 3Q2LA 3QI9A 4B6ZA 2GW5A 4WUKH 4QRQB 4LRIC 3S96A 5JIPA 5IEKA 5KSUA 3VDCA 4JO2L 1M4KA 1TZGH 4XP6L 3VFVB 4HKJA 3ULVD 5I1JH 3ARTA 4JGMA 1WV7T 3SDAB 3KPOA 3U1PA 2PPFA 3QQ9C 1IQWH 1P4UA 3M46A 3EO1B 4F8QA 1TQUA 2YJQA 4K3EH 4NZRH 5IJBC 4I3GA 5D6DA 5EBMA 1ZV2A 2JELH 2XLLA 1FAIH 2OL3H 3P3SA 3VXME 4FFYA 4JPKH 2K78A 3ZRCC 2W9EL 4XODA 2V2TA 2ZCKL 2ICWB 3SDYL 1DN0B 4RGMB 1CXHA 5ABZA 3NIDE 1F02I 3P9MA 3UJIL 3FT4A 2W07B 4ENZA 4PJEE 3KPQA 1OY3B 5K69A 2RAMA 2HKFL 5E1HB 3V55A 1OP5K 3QWOB 2EO9A 1R47A 4HFUH 3M1CA 2QPUA 4F7PB 4N3TA 2FWOA 3N40P 1HSAA 5ALCH 4C4UA 1G0DA 2LFGA 2DLEA 1L0PA 2OMWA 4IIQC 1KFAL 2HFGH 2E9GA 5JORB 3QB7C 2MHAA 2VRQA 4LPUA 1USQA 3H7BA 1VIWA 1KCUL 1M53A 2AXWA 4LT7A 1ZANH 1KYDA 5I74B 1SXSA 3LEXB 3VYPA 1HEJC 4GMTL 1Y0LA 3FCTB 2GJZB 3FO0L 4GO9A 1YDPB 2R0LL 4NCDA 3RZCA 1QFWI 3D8MA 3GMLA 4GKLA 3T6XA 1T83C 1Q0YH 2IIJA 2F7QA 3FQRA 3SGJA 4OH2A 1S7UB 1BP3B 4WCYL 2VO8A 5BMFL 3OD3A 4KRPC 4G82A 4PJHB 3SGEH 3SJVA 2CRYA 2F54A 3ABMB 1UT1A 4F8PA 1ZS2A 4GAGH 4PJ7F 3NDYE 5I1IH 3ARZA 1AACA 3EHBC 4UT7H 4Y16C 5EOQL 1I3GL 1IBHA 3GUFA 4UIMA 1RPUA 4PJ7A 4POUB 5AW6B 1YJDL 2ZQKA 2VCOA 4HPYL 4IHBA 4LSUL 4N2AA 2AXFB 1K4CA 4YL9A 3WE1A 5T1MB 4JBSA 5EU6D 2WCPA 3JWOH 4X5WB 3FW6A 5GRXG 5KBMA 4DTGL 2VZTA 2P5EB 2VXSH 1J8KA 1D6VL 4KRNA 2ADFL 5AKSA 1QKZL 3GM0A 2D7TL 1IL1B 1G43A 4MD0A 3LN4B 4PV8B 4ACTA 3SPHA 1W8EA 5JQ6L 2ZXWB 5F96H 1KXVA 3MR9B 4MQ7A 3BH4A 1JZ7A 5IG7A 1TQVA 2R69H 2HA1A 4K5MA 5DD1H 5GGSY 4HBQA 3ARGA 1HIML 4FEMA 3HC0A 1PG7L 2P8MB 3S0PA 4JM2D 2BS71 3LQAH 1EHXA 5F89A 3TVMD 5EF3A 2Y36H 1QW8A 2A6JB 2IEPA 4OD3L 4OZFG 5FV1L 1D9KD 1MCFA 3K1DA 1T20B 4GO8A 4WTXA 2AJZA 2V7NB 3F00A 5F7EH 3WIHA 1AD0A 3KH3A 4KV5E 5CJXC 2V5SA 1KJVB 3GM8A 2X3CA 3NACH 1DQJB 2E56A 2FECL 4NO2B 2VL4A 5CBAA 1ZD6A 3P11H 1Q9KB 1N8OE 4JCLA 2NQDA 3B8YA 3ESOA 1VGKA 2P7TB 2IGTA 3GSXB 4NN5C 4WAFA 3JVGA 2ENPA 3GRWA 4Z7OF 1Z5HA 4O02H 1GR7A 3U30B 3WTUA 4XPAH 3KG5A 4PGDA 3P0YH 1GSMA 1ZE3H 2FZ3A 5AKVA 4LARH 2OTUB 5HGBA 3ZJAA 4GUCA 1FC2D 3MGAA 1QBMH 4XXWA 2OTWB 1Q1JH 4X6DA 1JGEA 5AB1A 2VLLA 4TPRH 5B39A 4GAJL 2VERA 1EJOL 2FBRA 3MNWB 1AQKL 1JFQH 2DQTH 3MA9L 4OIBA 3P02A 1CVSC 3V6OC 2J73A 3NSYA 2Z92A 1ZLEA 1ORQB 1WC7A 1UB6A 4I1PA 3G9AB 1BVLB 5HYJB 1H3VA 3RUGB 3WO3B 3NYKA 2LTQB 3SE8H 1MH5A 2HVJB 2X2HA 3MBED 4B96A 4PI2A 5EC1B 4LEXL 5HI4D 2CJTA 4Q56A 4Y5XA 5B7EA 5HYIA 2J20A 1W0VB 2CQVA 5EEZA 3BD3A 5E6SB 1XR9A 1C7TA 3MXVH 4AOFA 5HHOA 4JDTH 2O6PA 4OB5H 4OD2B 4QWWD 2Q10A 5F9WB 2B1AH 1FGNL 5FGBA 1ZAGA 2EIMB 1F6LL 4M62H 1DZBA 3PAUA 2GTWA 1NBYA 4QNPF 2AFNA 3NAAL 3L3GA 5KN5A 4YJZL 5IOPB 4JKKA 4HJ0D 2XA3A 3MJ9A 4GYBA 2AQNA 4OKDA 5CP7A 1TDQA 2F1AA 3Q44A 4MDIB 3GUTA 1U3HC 2ZSVB 3GI8L 2KBGA 2P8PA 4MMXB 4QMEA 2EADA 1P4BL 2CR3A 4KPHL 3WHXB 4N8VG 4XZ4A 3QNYA 1EIBA 3MFFA 2PTTA 1G5AA 2CDEB 3MLXH 4GKZA 4GAFB 4K94H 4WWKA 2AQRA 2Y22A 4AYEC 1I7UA 1RU9H 3PWPA 5I1JL 2Z0UA 2NUTA 3QNZA 5B4MD 2C1OB 2H6UA 1GXEA 1WWCA 3QI9C 1UWXH 5I8EA 2AQTA 4N1EA 1T0MB 3CMGA 1GRWA 2MOQA 3WKYA 1HZHL 4K7FA 4K3EL 4NZRL 2W60B 3VFMA 1NGXB 4PRIE 4XPHH 4DGYH 3PV6B 3EYUH 1SJEA 4CUCA 3V2AR 2JELL 3S37X 1FAIL 2IANE 3SD5A 3N91A 2O5ZH 1NCOA 4BGDA 4JJ5B 4UOW1 1MELA 4G42A 1NIDA 5IB4B 5EUOA 5JOPE 3H1ZA 4HWZA 4LHUA 1N9PA 3C6SA 1N59B 4P2RA 4CILA 1FI8C 5C0RL 2GJ6D 4WUUD 1BFSA 4W6YB 1M7DB 3V95A 2R15A 3KYOB 5I6PA 5EH1A 3DETD 4KZ0A 5D7LE 3VFOB 4ZUUB 5JOEA 1DVFD 1ADQA 2FBJH 4HFUL 1QSFB 1HJBC 5ALCL 1I31A 2DIBA 4PW3A 1I1AD 1QUNA 1ZHBB 1FYTB 1G7PB 5C7XH 4FZEH 3EYVB 3CZEA 3V5HB 5GS2D 4XI5D 2AV1B 3T6WA 4C56A 2GFBB 2XTSA 4J1UA 4QKXB 5E9DB 1LXMA 4XHJC 5DT1L 5AVRB 1JPSH 2X09A 1JV5B 2P28B 4KBPA 4RGNC 1Q0YL 4XWOC 4JG1H 4NWTH 3T4AC 5MEQB 4XNBA 1CL7I 4L2LA 4XPBH 2BOCB 1NZRA 4XNDA 5ETUA 1RUQL 2I07B 3RPIA 5EN2A 3LKRA 4APQC 2YKLH 1SOSA 4UT7L 3F01A 2WO2B 3GSVB 5E8EB 2WGNB 3B9KB 5E6IA 1U4EA 4N22A 1UTDA 4X6CA 4B9JA 1A3LL 3HLAA 5JDJA 3VO0A 1QVOB 3WS3B 5FKPB 4NQCB 4WNQB 1NUGA 2VLRE 1M9SA 2IV8A 2UXVA 4J27A 4XE0A 1CD1A 4AGPA 5JR1H 3W56A 3T71A 4U6XA 3AREB 3QJXA 5ESQA 3QUYD 1S7RB 2DI9A 2VXSL 2X4TB 3MXWH 4JZJA 4ODXB 5JOFA 1VSCA 4AYFB 4FP8H 5KJRH 4I0PD 3HR5B 5ESVB 1KNOB 1OAUL 4NRXA 4U1KB 1DLFH 4MXVE 1S4IA 3B2UC 2R69L 3K4DA 2X7LB 3RNQA 1F3RB 3ZMNA 4MS6A 3ULVF 2J4WL 2PXYA 4KZCA 2G2PA 4ZNEE 3DMMA 2MTPA 3LVEA 1FZMB 2DM4A 2JKSA 4WI2A 1CDUA 5GHWL 2IDUA 3X1GA 2EDQA 1JXJA 3HS0B 2Q8BH 1KXVC 4JY5H 2Y36L 5AUMB 1MNUH 5BV7L 3KLLA 4A67A 1RHHA 3WG7B 5E08H 1DQIA 4OCXH 5I1CH 1HZLA 1G4MA 1RFDH 4LP5A 4RMWA 1QRND 1EPFA 3NACL 3RWGB 2CM6A 2PYED 3CLEH 2VAAB 2BC4A 4FTVD 1M42A 5KSBF 3SGKC 3EAKA 4JGJA 1J05A 2HWZH 1J9TA 4XVTH 3MJWA 4V1DE 4GMSL 5EWIL 3P0YL 5KSBA 2HMIC 4WSKA 3T0EA 3B7TA 4HKZA 1QBML 4PMEA 3BIKB 1BVZA 3ZUCA 5AOZA 4TPRL 1N7MH 5D4HA 3KL0A 1JFQL 2VISA 3JVGC 3QR1A 1DUYA 4R96A 3I02A 1RZKL 2DEYX 2O6CA 1D7BA 2Y3NA 2XTJD 5SX5K 2XWTA 1CDCA 1XH3A 3K8KA 2RIKA 1HCZA 2OBGA 3HZ3A 3KEHA 1PD6A 2WVVB 3QS3A 4ZXBB 5I71B 4PUBH 4KX7A 1OZUA 2WIMA 3HCVA 4TTDD 3MRQA 5TE7H 3C87A 3N6YA 5BVPL 3GS0A 1KULA 3MV8E 1JWMB 2JVUA 3K80A 1JZ8A 2ESVB 3GK8L 3K72A 4GG6B 4XPGH 3JUZA 2NDFA 3UROR 5BS0D 4QHLB 1WZ1H 2D2OA 4GW1B 3MDJA 4JDTL 1PYWB 3B2VH 2XWJB 2ZE0A 1FZJA 3MOBL 2Y1VA 1P84K 3O3EB 1JYXA 1XXFC 5IW1A 3VA2C 1UCBH 4R4BB 3DV4B 1AC6A 1WT5A 4BEIA 2M2DA 5E1IA 1P7QD 1RVFL 1UM6H 1JK9B 2VLKB 3FU0A 5FOBA 5FYJH 5EU6A 1AE6L 1J87A 1FNGA 2VKXA 3QXWA 2R2BA 1DHKA 1NUNB 2BW4A 1J10A 4ODWA 1WWWX 4BSJA 1QBAA 2E7LC 5C0CB 2DQIH 5JW3H 2ADGA 2V8LA 4ZOBA 2QTVA 3DO3A 2CE6A 3QJVB 4ZSOA 5CD3B 1I9JH 1T21B 2WNGA 4YH6A 1TR7A 4KJYA 1JK8A 3VXMD 4N9OB 4JM2F 1RU9L 2HT2D 3NSFA 1KZQA 1CVRA 4FYSA 4TVPL 4JFXB 2EDYA 1H0DB 3FTSA 3S7GA 4Z7VF 4PJGB 3EJRA 4BYHA 2OMYA 4Z0BL 3AY4A 1IT9H 2FHBA 1SOQA 5K1JA 3V6ZB 1UENA 3B9DA 3CQFA 4Z7VA 4PRHB 4WWKC 5I1DB 4XPHL 4DGYL 2QGCA 3D9AL 4NC2B 1C8QA 4B41A 1BFVH 2YZ1A 4MXWL 2XIIA 3EYOA 4L5FH 2E76C 5TFSH 1ZT4B 3BSZA 3SYCA 4H40A 1RZIB 4EIUA 1T1WB 5INDA 2WMPB 3M1BB 4TLSA 5DYOB 5EU7C 4ONHA 4NZTH 3BD5A 1KTLA 2VWEE 3KGRA 4LSQH 3CV5A 5CKAA 1MXGA 4HUXB 3FO1A 3FQUA 4IRJD 4XBPB 2LABA 3O2VH 2Q86B 1BF5A 1W6WA 2WOBA 1LL1A 2FX8L 3DJTA 1JHTB 3G6AB 4X7TA 4N9GA 1WQVT 1ZTXH 1E9OA 1G1OA 1MREH 4X42A 1W15A 1Q0XL 2E3VA 4FZEL 4YSDA 2APBA 2FLRT 5GISH 1K8DB 2YFNA 4G7QB 1TLKA 4PGJA 2CDFB 5MERB 3AS3A 1X5KA 3GPSA 4YO0B 1MFBH 3TLRA 3QGVA 1BVKB 1BOGA 5ICUA 2XWBB 3IMWA 4NSKB 3VFPA 4PV9B 4D94A 4XPBL 1WZMA 1GH7A 3EJSA 3BT0A 5JDSB 3MBEA 3BE1H 4KJPD 3IU3A 4M4RA 2B2XH 1HDMA 1S78D 2YKLL 4HK0A 4JCMA 4P23B 4TQHA 3BPCA 1LDSA 1KGYE 3REVB 4EN3B 3HEIB 3IAQA 4JDZA 4MJ6A 1DQLH 1QTSA 2H41A 5TK2A 1CDYA 3DWTA 5FR3A 3HPLB 1M7UA 3RJDA 2W88A 1N8ZB 2B0SL 1WIPA 4GXUM 4DSYA 3IGKA 2ARJB 5FM5O 3DK0A 2FIKB 4FLOA 5GRWA 4R2GD 4OGYH 3MRJA 1QI5A 3OHXA 3VGAB 1MCWM 3MV9B 1WAPA 4FP8L 1JJUA 5KJRL 1Z9LA 4HZAA 4RAVA 1JMZA 4EI6A 2D0GA 4X5XB 4X9YA 3CVCA 4G80B 5DVKA 2P5WE 2AMUA 1PY0A 3WO4C 3ZL4H 4HUVB 3BFOA 4FE9A 4XMLH 2D7NA 2XY2A 4FYTA 4FXGB 4RFNB 3F7RA 1J8HA 2J88L 3A4AA 4JZJC 2FTAA 5AYTA 3X12A 2X4PA 2PP9A 3GMMA 4Z95L 5DZJA 4M8QB 4Y0GA 5DD0H 1YNTB 5CNHA 2JI2A 4WHYG 4L1SA 4AITA 3QZWA 3D0AA 2BSCA 1MNUL 1AAJA 4H13C 1ZT7A 4Q2ZB 3N85H 4OV5B 3EFOB 3QULA 1XTMA 3X11A 1LEIA 3X1NA 2YD3A 4OCXL 4TULH 3CX2A 5ICYB 4DEWA 5L8JB 3RFZA 3F05A 3MCKA 1TVHA 4JQXA 4QRSA 5C09B 5DEFB 1ZLWH 3CLEL 4YVUA 2BSED 4LCVA 3D25A 4G7YH 1LMIA 2C26A 2HG5B 2HWZL 1FQ9C 4BFJA 4XVTL 3BO8B 1PSKH 1XEUA 3IGFA 1D5MA 2N4IA 3T3MF 3T8XA 4WSJA 2GJ6A 5LKNA 2FJGB 4WUUA 4K7PY 1NKOA 2AEQH 4L3EB 2YMXH 1N7ML 3MBWB 4MJ4A 5DMIL 3S48A 3SOBH 1DVFA 2Z4QA 2YA1A 4HYTB 3G5WA 3MJ7A 4QYOB 3QPXL 1YNKL 1RPQA 3KPSB 3IS0X 1IGFL 3ECWA 2V5MA 3IE4A 5D7KE 5KJ7E 1LEKB 5EFIB 4LSRL 1E5UI 2W0FB 3UO8B 4IGBB 4GKNA 2WZ5A 2CKBH 4JFOB 3TBWB 2Q3ZA 1HYRC 2XA8H 3U2JA 2P26A 5KS9A 3KGTA 3IETB 3MGTA 3PHOB 3PWJA 1R1CA 2X9XA 3H4FA 4U3SB 2FSEA 5IB2A 3NQIA 3QEGH 1BXVA 1WG3A 1OE1A 1IVTA 3MGOA 2BCMA 4PJXF 1NAMB 5C9JA 5FO9B 4G6MH 4XPGL 2B14A 2HVBA 4PTUB 3MLTA 2MPVA 2R9HC 4JFQA 4H0LC 3U7YH 3O41A 2VNCA 4KGJA 4I18A 4PJXA 2BY0A 5D2NE 2VUOA 3B2VL 4F33B 1F0LA 1WTLA 1XH2A 3UX9B 5JHLA 4M56A 4PG9B 4XVUD 2EDRA 2OMTA 1GZPA 1URIA 4JN1H 2VZSA 4KTEH 43C9A 5CAYB 5TDOA 3ME0B 5HBBA 3SE4A 4NQTA 4TSAL 3U0PB 4PJ9D 3RRQA 3RWEA 1RY7B 3G3LA 2VDOB 2ZP9A 1A1OA 2VLME 2YAMA 1SJVA 1AFVH 4NKQB 5I8OL 1A2YB 5H35A 3S37L 3EF7A 4PJAE 4PCKA 3HFML 2F18A 1BAFH 4Z23A 1I9JL 4PRID 3EFDL 4R8WH 1EWHA 2IAND 1KPRB 3IBEA 2AQQA 4BA8A 4CC4A 4XRCB 5HHPA 5JOPD 1WFMA 2IDCA 3FCSB 1OCWH 4FQLH 4KUCD 3EADA 4LP8A 4BELD 5DJAA 4ESKA 1R3KB 3BH9B 3ZE0B 2QZQA 3LKQA 3K71B 1S7SB 3MLWH 3LMJH 3E8UL 4MD4B 3B34A 4ZAKC 3MLSH 2AJXH 3IEAA 4UTAA 5D7LD 3MUGB 5KVGE 3B3IB 3HAEA 4NRZB 5TFSL 4WJ5B 1OE2A 1U2HA 1VFUA 3OXRA 3AY4C 3RWDB 4JM2C 4NHCL 3IRPX 4X99B 3S4SG 2Y3AA 1BGXH 1T1ZB 1HH6B 2ZKMX 3T2PA 1L6XA 1XR8A 3AAZA 3TVMC 5FA3B 1IFRA 5I2IA 3ATEA 4LSQL 3RVXD 1D9KC 1MI5B 4LVHB 2VDRL 1CDJA 1A6VH 2UY6B 3HS9A 3MRDB 3FT3A 3X17A 3UPRA 5C0FB 3GF8A 3QDGB 1K72A 1ZTXL 1I3VA 3TN0B 1AYOA 2XX1A 1UB5B 1YAZA 1FLRL 2E27L 2BOLA 1V10A 4K9EH 3CVIH 2VW4A 5C08A 2F7RA 5ITFA 4JGNA 1RK0A 2BH0A 3B2DC 4M5YL 2OJEA 1MFBL 1W8OA 5T3ZH 4AM0A 2XXMB 3VWJA 2PTUA 3L7EA 3NIGE 4HUUB 1XV8A 4Y2DB 3VD2A 4DAGH 1M56B 2IAMD 3U4EA 5A3ID 4U0RC 3VI3A 5F7UA 2DTMH 4ELKB 2NXZB 3O9WD 2VLRD 3BP5B 1J5OH 4OZIE 2B2XL 2ZOTA 3WJJC 1XF4A 3VJ6A 1TYRA 2V0AA 5G5DA 2ADIB 3ARDD 5BS0A 4TRPH 1DQLL 1XL4A 2N01B 4HS8H 3OGCA 2B3RA 1C5CL 5BQDA 5IV2B 4HZLA 4EKJA 2XZCH 2DWDA 2WBXA 1G7LB 1H9VA 5EZIH 5AOMA 4E9WA 2CA3A 1PKQE 4PCSA 1TUPA 1BQHA 4CVWA 3JTTA 1Q90A 4OGYL 5LGYA 1P1ZA 1WE5A 4QWWC 1XGRA 3MUHL 5EOCJ 1YYLH 4QT5B 4RVBA 2J21A 5IVXB 2XN1A 5B1AB 1UM4H 3QORB 4UV4H 3ZL4L 3KW8A 4XMLL 5DJ2A 4YK4B 2ZXCA 2NW2B 5J4MA 3EYFB 1S9XA 4HJ0C 4XB7A 4A6YH 3DLQR 2ZOWA 2MRYA 3WIFB 4E5XG 3HHRB 1H6EA 4G8IB 3SDCA 5T5FL 3QUKB 4M8UA 4H1LH 1B4TA 1GVIA 3MCYA 4PVLA 3VXMA 4AV5A 1ZVHA 1JWUA 4AMWA 1BEYH 3NIDF 1EJ8A 4JHVA 2CLVA 4UTCA 4B9IA 4PJEF 4NO3B 1P5VA 3VQMA 4V1DD 3U9PH 4OJAA 4Z78A 4TULL 5IBUG 4BWTA 1RJLB 1QRKA 1VLXA 4PJEA 4Z76B 1FL3A 4R7DA 3EOAB 3NUKA 1A4JA 3CDZA 3FFDA 3PUUA 4N0UB 3ZGIA 3O8XB 4O4YL 4AGLA 2JFCA 4HAFA 4O9HH 1E30A 4B9PA 4HH9B 4HJIA 3OG6B 2OP4H 5JHAA 1NFIA 3SYOA 1USZA 4O2CA 1OD7A 4JQXC 1I1YB 3BH8A 4YSOA 2X2YA 4O2FB 5J5EA 2AEPL 5F97E 2C9UA 2A6IA 4H8HA 1XCWA 5GGRY 4IRJA 3EJQA 4Z7WE 3FQXB 2VDML 3SOBL 1T7WA 3VMPA 1CFNB 4XCEA 5DMGD 3MV8D 4JM4L 2MSPA 3DX8B 2ENQA 3BPNC 1AQDA 2ZOLA 1FVDA 4PJDB 4LLVB 5CP3H 2J72A 3TWCH 2XRAL 3IJSB 4NXKA 2CKBL 3AACA 3T2LA 2H7WA 2JK5B 3ZRSA 2OCJA 2BSDA 3DETC 3L5WB 1T2JA 1XF1A 1DVFC 2XETA 2ESVE 4A2LA 2BWDA 2EQDA 4X80L 3WS6C 4YHYC 2CUIA 1MN4A 4X5PA 1I1AC 2DN7A 5F3HB 3KLAA 4G6ML 5SWSA 3VXSB 2WQSA 1SF5A 1GA2A 1U8JA 3DIFB 4XI5C 2QJDA 3NSCA 5KAQF 1UWEL 3A4FA 1OAKL 5HGAB 2EE3A 1NWOA 4O00A 4YPGB 4YWGH 3V8CA 4AQ1A 2A3TA 4YVNA 1SFDA 1CLYH 1MUJB 4I88A 5C3TA 5I23A 3FU5A 4HKBB 5ICXB 4EO5A 4PG2A 3OKMB 1OV8A 4JRXE 4X98A 1ASOA 1N10A 1GKEA 4JN1L 4KTEL 3QEUA 1XCQB 3MX0B 1TZIA 4L8SB 1ZPUA 5MENB 1TTAA 3TF7C 1R24A 2WLKA 4FFYH 2C7UA 2QKIA 1QFUH 3H42L 3HW7A 3BKYL 2W81C 3D2UD 3ZKQD 1SOXA 2BPBA 3DX1A 2YIHA 1T0NA 3CZGA 3SE4C 2GK2A 3O3DB 2NZ1A 4KV5F 4R8WL 3MV11 4ELDA 5G4MA 5FUCC 3WTYA 2CCVA 3RI5K 3OR7B 4LGPB 4PTTA 1GYVA 1AGDA 1T6WA 5FK9A 4Z7NB 1JBJA 3QUYC 2DWYA 5HP5A 2DM2A 4HJTA 5IY5B 2R8SH 4FQQB 3V4LA 4F1ZA 1OCWL 2V37A 2CHDA 2XBDA 1UC6A 2JB5H 4XGZB 3O4OC 2DAVA 4I0PC 4XO9A 3L3KA 5D2LB 5EO1A 1NLBH 3GT6A 3SBRA 3M88A 2YSSB 5HJGA 3VYNA 4XCCH 3RBSA 1PZ5A 4I85A 3WGUB 5EF1A 4WDIB 3LD8B 3SKNB 1ZHKA 4RIRA 3W37A 3HTLX 5CGBA 1SXZA 1OP5H 1Z9SA 3F12B 3U82B 3CBJB 3D48R 3L3IA 2JKIS 2Y5QA 4Z5RB 1KJ2A 1VZGA 3L9RA 3VGDA 4P49A 4XOAA 2NXYB 2PCYA 5FDWA 5DVNA 2CBMA 2SEBA 1VFBA 2AF2A 3LNIA 3BPOB 3QIBA 4GY4A 2BSEA 5AVWB 3NJGA 1SUHA 3WTXA 2XZQL 3UGXA 1MDAA 2C4FU 3MNVB 3NFNA 1SEBB 1MHEB 1KEML 4AIZB 2GBVA 4MA7H 2FE0A 2M26A 1P84J 3AG4B 5D96B 2OZ4A 2AS5M 1K3ZA 4X4ZA 3L3OB 1QG3A 3Q5TA 4MB3A 2H1XA 3SGDI 1A02N 2B16A 4XP4H 1AOZA 3I9GL 2FQEA 3WL9B 3FU8A 5IMLA 5DJCA 3CSFA 1HVXA 1ZLUK 3N1GC 2XNAB 4IQHA 4WU5B 1PW3A 4TMPA 3IFOB 4MWFA 3FBKA 2WQXA 4YGAB 1VEPA 5GSVB 3WLBA 3AY2A 1JPEA 2DTML 1FZKA 4HUWB 3QJHB 5F7WC 2XTJC 3B5GA 1WGVA 2ZXQA 1FIEA 1A4BA 2CWRA 3LV3A 3FO9A 4X83A 3QJUB 4PEEA 1ZOXA 4EIBA 1ORSA 4CADB 3CVDA 3WFCH 4XHQA 3QRGL 3WN5B 1EEYA 3JYBA 3MLUH 2IDFA 2P5WD 4R7VA 1I53A 5DRWA 3TNMA 4KKPA 2IPKA 1GC1C 1XIWA 1TYEB 3ZTNL 3IAGC 1UD4A 4NBZB 2O61B 3Q7JA 2EEDA 2X2JA 5J6SA 4AH2A 2WSPA 3WIHH 2EH8H 3UDWC 3OKKB 1PLGL 3S34H 2FATH 2R23A 3C5ZC 4M6ML 4Y1AE 3NJFA 1YYLL 2Q6WA 3C5SA 1VGEH 1OGAE 3UACA 2I9LB 1GS8A 4UV4L 3TT3H 4AMKH 3M17B 2EE2A 3QJRB 5AKRA 5EO0A 1EAPB 2G2RA 4BUGA 4J4PD 4U1SB 4LVEA 1BLNB 1JXGA 3OLGA 3GRWH 2VN5A 3IBOA 4A6YL 1T1YB 1MPAL 3BQUB 4PRIA 5F7MC 4HU8A 5KG9B 1LO4L 4OZHB 4LPCA 3ARRA 4KUCF 4HJUA 2IANA 4C54A 4BWWA 3FQWB 4TLUA 5ENWB 1QTYT 2BP8B 4DH2A 4H0GA 3FBQA 3IDIB 1NGWB 3S2CA 4DKEH 1YUKB 4F3FA 3UTOA 4LSVH 5EF0A 4EI5D 3UAAA 2AEWA 3ABZA 2VMDA 2X9YA 2DH3A 1NIEA 2HT2C 5I17A 1YYMH 2DQEL 1XXDC 1LD9B 1NCCH 4IOIB 4O9HL 5AENA 1JPFA 2Y7OA 4LCWE 1ND0A 1TZOA 1XF2A 1JXDA 1OSPH 1U21A 4JREB 1MJJA 2OP4L 2CIKB 4Y4KD 5D7KD 3CFQA 2YPLB 2IH1A 2WXQA 3D1MC 1LE5A 2PW2A 4IK6A 3WV0A 2VQ4A 3GD1C 5ANMB 3C9NA 2ZNXA 3U4BL 3MRHA 4ZS6C 1E5ZA 4RMQA 2ERJC 3JV5A 2HVKB 2FWLB 4OLWH 5D5MB 4YSUA 2D4DA 1M7IB 2XXCB 3QDJB 4IDJH 3ENEA 4NM4H 4P06A 1AOHA 4XNUH 4M6NH 3MJ9H 3SDDD 3WJLA 4IRJC 1XB3A 1R3JB 1SDDA 4YHNB 4ZUWA 1BZ7A 1OIOA 3VWKC 35C8H 4GAAA 4JR9H 1KF9B 1WICA 4XVJH 3NJKA 3PFUA 1BBJA 3NJVA 4NNXA 1VESA 1PVHA 3RFRA 2WXKA 2IADA 3D30A 5HHNA 3BXNA 5EPMA 2VLJE 5DJDB 3QUXB 1CK0H 3W2DH 2IALB 1C8PA 2VLRA 1OM3L 2VLMD 4K5NA 2WUBH 4PD4K 5BV7B 4KOCA 3UCRA 3ARDA 4PP2A 1A7BA 2IGFH 4JFVA 2BNUA 1V3LA 1IM9D 1ROCA 3FT1A 4MXVF 4HETA 3UAEA 3OX8B 3DI2B 1FSKB 4HSAC 2NX5B 3DIVA 1T6BX 1ZJAA 4KJPC 4M9OA 4AQ1C 5IIEA 2NY7H 3FMGH 5H94A 1S78C 3Q01A 5EBLB 3TZVB 5CCJA 4FFYL 4PG2C 1SEQH 1QFUL 2CHWA 5E6UB 2AQPA 2EABA 4LE8A 5FGCB 3H85A 1IKOP 2ICES 3LIZA 4JFYA 4ZYKB 2XVBA 3NTCH 2ZP0T 3LDBC 3WY3A 5HYSA 1JD9A 1HHHB 5CU5A 3VQ1C 4UINL 1UACL 2AGJH 5AAMC 4Z77B 1DBKH 2QQQA 1EEZA 4YXHH 3E9TA 3UBXI 3H3KA 4R2GC 2Z1KA 2I25N 1ADQH 3K0YA 5EOCH 1KXTB 1AGCA 1NC4B 1NJ9B 3B7UX 1ZA6B 3SE6A 3BAEL 1H5BA 4L4TB 3WD5L 5AAWC 1NQBA 4WHTB 4NPJA 3COOA 3DUUA 5IM7B 3WJMB 5IWLA 1NSNH 1PDKB 2Z8VC 4U6YB 2WQ8A 4IU2B 1M1XA 1Y6MR 3EDEA 3IDNA 1JP5A 2X40A 4BZ1L 2X2IA 2WSKA 4V1DA 3V0IA 4A7GF 2IG2L 3DURB 1GZHC 1RJYB 3CFTA 4N0YL 2VYRE 3WKNA 4QOKE 4MA1B 1S8DA 1WDAA 2YEVB 1IBYA 1ZEAH 3MRCA 5EEVA 3FHEA 2XQBH 3CCHB 2VT0A 3RQ3A 3OKYA 1L6PA 3QO1A 4AQEA 3DX9A 2DZEA 4LIQH 2F61A 5LO7A 4M03A 3D3VA 3L1OH 3MRFA 4F7KA 4GJTB 4MA7L 1TTGA 4F7CA 3GO1H 4KTDH 3ARBD 4Q8BA 1N5AB 2FD6L 1A9BA 4PJCE 2ZIDA 4EIGB 2DKSA 2NY1B 2NRDA 2DJMA 1U30A 5I19H 4XP4L 1OGSA 1O9ZA 2F1BA 2PCFB 3MV8A 2BVPB 4B9CA 2DLHA 3NSDA 2F5AL 1WYJA 2CLZA 5K9JH 4NZFA 3H2PA 5TQ0H 4H2AA 4JPIA 4QRRB 2BP0B 5I0WA 3VI4B 5IQ7H 4K23L 4ZTOL 3O3AB 3FTGA 2GBUA 3KM2A 3AXLB 4HF5H 1OE3A 5DDHA 4A2FA 4RNRA 3MKGA 5T1DL 1RULH 2X70A 2UZXA 4DK6A 2AQ3A 4KMLB 4Q0XH 4K5LA 5I1KL 5IJCC 4IBWA 1NIFA 2BS9A 2UWEE 2DLTA 1AKJD 1NBVL 2KC0A 4FLQA 4P5RA 1CIUA 3MLUL 4ELMA 3FRPG 4JPQA 3ULVH 3SKJH 1N6QL 1TZ8A 1AGEA 2DTSA 4QRQA 4W9HC 1C5DB 1RMFH 4TL4A 3IMRA 3VFVA 1OB0A 5CFAA 1UOWA 4Y7OC 1N0XH 3S34L 2E86A 3AROA 4KK9D 1B4RA 3P2TA 3SDAA 1CGXA 3KXFB 4OUOA 4XVUC 1EK3A 4WENB 4AMKL 3TT3L 1RQ5A 2C34A 4GBXB 4X8JB 3U4AA 4FADA 4XCYB 1U33A 1F2XK 3S5YA 3T65A 3CPLA 1EZVY 3D2UA 2HLEB 2OS7A 3RBGA 3A67H 1GHFH 1A21A 1HINL 5ITBH 5JPNB 2BFGA 1DJGA 3S3SA 3U9UB 1J0IA 1H3GA 4PJ9C 3GMNB 1V05A 4FYQA 1NOLA 1K5NB 3IFNH 4HXBH 3KWWA 1DN0A 4CVUA 3EOTH 1JGLH 4AXWB 1A8JH 1DYZA 3TBSA 4Z3EA 1KV3A 2W07A 3TYFB 5C0EB 3ARWA 3QJTB 4JPSA 1YEDB 4LSVL 4I0KA 3VH8A 4B50A 3CFDA 3MLVL 3QWOA 2J6EL 3TGXA 2DW5A 4F7PA 2YD9A 4NP9A 2W9DL 1GS6X 1YYML 3FYEB 3QQDB 4MA3A 4LNVA 5FO8B 4UM9B 4QXTB 4F8TA 5JORA 5KSVB 2EE9A 1OSPL 3U46A 3KL3A 4K8RD 4NC0B 4AW4A 3SQRA 3LEXA 5JW4M 1DE4B 4DK5A 3FCTA 5C2BL 2GJZA 1PBYA 2NCMA 1VERA 1YDPA 4XB8A 4WU7A 1F86A 2AXGA 1KYUA 2ESVD 2JJWA 5KBLA 1S7UA 2XZZA 2EC9T 4OLWL 3QIUD 3OQ3B 3V10A 2C4FT 3FU9A 4LCIH 4JRLA 5D7SL 1I7RB 3RVXC 4CU6A 3BT2H 3ROOB 1JE6A 4LL9A 5E8OB 3QUZD 3R4DA 1E67A 2QVIA 4OF7A 5HGHB 3KJ6H 4MMZA 4WEBH 4J6RL 2WXGA 4JO3L 1Y07A 3O6KH 2R7EA 4ZPVA 3NA9H 1A6AB 2AXFA 2X42A 4JRXD 4MYPA 1OK0A 2WXPA 5T1MA 3FOLB 3UYPB 2HX8A 2F58H 4GXVL 3WJLC 1FN4B 5FYKH 3ULUE 3GHPA 2FVNA 4KC3B 4X5WA 3HG4A 1A6ZB 5I6LA 4FI6A 3BPLB 4HA1A 3I74A 3TV3H 4PV8A 3LN4A 4GSXA 2GJRA 5IEHB 5ISZB 1IIIA 1HWGB 4R0LC 3SKMB 5FECB 1DJZA 2IAMC 3EG9B 5A3IC 3DNKA 4AEHL 1FRGH 1CXKA 3O9WC 5DHYA 4A37A 3QS2A 2NY7L 1NFAA 2P8MA 2DQHL 1K2DB 4IKLA 4P2OB 5L9DL 2NY0B 2GBAA 3EH3B 3BSZH 3GKWL 1AGBB 3W9EB 2A6JA 2VM4A 4H88H 2HH0H 2AK4E 1T20A 2QVKA 3VSQA 3VXTB 2V7NA 5GJSH 2AGJL 1UQSB 4J4PA 4RMVA 1BCIA 4DP1X 1F1GA 2JTDA 5D2LE 1DQJA 3VUAA 4NO2A 3WE6A 3G9VA 1ADQL 5I1LB 3K5SA 1Q9KA 1U8MB 3F7YB 1HILB 4TTGA 2IBZX 2VJ8A 5FX3A 4XCFL 5DHXB 1A6TB 4K15A 3OMAB 4BINA 4L05A 2OTUA 1HCFX 3MV7B 3FL7A 2EDNA 4NKDA 3VNYA 1JZDC 2OTWA 2WWKT 3NSXA 1WD8A 3OB8A 1MRFH 2APXA 1H5BC 3NFSH 3C8DA 2I26N 4LASH 3P0VL 4KMQA 4CNIB 4M29A 3TBYB 3E6FA 4PHXA 5IR1B 1IAOA 1ZHNA 1MW2A 1ORQA 4XBGB 1PMYA 4B7LA 4Q7DA 2R1XA 4AC4A 5J89A 1BVLA 5HYJA 3MRKB 2WLZA 4DZBB 3L1OL 2QDWA 4BKTC 5DGRA 1BJMA 3DXAE 4LVNB 1QNZH 3ZKXB 4U1HA 1W0VA 4YDNA 1HNFA 2XN0A 3EGSB 3JBG7 4EN3D 2E75C 4LZKA 1B0RB 2D3VA 4A55A 2QHRH 1W8NA 4OD2A 5EIQA 5K9JL 3LH2H 3NCXA 5JXEC 5FO7B 3F7KA 3B43A 4U1GC 3Q0HA 2YD4A 2H8PB 4RQQB 3VFRA 5IHHA 1ET5A 4CKVX 3WTWA 4ZQKB 5IOPA 5DF0A 3V6FB 4ILDA 2H1LM 4JVPA 3D07A 4MDIA 4N2DA 3BN9D 2R51A 4AENB 1RULL 3SYAA 1R3HB 1GAFH 3PWUB 3QXAB 5DQ9B 5IROD 4Y1AD 1NGZA 1BQSA 4FQIH 3WHXA 3ARQA 2CJ3A 1OGAD 4PJAF 5SV3A 3NIFE 3CFJB 1MJ8H 1V3MA 1ZT1A 1MCOH 1RMFL 3Q6GL 1TU2B 3W57A 3WFDL 2CDEA 1BD2B 2EYTA 5A2CA 5D70L 4YIQB 1IM9A 2D7OA 2BNRE 3N44B 3TCLB 4F7EB 1N0XL 1S2EA 4L9DA 1TFHA 5M7QA 1QLFB 3NZUA 4EJ1C 1F2QA 1YQ2A 4L48A 3UTSB 4YDKL 1E4HA 5SWQB 2VDRB 4J5VA 4HJJH 4LLYB 4J3VA 2X3AA 1L5GA 5ITBL 4QY8B 3DHPA 3MO1A 5IK3B 1JAEA 2EUZA 4Z3GA 1IGTB 4JJ5A 4NFDA 3GQFA 1W6LA 1D5IH 1CGTA 1BZ8A 1HXYB 1NC2B 3APDA 3QFGA 4YSEA 4HJ1A 2V2XB 3EOTL 4LCWD 5JHMA 1E3XA 1IAKB 1XBRA 3CN4A 1IBGL 1M7DA 1XAUA 3VGFA 3PGCB 3OAZK 1FH2A 3KYOA 4NKMB 3B9VA 4ODTH 1CMOA 4HX1A 2BHYA 3VFOA 2F2HA 2XQ0A 2V9QA 3DV6A 1YA5A 4HH8A 1BPVA 2DRUA 1NMBL 1VACB 3R06B 5F70A 4IS6B 1ZHBA 5KUKA 1G7PA 3ZKSD 4EVNB 3P4LA 2AABH 5BOJA 2X44D 2YPLE 3TH4T 2AV1A 4YBQC 2XPZA 1AHWC 4BCXA 2GFBA 3WFEL 2TSBA 3EFFB 2HJKB 5E9DA 1D5XB 2H26B 3BIAX 1U8PA 2ZX6A 2VAJA 1PZ3A 3NIGF 4KU1A 5D1ZB 2HN7B 3S5LB 5JHLH 4LU5L 5MEQA 2J8UE 2BOCA 3RL1B 4EE2A 2I07A 5GRVL 5HXMA 1OARH 4I5BB 4OZIF 4LCIL 2VLJD 4FNQA 2BVQA 3PV7A 2X28A 4JFSA 4G7RB 3GIVB 3O6FD 3RURA 4H1LG 3VYOA 2X4RA 3GSVA 4OZIA 3OLIA 5E8EA 3B9KA 5I75B 4PGZA 1WPCA 1WEJH 5DVLA 3Q1SH 1F8TH 1ICTA 1UD5A 3U36B 2NT1A 1WBYB 3WS3A 5FKPA 3UXFA 4NQCA 3IWUA 4WNQA 4G8GE 5L88L 4JO5A 2KHAA 5EDXA 3QQ3B 4Y1TA 4KI5C 3L3HB 3AREA 4NRYB 1G87A 2XICA 1S7RA 3BWAB 4MMZC 4ODXA 2CHNA 2EDWA 1NFDE 4LDCA 4AYFA 1AXTH 4H8PA 3MUY1 3HR5A 4NQXB 1KNOA 3ZKMD 3AMKA 1S3KL 1UJ3C 4I77H 3F6IA 1CFQB 3HZMA 1F1AA 1QWHA 2G3NA 2Y7QB 5KVFE 2ILLA 2X7LA 3H9HB 2IBZY 4N2CA 4HCIA 1LP9E 1U2YA 1FZMA 4UTAH 4ZUTB 3HAEH 3BSZL 4FXKA 2MOVA 4KDVA 3VAEA 2CGYA 5E95B 5AUMA 4Q9RH 2PW1B 2HH0L 2MCPH 2KI6A 5JHDE 1XF5B 4CVZA 1CCZA 4K5OA 1Y1UA 3SO3B 3RWGA 2VDMB 3K3QA 1B90A 1UH2A 2NYKA 5B3JE 4L4TE 4U4BA 1U3YA 4NQDB 4QOKD 3HZVB 2CBOA 3DTXA 4OKVB 2UY7A 4QIRA 1KCSH 1S7VB 3CU7A 4UQDA 2CKBB 3SQOL 4UQ3B 4NN7C 1F4XH 2VXVH 1IE5A 2WVTA 1E6JL 3V5DB 5F1KC 3BIKA 5ID1B 4Z7WF 3QPKA 5DK2A 1MRFL 2FGZA 5F8RC 4KI1A 3G5YB 1I7ZA 4BXSV 2QFRA 1JRHI 1WHPA 1RAMA 2R0WH 4BXVA 4DW2H 4WI0A 4ZXBA 1A3ZA 2J1WA 4EI5C 4AYID 2EIZB 3D33A 1YECH 1KBGH 5GRJH 4PD4J 3TBBA 2Z31D 4JZOB 1KGUA 5A2LH 4A7QA 4GI6A 4GRMB 4QJ5B 1JWMA 2AITA 3L4VA 2ESVA 3K2MC 5TQ2H 1MVFA 4QHLA 5HHVH 4LQFL 5DQDH 1JTOA 4Y4KC 4GW1A 3UH8A 2XWJA 3LB6D 3MV01 4OGXH 4PJ6A 3LH2L 5J13B 1WISA 3O3EA 4P48A 1KLGB 2VZ1A 3QNXA 5CZXC 5EIIB 5B1CA 4IIQB 1HEZB 4R4BA 3DV4A 4XPFL 3U9WA 2R59A 5JIHA 2JLPA 1JDDA 2VLKA 2Y25A 5D1QE 2FLMA 3SDDC 3TTSA 4AGMA 3AGVA 5D2NC 2WYZA 2CHXA 4XMUA 4IOFD 3VX0A 4K0OA 5JIKA 5CEZH 1OAXH 4D3CH 2VXTH 3MJ8B 4D9LL 4KRPB 2OR7A 1MCOL 2Q2LA 3E38A 1SXCA 1T21A 2B59B 4JX0A 3OLDA 2NY3D 3KWXA 4M8VA 4DP8X 2D03L 3EHBB 4NS0A 2ENSA 1XGPB 4OT1H 4Y16B 3L17A 3SCMD 4N2GA 3NEEA 4JFXA 2CU9A 1MCPH 5JW5B 4PJGA 4LLWA 5GZNA 5HVGB 2A0LD 3NK4A 4MZ2A 1U8KB 3V6ZA 4NJAH 3T0BA 5I1DA 1SVCP 3NGBC 1UWYA 1E8ZA 4JKPH 1A0QH 1E4XI 1DFBH 3NVQA 1QBLH 1MDTA 4KH2A 4P5TD 2WXMA 4YFLI 3QG6A 3PHSA 2EP6A 3BDBA 4GSRA 1T1WA 2WMPA 3PWVB 3M1BA 5DYOA 4QF1B 3LKNB 4QRBA 4JFDB 5BRZE 2VZ3A 3FQYA 4ANWA 4KZDH 1DQDH 2J6WA 5IP4A 2AJUH 5AALA 4HUXA 5J6HA 3F58H 2Q86A 4UYPA 4NN6C 4N26A 5IGXH 1HSBB 5I1GH 3G6AA 2FO8A 4JFFE 4NKOB 5ECJE 1KPUB 2O6FA 5I76A 4F91B 3WMPA 4GT0A 2BK8A 4OBRA 1CD9B 4KAQH 5J06A 3LEVH 4P05A 5MERA 1KLFB 3BX7C 2B1OA 3QHZH 5CF3A 1BVKA 1JS4A 4NSKA 3DC0A 1SXAA 4HG4K 1VADB 4NN5B 2RH0A 5DK0A 5JDSA 1OARL 4FHBD 3HN3A 5T8IA 5D7JD 2ICWI 2Z93B 3ULUD 4LP4A 4P23A 2YZ8A 2BVEA 4G6AD 4AX3A 5TGBB 4EN3A 3P77B 3TWYA 2EILB 5MHSE 3AT8A 3UTTB 5B39G 4UQ2A 1XDTT 5LUMA 3Q3GB 3DVFA 1OCZB 3D6GA 2ZWKA 5GGVY 2QPSA 1G9NH 2ICWJ 2W1NA 1JZ5A 1MFCH 3ARBC 4A6YB 5C6TL 2E6PA 5J9PB 3VG0L 5CGMA 1MFDH 4NYLB 4TNWF 2ARJA 2V4LA 2W92A 1L9QA 5FUOH 4HOWA 3JV0A 4R3SA 4OZ4B 2X4OB 4EZMA 3MV9A 2O1AA 3ZXAC 3RVUD 4X5XA 4DO6A 4PWJA 1K8IA 4G80A 4CU8A 1A1MA 5IROA 3L5XH 4JFUA 3O45B 3IFPA 4Y1AA 5FFOA 2AK4D 1RZ8B 4NUMA 3FF8A 3K1KC 4PJFE 4FXGA 5EEUA 5M94B 1X5FA 1MNNA 3CAFA 3LKOB 5DUPH 1IKNC 4X5LA 5AW3B 1H9DA 3GNML 4M8QA 1YNTA 2YK1H 5E2TL 2WVSA 4XMPL 3OKDA 5FYLE 7FABL 5ALBL 1HL4A 4ODSH 5DLLA 1FF5A 1XH1A 1J11A 1WBXB 4OV5A 3BESR 3EFOA 2YWZA 2ATKB 4NM8H 1MQ8A 1ZDSA 1U3HB 1KTDB 4Y19E 3ESPA 1E5AA 1NPUA 5E2VH 5F7YC 5F1OB 3X13B 5DEFA 2O5XH 1DJSA 2LOEA 3ULAB 4TNVK 4KK9C 2XQYK 3CQPA 2PUQT 1CWVA 2OZ4H 3FONB 2HG5A 4K2UL 1XGTB 5TE4H 2N7BA 4LOVA 5EEYA 3BO8A 1NGPH 2VITA 3FQ2A 2BWIA 3RVTD 2X87A 1WJ3A 4NQUA 2VXVL 2FJGA 3FUDA 4RH4A 4CU7A 4WW2F 3BVDB 2Y07L 2DICA 4L3EA 3VGEA 4DPRA 4OY9A 4QHPA 4F5CE 5K1NA 3MBWA 1AQ8A 3F84A 1CFVL 5C0BE 4AIXA 4X9HA 1D5ZB 2WLIB 2XN9B 3CHSA 1YEKH 3DHUA 3DXAD 3GXPA 3PL6D 7PCYA 3QI9B 4QYOA 3UAJA 4G71B 3HVNA 4WW2A 5FW6A 5AD0B 3ZZQA 3UL4A 3S96B 4DZ8A 2E7BA 3TT1H 1LEKA 2YRZA 1F90H 3FAWA 2W0FA 4IGBA 3F7VA 4JFOA 4QAMB 3KPPA 4Q52A 4BFOA 1ZLUH 3VACA 1GC1L 3DX7B 1WZAA 1A66A 4LHUG 4XXDA 1KBGL 5GRJL 4U3SA 1IGIL 3ZDYE 3ZKNC 4GP5B 2GVYA 2P8LB 4GAYB 4DT2A 4F9PA 5FO9A 4LVOC 3C2SA 3HB3D 2BDNH 4ODHH 5TQ2L 2TRHA 2R56H 2OSYA 3FJTA 5HHVL 5C8JA 4G9FB 5CR8A 2DL9A 2EXSA 4XAWH 4F33A 1QFWL 5TJWK 2VLJA 3FU3A 3HG0A 5EZOH 4RDQG 3O6FA 4RETB 3TV8A 3P9MB 2BO0A 1SDYA 4U7MA 2UXGA 3CFUA 3D18B 3QIUC 4JHWL 2EIKB 3ME0A 4MNGB 3RJOA 3NRQA 3TM6A 4AC2A 1U4FA 4MAUL 3U0PA 2BNRD 5BUAA 3CXDH 1BQLH 3AQZA 1F6FB 2G4GA 3KGUA 4APXB 1HSAB 3QUZC 1KGJA 1QLEL 4RGNB 3DYOA 1NCNA 2DQJH 1W80A 1A2YA 1ASPA 3T4AB 3L5IA 3RDTD 1FBIL 3H7BB 1CYWA 1OSEA 3MYZA 5HD8D 4A2GA 4O2EB 4KUZL 4H25B 2JSFA 1KPRA 4I3RL 1RK1A 3ZE2F 3NESA 1ZTMA 4UANA 1M3JA 4XRCA 1H19A 1X5MA 3FQRB 2A83B 5IREA 2ZG1A 4LOUD 3SJVB 2F54B 5ICZB 1R3KA 5JXAH 4F8NA 2GTZB 1OPGH 3BH9A 3K71A 3NZSA 3U6XA 5KTEH 4MD4A 3PE9A 5K33A 1QBLL 5I5RA 3MUGA 4UIMB 1JZFA 3B3IA 3NABH 4X7SH 4PJ7B 4FJ6A 4PY8I 4WJ5A 4UWQB 5CN3A 2M1KA 5AW5B 3OL2A 4X99A 1T1ZA 4F37K 3CIQA 2YPLD 3DJSA 4XNZC 3EBAA 3L1FA 3DGGA 5FA3A 3RGBA 4OUUB 1VCBC 4L3CA 4QOKA 5F93C 4PY8J 5HDRA 1MI5A 2ICCA 3F58L 3MRDA 4U1IB 2LU5A 3MA7A 4HLJA 3MBXH 1DQML 3QDGA 3VA6A 5I1GL 3LQMA 3TN0A 1MJ7H 5JHBA 4LGRB 2N7AA 1UB5A 3ARPA 4PJCF 1Z9NA 1QSVA 1JNNH 4ZUVA 4ZUSA 2A77L 2E9BA 5A2AA 1INDH 3C08L 4W6XB 4PJCA 4HOZA 4R4FH 1QPPA 2NY6D 3QHZL 4OLYL 4KQ3H 3OZLA 3FN0H 1AHMA 3LH9A 2Z8WC 2DBJA 2H45A 1JGIA 4RMRA 3ZMRA 4HUUA 4MKTA 4Y2DA 1S9WB 4AEFA 2HPOA 2QLYA 1XMEB 2VR9A 1AZCA 5H2BB 1XT5A 2EICA 3BEVA 4ELKA 4G8GD 5DUJA 1AD0B 2Z31A 1JN6B 4DQOH 1V55B 4G1EB 5AG9A 3K6OA 3WHE1 4NGHH 3ZE1E 2IVFC 2ADIA 4PWIA 4JG9A 3V52H 1PFCA 3N5AA 2UWEF 2YRLA 1VGKB 1FH5L 2EXYD 1G7LA 3Q8AA 4MCZB 1MFCL 1JRHH 1NBQA 2MEJB 3LIZH 3QUML 4PGDB 2WLLA 2X0UA 1MFDL 3NOIA 4UTBL 4H4NA 1A7OL 4N2KA 3A5VA 5HGBB 4X4KA 4Z7OB 1CFSB 3VXUB 1UHVA 4OQTL 1IM3D 3PUCA 2WZPD 3HS8A 4BFFA 4GKSA 3BYTA 3TCTA 1PEZA 2LHAA 5IVXA 2YAPA 3RIFK 2I27N 3QORA 3L5XL 3SPGA 1XTLA 2XKUA 3VXRE 2UX6A 1SPDA 4L18A 4Z7QE 3C8KB 2CKNA 1WC7B 2NW2A 2P52A 1RIUL 3AS1A 3MLZH 3EYFA 4MSWB 5JHDD 3QNFA 2CO6B 3FTUA 2ZUVA 1EA9C 4G6JL 3U2SA 3NJHA 1E9PB 3BN9C 3LXUX 3QQNA 3MCLH 2F7PA 1SLVA 4YLBA 5B22A 4OLUH 4L4TD 1MH5B 3DSFH 2NTSP 4HPOL 3GS4A 3CHXA 4OFVA 1W72L 3SCMA 4FFWD 4QXGL 4ODSL 4FNTA 4YHZH 1HHJA 2XV0A 3UZEA 3GHBL 3S8FB 4NO3A 1URZA 5HHOB 2CRIA 1R0AL 1RJLA 4IKJA 3UGUA 4R4ND 5EO9B 4Z76A 1BJ8A 2O5XL 3EOAA 4KVCH 5DRXB 4DUVA 1WTGT 2X10A 4HCRH 1CYGA 1WRFA 3APNA 2OA9A 2OZ4L 2Z34A 3AWFA 4WK4B 4HH9A 3PRZA 1OAYL 2XN2A 4KXDA 1NGPL 3QCVH 2DBLH 1WSST 4QHUB 3UYRH 2Y7SA 5A2BA 1P7HL 4CGUB 1FHGA 1I1YA 1JF6A 4O2FA 2ZCLL 1Z0MA 3GRGA 5CZVL 1OF0A 4J3BA 3IJEA 5BJTB 5LVEA 3FQXA 2ITFA 5AZUA 2WWNA 3MFFB 1CFNA 1YEHH 5DXWA 3GXNA 3DX8A 3L9EA 2FEEI 3MACL 2JJTA 4PJDA 1NEZG 4WWKB 3CHPA 1F90L 2Q20A 3JUYA 3IJSA 1QFHA 2L7QA 2JK5A 2NUTB 5I6KA 1AZVA 4MJ5B 5T1KB 4WW2C 4X0KA 3AXHA 1T80A 5AZEL 3VFGH 4ODHL 2APTA 3B5TA 3X3GH 1EJFA 3ULUF 2DPKA 2R56L 4UOJA 2YUWA 3SY0B 2ZX7A 4XAWL 5HGAA 3WN6A 4YPGA 4ZX5A 4G42B 5D1QD 3JWNC 5D7JA 1FORH 1A6WH 1MUJA 2X3BA 3QEQE 5JUEH 4HKBA 5ICXA 4P2RB 3OKMA 5DHEA 2NY5C 2A7BA 3FFCB 3RAJH 1FFQA 1CR9H 5LQBL 1GJIA 1XCQA 3MX0A 3V8OA 1OP4A 4NQEB 3MRPB 3K0WA 5MENA 1CLOH 1X5JA 3GWJA 3CXDL 1YEWA 1BQLL 3O6FC 2WQVA 3QBTB 4A68A 5I30L 3OHMB 2DQJL 2E7CA 3EZ8A 3OTTA 1C9SA 4C56B 2CALA 3U6RB 3O3DA 1AO7B 1NKGA 3LYRA 1EQWA 5JW4Q 3IRCA 3ZZ1A 3MLPA 3IM1A 1P53A 5BPPA 3RVWD 3NSJA 4NENB 2AK4A 3OR7A 5EA0L 2GK0A 1WAEA 1IAIL 4ZJ9A 1CG9B 2VSCA 4NI3A 4N1HB 3RIAK 1J5IA 5T1LB 4XGZA 3UIYA 4ADJA 1X4XA 5D2LA 5JXAL 4ZW6A 1CFTA 2WP3O 5BRZD 1OPGL 3LKRB 1A9EA 3SKNA 1CPUA 2DI7A 4WFHE 1KTBA 2YKKA 4RRPA 2WTRB 1TT6A 4GH7B 4NUPA 4GI8A 4X7SL 3BAYA 3O6MH 5I1HH 4JFFD 4LPTA 1ETA1 1TJIL 3EJUA 4Z5RA 3HLAB 1A25A 2RACA 4F92B 4N2HA 5TF1L 4BUQA 4POYA 1MCWW 2ZUWA 2X1OA 1OT1A 3OJVC 1WS8A 1E6OL 2XJKA 3PLYA 5ESQB 4JZJB 5JOFB 3LZNA 1SEBA 1JF1A 4FHJA 1R9FA 5EZLB 4AIZA 2DI8A 2UUDK 3QZWG 1MJ7L 3LRLA 4M1GH 1S7WA 3L3OA 3RZWA 2IWGA 4NRXB 3HVDA 3FNKA 1DCEA 4OFQA 4BIKA 3DXAA 3MZTA 3KS0H 3PL6A 1IB5A 5C71A 4FNPA 4R4FL 5F3BA 1X4YA 1TJMA 5GZOD 3TJPA 4BFIB 3FN0L 5MHSD 3GXMA 4WU5A 1CJYA 4U4IA 2IPTH 3IFOA 3ZDWA 1PGRB 4R9HA 4F93B 4CAGA 1FFOB 3S88H 1KBPA 1CDHA 2A6KB 1N2RB 1NM9A 3VW3H 3UTTE 2C9AA 3BJ91 2I60L 3HUJE 5KVDE 4KKCD 5E94B 3BDXA 1U58B 3C2AH 2WLNA 4CADA 1MHPH 2LU7A 4LPXA 3E2HC 1I75A 4XC3H 4JDEB 4XN7A 5KEZA 3ABLB 1RZJC 3WN5A 5CLXA 4W6WB 5E4EB 3NIFF 4EF3A 1O6SB 2Z31C 1FLTX 4OJYA 3LIZL 5HPMB 5KSBB 2WKGA 2WUCH 4M7ZC 2O61A 1B4JL 2IV9A 2NY0D 4HKZB 4JY6B 3OKKA 3ZDZE 5A2KH 1SQMA 4PMFA 3LB6C 6FABH 2OMBA 2VISB 1Z7JA 4LSSH 1DUYB 2YD2A 4R96B 4EZLA 1MAMH 3UEQA 5FYLD 2I9LA 1KTKE 4MA8H 3UBXG 4U1SA 2ZUXA 1MZYA 2AKRA 1PY9A 1COBA 1WO2A 4R26H 3Q48A 3FB7A 1T1YA 3BQUA 2CPCA 3MCLL 4Y19D 3JWNG 4DP2X 1XGZA 3IVKB 4F7MB 4ZNCD 4DOHB 3NEXA 3MRQB 1KWKA 2GT9A 3DSFL 4WV1A 4FC3E 3FQWA 5J1SC 4IOFC 5ENWA 5C86A 1INEH 2WAQA 4CVXB 4J23A 2HZHA 4AVJA 3RILA 1YLBB 3N43F 4PPTA 1NGWA 5DRNB 3DVGB 4L8DA 5CUSL 2AJSH 4TVUA 2CZNA 4MAYC 2NY3C 2Y7LA 2BIQA 3Q2NA 3ZQXA 1JG9A 3BZ4B 1OP9A 1E43A 1MQKH 4HCRL 4JS7A 3EZJB 3HG1E 5C0BD 1AXSA 4IOIA 2LE9A 3IMVA 4QUOA 2A0LC 1Z5YD 4HG4J 4JG0L 2AZAA 3RX5A 5TD4A 3QCVL 4DVBA 4S0HA 2K45A 5EU6B 1GGBH 2YPLA 1FNGB 1FFNB 3ALPA 4KXZI 3PXHA 3Q9PA 4AL8C 3JTBA 4ODWB 4P5TC 4B95C 1LNUB 3F8UB 1RUPH 5ANMA 2NNRA 4FN0A 2D7MA 2J8UF 4P46D 2NSMA 2HVKA 5D5MA 1M7IA 1MFUA 4FI8A 2I24N 4MJ2A 3N41F 1JPTH 3EJJX 3SY6A 1J1XL 1JK8B 2QQLH 3GJFA 2ZUQC 4ZAKB 2LAGB 3M7FB 3PGDB 2X41A 1R3JA 4YHNA 5LAXB 5B3SB 3V0EA 1AR2A 2JTYA 1JSYA 3DO4A 4WEEA 4QTHA 5FC9A 1DVTA 1GGIH 1KOAA 2GY7B 4JM2B 4KFMA 4DCQA 4PWGA 3HRPA 4M43H 4Z7VB 3TVMB 12E8L 2HJFB 4F1SA 3NA4A 2Q7AA 2C7FA 1E9QB 5C6PB 5DJDA 1D9KB 5IHUL 2IALA 2A4EA 4N5ED 4G8GA 1AYRA 4PYGA 1NFDF 4E9RA 2XPYA 1FORL 5D93C 2E9WA 4AEEA 3IN0A 5INDB 2VQTA 1F4YH 4G1MB 4MNGE 3ZOAA 4UQBA 1UADC 1KTLB 5E6RB 3ZUNC 1UWGL 3QSKB 2FO1A 2NX5A 2YGNA 2RCSH 4C59B 5D7JC 1DL7L 1LP9F 1GL4B 5EBLA 3TZVA 4PJ5E 4GKOA 4G6AC 4X7TB 5JTWA 1U95A 1KFGA 2C9QA 4YLCA 1BQRA 4D8OA 4I8DA 2Q7YA 2FBOJ 1LP9A 4ZYKA 1IM3A 3SKOA 2A5UA 1K4DB 4L2YA 4HK3N 4U0RB 1HHHA 3MRIB 3Q2CA 4AWJC 2QPFA 4FFVC 3G5XA 1G9MC 2Y72A 3WEMA 4KY2A 4Z77A 4YSSA 3Q43A 5B3JF 3OWEA 4TV3A 1BOGB 4ZW3A 1SYSB 5JW4R 1KXTA 1OAQH 1NJ9A 3RVUC 1ZA6A 4H8VA 5IVNA 4L4TA 4WHTA 1BQHG 3DRQB 3CLWA 3IU3B 1YMHB 1A1NB 4JAMB 3WJMA 5IM7A 1JZ2A 5D6CB 1PDKA 4U6YA 2IOOA 3AS0A 4IU2A 1YPZE 2CUHA 1X4ZA 4OFYD 2EO1A 1D7DA 2VH5L 3GSNA 3O6ML 4Y5YC 1TZHB 2YGQA 4CBZA 4AZ8B 3FHAA 1MEXL 2YQ2A 5F1IB 4HS6B 2ZYSA 4DIXA 2K7QA 2WXHA 2IH8A 3K81A 4U1JB 1WZLA 2BERA 3MROB 25C8L 1ZA3A 2XUWA 3A4EA 1NH6A 3LNDA 4PSRA 3WY4A 3WTTA 3MRJB 3OHXB 1HQ4B 4L8BB 3BKCH 4EI6B 1OT2A 4G8EB 3RWFB 3FT2A 1MFEH 5IQMA 1K9TA 1F45A 4DGVH 1YUHA 2EXWD 1N5AA 3B3BA 4P2AA 4DEUA 1RIHH 1RD6A 1MG2C 1RZGA 5HVHC 2UZYA 2X4PB 2PCFA 3PAZA 4GQ9L 2BVPA 2H0FA 3VSVA 2Q7NA 3RVTC 4AT6B 3IDXH 1V27A 4JRFA 1UWXK 2V6HA 2IPTL 2H1PH 1A4AA 1O75A 2DYSB 3S3JA 2BP0A 3VI4A 1ZT7B 3PL6C 3O3AA 2KZKA 1HI6A 4PJIF 1LEIB 2BSRB 2LR4A 5F7LB 5A6IA 3P3TA 3AXLA 3D4GA 2O6DA 1YEFH 3VW3L 2MNWA 4OZGE 1MAJA 1JL8A 4YHMH 1ZLDA 4DPBX 1OAZL 1B0IA 1CQYA 5A7EA 3AADB 3C2AL 4FNRA 5C0IB 4YXLH 2E6JA 4KKZA 4JQVA 2F5BH 3JV4B 1I7TB 3QJZA 2Y1ZA 4QD2E 3S3PA 4YPJA 4LF3B 4S1QL 5C70A 1AR1D 3VXRD 4N5UA 3FTXA 3HB3C 5ADOL 3BPNB 4AVHA 3GBDA 2GJ6B 3V6BR 4WUUB 5BRPA 1BIIB 1VCAA 5AW8B 1MIML 4TSBH 4FLHA 1UFGA 1FCGA 4TVSa 3T3MB 4RESB 3IFLL 2EDXA 1DVFB 1CF8H 4J8QA 4IBTA 4YHYB 4JANA 2DLFH 4GBXA 4X8JA 1I1AB 3MN8A 4PY7A 1C1EH 3N9GL 1PNDA 3WEOA 2Y9RT 4R26L 4GKNB 3H9YA 5I1AB 1HAUA 3U9UA 3MGTB 1UZ8B 3DX0A 4HEME 3WUWB 4PJBE 2ARWA 1K5NA 1MCQA 1INEL 3EDFA 3NCJL 2OFQA 2GIYA 4W9ZA 2BY1A 4AXWA 4DO5A 5C0EA 3TYFA 4FX5A 3RDTC 2AJSL 1LK3H 1MLBB 1AR1B 1YEDA 4PJXB 2A2QT 1NIBA 5BRZA 5HD8C 2X12A 2VW6A 2Y2TA 3IF1A 4K3HA 4XMKH 2NR6A 2EYSA 4WV1C 5DK3A 1MQKL 4K8RH 3QQDA 2OMTB 5FO8A 3OPUA 2X6BA 4A04A 4UM9A 4QXTA 5FS5A 4LPWA 3SE3A 2WSDA 3VFNB 3ESNA 5KSVA 2IXQB 1T89A 4S0SD 1YG9A 5IHZB 4KHTH 4ZS7H 2YD7A 2PMZA 1BREA 3H2QA 2JMRA 3U7WL 3RWEB 4KO9A 1EBPA 3H0TB 4N85A 2A9BA 1HU8A 1NLDH 3AWGA 3QUYB 4P9HC 4L0YA 2HXAA 5H35B 4MZRA 1VPOH 3O4OB 4I0PB 2BINA 2DOCA 4WNSA 1GOHA 1AI1L 1EX0A 2QQLL 3H9SE 2AV7A 5GGTL 1I7RA 4MB4A 3ROOA 3KPMB 3FAXA 2NCEA 3NEOA 1E8XA 3EGDA 5HHPB 3CFCH 2NUPA 4GXFA 5HGHA 5B38B 3QEQD 1VAHA 5I6OA 4KVNH 4XE5B 3WU1A 4GS7C 5DJAB 4BQCA 1A6AA 5DVMA 1HE8A 2HFFA 3FOLA 3LKQB 3UYPA 1FN4A 2AJYH 3BOVA 5I6NA 5GSRB 4Y2LA 1XVSA 3HAEB 5F6HJ 5LBVA 1ZVNA 5K93A 2WXJA 1A6ZA 5I0DA 2NY6C 3VGBA 2VN7A 1QRNB 1F5WA 2VR6A 4S11A 5ISZA 2PYEB 1U93A 2J3SA 2W38A 3SKMA 4FTVB 3T3PE 5FECA 5I2IB 3EJTA 4HDIA 4PJFF 4OSUL 1YSOA 1N6VA 2L7EA 4FZ8H 4HIJB 2R0KL 3UC0H 2A9CA 4NP4H 4BE5A 2RCSL 2ZKWA 3UPRB 3P4OB 2ZX8A 5E70A 1SY6H 2JI1A 1FL6A 1IC5L 4HBCL 2FJUB 2HKHH 1YQVH 1AGBA 5HHXH 2DWEB 2EXYC 3W9EA 5KVGL 2I85A 4GPVA 3G5ZA 3M45A 3SBWA 2J5LC 2BMKB 4BFGA 3VXTA 4JFEE 4IBUA 2XTJB 4WFHD 2OJEB 1RURH 2YBRA 4HLZG 1UQSA 1HT6A 4J3OH 4XTRD 2D0FA 1GJUA 3V0WH 2I7OA 1T6VN 5I1LA 3DO7A 5BZXA 3UZVA 1OAQL 1OAJA 5TPWL 1MCNA 3F7YA 1HOCA 3U4EB 3OGOE 3R8QA 3ARVA 5GS0D 1HILA 1B0GB 1BECA 2MCMA 2DQGH 3OPZH 1IRAY 3FYIB 1XF4B 2BRRH 2XPGB 3MUZ1 3MV7A 2NZIA 5G5DB 3VJ6B 4AUUA 3SDXE 5BS0B 1TJGH 1RZFL 1D7CA 3S35H 4BBWA 5CMAA 4LCCA 2X5PA 1IO4C 4HZLB 3C5ZB 4MCNA 3O3UN 5LBSH 2XU9A 5DVOA 3B37A 1IFHH 1HH9A 4FFWC 3IDGB 1U6AL 3TBYA 3JTTB 5C0BA 4DKDC 2ALWA 5BW7C 4XBGA 2WOYA 4IJ3C 3STBA 1SYVA 2Z8SA 4MZIA 3T4YA 1P1ZB 1P7QB 3MRKA 4DZBA 1XGRB 5FM4A 2YXFA 3MNZB 3ZDYF 4DEPC 4R4NC 1YNLH 5BCAA 3RWJA 3WHE0 1I9RL 4DGUA 4DGVL 5AB2A 4RX4A 2EEFA 1HWWA 1DJHA 1GS7A 3EGSA 2BSSB 1RIHL 1S9XB 1KJMB 2O26U 1K3IA 3D34A 5HPOA 1QLEB 1SHMA 5EIVA 3VXMB 1I4FB 5JMOC 1MCJA 3GKZA 2O4EA 2LVEA 1JWUB 3PAYA 2FJFB 2H1PL 4FI7A 2H2SD 4NLHA 4RLDA 2X6VA 2YA2A 4EBQL 3DX4A 3LCYA 2YGPA 4WJKB 3ATDA 2DWTA 2X0VA 3J27A 3NIDB 3PAVA 1CXFA 2J57A 4JO1H 2H6OA 2PTVA 3HNVH 4W4OC 4AENA 4PJEB 5EV7A 1R3HA 3GI9L 3QXAA 1A4JB 1S3RA 4KK8D 5DQ9A 1BG9A 2CMRH 2F5BL 4AGNA 1FFPB 1QHPA 1CGSH 4DN3L 2ERJB 3WOVA 1A3QA 3CFJA 5MEPA 2ZCHL 3MJ6A 2I69A 5KVMC 3OB0H 3BLKA 2CJSA 4HEPA 4FAAB 4ZMPA 4O2CB 5BUPA 4PB0L 2VSMB 2DIAA 1VZHA 3OLEA 4KFZC 1A7RL 1J1PH 4MVBD 2A6IB 4F7EA 1A14H 4IRJB 5D1QC 3MU3A 1QLFA 4EUPG 3ZVVA 3VWKB 4RGOL 3SODB 2WWMD 3NCYP 4Q9CA 1UGNA 3CN1A 5SWQA 3UG3A 1GCFA 2ZOLB 4LLYA 1C1EL 1OXYA 3EUUA 1KXQE 4QY8A 1F18A 1DVXA 2AQSA 4RRPM 5EU5B 4BK5A 2X1QA 3IDYC 1IGTA 1T22A 5CJQL 4D8PA 1QFPA 3HMXA 1SNRA 5I9QB 1BQKA 1HXYA 1NC2A 3HG1D 1HKLH 1LLAA 2V2XA 3TNNB 2RR3A 2EKJA 1Q9OB 1IAKA 1U8JB 4M7KH 1JI2A 3BUYA 2CUMA 5FCUH 4DP4X 4ATWA 1UA7A 3CVBA 3EYSH 1R5VB 3HRZC 3PGCA 4KQ4H 4WI7A 1T5