3LTVA

Mouse-human sod1 chimera
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
153
structure length
153
Chain Sequence
AMKAVCVLKGDGPVQGTIHFEQKASGEPVVLSGQITGLTEGQHGFHVHQYGDNTQGCTSAGPHFNPHSKKHGGPADEERHVGDLGNVTADKDGVADVSIEDSVISLSGDHCIIGRTLVVHEKADDLGKGGNEESTKTGNAGSRLACGVIGIAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Superoxide dismutase [Cu-Zn],Superoxide dismutase [Cu-Zn]
publication title Structures of mouse SOD1 and human/mouse SOD1 chimeras.
pubmed doi rcsb
source organism Mus musculus
total genus 41
structure length 153
sequence length 153
chains with identical sequence B, C, D, E, F
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2010-02-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 3ltvA00
1XTMA 3ECWA 4A7UA 1OZTG 2NNXA 2APSA 1OAJA 2LU5A 4B3EA 1BA9A 1JK9A 3SODB 1AZVA 3KH4A 2Z7WA 2AQNA 3HFFA 1YAIA 2Z7YA 1HL5A 1BZOA 3K91A 1COBA 2WKOA 1SXAA 3KH3A 4L05A 1B4LA 3GTVA 1E9PB 3H2PA 1F1DA 2XJLA 2E47A 1TO4A 1TO5A 2VR7A 2WYTA 4A7QA 1SXBA 2SODB 3HOGA 2WZ5A 3L9EA 1Q0EA 1XSOA 3QQDB 1IBHA 1SXCA 1SDAB 1E9PA 3CE1A 4MCMA 3ECVA 4FF9A 1OALA 1QUPA 2ZKYA 3PU7A 1E9QA 2WWOA 2WKOF 2GBTA 3ECUA 4A7SA 1SXSA 3KBEA 2VR6A 3QQDA 1S4IA 3S0PA 1PU0A 1N19A 3GZQA 4BCZA 1CB4A 2GBVA 4OH2A 3LTVA 1SOSA 1E9OB 4MCNA 1Z9NA 2AQQA 2C9SA 2AF2A 2VR8A 1L3NA 1SXNA 1SDYA 3CQQA 1UXMA 2AQPA 2GBUA 2WZ6A 3KM1A 1OEZW 1SPDA 4A7GA 2WYZA 1PZSA 4BCYA 1E9OA 2ZKXA 3F7KA 1F1AA 3F7LA 5CU9A 2C9UA 1B4TA 3HW7A 3MNDA 1N18A 1F1GA 2AQRA 2K4WA 1RK7A 3L9YA 4A7VA 1IBBA 1EJ8A 3T5WA 2AQSA 2Z7ZA 1IBFA 1FUNA 1SRDA 1P1VA 3KBFA 1YSOA 1DSWA 1JCVA 2WWNA 2ZOWA 1UXLA 1MFMA 2C9VA 3GZPA 1SXZA 4BD4A 3H2QA 2R27A 1CBJA 3GQFA 4U4IA 4A7GF 3MKGA 1ESOA 5KBMA 1Z9PA 2Z7UA 1XTLA 1HL4A 4A7TA 1DO5A 1EQWA 1IB5A 1KMGA 3GZOA 3KM2A 4N3TA 3GTTA 2AQTA 2JLPA 5KBLA 2V0AA 4OJAA 2AEOA 2Q2LA 4N3UA 1F18A 1YAZA 2E46A 1IBDA 1JK9B 2WZ0A 3CQPA 5KBKA 2XJKA 2ZKWA 1E9QB 1U3NA 2JCWA 3RE0A 1OZUA 1PTZA
chains in the Genus database with same CATH superfamily
2VSCA 3FJTA 1IL1B 3MVSA 2HWZH 4LPWA 1KENH 4X4ME 2E7LA 4MLIA 4U1IA 5CD5C 3O3AA 1RD6A 3JZ7A 2ZCKL 3OKEA 3ZRSA 5JYMA 1JZ5A 2H5UA 1II4E 2TAAA 5ITFB 3DJZA 4Y16D 4JJ5A 4L0ZA 2I9TB 2NTSP 3MX0B 1RZ8A 5JQ6H 2EECA 5IM7A 5I6OA 2FGZA 1PL3A 3BO8A 4NZDA 1OGSA 3G3LA 4P2RB 2R69A 1E2VA 4UDUA 4BWWA 2XQ0A 5E8PA 3O3UN 1U3HC 2ENPA 2NY4D 4I1RA 4NBXB 3SY0A 1A1MB 3QXTA 1EEZA 3H9SA 4KITB 1BF2A 2BP3A 4MD5A 4WI7A 4Y9FA 1DL7L 2KC0A 3O9WD 5I18H 4R4FL 4LB8A 1NEZB 3EJJX 1WICA 5DO8A 4FQXB 4EI5C 2I9LB 4WWNA 1R6VA 2PYED 1TETL 3MREA 5DU7A 4PJDE 4LF3B 1T22B 4ZK8A 3S36L 4BFNA 4ZNCD 1MG3C 1YEKL 4G8EB 2V17H 4BKTC 4QNPE 1MHEA 3P4LA 1GKOA 3G5ZB 1A2YA 1HCYA 4MXWH 4F15B 1SJEA 1V3JA 3ES6A 2NY2B 3EO1A 4F1ZA 5ID1B 1TJIL 5K9KB 4DAGL 5B39G 1MIMH 1BZ7B 2G9HA 2UYLA 3DVFA 5TE7H 4UT6L 4GI6A 5HJ3A 5KVEL 1UUSA 2DTML 3HE7C 4LLAA 2FNWA 2P8LA 2OW6A 3K4AA 3SGKC 2E27H 5I30L 1BQUA 4JFQB 4GI8A 3LZFL 1W9XA 4HHWA 2H32H 5J89A 3HMXA 5DT1H 1M53A 2BLFA 2J5WA 1CR9H 2DYSB 5D2NC 2YGOA 3WNLA 2JB5L 1GIGH 3DVNB 2H6UA 3GKZA 3P30L 3VRIA 1KPRA 3T3PB 3CFNA 5IB3A 5LQBH 2WNGA 2CK0L 4P2RE 4WO0A 5PAZA 4OUUB 2BVQA 5FS5A 2IPUG 4NP4L 1YNTB 4MJ2A 1JP5A 1N9PA 4Y2OA 4EOWL 1T0OA 5C0DA 4G9FD 2J43A 4KTYA 3SKMA 1JPST 4ZFOB 4YSDA 3K6DA 4OZIA 3VXME 3DGGB 5E6IA 2AQTA 4J3SA 4PGEA 3PGCA 4U0RC 1FBIL 1ZLWK 4PSRA 5EB9A 3LQAL 4H8PA 3L16A 1MHPH 2LVEA 4U1SA 4O2FB 3A21A 4HT1L 6TAAA 3BAEL 1RL1A 4FI7A 4UNTA 5F7BA 1KGUA 5KANG 2X4PA 3G08B 4XH2A 3IFPA 3ZKXB 3DYMA 4FLQA 4EUPB 5BVJB 5CZRA 3GSNL 4AMKH 3MYZA 3GXFA 4PREB 2ISDA 3IS1X 3FQ2A 2ZZUT 3W5MA 4FNRA 2GAZB 1B4JL 4G6MH 4U1HB 4UUJB 2D4FA 4EO5A 3W37A 2IH3A 1R3LA 1M2OA 1A64A 2CKBH 2Z0UA 2VYRE 5F7UA 4OCXL 5T1MA 1T7VA 4MJ5A 4V1DA 4HX1B 3H2WA 2Y23A 2E47A 1J5OL 1F90H 2Q8AL 5CJBA 5L0QC 3U7WL 3FTXA 3VH8G 4NQED 5C0RH 2APFA 1UUNA 4G7YL 4JFFA 2PYFA 3I3DA 1FYTE 1NMCB 4CNIA 3GJFB 1HHHB 5HVHB 3LQAC 4R7NA 5J6SA 3T3PE 5AW9B 3STBA 2XVKA 2FZ3B 5I6XB 4TLTA 2CBPA 3DX3A 4NYLB 2XZZA 4FLSA 4QXGL 3QAZC 3WLWC 4AW4A 5FB8B 4KTDL 4R96B 1RPQA 3FUDA 2VM4A 4LCWB 1RPUA 4PV9A 1OPGL 5TPWH 3ULVF 3MNMA 5JOFA 4LLVA 3PHQB 4XNMB 3RWDB 1U8OB 3GJFK 3T1WA 3W9DB 3ARVA 3X3FH 4IDJL 4XPBL 4ZSOB 3Q6GL 1ACYL 4JMXA 4X6CA 3H56A 4GSRA 2V5YA 4ZMVA 5A6LA 4U1GC 5CU9A 3D1MC 4H1LA 1CU4L 4JO1H 5D5ME 4NBYB 3Q8EA 1T7ZA 4R5XA 1CLZH 2ALAA 1NM4A 2R0KH 5CUSH 2X1XR 5ESQA 4XCFH 4PTTA 3U46B 1C5BH 3RPIA 1IGTA 3L3OA 4FI6A 4DOHE 1WH0A 4F7CA 3U6RA 1JPTH 4AZ8B 4MAYC 1MUJB 2OK0L 1KLUB 1UD8A 2PR4H 3U1PA 1WS8A 2OQJA 4KBPA 4HHAA 4PJCF 3PLYA 3TBVB 3U9UB 5L9DL 1Q1JH 3VWKA 1DQQA 2JSFA 4HAFA 3JYBA 1V3LA 3FW6A 4G8FB 5G4NA 5IB1A 2B59A 1SZNA 4GB9A 5KYUA 5TK4A 1D9KD 3B9KB 3O3EB 5E2TL 1HEZA 3E38A 4LLYA 2ZUSA 2KDGA 2CGZA 3O3DB 5L7XH 1UJTA 2H1LM 4IOIB 4N87A 4CMMA 4OIBA 2VGLM 3CFBA 1JGUH 4HIXH 5J6GB 1S7TB 2OXGA 3L5HA 5DD1H 1JTPA 1NJ9A 1P7QB 5EU3B 4LCWE 3ZHNA 3DOHA 3FMGH 3HLAA 2J1WA 4ODXA 1IIIA 2X9YA 1X5LA 1KIRA 3FUFA 3LRMA 2PW1A 2VLKD 3V55A 5SV3A 1AZVA 5IQNA 3AGVA 1HHIB 1UT2A 1XGPA 2QQLH 2YOCA 3ISWA 3WFDH 2F1EA 2Q3ZA 5DQ9B 5EA0H 1OANA 1ZEAL 4R8WL 4D9QE 1I8IA 3DHJA 4YPGA 3TEUA 1DUZB 1ZLWH 3FQUA 4LCYB 4QRTA 3KW8A 3UG5A 5B3JE 5CJQH 2IH1B 4AGNA 1O6VA 4JKWA 3GPSA 1AD9B 4BINA 3CFDB 2VLMD 4Q6IA 5DTFA 3ZTNH 2FTAA 1M2VA 4TVPH 2MOGA 3E8VA 3GLEA 3RX9A 5T5NF 3KPSA 1LLAA 4X7SL 2ROXA 2AJZA 2B15A 4XN7A 4BFIA 2QQNH 4OFKA 3U4KA 1A9BB 2IANB 3RIKA 3V0DA 4PJ9B 4KZEH 2J8UB 2EVFA 4M7KL 2WZPD 4OSUL 5IEHA 2GBAA 4BA0A 3C08H 1XHHA 3D4GA 2VZUA 3DECA 5CFHA 2HZHA 4EUPH 4ZUSA 3EDJA 5T1LA 3MC0A 4MQ7B 3CPLA 5JXAL 5J4MA 4LASL 5MEND 4G1EB 4FQ1H 2VDML 1PG7L 3KYKL 1GYVA 5E1AA 1XCXA 3UROR 5AG8A 3KL3A 2XACC 3WO3B 4AYGA 3KPRD 3KXFA 3FB5A 4H5SA 4RESB 4EN3D 4DF9A 2DZEA 1G9ML 3OLEA 1IZKA 1DSWA 1QG3A 1LE5B 3GI9L 1CQYA 3ECQA 4WI2A 5HYQB 4GG6F 2EKSA 4HFUL 4DVBA 3HS0A 4FL4B 1U41A 1A3ZA 4GT7A 1TJHL 4B9GA 4BQCA 1OGAB 4QRRD 4FA6A 2XWDA 3ULVL 2WQ8A 3BAJA 3RQ3A 4JPQA 4EDXB 3HAEA 3GJFH 1OARH 5EN2A 1EDHA 5F89A 1ADWA 3F2LA 3LRSB 4PW3A 4N5ED 3ARGD 1JZ7A 1YEEH 5FA3A 2HWZL 1F4HA 3IRCA 1KENL 5CSZA 4BKLB 2F5AL 3GLZA 1FQ9C 3DX0A 3J8F7 3EBIA 5EBWA 1LTXA 1ID2A 2C1OB 3NZUA 2IANE 4NHCL 4TL5A 5JQ6L 2DM4A 1F3JA 1C16B 3MBEB 2LQRA 4FQCH 5BZXA 2AJUH 3UPRB 2PUQT 4Q89A 4WVRA 4Z8FH 3EJSA 3B2VH 1T2XA 1XIWC 1G9MC 3EHBD 4FHKA 4KKLD 2AERT 4Y1AB 3OKMA 4GBXC 4GFXA 4PJGA 4XBGB 5J57B 4W68A 4Y0GA 3NJIA 1G5AA 1ZA3B 3GIVA 1CJYA 1JGEB 1FL3A 3ULVC 3Q05A 3CN1A 1JV5B 5I18L 1XGTA 2D03H 2D7TH 1I7TA 1INQB 1EERB 5FW6A 3UBXA 3V0AC 2XIDA 2XIIA 1KUMA 1MHHA 4ZUVA 2CWRA 1ODUA 3VD5A 3CE1A 5E4OA 3P4MB 2IAMA 4XP5H 2V17L 4PHZA 1OGAE 2XWRA 5F97E 1M7XA 3WNJA 3TNNB 5T33L 5LLIC 1ORQB 1Q4NX 2VL5B 1WISA 4J3OG 4MXWL 1S4IA 1WK0A 4N0UB 1AE6H 4OJCA 5MEPA 3Q1SH 3KMDA 4TUUA 1PQZA 1UXWB 1MIML 1RHHA 5TE7L 5CWSB 1SBSH 3KGSA 2NSMA 4MMZA 4ATTA 3D0AA 5FUCE 1WT5A 2OJZL 5C0ND 2VUOA 4K5NA 3OSVA 4XI5C 2AJVH 4ZZFA 4HXAH 2E27L 1RI8A 2X1PA 1HYSD 3NSJA 5CGYD 5FYKD 5MI0B 1ZIBA 2FLBT 2VL4A 4N90E 1QHQA 1CR9L 3VFTA 1AKJD 1GIGL 4L3EA 1HXYB 3IGAA 2FJSA 5LQBL 5KANI 1HCZA 5D7JD 1CGWA 3ARRA 3FUKA 5AVYB 1FL5A 3V5HB 2NQCA 4Y1AE 3AMLA 4F33A 3HC0A 2CKNA 4GYBA 5MERB 5DJ2A 1PJ9A 4UDTB 5ICXB 1OP5K 2LU4A 4GRWB 4G6FD 2CMRH 1OGTB 4HEPA 4RMVA 1RSFA 2WWMD 4GMSH 4PLOB 1BAWA 4G8AC 4RDBA 5EIIG 2NRDA 1JCKA 1MHPL 4IMKA 2UX7A 4NAJA 4WWID 1HJCA 3GBNH 1KXVA 3P9MA 4PD4J 1WFTA 2GJPA 1UURA 4FULA 4AMKL 1EXUB 3T4YA 4AUYA 5BUGA 1JYVA 2JMRA 3QARA 4UI2A 1ZHNA 4XGZA 1IQDA 3VTAA 2XBTA 4G6ML 2Q1EA 3QI9A 3S37H 3ZL1A 3ZJAA 3QUZB 4BUQA 4LKCA 5DHYB 4N0UE 5TDPB 1BQSA 2CKBL 4XO8A 3SPVB 4TMPA 4GP4B 4HCGA 1EWHA 1EX0A 4MS6A 2FEDC 1XSJA 4Z95H 2ARJQ 5AZEH 4XB8A 1TITA 1F90L 4G3YH 1Z1WA 3D52A 3SDXA 5HGHB 3WEAA 2VRQA 4GJTB 4ZS7H 4HS6A 2WXPA 5C0RL 2X0UA 2Y25A 2Z4QA 5I1EH 3O2DA 3S2CA 4WJ5A 2VZ3A 5AVSB 3DARA 3U2SA 3PUCA 1AHWC 1WFUA 2I07A 1E4WL 2OMXA 4B5EA 3NIFB 1S2EA 4LFHG 1I1FA 2ZX6A 2FECI 4U6XA 3RDTD 4J4PA 1IKOP 5EEWA 3T2LA 4KAQH 5C0BA 5INDB 4QY8B 2HG5B 3QZMA 3ILQD 5KEZA 4L9LA 2DM2A 1JXKA 2H6PB 5TPWL 4K5OA 1P5VB 2DPKA 1SN2A 2DL2A 4NNYA 4XX5A 3ETSA 4WFGD 4WI6A 3VI4B 4KOBA 3F7RA 1U92B 3X3FL 1JNHB 1CFVL 3N55A 4X9FA 4HUKB 5I19H 4RFNB 1BQHB 4W9FC 4GUCA 5EHFA 5CCJA 4WU5A 3C5SB 1KDJA 2E8ZA 1TJXA 3K2KA 4JFXA 1G7JA 3LHAA 3HB3D 4J8RA 4JO1L 4P5TC 5E2JA 4ELMF 1BVZA 5BRQA 2ZF9A 3NCCB 1CLZL 2R0KL 5IHWA 1OIOA 2NNAA 5CUSL 4XCFL 5FFGA 1P0SE 3BEWB 2NUTA 1C5BL 1XAKA 3VE0A 1OT1A 4JFEE 5AW7B 2Q20A 1MRFH 1T66C 1JGIA 4DP1X 1FH5H 1XGRA 3KYOB 1QQDB 2B4CH 2PR4L 2QQKH 4AUUA 3ARPA 3AS1A 4WFHE 1YNLH 2J8HA 1OV8A 3TIDB 3ETBF 3HG3A 3KJ6H 4YFLI 5LHDA 1M4KA 1Q1JL 1I8LC 2WSPA 4IBYA 4JQXC 1SF3A 4C58B 4IKJA 3AG4B 5ICUA 2Q86B 5ISZB 3GD1C 3EDEA 5FO7A 1A9VA 1K5NB 1D6VL 1NC2B 3AQZA 1IBYA 5E9AA 1DVFB 4JDEA 3SOTA 2EXTA 2ZUVA 2FQDA 1SEBB 3B83A 3NIFE 1XGYL 4R97C 1BZ9B 3T8VA 5L7XL 5C0EB 4G5ZH 5GJTH 1R33A 2F53D 1JGUL 1KMGA 4HIXL 4BH7A 1U8QB 5DJ0A 1OGPA 4KV5F 1DEDA 1Z5LB 1UKTA 3FFCA 3DMMB 2EILB 3WHE0 5D6CB 5I1HH 5DD1L 1R3JA 4Z7VA 4L4VB 1IAIH 5GZND 3ARSA 3FMGL 5D7IA 4PJEB 4IRJD 4C4KO 1CGTA 2RCSL 3O45A 4FTVD 5C7ZA 3DK2A 2JJVA 4HISA 5HGAA 3FQRB 5GRVK 3VFUA 4L48A 5I0ZA 2XXFA 4PYHA 5L4FA 3BQVA 2QQLL 3KHQA 3NUKA 2C4FU 4N9GA 3TT3H 1GVIA 1OP5H 3WFDL 4MA7H 1IGCH 2BP8B 5EA0L 3IDNB 1WV7T 1SJXA 4FKKA 2JXMA 3TBBA 1JXGA 4RMQA 3HN3A 1LO2H 5F96L 2WBWB 2JJTC 1RZIB 2DMBA 4G8IB 5CJQL 1SMDA 4KGJA 5AYUH 5B1CA 3QJVB 1N6UA 5C0CD 4YSTA 5ESVB 4Q9RH 4ADIA 1UD5A 4WZ9A 1LQBC 4JFDA 4FQXC 4DO4A 3PWVA 2CO7B 1PDKB 4TVPL 5FHBH 3GO1H 5G5DA 1BJ1H 3AADB 4GRWH 1ZA6A 4ZFOL 4GW4B 4X0KA 5ISZE 5C0JA 1IGYB 2YXMA 4Z3FA 3B37A 3RRQA 2QQNL 2R2BB 4Y5VB 3PABB 1MWAB 4A04A 1HXKA 3PXLA 1SOQA 1AO7D 4KZEL 3VFVB 1AI1H 4PJFF 4F15C 4ZUWA 1BBJB 2GCYB 3KPLA 1WZLA 4HG4J 3C08L 1PZDA 5BOZG 4R0LA 5SX4I 2EUXA 4QOKB 2ZG3A 2DQHH 5KOVC 2AV1A 3GZQA 5HHXH 3H9YA 4GG8A 4FQ1L 4L4VE 1ZLDA 3TO4A 4PJEE 1E3ZA 2CK2A 1IARB 3NIGF 1F11A 1VADA 4R6UA 4HOZA 3FUIA 2AJXH 1AMXA 4HWNA 5EBMA 1YDPA 3GXUB 1N8ZA 4YO0B 1NBYB 5C0GB 1ZSDB 4Y19D 5L2KB 2R4SH 1J7VR 1M6OA 2F2HA 3WNIA 4XB3A 4KK8D 4C56A 3D7PA 3HW7A 5C8JB 3OXRA 4ZDHA 2YUXA 2X40A 3U0WH 2K4WA 2FSEA 4PWGA 3GXTA 4QXUH 4F2EA 5IVZB 2HVKB 2GYSA 2AK1H 1XZ0A 1OARL 4QR7A 5DS1A 2J71A 3QJXA 3UGXA 4KRPD 3SCMC 1TQBB 3QB7C 3Q8BA 1ES0B 2FGWH 3ZKXC 3CC1A 4H13C 1FNHA 3TZVD 4A2MA 3KDMA 3QZWB 3CDCA 3MKKA 5IB4B 4Y5YC 1V5JA 4HGKC 4NQSB 1GA2A 4WW1B 4PJXB 4YK4C 2M8XA 4LHUB 5F9DC 3FAWA 4XRCA 4N3TA 1FCCA 1IKFH 3FCGA 3NJFA 1BVNT 1IO4C 1J8HB 4FQCL 2AJUL 2W94A 5ICZB 3QFJD 5DRZA 4Z8FL 1G7LA 1BZEA 3FTZA 4U1IB 3B2VL 4ZX5A 3TN0B 5CKAA 3ZQXA 3H1ZA 3L3JB 4UQCA 5DLMH 4RLDA 3VGFA 4LSVH 1WA0X 8FABA 1RZ8B 4WKZA 1N2RA 5F7FA 3IJHA 5GGTA 3TYGH 4WSJA 1ZAGA 5IOKA 1JVOA 4ZAKA 1JDCA 5IM7B 4Y4FA 3BO8B 3MCG1 5AKSA 1NMCC 4XT1C 4XP6H 5ETUA 4OFPA 4TUKH 4H26A 5E8PB 2D03L 2P26A 3MLZH 5GRYA 2YPKA 5CF3A 3SY0B 2OMWA 5I6XC 5EF3A 5D7SH 4DNLA 1EEZB 3RVWD 3KYMA 3H9SB 1RZKL 4X4XA 4MD5B 2W38A 1I3GH 2JKRM 1TZIA 2OR9H 3LH8A 5DEZA 4XP5L 3ULUD 3EF7A 2JIXA 5F0PB 2CBMA 4U7MA 1FGVH 2EEXA 1FP5A 4HMDA 1AE6L 4F2FA 2DDQL 3Q1SL 2J88H 4FZ8H 3KLLA 1SBSL 3UG3A 1NCAH 2EUZA 4OLEA 4S0SD 5D1ZC 3I75A 1OF0A 5AAWC 4HXAL 5DUBA 1MHEB 5SWQA 1QFUH 1MCCA 2Y2WA 2Z6FA 1N8OE 5FOBB 1SJEB 4PJXE 3NFPA 3ES6B 3EO1B 4XMTA 3EH4B 4BWUA 3I84A 2A73A 3CIAA 2A6DA 3G5VA 2XFXA 3IMRA 3QO0B 4X2UA 2UYLB 5CIPA 1J8HE 5HI3C 2B7DT 3EH5B 4BFJA 5HJ3B 4HUXA 2DYPD 1UXSB 2P8LB 4GKLA 4B9PA 2PPAA 2BVUA 1UA3A 1M7DB 2QGCA 4WTWA 1XCTA 2H9GA 2CMRL 4LVHB 3QJRB 4Z3IA 3VRIB 3TJHD 3STZA 1KPRB 4GMSL 2OXHB 4FRWA 5IB3B 3L7FA 2GJ6A 4X4ZA 3L3IB 4JKNA 4NP9A 3B9KC 2I24N 5AVZB 5JZ7C 1NOFA 2QHLA 1DBKH 3GBNL 5C0DB 4I48A 4IOFC 3SKMB 4OZIB 1XF4B 3MA9L 2V9RA 5E6IB 1AG0A 1UD3A 1MAMH 3H9SE 4M43H 2Y3AA 1HNGA 1LEGA 3B7SA 3NK3A 3PGCB 4PGEB 5DFVC 2YGPA 3L8QA 2OA9A 4LPCA 3OF6A 4I0PD 1MWAH 4U1SB 3CSGA 3N3EA 1WD8A 5IT2H 2ZOKA 2HN7A 3Q2CA 2X4PB 2HT3C 3IFPB 5AVQB 3SYPA 3C5JA 1ZS2A 4HH8A 2PKDA 1TQVA 4Z95L 2R39A 3VXSD 4P05A 3WV0A 5DC2A 1CG9B 3IK2A 5AZEL 5I75C 4OIAA 3KVPA 1XQ4A 2Y1VA 4ZS7L 1LEKA 2C5DC 2IH3B 1R3LB 3QRLA 4XWOC 5I1EL 3WLBB 3CMGA 1LDSA 4NERA 5CCHE 5LCVH 3FB7A 1U8KA 2KLTA 5JHLA 2HAZA 3H4HA 3PAYA 1LMIA 4PW9A 4RCAA 1KBPA 4XN8A 3KH4A 1NGPH 1XF1A 4KAQL 4PVBA 3MNZA 5IROD 2LLNA 4LHJB 4NO3A 1SXAA 2ENSA 2PYFB 2ZKHH 4HZ1A 4CNIB 3B7RL 3BP7A 5IK3A 4KI5F 1T21B 4AITA 3T2NH 3AS0A 3BUBA 1ECZA 2ED6A 3J7HA 1TENA 4LVEA 3RUGE 2YA0A 3ABMB 4G59C 3UMNA 2WB1A 4RSVA 1SMAA 3MUZ1 3QHZH 2XV2A 3SGJA 1S5IH 4OQTH 5HJGA 4QHPA 4HIJA 3EJUA 1N3NA 3O8XD 5JOFB 2XLLA 4LLVB 2IV8A 1ILSA 1NCNA 1GGTA 4AZUA 4B53A 2WXIA 2JCCF 1B2YA 2JJUA 4XNBA 4P2OA 3U9PH 3ARBD 3GMQA 4X6CB 1IV8A 1ZXKA 1MRFL 3VDCA 1FH5L 4H1LB 1E0OB 2B4CL 2QQKL 3GM0A 5EO0A 4LLWA 5A1AA 3ZE2F 2N56A 1YNLL 3MOAH 2ENYA 3IE4A 2EINB 1CK0H 1MCEA 5DXWA 5ESQB 2J55A 5IUCA 4HUVA 3RPIB 2AV7A 2CU9A 1RQ5A 1VACB 3L3OB 3T0VA 4F7CB 5JORA 1GOFA 2ITDA 2C9UA 2R69H 2DQIL 3UAJC 5I8CA 3QDHA 2OQJB 4AIEA 4M3JA 3OJDA 4G5ZL 4NENA 3P0GB 1J0YA 4JG1L 5GJTL 3D18A 2JQZA 5FUCC 5BRZA 3HI1A 1QHOA 2MCMA 5IB1B 2WWKT 4BM7A 4C83A 1I8KA 3BVNB 1USZA 1SXZA 1EFQA 5I1HL 1IAIL 2P8MA 3VFGH 3FO9A 3MROB 1W15A 1HEZB 1NMBH 4LLYB 4LMQI 5EZIL 4A2FA 4AE1A 3KPQB 3DO3A 4PGCA 1SVCP 5EF0A 1MFEH 3CFBB 3HJ0A 1TTCA 4B9IA 2OXGB 3TT3L 3V10A 4NUGL 2B4CC 4MA7L 1IGCL 1NJ9B 3CG8A 3HLAB 4S1SL 3MBXH 4ODXB 3F64A 3AY4A 4BH8A 1KIRB 3MJGX 3RNKA 1IBDA 1W0YT 3N41F 2BNRD 4L0PB 4P57A 5LAXA 1Q9LB 1ITCA 2PW1B 4O51A 1LO2L 4HV8A 4QHKJ 4XAWH 5DCCA 2XT1B 3KPMA 5C70A 4X6CE 5AYUL 3LEYH 2OMUA 1BAFH 1V05A 1XGPB 3BIKA 3EZ8A 3PQYD 4Q9RL 4FMVA 3H6AA 5C2BL 2G5UA 1WFJA 2MKLC 3SE3C 1I8IB 3SODB 1HSAB 3DSFH 4J2QA 4YPGB 3GO1L 5FHBL 5T1JA 3AT9A 3FQUB 3HMXH 2Z3FA 2K0RA 1XXFC 4DP9X 5HD8D 1H3PH 1CVSC 5ANHA 3GYRA 3GXIA 2E5EA 4PAZA 4Q6IB 5DTFB 3QQ4A 4JHWH 4N24A 1M2VB 3FHAA 2Q7YA 2HSIA 2ICWI 3C6EA 5DHVB 4JPSA 2C3VA 4KVPA 5T5NG 5KN5A 1GW6A 3KPSB 1Q0EA 3AFLA 4YEFA 1KFGA 2DQHL 3JT2A 5B7MA 4BFIB 2AJZB 3DXAA 5C0IA 3HC4L 5HHXL 5CMAA 3SBWA 3QG7H 4OW6A 1SFDA 3ZKMD 4AL8H 1F3DH 2DWEA 4N68A 1YA5A 3UERA 5MI0C 1NSNH 4PJ8D 3TXAA 1KB3A 2DI7A 3D34A 4BSJA 5IEHB 4B7IA 1HKFA 2AJXL 2IJ0C 4WF7A 5I0WA 4ZX6A 4ZUSB 3V2AR 1ZY9A 5T1LB 1O9WA 2O6PA 3DO4A 3GSRA 4JG0H 4N20A 5E1AB 1SUHA 1FFRA 3V0IA 1HEJC 3SE4C 4RGMB 2FATH 2YPLA 3KXFB 3R7RA 3EG9A 3LQZA 3FB5B 1SXNA 4H5SB 3TPKA 4QXUL 3SZ6A 1J1OH 1A6TA 2VM9A 2VLRA 2W59A 3T0AA 5IMKB 1P6WA 4PRAA 2A4ZA 1YEDA 4Y2DD 3CWGA 3MUHL 4B60A 1H8OA 2A1WH 2FGWL 4KI1A 4DVBB 1NFDA 3HS0B 3KWWA 4OF8A 2OJEB 3FT4A 5LAPA 3PDGA 2IWGA 2YGQA 3IXAB 4LEXH 5EH1A 5EN2B 3TYFB 3GBDA 4GO8A 5F89B 1U93B 1WTGT 1IKFL 2WLHA 1N6VA 2A4CA 5BQ7A 5D6DA 2WQVA 5SX5K 1ZLUK 3QUZC 1X6LA 2K3TA 5FA3B 1VESA 3TONA 3GMLB 5DJCA 4BRJA 5IFJA 2V5RA 4FKEA 1PLGH 3UYRH 4FXLA 5EBWB 3V7AE 3SDDC 3KPSE 4PCSA 5DLML 4LSVL 3GMRA 4GSQA 1TMQA 4E42A 2EEBA 5C6TH 1F3JB 4P9MH 5DZOA 2W9EH 4KDTA 1ACZA 3CSPA 3B2DC 3TYGL 4KI5C 3X1FA 1KB9K 1M1XB 2E46A 3OG6B 4XAKE 4OJDH 3ATBA 3FCUB 4NWUH 4XP6L 3R8BB 4AKOA 4CC4A 3U1SH 4TUKL 1J5CA 1ICTA 5TTRA 2D7MA 3MLZL 3OKMB 4PJGB 3M07A 4AC2A 3GBMH 3I6KB 3VXUA 2P5EB 4KXZI 4B5ZA 1GCFA 5D7SL 4H1LH 3TPUA 1JPFB 1RJYA 2CRMA 4JEGB 3GIVB 3UYOD 5ABAA 1F0LA 1I3GL 4KO6A 1A14L 1KELH 2HB0A 2OR9L 5E9DD 4APQD 4WKXA 1XGTB 1BM3L 5M95B 2D2CC 3CVBA 1I7TB 2EDXA 4NI3A 5GRVL 4I77H 1FGVL 3UBXB 3VFPA 2ESVD 2BWDA 4POUB 2J88L 3FAXA 3IGLA 1MHHB 4FZ8L 3X12B 4G7QB 3LV3A 3UTTD 4JMNA 4RFNC 1NCAL 1AY1H 1UQSB 1Q8MA 4A7QA 1D7CA 3G04A 3GZKA 1KJ3L 1QFUL 2UZXA 2APBA 3M17A 1SDAB 5MEPB 3KS0J 1PQZB 1RHHB 3SHSA 1DQML 1CVRA 3DX2A 1HT6A 3K2MC 5JHBA 2A9NH 3HHMA 3HC2A 1ROWA 4A55A 5J1TC 1UH2A 4KQ0A 2XWJB 4F9LC 1MZZA 2M1KA 4F37F 1ZTMA 4WCYH 5GS1A 4HEME 2BSSA 1CT8A 2EDTA 4P2QA 3CDZA 1CICC 3SDCA 3VFTB 2NDGA 2WZAA 1O6TA 1LEIA 4L3EB 1T6BX 2G3ZA 4LU5L 3U0TB 5IQMA 3IGAB 3BRFA 2DWTA 3QGVA 1GPOH 1G84A 3VM7A 1RZ7L 2IOOA 1CDUA 4F33B 1DBKL 3BCDA 4PIBA 5DJ2B 1ZV5A 2P5EE 1QD0A 3P9WB 4XN5A 4YSAA 4NC1E 2QTEA 4NUJA 2YD1A 4YPJA 1MAML 1HHKB 4M43L 5IVXA 3DMMC 4BUGA 1P5UA 1QSZA 1ZE3H 2PXYA 3JVGA 4JANA 3FFDA 1MWAL 2Z8VC 4HGMA 3U82B 1KIUA 2BMKB 2R83A 3M1BB 5IT2L 3ML8A 4JPVH 1ZWIA 3IRZA 2JJSC 3T4YB 4F27A 3LNFA 4UOZA 5DUMH 4LL4A 1ZHNB 4XGZB 4OAWA 2YWZA 4FG0A 1IQDB 4KGLA 1T1WA 3QI9B 2R8SH 2Y5QA 2VLME 3J07A 5LVEA 4LKCB 4ODWA 1FIGH 4Y4KD 3RP1A 3HG1A 5FEBA 4LSRH 4H44C 5HI4D 4NZRH 3ZGHA 1JD9A 1OE2A 3MRDA 3GBLA 5KYXA 1NLBH 1CFQA 4KWUA 5AVRB 1J87A 1PIGA 3FCTA 3TVMC 3S3CB 3SDXB 1NGPL 5F9JA 1KYDA 4IKIA 4HS6B 3HG0A 3FDWA 4YHOL 4AQ1C 1S9YB 4L1HA 3VFOA 2Z4QB 2ZKHL 2Y2TA 1U8CB 2B1AH 1GH7A 4S0TD 4YDLB 5SX5H 1JGDA 4KH2A 4XO3A 1ZLUH 2I07B 4Y5VC 2YA2A 1YHPA 1NDGA 2OMXB 3RWGA 5BZZA 4ZMPA 1I1FB 2Y5TA 4U6XB 4GRLD 3RHWK 1VFMA 2H0PA 2ZWZA 2XUWA 5C0BB 3KPRE 4TRPH 4TUOA 3MGTA 2DEXX 1GXEA 4L9LB 3QHZL 4GI9A 4A2DA 1S5IL 2Y5EA 4HKBA 2OSXA 3HAEH 3QRFM 4NNYB 1NCTA 5F7HA 4MNGA 1LJMA 2JI1A 1GGYA 3U9PL 1L6XA 2CCWA 4FAAB 5FW7A 2K4AA 3A23A 3ZN6A 4DPAX 1FH2A 4WU5B 3CVDA 2DBLH 2HX8A 2OSLA 4P06A 3WIIH 1BGXH 1EZSA 1G7JB 4N85A 1LO5B 4J8RB 4TOYH 3ECUA 5I1LB 5JDJA 1GGBH 1MN4A 5J1SC 3HG4A 2ZX9A 3MOAL 1TCRA 5DEJA 4U6TA 4KKBC 1CK0L 2NNAB 4E36A 1RJLA 1VDGA 1DQDH 1BQ5A 1EAPB 3VE0B 5AFAA 4P5RA 2FJHA 3GT6A 4GIAA 2R69L 3TCTA 1OLZA 1TQBC 2ICEC 4LCUB 2O5ZH 3TH2T 4DGVH 4GY4A 4OJYA 4GKZA 3SDXE 5F3BA 1FZMA 4XXWA 4TPRH 1JXDA 1OVZA 5FO7B 3C60D 4GQPH 1ED3A 3KEHA 5F1SA 2B1HH 1NBQA 3VFGL 3TX4A 2AQ2A 3DX6A 1NMBL 4JDEB 2NY3D 3DA0A 2UY6A 1BQKA 4QTHB 3VFSA 4XPGH 3QUXD 2KQNA 4NZFA 1MFEL 1PZBA 2E7LC 3X3GL 1C7TA 4GAJH 5CN1A 5DJ0B 4BH7B 3AACA 3K71A 1P84J 3FFCB 4TVUA 2B8OT 3H2QA 4PWIA 1QBAA 4Z7VB 1NIAA 4PGBB 3CXFA 1OAQH 5D7IB 1KGCD 3MBXL 5F7EH 4X6BA 5DQJA 1ZT4A 3O45B 4AYMC 2JKNA 1SUJA 2V3EA 5GRJH 5I2IB 2RB8A 5HGAB 4XAWL 2VQTA 2BWIA 3VFUB 4FQJH 5IBUB 4I3SH 3K81A 3LEYL 1BAFL 1UFUA 3CHXA 3PP3H 4G72B 4N2BA 4N9GB 3FT2A 3WOVA 4X5LA 1Q9OA 1IFHH 1T1YB 4Z76A 2XG4B 3FHEA 3DSFL 4HUWB 1CBVL 1HKLH 5HHQA 3ATDA 3HMXL 4OGAC 1ASQA 4RFEA 2JKJA 1DSYA 2WQUA 1H3PL 5J56B 1QRND 4PN6A 4HH9A 2WLLB 4KKAD 1IJNA 5E9NA 3PWVB 1B0WA 4WEMB 5G5DB 3DJSA 1ZA6B 1CS6A 4J3WA 4X0KB 3BMWA 5ALBH 5C0JB 1PSKH 5FW8A 4LRIA 2J6EA 1QLRA 3QG7L 4R83A 4JRYA 5D1XA 1BZQK 4AL8L 3QDMA 3QEQA 4V2CB 4ZUWB 3T0XA 2ZUUA 1NSNL 3NH7L 4M6NH 1FZOA 1SXBA 4OFIA 3KPOA 1DANT 4KPHH 3ARXA 4N2EA 2G5RA 3BH8B 2F7QA 1XF2A 2VDPB 4AEFA 5FPIA 3KGRA 4XPHL 3FFCE 4GG8B 1S7XB 3IDUA 1UA6H 5HDBB 3TO4B 1PZ3A 1IEAA 5D7IE 3EH3B 5KVDE 1KTJA 3CX5K 2FATL 5T3ZD 1VADB 2W8CA 4NRYA 3EBHA 1J1OL 2BY0A 5EBMB 1UWXK 4AQOA 2NYKA 4PBDA 3CK0H 2O6FA 3EGSA 1N26A 1M6OB 4DZBA 4C56B 3EO9H 4NN5C 5LG6A 2V37A 3OXRB 4ZDHB 4L4TB 1TFHA 2FSEB 2QFRA 3SDAB 3O2DH 4HK3J 2A6JA 1D5MA 1XZ0B 4LEXL 4NWTH 4AL8C 1TLMA 2UWEB 1K3IA 3QUKA 3GMMA 1R3KB 2XQBH 2VDKB 1QPKA 1TTBA 3BKMH 2TSBA 1DLHA 4AVHA 1UM4H 2OAAA 3Q2LA 2WXOA 2X2YA 1REIA 4IIQA 1ZRUA 4N8CH 4AM0A 3UYRL 5C9KA 2XRAH 2CHZA 4S2SA 5BCAA 3NSDA 3BQUD 3MLTA 1ETJA 4JPKH 1GHFH 3P3YA 4N0YH 4QO1B 3V9FA 4WK0B 3L3DA 3RI5K 5C6TL 3FT1A 4P23A 4P9ML 3QIUB 4KC3B 5C09D 3O6LH 3BP6A 2Q87A 1M57B 2FT7A 2Z7UA 1VEPA 3QIBB 1G7LB 4LCVA 5I82A 4A7TA 1DO5A 4NWUL 1X4ZA 3U1SL 5GZOD 2A9AA 2J57A 4HKZB 1HQRA 3GBML 8FABB 4WKZB 4N25A 1MLBA 1N2RB 1EZUA 3IJHB 3MTXA 1X5YA 3FQ4A 3BKCH 1U3ZA 2V2TA 4ZAKB 1BX2A 1KELL 2UY7A 5ETUB 1MVFA 4H26B 4P04A 1SDDB 3RE0A 3NJLA 2YPKB 2PO6B 4FFYA 4I77L 2OMWB 2PWFA 3TH3T 1PZAA 2YEQA 4N6RA 3RGBA 2ZSWA 4NUMA 1YY9D 1GCYA 3KYMB 1TDQA 4BZ1A 3ROLA 4X4XB 1KBBA 4PH8A 1TZIB 4E9WA 1OD9A 5FOJA 3T0ED 4QLWA 4L8CA 1CFMA 3MRFA 2Z7YA 2B0SH 4L4TE 3WUZA 4MJID 2R7EA 3NZHH 5CZKA 3EJTA 2GUYA 5LWYH 4XTRC 3IU3A 3K6SA 2UWEE 3W5NA 2N59A 5TQ0H 3DV4A 4Q0XH 4O5LH 3SY6A 2BZ7A 5KVFH 4MJ4A 2A9NL 3DWTA 2IGLA 2X6MA 3WE6A 1TKWA 3LD8B 5DUBB 5SWQB 3GSVA 3MCYA 1FVCA 3P0YH 1BVNP 4FADA 1QZ1A 4WCYL 3NFPB 2KQMA 2GSGA 2A73B 3G5VB 2A6DB 2XFXB 4A2HA 4FF9A 3KLHC 1BZDA 5L8JB 3D50A 2F53E 3CZEA 3B9EA 3FPXA 3CLWA 3DPBA 4UT7H 3L3OC 4HUXB 4WK2B 3H3KA 1GPOL 3NABH 1VGKA 2HKFH 2I7OA 3AMKA 3SEPA 4JE0A 1LP9E 1NIDA 4N0RA 4QGYA 5DMIH 3GIZH 3SGEH 3UJIH 3K4ZA 4KROD 1XCTB 4FTVE 5DHXB 2H9GB 5B39A 3VWKC 4JY6B 1AR1D 2EDOA 4MQXD 3V4UH 4P99A 3STZB 1QVOA 1L3NA 3CLEH 4EI6A 1XGQA 3MRRA 2EDBA 1TR7A 4OM1H 3FBKA 1OWRM 1KXHA 1E9OA 1Z9MA 3FCSA 4JPVL 2EJ1A 4QTFA 4ZS6C 1NTDA 1IAMA 3CFIC 3NA9L 1CYXA 1KTCA 1AACA 2EXYD 4FG6D 4NC0B 4Z7UF 4GQ9L 1LEGB 3DRTA 4KOCA 4UTCA 4BFFA 1JHLH 1HC1A 4WNQA 3V8OA 3NYKA 5T8IA 4HJGA 1SRDA 5ACMA 2BOBA 5J8OA 3GRGA 5K5YA 2JELH 2R8SL 3PWPB 2ZOKB 4XE0A 2HN7B 4S1DC 1FIGL 1KPVA 2QSTA 4XMVA 4PM1A 4LSRL 4NZRL 3HC3H 5HI5C 5HHNA 2HMIC 1EMTH 5FFOA 2B39A 1NLBL 7PCYA 1CUOA 5EDSA 1AO7E 2YRBA 5DDHA 1T7WA 3UC2A 2JQAA 3N42B 1LEKB 3VNZA 1LHZA 5KYWA 2EP6A 2XXCB 4PJHE 1FFNB 4N2HA 1VZIA 2B1AL 1XH0A 2DD8H 3FB7B 4NZUH 1ZE3C 2AAAA 4PCKA 2Z31D 4QCIB 1U8KB 3F5WA 4YLQT 3RHWF 4HFWA 2E8YA 5K59F 2WYHA 1JG9A 3MRCA 4Q6IC 4XX1E 4YHZH 1PTZA 2GJRA 2WXKA 3MNZB 3DTDA 5IBLD 4TRPL 3V4VA 4NRXB 3U4EA 2GHWB 5C97A 5IK3B 4HGWA 3QJTB 1WBZA 3ZDYE 4FHJA 3RKPA 3VD3A 4S1RH 5C0FA 1NAMA 5CN3A 4CU6A 1I53A 1IAIM 4V33A 3AT0A 2E6PA 1BV8A 5D1ZI 4XR8C 5F3HA 3VMOA 4KJPD 3QH3A 4NKQB 3LVEA 3WIIL 3QXDB 1E6OL 2VUYA 5DGQA 2WW8A 4TOYL 5AVVB 5DMGD 1N3NB 4W9JC 3W56A 1GGBL 2LAGB 1RK1A 4OLXH 3QQ3A 3PWPE 4P2OB 4WNSA 3GMQB 2OYPA 4XP9H 3TC9A 1UM6H 3IFLH 2V5MA 3ELAT 4I2XA 4U49A 4ESKA 1TVHA 3KLSA 4KK5C 3BWAB 3E7JA 5B8CA 4DGVL 4CSZA 2OMVA 4TPRL 2BY1A 3HS0C 3W2DL 5GGTH 3E0GA 4AYID 4HUVB 2AV7B 1A1NA 2EABA 3X13A 1SFHA 3OMNB 5EDXA 5JORB 2ITDB 3CZJA 4YHPB 5JXED 3W11D 2B1HL 3ORJA 4TQEH 4BFKA 4QNPF 5T1KA 4CN1A 4N2GA 1CYGA 1SHWA 4XPGL 2G75A 2PCXA 3OJDB 4NENB 4YBLB 3D18B 4AQ8A 4B6ZA 3L3HA 4EXPX 4IGBD 1G4RA 3ZXAC 4GAJL 4MAUL 1PD1A 3HI1B 3MLWH 4Z7WA 3MV8D 3MXWH 3RU8H 4F91B 4C83B 1BF5A 4A38A 5CZXD 2P8MB 3FO9B 1DE4B 1OAQL 1RIVH 3ARZA 4WTZA 4PG9A 4YNYA 5F7EL 1KULA 1UOWA 3SIKA 1NFAA 3LN5B 4IKNA 2VLKA 4PGCB 5GRJL 3B2PA 3EJYD 4OUOA 2CM5A 1A8JH 4E5XG 4JJHA 4FQJL 3F12A 4I3SL 5CR1A 2C9VA 4B27A 3VRJA 2FJGA 4GP5B 1O75A 2OMBA 3RTQD 1IFHL 4PVMA 4PV1C 4KNTA 4YXHH 1XTLA 2AMGA 2HRPL 2X28A 4FX5A 4AYFA 1WWBX 4JO8A 3RNKB 4BH8B 5FF6B 1U8NA 4P57B 4O51B 3W0WD 4HV8B 4M93B 4DESA 3KPMB 3F7VA 5CIPH 2OMUB 3EOAB 3BIKB 5JIPA 5EUKA 4RAUB 4AE0A 4ZPTB 1ZMYA 1MCOH 2LT9A 2MEJB 1WBYA 1QBMH 1CQKA 4ZNEE 1RVFH 3O4LD 2IAMC 4JKPL 4RZCA 1PSKL 3UZEA 3EDDA 3WN6A 2NNXA 2GPZA 4IU3A 1E7VA 5GS3A 5B7FA 3D6GA 4XVUC 2WZPA 1E4XH 1N64H 2VDOL 3HNSH 1URIA 4KJQD 4N1CA 3QQ4B 4KZDH 4HZLA 2Q7YB 1TQCB 4M6NL 3SKNA 2C3VB 4J3BA 1IC0A 4UZGA 4W4NA 2L4OA 4MMZC 3BJLA 5LGYA 5DJ6A 3SZKC 1WT5C 4U6VH 5MENA 3DXAB 5C0IB 2QMKA 2YQ2A 2PABA 3U6XA 3U7AA 2BX5A 1YQVH 2DWEB 3AROA 1UA6L 3VWJD 3WJJA 2M26A 4N0CD 3ZQWA 3ZK0A 4PQXA 1NLDH 4HC1A 1L9PA 2VJ8A 4ZXBD 5IQ7H 1KIQA 4XCNA 4LE8A 5DVNA 5E1HB 1VRSA 3GSRB 3ZRCC 4DH2A 4GH7B 1BM7A 2NXYD 1XGZA 2WHVA 3CK0L 4Q7DA 5KZCD 1F2QA 4UV4H 1NBCA 3VJ6A 3GHEH 1E5AA 2XU9A 1BEYL 2YPLB 3EG9B 3LQZB 3O2DL 4O58L 2O5NA 1XR9A 4NWTL 3VXSE 1CLCA 2YD4A 5JHLH 4IMKC 3GDCA 2XQBL 2FT6A 1AZCA 1A7QH 1WAAE 1LVEA 3BKML 1KXVC 5INCA 1UM4L 3NRQA 3KL0A 3KWWB 3S5LG 4N8CL 1X5JA 3FT4B 1K3ZA 2XRAL 3DOIA 3BRGC 1N6QL 3MLVH 5B1AB 1J5DA 1QR4A 4JPKL 4G70B 5FO9A 2AXFA 1GHFL 4N0YL 3RI5F 4CBPA 3QI9C 2E9GA 5D5MF 1BZ8A 5D2LE 4JRFA 4X0NA 5DZVA 3N40P 35C8H 1UHVA 4ONGL 1U8JA 2A3TA 1DVSA 3DC0A 4OCWH 4BHUA 2WQAA 4G8GA 1SGKA 4WTXA 1HZHH 1KJVA 3GMRB 4E42B 3LSOB 1HHGA 2V3FA 4RISH 3BX7C 2HTKD 5AKTA 1QR1A 3BKCL 1YUHA 4M5TA 4YDLC 1IVTA 1DQVA 3OQ3B 5GGSB 2MIZA 1V7MH 2YD5A 3BXNA 3VXUB 1PX4A 2DI9A 3GFUA 4M6AA 4J4PC 3TPUB 1RJYB 3CFMA 4W9EC 43C9A 3IETA 4KTGA 1IAII 3RG1C 4AQAA 4WFED 2YPLE 4L9LC 1KGIA 1X7SA 4U7SA 3P02A 2J2ZB 3UGUA 2AQ3A 4KO7A 3ABGA 3VFPB 5LWYL 4URKA 1IAOB 5D55A 1FO0A 1QP1A 5CD5D 4MRCA 3ZKND 1F00I 4Q0XL 3N43B 3QR0A 4O5LL 3WNNA 5KVFL 2P24A 3NEEA 4JVPA 3HIZA 2BIHA 3EYOA 3BFOA 1IVLA 3BZ4A 3G04B 4PY7A 1KF9B 5JIIA 5D71H 5GRUL 1OLLA 2UZXB 3EJZD 3P0YL 2J4WH 4MB3A 4DWHA 3M17B 1HJBC 4X5PA 3DUUA 3RZWA 1UWYA 4MQSB 2I5YH 1U3HD 4GUQA 4UT7L 4ETQA 1MCKA 2XZAL 3F7PC 3NABL 2HKFL 3FB8A 2JKSA 4K71B 4L3FA 3VI3F 5DMIL 2FHBA 3GIZL 4GLRH 5I0VA 3UJIL 5IWLA 1G0DA 4XVJH 2OM5A 3IVKA 4L8DA 1CT8B 4P2QB 4IBSA 3CDZB 4TXVB 1BFVH 3SDCB 4R2GB 4AQZA 1LEIB 4K94H 4P5KA 4EI5D 4OZGA 3CLEL 3CV5A 4OM1L 3UAEA 1L9RA 4QJ4B 1I85A 4F7KA 5DZJA 1J8RA 1Z9NA 1ZLVH 2BNRE 5HDWA 4OLWH 2IBZX 4KX8A 4CBZA 5IVXB 1JHLL 2Y7SA 3DURA 3A5VA 4FERA 3WI9A 1FPTL 4M8QA 1P5UB 4HULB 2PXYB 4JANB 4AUJA 3PQYE 4YDZA 3TF7C 2QLVB 2KL6A 2FO1A 1HEHC 2JELL 1KIUB 3X1GA 2GTWA 1DVZA 3HE7D 1ZWIB 3EO0A 1UZGA 4MB4A 3HC3L 4J23A 1EMTL 2FH8A 4M02A 4P3DA 2YAFA 4TLSA 2WO3B 3LPFA 4OAWB 5FYLD 5EIIA 4PV8B 1T1WB 3CHPA 4GQRA 2XN9D 1M7UA 3JZYA 1Q0XH 4AV0A 3QORA 4BD4A 1MFBH 3U4BL 3HG1B 4S1QH 3SPHA 4AK1A 2GW5A 1WZ1L 2DD8L 2RQ8A 4LPUA 2Y7MA 2H2PD 4NZUL 3MRDB 3P73A 4PY8I 3WFEH 2OMYB 1HL4A 5KYXB 1CFQB 3RDTA 1EO5A 5ID0A 5SV4A 3FCTB 1AKPA 4S11A 3VQ2C 4ZT1A 4YHZL 5I5JA 4W6WB 1USQA 4WU7A 3O2VH 4ATWA 5ENWB 3N5AA 3VFOB 2R29L 3GB7A 3S96A 4GT0A 2AEOA 1JGDB 2J7LA 5DK2A 5DWUH 3ATAA 3FQYA 3M7OA 4S1RL 3RWGB 2Y5TB 4I9WD 4M1CC 1HH9A 3PP4H 1CDYA 5DC0A 4AYDC 1A5FH 4R0LC 3MGTB 2BXZA 1B9KA 3FU6A 3N04A 5HDOA 2VT0A 3POHA 3SJVD 4C4KT 5E94A 1CPUA 4QRUA 3TO4C 1M9WA 2WD0A 4OLXL 5D7LD 3ARDA 5HGGS 3UBFA 1OB1A 3IFLL 3I3EA 4MKMA 3OKYA 4QRBA 5GJSH 3N44B 2C7UA 4N2IA 3OKOA 4ZRGA 3ZYZA 2OSLB 2VR7A 1D7FA 2P5WD 5JIQA 4YWGH 4DP2X 1RAMA 3UZVA 3VFMA 1TCRB 1VB9A 1QKZL 5GGTL 1RJLB 2V9TA 4IQHA 1GW0A 4WHTA 2ZT9C 3CDGA 3HG1E 5AD0A 2A9CA 1ILUA 2FJHB 4BGDA 2WKOF 3HE6A 2IPTH 4PGDA 3WLWD 3MZGB 2BY2A 1N19A 4ZG1A 4RX4D 4LOUC 2F7PA 4H1LG 5F3BB 1U8LA 2OX5A 1FZMB 4PBVC 5IMOA 3RU8L 3MLWL 1OCOB 4H2AA 5GZNA 3GSUA 1ED3B 3S7GA 2N4IA 4BSVA 1RIVL 3Q5TA 3WBDA 5FGCE 2UY6B 2AQPA 2DOCA 4PJIE 3VFSB 5ILTH 4HIHB 3AG1B 3ABKB 3V6OA 3K71B 3BW9A 2AZUA 3VGAB 4K5LA 5KBNC 5DRWA 1OB0A 3H55A 4YXHL 3QDAA 2ESVE 5DQJB 1ZT4B 5MP6H 2VKWA 2D7NA 3RPKA 1N68A 2FX9H 2ZONA 4YMPA 4ZAKC 1K4DA 3MRMA 4Y4FC 5C0CA 1TTRA 1HSBA 4YSEA 2AK4D 2X05A 1O7DC 1HHJA 3FT2B 1Q9OB 4MD0A 4Z76B 2VIRA 1MCOL 5EF1A 4OZHA 3WJMB 1QBML 2C9XA 2CDEA 5HHQB 1ASPA 2YUZA 3HLKA 3MLXH 5JIKA 1AXSA 1RVFL 1UJ3A 2I7SA 3HPLA 1WGVA 4RFEB 4MTMA 1RK0B 1BJ8A 3IF1A 3PFQA 1E4XL 1N64L 3HNSL 5B21A 2YRLA 4PS7A 4KZDL 5BV7H 2ED7A 4UQIM 1IE4A 2RMNA 1FJ1A 1I4FA 4ENEC 3T8MA 5I1GH 4R90L 4U6VL 4E9SA 2COVD 5A3IC 4UT6A 1QLRB 1S78C 4KHXH 3BH9A 3NCEB 5D1XB 5CBAA 5HYJA 1YQVL 1FNSL 3QEQB 3CZUB 2DRUA 4Y1TA 4F7TB 1G0XA 2YD6A 2CHWA 5FC9A 2VLJB 3KWUA 5I1KH 1SN5A 3D12B 1NLDL 3CXHJ 4BZ2A 5IQ7L 1XF2B 2VZ1A 1GYUA 3JTBA 2P1YA 3HNVH 3SD5A 2VNCA 4UV4L 4JKLA 3GHEL 2QGBA 3CZFA 3BSHA 4G7SB 2Z8RA 2ADJB 3WKYA 3QWQB 4ZI8A 1MVUA 2COQA 3EGSB 2X4SA 3TZVA 2IWEA 4X42A 2QPFA 1G1YA 4X4YA 4FLOA 2I60H 4OH2A 3DX4A 4IHOA 3U4AA 1KTKE 3MLVL 2BC4A 2A6JB 1AH1A 4DCQA 3QUKB 3GMMB 3PG2A 4ZTEA 1KCRH 4OGQC 1OCZB 2D0HA 1C5DA 2W0PA 1DLHB 1EGJA 2DEYX 4XBEH 4E68A 35C8L 2L3BA 4IIQB 2WXRA 3QYMA 5DURD 3MLSH 3AWFA 4OCWL 2DW5A 5I9QB 3F62A 4K9EH 4S2SB 1DO6A 2VDNB 5FV2A 1NFDF 3MLTB 2IQAB 1HZHL 2HXAA 2X4RB 3JWNG 3HAEG 3L3DB 4OF6A 4P23B 3QEQE 2XWEA 4RISL 3BP6B 1EIBA 3WFHA 2YC1A 5L6YH 4GPVA 1FUNA 2VLJE 1TSHA 3NJXA 5B38G 4JO3H 2JNZA 4B3VA 1LE9A 3QDJD 1V7ML 4J8QA 2Q6WB 2FX7H 4HBCL 2GB2A 3QJZA 1AS7A 2F74B 2ZCLH 5GGSY 5BW7A 1MLBB 1CD1A 1S7VA 2X0WA 4O00A 4KKZA 5E00A 5DZPA 1TFPA 4Z7QB 2V2TB 3ZUCA 1BX2B 2UY7B 4HG4K 2EIDA 1FCGA 2FYYB 2HLFC 2C1PA 2VMDA 5ALCH 2ZXWB 5E4IA 1J05A 1Q90A 4ZOBA 3GI8H 3HNTL 1NINA 3ZDZB 4N6RB 4HSAC 2ZSWB 3IN2A 4D7BA 1R19A 4BQ8A 2D7OA 4TF4A 1C1EL 1WFOA 1QASA 4DW2H 5HHMB 4L8CB 3MRFB 4MMXA 3SGJC 2ZCZA 4AVIA 2G3NA 4WQOA 4EQ2A 3IU3B 3K6SB 1CO1A 2J4WL 3D0VA 1QPXA 1SQ2N 1U3JA 1UCTA 2XV6B 3UBXG 3KWVA 2I5YL 4P2OC 4GBXD 4IW4C 3V5KA 3ARTA 4HA1A 2GSIA 5DRNA 1EZVY 1CD8A 3HFFA 3S3DB 1LL1A 4LL1A 3WE6B 3R06A 1TKWB 3VYPA 3GSVB 1FVCB 1A4KB 1NPJA 1PYWA 4TTDC 4XCEA 2QPEB 2OCJA 2F1BA 4XVJL 2GSGB 3D2UD 3VO0A 2O4EA 4FQHB 3IS0X 1P9MA 4NQDA 3A4AA 2Q3XA 3RVXD 4K94L 1ONQB 3RIFK 2A6IA 3BP4B 1E65A 2EIEA 2Y7QA 3B34A 1VGKB 4NQCA 4ZFZA 3FU9A 4OCSH 1TG8A 4DP6X 2EE0A 1I1CA 2VZVA 4YBLC 3S6CA 2WK2A 3VXRD 2DMHA 5B39B 4OLWL 4FQ2H 2PLTA 4Z7QE 7CGTA 5KSAB 1QVOB 5IZ7A 3LIUA 4JM2B 3MRLB 2DQTH 4EI6B 2ODIA 1XGQB 3MRRB 1YN7A 4PTUB 2O93L 2YMOA 2ODHA 1E9OB 3FO2A 5AW8B 3ZYIA 3GK8H 1JFQH 2NR6D 2C3XA 2ARJA 2VR8A 3DRTB 3VQ1C 1EH9A 4WNQB 3FSAA 5HHME 1QRNE 4HJGB 2J6EH 2PMZA 2BOBB 3HUJE 3Q43A 4JFPB 2DIEA 4XNAA 1JF1A 1Q0XL 3AY4C 4JM0A 2FT8A 1KPVB 1MFBL 4K94C 3IDIA 4S1QL 4M93C 2EDEA 4HAGA 4ZMXA 5HHNB 1L7TH 3LZOA 3WFEL 2PWGA 4Q52A 1YMMA 3PWUB 1YYMH 3VG0H 4BFGA 4X7CC 5IGXL 5E8EA 2YSTA 1ETA1 4I5BA 4MNQA 1NCDH 3O2VL 4B7LA 5K69A 5FK9A 4A7GF 3SPCA 3GMNB 1A4AA 1HH6B 2YJLA 3TEZA 1N59A 5GRWA 2IPUK 4P3CH 1RUPH 1E5UI 3F5WB 5DWUL 1Z3GH 1H8NA 1MFUA 2KBGA 4HFWB 3MRCB 1WIOA 4JKMA 2PW2A 3VXPA 1WPCA 1TQCC 3PP4L 1BMWA 3V4VB 1A5FL 5T3ZE 1IILE 3WN5A 4IM8A 5DSCA 1DVYA 4OLUH 3SBWC 1LWRA 3F58H 4NSKA 5C0FB 1NAMB 4BFBD 4XNZC 3GHPA 4OFDA 3ARBA 4C59B 2FEDD 3FTWA 3KPPB 3VH8B 5F3HB 3D8MA 5GJSL 5MEOA 5E08H 3LY6A 3FSWA 3QH3B 3TGXA 1YPZB 2Z93B 1A4CA 1X5AA 4Z7NB 5DHDA 4YWGL 2VDNH 1HAUA 2P8PB 4IRSD 4PRHA 3EH2A 2WNWA 4PUBH 1RK1B 3QQ3B 5HHOD 2CO3A 5JYLA 4URTB 5EF2A 1AZNA 4I2XB 3NCFB 3EYQC 2ZPKH 2CNYA 1TVHB 2IPTL 3CVIH 3ECBB 3L9EA 5B8CB 4NIYE 4JO2H 3APFA 3CH8A 1BJMA 1G1OA 2OMVB 3CX2A 2WCSA 5C09E 3BUPA 1HINH 1MNNA 4XBMA 15C8H 2NY5H 4HPOH 4EVNB 3V4PL 2XX1A 5DS8A 4RAVB 1A1NB 3X13B 1J86A 3LXCA 4WV1A 5T1KB 1PF3A 5MHSD 1BLIA 4PB9H 4FFYH 5ILTL 5D6DC 2AP2A 2G75B 1F02I 4IJ3C 4OJFH 2O5XH 2Y06H 4OM0H 3BN9C 5EORH 3D85D 1CLOH 4P5TD 4BZ1H 3H53A 4ODVL 2AF2A 4A2LA 4FFWD 2FWOB 2LHAA 4EEEA 4ZW6A 4YNYB 4PG9B 1QSEA 5IHZA 3EOTH 3NJNA 1GC1H 4PJCA 5CEZE 4DERA 5CCKH 4KDTC 2V7HB 3ZO9A 1T66D 4TL4A 4NRZA 5LGHL 3F12B 4AVJA 2DQFA 4CC4C 4Z7OB 1JS4A 4HUNB 3VRJB 1FZKB 5I16A 4Z7AA 1C5CH 1OXYA 3CFJA 2JB6A 3OR7A 4IOSD 5JTWA 1YPZE 5JPNB 4AYFB 1HK6A 1P1VA 3B43A 1U8NB 1WVZA 5DD0L 4GAGH 3MLXL 1UT9A 5DO2C 2K8QA 5DVMA 5HJBA 3F7VB 1KCVL 3WIHA 4FXTA 5C07D 1B6DA 3CN2A 4UIMB 1R1CA 2G5BA 5EUKB 4C8XA 4B9KC 2W80C 2LFEA 5BV7L 2KLSA 1DJHA 1WBYB 4EE2A 3EDKA 2F1AA 4EI5B 3LJ3A 3NMEA 3ZE1F 3D39A 1BBDH 1XGUB 4JRXA 5I1GL 3F85A 3II1A 4RZCB 4KHXL 4IU3B 4LEOB 3KYNB 1WCQA 3IJSA 3V9EA 4P2RD 4HZLB 4P46A 3VA2C 2VJXA 3SKNB 4EZLA 5I1KL 2VR9A 3VSQA 2WOYA 2Q0ZX 3AAZA 5DJ6B 5D1QA 3BESR 5MENB 2C7FA 3ZU8A 2V9QA 1F6LL 3HNVL 4NFBA 3N1GC 4K71C 1A6ZB 4HSQA 2R51A 4B97A 5GS1C 1L9NA 3G5WA 4GIOA 3SDCC 1ACXA 4R2GC 5IHUH 4NO5A 4IEFB 4FQXD 1KIQB 4XCNB 1SYSA 2PWHA 1DLFL 4Z7OE 1TO5A 3GXMA 4ALAL 5BV7C 1F6FB 2DKMA 1I1RA 1DVUA 3VJ6B 5EIQA 3MOQA 1B0RA 3C5ZA 3TBYA 3RUGF 3MRPB 2I60L 2ZXCA 2OR7A 5BQDA 3VDBA 3JVFC 3VG9B 2NY2D 5KSBA 3BSZA 3QNXA 4X5XA 1P5UC 2PXYC 3JVGC 4J2XA 1KCRL 5LG1A 2L7EA 4YE4H 5INCB 1JAEA 4WEBH 3FO0H 4XBEL 3VB8A 5HHVL 4F7MB 1CDGA 1TXKA 2VQUA 1SOSA 3MLSL 1TYJA 3ZTCC 3V4VH 2HCZX 1JUFA 1OOAA 1EHAA 2AEPH 3LPPA 1KG0A 3GS7A 3U83A 2NXZB 3UCQA 4NPYA 4YBQC 1NAMH 3VD4A 4GG6A 3MO1A 4PJ5A 2P28B 3N1PC 3GHBH 2EUWA 3QAQA 1U8JB 2CRYA 32C2A 4J3UA 4JO3L 2HT2D 4TVPD 5E23A 5E6ZA 5H4ZA 3NJGA 4G8GB 2WBJA 2E7DA 4HKXA 4HW6A 2FX7L 3FKUS 1KJVB 5DD5H 1JTTA 2ZCLL 1FLRH 1QR1B 1WGOA 4APQA 1YUHB 4JK0D 3AW5A 1KCLA 1KXQA 3MAWA 4X5RA 3UBXI 5ALCL 3BGMA 1VIWA 1EBAA 4NI6A 1MCFA 5T3XE 2GI0A 3GI8L 4IIZA 2EO1A 5FXCH 5KBMA 3WTTA 3UTTA 4Z18A 4IBWA 5AW5B 2G30A 5GHWH 2ZP0T 4DW2L 3OWEA 3D3VB 5CLWA 1NICA 4S10A 3WDJA 2XVGA 1NCBH 2WLKA 1AGDA 3FU3A 1FO0B 3MFFB 5DFWH 4LKXA 1T7XA 3B9AA 3SGDH 5AW6B 3GC3A 4FYRA 4PY7B 2O30A 4DSYA 3SO3B 2W1NA 3MCKA 2XHNA 3ARFB 4N8VA 2FLRT 1BD2A 4MBRA 4UWQB 4M56A 5F70A 1T2JA 2RACA 2QKSA 1PGRB 2JE8A 3DUUB 4JHAH 3ENEA 4OQ1A 3GEWB 1NGQH 1E2WA 1V7NH 2D3JA 3D2TA 4X98A 4YVNA 4ETQB 1F4XH 5BO1H 3H7BB 3LKOB 4JO5A 2N01B 4OCSL 4I7ZC 3TP4A 4G8GE 1VEOA 1G1KA 3HA0A 3IVKB 2Q9OA 4L8DB 5DHMC 4D94A 4LCWD 4ZMYA 4XXWC 1BHGA 3TO2B 4FQ2L 1XMEB 4QRPA 1DJZA 4P5KB 4JY5L 2GT9A 4YN3A 5TGBA 2DQTL 4KUCD 4LXFA 2EACA 4MDIA 1RPKA 5H35A 4JFHE 4LAJH 2CLZA 5ANMA 4LOVA 2ZUQB 3GK8L 1JFQL 4ZX4A 1INEH 4D9QD 2V6HA 3SPGA 3W0WE 1BFOA 2XPGA 5HSFA 1YY8A 5HYFA 3D3VE 3FB6A 5I1AA 5HI3D 2J6EL 4MASA 4CDHA 4W1TA 5E03A 1H6FA 2GTWB 4M6MH 5DYOA 3FHQA 4O9HL 4V2BA 3EO0B 5ICYA 1HESA 1L7TL 1SDYA 4GOSA 4HETA 3O4LE 4JFZH 4P3DB 3A22A 1NH6A 1IC1A 3QIWA 5EIIB 1YYML 3VG0L 3Q8FA 2J73A 2CJTA 5CEXB 2YFOA 4QYOA 2ICWJ 4JL1A 3QORB 4TNEA 3ZE0F 1Q94B 3JV4B 3TBWA 3B9KD 1RK7A 1S3RA 1MJJA 2ENQA 5JZ7D 3FFOA 3QUGA 4P3CL 1RUPL 3P73B 2ZNWA 3S34H 4HC1H 1Z3GL 4IOFD 3L13A 1B4RA 2ADGA 1RU9L 5DJ8A 3DDFA 1MY5A 1VSCA 3B7UX 3FT3A 5E8NA 4E2OA 3S96B 1P7QD 1F58H 4OLUL 5DK2B 1H6EA 1T0MA 3PHAA 4LRIC 5D1XC 2O61A 4R4BB 3N1MC 5D70H 2X2JA 4KXCA 3BZFA 3I02A 1HH9B 4YHKH 5IB2A 3BKJH 3UTSB 3NAAH 5DEFB 3OZLA 5EBGA 4ANUA 4Y9GA 1T5WA 4XWOD 3ZMEA 1Z0NA 4PUBL 5E94B 3UTZA 4K7PH 4YZFE 3VD9A 1E30A 1PFCA 3ARDB 3HHRB 3T08A 3MGAA 4PU2A 1OB1B 5A6MA 2ZPKL 3OKOB 2I26N 1VGEH 1OE1A 2Z7WA 3CVIL 3VYNA 1RJCA 4R7LA 1JYNA 2R2CA 3N50A 2KERA 5B1BB 1IFGA 2VMJA 4KZ0A 4JO2L 3UZVB 3VFMB 2E3VA 4OIFA 1B4LA 4PP1D 1A02N 3A6BH 2IAND 2XKSA 4HPOL 2NY5L 2C4XA 2K9UA 4PJ9D 3V0EA 1MEXH 2JTDA 3MUUA 3CDGB 4WHTB 1XBRA 2AABH 3HE6B 4NNXA 4PGDB 4ELMA 3NIDB 4LDLB 4FFYL 4PB9L 5H4YA 4OJFL 1TNMA 2O5XL 2Y06L 4UQ9A 3EFOA 3P77A 4OM0L 2OX5B 5IMOB 2FUTA 5EORL 2F8XC 1CLOL 2VM3A 4IIQC 4MA8H 4BZ1L 3T8XB 5I9QC 4X6FA 2H3KA 3GSUB 2A99A 1RCYA 3QDGB 2J1ZA 2XWBB 4BSVB 2DV6A 1FFTB 5JQIB 1MCWM 1N5AA 5CCKL 1FO0H 1IIKA 4HBQA 5DD6A 5DI8B 1N7MH 4MJ6A 2IMMA 4WFEE 3BW9B 3U7YH 2NY4C 3UTSE 3VUAA 1C5CL 3A3YB 1XH1A 4Z7WF 1OGAD 1PPIA 1XZWA 4UYPA 4ZW5A 1T7YA 2NY5C 2HX9A 3UAJD 5AAPA 4GAGL 1I8MA 3O9WC 3MRMB 4HK0A 3KE0A 5HTSA 1NFKA 3JYCA 1HSBB 3DHUA 1ZD6A 3ZKQD 1DEEA 1F6AA 1HHJB 1DVXA 3MSPA 2W65A 2D4DA 1KZYA 1HVXA 1IBFA 1PZ2A 3O3BA 3IMVA 4G43A 1FA4A 4OZHB 2HA1A 4KDWA 3BCFA 2CDEB 3JV0A 4CN6A 1BBDL 2G3MA 4N90D 4ICXA 1ODAA 3GQFA 3L1FA 3LYRA 4M9PA 3OL2A 3DRQA 3MBED 2F08A 3S3JA 1N12A 1X3DA 1XD0A 1GC1C 4U0RB 4BFOA 3GZOA 3Q1EA 1FJ1B 3NIDE 4FEMA 3IXTA 3WHE1 4JS7A 4Y1AD 1CZ8H 4GS7B 3CMOL 4OCLC 3VD2A 2DH2A 3O4OB 1JD7A 3OLIA 3BH9B 4OZFG 5CBAB 5HYJB 1VAHA 3D87B 2IBGA 1RKRA 1WCBA 4JY4A 3OMZA 3BWUC 3QDGE 1H3TA 5EU6A 5AVXB 2JCWA 3SBQA 3INOA 5IOPA 2Y1ZA 2C3WA 3RVVD 5IHUL 2EE2A 2ZQKA 3P11H 1NL0H 5FX3A 3ROOB 4E9RA 4YHLL 3RIAK 4W9ZA 3PJLA 1MPAH 2AQNA 2F54B 2XTLA 2CBTA 2WLJA 1D7BA 1T1XB 1TZHA 3CZFB 1CTNA 3L4ZA 4BWTA 1T0PB 4XHJC 4AEIH 1W0VB 4O2CA 3CFEB 5D2NE 1MVUB 1P84K 4XN4A 5IMLA 4YE4L 3T77A 1M7IA 2GY7B 1VFBB 2X4SB 2WVTA 3FO0L 4WEBL 4DT2A 4X4YB 4OZHE 1FG2A 2N3JA 3DHMA 4FKHA 1T04A 4K7FA 4IHOB 2ZXGA 3V4VL 4BQBA 1RURH 3QXVA 1A3RH 2AEPL 2BC4B 1B9ZA 4RZKA 1T0NA 3GSNB 3ULSA 4DCQB 3VSVA 5GQBA 4KXDA 1HL8A 2HVBA 4I18A 1U8HA 5BJTA 1NAML 5BZWA 3FUHA 3VTTA 4K7PY 3GHBL 3LKRB 1JHKH 2AZAA 4ODHH 1T4KA 2DWYA 1SHSA 3FH7A 3NCJL 3S4SG 4WW2A 4UM9B 4HIIA 3HHSB 3FTGA 3M7FB 4LMQE 4WUUA 3H85A 5DD5L 5KVEE 3F3HA 4PYGA 4I9WE 1FLRL 4D9LH 2APVA 2GTZA 3P40A 3BI9X 1VPOH 2VLLA 2ZSVB 2XNAA 4YUEH 1W6WA 3WFHB 2YC1B 1FWXA 4BRVA 3Q2VA 3HRPA 4K5PA 4Q56A 3FRUB 1D2OA 4BZYA 1LE9B 1TVBA 4DKEH 1I7UB 3QVAA 3E2HC 4HJSA 2EYSA 3BZEA 3CSYB 3AXLB 3CBKB 1CD1B 1S7VB 4MAYB 5GHWL 2F54E 2C3GA 5D7LE 4L8BB 5E00B 1W6LA 3T0EA 5IFAH 3WTVA 3LHPH 2JI2A 3HS9A 4MJIA 3QUZD 2C1PB 1E28B 1NCBL 1J05B 2CHDA 2PTTB 3KG5A 4JFWA 3PL6A 1U58B 1R0AH 4BIKA 4LBEA 4MHHG 4WFHD 5E0QA 2IDQA 3OMIB 4LCIL 3UTOA 2Q5BA 4NS0A 3WG7B 4XOBA 2XWCA 3FTUA 4Q4IA 4W9HC 5BRPA 4M1DH 1U21A 2Q3AA 2WTOA 1NGQL 3V5KB 4AM0Q 1GZPA 3M46A 1V7NL 4FA8A 4NB7A 1F4XL 3VSTA 3QR2A 2DY2A 3WDIA 5FM8A 1LK2A 2VR3A 4UINH 3W57A 1A7BA 4XCEB 5B8CC 2WVSA 1HWWA 4NQDB 1P4LA 1IUZA 1E4XI 1HL5A 3RBGA 5AUMB 3RWHA 1MCBA 1OT4A 2Y7QB 4E0RA 4NQCB 3GLDA 5GGQH 4ZFZB 3IEAA 3H2PA 2VE6A 1WIUA 1DL7H 2Q10A 4MSWB 3RWCB 1ET7A 4ZMAT 5F2FA 1PY0A 4AQ8C 1INEL 1T20A 5DWPA 5EUOF 3VGBA 1B0GA 3D30A 2A7BA 4FEIA 3PWNA 1KTLA 1U91A 2Z4TA 3R19A 1MW0A 3NPZB 1NCGA 1YN7B 2EEFA 4DP8X 1XB8A 2DS4A 4JBSA 4OZGF 2HFEA 3CNKA 1D5XA 4H25A 2Z0BA 2YXWA 2ARJB 4B95C 3DIVA 3AUWB 1KOAA 4JFZL 1R46A 2GTQA 5DVKA 3OAWA 3L9RA 2HJFA 4L2YA 4UT6H 4QXWA 1JZ2A 5KOMC 5ISZD 1SYVA 3FNKA 3IYLW 1JF1B 3B5HA 2PCYA 1DJWA 2ZYIA 2FJFB 4J5VA 1FIEA 4OLYL 3UABA 1NC2D 3IDIB 5I6NA 1DVFD 3ZL2A 2D9CA 3MGOA 3Q48A 4ANWA 2FB4H 4XMZA 3APDA 3IPFA 5DHEA 4HC1L 4BZ2H 1YMMB 1L6ZA 5GRXG 4P5SA 3H0TA 5E8EB 2WLZA 4MNQB 3PFUA 3VB9A 1DCLA 3DMMD 4ERSH 1QWHA 5FK9B 4L4VD 3CVHA 1F58L 4RETB 5I8EA 4EOWH 2Z7ZA 3D09A 4JFOA 3UZEC 5KS9E 5GPRA 3D51A 2FHCA 3CFUA 3QEUB 5D70L 1JV2A 2HFFA 1KFAH 3RY5A 4OVUA 5CJXA 2AXGB 4YHKL 4TNFA 3PV6A 4NO0A 3BZDA 1EAJA 4HXBH 1MRCH 3WN5B 3UFIA 3DV6B 3AG3B 3NAAL 1EQWA 3WJLA 5DSCB 5JMRA 4X6DE 3EIFA 5EEVA 5IG7A 3MR9A 3IDMA 3B4NA 4K7PL 2QV4A 4HIEA 3WJJC 1MF2L 4P0DA 5IBTL 1G7HA 4G83A 3H4FA 5AG9A 1EGJH 5MEOB 2LOEA 2WZ0A 5IW1A 3X1EA 1VGEL 2DLIA 4ACPA 1D6EA 3OLDA 4U1LB 3OKDA 3ELQA 3IJYA 5FUZL 4PRHB 1XIWB 4AW7A 3PS6A 3A6BL 1BA9A 2DQGH 4XWGL 1MEXL 4KX9A 3M86A 2AABL 5CGBA 3VG9C 4AH2A 2YQGA 3E80A 2H3NB 2E76C 3L5WB 4F80A 1BVOA 1X5IA 2VTFA 4QOKD 2CJUH 2EE3A 5E8DL 3MV8A 4MA8L 4G6AD 2IWFA 2E6JA 1UTDA 1FGNH 4A68A 2UZYA 2ZICA 1OF2A 4WV1B 2WQWA 4LDEB 1TZOA 1L9TA 3O2WH 3NPSB 3MJ9A 4MKTA 4W93A 5FFLA 3QJFA 4RBPH 5ACZA 1FO0L 5I8OL 2O1AA 5KJ7E 4F7EB 2V2XA 1E9QA 1N7ML 4KKLC 5L2KD 4GLRI 2OYLA 3T6XA 3U7YL 4ZW3A 3NZ8B 1TTFA 4YHYC 1JWSA 4KKBD 4XPBH 2IOMA 3E6HA 3CC5A 2NY1B 5FYKL 1QSEB 3AT8A 1LP9F 3TBTA 4PJCB 3UO8B 1JZHA 4NRZB 2E4FA 2DQFB 3ILEA 4F58H 5I16B 2OS7A 3IBEA 3CFJB 3OR7B 1JE6A 4NKDB 5FYJE 5KTEL 3AXHA 4W9CC 3GJEA 2D31A 2AKRB 4CSSA 2FQFA 4DP7X 2XBDA 1ZS8A 4DKTA 4LHUD 2X89D 4E5XA 4M3HA 1J8HD 3EYUH 3RX5A 1YJDL 3PNWA 2R1YA 2G5BB 1XT5A 2XFGB 3ULVE 2OP4H 3WO4B 2JV6A 3MN8A 4I89A 3QE5A 4DQAA 1CMOA 4KO9A 3TN0D 3GEFA 5E2TH 1CZ8L 2VH5H 1A1OA 4UTBL 3D39B 4YDNA 5C0NC 4JRXB 4U4IA 5EZJA 1Z9LA 4G1MA 3VGDA 1OW0A 4BK4A 3VWJA 5HVGB 2X4TA 3IJSB 3SO3C 4DETA 1MDTA 5E4EB 1BOYA 1JIBA 2J72A 4P46B 1MCNA 1Z0MA 4WI8A 4X7EC 5FCUH 2H32B 4B9FA 2V0AA 4ZXBA 4PJHF 1AIZA 1X5GA 2MWCA 5D1QB 1NL0L 1E3FA 3QPXH 4LHQB 3RIAF 3OM3B 1MNUL 1GR7A 3H9SD 7FABH 4TLKA 1B3JA 1MPAL 4MBOA 5IWLC 3IKKA 5C0AA 1QSEE 3WSQL 3QQXA 1FZJA 4WENB 4A7UA 4P59L 4R8WH 1ZJAA 4AEIL 1SYSB 5KJRH 3ZDYF 2WSKA 4ZX3A 4Z23A 3OLGA 3AY2A 1I85C 5CINL 5CHNA 3FN9A 3K0WA 4KKCC 1B0RB 1FG9C 3C5ZB 1IFRA 1KTDB 5I74C 3ARWA 1AYRA 3MBWB 1RURL 3VM5A 4F5CE 1A3RL 2XG5A 4PJ7F 4BBWA 3WIFA 1I31A 2VB5A 3QNXB 4X5XB 3RX7A 4ONFH 2FNBA 4IK7A 3HBGA 1AQHA 1NOLA 3N1QC 3RWJA 4PGJA 1JHKL 4XP1H 2KKQA 4QHMA 4EDWH 1IEBB 3R4RA 4ODHL 2Q7NA 2MHAA 1Y07A 4MFHA 3LZQA 3DJTA 2IC2A 3D39E 1KG0B 2ZTBA 3QPQC 4HCFA 5K39A 3PGDA 4NJAL 4ZO9A 5JIMA 5TF1H 2E86A 5M94B 2BSCA 4NPYB 4GG6B 4OD2A 4PJ5B 4YUEL 1VPOL 3QORC 1JJUA 1KJMA 4J1UA 4XPTL 2XETA 3TTYA 32C2B 3S5LA 3ZZSA 4I1PA 1P2CA 1GGIL 2G4GA 2NZIA 4MD4A 4DKEL 4X8JA 1H6UA 2WBJB 4GXVL 4MHHI 5D1QE 3VXNA 4HKXB 3RDTC 1WYJA 4X7FC 3KNBB 5FYJH 3TA4D 2LGNA 3K72A 5E6ID 4Q97A 2QSQA 4K8RD 3V0VA 4MZ3A 1DDHA 4MCYA 1O9VA 3BUQA 1Y6NR 4QRAA 1WA1X 2BDNL 3LHPL 5IFAL 1MSPA 2YD9A 4GUPB 3LEXA 1NDTA 1OTUD 3BGMB 4JPWH 1TT6A 3QZPA 4MJJA 1AD0A 4UBDC 4RMTA 5LBVA 5IV2A 12E8H 4PG2A 3O0RH 1Y6MR 4HJJH 4TUJA 4LLUA 1R0AL 1QFPA 3WHXA 4ZQKB 1UB5A 3MRKA 2X2HA 1ZVSA 2E4TA 3L4CA 1I1AA 1TSRA 2FR4B 4A67A 2APTA 3F83A 1K5WA 4P49A 2ZYRA 2F5AH 3ULUF 3FONA 1AGDB 2Z35A 3D69A 4NZJA 1AXTH 1TNNA 2X1OA 1MFDH 3B2UC 4M1DL 2NNCA 3ARDC 3KXFD 4OFYA 3QO1B 3F8UB 3E9TA 1BQRA 4NHCH 1GKEA 4DO5A 1ZVHA 1IAKA 2G0KA 5JHDB 4O2EA 1AGEB 4IU2A 4UINL 3IB4A 4G7VH 3MCKB 5L8LB 4QRFA 2ZYHA 5MHSE 1BD2B 1FORH 2BVYA 4UMSA 3NJKA 2VSMB 4GG6E 4PJ5E 1TTGA 2MOVA 5EO1A 3T65B 2F9BT 3WKNA 3DX8A 1MJ7H 3F05A 4X98B 1ZHBA 3FQXA 4FCHA 2OW7A 2YO3A 3GLAA 3HE6C 1GRWA 1F4AA 3HKFA 3PHOB 5GGQL 3T09A 2AJYH 2AAVA 3Q9QA 2YGVA 3LPOA 4U1KA 4KRMB 5BMFL 4U3CA 4YR6B 2TRHA 1KYUA 3I85A 3SSGA 3L54A 1TCMA 4QRPB 4XTRD 4Q8BA 2GT9B 1CTOA 5F7MC 5TGBB 5GZNC 3WIHH 3BVWA 3V7MA 1CLYH 4MDIB 2YRPA 5H35B 2YEZB 1DJGA 5T33H 5KUMA 1A21A 5ANMB 1UGKA 4BFEA 3LPGA 3IPBA 1XSOA 4FJ6A 5LO7A 4ZQTA 4RGNB 3V6OC 4UQ2A 5C07E 3FO1A 5I1AB 1T2QH 3QJHA 3KLHD 3NZSA 2GK2A 2OJZH 2AJSH 1AP2A 5DYOB 5H94A 4BE5A 1SXSA 1NM9A 1E8WA 2Y7LA 5ICYB 3N6YA 1TTAA 2WTPA 1WQVT 1KBWA 2FB4L 4OLVL 1ZANH 4AEEA 4N2DA 3QIWB 4BZ2L 3GSOB 3KVDD 3Q44A 5JHDE 1CCZA 5FGBA 3FTVA 4TVSa 4ERSL 3ZSTA 3CZLA 2GUOA 2JKLA 4KQ4H 3TBWB 3KL5A 3GMPA 4CW1B 1G43A 4JL2A 3ZTJH 1UJ3C 2HRLA 3K1KC 3RZCA 2HX7A 3EUDA 5GRZA 1DCEA 5JLZA 1JMXA 4ZS6D 3I6SA 3N0AA 2Y9RT 1ZCRA 4ABVA 3F7LA 4MYWB 4PRNB 1KFAL 2ADGB 2OMTA 2RA1A 2APXA 5DJ8B 2IG2H 5LNDA 1F1GA 2WQSA 5D2LF 3FT3B 4AJYV 3ASOB 4HXBL 3SCMB 1MRCL 4GS7C 2BIQA 3TASA 4OD1L 2ZUXA 4QRPE 4M7ZB 3O4OC 5TDOA 2O61B 1T0MB 4S1DD 3T2OA 1A7NL 1B2WH 3IDJA 2OULB 2ZX7A 1FL6A 3BSZH 3QNFA 5B7EA 4Y5YB 3NRPA 4MS8C 2OSWA 2HMID 3BZFB 3I02B 3KHOA 4WWKA 4K3HA 4X9BA 4YK4B 3ZZQA 4ZFGH 5IB2B 4DK5A 5ANME 3IMBA 1EGJL 4JM4L 3OGCA 3FQ1A 2BVPA 2CGRH 3FTSA 4HJ0C 2K8MA 1WWAX 3HZVB 1T5WB 2KHAA 1A0QH 4KK8C 3UTZB 4XVSH 1AVAA 2HP4A 4WJKB 3A47A 2XC8A 2DQGL 4Y5XA 1MVYA 5AEAA 1E67A 1X5KA 4KX7A 1F8TL 1H19A 1BMGA 3ZRFC 4WAFA 2RFXA 4RX4A 3L45A 3A67H 1GAFH 4QAMB 1TZAA 4EZMA 3KPSD 3P4NA 2CJUL 2XICA 4GXFA 3TZVC 1E4WH 1FGNL 1WFNA 5KSUB 3ULUL 4TVPE 2ETWA 4ELDA 4FYQA 4XAKD 3BWSA 5HGDA 3RFZA 4ZW7A 2IPKA 3O2WL 3U9WA 4ELMB 2WLIA 4JHBA 4NLAA 4NQVA 5T1LD 3TWCH 3V6FA 5HP5A 3EFOB 3G5XB 3IKCA 3AREA 4CVWA 4TSAL 4M8VA 1A7PL 4GAYA 5IY5B 2AEIT 3MACL 3QPKA 4X6FB 4AG4H 3M88A 4F24A 1A4BA 5KJ4A 1CFVH 3BPLB 3T0BA 3VVWA 4XPFH 5D1ZB 1HWHB 5EEXA 25C8H