3LQAH

Crystal structure of clade c gp120 in complex with scd4 and 21c fab
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
225
structure length
225
Chain Sequence
QVQVVQSGAEVRKPGASVKVSCKVSGFTLTGLSIHWVRQAPGKGLEWMGGFGPEENEIIYAQKFQGRVSMTEDTSTNTAYMELSSLRSEDTAVYYCATGGNYYNLWTGYYPLAYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords T-cell surface glycoprotein CD4
publication title Structure of a clade C HIV-1 gp120 bound to CD4 and CD4-induced antibody reveals anti-CD4 polyreactivity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 37
structure length 225
sequence length 225
ec nomenclature
pdb deposition date 2010-02-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3lqaH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3lqaH01
3KPQB 5T5NF 1H0DB 1H15A 4G8FA 3FB6A 3V7AE 4Y2DC 4Q9RH 4UMGA 5I30L 3K0WA 5CJBA 4PB9H 1OAYL 2RFXB 3T1FB 4FQXC 4HWEH 5FKPA 3MLYH 4D9RD 2I25N 3C6LC 3STBA 2ZCLL 2R4RH 1IGCL 4ZFOL 3NH7L 3D39A 2A77H 3M1BB 3RIAF 4EXPX 3EO0B 2V9TA 2BVUA 2BP3A 4P0DA 4KK8D 4JVWA 3NPSC 2VLMD 4OF8A 3A6CL 4R26H 2M1KA 4S0SD 4OCSL 3GMOB 2YKLL 5D72L 4LL9A 3MLRH 3HMXL 3VFRA 3D85A 4YDVA 4F37F 1GC1H 3TH2T 4WHDA 4HAGA 2UYLA 1OHQA 2VXSH 3VH8A 1YQVH 2I60H 3WNPA 3FFDB 4PJ5B 1FAKT 1F3JB 3QQ3A 1PEWA 4KJPC 3X3GH 1NGZB 3U9PH 5DFWH 2WV3A 3VFWA 4PJEB 4LPCA 3QDMD 5E8PA 1T1WA 4WU7B 4GUPA 1BZ9A 2AEPL 1FDLH 2QQNL 3GIZH 4YR6A 4CUCA 3RPKA 2FLRT 2A6JB 4JFQA 1RVFL 4XZUB 1CXKA 2DLIA 2VDNH 3W39A 2Q87A 2I07B 2WANA 3MRNA 4QTIH 4O5LH 3GHBL 5SX4I 1OB1A 4OI9A 2BSTA 5MHSE 4OSUL 1SM3H 3PWNB 2YRLA 1CVSC 1HZHH 4NC1E 1SVZA 3VXME 2D31B 1XF2B 4RAHA 4L29A 4FP8L 2QJDA 3CSBA 2O5YL 4QHUA 1IKFH 3E0GA 5HVGB 4K3JH 1YNLH 3FFCA 3GI9L 3RKDC 2CJUL 4TYUA 3C8KA 2BOBA 2CKBL 1A3RL 1HN1A 2R8SL 2OXGA 4K94L 4X9HA 3ROLB 3IETB 3KYAA 3IDXL 2EDBA 4OZFH 5IK3A 1JGLH 5KVDL 4HG4J 5GS2D 3LEXA 4I9WE 5GGRY 2E27H 4PJGE 3SDAD 3DUSA 1AQKH 5HSFA 3T8XB 1G7QA 2VNCA 2ZG2A 4L3EE 3DVGB 4GG8A 5B4MD 1KFAL 4FQCH 5EO1B 4F3FA 4ODWB 2N56A 4N68A 3RA7L 5JZ7C 3INUH 1DCLA 1K9TA 3CX2A 3HZVB 1T1ZA 1XGYL 4JRWA 3S34L 4WW2A 3S97C 5TJWK 1K3ZA 3ZSSA 4YX2H 3CXDL 1MCLA 3CD4A 3OJDA 4WO4D 5DK0B 4LRNH 5HGDA 3VI4F 1NMCB 1PQZA 5ETUA 1I9JL 3RQ3A 5F44A 4MXQD 4G3YH 2E8YA 3QEQB 3HC0A 5IHUL 4QCIB 1UWGL 4W68A 1J9CT 3OKKB 4JPKL 2A73B 2HJKB 2A6DA 1QUNA 1MAMH 1NGYA 1QG3A 4K7PY 4RMUA 5JW5B 1FN4A 5ICXA 3MXWL 4Y8DC 4NCDA 5K9JH 5D1ZA 5EORL 4I3RH 4NBYB 2NXYD 4UIMA 4MAUH 5E5MA 2BHYA 5B3NA 4EDXB 1OAZH 4ZUVB 3OF6A 4ODUB 2CO7B 3W9EB 4HKJA 2F53A 1CFSB 3QCUH 2Q8BH 4C56A 3KLAB 4KRPB 4KJYB 1JZ5A 5IR1B 1UM4H 3ME0A 4M7LL 2CUHA 2DLGA 4PJCA 4D3CH 5JPNB 4YK4C 4X6CE 3BDYL 1OOAA 3MJ6A 3GK8L 4GRMA 4HWBH 3TO4D 4G7YH 1F42A 5JW4M 5ANME 2BRRL 4KVNL 3VWKB 5F7FA 1DDHA 2ITDB 1J1PL 3GSUA 1JGDB 4XTRC 2OK0H 1C5CH 2RGSA 1CE6A 5TFSH 1GHFH 2NPLX 1T83C 1HXMA 1RZFH 5GZOC 1IEHA 3SE9L 4U7SA 2MQ3A 4S1RH 3D25B 4L4VB 3GHEH 4M62H 5FHAL 1QBLH 3UJIL 4G6KH 5CD5C 4XC3L 5AAWA 1KXTB 5HHNA 4EUPH 1LO0L 4P2CG 2GTZA 1CT8A 2VZOA 3MC0A 2DKSA 1FH5L 3FO0L 3UZQA 3QIUB 5T3ZE 3K2UH 3DRTB 5D6DA 4D9LH 2FR4A 4UUJB 1OL0A 3DIFA 1UWXK 5FUCE 3MNZA 4EI5D 1ZGLM 2BVOA 3RWHB 1MIML 3I75A 3Q1SH 4HV8A 1CD1A 2VLME 1IAOA 2G75B 3O6KH 5E8OA 4LCYA 5KOMC 4Q9RL 4FQLH 3HI5H 6FABL 1TCMA 3T0AA 1DEEB 4PLKD 1OT1A 2XWTA 5EC2B 4PB9L 3HCVA 3SKMB 1M1SA 1MHCA 4HWEL 1F90H 3EJYC 3MLYL 1A6ZA 5DVNA 2XTJD 4M4RA 5D7IE 4F9PA 3ZE2F 4XNQA 2XIDA 4U0RB 2A77L 2LABA 1AKJA 5IB3A 1XF3A 2HT2C 3ILQD 2RHEA 1X5GA 4N0YH 1OLLA 2L7JA 2V2WA 4DTGH 5CINH 3SHSA 5GGQH 5B39B 5FFLA 3TH3T 4R26L 3O4OB 4NN6B 5ID0A 2C1OA 1Z3GH 1YY8A 1MUJA 5JOPD 5C71A 3MLRL 2FBJH 4XPFH 1WZMA 1S7UA 3DUUA 4JM4H 4X4ZA 1GC1L 1RIUH 4NQED 3TBWB 1MCBA 3SCMC 3FRPA 4QY8B 4CNIB 4AYFA 1YQVL 2IBZY 3KPSB 2I60L 3LN9A 2HVKA 5HHOB 4N90E 5AZ2H 1U3JA 2IPUG 1X5YA 5D1XD 3OG4B 3GNMH 3X3GL 4NN5B 3U9PL 4PJ5D 1X5ZA 4U1LA 3ZKMC 4P5TA 2BY2A 2VL4A 3GIZL 1SYVB 5HGAA 4HHAA 4D0DA 5C9JA 4B7IA 2BY3A 3ZYOA 2VIRB 1TLKA 2J6EA 5EO0B 3BZ4B 4QTIL 4O5LL 4NQVB 4KXZI 4NKMB 2DIAA 1AXTL 3CPLA 2AABH 1S9YA 1AY1H 1SM3L 1HZHL 3BZEA 5FGCB 5ENWA 5K59F 5L0QB 3P4LA 4PJ8A 4ZSOB 4HUXB 5FOBB 1ZXQA 2J8UE 1IKFL 3NFNA 4K3JL 1YNLL 3RBSA 4M1CD 4GAGH 2R69L 1VADA 4TTDC 4JFZH 2DLHA 4M3JA 5I1AB 4GAJL 2DQFB 1W0VA 2VLKD 3VE0A 5B22A 4M02A 4P2OD 5L2KB 5IHLB 1V3JA 4HJ0C 2VAAB 1WZ1H 1JGLL 3EDJA 5I16A 2E27L 4I48A 1AQKL 1T3FA 2NXZC 3SGDH 3IDIA 5C9KA 2BOCA 1SBSH 4WUKL 1MCPH 1R5VA 3GSOB 1XR8A 1HHKB 4D8PB 1N5AA 1BF2A 5TDOA 4YNYB 3INUL 4Y5VC 1MRFH 1BQHB 5EC1A 3ARFB 3QDGE 5F96H 4XXCA 1CBVH 2XN9A 2QEJA 3QA3B 3DVFA 1PJ9A 2VTFA 4HFWA 3J7HA 4LRNL 5CEZD 1IM3B 4EEEA 4OLYH 1MCJA 5INDB 5IBUG 1CTOA 2EEDA 1VERA 1HE7A 4G3YL 2XQYK 3HZYA 4KI5E 4OF5A 1UWXH 1QRKA 1TXKA 2ZOKA 4PJXE 2YXFA 3FQXA 3QEQD 1MAML 4PUBH 2YZ1A 2PETA 3K4AA 1M7IB 1UZ6E 4X4XA 3K4DA 3SN6N 4NQCA 4X5LA 2B5IB 2VITA 5K9JL 3KLHD 5EZLB 3S96A 4I3RL 2ZUQB 5EOCL 1IGTB 4KDWA 4MAUL 3WO4C 2NY5C 1T6VN 2JJSA 5SWSA 1OAZL 3ZE1F 1ETZB 1B0GB 1BZ7B 3G6AB 4N9GB 1G7LA 3QCUL 1SJHB 5ESAA 3ARGA 2Q8BL 4R3SB 3U0PB 4ODXA 1UM4L 1CG9B 3D3VB 4MAYB 3HB3C 5E8NB 2Q6WA 4D3CL 4DQOH 4M7ZC 2DMKA 4Y7MA 4HF5H 4HWBL 1G7IA 4MD5A 5BRZB 3IVKB 3JUYA 4G7YL 5DMJB 4POYA 4NO0B 1CXEA 4UU9B 5D6CA 3AU1B 2UVEA 4NQDA 4OZFG 5EU7E 1EH9A 4JZNA 3AREA 2OK0L 3IU3A 1C5CL 5AYUL 2CXKA 5TFSL 4FTVA 1GHFL 1G0XA 3BH9B 1RZFL 4POZC 3E1F1 4S1RL 3GHEL 4M62L 1QBLL 4G6KL 4KUZH 4ERSH 3CUPA 4Y5YB 5I15H 1RPQA 5JUEL 4J23A 2BNQA 3L7FA 3ZKSD 5JLZB 3F5WA 1XGPA 5JOEA 5DJ2A 2SEBA 4LDOB 4G6AD 2WWMC 4NC0B 1QYGL 3HA0A 3UTTA 1U8NA 1VEOA 3K2UL 4HFUH 3ZE0E 4LKXB 4D9LL 4PRHA 5DZLA 4YAQA 5I17A 3LKQB 3RVWC 1BVLA 5D1ZC 2E6QA 4NQTA 4Z7UF 1YMMA 3KLSA 3N50A 4N8PA 3Q1SL 4AH2A 4GBXA 3O6KL 5DA4A 1DUYA 2AJZA 3BO8B 5F7LB 2BNRB 4FQLL 1JGEA 3HI5L 3PWJA 5E2UL 3KJ4C 3WE6A 3NN8B 4TULH 2VXUH 3QXAA 4U6YA 4U1HA 2OTUB 2JF1A 1GZQA 3C08H 3FMGH 1F90L 4UDTB 2Z92B 3OB0K 2VXQL 1AFVH 3PGCA 5DMYA 5AAMA 2AEIT 1WAAE 4Y4KC 5FCUH 1A0QH 4PJ5E 2EC9U 3V6OE 1MELA 4N0YL 5HYIA 4YLQT 1TFHA 3BPCB 4DTGL 5CINL 4X6BB 5GGQL 2VLRB 4PJEE 2NR6C 3A6OA 4U1GB 1I8IA 3HZMB 2YUVA 1P7QD 3JWNC 3RX7A 5FYKH 3KYKH 2FBJL 4XPFL 5IBLC 1I8KA 3P4OA 1SJEB 4DUWA 1UH3A 4JM4L 4Z0XA 1RIUL 4KJQD 3AM8A 4UB0H 5CZKA 1LNUA 5AZ2L 4R9HA 3TZVB 2IANA 3GNML 4OCRH 5MEPB 3WNLA 2YD5A 5HHOD 1CF8H 5GJTH 5D1QA 4GG6A 2XFXA 5ISZD 3IF1A 3IDNB 2CSPA 3VI4E 1FL3B 1HSBB 5HGHA 4RGNC 5MEND 1G9MH 3L7EB 2PN5A 4MA1B 4PRNB 1FVDB 3CCHA 3CXHJ 4EUPG 4I3SH 4OM0H 4WI9A 5D6DC 5MERA 1D5ZA 5C09B 2MCG1 5KOVC 4RMTA 4NQUA 1FYTB 2AABL 4EQ2A 4R8WH 3U36B 3VXQA 3QUMH 3RRQA 1I8LA 2OSLB 4Y5XA 3QNZA 1U93B 1HOCA 5KSVA 3WO3B 3WIHH 3HAEA 5E24E 5F72S 4GAGL 1CDCA 3H7LA 4W6YB 2NZ9C 4JFZL 4AT6A 1HILA 1G0DA 2MTPA 3QP3A 2APVA 5E1HB 5HVWA 4RMRA 4PJBF 3VWJB 4HEPG 1GXEA 1KPVB 2DQCH 3HE7A 5SV4A 2P45B 1F11B 1WZ1L 1EZVY 2X1QA 3QJFA 2GSIA 4EQ3A 1JI1A 4YDJB 5IUSA 1SBSL 4OQTA 4YHNA 1MCPL 1ZV5A 5B8CA 3QEQE 3AS2A 4QT5B 3P9WB 3FONA 1MJ8H 3T0EB 3KYNB 1HCFX 1MRFL 1IQDB 4UDUA 1KB9K 5EIQA 4TTGA 5F96L 1OTUD 1QFWI 2KQNA 1F3RB 1CBVL 3I85A 4LLUB 4XT1C 2X4OA 4C55A 3ARFD 3DI3B 4ZFZB 1ONQA 4JRXA 1Q9OB 2G9HA 5I74C 2GUOA 2AS5M 1QFHA 3M07A 1I3VA 5EOQH 1E4WL 2QSQA 5F89B 1RUKH 1YYMH 4OIAA 2VDLH 5FIEA 1DN0B 5KANI 3PP3H 4RAVA 3WFEH 4P3DA 3EOAA 2P8PB 3L5IA 4JGUA 1W2KT 3MLXH 3BPNC 3QJHB 5FGBA 1IAII 5C0ND 4PUBL 1DN2A 3BOVA 4HIJA 2CUIA 1BJ1J 1QSVA 2EIZB 5E99L 3GJFA 5C0RH 3O2VH 2R1XA 4HD9A 2IPKB 5D7KD 5DVLA 3OB0H 3L5JA 3AS3A 2QSCH 4KK6C 2F8OA 4ISVA 1IFHH 2ESVB 1GGTA 3VCLA 3O9WB 1I9IH 2GITB 4HS6B 3T0DA 2ZSWA 3BRGC 5EBLB 3IDUA 1EO8H 1ROWA 2VWEE 3ARYA 2BVYA 3PHOA 5KS9B 1DFBH 2C7UB 4N0FB 4DQOL 1F2XK 2FJGA 2X4NA 4MQ7B 3RTQB 3VJ6B 3I6KB 2DQEH 2HLAB 4HF5L 4L4VE 5FXCH 1WIUA 2V5TA 1VDGA 2A6IA 7FABH 3ZE2E 3KS0H 1U8LB 4YPGB 5BRZD 5DMKB 4NO0D 3B9KD 1A2YA 2XQBH 3UMTA 4L3AA 4K9EH 4XXCC 1OY3B 2BERA 2PR4L 1U8JB 4EN3B 5DHXB 4ZUSA 4PYGA 2VZ1A 3QPXH 2DM2A 3EFFB 4BELD 3UP1A 2R15A 4KUZL 4ERSL 2X89A 1B88A 5I15L 3AXLA 2AV1B 4KK9C 5IB5A 2LTQC 3MR9B 4FQQB 4XBEH 4TNVK 1AD9A 3KPRD 4ORGB 5DJCA 5CZXC 4PJFB 5DHYB 5ID1A 2A83A 2YWYA 1XGTB 3MRBA 2H32A 4AM0B 3DMMA 4U6XB 3QNYB 2O5ZL 1JTOA 1U3ZA 4HUWA 3BP4B 4ELKA 2HJFB 1JV5A 3FO1B 5F3HA 3QUMB 4UBDC 2H2PC 4YIQB 5ICZA 2VXUL 3BN3B 1R3KA 5JO5B 3ES6A 2HLFD 4PREB 3G5VB 4TNWK 1VPOH 2P43B 3C08L 3FMGL 2OL3A 4KJWD 4ZO9A 1AFVL 2ADJB 2XG4A 3PWVB 4KKLD 4PP2A 5FCUL 3KPSE 3MRJA 1A22B 2ADGA 1A0QL 4HIXH 2FRGP 3QIBB 5HPOA 1J88A 2PXYB 3ARSA 3L3HA 2VYRE 3K8KA 1RJYB 4KGJA 3QQNA 3VXMA 1BX2A 4OZHB 1EX0A 3L3OB 5A40E 5GS0H 4LIQH 2VLRD 5FYKL 1ORQB 3KYKL 1NKOA 4ZS6D 3DPBA 4P9HH 2BVQB 4I8DA 4X5XA 1TZIB 4E0RA 4C4KT 2ED8A 5INCB 3D0LA 5D5MB 3T0VA 2R9HD 4OLZH 5EOTA 4QHKJ 3WHE1 1MNUH 1KLUB 4OCRL 3DSNA 1P4LA 5FGCE 2J8HA 4PJGA 5GJTL 3QFJB 4XRCB 4ZSOE 1HCVA 1O7SA 4L3EA 4NJAH 5IVNA 1G9ML 3F8UB 2Z4QA 1PG7X 2XI9A 2OBGA 4NNYA 4I3SL 4OM0L 4K7PX 5L2KE 3PNWB 2D7TL 5IFAH 3QUML 2QTEA 3ZT5A 2PO6B 1YEHH 4EI6B 1N7MH 4GBXC 5HD8D 3DXAB 4OFYA 4QHMB 5GRZA 3VG9C 3WIHL 3KPOB 2V9QA 2YK1H 2V5YA 3BWAB 4YEEA 5GRWA 1D9KD 3O11A 2H41A 4HGWB 5AUMA 1INQA 1FL5A 1YNTB 2IMMA 2Z31A 4LPYA 3FQRA 5HYJD 1JUFB 4NKIL 1I7TA 1UKTA 4P4KB 4PV9B 3X11A 1GGIH 4UOW0 3GGWB 4Q6IB 4UT7H 2F15A 1KNOA 3FB5B 1QRND 4P5MB 4WFEE 1VFAB 2P5ED 3BDXA 3F7YB 5E6ZA 4YH6A 1VENA 5FDWA 2IC2A 4H0HB 5C6WH 1MJ8L 2EDLA 2OXHA 2L0DA 4YHIB 3LKRB 2BCKA 3FZUC 5IB2A 4WW1B 4NUJB 1UB5A 4NDMA 1F6LL 1NC2B 1F4YH 2KKQA 3K8LA 1DL7H 3TVMB 5E4EC 3RNQB 1QO3A 2KQMA 1NJ9B 3BUYB 5EOQL 5FUOH 5JDSA 3RWDA 1U3HB 1RUKL 1YYML 2VDLL 4X6CA 1DVFA 2FATH 1DQJA 5DUBA 3CU1A 3ZKND 5LXGH 3EYQD 2NNAA 1V5JA 1GGUA 3QUZB 4CN4A 5LQBH 5EBMB 1EHXA 5HHMB 3MLXL 2ZSVB 2HRPH 4KWUA 2C3HA 5ANMA 5DK2A 2VZ3A 3MBXH 1DR9A 4H1LH 3FT4B 3TFKC 4A2LA 2NQCA 1S7QA 3D3VE 1VKXA 4KRNA 4MQTB 1OTTD 5C0RL 2APFA 3UDWC 1S9WA 1V3MA 2QSCL 3CDFA 1MY7A 3REVA 4Y5XC 2X4RB 3NIFE 5E5RB 1I9IL 3HI1B 4KVCH 5SX5H 4X0KB 5DJ8A 2HFEB 1FIEA 5HI4C 3JWOC 1EO8L 5H94B 1PG7H 5BXFA 1DFBL 4K7PH 4W4OC 1QSFD 3P73A 4G6JH 5E95B 3O6LH 2DQEL 2X42A 3KNBA 3B9DA 3MFFB 7FABL 2EXWD 1GCFA 5TE4H 2XZCH 5A3IC 2BSRA 1MCHA 1G7JB 3FT2B 4M1GH 2B4CH 5KZCD 5E2VH 2V7HA 4K9EL 3W2DH 2B8OT 3V52H 2BDNH 3A6BH 2G2RA 3HE6B 2MOVA 4I2XB 4L8SA 3EO9H 3QPXL 4QF1A 5D7IA 4JO2H 1REIA 3LEVH 4I0PC 1WFNA 3GSVA 5L7XH 2FEDC 3O3AA 1G84A 2BNRE 1RHHB 4XH2B 4XBEL 5CLTA 5FECA 4U1SB 3JV5A 4PGDA 3BE1H 3EZ8A 3DO7A 2AK4B 5FGBC 1ITBB 2ED7A 1I7ZA 3MLTA 2IH3A 4ZQKB 4MHHG 2FX8H 2FZ3A 3VG0H 4LLWB 3RY6A 4HT1L 3MV9D 3S6CA 3WFZA 5EFIA 4L9DA 2ARJQ 2HA1A 4M93C 3MV11 1I7RA 5ACZB 2D0HA 2VLRE 4L1HA 4F2MB 1T5XA 3K81A 2W1NA 3U7WH 1DANU 1QSZA 2GTWB 2OI9B 2P42B 4XMLH 5CMAB 1VPOL 1ZVSA 3UTZB 3WUWG 4G9FB 1U2CA 2AK1H 4XNUL 3S88H 3MRHB 4Y8AA 5C0IA 4HIXL 3SDAA 5I1CL 2YC1A 3PV6A 2R2CA 3QIBD 3NA9H 4FFVD 2V7NB 2PXYD 5E70A 4NQSA 1QFPA 3MODH 5GS0L 4LIQL 2J8UA 4G8IA 2IADA 4H26A 4OLEA 1H3WM 4P9HL 1DE4B 3HTLX 4O02H 4G43B 4KXZH 3UYRH 1Y6KR 5C09E 4ZAKB 1H3PH 1IC1A 1FYTE 3WDJA 2ERJC 4OLZL 1X6NA 4LCWD 1KN2H 5AG8A 2R1WA 3EOBA 5GQBA 3V0WH 3B3IA 4X6DB 3RWCA 1A64A 2W91A 4NJAL 4I18C 1K8DB 1W0YT 3KAAA 5J1SC 5ERWB 1BOGB 4R2GC 5SWZB 3Q5TA 2D03L 5JDJA 4TUOA 1PY9A 4PR5A 1S5IH 2E9BA 3QDGA 1HHGA 1TJIH 1EJOH 5IEHB 2YPLB 4J6RH 4H1LB 3T77B 2NY2D 1CFBA 4LLDB 4AQ1B 5HYSG 3OKMB 5IFAL 4WHTB 1GZPA 3GMNB 1WCBA 1X7QB 2J5LC 2YRZA 3ULVD 3NCEB 3FJTA 1DQDH 1I7UB 1OAXH 1Y18A 4KMLB 3VI3E 1YEHL 3WL9B 1N7ML 3DUHA 4LDLB 2YK1L 4LP4A 4MD0A 4EIZC 3VXOB 3T0EE 3I6GB 1ZS8A 2OP4H 2BHUA 3UBXB 4PJXA 5CIPB 1Z9SA 3KPLA 1E27B 1WF5A 3BN9D 2FYYB 1GGIL 1KOAA 4IOSD 2YPKB 2YUWA 2JJUA 3CFKA 4HW6A 4UT7L 3DLQR 1NDGA 2XXMB 1FZOA 1UQSB 1FNHA 1S7VA 4XCNB 3L3IB 1T1XA 3IJSB 4ZFOA 2GY5A 3UZVB 5K33A 4GLRH 3PE9A 4L9LA 3P40A 5F9AC 1PYWB 3TN0C 4LU5H 3CX5K 3B5TA 1F4YL 4TNWF 1DL7L 1JHTA 5JTWA 2UVFA 1DQQB 3GSQA 4O2CA 2AVGA 1MHEA 5FUOL 2LU7A 3C8DA 1A1NA 3HMXA 3CIQA 1HHJB 1NGXB 3P3YA 4RZCB 1RY7B 2FATL 5I75C 3MJ7A 1U3HD 4J12A 5LXGL 5MEOA 2ESVE 3O8XD 2V2TB 1CCZA 1ZHLA 5DT1L 5LQBL 1B6DA 2CDEA 4YFDB 2HRPL 3JV6A 2C4XA 2H2SC 2NTFB 3V0VB 3QQ9C 3MBXL 5CKGA 3X12A 2HG5B 2Y5TA 3DGCR 1EEQA 3VFUA 2F54B 1RZ7H 1Z5LB 1P6FA 5CGMA 3NCCB 3ZYIA 5IMMA 5I0DA 4DJMA 1LVEA 2XOTA 3PL6B 2W9LA 3MROA 4X98A 1KCKA 1AP2B 3KPQA 4D9QE 1H0DA 4GW4B 4KVCL 4UILH 5DC0A 1R24B 4JE4B 5IMLB 1IEBB 3BX7C 4FA8A 3V95A 1PG7L 5FYKE 2RFXA 3T1FA 2Z31C 3U48A 4K7PL 3UYOD 1WCQA 3TNNB 2VLJD 4G6JL 4P3WA 4MGXA 4PBXA 3O6LL 3O2DH 4OGXH 2WQRA 3P4NB 1Q94A 2FSEB 4Z76B 4DZ8B 1CQKA 1F3DH 3EO0A 3IRZA 5TE4L 2XZCL 2B1AH 1RUAH 3WN5B 2B4CL 4HK3N 5F88A 2XKUA 4PJFE 5E2VL 1PG7W 3GMOA 3W2DL 2MKLC 3DX6B 3V52L 2BDNL 5JNYB 3A6BL 1JMZA 2EE9A 3SDCA 3GO1H 3L5WB 3EO9L 3QG6A 1NH6A 3EYOB 1WAAA 4JO2L 3LEVL 1JL8A 3FFDA 5L7XL 4PJ5A 1HINL 1F3JA 1UA6H 3V6OA 5EWIH 5DA0B 3BEVB 3KWWB 1NGZA 5DVOA 5IW1B 3SKNA 4Y2DB 3MA9H 4PJEA 3BE1L 3IAPA 2EDJA 2YN3A 4WU7A 2ZPKH 4NO2B 1S7XB 5CKAA 4P3CH 4XVJH 5D9SB 3MRPB 2A6JA 4XZUA 2AK4D 4FZ8H 3VG0L 4WDIB 3EJJX 3VXPB 3C6LB 4IJ3B 5FYJH 2I07A 4UT9H 3WLWD 2BNUB 3EDDA 3DJ9A 1SHMA 3MACH 3PWNA 5JW4Q 2D31A 1XF2A 3U7WL 1TVHB 4XMLL 1NBZB 3NPSB 5H2BB 1FZJB 2PNDA 3MOBH 1Q9WB 3RKPA 2AK1L 4JQXC 3TCLB 2NY1C 4TSBH 3WFHB 4ZNCD 2WMPA 1GOFA 4ZYKB 2MCPH 4AK1A 5D5ME 2A0LC 1C5BH 4LSPH 3ROLA 1H3VA 2LAGB 1EZVX 1RK0B 4HKXB 3NA9L 4MB5A 5FUCC 1QVOB 3QFJE 4MCYB 4NNPH 3IJYB 1D7FA 3PWPB 3T8XA 4U3XA 3MODL 5T33H 3BIKB 5EO1A 1NBVH 2E7MA 3CFBB 4ODWA 1F4HA 2OZ4H 4URTB 4DKEH 5EU3A 2I24N 3K1DA 3UTPD 3HZVA 4RDQF 4O02L 3UYRL 3LKPB 4K07A 1P7HL 2Q3AA 4HIHB 5JMRA 4L8SC 3O3EB 4W6WB 5AEAA 2EE2A 3V0WL 5DK0A 4JFPB 2L7UA 3DXAE 4ZPTB 2XWJB 1NFIB 1OGAD 3QEQA 5CBEB 5DVMA 3TJEH 4QCIA 4CADB 1CVRA 3OKKA 4HG4K 2A73A 2HJKA 2EDOA 1S5IL 1K4CB 1TJIL 4YGVB 4J6RL 5JW5A 4LARH 5BVPH 2D0FA 3TIDB 1DQDL 1OAXL 1XZ0B 3H9SB 4BFBD 2MPAH 3VFMB 5JIIA 3SDDB 1LE5B 4LEXH 4GKSB 4EDXA 2I27N 2OP4L 4ZUVA 2ENSA 1QFWH 2MSPA 4ODUA 3FB8B 3JTTB 2Z93B 1CFSA 3KXFD 3QO0B 4CU8A 2DQJL 3VRJB 3DX7B 4RFEB 3KLAA 1AGCB 1LEKB 4KJYA 2QADC 4G8EA 4AL8H 3BUTA 4GMTH 4JEGB 2BVTA 3ARDD 4CDHA 1FNGB 1CR9H 2HFGH 4P2QB 5J6GB 3VFNB 3VFPA 1NEZG 1IAIH 2N4IA 2ICWI 5HHME 5MEQB 4LU5L 1RAMA 4M1DH 3VWKA 3IDYC 2IQ9H 4R7NB 2ITDA 5H35B 1FJ1B 3JBG7 1JGDA 3LQAH 2W9EH 1G1CA 1EPFA 3X13B 1FNSH 3ALXA 4RA0C 2OR9H 4F8TA 1JWSA 2QQLH 5GGSY 4QWWC 3D25A 4L4VA 3RZCC 1T4KB 5I2IB 2XY1A 1FNEB 3IFOB 3NA4A 2A6KB 2VR4A 1RZ7L 2WBWB 4N0CD 3QIUA 4JHWH 1TPXC 3T4YB 5I1GH 3DRTA 4PJ7F 1FRGH 4J4PA 4JY4B 1QFUH 4UUJA 4UTBL 3BHBB 1KPRB 4YK4B 2FGWL 3PL6D 3RWHA 4MVBC 4XI5C 4RDQG 3U79A 2IH1B 2G75A 1EO5A 4TVSa 4KRLB 3IDJB 4UILL 4Y1AB 4QTHB 4JHBA 2CRMA 3VGBA 1DEEA 2A9NH 3P0VH 5ITBH 2AJXH 4Z6AT 5EC2A 4OCXH 3SKMA 1HKLH 3VDBA 4I2XE 2K9UA 1KV3A 3O2DL 4OGXL 1QD0A 1NCDH 1FAIH 2Z8WC 4HH8A 5SWQB 3EKCA 2ZG3A 5DD1H 2B1AL 4OZFA 1RUAL 4X7TA 5B39A 4UV4L 2AK4E 5FOJA 3VU2A 4HULB 1UC6A 4LVHC 3VA6A 3QDJB 2HRLA 5GGTH 1K5NB 3GO1L 3TBWA 3U9UB 4Y19B 3RNKB 1XMWA 3MV7B 4QY8A 5IHZB 3KPSA 4JAMB 4OCWH 4P59H 4JFDD 1J0IA 2VQ1B 4C57C 2AV7B 1B0RB 1UA6L 5EWIL 1OPGH 2DQDH 4RRPA 4FFZH 3MA9L 4NKOB 2ZPKL 3UROR 1VGEH 1DANT 4P3CL 1SYVA 4XVJL 4X5WA 1ZVYA 1O7VA 4G9FE 2JCCB 4Y2DD 1L6ZA 3I9GH 4LHUG 2VIRA 3ARBC 2X4PB 4I77L 3BZ4A 3AFLA 4FQXD 3I02B 4NQVA 4UT9L 2HTKC 4UAOC 2FL5B 4FXGB 3SY0B 3R06B 1MQKH 4Q0XH 4A6YH 1XIWC 1FYHB 4ZSOA 4HUXA 4XWOC 5FOBA 3ORJA 3K80A 3MOBL 4MJID 4ONGH 2W65B 5I1AA 1R3IH 4TSBL 5FYLH 2DQFA 2MCPL 3SCMB 2OCFD 1C5BL 5L2KA 4LSPL 2VAAA 2EXYC 3OAZK 5E08H 2OS7A 1KCRH 4X6DE 3FTGB 4WHYG 2ZUSA 4NNPL 2JCCF 1LEIB 4JFXB 1KIPB 3GBMH 4UV7L 5DJAA 3WXWH 5EOCJ 5T33L 1NBVL 3GSOA 4BZYA 1HHKA 2OZ4L 4D8PA 4DKEL 5SWZE 3RWFB 4YNYA 1D6EB 1UT9A 4U1NB 3ARFA 1J05B 4PGCA 2YPLE 3OKNB 4NQXB 3SDCC 1QFOA 3QA3A 3LY6A 2NY3B 1IM3A 3PDOB 5INDA 1FC2D 2HKHH 2EE3A 1S7RB 1CGXA 4ALAH 2JIXB 5CHNA 3TJEL 3LKOB 4OKVA 2GJZB 1J1XH 3K7UA 4AY0A 2WUBH 1M7IA 3RKDD 1JRHI 2E9WA 2H3NA 4LARL 5BVPL 3MQIA 5EZLA 2ADIA 2XPGB 1IGTA 2P24A 4ZFFB 2NXZB 4JQVC 2VL5B 1RJLB 2MPAL 3BRFA 3H9SD 4LEXL 3LKSB 1QFWL 1ETZA 4WI2A 1B0GA 4Y5VB 1BZ7A 3G6AA 4N9GA 3VFGH 1SJHA 3F7RA 4R3SA 5JZ7D 3U0PA 5D71H 4AL8L 1Q38A 1MWAH 1CG9A 3D3VA 5F1NB 4MAYA 5E8NA 4HC1H 1CR9L 2HFGL 3LAFA 4XPBL 3IVKA 2VR5A 3OXRB 3BAEH 4P2QD 4JCMA 4NO0A 1IAIL 3DYPA 3CNKA 3VFWB 4UU9A 4LEOA 3AU1A 4M1DL 2JB5H 2IQ9L 2X9YA 3LPGA 1BZQK 2DMCA 3LQAL 2F54E 1OP5H 4FNLH 2EDHA 2W9EL 1G9NC 2F8VA 3W39B 1RU9H 1FNSL 3BH9A 2OR9L 4X7EC 1P7KA 1NANH 5BOZG 2QQLL 1UH2A 3RU8H 2NY6D 4LLMB 3WO4B 4JFHE 2AW2A 1ORSA 1VACB 3ARQA 1S7WB 4Y5YA 4MZ3A 2YRPA 1JK8B 2PYEB 5L9DH 1A3LH 4Y4FD 4TVPH 5JLZA 5DTFB 5KVFH 4Z0BH 5E9DD 2BOBB 4JHWL 5I1GL 1ZA6B 2YBRB 5L8JB 5HHVH 1J8KA 2NX5D 4LKXA 1FRGL 4Q7DA 3SKJH 1QFUL 5F7UA 5E2JA 4V1DD 3LKQA 4OF0A 5C0FB 5CWSB 3BGFC 1OCWH 3BO8A 2BNRA 3OAZH 4A6YB 1ZGLP 3NN8A 2A9NL 3P0VL 5ITBL 2AJXL 4PLJC 4F7CB 1X9QA 4OCXL 3KHQA 3MUJA 1YN7B 2OTUA 2IWGA 1HKLL 5DJXB 1LK2B 5I73B 4UDTA 4F58H 2I9LB 4KRPC 3S3PA 1FAIL 4PRPD 2EECA 3DNKA 3OJDB 1PKQE 3MLSH 3VXRB 1B2WH 3V4PH 5GZOD 3BPCA 5DD1L 3B83A 4X6BA 2VLRA 5CD5D 3TF7C 2UZXB 3MV8B 5K9QI 4X7FC 4XC1H 4ZO6A 5KANG 3HZMA 5HHXH 4U05A 1SJEA 5GGTL 1I1YB 4P59L 1EMTH 1HSAB 3NTCH 1OPGL 3BISA 3TZVA 5MEPA 2IALA 1FFRA 1EAPB 4ZPVB 2HVJB 3KG5A 5GRVL 3KJ4B 1VGEL 3IXAB 1MEXH 2VOTA 3L7EA 3I9GL 4HUKB 2BRQA 3B5HA 4PRNA 1FVDA 5BOPA 3MBED 5J89A 4Y4KB 1LDPH 3MNWB 4QRSB 5C09A 3EJYD 2R2HB 1FYTA 1JVKA 1YPZF 1FIGH 3S4SB 1MQKL 4Q0XL 4A6YL 3SDXF 3PWPE 2OSLA 3I6LE 1U93A 2HT2D 5C70A 3AB0C 1K4DB 2AERT 1DSFH 2GAZB 1PAMA 4ONGL 4KKNA 1R3IL 3VXUB 5FYLL 5J11B 1F8TH 3VWJA 5I8EB 5JOFB 3O45B 2ZNWA 3WFDH 1C5DB 1KPVA 1F11A 1MWAB 4HEME 5E08L 1KCRL 1A9EA 3QUXC 1BFSA 4YDJA 4U31A 4DKAA 3GBML 3WXWL 5IBTH 4L8CB 2DWEB 3T0EA 5KN5B 3ZKMD 4NN6C 1IQDA 1GPOH 5C1MB 2XKNB 4QRRE 4LLUA 3QBTB 1Q0XH 2R56H 1Q9OA 3LH2H 5F89A 3L1OH 4KZEH 3H9SE 2HKHL 2BVEA 1DN0A 3I75B 3JZ7A 4NN5C 4ALAL 4R4BA 3QIWC 4OLUL 3T3MF 3I3EA 5IVZA 1DQTA 3KDMB 3QJHA 4OLWH 3T09A 2XWTB 1J1XL 2WUBL 5GGVY 4LFHD 5F9WC 2EH7H 3MZGB 4TTDD 1AXSA 3TBTB 2EIZA 1U8QB 5HI5D 4O2FB 3U7YH 4GW5B 5EH1A 5DQ9B 5D8JH 2IPKA 4P2QE 1XF3B 2EO1A 4HJ0D 3SE4A 3WCYA 5EU6B 3D39D 3ZO0A 2ESVA 2NXZD 5L0QC 3GZKA 3O9WA 2GITA 4YUEH 2XXCB 5GIRB 1WGOA 3QI9C 5EBLA 2Y6SC 1BWMA 1MUJB 2VZTA 5DFVC 5D71L 5DD6B 3BKYH 1S7UB 1MWAL 4KROD 5F21B 5F9JB 3UPRB 2AXHA 2C7UA 5I1IH 5I74B 2E7LC 3O3UN 1PFCA 4N0FA 3RTQA 4MQ7A 1P5VA 3VJ6A 2PW2A 3I6KA 4PRBB 1LO5B 1A7BA 5IV2B 3BAEL 3ZHDA 1U8LA 4Q58C 1VFMA 4YPGA 2CR3A 2DBJA 5DMKA 1OAQH 4MX7A 2JB5L 5L8LB 3BPNB 4OD2B 2X4TB 4BH7B 4YFLF 4D0DB 2J4WH 4K2UH 4FNLL 3LN4B 5C9JB 4HXBH 5CILL 4LCUB 1MAKA 1RU9L 1U8JA 4EN3A 4OF3A 3FOMB 3OKOB 2IEPA 5J06A 1S9XB 5FYJE 3RU8L 3EFFA 2EKJA 2JJTA 5CJXA 1ZGLB 1RSFA 2AV1A 3RBGA 4Y1AE 3MR9A 4FQQA 2Y36H 4HPYH 5I71B 4RA3A 1XF4B 4ORGA 4IS6B 4PJFA 5DHYA 3FB7B 4Z0BL 3RVXC 5HHVL 4AM0A 3JV4A 3FN3A 3FFCD 4U6XA 3C9NB 3SKJL 3QNYA 5CGYC 5E56A 3BP4A 3GFUA 3NFPB 2AQ2A 2HJFA 4BZ2H 4LHQB 3FO1A 1OCWL 1KEMH 3QUMA 4ZNEE 4YIQA 5JO5A 2AJUH 5HDBE 4ESKA 4LPVA 3C5ZC 3WIHA 3UPAA 2J7LA 4K8RD 3QDJE 3M45A 4F58L 3KPNB 1ZA3A 2ADJA 3PWVA 5IQ7H 1YEKH 4Y19E 3MGOA 1OARH 2YD7A 3B6SB 4EOWH 3MV7E 2M26A 3QIBA 3MLSL 4IHOB 4POZD 1B2WL 3V4PL 1MLBB 1RJYA 2DTSA 5DJYB 2YN5A 2LTQB 4O9HH 2V2XB 3L3OA 4WV1C 4S1DC 4NRYB 3TYGH 2JCCE 1ORQA 2P7TB 2WLZA 3MV8D 5HHXL 5IEKA 4CVZB 4QRPB 2BVQA 1KUMA 1TZIA 4TRPH 5KW9H 2WWMD 3T3PF 4A2MA 4CVWA 4NQCB 5INCA 5D5MA 1EMTL 3SBWA 3RGVB 1WC7B 4M03A 3TIEB 3RVWD 5D1ZD 3NIDE 3QFJA 4XRCA 3BQUC 4ZOCA 3CSGA 4WTZA 4DW2L 2QLVB 1MEXL 1EAJA 1J10A 4OUUB 3BH8B 1BFTA 3MRKB 4QHNB 3OF6D 2F53D 5IGXH 1LDPL 4C56D 2FO4B 5LCVH 3PNWA 2VDML 2R29H 4Y4KD 3BSZH 5JR1H 2PO6A 4CAGA 4EI6A 5C0BB 3OX8B 2FH8A 3DXAA 1LO4H 3KPOA 1LP9B 5FM5O 3BWAA 1DSFL 5ADPH 2DJ4A 5JHDB 1L0QA 2VO5A 4HGWA 1YNTA 3ZDXF 1F6FB 2XYCA 1F8TL 1JUFA 1VHPA 1FCGA 5CGTA 5IBLD 4PV9A 4P4KA 1MIEH 2VUOA 1LWRA 3GGWA 4Q6IA 5JXEA 1IKNA 3FB5A 4P5MA 4JO1L 3RDTC 1VFAA 3A0OA 3STLB 3F7YA 2X44D 3UC0H 1QKZH 5IBTL 3FQTB 1KXVC 3G6JB 3LKRA 3F5WB 3RVUD 1GPOL 3TT1H 4KKAC 1P4BL 4WW1A 4RGND 1U8NB 1NC2A 4LPTA 1Q0XL 3RWIB 2R56L 3TVMA 3LH2L 3RNQA 4EDWH 4G5ZH 4PV8B 3BUYA 1NJ9A 3L1OL 1NFDB 1LP9F 1GJIA 3RUGB 4KZEL 1YMMB 3ELAT 3TZVC 4GBXB 3VG9B 2AJZB 4F33B 4Y89A 2ZUYA 3QUZA 3WFCH 3PWJB 5EBMA 3QUKB 5B3JE 2X2YA 3E8UH 2ZSVA 1CDYA 3KS0J 2Z35B 4R97C 5F7WC 2EH7L 3FT4A 2NZ9D 4IMKC 1IARB 2VKXA 5DK3A 3U7YL 2YUXA 5I0ZA 1E4KA 1OW0C 3B9EA 4APQC 5D8JL 4HS3B 1OSZB 1CD0A 2RB8A 3G6JF 4PJIF 1JNNH 4LSQH 3CVHH 4L4JA 1AKJD 4K3HA 4OZIB 2X4RA 5JQ6H 2IJ0C 4YUEL 4PJAB 5EU6D 3TM6A 3HI1A 4NOFA 1NGQH 1XGUB 3V79C 5CEYA 2HAZA 2HFEA 3OZ9H 1VB9A 5ESVB 3NVQA 3BKYL 3RWGB 5H94A 4WFFD 1AXIB 4JY5H 1K2DA 3D9AH 1I1FB 4OUOA 3VWJC 5I1IL 1S5HB 1JTTA 4LMQI 1D5XB 3V5HB 2ED9A 4KTEH 3MFFA 1NAMH 2PYEE 3MNVA 1OAQL 3FT2A 5F7YC 3S5LB 1CZ8L 2J4WL 4K2UL 4P5TD 3ESUF 4HXBL 1DBML 3W81A 3NAAH 4S2SB 3HE6A 3VFOB 4UINL 4I2XA 4JFYB 3GSNH 3TNMB 4PJAF 1MJJB 4ZUUA 2DLEA 5C3TA 2Z8SA 1S8DB 2R1YB 1RHHA 1Q1JH 2DL9A 1R5WB 4GQPH 4KK6D 3QULB 2Y36L 4HPYL 1X3DA 2CR6A 4I1NB 2D7MA 4M6MH 3QEGH 3HAEB 4U1SA 3SOBH 1MCFA 1SY6H 2AK4A 2JB6A 3VXTA 1U6AH 5D4QA 2GJ6B 2VRAA 5DJ6B 4ZQKA 2UWEB 4LLWA 5FYLE 2GFBB 15C8H 4JZJC 1N2RB 4JM2F 4BZ2L 3VXRE 1BQUA 4ZG1A 2GSIB 5J7CC 4YHNB 5IB4B 3C5SB 3MV8E 1S7SB 1YPZE 5H8DA 4IRSC 4F2MA 3KYMA 3O9WC 2GTWA 5CMAA 3FONB 3PV7A 3UAJD 1QBAA 4P2RB 3UTZA 2P5WB 4G9FA 2DLFH 3U6RB 1O0VA 5IQ7L 1YEKL 3MRHA 1SJVA 1OARL 1K8IB 3G5ZB 4EOWL 1U42A 1ONQB 4HUMB 2XN9D 3RTQC 3HUJB 2YD3A 3CSYA 3S36X 4I0PB 1NL0H 1MCOH 3ZTJH 1N26A 4O9HL 4M8VA 1I1AA 2UWEF 4KK9D 3TYGL 4LNVA 4OAWA 3MRFB 2CGRH 3BESR 3WEXB 2C3VB 4M7JH 1I4FB 1DE4A 2FNBA 2AJ3B 5KW9L 4G43A 4XXDA 1AJ7H 1NKRA 4ZAKA 1FFQA 5JXAH 3V6FB 4MQXC 5BVJA 4M93B 4NQCD 1RZKH 1JPFB 2JJTC 4IOFC 4X6DA 3S7GA 1MCWM 3CVIH 3BP6B 2WBJB 1JTPA 1K8DA 2DTMH 3AS0A 3G5YA 5ERWA 1BOGA 2H2PD 5SWZA 1P9MC 2XNAB 3AROA 3ULSB 3VXUE 2NYYC 1UCTA 3HUJF 3T3ME 1E0OB 4YHMH 5J57B 5IGXL 5CS7A 5DO2D 1G9MC 5IEHA 3LRSB 3TP4A 2YPLA 4H1LA 5LCVL 3T77A 4F7TB 2CKNA 4LLDA 1OLZA 4O58H 3BYYA 3OKMA 4Y16B 2R29L 4WHTA 3ARWA 3GMNA 4PGJA 1X7QA 3BSZL 4DCQB 1I7UA 5JR1L 4HZLB 3RY4A 3WL9A 3F7PC 2DIBA 1LO4L 3NCBB 4KI1A 3FT3B 2OR8A 3OGCB 3VXOA 3CVHB 1KELH 4CMMB 5ADPL 3MXVH 1K6QH 1P1ZB 3EGSA 3I6GA 1A2YB 1TENA 5CIPA 1NCWH 1E27A 4N8VB 5CSGA 3RJQB 2VE6B 1MIEL 2FYYA 2YPKA 3OGOE 3ARED 4HIEB 3W0WB 1FC1A 4OV6F 2ERJB 4PP1D 1E4JA 4PD4J 1UQSA 2LU3A 2PTTB 2WIIB 4XCNA 1N3NB 4LBEB 2FJHB 2IGFH 3F58H 3L3IA 3UC0L 4P49A 3GRWA 4UOW1 3IJSA 2QL1A 4QNPF 1I8MB 1QKZL 1U2HA 3NACH 4I18B 1DBKH 5ILTH 1PYWA 1NAMB 4AEFA 4R2GB 1M6OB 3UTSB 1AD9B 2BNQD 1XR9B 3TT1L 5A2LH 4TVPE 1RHFA 3S5LG 4J3OC 5E6IC 2XA8H 5BZDB 3Q3GB 5JIPA 1CK0H 3MUGA 5F7DA 4X6EB 4Z7VB 1DQQA 4EDWL 4WGWB 3UTTD 3OAYK 4KDTA 2FECI 3GSRA 4DWHA 2HTLC 1HHJA 3MRIB 2AJVH 4PRHD 4RZCA 1A4JB 3S36H 1CFVH 5EU6E 1CDHA 4BQBA 4NRXB 3IDGB 4OD3H 1IJ9A 4YHPB 1YMMD 3WFCL 4ELMB 2DOCA 4GBXD 3E8UL 3MLWH 3VXNB 3W5NA 3LD8C 4KHTH 3V0VA 2HG5A 1Y6MR 4KZDH 2F54A 1PD6A 1CXIA 4BK5A 3PL6A 4DN4L 4K3EL 3EFDH 1JNNL 2EIEA 4P23A 3CVHL 1T2QH 2PO6C 3MRCB 5JQ6L 2O26U 1C8PA 1MJUH 4GW4A 3JTSB 2VUYA 3PGFH 5FO9B 4Z7VF 4XGZB 1NGQL 1R24A 3TN0B 5GGSB 4LSSL 3OZ9L 1IEBA 3V5DB 3FZUD 4JY5L 3D9AL 2V5MA 4P4KC 3TNNA 4Q6IC 4B0MM 5JXEC 4HS8H 1IKNC 4PIRF 3P4NA 2FSEA 5I75B 4Z76A 3OKDB 4DZ8A 3MYJA 1NAML 5EBGA 5HJ3A 4S11A 1I3UA 2P48B 2APWA 2IAND 4L3EB 4N0RA 1V7NH 5D1QD 5F7HA 3BRDA 2X9WA 3DX6A 3NAAL 5JNYA 3TPKA 3L5WA 3TFKD 2YD2A 3EYOA 3UTQB 3GSNL 1CFQB 4K9EC 3MCLH 3DBXB 5DEFB 3RIAK 1MI5B 3DX8B 2MHAA 2Y07H 2Y5EA 3OJVC 1PKQA 5KSBB 1A6AB 1Q1JL 4U1MB 5JIKA 3KWWA 3EIFA 5IW1A 4K23L 4MDJA 3SOBL 4M6ML 3QEGL 4RFOH 1QBBA 2OTWB 1S7XA 1C08B 5BS0B 1U6AL 4BYHA 1QSEB 3MRPA 2M2DA 3RHWK 4F37K 4YC2B 1IE5A 4WDIA 5HI4D 1I7TB 3VXPA 3C6LA 2CQVA 2BNUA 1QLFB 2DM7A 4I0CC 3HE7D 4QHLA 1KIRB 1AO7B 4HKBB 1TVHA 1A1MB 1EGJH 5H2BA 2Z0BA 1Z2KA 2VB5A 2DLFL 1Q9WA 4QRPE 2B0SH 2FBOJ 3QXDB 3TCLA 3WFHA 2P5WD 5KSBF 3B9VA 1V8HA 5JDSB 1Z9LA 2CIIB 4DGIH 4MLSA 1NL0L 4HK3J 1MCOL 3M8OH 1RK0A 3QCVL 4HKXA 4NZTH 1QVOA 2WSKA 4MCYA 3IJYA 3PWPA 1EUTA 3OAYH 2NNAB 4HKZB 4DN3H 3BIKA 4R4NC 3CFBA 2CGRL 4HBCH 4WO4C 1JYVA 4M7JL 4DVBB 1EDQA 4KDVA 2R2BB 3DTXB 5GS0C 3LKPA 1QPPA 1AJ7L 3GMLB 3L3GB 1JZ8A 4HIHA 5JXAL 3O3EA 3DYOA 5KTEH 1ZAGA 1T5WB 4NPYB 1HK6A 1RZKL 3KPTA 4KV5E 4XCEB 4JFPA 4U0QB 3CVIL 3OSKA 3DRQB 4LAQH 5C0BE 25C8H 4ZPTA 2Q1EA 2XWJA 4GMSH 1LP9E 1NFIA 2DTML 5CBEA 3GMRB 5JHDE 4CADA 4LHUA 1L9NA 1W8NA 3BW9B 4YHML 2NY1B 5DQJB 4YGVA 3RVTD 4QRRA 1NBYB 2DQGH 2VN7A 4IOIB 5BXFB 4S1SL 1BVKB 4O58L 2HN7B 4U7MA 1J18A 1XZ0A 1IZKA 1EVTC 1MRDH 3H9SA 4RMVA 1G0YR 3VFMA 5KG9B 3SDDA 1KELL 2NZIA 1LE5A 2YR3A 3MXVL 1K6QL 1NSNH 4GKSA 3G6JE 4PJIE 4Q2ZB 5D2LB 2OI9C 3JTTA 2Z93A 1HYRC 4J3TA 1NCWL 2H8PB 3BKCH 3QO0A 3JV0A 4XP5H 1A7NH 3O6FC 3TO4C 3VRJA 3DX7A 4RFEA 1AGCA 1LEKA 2C9AA 3QWQB 4L8SB 4Z7WB 5FGRA 1TJGH 1NFDE 3VRLF 3RUGE 1UGNA 1YA5A 4JKMA 1T89C 2IGFL 1BOYA 1FNGA 3I3DA 3F58L 4PJDB 1INDL 1KCVH 4P2QA 5J6GA 3VFNA 4JKKA 2EDXA 4QRUB 3HG1B 3NACL 1DBKL 5ILTL 5EUOF 1I1AC 1WV7T 2IPUK 5FECB 5MEQA 4BSJA 4TQEH 1N64H 1JRHL 4R7NA 5H35A 2XA8L 3UTSD 1FJ1A 4R0LC 1CK0L 1NCUA 4Z18A 5KSAC 3X13A 1I75A 1JI2A 1GOHA 4ODBD 3S36L 1CFVL 5D2LF 2HFFB 5E6YA 4OZIE 4OD3L 3SJVB 2GW5A 4MDIB 5E2WH 5B38G 3MSPA 3ZZ1A 4WNQB 4PJAE 5DF0A 5EIVA 5I2IA 3MLWL 1FNEA 3IFOA 1F3DJ 4KHTL 4UT6H 1BFVH 1IGFH 3LMJL 2A6KA 4Z7WF 1S7TB 2NY0D 4WWKB 4Z77B 3O3BB 1BWWA 4PJDF 4NM8H 1WTGT 4YZFF 1KCUH 2QADB 1JF6A 4YHKH 3T4YA 6CGTA 4F7MB 4Z78B 3BHBA 1X4YA 1KPRA 3EFDL 4TOYH 4MA7H 2CRZA 1NCAH 1T2QL 4XBGA 3OB8A 1MJUL 2IH1A 5MHSD 3IDJA 4Y1AA 4QTHA 4UIKH 1KFAH 4U3CA 1ZLSL 3VXMD 2IADB 5KBNC 3IDYB 4F7EB 3RA7H 3ILQC 1CGTA 1MHPH 3TN0D 3OAUL 1QFWM 1XCTB 4MQSB 4HXAH 3H3PH 2A74B 2G5RA 4HAFA 4HS8L 1E4XI 4JB9L 2CLVB 2CXGA 4XVUC 2R23B 4OFIA 1ZSDB 3PJSA 4JGMA 1HQRB 1A7OH 5SWQA 1IM9B 1RJCA 1RURH 3RZCB 3D0VB 1KTDB 1V7NL 4G6FB 2W0FB 4ZNEA 5BQ7B 4UNTA 1CU4H 4AG4H 3LV3B 4H5SB 4L3ED 4JPKH 1IAIM 5I76B 5D1XC 2H2SD 2GJ6E 3QDJA 2OZ4A 2UWEE 3HLAB 3QQ9D 1UXWB 2B4CC 1K5NA 1R3LA 1TPXB 1QBMH 3U9UA 3D1MC 3GMPB 2ZOLB 4Y19A 3RNKA 3MCLL 3F12B 5E8DH 1NC4B 3MV7A 5IHZA 3E3QC 1JF5A 1GIGL 4KDTC 2VQ1A 5T3XH 2Y07L 3MRQB 2AV7A 1B0RA 3EYVB 5CFHA 3H2WA 4RFOL 4NKOA 1UYWH 1A8JH 4OFYD 2ZUVA 4P2RE 2P5WE 2JCCA 3PQYB 5GPRA 5ADOH 1QSED 5DWUH 4IRJC 5I8CB 1FHGA 2Z31D 3I02A 1JFQH 3IDMB 2HJLB 3HUJE 1FZOB 3S98A 2FL5A 4FXGA 3SY0A 3R06A 4P23C 2KDGA 4KK5C 4P2OC 1EGJL 4Y2OA 4MLIA 1BP3B 1AC0A 1G9NH 3U4EB 2B0SL 4LVHB 2W65A 3O6MH 1UM5H 2QSTA 4GRWF 2OM5A 3SCMA 1ZOXA 3GSQB 4NRZB 4O2CB 3WJLA 4G9DA 3RPIB 1TNMA 1CN4A 4JREC 4Z7QF 3M8OL 4NZTL 2X41A 4Z5RB 3FTGA 3SE9H 3MJ7B 4YDKH 4QOKE 1LEIA 3JXAA 4JFXA 1KIPA 1ZHLB 4X9IA 2G5BB 4DN3L 4HBCL 4MNGB 3RWFA 4Y4HC 1D6EA 1JZ6A 4U1NA 3X12B 2VZUA 1IGMH 3ARBB 1J05A 4WGVB 4WRLA 1DBBH 2NW3B 2ORBH 3OKNA 4NSKB 3FO9B 4V2BA 1P53A 5KTEL 3F6LA 2I26N 1CDBA 3PDOA 4LAQL 25C8L 1XIWB 1S7RA 3SGKC 4GMSL 2E9JA 1FSKB 1B4JH 2JIXA 2DKMA 1XGRB 4GOSA 3LKOA 3MLVH 6FABH 3STZB 5DRXA 2GJZA 4YBHA 4F8QA 4IMLB 2WK2A 2DQGL 5IWLA 4DEPC 5HHQB 3W0WE 4B41A 1TITA 4IJ3C 1E28B 2GEEA 5IG7B 1FNLA 3TBSB 5T3ZD 2CKBB 2XPGA 1YECL 1Q94B 3QO1B 1MRDL 4JLRB 1BEYH 4ZFFA 2VL5A 3L3DB 1AHWC 1RJLA 2BSSB 2PYFB 3LHPH 1NSNL 3LKSA 5FYKU 3UTSE 2F8XC 5F88B 4Y5VA 3Q5YA 3BKCL 4XP5L 5I8OH 1KEGH 1T20B 1A7NL 5ALBH 1BJ8A 4Z7VE 4H8WC 1J0JA 3SDCB 1BJMA 3RHWF 1TJGL 3QG6B 5F1NA 3Q2CA 3EJZD 2B1HH 1T7XA 1KCVL 2AEWA 3D6GA 3D87B 4X9FA 2ZP0T 3U4AA 1T0NB 5F7EH 3MJ9H 3N85H 3OXRA 4ELME 3U1SH 3SKNB 4MSWB 3HG1D 4TQEL 1N64L 1T2JA 1M7DB 3BD5A 3FRUB 1BFOB 4PBWD 2VZSA 1MCSA 2FEEI 5DLMH 1GSMA 2EDQA 3IFPB 4ZDHB 3IT8D 1CLCA 1JCKA 1AXTH 4WW2F 4LLMA 3HR6A 4JZOA 1F6AB 1VACA 5IKCB 1S7WA 1QLEH 3FHAA 5E2WL 5HGBB 4JKLA 4N90D 1HHIA 1JK8A 2PYEA 5I1EL 1L0XA 3SJVD 4UT6L 1BFVL 1IGFL 3GBNH 5DTFA 2R69H 4NM8L 1KCUL 4YHKL 1ZA6A 2YBRA 2O93L 4GAJH 1OWWA 4AEHH 4ZODA 3GIVB 1AR2A 4IDJH 3CGTA 4BJLA 4TOYL 2GT9B 4MA7L 5C0FA 5CWSA 4XX1G 1NCAL 1R3JB 5LBSH 4XNMB 3AY4C 1EHNA 2X4SA 4MXVE 3C60B 4UIKL 4WUKH 3SDDC 4A6YA 1NLDH 2X4UB 5EU3B 4HCRH 3V4UH 1MHPL 3CMOH 3H8NA 4F7CA 5I1LB 3W5MA 1YN7A 5DJXA 1R5IB 1LK2A 2DD8H 3VH8G 2I9LA 5GGVL 4HXAL 3H3PL 3QXVA 2O61B 1NEUA 1MI5E 3QB7C 3GKWH 5EULV 1J0KA 1A7OL 5I1HH 3RI5F 5KSBE 1RURL 3VXRA 3SO5A 4QWWD 5BZWB 1IM9D 1CU4L 4OGZA 1LMKA 2AAVA 1YPZA 3J8F7 3MV8A 4AG4L 3RZCD 3MGTB 4KQ3H 3P77B 5BS0E 4HBQA 4G6FD 1C12B 1QSEE 3NCJH 2YA2A 4BUHA 1QBML 3AMKA 1I1YA 1U8KB 4JPWL 5E8DL 3QDGD 3TH4T 3S3SA 4DOHB 1URLA 5T3XL 2CMRH 2UY7A 1HSAA 3BGFB 1KACB 1P84J 2WWKT 5EOCH 4GXUN 1AO7E 1EAPA 3IB4A 3O81A 4ZPVA 1UYWL 2HVJA 4XI5D 4DKFH 3IXAA 4N5EC 3GSXB 2NLJB 4KI5D 4JCLA 5ADOL 4LGPB 5DWUL 4G8EB 1F4AA 1V3KA 1B9ZA 4Y4KA 5CJQH 3MNWA 5LVEA 1JFQL 4QRSA 5C0AB 3TESA 3U0WH 2R2HA 3LS5H 2P4AB 3DO3A 3S4SA 4OBRA 3VFPB 3NBNA 3O41B 4WHCA 2AJYH 3GSWB 3KLDA 1S9VB 5EBWB 1K4DA 2Z9TA 2FGZA 1G9NL 3IAQA 2GAZA 8FABB 1B90A 4LLQB 3V7MA 3O6ML 3VXUA 1UM5L 4CMHC 5AYUH 4AZ8A 5I8EA 5JOFA 3SGEI 3O45A 4YHLH 1I1CA 4NZUH 1C5DA 2D9CA 1MWAA 5IBUB 2X7LB 1JWSB 1UVQA 2JK5B 4NN7C 4BFEA 3N1FC 1QLRB 2FIRT 4TSAH 4HC1A 4YDKL 3RX8A 4OGAD 5DURD 3MA7B 3VRLE 2ZUXA 5JUEH 5MP6H 4O2EB 4L8CA 2DWEA 1BD2B 5KN5A 4HUVB 4J8RB 1JF1B 4MB4A 1IGML 3ZKQD 2XKNA 1FBIL 4J2XA 1QYGH 1DBBL 2ORBL 5F6HI 4LPUA 5FDYA 4BKLB 1RFDH 4LLYB 1P2CB 1L7TH 2D4DA 3HS0B 4FOMA 2Z91B 1YYLH 3ULUH 1RZIB 1B4JL 1UG9A 3AB0B 4Z9KB 1XIWD 3C2AH 3MLVL 5D2LE 5E2UH 1WFTA 3KDMA 4HK0B 4XWOD 5DUMH 4GKZB 3V4VH 4XNYH 2QR0B 4H88H 1UKQA 3TBTA 1U8QA 2VXQH 4O2FA 4Z7WE 5DJ0B 5D2NC 4GW5A 3BZDA 1SJXA 2VLLA 2BC4B 4PJDE 5DQ9A 1NDMB 4YZFE 3QUXB 1G6VK 1BEYL 1KXQE 5GS1A 1VFOA 5TQ0H 1AC6A 1QACA 2EXYD 3HG1E 5EU6A 4FHBD 3MRGB 3LHPL 4OZFB 5DC9B 5FUZH 4X7TB 1JHKH 5A2KH 5GIRA 1BBDH 3M17B 5I8OL 1KEGL 5ALBL 3L3JB 5DD6A 2ZCHH 4PLNC 5F9JA 3UPRA 4TN9A 3QRFM 3WJLC 3F7QA 1WVZA 3SDCD 2B1HL 2OQJB 4LKCA 4PRBA 1LO5A 5F7EL 5IV2A 3MJ9L 3N85L 1YNKH 3SJVE 5CBAB 2J1KA 3G04B 4X9BA 2GK0B 3QIWB 3WIIH 3U1SL 4IBLT 4D0CB 3SPVB 3B9AA 4MNHB 1MVFA 5I19H 4HDIB 2PCPB 1LEGB 1NLBH 2VN4A 4OD2A 2X4TA 4WTXA 4X5WB 4BH7A 1FPTH 3LN4A 2E5EA 5F9WB 1WUNT 4LCUA 1DEDA 3WKMH 5DLML 3FOMA 3OKOA 1JWMB 3LQAC 5M7QA 2NY3C 3EDFA 1S9XA 4NBZB 1PDKA 4P9MH 1ZGLA 1CGSH 1QLEL 2B20A 4EBQH 5HPMB 5C0JB 3EUUA 1MFAH 3GBNL 1KT2B 1XF4A 3QI9B 4IS6A 5IM7B 3LEYH 2CD0A 3FB7A 4AMKH 4UQ3B 4ZO8A 1F2QA 4AEHL 5IWLC 3C9NA 4MMZC 3Q6GH 3K74B 4IDJL 1MFCH 1O5DT 1A21A 5DEZA 2FHCA 3NFPA 4PJHF 2ICES 3EAKA 3MCG1 1OD7A 5JW3H 4MJ5B 4KKLC 2Q7NA 5LBSL 3EDKA 5DJAB 4WUUB 1DQMH 3QXWA 1NLDL 1PX4A 4G8GB 4HCRL 1ZKAA 3V4UL 3CMOL 2CH8A 1XH3B 2DD8L 4M9PA 3ZDZE 5FV1L 3KPNA 4ENED 5K9KB 4GFTB 4PGCB 3BD3A 3GDBA 3CZFB 3B6SA 3DECA 5DVKA 3GKWL 5C8JB 1E4WH 5I1HL 1KC5H 4RMQA 4IHOA 3SQOH 5J56B 1IC7H 1MLBA 4JKWA 5DJYA 4XCYB 4R96A 2V2XA 5CHNB 4HPOH 4KQ3L 4NUGH 5GRUH 4WEBH 1U8IA 3AMLA 4NRYA 3NCJL 2P7TA 3PQYE 4OKVB 4CVZA 4WTWA 4HMCA 4EUPB 4QRPA 3NOIA 4MS8C 5T1KB 2H3NB 5E99H 2DM4A 2CMRL 5F71A 3ZDYE 2ADIB 3RGVA 1WC7A 3TIEA 2P24B 3QPQC 3WMSA 1VESA 2IAMA 2HH0H 4DKFL 1KULA 4PY7B 1EHLH 1Q0YH 1AI1H 3DGGB 3LIZH 3C5ZB 4OUUA 2NW2A 3BH8A 3MRKA 4QHNA 2LQRA 4PLJD 4WWID 5DMGD 5CJQL 1Z0NA 3U0WL 1XGQB 2FO4A 2WAHA 2VQTA 2VR9A 4KRPD 2XACC 1D9KC 3LS5L 2J3SA 5E2TH 5D96B 4LVNC 2AJYL 5C0BA 3A67H 2XG5A 3OX8A 4ETQB 4OZGB 4E41B 3JWDH 1LP9A 4MA3B 4LEOB 4MNGE 4WV1B 1FCCA 5JHDA 3QZWG 4Z7UB 4O00A 3V6ZA 3VD9A 4PY8I 1EV2E 3VWKD 1N8ZB 5I73C 3FKUS 4W70A 1CDGA 5DQDH 4YHLL 2BZDA 4NZUL 2PR4H 1QNZH 1P7KB 1V3LA 4XMPH 4TSAL 5LAXB 4XPHL 4C54A 3ULUF 2H32H 4MXWL 2EDEA 3STLA 1ORSB 2RBLA 5EPMB 4L4TB 3BQUB 2Q20A 2MFNA 5MP6L 4L4VD 3FQTA 4XVSH 2ATKB 3G6JA 4PJIA 1CLZH 4GS7C 1A7RH 1D5BB 3VW3H 3EYQC 1FFNB 5FAAA 2CLRB 3RWIA 2V5RA 1RFDL 4RIRB 5J13C 1L7TL 1T03H 5C92A 4PV8A 3CFCH 3QIUD 4OZGF 1NFDA 2O5ZH 4KUCD 3PP3K 3RUGA 5TPWH 4J4PD 5AD0B 1YYLL 3ULUL 2CDFA 2R4SH 5DGQA 3C2AL 4F33A 3QUKA 5DUML 4JRYB 5A16B 3V4VL 2AKRB 2Z35A 4LOUC 1MHHB 2X6MA 4XNYL 3TV3H 5KAQG 4H88L 5DRZB 3S35X 1ZT4B 1IEAB 1ZHKB 1IQWH 5FF6B 1MCCA 4GAYB 4JHAL 4HS3A 3WIFB 5L88H 1OSZA 1NMAH 4MNQB 5TQ0L 5TQ2H 3RDTB 5K9OB 2KZWA 5HDLA 4QXUL 4OZIA 5FUZL 4XP1H 3B43A 5IOPB 1JHKL 3DURB 4PJAA 3SE3A 2YA0A 1BBDL 1XGUA 1KTRL 5ESVA 3LB6C 1L7IH 1H8NA 4IEFB 2ZCHL 2EXWC 3RWGA 1U8OB 3HFMH 3GKZA 5J11C 3PDGA 1I1FA 4YQXH 1WBYB 5DD0H 1S5HA 3T1WA 3LZFH 3C09B 3LOWA 2HT4D 3V5HA 1D5XA 3ROOB 4LSUL 1YNKL 3KPSD 5KVEH 3GJEB 1JN6B 4PJBB 5T3XE 2IALB 5EZJB 3WIIL 2EIDA 4KMQA 5I19L 3QIWD 1NLBL 4JM2A 3S5LA 5T1MB 1FPTL 5C0GB 4R97B 3P4MB 5I1DB 4S2SA 3WKML 3O0RH 4KQ4H 3VFOA 4JFYA 1U91B 3UDWA 4APQB 3TNMA 3S3JA 4YXKH 2D7TH 1MJJA 5C2UB 4P9ML 4OI7A 1PW3A 1CGSL 4OB5H 4GKOA 3ALPA 4PRIB 2K7QA 1S8DA 4EBQL 4S1QL 2R1YA 5C0DB 5CD3B 5IP4A 1R5WA 5IIEB 1MFAL 3QULA 1FP5A 5DYOB 4E42B 1RZJH 4JG0H 1PVHA 3LEYL 4XNZB 4AMKL 2QSVA 4NJ9H 1F5WA 1AGFB 2GJ6A 3NFSH 5DJ6A 2UWEA 2Y6SD 1E4XH 5DFVD 3Q6GL 4FRWA 4NKIH 1MFCL 4XPGH 1VGKB 2GFBA 4W4OA 2FD6H 1N2RA 1A9EB 5L2KD 3MFGB 5JW3L 5GS1C 4M6OH 1NCCH 3BD4A 5IB4A 3C5SA 1S7SA 3ARZA 1DQML 4WCYH 4CVXB 4ZXBA 3LQMA 4P2RA 2P5WA 4F7PB 3U6RA 2DN7A 5ACMA 1MVUA 4XB8A 1K8IA 3G5ZA 5K93A 1ZMYA 4CN6A 1ZHNB 1DQLH 5T1LB 3S35H 1CD9B 1DZBA 5C0CB 4DOHE 4PB0H 3HUJA 4P46C 1KC5L 4I0PA 2NCMA 3SQOL 4R7DB 1IC7L 4KKBC 4OQ1A 3WNMA 5I9QC 4R4BB 1WFOA 4HPOL 4WFED 4NUGL 1G7PB 5GRUL 2Y1VA 4WEBL 5IVZB 3Q48A 4NZDA 3C8HA 3MRFA 1KG0B 3WEXA 2C3VA 1I4FA 2AJ3A 1AXSB 1RULH 5C0AE 4JZJB 3V6FA 1WWAX 4HQQH 5CGYD 1JPFA 4MJ4A 1VFBA 4JY6B 1W72H 2HH0L 4K55A 1U36A 4U7KA 4QOKA 5F93C 1KTKE 3BP6A 3GI8H 1OAUH 4IRSB 2WBJA 3NCFB 3WBDA 1CICC 2DB8A 1EHLL 1Q0YL 1AI1L 3LIZL 2F19H 2F9BT 5I71C 2R0WH 4YWGH 2XNAA 3ULSA 4RCAA 4LSTH 2BSED 3LRSA 4F7TA 4LASH 4Y16A 4NKDB 3D3VD 2PW2B 2DQTH 4MAYD 5E2TL 4DCQA 4HZLA 5ABDE 3A67L 2A9MH 4HH9B 2PTVA 3FT3A 3WV0A 3JWDL 3OGCA 3CVHA 4CMMA 1BD2E 1P1ZA 4MX7B 3GM0A 3JUZA 1PKOA 5HYEA 4S1DD 4N8VA 2VE6A 1CLYH 5DQDL 4HIEA 3W0WA 1QNZL 2X4QB 2FB4H 2AEQH 4XMPL 2WIIA 2PTTA 3QDHA 1M71B 3GEWB 2WINB 1N3NA 4LBEA 2FJHA 3VGFA 3IJHB 2V5SA 1RMFH 1I8MA 4HIIA 2ZJSH 4I18A 4XVSL 1NAMA 3BQUD 3UTSA 1CLZL 1M6OA 2ICWJ 1A7RL 3OXSB 1MCRA 1XR9A 1MQ8A 4JFEE 1ED3B 5GRXG 4GRLC 5FYJU 3O8XC 3Q3GA 5BZDA 3VW3L 3JV4B 4X6EA 4Z7VA 1T03L 3CFCL 4HT1H 2Z8RA 3V2AR 5ALCH 5TPWL 3MRIA 1JZ2A 3RGVC 1A4JA 1HQ4B 5J1AB 2R4SL 2HWZH 4NRXA 3IDGA 4GT7A 2EKSB 2D7NA 2IAMC 4YHPA 4ELMA 3LPFA 5GS2H 4PD4K 3VXNA 2BNRD 4JN1H 4WY7H 5K59E 4JRYD 3TV3L 1SY6A 1ZA3B 2XICA 5F9DC 2OMBA 5HI3C 4XNUH 1IQWL 3MGOB 1OSPH 4B53A 1H5BC 4I3GA 5L88L 1NMAL 3LPWA 5I1CH 5TQ2L 5SX5K 2A38A 3V7AG 3MRCA 4XP1L 3DROB 1TIUA 3JTSA 4HGKC 5FO9A 4PTUB 4DFIA 4XGZA 3TN0A 4PJHE 5GGSA 4BFIB 3O4LB 1L7IL 1UZ8A 5IEKB 5C08B 1F58H 3HFML 5E6IB 3V5DA 4OIBA 3H7BB 2P46B 5I66B 4KKAD 5SX4H 4YQXL 2E7HA 5DD0L 5IJVB 2EDYA 4ZUTB 3LZFL 5KVEL 2GIYA 3OKDA 1X5HA 4QRTB 4BSWB 2OJEA 4U4BA 3TZVD 5C86A 3LD8B 5HXMA 5JORB 2FCBA 2IPTH 1IC5H 2D03H 1HYSC 2VJXA 2BMKB 3O0RL 4KQ4L 3UTQA 1CFQA 5DEFA 3DBXA 1MI5A 4YXKL 1D5IH 3MJGX 5IROC 3BKJH 2X40A 5TDNB 3DX8A 4OB5L 5C09D 1S9KC 2QQKH 1T7VA 1FYTD 4QEGA 4APQD 5KSBA 1ZHBB 1XCQB 1A6AA 3E6HB 4U1MA 4WUUE 4HWUA 3H42H 1JE6A 5ESQB 1R0AH 1FFOB 1RZJL 4G8GE 4JG0L 3WUWB 3WLWC 2OTWA 2BXYA 1C08A 2J8OA 5BS0A 1JWUB 3DSFH 4NOBA 4NJ9L 4PJ9C 1QSEA 3NFSL 3X14B 1E4XL 1WSST 5EZOH 3ZE1E 4XPGL 1YC8A 5DZNA 2FD6L 3V6BR 1OTSD 3VWJD 2M8XA 1AGBB 4M6OL 1QLFA 7CGTA 1FG2B 1HDMB 1NCCL 1KIRA 3PHQB 1AO7A 4HKBA 2BXZA 2FJFB 4WCYL 1A1MA 3T0BA 3SE3C 4RQQB 1T21B 3WS3B 5JPMB 3T0ED 3QXDA 3IU4H 1TVBA 1DQLL 3S35L 3QDMB 4PB0L 1JNHB 2CIIA 4MB3A 5T5FH 5T1LD 5IMKB 4ZD3H 2Y23A 3QUYA 4NWUH 3VGAC 4LK4A 4O51B 4D0BB 5C0CD 3Q6FB 2IQAA 3PGDA 1OGTA 4HKZA 4GSDL 5DT1H 3ULUE 5GZNC 4S10A 4TUKH 2APBA 2FIKB 4JM2C 5FHBH 4DVBA 2R2BA 3DTXA 4BQCA 5HYSB 3GMLA 1RULL 3L3GA 4YO0B 2GCYB 3CH1B 3BXNB 2VABB 4HQQL 1T5WA 4NPYA 1YEGH 4FQIH 1WTLA 4XCEA 3GBLA 1W72L 3DRQA 5D7IF 5T3ZL 3GI8L 5F7MC 1OAUL 4OZGE 4E41E 3LSOB 5CSZB 4FQ1L 3MZTA 2F19L 3GMRA 2ESVD 2R0WL 4Z7UE 4YWGL 2BVPB 3UO1H 1CGUA 5CEYB 3O9WD 3BW9A 4JQXA 4LSTL 4QLRA 3ZL4H 5DQJA 3SGJC 1NBYA 4IOIA 3DI2B 4Q74A 1K2DB 5HY9B 4WI3A 1BVKA 1U8MB 1KBGH 4LASL 2HN7A 5C0EB 1FNFA 2DQTL 1ZT7B 1DBAH 3DV4B 5E00B 3V9FA 3TT3H 4KHXH 3RTQD 1DLHB 2A9ML 4L4TE 5HHPB 1KJ2H 5E0QA 3MNVB 5KG9A 5D7JC 2UUDK 4RX4A 4DAGL 3R4DA 3UJTL 3ARDC 1BIHA 4Q2ZA 4WO4B 5D2LA 4OV5B 4D9QD 4PLOB 1ZLUH 4ZXBC 4AIXA 2H8PA 4XWGH 5DJZB 1CLYL 4FXKB 4P2YA 1WIPA 1DUZA 2FB4L 4JDZB 2AEQL 4Z7WA 1YC7A 1V7MH 4KTDH 5FYKD 1U8PB 4EN3D 4PJDA 1PLGH 4JVPA 4ZUUB 1KLGB 1L9MA 2IBZX 5KSUB 4MQXD 1OM3H 5J3HC 4U2YA 1HINH 1RMFL 2ZJSL 4QRUA 3HG1A 4IOFD 4JRYE 1F97A 3QEHA 1U9KA 2JB6B 4MMXC 1NGWB 3VXTB 4XP6H 2J8UF 3R0NA 4K71C 3G08B 5ALCL 4S0TD 1DBJL 3MX0A 4MNQE 1CXHA 2HWZL 2HFFA 3BYTA 2EC9T 1Y0LA 4JDVB 1TTUA 3SO3B 3Q5OA 3SJVA 1Z0MA 4MDIA 4WNQA 3N06B 2WBJC 4LGRB 3KYMB 4NO3B 4JN1L 4Q9CA 4WY7L 2YWZA 1S7TA 5MI0C 4QGTA 2N7BA 3AGVA 2R0ZH 3BP5B 4WWKA 3N0PB 4Z77A 3O3BA 3O6FB 3TO4B 1S78C 1UWEH 2JLLA 1R6VA 4F7MA 4Z78A 1OSPL 5EU4B 1UH4A 2G60H 4U1JB 4Y16C 1VCAA 3CSYB 5LKNA 1NBQA 4PJBE 3VD7A 5EU5B 3H9ZA 5CEZH 2P8LB 1KF9B 4I4WB 5A43C 5F6IC 1I1AB 3FQNB 5BO1L 3KR3L 4XCFH 4OAWB 3BKMH 4F7EA 4M6AA 1F58L 1RK1B 4KI5F 4R0LB 5LGJB 1EGJA 5BV7L 1XCTA 3O4LD 1J11A 1HNFA 4PJXF 2DYPB 4XXDB 1A6WH 1UM6H 2A74A 5KSAB 1TVDA 4FMFA 2CLVA 5BVJB 2R23A 2C3GA 1ZSDA 4MJ6B 5BW7C 1HQRA 4PRIE 1IM9A 1KYOK 4OT1H 2HTLD 3RZCA 3D0VA 1KTDA 3AC0A 2EEAA 2W0FA 5BQ7A 3LV3A 3QFJD 3D18A 3PABB 3G5YB 4H5SA 5GGRB 1X4ZA 1W0WB 2IPTL 1IC5L 2OR7A 3T65B 3TJHC 2XWBA 5I76A 3UYPA 3HLAA 3IAGC 1UXWA 4JN2B 4P5KB 4PG9B 3GMPA 2ZOLA 3QRGH 3F12A 1ZEAH 1NC4A 1D5IL 3BKJL 1YY9D 3MRQA 2QQKL 1X5KA 3EYVA 1CXLA 3EOYG 3C6SB 4ZOAA 2XTJB 3H42L 1R0AL 1J0YA 1RIVH 2PO6D 1RZGB 3DXAD 2EZ0C 3EGSB 5D70H 2VDOH 3DSFL 4H8WH 5HDOA 1YJDH 1BIIB 3PQYA 5AWNH 3UCRA 5EZOL 3CSPA 2UUDH 2DQJH 4HX1B 3MRDB 4JHZA 5C0CE 5I8CA 2BY1A 3IDMA 1OT2A 2HJLA 4P4KD 4N0UB 5JXED 2CRIA 4NQEB 3T08A 43C9B 1II4E 4WFGE 3SEPA 1KJ2B 2W0PA 3EO1A 3U4EA 1A7QH 2CUMA 1C7TA 2VISB 5D1XB 3IU4L 3DETD 1I3RB 1VA9A 4QGYA 5HVHC 5F7DB 3MUGB 2OYPA 4NRZA 5FM8A 3T04D 1NC2D 1N6UA 3RPIA 3LQZB 5T5FL 3GSRB 4ZD3L 3TVMD 4NWUL 3ZE0F 4Z5RA 3SKOB 1AIFB 1T22B 4ONHB 1KJMB 4YHYC 4X7SH 4RGOH 4XAKD 2AXFB 2G5BA 3D69B 4TUKL 2EC8A 5FHBL 4MNGA 4H0GA 1F4XL 3P0GB 5DS8B 3QUZD 5HHMD 3ARBA 5DEGB 2NW3A 2FHBA 4NSKA 1J8HB 4IRJB 4PG2C 3FO9A 3HPJB 4LVEA 1HWGB 3BVNB 3IFNH 3L95B 1YEGL 4FQIL 4LRIC 4UTBH 5H37G 1XF5B 4P23B 1WAAF 5I6XC 2FGWH 1G1YA 1IGJB 1OQXA 1XIWA 5F3BB 2H6PB 2VLKB 4G7VH 4P2OB 1I85A 1RZKC 1XGRA 4BM7A 3N1MC 3UO1L 3STZA 3MRLB 3ZL4L 4PJEF 1IAKB 1CI5A 4IMLA 4YC2C 4UQ2A 5HHQA 4WHYH 1KBGL 4AEEA 3HC3L 1E28A 1I1RA 1ZLWK 5IG7A 4JANB 3G9AB 4JREB 3TBSA 1DBAL 5GSVB 2CKBA 3TT3L 4NFCA 3QO1A 2DL2A 4KHXL 3ECBA 4JLRA 1NEZB 3MYJB 5HJ3B 1KJ2L 3L3DA 2BSSA 2PYFA 2R39A 4E5XB 5T5NG 5CP7B 4BH8B 4Y4HB 4UV4H 5IJKC 2ZZUT 3HN3A 4XWGL 2EIBA 4R4ND 1T20A 5F8QC 2DICA 3B2UC 3UX9B 3WDHA 1MY5A 1V7ML 4KTDL 5GS0D 3HE6D 1YEEH 1PLGL 5EDXA 1J86A 1OM3L 2MHAB 4M9OA 3QUYC 1PKQB 1T0NA 4L8DB 3C5JB 2IF7A 4MDJB 4KKCC 4MSWA 1RJZA 4IIQC 1M7DA 3FRUA 2NY6C 3WNOA 4XP6L 1BFOA 5EG6C 4ODHH 4DEPB 3MLPA 1MCWW 4DGYH 4I77H 4Y4FC 1JPST 3IFPA 4WENB 4ZDHA 1HHHB 4KRMB 1WBXB 2J88H 1F6AA 4JQVA 4QHLB 1AHWB 2XZAH 1L6XA 5IKCA 3RY5A 4AENB 2CDGB 5HGBA 3CJJA 3C2SA 4F9LC 3BPOC 5CAYB 1WLHA 3CDCA 1ND0A 3O4LE 2R0ZL 2EYSA 3RVVC 5TDPB 5C08E 4NHCH 4EZMA 1NUFA 1UWEL 4Q9QL 4FFWD 4G9FD 3O6FD 3GIVA 3VXSB 2G60L 2DDQH 2YEZB 2GT9A 1LDSA 4K3GA 3HHRB 1D6VH 3UBXI 2D2OA 1R3JA 3L9RB 1AR1D 5CEZL 1IVLA 3F62A 4XNMA 2AJSH 3C60A 4UV7H 1TCRB 4XCFL 1DTUA 2R0LH 5F70A 3BKML 2X4UA 1I1AD 5I1LA 5B21A 1T7WA 1MF2H 1R5IA 3GB7B 2Y25A 4GXUM 1J0ZA 1A6WL 1UM6L 2HT3D 2O61A 1Q72H 1JHLH 2DYPD 4LHJB 3MUHL 2FX9H 5KSAD 2LU4A 4ZAKD 4OT1L 4D9RE 5FM4A 5BZWA 3FQUB 4NHUB 3NZHH 1U95B 5T1DH 3MGTA 4KPHH 3P77A 5DDHB 5EIIA 4LHUB 1C12A 1CIDA 5CP3A 4AIZB 3U7AA 2Q86B 5SWZD 3OKEB 1ZLVK 4QRRB 2I9TB 1R3HB 3QRGL 1CDJA 1U8KA 4PYHA 1ZEAL 3PHSA 1PSKH 2YPLD 3HPLB 5GRVK 3TBVB 2MNUA 3MBEC 4H20H 1ZLWH 1RIVL 1UJ3B 2QHRH 5D70L 2VDOL 4H8WL 2R4RL 3GSXA 4JQIH 1YJDL 2VXTH 2NLJA 2CLZB 1LO3H 2C1PB 5AWNL 4M8QB 4YFEA 2ATPB 4J3VA 4WWKC 3GUTB 1T66C 1TQBB 2EYTB 3QDME 4DFHA 5C0AA 3CC5B 1P7QB 1XFPA 4E9LA 2DM3A 2RJMA 4KUCF 1AQDB 4XAKE 4XVUD 4DK3A 4K7FB 3O41A 3L6FB 4PJ7B 4XPBH 3GSWA 1JIBA 5EBWA 1S9VA 3O2WH 1TZHA 3R0MA 1FQ9C 4PS4H 2VXSL 3QHFH 4RGMB 2QQQA 1P84K 2CIKB 1A7QL 2GYSA 8FABA 1FZMB 1MFBH 4KC3B 4LLQA 4UNUA 1AE6H 5ISZB 5MENB 32C2B 2X7LA 2JK5A 1ULVA 1WQVT 1FDLL 1QLRA 4Q97A 2WLYA 1K85A 4X7SL 4HJJH 4RGOL 3VRIB 2VDNL 3MA7A 1T7YA 3MJ9A 4O2EA 2WZPD 1BD2A 1NCTA 2F5BH 4HUVA 3TGXA 4J8RA 1JF1A 4RSVA 3F7VB 3S37X 1YEIH 3TYFB 3I2CH 3FO2B 3BEWB 5DRWB 4BKLA 2F54D 4LLYA 3IFNL 4DUXA 1P2CA 1CGYA 3KYOB 1J8HD 1Q9KB 4IRJD 4U6HB 3HS0A 2Z91A 4G7VL 4XBGB 1RZIA 4P23D 5HI5C 4JFHD 4H25B 3H0TB 1KN4H 2CO6B 4HK0A 4KK5D 4GKZA 4XCCH 5IFJB 4LIQE 4CMHB 4JFEA 2QR0A 2VDKH 1ITCA 4TUJB 4OKDA 5DJ0A 4C4KO 4FQCL 3OKLB 2BC4A 5CUSH 4NN7B 1FZKB 1NDMA 4BUGA 3QUXA 5BCAA 3OG6B 4YBQC 1YN6A 3PJSB 3EW3B 4WI4A 5DSCB 4KROC 3O3DA 2YPVH 5DRNB 3MRGA 3EYFB 3QZWA 2BHZA 4M48H 2IMNA 2KL6A 5D7LB 3M17A 4YX2L 3L3JA 4Y4HD 2BX5A 1B0WA 4HCRA 1R3LB 5CLWA 1CLOH 3DV6B 1HEZB 1JPTH 1YEEL 2OQJA 1ZLVH 4GLRI 5CBAA 2IG2H 3G04A 4P4RB 2XRAH 4WI5A 2GK0A 3QIWA 1A9BB 4HJGA 1OP5K 4D0CA 1E6JH 3SPVA 4MNHA 4HDIA 4PJHA 2PCPA 1LEGA 2AQ3A 3WHXB 4ODHL 1JYXA 1KJVB 3EDEA 4DGYL 5D2NB 3ARVA 1TMCB 1JWMA 5HVFB 5GISH 3C6LD 3GMMA 2J88L 2XZAL 4JKPH 1EIBA 5HPMA 5C0JA 3KVQA 1ZANH 1FSKC 1I85C 3T2QA 1CYGA 1UENA 1KT2A 4NHCL 4BQ6A