3LTVA

Mouse-human sod1 chimera
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
153
structure length
153
Chain Sequence
b'AMKAVCVLKGDGPVQGTIHFEQKASGEPVVLSGQITGLTEGQHGFHVHQYGDNTQGCTSAGPHFNPHSKKHGGPADEERHVGDLGNVTADKDGVADVSIEDSVISLSGDHCIIGRTLVVHEKADDLGKGGNEESTKTGNAGSRLACGVIGIAQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superoxide dismutase [Cu-Zn],Superoxide dismutase [Cu-Zn]
molecule tags Oxidoreductase
source organism Mus musculus
publication title Structures of mouse SOD1 and human/mouse SOD1 chimeras.
pubmed doi rcsb
total genus 41
structure length 153
sequence length 153
chains with identical sequence B, C, D, E, F
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2010-02-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 3ltvA00
1IBHA 2AEOA 4BCYA 3ECUA 2GBVA 1SDAB 1SXAA 1F1DA 4MCNA 3GZPA 4A7UA 1BZOA 2WWNA 2R27A 1FUNA 1SPDA 1IBDA 1YAIA 3QQDA 1F1AA 1PZSA 4A7SA 1DSWA 4A7GF 1S4IA 2C9UA 1AZVA 3ECVA 4L05A 1F18A 1F1GA 2AF2A 1TO5A 3KBEA 5CU9A 3GQFA 2Q2LA 3KH3A 1E9QA 1PTZA 2AQQA 2WKOF 3GTTA 3F7KA 1SXZA 2WKOA 3HOGA 5KBKA 1Q0EA 4A7QA 1B4TA 1YAZA 4A7TA 1JK9B 2AQRA 1CB4A 3PU7A 1RK7A 2Z7UA 2C9SA 3S0PA 4BCZA 3H2PA 2WYZA 1E9OA 2WZ6A 2WYTA 4OJAA 4OH2A 4MCMA 2ZKWA 3HW7A 1SXSA 1ESOA 1SXCA 4U4IA 2WWOA 3GTVA 3QQDB 1EJ8A 1JCVA 2Z7WA 1Z9PA 1SOSA 3H2QA 1SXBA 2ZKXA 2NNXA 1YSOA 1IBFA 1N19A 2AQSA 3K91A 2VR7A 1KMGA 1E9QB 1SRDA 2V0AA 2XJKA 3MKGA 2ZKYA 3KM2A 2AQTA 1HL4A 3F7LA 3LTVA 1OAJA 1JK9A 3CQPA 1OZUA 3HFFA 2K4WA 2GBUA 4N3TA 1MFMA 1E9OB 3CQQA 1OEZW 1UXMA 3KBFA 2WZ0A 4FF9A 4N3UA 4B3EA 1Z9NA 1E9PB 2AQNA 5KBLA 3KH4A 1SXNA 3ECWA 1DO5A 3CE1A 1CBJA 1IB5A 3L9EA 4A7VA 1HL5A 3KM1A 2WZ5A 3GZOA 1U3NA 1OALA 2E46A 1N18A 2Z7ZA 1TO4A 2ZOWA 3RE0A 4A7GA 2C9VA 1UXLA 2XJLA 1XSOA 2GBTA 3MNDA 5KBMA 1OZTG 3GZQA 4BD4A 2E47A 1IBBA 1QUPA 2SODB 2Z7YA 1COBA 3SODB 1XTLA 1PU0A 1B4LA 3L9YA 1P1VA 1BA9A 1E9PA 1EQWA 2AQPA 1SDYA 2VR6A 2LU5A 2JLPA 3T5WA 2VR8A 1L3NA 2JCWA 1XTMA 2APSA
chains in the Genus database with same CATH superfamily
2Y06H 3BP5B 2BC4A 3QUXC 1WZ1H 2PXYA 4G7VH 5AAMA 2G75B 3NFPA 1ACZA 1XGTB 3DIVA 3S5LG 1PJ9A 4U4BA 5CCHE 2MQ3A 4YO0B 3MRHB 4OUOA 5DJ6A 1ZLEA 4ODSH 2WNGA 2BLFA 2P5WA 3A6BL 3IJEB 3QIUD 4I3GA 1GAFH 2YGVA 1CBVH 3PWUA 1J18A 3GT6A 4MQSB 5J0BA 4MKTA 4AE0A 3K6SA 1Q0YH 3BWSA 3VSTA 1BOYA 3FU6A 2I9LA 4M00A 4XXWA 1UADC 1GGBL 3V4UH 1H3TA 4AQ1C 1L0PA 1X7QB 3BD3A 2B1AH 4KXAA 4OZFG 4ZT1A 4Y1AB 5I1DB 3LPOA 4X99A 3RWIB 1CICC 2YJLA 3FT3A 4GKNB 4FYSA 1MI5D 3EGXA 5DD1H 2YMOA 3QJOA 4FD0A 4PI0A 1OGAB 2CG9X 1YEGL 5IQLA 4CU7A 2DIEA 3JWNC 1KB9J 4WFED 3JTBA 3KJ6L 1IGJB 1A9BB 3L9RB 5JXAH 3S9DB 1FIGL 4JFFD 4KY1H 3T9WA 1QI4A 4XMKH 4QPEA 4L4TE 1NCDH 1F4YH 4HXBH 3GO1L 3DVNB 2Z0UA 4KNTA 3P02A 1Z9OA 4WENB 2MNJB 4BKLA 3E6HB 4MMZB 4XN1A 4IRJD 4G80A 3ROOA 3U46A 3VG9B 2BS9A 5ALCH 1R3HA 3T0EC 5A3ID 2C9RA 3ZSTA 4CSPA 1MRFH 1BLIA 5HYFA 4WI3A 3QO1A 4GBXD 3TFBA 5E8DL 5DD1L 1GL4B 1HXKA 3HAEB 1U8IA 3AS1A 4BE5A 1CBJA 2Z93A 3TCLB 2I26N 3EFDL 1JWMA 2FJFA 1KPRB 4X5LA 3DX6B 1M1SA 1JNNL 3UTOA 3CVIH 1A6ZB 2PR4H 9PCYA 1OAQH 32C2A 3KW8A 4OF0A 1A21A 4P23C 3C09B 4TV3A 2BW4A 3LZNA 1FV1A 1YEFH 5KSAC 4N0UE 3RTQD 3SODB 4LDCA 1K6QH 5FYLD 3HLAB 4FQ2L 4N1EA 4Z3TA 1WUNT 1SN2A 4PRHB 2OMTB 2MHAB 4YHLH 1E9PA 1NC4B 1RU9L 3BGMA 3L3IB 4LMQI 3KPRE 3N43F 4JO5A 3QQ4A 3SZKC 5JXED 1LHZA 1N3NB 2EE0A 5F7BA 2DQIH 3P4NA 1NKGA 3WMPA 1PJWA 3KW7A 1HL9A 4JG9A 4JFYA 3V4LA 5CIPA 1CLOL 3MGAA 2F5BL 1VFBB 3NFNB 3QDMD 4MDJB 4HJJL 2L4OA 4KI1A 3B1TA 5DWUH 3WIAA 3ZMEA 3UTQB 3QJUB 4X4XB 3WS6C 4A2MA 3HTLX 5F0JB 2DTSA 5GS1C 3NJXA 5EBLB 5IK3B 4DKAA 3WIIH 5FK9A 2HG0A 5KSBF 4E41D 1SHXA 3JTSA 2GSIB 3BOVA 3RGVD 2R8SH 2ZOLA 2PYFB 3BAJA 2ESVD 1U42A 1U8HA 2YLKA 3VXSE 4FLRA 4NIKB 4H5SA 4ZTPL 3LEXB 5DT1L 1INQB 4YL4A 4TYUA 5C92A 4ZQKA 2Z7UA 3EOBA 3MRQB 3CZNA 4G8GB 1GGTA 1DJHA 2DWDB 2Z3FA 3VX0A 1ESOA 4IJTA 1VADB 4NZTH 5CM1A 2BY1A 4MNQA 4M7JH 1TU2B 3ZZLA 4JFHE 5DHYA 2WV3A 5SX5H 1AACA 2E76C 5EO0B 3WFCH 3DX2A 1AZCA 3AXLA 4M61A 2IADA 1R47A 1S7VB 1K2DB 2F7RA 3MKGA 3O2WL 5DGRA 4NUJA 2EQDA 4TNWF 1WFOA 3QXDB 4KKZA 1U3HA 1ODUA 4HUKB 2V2XA 5AW0B 5I76B 3GI8H 2KZWA 2H32H 2PPFA 2P8LA 3GNML 3MJ6A 4HWZB 1VEOA 4AH2B 5DMKA 1P9MC 2J20A 1E7UA 1AQKL 3QUKA 4XBGA 1B6DA 2PW1A 1PG7X 5KYXB 1MJ7H 1YUHB 4NJAH 3QFDB 4PJFE 1P6WA 5JPNC 4NGHL 3AWEA 1OP3K 1FA4A 1R5VB 3RKPA 4Q0XL 4TULH 1DJYA 3H3PL 2WAHA 4DSYA 3DJZA 3IK2A 2R4SL 1U95B 1OD9A 4LHJB 4LSQL 2H3NB 5SWQA 3MRRB 3OZ9H 5BW7C 4GOSA 1KLGA 1WAPA 1HOEA 3QJTB 4NUPA 2DYSB 3U4KA 2ZWKA 2W1NA 1RZJL 1W6LA 2NXZB 4AV0A 1CGSH 4YZWA 1FNGB 4F15C 4FFVC 1XF5B 2R0ZL 3S3BB 2BFVH 3P73B 4MSWB 4OJYA 4EAEA 4EBQL 3NUKA 2EKSA 3WFHB 4P8QA 5E94A 3N1MC 1BZDA 3ZBMA 5F8QC 1QTPA 3MRMA 3IMBA 4BQ9A 1GSMA 4XO5A 3GSNH 2QQNH 5G5DB 1GGUA 3SYQA 2XFXA 1NEUA 3D2UA 4LXFA 3NPSC 4IS6B 1NC2A 3HPJA 2WXIA 4P9HC 4UBDC 4HG4J 2X5PA 1RUQH 3BEWB 3G04B 5EO1A 4E42B 3MXVH 4QF1A 3NAAH 3QULB 4Z3GA 3O6KL 3FB6A 1YY8A 4AEHH 1KJ2L 3AUVA 3HJEA 3NZHL 1R5IA 1XQ4A 1NUNB 2X9ZA 4EI6B 5IREA 1G7QA 2ZWZA 5SV4A 4ODXB 2FVNA 3JV4A 5LCVL 4NQDA 2MMXA 1E2ZA 1GRWA 2BIOA 2A9NH 2IJ0C 3RZCB 1S3KH 4FNSA 5DK0A 2F8IA 1PYWB 3AT8A 4UIKL 2B2XL 5D2LB 2DDQH 2ALWA 4EE2A 2WYZA 4NO0B 4XO9A 3OKNA 5GSVA 1UT1A 4GIAA 1WPCA 3QXTA 7CGTA 1FZJA 4L3ED 3LKPB 4J4PA 5IMLA 1AQDA 1FQ9C 4FFYL 3PJLA 4NPJA 5IOKA 3R1GL 3KPRD 4JFPB 1I7UA 3U0PB 2O1AA 1E7VA 2HTKC 5CZXD 3L4UA 1D7DA 4WWNA 2EVHA 3CJJA 4IBQA 1XGZA 3T3PB 3WO4B 4GXVH 3MYJA 3LZFH 3VXTA 5KANI 3N42F 3T4YA 2BERA 2WCSA 4PJ8B 2EIJB 4MJ4A 1AZUA 1UA3A 5BZZA 3BIAX 4G8FB 4AVKA 1JYXA 3X3FH 4D8PB 1RUML 2PNDA 4I0PA 4J8QA 4AYDC 1YG9A 3FO2A 3TLRA 3GMQA 1FDLH 4RESB 2VUYA 5EO9B 3ECWA 5D7HA 1FGNH 1CFSA 4H8VA 2A6IA 4F57H 4AGQA 4PVMA 2JJWA 5DUBB 4KZDL 3BP5A 1BQLH 4GMSL 3VXQA 1FNEA 2E7CA 2YK1L 2WXNA 2APXA 4J3OG 4K3DH 3N2JA 4LT7A 1P6AB 4PJ9D 4W93A 1CTNA 3UBXI 4O58L 3FF8A 5SWZE 3VH8B 2YOAA 4RZKA 5GHWH 1ZWIB 1I9EA 4ERSH 3MYZA 4QOKD 5A7BA 4TLUA 1IO4C 4XH2B 4DP4X 4Q9BA 4YHPA 1I8KA 1AANA 5AALA 2HUHA 1R0AL 2UZYA 3CFBB 1DZ0A 1YPZF 2NUPA 1TYEB 4F9PC 2C8NA 3RG1C 1KJVB 3SGJA 3L4YA 4FZEL 1R34A 2J2ZB 4Y2OB 4WV1B 1XB8A 4JUSA 2QPFA 3EG9A 3CZGA 2C1PB 4NZFA 1D5RA 1WBYA 1EPFA 2A83B 2HFFA 3RFRA 1BJ8A 1CL7I 4G6JH 1J5OL 2X6AA 4LLWB 2XACC 3D06A 3KWTA 2VAAA 4XCFH 4HUVB 4C47A 1RUAH 3G5VA 3HC3L 1HI6B 3Q7JA 5EU4A 5T3ZH 4FMFA 3FO9A 5D7IA 4OTXL 1RY7B 4Z7WE 2IMMA 4XB7A 1G7MB 2YAQA 4N2FA 5JORB 4CC1A 3BO8B 3QS3A 4YS4A 2ZUWA 4PLOB 1RVFL 3OQ3B 2F08A 2JK5B 2VLKA 2PR9A 2D7OA 5E1AA 1KYOK 3MVSA 3O9WC 5LNEA 4KUZL 5I5MA 1G7HB 3V5DB 1NLBH 2CDGA 5FM8A 2WINB 2NZ9D 3OG6B 2WJ5A 1HH9B 2IAMD 3VWKD 1MPAL 2KI6A 4IU3A 1TQCC 3MRJA 2O5ZL 1QQDB 3ATFA 4X6DB 1S9WA 1EZVX 3GKWH 4G5AA 2VZSA 3VWKC 3DC0A 2NZ9C 3CX5K 4OGAC 3TJHC 2FRGP 1INEL 1XCWA 4HOXA 1J8SA 2X4TB 3B7YA 1MHHB 2OR8A 2W94A 2WCGA 1JWMB 4PY7B 1KPRA 4PS3A 4WHYG 3K6SB 4L8SB 3DK2A 3IM1A 4Z9KB 3ULUE 1A6ZA 4WW1A 5KW9L 1A4CA 3PGFL 4Z7OB 4NRZA 2FT8A 2ALAA 3VFPB 5TDOA 4NKDB 5E2WH 1OB0A 5A2FA 4EKJA 3GSWA 1NIEA 1BWMA 4WY7H 5FHAL 3ZE2E 2WBWB 2AXFB 3PFUA 3FT3B 4GKNA 2EE3A 4ELME 4JM0A 3OGCA 4R0LC 3RWCA 1JFQL 2CIIB 3FU3A 5KVGE 2W81C 2W07B 3FHAA 3OL2A 5F88B 4LEEA 4H1LH 4DUXA 8CGTA 2WXQA 2VN6A 1GSKA 1O75A 1MCPH 3BAEH 2C9XA 3N1FC 1OF2B 1L4IA 1Q9OB 2VE6A 3FUIA 3TGXA 3IPEA 1VERA 2A4EA 4Q9QH 3KJ4C 1BV8A 1M56B 1ZTXE 2G9KA 2QEJA 3PL6A 3UTSA 3IDYB 2ZYHA 1HHGB 3UMNA 3S4SA 4ZUUA 1L9QA 2VDNL 1EAJA 2FEDD 4R9HA 3FQYA 1OD7A 3PP3H 2XA3A 4HIQA 1NICA 4BBWA 3QDGA 4QTIH 1MF2L 5CSZB 2K7PA 1PY4A 1H3WM 2CBQA 3LEXA 1YEJH 2WSDA 2VR8A 4B95C 3I2CH 3R06A 4POUB 1C16B 4LLVB 1JGIA 4PYHA 4ZQKB 3S3CB 3MTXA 2DY2A 5AW3B 2R2EA 2ARJB 3MLYL 4F33A 2J6WA 3ARGD 3RJOA 1MCEA 3MLXH 2AJ3A 2BVOA 2WWNA 3RVTC 3T2PA 4XMTA 2VXTL 4F5CE 3L13A 3P9LB 4Q9QL 1PX8A 1KDJA 1B4JL 4IU2B 3E3QC 1VDGA 3SKNA 2X05A 2O72A 3Q1SL 3KBEA 2UXGA 3FRUB 3WO4C 1IZJA 3WLWC 1MEXL 1OAUL 4BUGA 3VRJA 5IR1B 1LM8V 2WVVA 1DBAL 4F8OA 1N3NA 3MRKA 1A1NA 3NIGE 3S98A 3VTTA 3ULUC 4JRYB 1TENA 2VDPB 3ZKQD 1DCLA 1U8JB 5GRJL 3RP1A 5EEWA 1OAYL 4XCEA 4GUQA 1QX1A 5KBNC 2NUTB 5IOPB 1T5WA 3TT1H 4QXGH 4P5TD 1XIWA 4KDTA 5EC2B 5BZXA 4YHYB 4Z7UE 3ABLB 1QSEA 4NENB 4HCRH 5F1NB 4K73A 3ZL4L 1S9VB 1MW3A 5IF0A 3DYMA 3WJMB 3QUYA 2NW2B 1MJUH 4MQ7B 3H7LA 3GJFK 2WK2A 1UM5L 2ZUVA 3VXPB 4OLZH 2P28B 4RWYH 1ZLDA 2NNAB 3FRPA 3MROA 4Y5YB 3C75A 4Z7WA 1U36A 1KGUA 3CLFH 4DVBB 1Z6JT 1AGDA 3N42B 5IWLA 3IWVA 3QFJD 3VGGA 1B6UA 4KVNL 1TZHA 1JNJA 2QKIB 1G7LB 5B3NA 3O2DL 2X4PA 5L4JA 5DK3A 4KU1A 5TH2A 5K9KA 4RH4A 4Z6AT 3WTWA 5DD0L 3P0YL 3W9DA 4GAJH 1QKZL 3DTDA 3K72A 3S5LA 4NRYB 2B9BA 2Q5BA 4HD5A 3WFCL 4DO6A 3VUAA 4IJ3B 4Y2DD 1KCUL 1PVHA 3C8KB 5ACZA 4XNUH 2EYRB 3M86A 1AFVH 1IGCL 4OY9A 3S8FB 3MQIA 4ZRGA 3UABA 1GYVA 1YNLH 2CHDA 2HLFC 3PXJA 3SKOA 2Z7YA 3TVMC 1BG1A 4HEMA 1SHMA 1UA7A 5DHVH 5EBWB 5IBLC 5MEPB 4DH2A 2ZAGA 3OKOB 5ABZA 5HJ3B 3QWRA 4TUJB 1XB3A 3P3YA 2Y22A 5EFIB 5KZCB 4GSRA 2ADJA 1EXGA 1OPGH 3P0VH 4P49A 4WJKB 5HI3D 3US9A 3ZZ1A 4DEPB 3NCCB 4YHZL 2H0PA 4LLMB 3P77A 1CGYA 4XVSL 1DQDH 2J8OA 2LR4A 3M45A 2PABA 1MUJA 4LARH 5SWQB 3GFUA 3PF2A 4MZ3A 4L1HA 3TPKA 3EJPA 3GJFH 4AZUA 4D3CH 1GZHC 3OD3A 4OQTL 5DRXA 3NIGB 4RAVB 1GIGH 3CVDA 4I2XE 2MKWA 1N59B 4OF3A 4QRBA 4WTQA 2AQ2A 1UURA 4Y2DC 4Q89A 2Y69B 1F00I 2CHZA 3BAYA 1A6UL 4NC2B 4MD0A 4MB1A 5IESL 5DDHB 3PPEA 4U6YA 1KLUA 1OM3H 3WNJA 3NJHA 4UT9L 1WT5C 2R23B 4KI5C 5F89B 2R51A 3MV7D 1D6VL 3SDYL 1S3RA 3WNIA 3WS3A 4F2FA 2JKWA 5FO7A 3BPOC 4W9CC 3UZEC 1T4KB 1UACL 4R0LB 3NIFB 4ODUA 3QARA 4KH2A 4A04A 1JERA 1AXTL 3MJ9A 4N0CC 4Y4HC 3RA7H 3S35X 3QDGE 1DN2A 4F80A 3NDZE 2R0WH 3GINA 3NZHH 4ODWA 2MEJB 4JDVB 2BCKA 1LWHA 3DECA 4B9PA 2XY1A 3EYQC 3SEPA 5LBSH 1W72A 1HE8A 5FWRA 1QFUL 4GP5B 3D85D 2VM4A 2IGTA 1OGTA 4LASL 5C6PB 2R1WA 5DYOB 2JKJA 3W5NA 4I87A 4PAZA 1E3FA 1XF3B 2R9HD 2RHEA 4LNRB 3V6OC 3KGTA 1JVKA 1O6SA 5TF0A 4YN3A 1H3PL 5IM7B 4JJ5A 1A7OH 4HJGA 3AQZA 2HG5A 4NAQA 2WYHA 4RVBA 1AO7B 2I27N 5DJ2B 5I0DA 3AT9A 3VGAC 2WMPB 1P7QA 3QJFA 4JCMA 3T6VA 3Q6FA 3GRWH 5E1GA 3CFMA 5T1KA 2UVFA 4UQ2A 3N04A 4YR6A 1R24A 5HD8D 2PXYD 2EDNA 3RTLA 3KXFE 3ARBA 4XOCA 1L7IL 3GBNL 4PYGA 4K7PX 4PJBE 3OWRA 1JNLL 1QUPA 1XGQA 2FHFA 4CILA 3KZ8A 3LMJL 4XN8A 1AZRA 3MHZA 1F4XL 1FFPA 1MHCB 1XF4A 3NJIA 4DW2H 3BO8A 1ODAA 2EDWA 3EGSA 3IFPA 4M1GH 5ABDE 1MJ8L 2WUCH 1U8QA 1ORSB 2UWEB 2C1OB 2YC1B 1FGNL 3MV9E 5ELIA 5HXMA 5C7XH 1TTFA 4N0UB 4HPYL 2I9TB 5E5RB 4M02A 9CGTA 1J10A 5C0RH 4FEMA 1JN6A 5ICZA 3ETBJ 2YBRA 1EDYA 3BPLB 5LWYH 2ESVE 3DOHA 1G9MC 4BKSC 4QXUH 1A6PA 2H0EA 3ETBF 1AI1H 4EI5C 5LAXB 1EXHA 2PCFB 1HH6B 1I1AA 3FB7A 1IGFL 1XB6A 3I02B 3FCSB 5ADPL 1D5BB 4IRJC 4NRXA 3BVNA 5BO0D 1K8DA 2Z6FA 4YBLC 2N0MA 2UZYB 1WUZA 5D8JH 4H2AA 1LNUB 1UM4H 2P4AB 2RALA 3HI5H 4F2EA 5A6IA 5HPMA 1EXUB 4DP5X 3VDAA 4LLYB 4WLCA 5T1MA 3UIZA 5BS0B 4H8WH 3G5ZA 3U4BH 2NZIA 5AYUH 5D1QA 3WFZA 1CIDA 1ZAGA 4HMDA 5F6IB 4JNXA 1U8MB 5CFHA 2BINA 4LQFL 2QELA 4WKXA 3IMRA 3DGGA 1BBDL 3MGOB 5IGXL 1CJYA 2MTAA 3G5XB 4GBXA 1H15B 4R8WH 1G9HA 3P2DA 2R2CA 4TSAL 5T1DL 1L5GB 5EBGA 5JORA 1KV3A 4OCNC 4ELDA 3LEYL 1CYGA 2XXMB 2EVGA 3TZVA 3N06B 1A14L 2JK5A 1W8NA 4X7CC 3QI9B 4P2YA 3INUH 3BYYA 3RB5A 3AC0A 4JFWA 3TYFB 1CGWA 5MP6H 1J5IA 2D03L 2XTLA 1GHFL 2EJ1A 3QNZA 2FJSA 2GEQA 2VWEC 3Q0HA 2J55A 1MFCL 1OAXH 2VL4A 3KVDD 3R4DA 3NP4A 4QHKI 2BNQE 3OMZA 5TF1L 1IGTB 1GYUA 5GZOA 1I7ZB 4PJAB 2IQAA 3FT9A 1DLFL 3QUXD 3ZDXE 3GDBA 4FE9A 2C7UA 3MV7E 4PJGF 4JG1H 4NQVA 4WHDA 1ONQB 3UAAA 1YC8A 4ZYKB 4JZNA 1OXYA 2IOIA 2Y5EA 4M9OA 1IE5A 4R7DB 4BZ1L 2L7EA 4XBPA 5JO5B 1WHPA 2BDNH 4G2AA 2FJHA 4UTAA 1JV5A 4UQDA 1NGYB 1U8OB 2EZ0C 4KVPA 3W2DH 4WFGD 3HCVA 3IETA 3GSWB 1FVEB 4CDHA 1SLXA 1KF9B 4EN3B 3ZMNA 2XQ0A 3AU0A 5L88L 5GXBB 5L7XL 3T77A 5EUOF 2MWCA 1UJ3C 2ZUYA 2R69A 5JHDE 1JGDB 1H6TA 1RMFL 2OULB 3HMWL 2NQCA 1PCSA 3QH3A 5B3JF 1MCQA 4LGPB 3NDYE 4TL5A 5AEAA 3ECBB 1NUFA 2UZXA 2W59A 3TBYA 5EEUA 2QSCH 3CZKA 3HBPA 2XWTA 4UTBL 1T2QH 1C08B 4GG6A 1CI5A 3CFCH 1BM7A 5MI0B 4LPVA 3Q6GL 3PWNA 3S5ZA 5T3ZE 1LL1A 3ULVF 1TIUA 3Q9PA 2Q7YA 3I74A 3CZFB 2A38A 4U1GB 3UROR 1EAPB 4P5KB 4U1SA 1G9NL 2ZXDA 5EH1A 5C08D 2WJ7A 5AB2A 5I18L 1AS7A 1H0DA 5EZIL 2NY5L 2NYYC 3DIFB 3ILEA 1QWNA 3L3GB 2XN9A 2AF2A 2ZCHH 4JFDA 1WYJA 2OL3A 3NCWA 5MERB 4NOBA 1NCCH 2NQDA 3CHPA 5DJXB 4FCAA 2FO4A 4Z7AA 5JHDD 3COOA 3VD1A 3MJGX 2GT9B 3UXFA 1VEMA 1CLVA 1CLZL 4XWOC 2NNAA 3MROB 2DQMA 4Y5YA 3VWJC 4O2FA 2ROYA 2G75A 1RERA 3VGBA 1Q1JH 1XGTA 4S1SH 3D4CA 1TZHB 4LVHB 4N2LA 3VWJD 3GBEA 3H55A 4PIBA 5GJTL 4G83A 5I19L 5BO1H 4IRSC 2NSXA 2JKXA 5GS0C 4ZX3A 1KTCA 4TLSA 3V52L 4P59H 3WEMA 4HQQL 4MS8D 4FTDA 2GC7C 3ZHDA 3C5ZB 1OANA 3BFOA 3TNMB 1Z0NA 1OQXA 3JV6A 5I30L 4PJ7B 4S10A 2DB8A 5DUMH 5E8EB 2JXMA 3EJJX 4QT5B 4ZMOA 4Z77B 4JRYA 1LGVA 1IEAA 1QG3A 3HB3C 1YMHB 4G70B 4PJAE 2G5BA 3SJVA 1KCVH 3MJ7B 2OW7A 2FEJA 1AXIB 4XXDA 3ZKXC 5EBWA 5L2KE 1T5WB 5DEJA 1QEWA 2VZVA 2WWKO 1UCBH 2WZAA 4YZFF 5GS0L 4PD4J 4Y2DA 5HJ3A 3F7VB 4MXQC 2F54E 2X6VA 1HINL 4PCTA 1FRGL 3T4AA 4Z7VF 3SDDB 1WT5A 2CSPA 5DZ9A 4AJ0A 5E4EB 3DBSA 3SE4C 3I50H 1WEJL 1XGRB 3FKUS 5DXWA 2ZNWA 1ZV2A 1RJYA 1KWGA 2N7BA 4UT6H 1I9IH 3DXAB 4PGJA 5B39B 3Q8FA 2GBTA 4HFUL 5E00A 1OHQA 3ZE0E 3ATEA 3EDDA 1N6UA 4UNUA 4LHUG 1YYCA 4FQHB 3VGHA 2IFGA 4HSAC 1JV2A 5E1IA 2YHGA 2VH5L 3UP1A 3ZDXF 1S5IH 2A3TA 4HS3B 1QA9A 4HC1H 3L9BA 5TGBA 2Y06L 5GS0H 1UCBL 3DGDA 1A2YB 4HJIA 5SWZB 2XWRA 3UZQB 4XZUA 5INDA 4X8JA 4N68A 3QXVA 4M6ML 1XAKA 4QHMA 3PCYA 5E6ZA 1AKJA 3UJTL 1EA9C 1QBBA 4LCYB 4DGVL 5AD0A 2DYPD 5IHUL 1N5YH 4P46B 2BFGA 4M48L 4J3XA 4BHUI 2XDHA 3FYIB 4FFWC 2YUZA 4ODWB 4C56A 2PPEA 2VC2L 2QZQA 2OMWB 4ZW7A 2K3TA 5DTFB 2BY3A 1AIFA 4XVTL 4GXUN 1NCWL 2B20A 4I3SH 4NQXA 4ODHL 2XRAL 5FC9A 4WUUE 5DO2C 3B2PA 2XT1B 4GH7B 1PKQB 3ZHKA 2BMKB 1XR8B 3MLZH 3QXUA 4JFYB 4YGVB 4BCZA 4L8CB 3NCMA 3QQ3A 4OB5H 5CBEB 5C8JB 4PJCA 3NAAL 4WFEE 4YHMH 5J12C 3SGEH 1G6VK 4Y9EA 4XMVA 3BMWA 4HAKA 4ADJA 3C6LA 1NGQH 4P2QB 4XPAL 1SMAA 4XPHL 1QYGH 1G7PA 2QADB 3KCPA 2FX7L 4GIPD 4X2UA 5FK9B 3ARGB 2ICEA 3LXAA 2BOBB 4MD0B 1Q9KA 4ODHH 4EOWL 1ETZB 4N2BA 4MMXB 5D71L 4L5FE 1P7HL 4RIRB 2J1ZA 3F65A 1HNGA 4YIQB 4GSDH 2JV6A 4Q6YA 5HHOA 1T89A 2ITDB 4J3BA 4NQCB 3V4VL 3PGCB 4FFTA 3T08A 2X4NB 3KPPA 3Q2LA 2H2SD 5JOPE 4JPQA 1NOAA 1NH6A 3ZIMA 5CD3B 5I74B 2WVSA 3WNOA 5LJYH 1UVQA 3QFJA 4JFFB 3QZBA 2VKWA 3CG8A 1T2XA 2R29H 2FQFA 1MY5A 3EO9H 5I6PA 4S1DC 3PLYA 3QISA 4F9LA 4ZMLA 2R1WB 3QHZH 1DVXA 2OL3H 4JM4L 4YOKA 4ZUSA 4YO0A 1F4HA 3TC9A 4UTAH 5KSBE 2VZOA 4XO3A 5FA3A 3T65A 3UADA 5IM7A 1V7NL 1BEYL 3CUPB 4G8EB 2BVTA 1TETH 3MJ9L 3H9SD 1JUFA 4X4YB 4WVRA 1G9ML 4R96A 4TUOA 2CR6A 2VLKD 2X4SA 2CHNA 1QFPA 2J6EL 3FQWB 1FFOB 3MFGB 4K5LA 3S36H 4Y1AA 5LG1A 1LXMA 1N2RA 1R24B 5I2IB 2PR4L 4HUNB 5D2NC 1SJHA 3QAZB 1RZ7L 5EU6E 1SJEB 3SD5A 2KZKA 2BWIA 2D4FA 1RZFH 4E41E 1FFNA 3NPZB 4AJVA 3TBVA 4YHKL 1JMXA 3VFSA 2ID5A 3NJNA 1TO5A 2X1QA 4XPTL 4LHUA 3C5SA 3H4HA 1ITCA 3QO0A 4NKMB 4OCRH 4BFEA 5CJXA 1G9MH 2D31A 4DP2X 3RIAK 4AGMA 1Z1WA 4U1NB 1BVOA 2C9SA 3LDBC 4E42A 2WVTA 3HW7A 3MRFB 3HR5A 1EX0A 3F58H 4KKCC 1E4XH 1T21B 1OP9A 3N5AA 4ZMYA 1IGTA 1TJXA 2DQGH 4H8PA 2H6UA 4Y5XC 3EUDA 3D2TA 4IHOB 2LU3A 3TCLA 4WHTB 3EYOB 1OLZA 3CVHL 3QPQD 3QUXB 4Q56A 2A99A 3OKDB 2Q76B 4NUGL 4IIQA 3UGXA 1KEGL 1H3VA 2VQTA 3D85A 3JZYA 5D70L 5IV2A 3V4PA 2LE9A 2LVCA 3LTVA 1SFHA 4JFFE 3BZ5A 2XI9A 3PUUA 5DC0A 3KCWA 1HOCA 5D96B 1SYSB 3HCVB 1KC5L 3ARFB 2NYKA 1WC7B 1K4DA 3BKCL 4JGJA 3EBGA 3V0JA 2XVKA 3N3EA 5C0AD 2YKLL 4OLYL 1UXMA 4H26B 1G4RA 4U0RB 3T6XA 4JPKH 3OF6A 1ZGLP 2QV4A 3F04A 4W9EC 1A47A 3JVFC 4N0RA 2EDRA 3MOBL 4OJFH 2ZICA 1YNTB 5I1HH 3GSVA 2WM0A 2OYPA 3WJLA 4TNWK 4GKSA 1ZVSA 5GRVL 2K9UA 1U4EA 3CCHB 4GW4B 5IBLD 1UENA 3SDXB 1NANI 3D87B 1F4YL 4HXBL 4TNEA 4B0MM 2CH8A 5KJ7E 3ARRA 2F7QA 1XCTA 1X4YA 2VLRA 4JFEE 2F58L 2ZCKH 4K5PA 1PAMA 5LCVA 2H26B 1MIMH 1CU4L 2XN2A 1JYWA 3GUTB 4TPRH 4TUKL 4I4WB 3DMMC 4R97B 3SN6N 4LRNL 4N8CH 4YSDA 4PRIE 2O5YL 4OKDA 2KDGA 2PYFA 5D7JC 3LKOB 4JFZL 1KXQA 1I7ZA 3G6DH 1W0WB 4I9WE 4KHXH 1ILSA 3W39A 5EZJB 1TKWB 5H37H 3L5IA 4HPOL 3QJRB 2AI0H 1QLRB 1F1DA 2K4AA 1IL1A 2F0CA 4FXGC 3L3KB 4ZG1A 1J0IA 4IIZA 3KMDA 3RVUC 1E5CA 3ETSA 2OS7A 3H0TA 5H4ZA 1JV5B 3B9AA 3MZTA 3RL1A 4M43L 2QTEA 3ULVC 4M7ZC 2VQ1B 1P7BA 3MBXL 2IADB 3F62A 2OSWA 3EADA 1K2DA 2WKOF 1PKOA 3QH3B 1T6BX 2BNQA 4EDXB 3CXFA 1A9EB 5HHQA 2C26A 4S2SB 4PV9A 5M94B 5IUSA 3GSNB 3C09C 2DIBA 1QNZL 4XHJC 4OZGB 4X7SH 2WP3T 4ZNCD 1PDKA 2VDRB 2A2QT 2WYTA 3DURB 4XNBA 3UJJH 4GLRI 3NFNA 3T1WA 3MMEA 1WS7A 2G5UA 4FHJA 5EZLA 1IM3A 2P7TA 1LILA 3B56A 4TNFA 5C0IB 4JRYD 5I1EH 4L9LB 1N19A 3TBWB 5CINH 3PGDA 1XGPA 1SRDA 5K1NA 4CVWA 3L5HA 5F9DC 4U7KA 5GJSH 1DVFD 1OQOA 4PJBB 3ROLB 3ZX1A 2XWXA 3LRMA 3VI4B 3NFSL 2VLJB 5HHMD 4F8LA 3BGFB 4OCSL 1RUMH 4ZAKB 2X3AA 3WXVL 5KSAD 3LPPA 2OXGB 3OR6B 2XTJD 1WD8A 1JK8A 2R4RL 2VXUH 4BWTA 1J9TA 5CCKH 4FQCL 4UT7L 1OCCB 3KBFA 4N20A 1QVOB 2BRQA 4XNQA 4AYFB 4HWBL 1DVFB 2LU7A 1PSKL 1P4IH 1S7SA 4NQEA 3QQ4B 1DLHB 3L9EA 3AROA 1B9KA 2EDBA 3GHPA 4U6XB 3WJJC 3FN3A 2YLHA 1KBPA 3ARTA 3FQ2A 3D9AL 3IAPA 3M6DA 5CIPB 5ICUA 2C9VA 5JNYB 2OYKA 2ROXA 2QT6A 4GT0A 2LHAA 3LIZL 3F83A 4FKEA 1JD7A 3P1VA 1RUPH 1AXSA 2G5BB 1DJSA 3FH5A 3WI9A 3D12B 1S8DA 1VKXA 3NG5A 4QGYA 3RKDC 1EFXB 3MODL 1NOLA 4C83B 2DWSA 2XYCA 3T1FA 4ZFGL 3O9WA 5DUJA 4W68A 4MS6A 4YFEA 3KXFB 1PCXA 2WQXA 4OCXH 1LEGA 5DQ9A 5I15H 3D8MA 3HE6D 1KPVB 3IFNL 3WTUA 4Q97A 2ZOTA 3L95A 1U8NA 2EVJA 3H7BB 5C6WH 3E0GA 3UEQA 2FUQA 4FYRA 4F91B 4Z3IA 4O2EB 4AM0A 4WO4D 4H8HA 1PFOA 5D4JA 2UY6B 1OSYA 3C6SB 4TF4A 3QQ9D 1NFDE 4TQHA 5I1IL 4JGNA 4K94C 1X44A 5ISZE 5DVOA 4AE1A 2OZ4H 4HUUA 5HHOE 2CLRA 2G9HA 5AG8A 5CO1A 4HCRA 3HS9A 4OGYL 3KH3A 1OTUD 1A2YA 5SWZA 4KY2A 3IKCA 3KE0A 1TEGA 2V9TA 2XN9D 3SD2A 5INDB 4JDZB 5I1KH 3W56A 3WSQH 5EUOA 4PTTA 4FZEH 1TQBC 4Y1AD 4JO4H 1Q8MA 1JK9B 3K6IA 4JFOA 4P2OA 1UWXH 2QGBA 3BMVA 4G7VL 4PBDA 3RYMA 4N5UA 1F11A 2YA2A 3P11L 5EDXA 4JKWA 2E8YA 5DZJA 4HZLA 2L3BA 3GSQB 3BVUA 5INCB 2WWOA 4LOUD 3AJ7A 4WWOA 2N0KA 4OFIA 1G1OA 4AITA 1LO2H 3UC0H 1N0LA 4G1EB 4EVNA 5FYLE 1GAFL 3ZE0F 3TPUB 1JGLH 1IJ9A 1PQZB 4IMKA 1U0QA 2QQLL 1S3KL 5BZWB 1CXHA 4NS0A 1FNEB 3BPNB 3X3GH 1A6AB 4ODBD 1FZOA 4FZ8L 3SDCC 1QZNA 1GMEA 4KO6A 1XH3A 1CTOA 2OR9L 2YSSA 4U6VL 3EUUA 3QEQE 5EOCH 4NO3A 5JLZB 2G4GA 4FYTA 1H9VA 5E8NB 1P1ZB 2D9QB 4Y5XA 4YDLC 4UTBA 4B9CA 1Y1DA 4HJTA 4KRNA 4YHPB 4R4NC 3T6QC 3D0AA 1DLFH 3QNXA 3UBGA 5C8JA 1BAGA 1T1YA 4MA7H 4G11A 5B7MA 2X2IA 3LKPA 5HYQB 2X0UA 2NUPB 4K2UH 2V4LA 1QSEB 4NENA 4PGEB 1FZKB 4Z76A 3Q8AA 1A6VL 1U8LA 1OCWH 5IBUG 3OXSA 4Z7QE 5DMGC 5AOMA 4DQOL 4G9FA 4PQXA 2I60L 5E8PB 1F90L 3KPOB 3TBSB 1OZTG 2E7HA 1FH5L 4YHLL 5CIPH 5DD3H 4LP5A 4BYHA 5C0CE 3NEOA 1FFQA 5D1XA 3CV5A 5K69A 2YN3A 2W0FA 3OZ9L 5FO8B 3T2LA 4QTFA 3D6GA 1S7UA 5DI8A 1WFJA 4ABWA 3GMQB 3O4LB 1HDMA 2WQ8A 2W5PA 3VI3A 1J86A 1CF8L 4JO1H 2G60H 3CFJB 1TJIH 3BD4A 4JFXB 3BQUB 3T4AC 4NO0A 2NCEA 3EOAB 3KL0A 5FGCB 3HN8A 1LWJA 1EBPA 2J21A 1A7PL 1FBIL 3RGVA 4TQEH 5ALBL 3HBGA 1NGWB 1F1AA 3P9WB 1RZ8A 2W0KA 3HZKA 3JWNH 3MRCA 3OSVA 4NN7C 4R7LA 4A7SA 3IWUA 4AX3A 3NMEA 3B2MA 2AQ3A 2WBJB 4Z3JA 1WWWX 3VMOA 3OKOA 3BDYL 2X1WL 1GYCA 2FSEB 5EFIA 3DX8A 1Q0EA 2HTLC 3D05A 1IKFL 3WGUB 2GJRA 3V4PB 4D9RE 3X2QB 2ZXCA 2KYIA 1E4WL 5F3HA 5JPMA 4ZXBA 4NKDA 2Q86B 1JGEB 4G7RB 2XOTA 5BZDB 4IDLA 4Z78B 4K9EC 4PJFB 1M6OB 3CPUA 5ENWA 1PZAA 4MCMA 3ZUCA 1X9LA 1K5NB 3G6JA 4B9IA 1D3CA 1SXCA 4N2AA 2CO2A 3DX3A 4LL9A 4XCCH 2AEQH 1T5KA 4K07A 2Y7SA 4MJ2A 4LL4A 1PW3A 3KL5A 2B5IB 3IJHA 4PM1A 4M6NL 4KHTH 3IXTA 5I6NA 2XKSA 4PJ9C 2BSSA 2PPDA 3TEZA 3INOA 3TF7C 3TT3L 1SUHA 3TVMA 3MLWL 4QHPA 3ZE0B 4EUPA 4IBZA 2ZP0T 4NI3A 3QEGH 5A2AA 3VH8A 4U1GC 5DJCA 4F7CB 3O2DH 4KJYA 1BM3L 2WXKA 3ZYJA 5EBMA 3I9AA 1MQ8A 3DYPA 4E9VA 2MCMA 2K6ZA 1P2CB 1CICA 3JTTB 1I1FB 4MCYB 2YRBA 2RB8A 4RSYA 5CD5D 4KMQA 1JPFB 3X1EA 3THML 1TJHL 4GAGH 2IDTA 1BBDH 5IHZA 3QDAA 6PCYA 1BW8A 1FG2A 3C60B 1RZJC 4RISH 1T7YA 5CJOH 1ZCRA 2OZ4A 2VQUA 4NX0A 3S96B 4WHCA 2B77A 1FDLL 3RE0A 1Y7VA 4I1PA 3KHOA 1XSOA 3QDME 4YNYB 4QXTA 2NX5A 2YN5A 2VUKA 4DGYH 3SBWA 4K8RL 2WBKA 5JUEL 1AJ7L 4OJEH 2H32B 1B0WA 2NR6C 2WNWA 4LPTA 4UIMA 2LQRA 3WNNA 4LSSL 1UM6L 4O51B 3X14A 1KOAA 1JTOA 3M7OA 1I8IB 2B0SH 3LN4B 5D72H 5IR1A 2EIDA 4DAGH 1AH1A 4CJ0A 5HDBF 4AGNA 1X5LA 5J1TC 1A0QH 4K7FA 2CXGA 4HV8B 4PRBB 3JWOL 4KKAD 4NQDD 2W91A 4XP9H 3DKHA 5HYJB 3WDJA 2KQNA 4HH9B 1X5AA 3FAXA 4EIGB 2YPLD 3TN0B 2FT6A 2AGJL 3LHAA 1MCIA 2QSVA 3SDDD 2P8MA 3CBKB 3C5XA 1BFTA 1IM3B 4YSQA 2BVQA 1U93B 3DVGA 2QZ5A 3OAUL 5CJQH 1F18A 2VMDA 3AW5A 1HKLL 1MCWM 3UCRA 4KJQD 5C9KA 2E0PA 3U82B 1QTSA 2NW2A 4MQ7A 4Z7NB 2DZEA 4R26H 5FOJA 5KJRL 3BGAA 5J9PB 1FL5B 4RZCB 1KIQB 3U0TA 2CBMA 4ZAKA 2WOYA 3QJVB 2DI8A 2IQ9H 2Y2TA 3P4LA 4KQ4L 4YHZH 5FGSA 5A2KH 2FR4B 2CO6A 5J4MA 1NTDA 3MFFB 1JP5A 1ASQA 2LTQC 4YEFA 1C12A 1NEZA 3MACH 5DMIL 3ULSB 5LAXA 4FXKA 1DVFA 1PKQE 3S37H 4XTRC 1NEZG 3NSJA 4ZPTA 4XP5L 2XQYG 3KPSA 4Y19B 1ICTA 2VQ1A 5F3BA 2IDUA 4BDVB 4A63A 2VR3A 4RDBA 5LXGL 5ITBL 3E8VA 5MEOA 3VRJB 3EDKA 4KRPB 4O5LH 1OK8A 1SOKA 1MHPL 1MVYA 3EJYD 4ICXA 3RQ3A 2B9AA 4YK4B 1NDTA 3MNWA 3MUHL 4JGUA 1I3RA 3T6WA 4AL8L 2YRLA 3QRFM 1PDKB 1E6OL 1RV6X 2KBGA 3GMRB 5PAZA 5EPMA 1U8MA 1M71A 3LS4H 1ZGLM 3ORJA 1EZVY 1N6VA 3BISA 1QW9A 3DGGB 1AGFB 2R0WL 2DPKA 3PABB 2FYVA 2W80C 3E1F1 1L7IH 3RY4A 1V3JA 4PSRA 1MRFL 4PB9L 1N6QL 3B9KA 3QZOA 5BV7L 3ETTA 1NGXB 2V3EA 3CN3A 4LEOA 3UJIL 3V2AR 4B9GA 2OSYA 3LRSB 4KAQL 2W88A 3OSKA 4O2EA 4ATWA 4LPUA 2ZCLL 1Q94B 5AW7B 4QAWA 5GS0D 4KTYA 2V33A 3N0PB 1CFBA 1P4BH 4Z7WB 3OR6A 3FXIC 1T7XA 4EUPG 1JK8B 4IIQC 2J5LC 5D93C 5JQIB 1HCVA 2XTJC 2YJQA 1KCKA 2X1XR 1A1OA 1I1CA 2QQKL 5HYJE 2HX7A 1N10A 2ERJB 3LZQA 4FYQA 3TN0C 3LH2H 4AYFA 2Q1EA 3MPCA 1AD0A 2VISB 3DLQR 2JCCF 2Y6SD 4NQEB 4UANA 1KLUB 5IB1A 4UYPA 2OA9A 4L8DA 5ID1B 4ZD3L 1HQRB 1IFHL 2VXVL 3T5WA 2YEQA 4U6HB 5D1QD 1CXLA 3ULVE 1T3FA 4G6ML 2EXWC 4IM8A 5B21A 4NKIH 3GEWB 1ZHBA 1PG7H 2DYRB 5DVKA 1LTXA 2NUTA 1DBJH 3TNNA 2BNUA 4BH8B 1UT2A 2EYRA 4OIFA 2VGLM 1BDYA 1TR7A 2DKMA 4MWFA 4HWEL 2UV3A 1JNLH 5CBAA 1BP3B 1L9RA 2UVEA 3O4OC 4QRRE 1L6XA 4PJIE 1ET7A 4BK8A 4FNLL 3KXFA 1P5UA 2KZ1B 3WTVA 4GSXA 4HD9A 4ZMAT 2AK4A 5E2JA 3ULVD 1Q38A 1BF5A 1AGDB 4MXWH 1NAMB 4LARL 4U7SA 1U8CB 2X4QA 3O8XD 1JAEA 2BSBA 1FNSL 5DYFA 1Z32X 5TE6L 1EAPA 3ML9A 5DRXB 3AREA 1OE1A 2BM3A 3UDWC 1BGXH 3TT1L 3TM6A 4JE0A 4S1QL 2E27L 4U49A 4UF7C 1SBSH 2W9DH 4XPGH 5FCUH 3SDCB 4UQ2B 1LK2B 4HIJA 2VN5A 5DJXA 1KJ2B 4FNLH 4OD2B 5DDHA 2ZJSH 4BFOA 2PYEE 3CZEA 2A73A 4F7EB 5CR1A 3WSQL 5CLZA 2DYPA 3NZUA 3VFWB 1WJ3A 4NPKA 5E4AA 1JSYA 5IB5A 3EH3B 4D0CA 1CXEA 1GC1L 3BAKA 2EAEA 1Z9SA 1B0IA 3P11H 3Q43A 4O9HL 3BH8B 3WUWB 3DX9A 4GUOA 4OZGF 1ZLVK 4A6YH 2ADJB 3LRGA 3AY4A 3Q8EA 2CJUH 2Z0BA 5BV7C 4R8WL 4PP1C 1NFDF 4ALAH 4WNQA 2X89D 2BXZA 2QPSA 4Y4KC 5DYOA 1BAFL 1A7NL 1J0HA 3T0EA 1MXGA 4HIIA 5ANMA 5D7LD 1NPUA 1NPNA 1T0MB 1CDJA 3WLBB 5D71H 3IGUA 4L1BA 1HX0A 2ZYIA 3TCXA 2E47A 4JKMA 4ZMTA 5JLZA 1LVEA 4FTVD 1H5BC 4NBZB 1RZ8B 5DMKB 3NJFA 4S11A 2PXYC 5AAMC 3NN8A 3UEZA 4MTMA 3KD4A 1N59A 1KXVC 4F7TB 2EYSA 4FI6A 2R1YB 5GGSB 2X9WA 3SCMA 3GMMB 3A4EA 4PVBA 1QP1A 3VWJA 1ZLUK 1FZKA 4RGNC 4DKFH 2OW6A 4Z76B 3AY4C 1MAJA 1SDDB 5JDJA 4TXVB 3WENA 5I23A 4GO8A 4MD4B 3FQTA 5T1KB 1MQKH 4UT9A 2R56L 5IQMA 2K8QA 1L9OA 5B8CA 1I9RL 1ZDQA 2E7DA 3IDIB 3K8MA 5DJ0B 4BZ1H 4LO9A 3RFZB 3PG2A 3FFDA 2XLLA 3L2LA 3VXOA 1FLTX 5FECA 5D1XB 1C5DA 4MDIA 1S7WB 4GKZA 3OTTA 4NLHA 3J27A 4ZFOA 4L48A 2ZYSA 3U36B 5KYNA 4GFTB 3KPTA 1GPOL 1HILA 5DLML 5E94B 1SXZA 2WKOA 3S4SG 2CK2A 3HC4L 4KROB 1M7DB 1ND0B 5GGTL 5CP3A 4LCYA 2A6JB 2NY2D 3GHBL 4X6CE 5TK2A 1FHNA 5KYUA 1HZKA 1X7TA 3L45A 4DKTA 4ANUA 1KB9K 1QWUA 5I0VA 4TKWA 1AD9B 4U4IA 3SQOL 4QRPE 1AO7A 4ANKA 4LLDA 1B0GB 2VZ3A 2YAHA 2NX5E 3FB7B 4NKOA 5HDWA 3V5KA 4OCMC 4KJWD 4O4YL 3I3EA 1X5IA 3AXIA 3PDGA 4OUUB 3CC1A 5IFJB 5F9WB 4XPTH 1E9QB 3BZDA 2DIJA 4WU7A 3HHMA 2J5LB 4XAKD 2Y23A 4LPYA 3BUYA 1K5WA 2V7NA 2HN7A 4XVUD 4QOKA 1RJZA 5DFTA 4OLUH 3CPLA 1PSKH 3UG5A 1OE3A 1NANH 4XX5A 1KYDA 2WZ0A 5I9QB 2GK0A 5CGTA 1N64H 4X5PA 1G94A 4GY4A 3MKKA 2DQGL 3ESOA 4Y4KD 5C0ND 1ZHKB 1LEKB 3X3FL 4PRBA 2VDNB 1G1YA 2WZ5A 3HNVH 3KEDA 4QYAA 4BZ2H 4KK6D 3C08L 4KUCD 2K8MA 1RPUA 3TVMD 4RIRA 3K6NA 4P2CG 3QIUC 3UGUA 4Z0BH 1CO1A 1FHGA 4NCC2 4PG2C 2P8MB 3TO4C 3HFML 4DP8X 5HHOB 3PWJB 4DPRA 4M5TA 4HYTB 2Y1ZA 2SEBA 2Q8AL 2YD3A 4BRVA 4UB0L 1MW2A 2XX1A 5DJZA 2VXSL 2QSTA 3NCYP 1CCZA 2NXYB 5D7SL 1SM3H 3QDJA 4GI6A 1C1EL 4AZ8A 1TJHH 2EDOA 1DE4B 4GAGL 4X0NA 1QBMH 4PP2B 1J0KA 3FT2A 1FJ1B 2L0DA 5CEXB 3FBKA 1B4RA 1ZT7A 5D6CA 5GS1A 1OY3B 4F1SA 1SUJA 4OQTH 2XPYA 2WN2A 4M1GL 5HPOA 3VM5A 1P7KA 3PHSA 3OXRA 1KLFB 4ZUSB 3RWIA 5AOLA 5KVEH 3BRGC 8PAZA 1BJMA 4FXTA 2F58H 2ZCKL 3O0LA 1PZSA 1DQJA 3X1FA 5IB2B 5F0MB 1MCDA 4K71C 3WGVB 1WTLA 2CDFA 4WW2F 4M5YH 4P4RB 2VDKL 1DCEA 1KGXA 1AY1L 1T20A 2EDJA 3D4GA 1RIUH 2HCZX 5AKVA 3KNBB 1YYML 3VM7A 3QEQB 2WW8A 4WSKA 1JZIA 5HI5D 4U2YA 1F8TH 1O6VA 3PP3K 4FG0A 3REWA 4YHML 1RZQA 3DV6B 5ISZB 1MCRA 5IEKA 2J2ZA 3HG1A 1HQ4A 3E3QE 4AMKH 1L9TA 3U46B 1YEGH 3TO4D 2B59B 2I7OA 1KCRL 4UMSA 4L37B 3ZGHA 3KXFD 3L6FB 3L1EA 4JVWA 2WYIA 3AG1B 2P24B 4XGZA 3U7WL 4QHUA 1F4AA 5A16A 4HUVA 3HRZC 2GITB 3ARFC 1ORQA 2XZAL 5E70A 1U8IB 2Q3XA 3AAZA 4NSKB 2HSIA 2NY1B 4J6IA 2BRRH 3IDJA 3ARDB 3ATDA 4NC1E 2GHZA 1SY6H 2ZX7A 2JTYA 4LBAA 4NO5A 1FL5A 2VXQA 2BX5A 3FPYA 3IGKA 2YD7A 2XWDA 3DPBB 4PV1C 4AJYV 3MLTA 5KS9B 4HOMA 3CX2A 3O3EA 3OPZL 2IQ9L 3RRQA 4HKXA 2Z9TA 4D9LH 3BKJH 3DX7A 1I8AA 1V54B 4DEPC 3JSSA 3KR3H 3C8DA 1I4FA 2ENJA 1BQLL 2W38A 3KLQA 3WDIA 1QQDA 3ISYA 1A25A 4FQIH 3FTVA 1RP8A 3JZ7A 5FKPA 2E9WA 3D34A 5BS0D 4O2CA 4O58H 1IARB 3A6CL 5J56B 1F4WL 4KNUA 4R97C 2VERN 3P9MA 2H6PA 5D5MA 3ZIYA 1QATA 2GEEA 3IMUA 1AC0A 1NINA 1TSHA 1QSEE 4HH8A 5LN8A 4XNYH 2H8PB 3LKQA 3VO0A 1RQ5A 3MJ7A 1Z5LA 1CD1B 2ZX6A 3NSFA 1BVKB 5I66A 3ZYIA 2P26A 4WFHD 3PUCA 5F2FA 3DIFA 2JB6A 2NY2B 1KFAL 1B4LA 4FHBD 1CXKA 2OMZA 4JM2F 4HJ1A 3C5ZC 2XKNA 5AB9A 2AEWA 3D69B 3D39D 2Y9RT 1KNOA 3HBZA 4FTVA 2JLPA 4MNHA 1K8IB 2CKBL 3KYMB 2Y5TB 2X4RB 3WV0A 3KLSA 4JFVA 2AKRB 3F7RA 1UUNA 1BZ8A 2YS4A 1RK0B 3G6AB 2APBA 1MCBA 3GZPA 3O4LE 4KWUA 4R5TA 4C54A 1F5WA 1AQ8A 4MVBC 3EF4A 2VLRB 4K5OA 1DQKA 2A9BA 4UAHA 5ERWB 4ERSL 3AREB 2LGNA 4V1DA 1DTUA 1XV8A 3IU3A 3Q6GH 3H56A 5CNHA 3DO7A 3C5ZA 4HC1L 1ROCA 2OFQA 5FGCE 3HRZB 2B1OA 2COQA 2H1LM 1ZANH 3WN5A 3CDFA 3B5HA 3VQ2C 1HAWA 3MV11 4AENA 4PLJD 5IB5B 2MJWA 3SPGA 1VZGA 2FEDC 3QUKB 4WUUD 2W9EH 2PW1B 3MSPA 2K6YA 5HP5A 2WCPA 1T03H 2AEIT 3CMOL 1ZIAA 5FUCC 3GWJA 3WFBH 4ACPA 2F68X 4PR5A 5K33A 4LOVA 2OMXB 3CSGA 1IEBA 3HC3H 5CEZD 4S1SL 3ARVA 4OD1L 4F3FB 5KS9E 3UAJA 1JI2A 1U8PB 2BVEA 1U95A 4EEEA 3BN3B 2L7QA 3BSZL 3PQYA 3OLEA 4OBSA 3KM2A 2AJZB 1NBYA 2DQCL 4ISVA 4E41A 2YMTA 3C6EA 5F6HJ 4MMYB 2IH1A 4CSZA 1MFAL 3MRKB 4M4RA 5IG7A 4A66A 4RGOH 5FYJL 3GB7B 2Q6WB 3VRIB 1FNGA 3FZUD 1S5HA 2H3KA 4OZFA 5HHPA 3SE8H 4H88L 4GG6E 4YL9A 1IFGA 1NCUA 1NCBL 1RJLA 3VFOB 1Q72L 4P2QD 1JD9A 4X80L 4ZODA 1EUUA 5F1NA 2JELH 3PPSA 5DA0B 3VB8A 4TOYH 5J8OA 2EKJA 4ZTOL 1BZ7B 1INEH 3W0WA 3UTSD 1F3RB 1FFOA 1MRCH 2CLZB 3LVEA 1OTSC 5CEYB 2WLMA 4JFDE 5DS8B 3BEWA 3G04A 4MZ2A 3H8NA 2XJLA 4F7EA 4NFBA 5E1QA 3HC0B 3H3PH 5DD5L 5E95B 5GQBA 1TNNA 2BWQA 4EI6A 2NSMA 2JI3A 4GSDL 1MF2H 3ARBD 3PGCA 1QFOA 2LFEA 3V0FA 2AK4E 4KXBA 5B4MC 5EC1B 5D1ZD 4P04A 4O9HH 3QDMB 1BQUA 4OFKA 4JFFA 3UBXG 1OP5H 1A1MB 2O6EA 3MA9H 4QRPA 1UOWA 4WK2B 2XBDA 4P4KD 3IBEA 2RCSL 2MCPL 3RKDD 4DQOH 1BAFH 4X7DC 4ZUWB 5K9OA 1AKPA 1IBGL 2DBLL 3POHA 4WW2C 2JSFA 4K9EL 1JZ7A 3DX0A 4PW3A 4RNRA 3QWOB 1AXSB 1ACCA 3IN0A 2NDFA 1IC7L 4ZDHB 3NA9H 3V5KB 4G9DA 1S8DB 2M8XA 5JQHC 3RDTA 1VKXB 3Q8BA 2EIMB 2FX9L 3OAWA 1F1GA 1SLUA 4MMZC 4MB5A 1HL8A 4BM7A 1TETL 2ICEB 1OSPL 2VRKA 5L2KA 4PW9A 1RIVL 1H9DA 4XE5B 5DQ9B 1ETZA 1EUTA 5IIEB 4NHUA 4PEEA 1ZE3C 3H7BA 4KXZI 3LNHA 1YY9D 4MDRA 3ZHNA 4NQUA 3RJDA 2VABB 4OLVL 5BVJA 1JPGB 2F8XC 3C6SA 2DDQL 3FO2B 3V5HA 1YECH 3KYOA 1DJWA 3EFFA 1O9ZA 2QMJA 2BS8A 1NBZA 1ZHKA 4P23B 3H6AA 3U36A 3VQMA 2VR7A 3CCHA 3MV01 5JDSB 3I6GA 1J1PL 1MFBL 1MRDL 5DEGA 4Y1TA 3QUHA 2H0JA 5TE7H 1MCPL 3BAEL 4GXUM 1NGQL 4P2RE 4ZUTB 3VDBA 3ZRSA 1A65A 3WEOA 3D4YA 5D4IA 5KS9F 1PIGA 2J12B 2SEBB 3BKMH 4WI9A 5CZVH 4FQ2H 1IVLA 2HMIC 4NUQA 1DVYA 1RPQA 4KKLC 3O6ML 1EZSA 1WWBX 3OBAA 5B1JC 5IQ9A 4J8RB 5LN4A 2BVPA 5DCCA 1MCJA 4QLRA 2XV2A 2EXWD 1EEYB 3LKSA 5I1GL 5IROD 1P4BL 1TNMA 1TKWA 4YXKH 1UFGA 4PRPA 4UQAA 4JCLA 4C57C 5IWLC 1WV7T 3ILPA 3RDJA 1BXXA 2K9FB 2P8PB 3MC0A 3L3HA 1JE6A 1SOQA 3RUGE 3SSGA 5MEND 1JTTA 2J3SA 5CR8A 3ARFA 5IB4B 1COBA 2XX0A 1OWWA 5EIIB 5CEZE 4Y8DC 1AKJD 1G7MA 1HIML 3CHXA 4L4VD 2QQQA 1AZBA 2QV2A 3L1GA 3L7FA 5L0QC 2AQPA 1AP2B 5C0DA 3A21A 2WMPA 1LP9F 1MWOA 4YK4C 1KTLB 3FFCB 5FIEA 1ML0A 4GKSB 1XF1A 3MCLH 4PIRF 3OAZK 5GGUB 1THCA 5ISZD 3AITA 2VSCA 1AG6A 3L2NA 4XX1G 3O6LH 1CDGA 2CGYA 1RVFH 4LVOC 4KO7A 2P7TB 3TFKC 2Q8AH 3VSUA 1S4IA 1SFDA 4BHUA 2GSMB 1YNKL 4JO3L 5KAQG 2AMGA 4EXKA 1TZGH 3N9GH 3ARDA 5CGMA 1M57B 5K1VA 5BJTA 2Q76A 3D48R 2WZPD 5JQ6L 3OM3B 1YAZA 4NZDA 2BP0A 4OTXH 3FBQA 2D3LA 5FHBL 2NW3B 4JY5L 1EO8L 3QXWA 1QZ1A 2YPVA 4HS6B 4M7LH 4IGBB 2IPTL 2G2NA 4Q9RH 4M48H 4F8TA 2CDEB 3H0TB 2XQYA 3VXSD 4NAJA 1S9XB 3BZFA 3HZKB 2EUVA 3RL1B 5D7JB 3IJYB 5LVEA 1JWSA 4L9LC 1JVLA 2ZUUA 1ZVSB 2ESVA 5C7ZA 3P9MB 1MJJA 1CGVA 4XP4L 1TZGL 3QIBB 4A67A 3AG4B 4W9ZA 5D1XC 3WO3B 4N2KA 1A9EA 4Y4HA 1NSNL 3Q2CA 3VFVA 5KSBB 1MCOL 2ZXGA 2QSQA 3C12A 2B2XH 3FU0A 3HFFA 4P5TB 2DN7A 4UNVA 3W37A 5BZDA 1QNZH 2B59A 2RD0A 3O4OB 3MNZB 4PJCF 4G42B 5HHME 5E2TL 1FFTB 3I6LE 2YGQA 1FYTD 3GIVB 1VZHA 5CP7B 5EZLB 1FE8H 4FMKA 3G5XA 2PUQT 2ZPKL 3RUGB 4IMLA 2FE0A 3IJHB 2VDQB 4PJGA 1FH5H 4JDEB 5D4HA 3BWAA 4IKLA 2DV6A 4ZS7H 2YPVL 3HHSB 1TO4A 2ARJA 2X41A 4RA3A 1MNUL 1IL1B 2J57A 4F33B 1E90A 5C3IA 1FVCA 1MVUB 5IEKB 1LYQA 4WZ9A 3EFDH 3FU7A 1SEBA 3U9PH 4AL8H 5E23A 5EV7A 3LV3B 2YMXH 2AXWA 1WH0A 4YUEH 2MNUA 3MV8D 4GW5B 1KBGH 4KXCA 1EAOA 4PW4A 3D51A 2HTLD 3EJRA 5DJYB 5C0RL 1A66A 4P2RA 1YEFL 4ES9A 4YDVB 3T0WA 2BH0A 4Z7UA 1A7RH 3NYKA 2EEFA 4PWGA 4G6FB 3SE4A 1O5DT 3JUYA 2O93L 4JFOB 2BIIA 3FUDA 2ITCA 3ZDXB 3RVVC 5D1ZA 1XD0A 2Z31A 5B1CA 2F7OA 5IOPA 2YSTA 3CIQA 1J5CA 2FEEI 3HHRB 2YPKA 2QSCL 1IM9A 3GBNH 3CSBA 3EJQA 4H40A 4N6RA 4CMHC 4P4KC 2VM3A 5C07A 4G5ZL 1CLZH 3VXRB 2X1OA 2X4UB 1NBCA 4NNXA 4C56D 1I8IA 2J8UF 4PRHE 3F2LA 1JZ4A 4B9KC 2XPGA 2DWEA 5MHSD 3C2AH 3VI4A 5IJCC 1LO0L 4XAWH 1NC2D 4M6OL 4DK3A 4AYBA 3D50A 4OLXL 1CICD 1CB4A 2Y5TA 5A2JH 4ECNA 1YQ2A 4G6MH 2NXYC 3BFQG 4FGMA 1JRHL 1VGKB 4JDTH 4LU5L 4NN6B 4U0QB 3T0VA 4BFIA 1A7OL 3ZL4H 5JHDA 3DV4A 1KBBA 1YN6A 4L4VE 3IFOB 5IBUB 3L3JB 3TYGH 4P5KA 5JHLL 2DQDL 2WXFA 2UYLB 3VI3E 4X4XA 1ERNA 3L3DA 2CLRB 3GI8L 5H4YA 5I1LA 4HKZB 3H54A 3ZPDA 1TZAA 1WZAA 5CEYA 2ZKYA 1GGYA 2WQVA 3C5ZD 1JPSL 4KRPC 4UU9A 1MFCH 2I9LB 4B7LA 1WAAE 3LKRB 3OF6D 1DUYB 3VXSB 3WKQA 4MB3A 5MHSE 2ORBL 4GBXC 4F7KA 2E74C 1BD2B 1FRGH 2DQFA 1B2WL 3MFFA 2W9EL 4RSVA 3RGHA 3MRIA 1KY6A 2X6UA 1T03L 2ICWJ 4BA0A 1DQLH 4WWID 2KH2B 4NP4H 4HISA 4PHXA 3JBG7 4P9HL 2B1HH 3K6DA 5AW1B 4M93B 1JXGA 2VYRE 3T0AA 5MEOB 3CHQA 5HHXL 4DGIL 1M6UA 4WK0B 3GK8L 2CM6A 4MMYA 3ULUF 5I0WA 3BQUD 1DFXA 4J3VA 4MHHI 5LDUA 4R7VA 1J7VR 5IROA 2D03H 4Z7WF 1R3HB 1SJXA 3T04D 1E5UI 2I24N 1EO5A 3VJ6B 2IH9A 3FUKA 4OV6F 1SN5A 3K0WA 3QJZA 3VFOA 5L2KB 5C0CD 1JHKH 3GRWA 4YQXL 1YNLL 4ZW6A 1T7VA 3MXVL 2QVMA 1D2OA 4KKNA 1NGPH 2X53A 2R69H 3OB0H 4XP6H 2LU5A 3UERA 2A6DB 3DUHA 1UGNA 4ONHB 1JL8A 4WIQA 2CLZA 3UBHA 4LK4A 1Z2KA 43CAA 3BDXA 4NJ9L 2ZX9A 4OM1L 1RJYB 4FL4C 4XMPL 3IU4L 4B3VA 4PRNB 2I60H 2Z64C 3FTZA 4X7FC 5DZVA 4GUPB 5ENWB 4PV8A 3RURA 3H9SB 4PJDF 3CXHK 4PJXF 1QRNB 2A6KB 2QFRA 2WNKA 5T1LB 5T1DH 3RWEA 3VXUA 5D6DC 2ZUQC 1VACA 3PXHA 2VLJE 4LCWA 3PHQB 4G3YL 4UDUB 1PD6A 4UINH 3SQBB 2EC8A 4KJPD 3GSRA 3U6XA 1HHIA 2CLVB 5JYLA 1N7ML 2IGLA 1R4XA 4YBQC 4IS6A 4PJ6A 3ERXA 1IAKA 4FFZH 3KGRA 4U7MA 5F7YC 4P59L 2AI0L 3QWQB 4LKCB 4M6AA 4UIKH 5EMYA 2ZKWA 4HJGB 1LE5B 4XXCA 1TMCB 2H3XC 4NO2A 2BRRL 3BP6A 5E51A 2DLHA 5K39A 2HT2D 4QYOB 4X42A 4PLJC 4J28A 1MI5E 4XNZB 4Q2ZA 3KLKA 4IRSB 2NTSP 1PLCA 2OQJB 5CHNA 4TRPL 3DX8B 4BWUA 5KOVC 3P0GB 3VWKB 2XIDA 3UZVA 3EH1A 4PUBH 1HHKA 3MBEA 5BV7B 1DBML 1NMBH 4JPSA 5D2LA 3N40F 1E4WH 5LLIC 1JGEA 1KB5B 2ADYA 4JRFA 4N28A 4QRTB 3DDFA 3N40P 2V5YA 1B90A 1YJDH 1BAWA 2VDRH 4IKIA 3GXNA 4L23A 1RP9A 4MVBD 5JZ7D 5E99H 4EN3D 3QZLA 2H4EA 3LNGA 3MXWL 2IF7A 3KYNA 4AT6B 5JW5A 2DWYA 2WXGA 3IXTB 4F92B 2Z4QB 4BUHA 4HV8A 4LDLB 2BSSB 1TPXB 3HE6C 4K5NA 1Q9LA 4A39A 1KJ2A 2WAQA 4YFDB 2Y7QA 5EEZA 2BSCA 5KN5B 2V8MA 3GMNB 3TV3L 2MQ0A 3CVHB 2H2SC 3BUQA 1WCBA 2R0LH 3OZLA 5I15L 1P5UC 1UWGL 1UH3A 1V3LA 2CMRL 3IJEA 4YSSA 4Q14A 4CW1A 3VFGL 2J8UE 3RFZC 4IRZL 4LCIH 2VDRL 3BH8A 5DZNA 4I0PB 4U3XA 1L9NA 5K59F 4KKBC 5BVPL 5HPMB 1KACB 3C60A 3QI9C 3I6KA 4OKVB 4CVZB 1QRNE 4YHYC 4WNQB 1P0SE 4KV5F 4N2IA 3S7GA 1I7TB 3T0EB 4LCCC 1NFAA 2JKIS 4N2OA 3C08H 1CDHA 4WQOA 4NCDA 2HKFL 4A7UA 4PWJA 1K5NA 3G6JB 1URZA 4HFUH 2D73A 1KCSL 2XA8H 1Q0YL 2DEWX 2GAZB 1WIUA 1IC4H 2BIPA 3WG7B 3IJYA 1DVSA 4MSWA 3ECQA 4AUJA 5J11C 5GGSA 1P5VA 4WGVB 4CKVX 4IOFD 2HYMA 1YEEH 1U3JA 2DL9A 1OWRM 5D72L 5JHMA 1BQHA 1CLYL 3QI9A 4JY6B 4ODTH 5AOKA 4N2CA 4YLCA 1BWWA 5ESAB 4APQB 4F58L 3KLAB 1NCAL 4HALA 1XHHA 4FXGA 2VR5A 3MNZA 5FM5O 3L7EB 4KVNH 3UYRH 1IKFH 3QULA 4ZTPH 1BFOB 2E27H 4Y9GA 4K5MA 2QQLH 4AUUA 4WWKB 2HWZL 3BSGA 2AGJH 1HHHA 2QR0B 5AYUL 4FG6C 4WUKL 1PNCA 4LCUA 1FYTB 2C9QA 1I1AD 4KK9C 3RZCA 3C5SB 3KEHA 2L7JA 1KMGA 3L3OA 4ZX5A 1QEXA 4V11A 2V2TA 1Q72H 4AKOA 1G7HA 1KDIA 3VXUE 2FR4A 4TOYL 3L08A 3L4VA 3OKNB 5GSVB 4Y4FD 4MJ5B 3UBXA 2JF1A 4UV4H 2PWGA 3DI3B 1NC4A 3BGMB 1USZA 3L3IA 3ZKMC 1R3JB 2WLJA 1HSBA 4L1DA 3US1A 1NQBA 2X4TA 5IVZB 1OSZA 4A6YA 4BZ1A 5CLWA 1R1CA 3AB0B 1KT2B 4JKPH 1MJJB 1C08A 2QKIC 2DJ4A 3BQVA 3MCKA 5DRNB 1JZGA 4WU7B 5DZPA 3SPHA 1N18A 6FABL 4AIOA 2DQUL 2D0HA 4GIOA 4HFWB 3QZWA 5IV2B 1VFBA 4YFLI 5AVSB 3L4CA 4PJXA 2YPKB 2FBJL 4Z7OE 3BRFA 4NNYB 4OIBA 1T6WA 2JVUA 3FCTB 3LB6D 2XXCB 5L8KB 1M71B 4JFDB 3JTSB 4AC4A 3U2SA 3QORC 4AY0A 3GMPA 4LNVA 4JRXD 2EDQA 5J9PA 4AQ8A 4YPGB 2TSBA 3UOAB 5L88H 3FF7A 3SGEI 3SE9H 2ZTBA 2DMCA 2AJVH 2AK4B 4GKOA 2ATAA 1TVDA 3PY9A 4LPXA 5AAWA 4DP1X 2F9BT 3ASOB 1E27A 1LDPH 3CDCA 4IRSD 2KC0A 4CBPA 2MPAL 1ZSHA 3FU7B 3ULSA 4FXKB 5DHDA 3UTSB 3PJNA 3X11A 4OR1A 1AOZA 1FGVL 2P49B 2A4ZA 5DHYB 5JXAL 1KG0A 3QWRD 4KNQA 5I71C 1CDIA 2QLYA 3TBCA 5ANME 1IQWL 3OKMB 4P2RB 3OV6A 4U1JB 4H8UA 1G9NH 4JFEA 1JRHI 4QRRD 1VLXA 4R4FL 4RQQB 4WI7A 3W11C 1FL3B 4Q6IC 1HQRA 1T83A 2DQHH 2F54A 3MNWB 1DUYA 5H2BB 1U3HD 4N0FA 4AQOA 3VGEA 2X42A 4KQ3H 4RMWA 5B7FA 1WCQA 2AQRA 2UUDK 1YEWA 4GKLA 5AWNL 4KKLD 1BXUA 1WBYB 1CPUA 2A83A 3WKMH 5D6DA 5E5MB 3WXWL 1DBAH 5KYXA 1SOXA 5ICYA 4UT9H 4KO5A 4YSCA 1ZLSH 4N24A 3DX9B 3EH4B 1EWHA 4R3SB 3NSXA 5E6RB 1WD9A 1UACH 1SOSA 1SVZA 4YMPA 4ZPVA 3FYEB 1AR2A 3WXVH 4F1ZA 2GCYA 5SX4H 3W0WD 3W3BA 2NY1D 3KLHC 1QSVA 1H3GA 3CX5J 4O00A 5EA0H 3UMTA 1TFPA 1RZKC 2E7LA 2ED7A 1GVIA 3LNEA 2FO1A 3BP4A 3QIWA 4X0KB 3FN0L 2BO0A 3IPFA 1LO0H 1XGUB 4XAWL 1C9SA 4HJUA 4X5RA 5FGRA 3GIZH 1NFKA 3V4PH 3O41A 5I30H 3U4BL 3JT0A 1AAJA 4TLTA 3L1OL 4JL1A 4MXWL 4J23A 2PTUA 5DEFA 5D9SA 5J3HD 3PAYA 3IDGA 2BSRB 3MGTA 5I6MA 4RWHA 4J3SA 4ORGA 1IB5A 2V17L 3SKUD 1OK0A 2Q3AA 2XWEA 1UCTA 3PGDB 5FYJD 4U3CA 1KXTB 3SDCA 5F7KC 3VD5A 5KUMA 3U83A 1BOGA 1JIBA 3TO2A 4EIBA 4YX2H 2A73B 3FB6B 5A6LA 3B8SA 5J11B 1NM4A 3FFDB 5T5FA 1KYAA 5DQJB 5KYYB 3GGWB 4DETA 5EEYA 2ATPB 1C5DB 4JFUA 1H6UA 4A2GA 2CCLA 2IWGA 4OI7A 5HY9A 2UUDH 4H44C 3QR0A 2WLHA 2Q87A 3RDTD 2VN3A 5CMAB 3ARYA 4DP7X 1IIKA 2MCG1 3V4UL 3APDA 4W9GC 4MAUH 4L3CB 4MJ6B 4GRMA 1DLHA 2C3HA 5GGRB 3DMMB 4GEJA 4ZFZB 4NRYA 3RBSA 5T5NF 1RLBA 4FABL 4LSRL 1E4XI 4GNKB 2HFEA 4W9HC 2EDLA 3QE5A 4YXHL 5ANMB 3HG2A 4OCXL 2W65B 2C4XA 4XVTH 2LFGA 3LX9A 1UHVA 1I8LA 2J43A 2C5DC 4XNAA 4K55A 4KFMA 3C60D 4L3EA 5DD5H 2D3JA 2ILLA 4M3JA 5T5NG 2ODIA 1DQDL 5F7EL 4NWUL 1XSJA 2J44A 1ADQA 2EYSB 1G7PB 4Q4IA 3ZN6A 4AXWB 2IPKA 5IFJA 5DZOA 4LVNB 1NDGA 4KQ4H 4AI7A 2VOTA 4QCIA 4KJQC 3QG6A 3FU8A 4MJIE 4BSWB 1IFRA 1RZPA 3WEXB 4G82A 3TWCH 2H1PH 2HRHA 3A24A 2X2YA 4IBYA 5HJGA 2JQZA 4LLMA 4OGYH 2CRIA 3R4RA 3EDJA 4BK5C 3JT2A 3G6AA 3O45A 1X5FA 2VTFA 3LB6C 4AQ1B 3HAEH 3QDJD 5ITBH 3LRLA 3ZT7A 1DJZA 2OBGA 3JQOB 1H5BA 5TDPA 4RAVA 1JCVA 1L0QA 4PCSA 4D7PA 3IU3B 2DQEL 3UPRA 2YOCA 3ZL1A 3BZEB 1ZRUA 3BJLA 1D9KA 5HJDA 3RWFA 5AKRA 3JYCA 3PWVA 4G8GD 3VA6A 1GGIL 5DFVC 3NIDF 1I85C 2LOEA 4QHNB 4BSVA 2P5WE 2V37A 5HTSA 3GSRB 5HVHC 1KJ3L 5ICXB 3W2DL 4S1QH 1IAIH 4E36A 2YZ8A 1OZUA 1IRAY 2A6JA 4BK5A 3F12A 1WITA 4FG4A 2WPGA 5FUOL 2A4CA 4ANVA 2DQJL 1L9PA 3TBBA 3QCTL 5MP6L 2HRPH 4YLQT 2V5SA 2RAMA 4HK3J 1AGEB 5AKSA 1NM9A 4PFEA 1HS6A 2X9YA 1Q9WA 3B8YA 3ZT5A 4DZ8B 1TZIA 5GHWL 4L0PB 3WJMA 5BMFL 5BUPA 2ZAHA 3TA3C 5E2VH 3RVWC 1FZOB 1TUPA 3P54A 4ELKB 2C3WA 1EJ6A 2VMJA 3LY6A 2HVKB 5DC4B 4BD4A 3FT0A 2NNCA 3JWDC 7PAZA 3VRIA 4OLUL 4QRTA 3OPZH 1DSYA 3NCJH 4U1HB 5F7WC 3HI6H 2MSPA 2DQJH 3ALWA 3NGBC 3WY3A 1G6RH 2QKIA 2C9PA 5DRZA 3RX5A 5C0GB 5IKCB 3DTXA 3NIDB 2VSDA 3QEQA 1HZLA 1HJBC 4C58B 4G59C 1L3WA 5J57B 3KS0J 4XN9A 4EN3C 2IGFL 4PJ8D 4WKZA 3U1PA 4A55A 5C09D 2JJTC 1OOWA 4OW6A 3GXIA 1XIWD 5EG6C 5ADPH 3C8KA 25C8H 3QUMH 2E4TA 4L37A 4KC3B 3MRFA 4OCWH 1UWFA 3L5WB 3HN3A 3VFRB 4X7EC 1XR9A 1KBVA 3UAJD 1I9RH 3X12A 1TQWA 1FFPB 2DM2A 4Z7OF 4IW4C 1S9YA 5DJZB 3MRNB 4QRSA 2QQKH 3CGTA 4TSBL 3J2PA 1RLWA 2TRYA 1OB1B 5AL8A 4L18A 3D85B 1YMME 2IANA 5BVPH 5EF0A 1WA0X 1GA2A 2VZTA 4IBLT 2V7NB 4KKBD 4DFHA 5ADOH 2EC9T 2I9TA 2UWEE 3KJ4B 3PU7A 5JW3L 5C09E 2XQBH 3CPLB 3SGDI 3C87A 4DN3H 4JJOA 1WVZA 2I7SA 1W16A 2BOCB 1JGLL 3ZU8A 5M95B 1EJ8A 1FL6A 4MA8H 4L2YA 3WKYA 2ZT9C 1KN2H 2FK9A 3MUY1 3GYRA 3NEEA 3RWCB 4Q0XH 4TULL 3F5WB 4M1CD 5FYKD 3FCSA 2EO9A 4PJBF 4GG8B 1XBRA 4PS4L 2CUIA 1PMYA 1JPTL 1LEKA 4YBLB 2H6PB 1KC5H 3KNBA 4W1TA 5F88A 4P48A 5FYKH 1DR9A 4E68A 3DOSB 1YMMD 3ZRCC 5IFHH 1AFVL 3WYRA 4F2MA 4EI5A 5DHVB 3HG0A 3VXRD 1CD1A 3KYAA 5IMMA 2VL5A 1FC1A 1RZGA 4CC4A 4JK0D 3RX8A 3ISWA 1CYWA 1KELL 5BVJB 1R17A 5D7EA 4R5VA 3VQLA 4JDVA 3PWPA 4Y16B 1DE4A 2Q7NA 1Y18A 1H15A 3DRQA 4BH7B 4LCUB 4NSKA 5TTRA 3ZTNH 1A9BA 1VSCA 3L9RA 4XI5D 4DFIA 5A6MA 3MO1A 2CQVA 3IDJB 3THMH 5L2KD 2D0FA 3H9SE 3QIWD 4F8NA 4Z0XA 3OXRB 3IN2A 3FCGA 3AZUA 5I5IA 2VLKE 3OR7A 3E6HA 4MMZA 5DF0A 2P9RA 2R0KL 3BESR 2NR6D 3RI5K 4B60A 2ZWNA 5C70A 5J06A 2MQGA 1MFVA 1D7BA 3WU1A 5JHLA 3I2CL 1P69B 2HG5B 4PJHF 5FB8B 1VPOH 2NY3B 4G8AC 1NCBH 4NO0D 5GRVK 5C07D 3QUZC 4H8QA 3HAEA 1HSBB 2BNQB 2CJ3A 4EDXA 2VC2B 5B38B 1E4HA 4N1CA 4FQQB 4Y9FA 3ZTNL 4S2SA 4QWWD 4FC3E 4B9FA 4PRPB 4ACTA 4XWGL 4M43H 2XG4A 3E2HC 4OI9A 4XVOA 3ARBB 3CHOA 2NX5B 2AW2A 1IBDA 2DQTL 1D5ZA 2ZZUT 3A4AA 2WHVA 4PY8I 3QUMB 1FV1B 4D0DA 1CFNA 2A9ML 1YPZE 3JV0A 3L8QA 3GXTA 4X5WA 2FIKA 2V3FA 5GGTH 1KENL 3ASNB 3PQYB 1YLBB 1ADQH 4QJ3B 2PCXA 4EN2A 5L8JB 1NBYB 3HG3A 5CWSB 1OTTD 2NY5H 5I0YA 5IBTL 2X4OA 1EEZA 5EUKA 1TQUA 2ZXAA 3S37L 5ICZB 3MREB 1A6UH 4NHCH 3D1MC 2XN1A 4MBOA 4DGUA 4GO6B 3TCTA 4XOBA 3QPXL 4JKNA 1RZFL 1P84K 4M7KH 5ERWA 4NQTA 1FNHA 2DKUA 1S7SB 1BF2A 1VZIA 3DVGB 4RWYL 4CNIA 5BW7A 5H37A 3B2XA 1K8DB 1J9QA 2BCMA 2A77L 2FJFB 2DF3A 5BRQA 5DS8A 3K2UL 5BJTB 5CUSH 1RIVH 3QIBC 4X6DE 3TBTA 3B2VH 2VDML 1FORH 4Z18A 1S7XB 4OZHB 2H8PA 2BNQD 2FX7H 2QADC 2NY5C 3A47A 1JPEA 3HLAA 4V2BA 5AW6B 4C4KO 2Q8BL 3QR2A 4LVHC 2CO7B 3SDCD 5FDWA 1RU9H 4PR5B 3VTAA 3WOVA 1D5IL 2MTPA 3UJIH 4JHWL 1I7RB 3ZQWA 5AG9A 5JHLH 4L1SA 2QTVA 3OPUA 3F84A 3LIZH 3UFIA 1VB9A 3KYMA 1U8PA 4UCFA 3APFA 3WKPA 3GZOA 3TNMA 5KVGL 2LLLA 3BP7A 3QIBA 5LWYL 1M7IB 3TH4T 1G0YR 3FUNA 1AR1D 4JRWA 4AMWA 4Z8FH 1FLRL 5JA9A 3LH2L 4BFFA 1XH2A 4PWHA 3KPQA 2WNXA 5HHPB 2HKHL 5FYKE 4UBDD 1TG8A 1YUHA 4AYEC 1BIIB 3MJ8B 1V55B 2HLEB 4K94H 3BW9A 2H9GB 4AYID 4JFTA 1GS7A 1KJMB 5JPNB 3IDGB 3RJQB 3SDDA 4ZO8A 3G08A 1FYHB 3PNWB 3D33A 4JFSA 4U1MA 1PLAA 5EUOB 1XTMA 3TEUA 1ES0B 2FD6H 2RH0A 3O0RL 1OT1A 4OFPA 3CN2A 4JZJC 3UP6A 3WFDH 2FJHB 2NQ3A 3ESUF 1BPVA 3RTQB 4AQ1A 1TDQA 1FAIL 1FVCB 1MVUA 1PIFA 2F61A 1V7MH 3Q2NA 1A3RL 2WLLB 3SKMA 5ID0A 3FTYA 1TU2A 4NKQB 2CAKA 4YEEA 4NT6A 1F42A 1H3UA 1T0NB 2ATPA 3MV7A 4DKEH 2A74C 4GW5A 1X5MA 4LVNC 3OJMB 1E40A 3PWVB 1NDMA 4XOAA 1QBLH 1JGDA 5DEGB 1CDYA 4BSVB 4KDWA 3QXDA 2ADGB 4M7LL 4AK1A 4P57A 1QBML 2YSSB 2IH1B 3QK0A 5IG7B 5ICXA 4X8GA 5BXFA 3LVTA 3TO4B 1A0QL 1NCWH 3K4ZA 2NXZC 1GW0A 4QMEA 4EKXA 1B3IA 5C0JA 4DGWC 1U92A 1BGXL 1GGBH 1QR1A 4J12A 4TVSa 2J1YA 3HUJF 4L3EB 3V55A 5A2BA 2YAOA 4LPWA 5E9DB 3QJFB 4HEPG 1FO0A 1IVTA 1BZEA 1J8HB 2ZSVB 4KMTL 1AGBA 2VZUA 1EVUA 2V0AA 2L8AA 2E9IA 5E8PA 4LHQB 3ZQXA 3ILPB 3FU5A 1KLGB 2P8PA 5KJRH 4FX5A 3KPOA 1FG9C 3I6LD 1W8OA 3X1GA 4DUVA 1FYTE 1XGQB 2GBUA 2NT1A 3VD2A 5BRZE 4YSPA 4DN4L 2BY0A 2NXZD 5AW4B 1SHWA 4MNQB 5E2WL 3MLRH 2NLJA 2M2DA 2WZPA 3DJRA 3B7RL 1KGCD 1U8QB 1YDPB 2NPLX 4MLIA 1U33A 1EHKB 1W91A 1WS8A 1WBXB 3D3VD 3AU1B 2QHRL 4MAYD 4HPHA 2FBJH 3ARGA 4ZTEA 1MY7A 5HI3C 1U4FA 3DROB 4X80H 1M3JA 3DHMA 1Q9KB 5F6IC 4UAOC 1CFVH 5I1JL 2V5TA 2TSAA 5LGHL 1XEDA 3VXSA 1LP9E 2ZXEB 5AVWB 4D0CB 2XNAB 5EZIH 2V6HA 1XH1A 3DIDA 2BHYA 1S7QB 3LH8A 3X12B 4UDTA 5C09A 3T3MB 2QMKA 3F7YB 2JI1A 4QXVA 2BP8A 1LNUA 2EVIA 4H7VA 4J8RA 3SGDH 1IGYB 3WLWD 3IJ7A 1CU4H 1XMWA 2OTUB 4OQTA 1J11A 2WXPA 5I1AA 2ZOKB 1XMEB 1DBBL 2VDQH 1NMCB 1FGVH 3LPFA 2LT9A 5JW4N 3BIBX 4I89A 2XHNA 3MA9L 1JWUB 3MACL 5DMIH 4GP8B 1E4KC 4L3FA 1A4KA 4NAMA 2V5RA 1N0XH 4UT6A 1HYSC 1A5FH 3M8OL 2EE2A 2IDCA 4I9WD 4XH2A 3QVAA 2QGCA 5L6YH 1G7IA 2X1PA 1CG9A 1GJWA 1NBZB