3LQAH

Crystal structure of clade c gp120 in complex with scd4 and 21c fab
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
225
structure length
225
Chain Sequence
QVQVVQSGAEVRKPGASVKVSCKVSGFTLTGLSIHWVRQAPGKGLEWMGGFGPEENEIIYAQKFQGRVSMTEDTSTNTAYMELSSLRSEDTAVYYCATGGNYYNLWTGYYPLAYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords T-cell surface glycoprotein CD4
publication title Structure of a clade C HIV-1 gp120 bound to CD4 and CD4-induced antibody reveals anti-CD4 polyreactivity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 37
structure length 225
sequence length 225
ec nomenclature
pdb deposition date 2010-02-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3lqaH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3lqaH01
4CADB 1TLKA 2AS5M 4Y5XA 4BH8A 4C56D 5L0QC 3CH1A 3WXVL 1VEMA 3RZCB 8FABB 3TH4T 4WHYG 3W9EA 1NDMB 3MGOA 5I17A 2VLRB 1FNSL 1UH3A 1HHKA 5T1LD 4P2OD 5F1IB 4Z7UA 5E6IC 5EUKA 1R6VA 3HRZA 4WWKA 5D2NC 1SY6L 3IDJB 5LBSL 1TVHB 3IFLH 1F42A 5F9WB 3F58H 3IDGA 1MCIA 1Q1JL 5ALBH 4JZOA 5CJBA 2L7JA 1S9WB 1K8IA 5ID0A 3ZKXB 3LKQB 3O8XD 1PYWA 3VD7A 2AW2A 2NY3B 4JLRA 5C0CB 3VJ6B 2EH7H 4FXGB 2FECL 5FK9B 5T1MA 4JFDE 1G7JA 1EO8H 4I9WD 4XP5H 3IDNB 3AB0B 3LMJL 3QG7L 2YUXA 3WKNA 2YBRA 4U49A 3CVIH 4BFEA 4MB4A 5KZCD 4Z9KB 3CFCH 5IBLC 4HKBA 1RHFA 3U46A 3MJGX 1NCAH 5E2UL 2B20A 4I5BB 4XH2A 2YUVA 4GLRI 3WDIA 5GS3A 5D2NA 5KS9E 1R0AL 2NX5A 4YPJA 5CZVH 5I66A 2VUYA 2CMRL 4HLJA 3GMMA 4KK5C 1R3LA 3EHBC 1UM4H 4L4TA 5DA0B 1W0YT 1ZE3C 3UTPE 3D2UD 2OL3B 4OZGE 4XNYL 4Z6AT 2IPUG 4MJIB 4ACPA 4PD4J 3QUZD 4MAYD 1W0VA 4NQCA 4ORGB 3AAZB 1FRGH 2H26B 5E2TH 2R0LH 3SKNA 1C08A 3ARDB 1OD9A 3KNBA 5LGJB 3GSOA 3HPJA 4PTUA 1FL3B 1OQOA 5EO0B 2W07A 1RZJL 1FNGB 4JHWH 2SEBB 4KRPB 1OW0C 2NMSA 2H2PD 3MRHA 4XP6H 3TO4C 5JO5B 4UNVA 3S36L 1M71A 4I18C 4PR5A 3C09B 3GSQA 4KK9C 2QV2A 4OGYH 5HYFA 5ETUA 2VZTA 4KZDH 4QGTA 1BLNB 5HYQB 1KXVC 4WGVB 1G9MC 3A6CL 2A6IA 1RJLA 2XZAH 3QIBB 3N9GL 5B39B 1M7DB 1X5GA 2FGZA 4DKFL 2J6EH 4HUWB 4OSUH 3PXJA 3UPAA 5FM5M 2HWZH 1GSMA 3GO1L 4P5TD 3X12B 1MOEA 2D7OA 4N8VA 5BMFL 3E3QC 2BZDA 4N0UA 2X89A 5ITFB 2BX5A 2I9TA 4EI5B 3MLRL 5H2BA 3QXDA 4GQ9H 4NQSA 2GI7A 3R1GL 1X5LA 5EUOA 5KSUA 3RJQB 2HJKA 4FQQA 1P4LA 1IC4H 5FYLE 1GPOH 4MHHI 5B38B 4R7NB 4N90D 4ZUWA 4OFDA 5CBAA 2YRPA 3VI3F 1IL1B 1HCVA 4ZG1A 5GRVK 3RL2B 1AJ7H 4NFDA 2FX9H 1C5DB 1OW0A 2VL4A 5FYLH 5JDJA 3BRFA 1S7QA 3TO4A 4LU5L 1N4XL 1N26A 4KMTL 3BQUD 4I18A 1QLRB 1H3GA 1Z2KA 4MDJA 3RIAK 2W65A 3PL6C 4WFFE 4XNZC 3WNNA 1FGVH 4LSQH 5IBTL 4XCYA 4BQCA 4YHMH 4W6YB 5IESH 4JDTH 4NKMB 4OUUA 1R3JB 4AM0B 2LFGA 3QQ4A 5D8JL 1CFQB 1S9VB 2EDNA 1HHIA 1DQLH 5CGYD 4OZIE 5I8OH 1RIVL 5E9DD 2W9DL 1NKRA 5KVEL 3TZVC 5KSBE 4PIRF 1TVDA 1J1XH 2KQNA 3EOAA 4TTDD 3GUTB 1E6JL 2E7MA 2MHAA 3EOTH 1BD2D 4X6EA 4E9LA 1I7RB 3MV8A 2DQJL 1MI5A 3V2AR 4AYFA 3QUML 1XCQB 5BVPH 4CJ0A 4O4YH 2R15A 2E7LC 4MD5B 5BZWB 1B2WH 1LP9F 1U8JB 3C5ZC 4R6UA 4UDUB 5E94A 1DR9A 5DD0L 2IMMA 1D9KB 1YPZF 5AZEL 5CEYB 2BDNL 4O02H 4F80A 2DQIL 3BDXA 3GSNH 4YC2B 5ICYB 5LGKA 5I16B 3UMTA 4L4VB 3MLVL 2DM3A 2YXFA 2CH8A 3GSXA 1MF2H 3KPLB 3BN3B 1T1WB 3PL6A 5CZXC 1NSNH 2ZP0T 4ELMB 1KJ2L 1L0YA 3GMRB 1H15A 2LV4A 5FGBC 4EVNA 4KK8C 1IEBA 4GKNA 3QNYB 5A43C 1VB9A 1BFVL 5B4MD 1JI1A 3WHE0 4CMHC 1HOCB 1TJIL 3C60B 4HUVA 2VWEE 5SWQA 1YC7A 2ZSVB 2CGRH 3WJLA 4KI5D 1FSKC 5M95B 3C6LC 4LLYA 1X7QB 2ATPA 4OF0A 4IOFC 2DTSA 1H3VA 3MR9A 5TF1L 2R1YB 3WO3B 1KYOJ 2E7LA 2X7LA 3DVNB 5IR1A 3C5ZA 2R4RL 1KB9J 3BT2L 3O6FC 1L7IH 4DTGL 4XTRD 5E56A 4NZTH 4PJEE 1YNKH 4P2QE 5E8OB 5IVXF 1OSZB 3HS0A 3HC0A 3EW3B 3IJHB 2O61B 4MXWL 2DMCA 2BVEA 1WBZB 1K4CB 1ZT1A 3DMMD 3IFOA 4PD4K 4UT9L 1XR8A 2C3VA 2P46B 3BVNA 4Z7VE 5SWZD 3OQ3B 1KJMA 1D5BB 4M6MH 1MRFL 3CPLA 4E42B 4NRZB 4FQXD 1JBJA 5FGBA 3I02A 3RVUD 1MCOL 3FONB 1JRHI 3GI8L 5KVGL 4IRJB 4QTIH 3GNMH 2W0KA 4NDMB 5MEQB 3MRKA 4KTYA 5HHVL 5I15H 4L3CB 3ZKSD 1G9ML 3WE6A 2F54B 3TFKD 1FC2D 3KPRE 5EO1B 1IQWH 1HSAB 3C6LA 5ENWA 4HS3B 1T7XA 2UY7A 1BF8A 4FFZL 2EDOA 4J7RA 1VKXB 4TVPL 1J0ZA 2CKBH 2B0SL 3O6FA 1N5AA 3WNMA 2E27H 4OLVH 1Z5LB 1KBGH 1H5BC 4FOMA 5IMMA 1HINL 3TT3L 1QLEH 1F3DH 1F3JA 3RX8A 4KUZL 4YGAB 4IRSD 1CDBA 5I1EH 3KPTA 1C7SA 5KTEL 4X7TB 1HHHB 4GKZB 5FUZL 3G6JE 5CIPB 2CLVA 2X9XA 5D7LE 1TENA 3T0ED 5HI5D 4KZEH 4H1LH 4UNTA 2VLJD 1AKJD 4ZXBA 1KXTB 4U1SB 5JA8B 3T1WA 5C07A 5CBEB 3QUXB 5D4QA 6CGTA 2LU7A 2R56H 4QXTA 5EA0H 2WV3A 2C4FU 4LEOB 4NQVA 4JE4B 1P53A 3KPQB 1LO0L 3QDMD 1D6EA 3Q3GA 1KCVL 4LGPB 1I85A 2HFFB 1QZ1A 1F3DJ 1HNFA 1OM3H 3SHSA 3WUWG 2FGWH 4KJQC 5JORA 4TN9A 4NRYA 3REVA 2VE6A 1HEZB 2HTLD 3BUTA 1QR1B 4Y88A 1GGIL 3QDGE 3J7HA 5F8QC 1KT2A 4NO0B 3D2UA 5MI0B 1I8IA 3GMQA 1I3GL 3DVGA 5HDOA 1JZ8A 4H26B 1H5BA 4OZHB 3P0VH 2ICWJ 1A47A 2BNQB 5F1NB 5MP6H 2MSPA 5GHWH 3RX7A 3B6SA 4PRHB 4RDQG 5I76B 1IBGH 2JE8A 3MJ9L 4N8CL 4AIZB 5C9JB 1FV1B 1EEYB 3O11B 4L8SC 1WZ1H 5F1IA 4MXVE 1D6VL 4LBEA 3VCLB 2FB4H 2X9WA 1TVHA 3BQUC 3TPKA 2VAJA 4CDHA 1A7BA 4F3FB 3TWCH 3FFCD 5EU6D 2RGSA 1RPQA 5KW9H 43C9B 3RA7H 1BF2A 3KPMB 3DV6B 1JGLL 1AIFA 3ROLA 4RFOH 5KOMC 3QDJB 1S5HA 1R3IL 1SYSA 1AR1C 1QRKA 5HHQA 4POZC 3ZKMD 3S96A 5DVLA 4ZUVB 4KVNH 3MV7B 1WISA 5JW3L 2V2WA 1V3MA 4YHPA 2OQJB 1MPAL 2NY6C 1J0IA 4BK5A 5EO9B 1IAMA 3BZ4A 1HH6B 4YE4L 1U3JA 3D3VD 5JZ7D 2AGJL 4ZAKC 3R06A 3HE6B 4TYUA 4L8SA 2D0GA 1GGBL 4R90L 5DJXB 3BGMB 4RQQB 5TGBA 3ARZA 2Z93A 1G7IA 3QG6B 1KYOK 2RIKA 3HC4H 5C08E 4KRNA 2DWDA 1LDPL 1VGEL 3SOBH 3PHSA 5BRZA 1F2QA 4GUPA 1KB9K 3QH3A 4L8CB 2EDDA 2FHCA 1X4YA 4LSRH 5DUML 1E4JA 1PZ5A 1LEKA 2EDKA 4U1JA 1CGSL 1CGVA 3AAZA 5FF6B 3S5LB 4ZOEA 5E9DA 4G7VH 5A1AA 2C3GA 4OBSA 4LKXB 1S7WA 2R0WH 2EZ0D 1BX2B 4M62H 4GMSL 2YPLE 1NBYB 1YY9C 1OP9A 4OFYA 2AAVA 3GSWB 1UQSB 3MRFB 4PJ5B 1T04A 4CU6A 3SE9L 2BSTA 5GGQL 1FYTA 3N1QC 4WO4C 3X13B 2YD6A 4QRTA 4JFFB 4UQ3B 4ZAKA 4XTRC 4H8WH 1CGUA 1QVOA 4HIJB 4M7KL 3LKNA 2Z31D 5BQ7B 1F4WH 4XXDB 3OKNA 4HWBL 1WCBB 5F9OL 1Q0YL 1J11A 4HGKC 4LAQL 5L88L 1D5ZB 3NACH 1C12B 5E5MB 5EWIH 4R0LC 4Y4FD 4MVBD 4HX1B 1M6OB 3GIVB 1TTUA 1I7ZA 4FS0A 1G7HB 1U95A 4NOBA 5AAMA 1LE9A 3UTQB 4CW1B 4YFLI 5DQ9A 2Q6WA 2VQ1B 3DO3A 2UZIH 4OLWH 2B2XH 5J11B 4LVHC 2X4TB 3TFKC 2GY5A 5CSZA 2HG5A 3F8UB 1NL0H 1IVLA 1LE5A 1NFDF 4JFZL 1A21A 4UTBL 4NNYB 4MNQA 4EQ2A 1ORSB 4DGIH 3G5VA 2P8MA 4WO4A 4KVCH 2AEQL 4XHQA 3VXTA 1FO0B 4OCYH 5DEFA 1IGCH 4FHBD 1CWVA 1UEYA 2DKMA 2WBJB 2NQCA 4NKMA 2OZ4A 4IRSC 1YEKL 5HSFA 3QBTB 1PAMA 5KN5B 5GRZA 1ZHBB 4J3XA 3P11H 4QHUB 5BZDB 1OWRM 1HXYA 4ZNEA 4JM2B 3MJ8A 2F15A 4JPWL 4LRNH 4NQTA 4R0LA 1C5BL 4I1NB 4U6VL 1IAKA 1A6AB 1HDMB 4WI6A 1XF4B 3SDCD 1JF1B 4FQ1H 2R9HD 3WS3B 4KXZH 1I1YA 1WGOA 3VGHA 2FD6L 4MB5A 5C2BL 2PO6D 1KPUB 1OGAD 5K9JH 1YY8B 1SHMA 1BQHA 2HTLC 1QRNB 3P0YH 3ECBB 4RGNB 4UZGA 3MYZA 5DRZB 1JFQH 2GJJA 4NHCL 3B2UD 5GZOD 3WDHA 3G04B 3AMKA 4PGBB 3NOIA 5CD3A 4NCC2 2HVJB 4HULB 3PABB 4Z7OF 1TTFA 2BY1A 1J87A 1OWWA 1OTUD 3INUL 4ELMA 1AH1A 3X14A 1IKFL 3V52L 4IRSA 4L8DB 4YQXH 2ESVA 5DC0A 1T03H 4I3GA 5I2IA 4IRJC 3VFOB 1HHGB 3CUPA 1WQVT 3NGBB 2APXA 3D39B 5FCSH 2EXYD 1R24B 4RFEB 5SWSB 2ZSVA 5EOTA 4QXWA 2BNRB 1O5DT 3QUYB 4KPHL 1KCUL 1YN7B 5MEOB 3G5YB 1X7QA 1JPTH 5DF0A 2YHGA 3MRIA 3CFJB 3O4OC 3QDHA 1G7PA 5CMAB 5C0AE 1FZKB 3GIZH 3QNXA 5AG8A 1YEGH 1CBVL 1J1OL 4O2CA 4PLJD 4YUEH 3S35L 5K59E 4M1CD 1EXUA 1AQDB 5AYUL 1DVFD 1IGMH 5HHMD 4IS6A 5F1KC 2H9GA 4HFUL 1OSZA 1HKLH 2NZ9C 2CK0H 2O5XL 3RGVC 2C7UA 1DANT 1IAII 4LKCA 5EBWB 4JDZA 2BOCB 4GW1A 1MCSA 3CDGB 2P24A 3PWVB 1EEUA 2YC1A 1EMTH 4GAYA 5FYJD 1CGWA 1MLCB 1RK1A 1BGXL 1U8IB 4OUOA 4IRJA 3VXSB 4M02A 4QRRB 5BVJB 1MRDH 1FAIL 3L1OH 3QPQD 3HUJE 1R5VB 3ARFB 4M1GH 1GL4B 4JFHD 2G9HA 2EXWC 6FABH 4I0PD 1A7RH 1T80A 3QNZA 5BS0B 1UVQB 1YYMH 1EGJH 2F54A 1VFOA 4M1DL 1TCRB 1BVLA 2IF7A 4PLKD 4QF1A 3VG0L 3ZYIA 4LPTA 4I77H 1ZOXA 2UYLA 4NN5B 2VLME 2FEDD 4C59B 4GS7C 4N5UA 4MAUH 3H42H 3NN8A 4H5SB 1U8MB 1INEL 4MJ4A 3PHOB 1K4DB 4WDIA 3DURB 2J5LB 3LD8B 3MLZH 3RGVA 1INDH 2Y7QB 1KNOA 3KPSA 2FHBA 3NCJH 1NGZB 3IFNL 4MQSB 3SDDD 2MPAH 3QUMB 4WHYH 4XP4L 5CS7A 4N0FB 2X05A 1JWUA 3QCVH 4G6AD 1F2XK 1JN6B 3LHPH 3OX8A 2P48B 1CU4L 3TN0B 3D3VA 4BZ2L 1NC4D 3ULUE 4BZYA 1D5MB 3KYMA 1A3QA 5FKPA 5IQ9B 1Y6NR 3KPQA 5F88A 5ITBL 4HT1L 2WBWB 2KL6A 3ULUH 4D0BB 4PJGE 5FM5O 5TFSL 3U82B 1I3RB 3BEWB 5TE6H 4MB3A 1JGVL 3LH2L 1QOKA 2CQVA 3MV9B 4W4OC 4Y4FC 4MVBC 1FZMA 2XA8H 2FSEB 2KUTA 4HHAB 3TVMC 2X9YA 3ARWA 2DM2A 2VMFA 1MJUL 4TQEL 5EPMB 3GB7A 5I76A 4PGZA 1F58H 2XG4A 3OGCA 3QCUL 2B1HH 3V0VA 1T7VA 1A4KB 1VEOA 3S37H 2EE2A 3HE6C 3V79C 3OKEB 1JE6A 1MCQA 5TDOA 4G6KL 4RMVA 1RU9H 4QKXB 4UTAL 3ARRA 1TMCB 3U4EB 3NMEA 3D0LB 3PGCA 4CMMA 4ZUTB 4F3FA 4KKBD 1DQQB 3MCLH 1PKQE 2V5TA 5FECA 2YPKA 4WTZA 43C9A 1BZ9B 2H32A 4M3KB 2M26A 2AJUH 3DV6A 4FQ2H 2D9CA 1QSFA 1ITCA 3QDJA 3MLYH 2ED9A 1OP5H 4ZS7L 3TV3L 1JCKA 4NM8L 5IVOA 3KXFD 4HIXL 4W4OA 4Y4FA 3PJSB 1GGCH 4LQFL 3UTZB 5IB2A 2NXZC 4JAMB 2YPVL 3TVMA 1P1ZB 5ESAA 2OTWA 1EHLL 1MY7A 4IBLT 5EO9A 3U2SA 5I0DA 3BN9D 2Y6SD 3UXFA 1SBSH 5BV7C 4HAGA 1Q38A 1MFEL 1XGPA 5F1OB 3HE6A 2EIBA 2E8YA 3ARGB 3PP3H 1NGQH 4TUKL 4YLQT 4KUCD 4OM1L 5CHNA 3HG1B 1LNUB 3CZJA 1GHFL 4D9RD 4OLZL 2OJZH 3T0AA 1II4E 4ODXB 5C6PB 7CGTA 4QT5B 1NEZB 1T4KB 4I3RL 4LLMA 2Q8BL 4L8CA 5KSAD 1OTUC 4Z7WA 3OSKA 4EDXB 4LLUA 3H9SA 1JV5B 1JWMB 5C8JB 5DTFB 2DQGH 2AJZB 3E8UL 4M9PA 4FQJH 2O5YH 1KC5L 5FF6A 1XR9A 3ES6A 1P7QA 1IAIL 4LP5A 2GUOA 3DUSA 1C16A 3LEVL 1UM5H 5FDWB 1IGJB 1FVCB 2ZPKH 3BH8B 1SJXA 3JUYA 4L9LC 2AEWA 1DSFH 3VU2A 1QFWL 1JMZA 5FUOH 4K55A 3MRDB 4X6BA 2J3SA 1T2QH 1F4YL 4M5ZH 3KVQA 3BZEB 1NFIA 4PLJC 3X13A 4FN0A 1NH6A 4QXGH 5JTWA 3K74B 1OGAA 3LB6D 2CIKA 2JLLA 4WW1A 4PJIA 4MJ6B 4N0CD 1MHPH 4CKVX 3LSOB 4JFDD 3AXLA 5IHBA 4XVSL 5JLZB 2OR7A 1DTUA 3EO1B 5MHSE 3MRQA 3JV4B 3QJFB 5IIEB 35C8L 1P69B 4E41B 1M7IB 3MLPA 1PG7X 1VADB 1ND0B 5E5MA 4NNPL 3V6ZA 1CXHA 3C2AL 4H0HB 4MA1C 3CVHH 4U1IB 4XWGL 1J86A 1AGBB 3GIVA 5L9DH 1DLHA 3RWIB 1G7HA 2OXGA 4NKDB 4N8VG 4KKCD 4CW1A 4MGXA 3ZDZE 1AE6H 4L9LA 2QBWA 3TH3T 2X4TA 4YIQB 3ZE2E 3OJ2C 3BZFA 3OTTA 5HI4C 1G9NH 3FRPA 3OF6D 2HP4A 4U1LB 3UTPD 5HDLA 4EUPB 3CX5J 4MQ7B 4G42B 4GKOA 1KIRB 1B4JL 2DQTH 3L5XL 1C5CH 1U8QA 4CNIA 3EOBA 3IU4H 4IOSD 1FL5A 4DWHA 4GAGH 3VFMA 4C56B 1FO0A 1S3KH 4KTEH 1G7MB 3DRTB 4ALAL 5JQ6H 4Y4KD 5KN5A 4LNRA 5DK0A 4OD1L 4P2OB 3KGRA 4G8GE 4ODTH 4K3GA 4QHUA 4YEFA 3QSKB 4Y8DC 5J12B 4EI6A 4BH7A 2R2HA 4LLVB 2Q76B 1KLGA 5TDPB 4HCRA 4MMZC 5DRWA 5HDQH 3O8XB 4A6YH 4MSWB 5IEHB 5DHVB 1PX3A 4DGVL 2E3VA 4XVUC 4HFWB 4P3DB 3AVEA 2EDEA 2LAAA 2X4UA 3CCHB 3F5WB 3KLSA 5FIEA 4HZLB 2XICA 5GS0C 4ZO6A 5AZ2H 2FX7H 2NY5L 3BP7A 2UWEF 5F93C 4PGBA 2HFGL 4K7PL 3LQAC 3BWAA 3H0TA 3BH9B 4CN6A 3OKMA 4UAOB 5FYLD 4Z5RB 3S4SA 2AQ1A 2R1XB 4L5FH 1LEGB 4DN4L 1MNUH 1E4XH 1FVEB 4AZ8A 3IDMB 1TZIB 1BBJA 1I1FA 1BIIA 4TVSa 5BV7L 5IM7A 2C3WA 4HKJA 1QNZL 5SWSA 4EBQH 1H3TA 4NZRL 4NQEE 3L3HB 2R0KH 1MVUA 4Y89A 5GGRY 1CFVL 4OZ4B 4WFFD 4L3AA 4M00A 2ICEA 3QUZB 4MAYB 3MNWB 3HI5L 3QZWA 1OP5K 2IPUK 1ZLSL 4GG6B 1ZGLP 2WW8A 3TH2T 5IGXH 3T2PA 2FWOA 5ADPL 4RMRA 5J0BA 4B50A 3ME0A 4DOHB 1G7LB 2A9NH 3L3IB 2ITDA 1RZIA 4Z7QF 1AO7A 4G6MH 3CFEA 3SN6N 3CDGA 3P4LA 5D6DA 4OFVA 1FAKT 1KB5H 2XTJB 2XTLA 3VXUD 3PP3K 2Y6SC 1ED3B 3I84A 4KGJA 3DIFB 3DTXB 2AJXH 4NT6B 3QEQE 4XMPH 3ARFA 1BMGA 4J2XA 1YUHA 1CDUA 5I8EB 1CR9H 4P5TB 1XGTB 5DQDL 2AK1L 2JK5B 4RISH 5IJKC 3QIUD 1KEGL 3ARQA 3B3IB 3U1SH 5JW4Q 3O6KH 2L0DA 3TGXA 1YNLH 4QWWD 3VWKC 3VWJD 4Y16B 2FBJL 2HJLA 5FYJL 3DI3B 1RVFH 3AGVA 4U3XA 3V5HB 4OCXL 4LSDA 3PHOA 4Z76B 2VN4A 4ZTOL 3WMSA 2YK1L 2VZVA 1EO5A 2Z8WC 5FUCE 2V5SA 2DAVA 1TZGH 1QYGL 5DJ8B 3EO0B 5AWNL 3STBA 3OV6A 4WCYH 1WCQA 3UBXB 4CBPA 3CSYA 1VSCA 2OI9C 4N0FA 4XC3L 4X6DA 3DYPA 4DN3L 2VRAA 3VRJA 1X3DA 1XZ0A 4X5XA 3C8HA 4ZFGH 1TZHA 5EIVA 4P2QD 4UOW0 1N2RB 3CDCA 5FO9B 2VXVL 3CX5K 1JHLL 4P57A 1DBMH 1AD9A 1J8HE 1WBXB 4YHZL 2ZKHL 3QXVA 5TDNA 5GRWA 5IJKA 5HYJA 3MACL 3QEUB 3VH8A 1FL6B 3G5XA 5FV2A 2HRPH 4FTVE 1IC7L 3FQUA 3AREC 3VWKA 1J05A 1MAMH 4X5WA 1FG2A 2G5RA 5HJ3A 2BC4B 4HHAA 5ID1A 4J6RH 3O0RH 4KJWC 5JPNB 2AK4A 2UV3A 3OAUH 2PYFB 3MOAH 4QOKD 3VGAB 4KKCC 1I4FB 2R2BA 5GGTA 1N0XL 3IXTB 3RBSA 3VFSB 3KPRD 3IVKB 2A6DA 2EIEA 1P5VA 2P8LA 2WUCH 3BZDA 5IMOB 4HSQA 5DZOA 2AXFB 1U91A 3QPXH 3D0LA 2ZCKL 2V2TB 4JG0H 3ZT7A 5DR5H 4NZDA 4YHKH 5B3NA 1UWEH 3DUUA 3NIGF 3OR7B 4LFHD 3LN5B 4YAQB 4Y19E 3M07A 3W11D 1PZUB 1DUZB 5F96H 3SDXB 1YMHB 2E7BA 4QY8B 1A64A 3MQIA 4O9HL 3OMZA 2P5EB 4Y4KC 5INCA 2WWMD 5GRVL 5C0EB 4MMXC 4JFOB 4JN2B 1MFDH 3W2DL 2FR4B 5D7LD 2D31B 3QEGH 2WQ8A 1UENA 2Z35A 1BIHA 5GGRB 3AREA 3LEXB 1T2XA 5K9QI 4HIHA 3BOVA 3UJJH 3IDIB 3HFML 4G6JH 3NCYP 4HH9A 1UACH 4PLOB 1MIEH 3FRUB 4DW2L 1Q9KA 4XPGH 4HJGA 3MMEA 1BVKA 1QA9B 5DLML 3HC3H 5C2UB 1IM9A 4Z8FL 2O5ZH 3T3PF 5JHLH 1K6QH 3LCYA 3VXMB 4X99B 5CWSA 2QHRL 1HK6A 4KHTH 1OTTC 1RJCA 3QDGD 3MNVB 5DSCB 4NYLB 5KG9A 1ZHNA 3LKPB 1BJ8A 3FCTB 1ZMYA 3DMMB 3HG1A 1LNUA 3DO7B 3BGFC 4OCRL 5IW6A 3WDJA 4YXKH 3RWCB 1FFNB 5SWZB 3FB5A 4WJ5A 5GRYA 4RMWA 1NEZA 4MLIA 3VFUA 1UC6A 4FQXB 3VGBA 5IT2H 5J7CC 4WV1B 2KKQA 4KROD 1T20B 1JV5A 1JWMA 5AUMB 1HXMA 1YA5A 3MUZ1 4NP4L 4FABL 4Y4KA 3KPPB 3M8OL 4X6CB 3L3GA 1RZFH 4HMEA 4LSSH 3QQNA 1DBBL 4RWHA 2Y06L 1FNHA 1IGJA 2F74A 3NCMA 1FVCA 2E6QA 2OTUB 5I1DB 2VLKA 1MHHA 3PWUA 5E2VH 1Q9LB 4MCZA 3L5IA 2Q7YB 2BVYA 4HWEL 2Y5TB 4YPGB 2BRRL 2BHUA 2HT2D 5EOCH 3SE4C 1N8ZA 3NFPA 4DAGH 3ULVE 2CR3A 1NCUA 4O2FB 3GJFH 4GH7B 3IFPB 4BKLA 4FQIH 3O3EA 3IYLW 1VGKA 4HJJH 3IFLL 5GGSB 3RUGF 3LSOA 3F58L 2KZWA 2EE6A 4LCIL 5ACZA 3ULVH 1YN6B 1LVEA 3AY4C 3V4UH 2IANE 4J3SA 3CDFA 3T0EB 4MA7H 2VLJB 1AKJB 2P7TB 2E8ZA 5IHZB 1M7IA 1SQ2N 3H3BC 1GC1C 1UB6B 2WUBH 2MCG1 5EOCJ 2EH7L 2OMNA 3OPZL 2GITB 4X9FA 2DQFA 1EO8L 3BKJH 2DLHA 3IAQA 2QSQA 2FATH 2I5YH 4FFYH 3VW3H 2A6JB 4NKDA 3R4DA 4N1HB 3Q1SL 2XWTB 5C08D 3CVIL 2UZYB 3LVEA 4HIEA 3QIUC 1ETZA 2UVFA 5IVZB 2BP3A 3EDKA 5DMIH 3CFCL 1F02I 3CFKB 3SE4A 3W9DB 4IMKC 1UM6H 1NCAL 1KIRA 1I8MB 4AG4H 4IIQB 2KZ1B 3VXPA 1SJHB 4OZIA 1CLZH 4U7SA 4BK4A 1TQBB 3WD5H 5C0DB 3BP6B 5DJZA 5I1AB 1JYNA 1CGXA 2X4PB 1UM4L 4K3DH 2FZ3B 3AY4A 3K3QA 5ALCH 4NN7B 2YPLD 3D85D 4JO4H 3MLSH 3DGGA 5EU4A 1UWXK 2G2RB 4OD2B 3OKLB 1UZ8A 2NYYC 3FN9A 5KAQF 2OK0L 2IH3B 3FFCB 1W8OA 3FL7A 3NFNB 5EU6B 1FRGL 4OIAA 2V6HA 4KH2A 2ZUQC 5EZJA 5BJTB 4K3EH 3MPCA 4PJFA 4IJ3B 3N50A 4YXLH 2N7BA 3HZMA 1EA9C 1ZVHA 4XP6L 1TETH 1B90A 4P23C 3OZ9L 3K81A 5FKAA 4G8IB 4P3DA 2VDNH 1A1NB 4R9HA 3BPNB 2ZG3A 3QIUA 3V0WH 1T0MB 3K46A 2E7CA 1FZJA 5J6GB 5DK2A 4IMKA 4JQVC 3AM8C 1CICD 4KZDL 5D71H 1G6VK 4FA8A 2XZAL 3HZVB 4XB7A 4OZHF 4F7PB 5E8NA 4NNXB 2E6JA 2J6EL 4HS6A 3S34H 4OSUL 3P4NA 4JCMA 3P30L 2HWZL 5L8KB 1SY6H 3DROA 3V6FB 4AH2B 3MYJB 5HI3C 4C4KO 4F2MA 1G7QA 5FXCH 4L29A 3WIHH 5T1KA 2GEEA 4GQ9L 4DKAA 5I75C 5DFVC 1QD0A 1UKTA 4PG2C 43CAA 3IXAB 5L2JA 4DK6A 3NVQA 1XCTB 1GPOL 2XWJA 1T66D 2ICWI 5LAXB 4OAWA 5DZNA 1AJ7L 2FX9L 4YBLC 1OAQH 5FYLL 4P23A 1JGEB 2WWMC 2CLRB 3FHQA 3QG7H 4C83A 2DL2A 3UAJD 1INQA 1MFNA 2MQ3A 4EIZC 4JQVA 4YHNB 4MNGA 3BD5A 3AM8A 5FO8B 4U1HB 3ZE0E 1RZGB 4I2XA 1FGVL 4LSQL 1YZZA 1W72A 3U83A 5IESL 4JDTL 1DL7H 3TYFA 3E6FB 3GBMH 4TTGA 5DJDB 4KJPC 5C6TH 2NLJA 1DQLL 4OZFB 4Q9QH 2DIBA 2PW2B 4CRPA 4CL7A 4EDWH 5I8OL 4PJ7B 3PDOB 4K7FB 1R0AH 5ELIA 3KPRA 2VZOA 4QHMB 5BOPA 3DIFA 1J1XL 2Z31B 4PJBA 3QQ9D 3VXRA 1WUNT 3EOTL 5F70A 5FM8A 3TA3D 3VFRB 5D1ZC 2BY3A 3OAZH 5GIRA 4Q9CA 5BVPL 4O4YL 1PDKA 2JCCA 1ORQA 3CU1A 2H2SD 1B2WL 2ZCHH 3WS6C 2CO6B 3VMOA 4KROC 3K7UA 4JPIB 4UV7H 4Y16A 5DQJA 1CFNB 4HUNB 4O02L 2DWEB 3GSNL 4ONHA 5DUBB 3TNMB 4LP4A 2VZ3A 2QSTA 3T4YB 4Z76A 1MF2L 1LMKA 4RNRA 1NSNL 3MRBB 3SGJC 3TNNB 5DS8B 4HKXA 4RAHA 1OAXH 5D7JD 1CQKA 1CXEA 4UT7H 5C0AD 4U6XB 1AP2B 2X4RB 5FB8A 2YZ1A 4ODVH 4FQHB 4M03A 2J88L 2BNUB 3CFDA 3E1F1 4Z7UE 4K8RC 2GTWB 2CGRL 4RGMC 4XNQA 5D1ZA 5BMFH 4WW2B 2CLZA 5GS1B 5FO9A 4XCEB 1F00I 2CDFB 2DI8A 5FHBH 3SDYH 3Q0HA 2B39A 4ZS6D 1I8LC 2W1NA 4AQOA 4B7IA 3F6LA 3WS6A 4ZUSB 1L7IL 4JY6A 3M17A 5GSVA 4U1GB 1KIQB 1KLUB 3JV6A 3SDCB 5DJ2B 4NZTL 1YNKL 1NC2A 2BC4A 3IU3A 3RY5A 4WFGE 1BJ1H 1U8KB 2XRAH 2VL5B 3FQRA 3MXWH 4HDIA 2PO6B 2JB6B 2AI0H 4K9EH 5L6YH 5D5MB 1I4FA 1KCRH 2O26U 2QKIB 3IXTA 4M6ML 3SGJA 3LN4B 2YD7A 1FLTX 2VKXA 3GBLA 5CJOH 2CDGA 4QTIL 3GNML 3LKOA 3TCLB 3C6SA 2VZ1A 4OCWL 2VLMD 3WLWC 2FIKA 1FC1A 1O0VA 2IH1B 2VISA 2NX5E 5IHLB 2W9DH 1IQWL 3O3AB 4HLZG 2DM7A 2AKRB 2P5EA 1K3IA 3FB7B 1BZ7B 4M7LH 4L4TE 3EYFA 1E6JH 1MRCH 1S8DA 1FN4A 1I8LA 1ZHLB 4JM2F 2CKBL 2DQJH 4X4ZA 3RL1B 4WUUA 2E27L 1GYAA 5GGRA 1NAKH 1KBGL 3LEXA 4WTZG 3U6RB 3L3DB 1KSRA 4NQCE 3ULUD 1QLEL 3A6BH 3TIDB 3VFPA 3FOMA 5I1EL 5AZEH 3O9WD 2J1KA 3RVTC 1VFAA 2BDNH 4GOSA 4NN6B 2HAZA 2DM4A 2FJGB 1DVFB 5HHMB 5F71A 4N0YH 4KZEL 3MO1A 4MD0A 1PSKL 4M8QB 5IBUG 5J9PA 4OKVB 2YD2A 3FCTA 2R56L 5I74B 4NWUH 1NBZB 3WHE1 4D8PA 4MJ2A 5MEND 1KPRB 5C70A 2NXYC 4WENB 1URLA 4XNMB 4CVWA 1MSPA 3NAAH 1CT8B 2FGWL 2QTEA 4QRPE 3CFBA 1OD7A 4K2UH 3HNVL 4FZ8H 4G9DB 3S9DB 1IGYA 1MCWW 4BQ6A 1R5WB 3ZMRA 1FFOB 5I8CB 4I0PB 4N0UE 2FYYB 5IOPA 4PTTA 4QTHA 3DSFL 3V5DB 3SO3C 3KAAA 5E4EC 4P4KC 2DICA 3P0VL 1T1YB 2VERN 1MH5B 5IMLA 1IAIM 5EUOE 3GZKA 1Q9LA 1N3NB 5MP6L 1IBGL 1T66C 4UBDD 2NY4C 2A0LC 3U0PA 4KXZI 1FGNH 2OR8A 3REWB 1WZ1L 2VH5H 2HLAB 1G6RA 4PJ9C 3MXVH 2W0FA 5EC1B 3UAJC 2FB4L 3U48A 1CL7L 3D69B 3ARSA 3TWCL 1IGTB 5CD5C 5F9JB 1T6WA 2M2DA 4N1EA 3SDDB 4DGYH 2I60H 3RA7L 2R23B 2X1OA 1E6OH 5CEXA 1NC4B 4RFOL 2O93L 5FYKU 5HHVH 3RDTC 3T0BA 5JQHC 4KKAD 4G43A 2EKSA 5I1IH 3SPVA 1M7XA 3BIBX 3MZTA 5I6XC 3OAZK 3E3QE 3QQ9C 4UQ2A 4Y7MA 4FQPA 4KVNL 3FB8B 1JGDA 5D9SB 4W6WB 5JDSA 2XWTA 5T5NF 5EZLA 3ULSB 4PP2A 4P4KA 2EDQA 4PJDA 3MV8E 1MI5E 2DKUA 1A9EA 1EJ6A 4IRZL 1ONQB 5JIPA 1BVZA 4F58H 1FDLH 4Q6IC 3FFDB 3FO1B 1YECH 1RY7B 2Z91A 4ZFOA 2XN9B 2NNAA 4MA3B 3NZHL 4RZCA 3PNWB 5KTEH 4X4XA 4PJAA 4PJ9A 5FUZH 4JFPB 2X40A 2N7AA 3FRPG 2ICCA 3SOBL 1CFTA 2CIIB 3EJZD 5EZOH 4F7TA 4HMCA 3MUHL 4KU1A 4Y4HD 4LSRL 3P73A 5F7YC 5ILTH 4F33B 2F5AH 2NY7H 4IM8A 2J8UB 4WIQA 3RDTA 1Q9OB 4G7VL 3L7EA 4ZSOB 5KANG 4EOWH 1YC8A 3JTSA 4M62L 1FVDB 2F58H 4KMLB 4HMDA 1D5IH 4R4ND 3EBAA 5MHSD 2C1PA 1I3GH 3FT2B 3OR6A 1E4WH 1A1NA 2D3VA 3KXFB 3L95B 4O2EB 4X0KB 4Q6IA 1Y18B 5J6GA 4H8WL 5FGCB 1E28B 1F6AB 1KACB 1QSEA 4XGZB 4F7PA 1MCWM 5E5RB 1I1AD 4GW4B 4NKQB 1JF5A 1FQ9C 4URTB 1D6VH 3CX2A 4R7DA 1GAFH 3NACL 1S7RA 3GMOB 3GSVB 4RAVB 4FP8H 3RPKA 1CE6B 2AV1A 4HW6A 1KPVA 3G08B 1PG7H 3UEZA 4UB0L 1D3CA 3DOSA 4Y1AB 3S4SG 5KSAB 3DX8B 3LDBC 3D1MC 1U92B 4PS4H 1S7SB 3VE0A 4QHLB 2X4QB 2C5DC 1EVUA 1GZQB 2UZIL 4OLWL 1LEIB 2B2XL 4E0RB 2XQBH 3FOLB 3MJ7A 3TEUA 1MJ8H 4G8GD 4AEFA 2CLRA 2GIYA 5DMGD 4DGIL 2OP4H 5JW3H 3D0VB 4KVCL 3SKMA 3UZQA 3C8KB 2I07A 5E8PA 3BRGC 5F9DC 4QRSB 4OCYL 1MPAH 1IGCL 3QIWC 4HZAA 1NMCC 3LRSB 1A6TA 2FO1A 1NPUA 4PG9A 4PJXB 1YEFH 4LHUA 4L1HA 3O9WC 3P11L 5DJDA 2NR6C 1MLBB 3OG6B 4QHNB 3PWLB 5A16B 2VYRE 1OCWH 3BIKA 4P9MH 1W0WB 4FZEL 4JFDB 4LRNL 4G8EA 1T5XA 1VGEH 3GHEH 5C0NC 4YBQD 3BPLB 4YEEA 1QHPA 3VFWB 3FN3A 2OMBA 1DQMH 2V9RA 4C57C 5DUMH 5C07E 1N64H 4HK3N 3FO2B 3EYUH 3ILQD 4UUJA 5F97E 1EEQA 3RWHB 5M94B 5FA3B 5K9JL 4J3TA 1B0WA 3KS0H 1T5WA 5F7KC 2DWEA 3P0YL 5DUBA 5T5NG 4L3EB 5EU5A 3AU1A 1JFQL 3AUVA 3PQYE 5KS9B 3VXOA 1KJVB 5DJYB 3AC0A 5J6HB 2EDWA 2UWEE 1U3HC 4IHOB 2ZUTA 1WC7B 3LQZB 3QIWA 4NQED 5F1SA 4YQXL 1JPGB 5LGHH 1CN4A 4UBDC 1T03L 3O9WA 4PBVC 1A9BB 4RAUA 3NPSB 1P2CB 4X6FA 4U0RC 5JOFB 2ZOKB 2VLRE 3I6LD 5DRXB 3KS0J 1MQ8A 4LLQA 4S1RH 4CN1A 1WWAX 1V5JA 5ICXA 5L88H 4WW2A 4ZO7A 5GSRA 1JPTL 4LCUB 3NTCL 1MJJA 2DI7A 1L6XA 2RB8A 2FIRT 3DSNA 2J4WH 5IVXB 1AQKH 4YUEL 5C0JB 4WNQA 4Y5VC 3KLHC 5GISL 1IGML 1KIQA 1QBAA 3EFDL 4KKAC 4HJ0C 5C0CE 1JVKA 1OT2A 3QFJB 2D7TL 4BSWB 5H94B 4GT7A 2YZ8A 2VL5A 2P5WB 3VH8G 4YH6A 1S9XB 2JB6A 4JRYA 2IC2A 4YFEA 3GSUA 1U3HA 4UTBH 5DYOA 3ORJA 4KHXL 3TPUB 1EMTL 3LN4A 5F7EL 3B9EA 3H3KA 2AEQH 2X1PA 1PKQA 4HWUA 2CRYA 3W39A 5DGQA 1MRDL 3L1OL 1JZ4A 5C0GA 4XRCB 4M1GL 5F7WC 2F9BT 2VKWA 1YEKH 3FAWA 1AY1H 4YNYA 6FABL 5HGAA 5LXGH 3I2CL 1A7RL 5F7UA 4RX4D 2NTFA 1YYML 3PV6A 3O3AA 2HTKD 2AKRA 5BRZE 4UU9B 4PP1C 1H3WM 5I71C 4R3SA 4I77L 1WLHA 2X42A 1MY5A 4TULH 4U1MA 3QRFM 1X5AA 4MAUL 4MJIE 3WNOA 3PGDB 4Y5VA 3U6RA 3L3DA 4JFEB 1BWMA 2VDPH 2FD6H 4NKIH 3FN0L 1JPSH 4P4RB 3CLEH 2OL3H 1HHJB 1UZ6F 3MLZL 5DEGB 3S3PA 5HVWA 1A7NH 3NCJL 5KOVC 2G75A 5IQ7H 1J8HD 2MPAL 3T2NL 5DK3A 5CP7A 2IQAB 1CVSC 2JIXD 4N9GB 5KSBB 1T7ZA 3UROR 3MROA 4M8QA 3VA6A 5JOPE 4FTVD 1WTLA 1MUJA 1QFHA 3EDDA 2BY2A 1FYTE 1NBZA 5D2LB 5DI8A 1IKFH 5HY9A 1TJGH 3MRMA 2ZUUA 3GSNB 4J8RB 3V9FA 4YDLC 4G6FD 5IF0B 3TLRA 4ODUA 4MZ3A 4XNMA 2IADB 3VXUB 5F3BB 2LTQC 5DD6A 5DRNB 1IE5A 5EFIB 3OXSB 5TE6L 4B41A 5D1QD 3OJVC 2LQRA 3WNLA 3RVXD 2AV7B 1NEZG 4KPHH 3PGFH 4NQUA 2XA8L 4F15C 2VIRB 1DE4B 3MA9L 4XNXH 3V6OE 4GBXC 1NCNA 2VSCA 5I1HL 5IG7A 1TPXC 3VWJB 4Y19D 2AJSH 4Z7NE 1F58L 2D2OA 5JW4R 2B1HL 4NUJA 5AYUH 4CUCA 4LEXH 4DCQB 4R2GC 3F7YB 3MCKB 3UYOD 4GG6F 2O5XH 4YDKL 5GGVY 3TBVB 1AGEA 4EKXA 5T3ZE 4R97B 2K3TA 1RHHA 5ANMB 2LVEA 3EZJB 1SVCP 1WIPA 2W60A 3MCLL 3BAEL 1F6FB 4FXLA 1A0QH 1FLRH 2AJYH 3PIQB 5T3ZH 1AD0B 3QXAA 2CDEB 4MNHB 3VFTA 4FQ2L 1RUMH 3O4LA 2BFVH 4X4YA 3CSBA 1ZAGA 1MFAH 3MLYL 4ODWB 4LHQB 3JWDC 3WLBB 4PRAA 1U2CA 3IAPA 3VI4E 4ZYKB 1NMAH 1AGFB 1E4XI 2OZ4H 5IB4A 1QFUH 3ABZA 5J1SC 5GJTH 3ULSA 4Z7VB 2I24N 4GBXA 4TPRH 4NRXA 3OBAA 5J13B 3KDMA 3DBXB 4BFBD 4Z77B 3PWPD 3ARBC 4HUUB 1SBSL 1UA6H 4G5ZH 3KWWA 1NGQL 4M5YH 5E2JA 2CKNA 1UCBH 4QOKB 3C5SA 2YOCA 4QHKJ 3CC5A 2OJZL 1VERA 4JM4H 2CKBB 2IMNA 3ZDYF 2QADC 4EUPG 2CIIA 4LCWB 1CLYL 1XEDA 3T04D 1KUMA 3P4MA 1CQYA 3OJDA 4KKLC 4BZ2H 4ELME 2GSIB 5GZND 4CU8A 4MS8D 3OKOB 1F4HA 3V4VH 5HYSB 3ULVD 2YA0A 5D6CB 1F8TH 2J8UA 4ZPVA 2PN5A 1FJ1B 5B8CC 1UM5L 5ITBH 2OXHA 3FTGB 2ZPKL 3KYNA 1NJ9B 1DSFL 3G6JB 4CVZA 2W59A 2ICWB 5FUOL 4K71B 5H8DA 3LH2H 3KPOA 4RFNB 5D7LB 3L3OA 2YKLH 2F53A 1T2QL 3QT2A 4POUB 4M5ZL 3FQNB 1U8PB 3ARBA 4ZDHA 5HHXL 4B7LA 4QXGL 3BXNA 4NBYB 5DHYB 1P7HL 3EYSH 4QNPE 3MA7B 3BRDA 1MHPL 2I27N 1DBKH 1E28A 2DQCH 4GKSB 1EEZA 2C3HA 2Y07H 3SGDH 5HGDA 1AHWC 4I13B 4G6KH 2FNBA 1M4KA 2YD5A 4YXHL 3QDGB 4P46C 4U6YB 4EN3C 2GHWB 3QWOB 3C9NA 1EFXA 4LCCB 4MD4B 1CE6A 3CVHL 4M61B 2IBZY 3SJVA 1FCGA 1ZK9A 4YHOH 3MREB 4APQB 4Y1AA 4WFHE 5ERWA 2VR9A 5HHNA 4S1QL 3DX8A 2CK2A 5B8CA 5CSBA 4QHLA 3SDXF 4DFHA 1AE6L 2E9BA 4E0RA 5JXEA 3BO8B 1XF3A 1AR2A 1G9NL 2F54E 4O00A 1H3PH 5FUCC 5GJSH 3LEYH 4A2LA 4X4ME 2DQTL 2YPVH 3QISA 3D0VA 1C5CL 4KI5F 1YDPA 1ZA3A 3A67L 3IU4L 4P3CL 4GAGL 5EBLA 4YHLH 1J88A 1PEWA 1S3KL 4OB5H 4OI7A 3SCMB 1NUFA 3CMOH 3T1FA 2FO4A 1MHCA 2HVKB 3KLAB 3QEQA 1G0XA 2Q3ZA 3P9MA 4PJ8D 4LVNB 4X7CC 4ODTL 1AHWA 5H35A 2AXGA 4NJ9L 3KPSE 2IPTH 4P46A 4OLZH 2XKNA 4EN3A 2WANA 1WTGT 2GW5A 4ZQKA 5TQ0H 4UIMB 1JHTB 2GTZB 1LP9A 3AROA 2ORBH 3QDAA 4HPOH 4DVBA 3ZSTA 4LPXA 3MGAA 4HUKB 2YWYA 1U8OB 5HDQL 1YPZA 4TNVF 1NCTA 5DC4B 3L6FB 5I18H 1ZHKB 1SYVB 4RX4A 1K2DB 2PR4H 4LGSB 4PRPB 4PBWD 3SGKA 4D9LH 2OSLB 5J1TC 4NQDA 4X6CF 2FX7L 4E5XB 1JHKL 3JWDL 2WIIB 5C08B 1QFWH 4FRWA 4UIKH 4Q6YA 2EC9T 3MRCB 4ODSH 2VAAA 3U7AA 4MQXC 3QJHA 4OJFH 5DVKA 5D96C 3KPNA 4OZHE 1KULA 4YFLF 4L5FL 3T65A 3VFGH 2ED8A 3D25B 1MNUL 1E4XL 5C3LD 3VXQB 1HILA 4WHTB 3T8XA 3DJ9A 4JZNB 3ZL4H 5JOFA 1J8HA 4S0SD 2Z9TA 3RNQA 5TQ2L 5JPMA 2HKHH 1S7XB 3VRIB 4ZD3H 2DJSA 2AP2A 4LPWA 4EBQL 5ICZB 3EOYG 2DLTA 3UBXG 2YPLB 1N59B 3D85B 2R0KL 1KTLB 1B6UA 3DX6B 5FGSA 1CD1A 2CRZA 2Y9RT 5FOBB 1X6NA 3C2AH 3HE7D 3AS1A 5IKCB 5IB1A 3O3UN 3RWFB 5IW1A 4HLZH 5IVXA 3HAEB 5T5FH 3MRNB 5IGXL 5IB3B 3QAZB 1QSFE 3F12B 3QDJE 1I7TB 1OF2A 2VITA 2R39A 3MNZB 1HNGA 1S7TA 1XIWD 4EZMA 2A9NL 2XOTA 4HUXA 3Q2CA 2H32H 3WO4B 1JF6A 3BUYB 3FT4A 2F19H 4G6ML 2QSCL 4KFZC 2R2EB 2D4FA 1XGRB 3DX7B 1KB5L 1T0PB 4XWOC 4F7MA 1CICB 2ADGB 3HPLA 4LOUD 3QEHB 4D9QE 1OOAA 2E9JA 4UDTA 2AJXL 5MEPB 4XPHH 1T22B 3MRLB 4KDWA 1EFQA 2GK0A 4OD1H 5F7FA 1AGCA 1CR9L 1FH5H 3IS1X 4JQXC 1NGYB 2YEZA 2PW1B 4RISL 3X11A 3U1SL 3Q5YA 3O6KL 3RKDD 1YNLL 1KCSH 3ARVA 3H9SE 4NSKA 4ZPTB 1OB1A 5I30H 2QR0B 5INDA 3FO9B 4M93C 1RVFL 1U93B 4P5MB 1FORH 3NIFF 2VJXA 4HIIB 1QBML 4DGVH 1ZLVH 3I6GB 4P5KB 4WWKD 2DKSA 2VXQH 3TBWA 1TZGL 3F6IA 3QXTA 4WCYL 3L3KA 4WHCA 4YK4C 2HLFC 5DJ6B 3EJYC 5E95B 1LO5B 3D18B 3BI9X 3BMVA 2V17H 1CK0H 2R1WB 4ZFGL 1RJZA 4F9PC 1KGCE 3V7MA 5TE7H 4BJLA 3WNPA 2ZOLA 4WFGD 1XGUA 1R3HA 3WN5C 2ENSA 3V95A 1DBML 2IADA 3ELAT 4JQXA 1PW3A 1KCLA 2PTVA 4V2BA 2HJFA 2HRPL 32C2B 3TA3B 4NZRH 4X8XA 1CFVH 3ROOB 4LAJH 4X5LA 3IRPX 4J6RL 2FDBP 3VXNA 1Y0LA 3OAUL 1JUFA 2GQHA 4HXAH 3MOAL 1ZLSH 1MCCA 5I1CH 3ARTA 4HXBH 2YSSB 4DQOH 2NX5D 2XZZA 4OT1L 5TH2B 5ADPH 4MCYB 4DCQA 2WUCL 1NAMA 2WZPD 1JPFB 5IMKB 1ZT7B 2X4NB 4L4TD 1R5IB 2IANA 5HDBF 2AJ3B 3QPXL 5BXFB 5EZIH 5DR5L 3GBNH 4YHKL 1HH9B 1UWEL 4P9HC 4QGYA 1WAAF 4NGHH 4YDVB 1EK3A 4NQCD 4F9PA 5D7JB 2H1PH 5F96L 1A6ZB 3CLFH 3O81A 1A7PL 4GAJH 4PRBA 3WN5A 3I50H 4MJ5A 5E7BA 3W0WA 4XZUB 2AQ3A 1T1ZA 4D0DA 1R3KA 1VEPA 3BGAA 4QRQB 1F11B 3HNTH 2BSRB 1MFDL 2OR9H 4PJ7F 4I4WA 1FO0H 4M4RA 5HHPB 4BSVB 4ZYKA 3U0WH 4GRMB 1AGFA 5CKAA 3UJJL 1KEGH 2NY1B 1IQDB 4G6JL 3LOWA 1UACL 3SBWC 4NBXB 2ZSWB 4XPGL 2BHYA 2V7HB 2CUIA 1ZT4B 3RWJB 1YJDC 3HC3L 2W9EL 2JJTC 2O5ZL 5IJVB 5JHLL 3KJ4B 1S9YB 1K6QL 2H8PA 4HUUA 3UDWC 1KTDB 4GSDH 1RK0A 4QRPD 3KG5A 4KHTL 4KK5D 3EHBD 4HCRH 4JJ5A 1OAZH 1MHEA 2V5RA 4QCIB 1CLCA 3KYKH 4RBPH 4OV5B 1QRNE 4FFWC 2X89D 3O3DA 4YXKL 1S7UA 1K8DB 3WIIH 3S97C 1FNEB 2R29H 4LCWA 3MRPB 4I0KA 4S0TD 3TIEA 4GAFB 4KY1H 4UOW1 3VDCA 3NH7L 4J1UA 1YEIH 3GEWB 4XC3H 4FXKB 4JANB 3OKOA 1B4RA 4X98B 2EYTA 1X5KA 5D6CA 1RZFL 2ADIB 1I9EA 3NA4A 1EUTA 2XXCB 2XYCA 3D39E 4JGJA 3TO4D 2YRLA 4YHZH 2EYSA 5E2VL 2LU4A 5SWSE 4XNUH 1BOGA 5J1AB 2FL5A 3HE7C 5EOCL 4DAGL 4PRDB 7FABH 2IALB 3V8OA 4NQXA 4PRNB 1A7QH 2JJTA 5DMKB 4FQIL 1N5YH 3UDWA 2IAMC 3I3BA 4HKZB 1NCBL 3T77A 3O6LH 5F44A 1WZMA 3ULVL 4UINH 3CNKA 1CYGA 4XBPA 2MNUA 5DJAB 3V4UL 2ADJB 5JHDB 2C4XA 1WBYA 5FCUH 2Z4QA 4PJGB 5D5MF 4MA7L 1ZLUH 3MV8D 1MI5D 4U6YA 4GW5A 2G60L 4DJMA 1NAML 5GS0H 4JO2H 4RWYH 2Q3AA 4LOUC 3JZ7A 5MENB 4G9FA 3MGTB 3LQAH 3W5MA 3BKJL 5CUSH 2FATL 4O9HH 2I5YL 4FFYL 5CZKA 2M1KA 3VW3L 3U0TB 2HFEA 3B9KD 4XP1H 1NFDA 3I85A 3RJDA 3HR5A 1LO3H 4XCNA 2Q8AL 4Q74A 4XAWH 5IV2B 5AD0B 5MERB 4KJYB 2C4FT 1WZKA 3MFFA 3RHWK 5DMIL 4MX7B 1TQCC 5DWUL 2VSDA 5BOZG 2AJVL 1A22B 4M7ZC 5HGBA 3ZTJG 3MBEC 1A1MB 3UJIH 1ZLVK 2IAMA 3VGDA 3QXWA 1AGDB 15C8L 3WD5L 4AT6B 3SCMA 2X09A 5JIIA 1IEAA 4PB0H 3RPIA 2PXYC 4YZFE 4OLYL 4TUJB 4K3DL 3QHZH 2AQ2A 4LCYA 1VFBB 4JO4L 4ELKB 3KLDA 5F72S 3ZZ1A 4ZFFB 5DO2C 1QEWA 4LF3B 2FJHB 4ZUUB 1HI6A 1I7UA 4NPYA 3LIZH 3CJJA 2WK2A 1UB5B 3C5ZD 4UIMA 1JHTA 5FYKE 5FDYA 4JVUA 2BVPA 5K9KB 3LKRB 5I9QC 1U8OA 4K3EL 2WINA 4DK3A 4YXLL 4P9HL 1UKQA 3BPOC 5IW3A 2UZXB 1TETL 3PP4H 5FYKH 3IDYB 1KTKE 2VDNL 1DQTA 4PRPA 2Y06H 2OSLA 2PTTB 3IJYA 3V0WL 3NZ8A 1A14H 4R4BB 3O2VL 5FA4B 4NM4H 3LKSA 5HYJE 3IKCA 1A6WH 1WF5A 1GIGH 1PBYA 1UXSB 1PJ9A 2NY2C 4KDVA 5D71L 4KK8D 1TFHA 5EBMB 3MBEA 4HWEH 2BRRH 4OGXH 1W8NA 4BM7A 3SKUD 2IGFH 4MWFA 3QI9D 2AK4E 4PREB 3RI5K 3S34L 1CE1H 1CF8L 2PXYA 4TSBH 4CVXA 5HHOA 3U30B 1RZ8A 3DV4B 4C4KT 3IT8D 3P2TA 3VFNB 3BKMH 4ZODA 5JMRA 4LCIH 4WHTA 3TBYA 3C6LD 5EN2B 3WIHL 4IOFD 1QP1A 3G6AB 4NZJA 4XBEH 3IETA 3TBTB 5GGTH 1FFPA 4M6AA 4NZUH 1WICA 4Y4HB 3BIAX 3O6FD 3O45A 1ROWA 3UCRA 4HS8H 5FOBA 3EIFA 2JJSA 2EYRB 3OPZH 1XMWA 3T0VA 1AXSB 2E9WA 4S2SB 1OAQL 4WI8A 4Z0XA 3MRNA 1HQRB 2PCPA 4BZ1H 2ARJA 3IAGC 5L8JB 3Q1SH 3UTSA 4BUHA 4DZ8B 1LQSR 1KIPA 5C1MB 4NC0B 1IC5H 3CVHB 4BA8A 4U6HA 4HWNA 4ZXBD 1VCAA 4LDEB 5C07D 1XT5A 4H0GA 1QHOA 1DL7L 3H9HB 3GBML 5C6TL 3U36B 1PLGH 4Q9QL 1ADQA 1KJ3L 4EDWL 1QUNA 5IK3A 4P48A 1LO2H 2QL1A 5D93B 5B21A 4RBPK 4Z78B 1I1AB 4Z0BH 3MBXH 2BSSA 3HB3C 1LWRA 2A9ML 3R0MA 3DRQA 3HG1E 1DCLA 1XAUA 1LK3L 1NGYA 2ZCHL 3FQTA 2OK0H 1J12A 4JO1L 3RIAF 1E27A 4UV7L 3CGTA 2J8UF 3UTTB 3L5WA 4HBQA 1G0DA 5T1DL 2VLRD 4HV8B 1TDQA 4F9LA 5IFJA 3JTTB 3OZ9H 3G5ZB 3WBDA 4MDIB 5I73C 1DN2A 1X5FA 3DVIA 4CNIB 4G8GB 2VLKE 4LRIC 5BW7C 1OAXL 1MIMH 4RMQA 5I1KH 4K94H 4UT7L 4A6YB 5DVMA 5IB5A 3WL9A 4IOIA 1F45A 2Z92A 1XGQB 4ODVL 5HVHB 2VDQL 2GKIA 3IGAB 3TBSB 4QRPA 1RJYA 4HGWA 4KJQD 2NY3D 5C0CD 1HSBA 1IM3B 5DDHB 4G8FB 3P30H 1CVRA 1FG9C 1ZLUK 3GJEB 5E1AA 1KN2H 5FHBL 1RD6A 3SDYL 5JW5A 3VDBA 5FV1L 1U8HA 1ZSDA 2MMXA 4KUCF 2WM0A 4Q2ZA 2DL9A 3EUUA 2WSKA 4FMFA 1B0RA 1ES0B 4U1KA 5F7HA 5JNYB 2J12B 1JWSA 1JZ3A 3EYQD 1MELA 4HWZA 2EC8A 2XRAL 4OV6F 3P9LB 3MXWL 4MXQD 2AI0L 4K9EL 2MFNA 5L6YL 1P7KB 3PWNB 3B9KC 1KCRL 3BP4B 3STLB 2YSSA 3KYOA 5D70H 4R8WH 4RGOH 4LRIA 1A1OB 5BRZD 5BW7A 4Y5YC 5IMKA 4PB9L 2X4NA 5CJOL 3ARUA 4PGDB 4ETQB 1QACA 3I6KA 1L4IA 5C7XH 1OHQA 4MJID 4NQEB 4YDVA 1HKFA 4DUXA 1MAKA 1A6ZA 4OLUL 1AR1D 1DUYB 4EUPH 4PJXF 3BPCB 4JHBA 4POZD 1EJOH 4M7LL 5F6IB 2J7LA 5D7IB 4S1SH 5SX4H 1AI1H 1MRCL 4KRLB 3WJLC 4JCLA 2BMKA 5C0BA 4LSUL 4C58B 4M43L 4O58H 4KRPD 4OFYD 3B83A 1YQVH 4OQTA 5HHPA 1KB5B 1NAKL 5ISZA 5JOPD 2W9LA 2NY6D 3GMNB 4PRIA 3A6BL 5FOJA 1FYTD 3T2OA 2EEDA 3B9AA 2ITCA 4JREB 2GSGA 3RNKB 4ZAKD 5C09B 1EAPB 3BW9A 2IWGA 2V7HA 2NY0C 1EAJA 1UZ6E 4PJFE 2B5IB 4RIRA 4NO2B 1GC1H 3B9KA 2EO9A 1WFTA 4N0YL 2N56A 3Q6GH 4WU5A 3VG9B 4Y5YA 4JFYB 1UT9A 4Q9RH 4CVUA 3WUWB 2GAZB 5KS9F 1I75A 4NWUL 1MCNA 5EULV 3QYCA 1BFOA 3MRJB 5DHVH 3LS4H 5F7DB 3V5KB 4KV5F 2G5BA 1QPPA 3LRGA 1IMHC 2HKFH 4Y2DC 2XPGA 3NAAL 3QI9C 2A83A 4GG8A 2ERJC 4OZGF 1T3FB 1DQJA 2H45A 2Y4SA 2J88H 3BEVB 1G1YA 5L2KA 4K2UL 1IARB 4FZ8L 4QYOA 2BOBA 5EU7E 3HI1B 4BSJA 3BHBB 5HD8C 1A6PA 1YY9D 5JOEA 3RTQB 5T3ZD 4MNQD 1SEBA 1IFHH 2YN5A 4LVOB 5GRUH 4R96B 2UVEA 1IKNC 4WO4D 3L7FB 3TO2B 4NJAH 3HI6H 3P4OB 1FNAA 3GK8H 3U7YH 2Y1VA 3ZDXE 4LLDB 4ZFZA 4D0CB 1FGNL 3RUGB 2GYSA 1J0YA 4IMLA 2VQUA 4BQ8A 2DLFH 3GMPB 2VH5L 4OGZA 2OJEA 4HKZA 3MXVL 2HA1A 4M9OA 3WFHB 4P2RB 2X70B 2FH6A 2Q86A 2A73B 1Z9LA 1FIGH 5IUSA 3RWGA 3ILPA 2Z8RA 4DOHE 4DGYL 2ADJA 4MNGE 2I60L 4ZXBC 3UJTH 1BPVA 2JIXB 1YNTB 4I2XE 5CILH 4P99A 1J5OH 4Y2DA 1E6OL 4G80B 1MQKH 3EFFB 4OCWH 5EU3A 2W91A 1RZKC 2H3NA 4FTVB 3QI9A 4PV9B 2XTJE 4ETYA 2YN3A 1MCKA 1B0GB 1MFCH 4GRWB 1MWAA 1I85C 4I3SH 5I1IL 3K4AA 4HC1A 1VFUA 4AMKL 1W72H 1RFDH 1D9KD 4G6FB 3ARXA 4X9IA 1M05B 4KK6C 4PJBE 3D48R 3VXRE 1ZXQA 5EDXA 3CZFA 2OYPA 3IDUA 2A74A 5D1QB 1IKNA 3BKYH 2BCKB 3L3JB 4KJYA 4XI5C 1LK2B 2JCCE 4ISVA 4F58L 1FDLL 5D1XC 1YECL 4NO5B 3HTLX 3FT3B 2CR6A 3EYVB 4HK0A 2ESVD 3RZCC 4JFXA 3OAYH 1T83A 4LASH 3VMPA 4Y19B 1L9NA 3PHQB 4LNVA 4YGVA 3DHJA 1CGYA 5I8KH 5EZOL 1H0DB 4TRPH 5HVFB 4R4FH 1PSKH 5F9WC 1ZTXL 5I1LA 3U9UB 2R8SH 2X4OB 4JY5L 5ILTL 5KSBF 5CINH 2F5AL 2GJ6B 2NY7L 4ZUUA 2VABB 2XNAB 3B4NA 2ZUWA 3ZKXC 1XF2A 1NMBL 1X5IA 2X4SB 1PX4A 1YEDA 2VDKH 5D2LF 1TTGA 4ZOAA 1BQUA 4EOWL 2NY3C 4CU7A 2F58L 3HNVH 3PQYA 4HEPG 1D5IL 3HCVA 1CIUA 2XFXB 2UWEA 3AB0C 3D5OF 1E4WL 4JDVA 3WHXB 2PTTA 4JZJB 2QQNH 3DSFH 5H37H 3GRWA 5FA4A 1S5IH 1I9RH 2P8PB 4XPFL 5D1XA 1NDGB 1JZ6A 4TSAH 1G1CA 4NCDA 4CADA 4XBGB 1MJ7L 4WFHD 3RZCA 3EYQC 8FABA 4IRJD 3PWPB 1NDMA 4MXQC 2VLRA 2OLDA 1MCDA 3WFDH 3IDJA 1GAFL 1IGIH 5CLWA 4OM0H 2ZG2A 2ID5A 1CL7H 2F54D 4FP8L 1TJHH 3DVFA 4OCSH 3W5NA 3NBNA 1BEYH 1PG7L 3QQ3B 3G6AA 4O51B 1S9WA 3GJFB 3WCYA 3LKQA 1DZBA 3DXAB 4PS4L 5HGHB 3QULB 5C0CA 4P49A 5IEKB 4JVPA 3VJ6A 4FXGA 2XQBL 5FK9A 3ARDC 1MJ8L 12E8H 4S2SA 2NZ9D 4AEIH 3RGVD 2P5EE 1X5YA 1QBLH 3IDNA 4AIOA 4K07A 4PJEF 3KPSD 4TSCH 2OP4L 2AEPH 4KRPC 4K8RH 4HC1L 3T0XA 1DEEB 3T4AB 2EO1A 4WUUE 2FCBA 2EDFA 1GJIA 2DDQH 4IRZH 2YUWA 3C09C 4PY7B 1Q94B 1G0YR 3QUXD 4Z7VF 1P84J 1YEFL 1Z9MA 4YDJB 3RVVC 4I5BA 4CN4A 3NZHH 2EXWD 3C08H 1OAKL 1OCWL 3QIBC 4P9ML 1KG0B 1CD0A 3GHEL 3R0NA 3VXME 3EZ8A 1PQZB 2HN7B 1DQML 3N1MC 2YXMA 4DZBB 1N64L 2OL3A 3LPWA 2EDRA 4EI5C 3FZUC 4MJIA 1TIUA 2EDHA 5SWZE 1UJ3B 3V6OC 3EYUL 4G7YH 4ORGA 2H26A 1B3JA 3ARDA 3N1PC 5LGJA 3BE1H 1FZOB 5ESQB 1S7VB 1FL3A 3UTTA 2PKDA 5EO0A 5E2WH 1U0QA 1FNGA 4P59H 3RBGA 2SEBA 2HH0H 4PV8B 1J18A 3C5JB 4QHKI 5JO5A 4MDIA 1T0NB 5DGRA 3G6JF 2VDLL 4BFIB 4X9GA 5LGHL 1X5JA 4ENED 5GGUB 5DT1H 1BLNA 3B8SA 5HYQA 4JKPH 2D7MA 3QIBA 2APBA 4ONFH 4PGCB 5B39A 1M7DA 1BWWA 2YD3A 4M6NL 1QSFD 1RSFA 3D9AH 3QDJD 4S1RL 4HUWA 1CDCA 4PJ8B 5DDHA 4U33A 1OGTB 3X12A 2XZCL 5ITFA 4EI5A 4OF5A 4ERSH 4CJ1A 2J4WL 3V6OA 1G6RH 4UB0H 1AQKL 3TVMD 4F7EB 3ZLQC 5HBBA 3V6BR 3DUHA 1QR4A 3VGFA 5B38A 4R7NA 2XIDA 4D9QD 2X1XR 1CXFA 3T09A 1U8LB 2DLEA 1IL1A 3UPRB 3SDAB 1D9KC 5C0FB 3HZKB 3HE6D 2VC2L 3RL2A 1C5DA 1V7ML 4PJCB 2B4CC 1CLOH 1JTPA 4YC2C 1P7KA 3UYRH 4DEPB 1QQDB 3S7GA 2A38A 1ZVSB 3FAXA 1QLRA 4PJDE 3Q6FB 3P77B 3WNKA 3H9SD 1OLLA 3O41B 1I8KB 3OAYK 3DETD 1R3JA 4AM0A 1D5XB 1AY1L 1ZS8B 1CFQA 1S9VA 5LXGL 1O7VA 1GH7A 4OGAC 1P7QD 2OBGA 4PJAE 3C60C 4FZEH 4X7SL 1UXWB 4I48B 3QO1B 2J2ZA 2IPKB 4LSTH 4YR6B 3SGDI 3GUTA 1YMMB 3RWEB 2NXZD 4TULL 1I7RA 4JRXB 3K2UL 2VXUL 5LG1A 2BVOB 4JVWA 1XCQA 3NCYS 5L7XH 3MLTB 3MRRB 1FHGA 4MD5A 5BZWA 3GMNA 4LK4A 3SKJH 1U8JA 2VDPL 4NKIL 2Y72A 4UDUA 1JPSL 4UILH 3CLEL 2OL3L 1CXIA 1D9KA 1QLFB 3LPFA 5C09A 4UV4L 1EAPA 5CEYA 5F89B 3MRGB 1A7NL 3B43A 5ICYA 1VACB 5I16A 4NO2A 5IQ7L 4L4VA 1L0XA 3NIDE 1JYXA 5B3JF 3GFUA 1JPST 1XIWB 4AENB 3EGSB 4QRUB 1X4XA 4JFYA 3KPLA 4XC1H 4NHUB 4V1DB 1T1WA 3GMRA 1TJGL 4FQCH 2YA2A 3QNYA 4YHIB 4YHYB 3OKKB 5C0IB 3RY4A 1QSEE 2DLGA 1HOCA 5DJ0B 1LDSA 3C60A 3E2HB 1QSZA 4F8QA 1P9MA 3BEVA 4TUOB 3K2MC 4NWTL 3ZHKA 1JL8A 4JB9H 1U8NB 2BVQB 3PGFL 4HEME 4OFPA 2GT9B 3NTCH 2L7UA 1P84K 3RTQA 2R1YA 4XNXL 3E6HB 4GRLB 2A2QT 1Q9WB 2PYEB 3ZE1E 3DVNA 4LARH 3OHXB 2AJSL 2DD8H 4L9DA 1J1PH 1Z0NA 4Y5XB 5GISH 4BH8B 4LEXL 3CH1B 1OAUH 2EE3A 1MCRA 3EFDH 5E8OA 4L8BB 2H6PB 3P9WB 2WBJD 2D7TH 3RUGA 3V7AG 3W9EB 5I17B 1JP5A 3IJHA 2O61A 1HHKB 3SO5A 3SY0B 1WBZA 4Z7UB 5EUKB 1K4CA 1X4ZA 3HRZB 4WWKB 3ZTJH 2A73A 4KHXH 4E42A 1D5BA 3J8F7 5F7EH 4NRZA 3IDGB 4LPVA 1QFWI 3FONA 4OLXL 1A0QL 1EHNA 1EVTC 1FLRL 2AJYL 1YNTA 4JZOB 5T3ZL 5ID0B 1K8IB 1J0JA 2ARJQ 3QUXC 1S78C 3N1FC 1RUML 4NDMA 5MEQA 4F37F 2BFVL 1MFAL 1PYWB 4LPYA 2ZUVA 2XKSA 3HZYB 4JLRB 1B0GA 1H8SA 4L3CA 3I2CH 4K3JH 1NMAL 4KQ3H 3K8KA 1G7JB 1HYRC 2OZ4L 1HSAA 1P6AB 1QFUL 5EO1A 5HI4D 5DUPL 4P2YA 4HS3A 3H3PH 2FLBT 5GJTL 4X4MA 3H6JA 4TPRL 1VKXA 5MI0C 4OD3H 1V3LA 4OIIH 1EO7A 2BCKA 3O2DA 2WIMA 1LK2A 2DRUA 1Z5LA 3DYOA 4JGMA 4X9BA 5L0QB 3H8NA 1UA6L 4G5ZL 3FT3A 3M1BB 4HKBB 3SGEH 3U46B 3FN0H 4M5YL 5A3IC 1V3JA 3JUZA 3U7WH 1UCBL 4XH2B 2IBZX 1KEML 4X7TA 1HHHA 4GKZA 1RULH 4JM4L 1H8OA 5E6IB 2EH8H 5D2NB 2D7QA 3BMWA 3F62A 2NX5B 5CIPA 1HWGB 3D39D 5I66B 4UI2A 3T2NH 4LPCA 3GMMB 1A2YB 4L4TB 5SWSD 4U1SA 3GKZA 5CBEA 4XXCC 3QUXA 3ZYOA 2P42B 2X4OA 3QA3B 4ENEC 4KC3B 4DUVA 3V4VL 2GJ6A 4LEOA 5J57B 1LD9B 1F8TL 2HMIC 1W0VB 3PG2A 4LMQE 4NQCB 5DEZA 4XVUD 2HFFA 2ADFH 1C08B 3KNBB 4DKDC 1SEQL 3GSOB 4JG1H 3HPJB 4PTUB 1HEZA 1QR1A 5GS0D 1KJ2B 1K5NB 4NO0A 2YKLL 25C8H 2YA1A 3BX7C 3WHXA 3UZEA 5C71A 4H26A 3MA9H 1AO7D 1ERNA 1M71B 4ORZC 3GSQB 4PR5B 4OZHA 4M8VA 1F3RB 2GJZB 2BNQA 5I1HH 5F1NA 2JF1A 3MLWL 5ETUB 3EYSL 3TM6A 4PRHA 1DBKL 2DQCL 4FNLH 4AIZA 2J8OA 2VB5A 5C9JA 1Z9SA 4XVTH 1FV1A 2Y07L 1EEYA 2A6IB 1RJLB 2PF6A 3O11A 5CGTA 5TJWK 3ARFD 1JTOA 4YDKH 4JRYE 2DF3A 5C86A 4N68A 3VCLA 2DQHL 1B9ZA 4N8VB 4N0UB 4XXCA 1FFQA 2I9TB 5H2BB 4YHOL 3BAEH 3QXDB 3LPGA 3F7VB 4Y0GA 4NQSB 3DETC 5EUOB 3KPMA 5KSUB 2HJKB 2M8XA 4FQQB 4LDLB 4YFDB 3IS0X 4ZUWB 5I19H 5CBAB 3NCEB 5K59F 1H3PL 5GJSL 3LEYL 4XAKE 1LHZA 2XT1B 4ZUVA 1S7QB 3TO4B 5DZLA 3MV7A 2QEJA 4PBXA 5TPWH 3I3EA 1VFMA 4I18B 5HYIA 3WFBH 2OQJA 2DYPB 2Y5EA 2APFA 1OTSD 4YO0B 4M6OH 4OB5L 4YHLL 3RQ3A 4MDJB 4YX2H 1UEMA 1HH6A 3CMOL 1WWWX 3HAEG 5FYKD 4PGEB 5SX5K 2VDOH 1V7NH 4XCYB 4OUUB 3QQ4B 4CDGC 5TF0A 5DJXA 1HHIB 2ILLA 3BGMA 4RQQA 2IPTL 3QG6A 3MLUH 4FG6C 2X5PA 3HUJF 5HYJD 1CLYH 3EOAB 5TQ0L 4HBCH 2CUHA 4HPOL 4X6EB 2ORBL 2QJDA 3WFZA 2EIDA 3VWKD 3MV8B 2B8OT 1MI5B 3V8CA 4KKNA 1EIBA 1E4KC 2WP3O 5I18L 2AK4D 3B9DA 3S5LA 3FB6B 5E94B 2PR4L 3E0GA 1UH2A 1BECA 4D9LL 3G6DH 1SJEB 2F5BH 4LKXA 3GGWB 5ECJE 1BX2A 5J11C 5ACMA 5CAYB 1NBYA 4YDIH 2H41A 1Q72H 4UIKL 2FRGP 4ODSL 2I25N 3ZSSA 3GSWA 1UQSA 3MRFA 4PJ5A 2NW2B 4OJFL 2HT4D 3GSXB 5CCKH 5DD1L 3N06B 3PL6B 5HHXH 4XNZB 1H15B 4EVNB 5KANI 3S88L 4JFFA 4UQ3A 1IEBB 4GKNB 3VFGL 4HIJA 3JSSA 2WBJC 5D7SH 3ULUF 3ZL4L 5BQ7A 1WFNA 4XXDA 1WCBA 2HKHL 4ZD3L 4HUVB 4M48L 3TZVB 4TOYH 5SWQB 4WEMB 4YXHH 1OGTA 4JM2C 1D5ZA 2DBJA 1C12A 1PKOA 4LLYB 1TXKA 2ATPB 3ARED 3F7RA 4PJGF 3MR9B 5CJQH 1A5FH 4HX1A 4XPAH 4J4PC 1E4KA 1M6OA 5JA9A 5T5FL 4KJWD 5IR1B 3C5ZB 4S1QH 1JIBA 3JBG7 3O4LE 1IM9D 5IFHH 3UTQA 2PTUA 1P5UA 2R4SL 1JZ2A 2VQ1A 3JVGC 1A6VH 3UPRA 3SDAA 3HS0B 3HC0B 4JR9H 3ARGD 1V3KA 2F19L 4RGNC 4DUWA 1ZT1B 5KVFH 3IFOB 3HG1D 4NNYA 5CFHA 1XR8B 2C3VB 3T3MF 2WMPA 1ORSA 4Q9BA 5F6HI 1KJMB 3CPLB 3Q6FA 3A67H 4P3CH 3I02B 2DMBA 4RMTA 3RWDB 2JB5L 4XPHL 2WBJA 4CMHB 1JI2A 3MRKB 5T1LB 1ZHBA 5HXMA 4OI9A 2XN9E 1AC6A 1FH5L 5BZDA 3NGBC 4NJ9H 2A1WH 4JM2A 1UWGH 3WE6B 3N0PB 1FSKB 2EECA 3C6LB 3QO1A 5ENWB 2VLKD 3BYYA 1KTRL 1YMMA 1KCSL 3QUYC 4J4PA 1A6AA 1HDMA 1XF4A 4IDJH 5I30L 1JF1A 3WS3A 3O6FB 1N5AB 1ZEAH 1FORL 2VQTA 2J8UE 5IMMB 2XKUA 3JVGA 3WIFB 2BRQA 1F3JB 1KPUA 1EZVY 2VXQL 1YY8A 1OTTD 3O6MH 1DQDH 1QRNA 3T08A 3ECBA 3GKWL 5DRZA 2DN7A 2CLVB 1JHKH 1DJSA 4JKKA 3G04A 3JWDH 2F53E 2HVJA 2IQ9H 3MOQA 3PABA 4OF7A 2V17L 1CK0L 5KZCB 5D6DC 9CGTA 5C07B 1DEDA 5TE7L 2EEBA 4QXTB 4A2MA 4L8DA 5FGCE 1C8PA 4NQVB 3DGCR 4ONGH 4WEUD 2MOVA 5C0IA 2CRMA 3V4PH 3VFOA 1HHGA 1D6EB 3Q3GB 3SEPA 5DJ0A 5F8RC 3ARFC 3D39A 4PUBH 5JORB 1FBIH 4NRYB 5TQ2H 1R24A 4JQIH 4RFEA 3REVB 2VE6B 1U8NA 1SMAA 2BNRA 3QUYA 5MEOA 1KT2B 1YN7A 5I1GH 3G5YA 5E00B 3D2UB 4JO3L 2GT9A 3FJTA 4D9RE 1I8IB 3GMQB 1X44A 3CFJA 3DVGB 3MSPA 3SJVE 5CMAA 1U2HA 1FZKA 3MJ6A 4GRLA 4HXAL 4Y1AE 1Q9WA 1H5BB 4NN5C 3VI3E 5LQBH 2WWKT 1AQDA 3OHXA 4QLRA 5I1CL 4HXBL 4DQOL 3B6SB 4BELD 3CFIC 5F7LB 4L8BA 1NGXB 2H6PA 2J5LC 3LD8C 1PG7W 3SY0A 2XWBB 5EZIL 5EBWA 3F7PC 4LBEB 5E7FA 2BOCA 2QSCH 3GBNL 4NGHL 3PWVA 3HKFA 1OTSC 5KBNC 2YR3A 2H1PL 1MLCA 3CLFL 2IJ0C 1U8IA 3TN0C 2P49B 3FKUS 4GAJL 3I50L 4U4BA 3VXSA 4QRRA 5BVJA 4PJXE 1FE8H 1R5VA 3ROLB 1AIFB 3HNTL 2EC9U 2OR9L 3HZYA 1FO0L 1S5HB 1SYSB 1WJ3A 2MQ0A 3U0WL 5BS0A 3D87B 3OKDB 1UVQA 5HHQB 1TCRA 3S96B 1T2JA 3ZDZF 1LP9E 3X17A 2V2WB 2EDTA 5GRJH 3ZE2F 4YHPB 2CJUH 1JNLH 1YPZE 5DD3H 3BZ4B 4H5SA 1U8MA 4GSDL 4FQLH 3LRHA 1QBMH 3M1BA 3U4BH 3SQOH 1K4DA 1MREL 3DURA 4HCRL 2D0FA 3R06B 1OAZL 4WI3A 4L8SB 3KYKL 4NQDE 5GGSY 2Y7QA 5E6IA 1WZLA 4L3EE 5TGBB 3WIIL 2Z93B 1G7IB 1NGZA 3BQUB 2R29L 5T1KD 1UJTA 3QUMA 2DWDB 2NYYD 2HT4C 5BRZB 1UWXH 2VR5A 4KV5E 1A2YA 4GUPB 4KY1L 3QH3B 1JN6A 3BISA 1YEIL 2YS4A 3TN0A 2D03H 1D5MA 1PZ5B 1LEKB 3QA3A 2DI9A 5IQ9A 1LD9A 2EDJA 3F7QA 4UT6L 4U1JB 2KH2B 2NPLX 4P23D 5DXWA 3SE8H 5E9DB 2DLIA 4D0BA 3RAJL 1S7WB 1I3RA 3BEWA 2X6MA 4XNUL 3FQXB 1BD2B 1JNNH 1KJ2A 1X9QA 1K5NA 3MV9A 1KIUA 3QP3A 2FSEA 2PETA 7FABL 1T04B 1B6DA 1A7QL 2BSTB 2NY6B 3WXWL 1N5YL 5IVXE 3CU7A 1FYTB 3ISWA 2XTJD 5I0ZA 2GJZA 1MCPH 3O6LL 4QRTB 5EPMA 1BJMA 4ZAKB 1QVOB 4UINL 3LKNB 4OT1H 2I26N 1A4KA 5HI3D 3QFJE 2ATKB 3VXRD 3ARGC 3OKNB 2BJMH 1QBBA 5FCUL 3OKEA 1RUKL 2P5WE 3QWQB 1F90H 5DFVD 3U4EA 2IFFH 2MCPH 1HYSC 4ZUTA 3VGGA 5GS0L 3KJ6H 4JO2L 4RWYL 1DQQA 3QRGH 3I3DA 3F7VA 3LQAL 1A7PH 1BZ9A 5CUSL 4Y16D 1I7ZB 5J3HC 4WUKH 2DB8A 3JWOH 3UZVB 1U95B 2CPCA 4XP1L 2YUZA 4K94C 1LE9B 5DQ9B 2Q6WB 1LO3L 4XAWL 1AC0A 5CSZB 5D7IF 2HG5B 4U2ZA 3PJSA 4N1CA 1LE5B 3UTZA 1IGFH 4JAMA 4MNQB 2EICA 3UJIL 1P1ZA 1F5WA 3G5VB 2P8MB 4WO4B 4KJPD 2DYPA 4YO0A 1LO4L 4JY4B 3VXTB 3PUCA 2W9EH 5DEFB 4PGEA 4PB0L 4JFEE 3QHZL 3ARGA 3QB7C 5D1ZD 2VXSH 1HXYB 4ODXA 3CD4A 3MJ8B 1MCJA 3LIZL 4QT5A 1T4KA 4AL8L 3GM8A 4R0LB 1VPOH 4EDXA 1OAYH 1UGNA 1IAKB 3NH7H 4WHDA 1RUAH 5C8JA 5DTFA 5D2LE 2AJZA 1KV3A 1NC2D 4N9OB 1I1YB 2QLVB 3PP4L 5FYKL 3FB6A 3VXUE 2KBGA 4LVHB 5FDWA 1A14L 4XHJD 1SJEA 4NM4L 3BH8A 2YD4A 1BQHB 3GGWA 3WFCL 1A6WL 4RDQF 1GIGL 5SX4I 5T33H 5CP3A 3MRDA 4OGXL 5CD3B 3TC9A 2NW2A 2IGFL 2VDRL 3B5GA 3BZEA 4X7FC 4ODHH 1CE1L 3X14B 4R26H 4TSBL 1NCBH 1SVZA 4K8RD 4IRSB 3BKML 3MOBH 3TJHD 2ESVB 4MJ6A 5I2IB 1VA9A 3DI2B 2XQYG 1RV6X 2DJ4A 3CUPB 3CMGA 1CGTA 2P5ED 3CXDH 4ZTPH 5JLZA 4P2OC 4XBEL 3TZVA 3EO1A 4GFTB 5GGTL 3JV4A 5J12C 4NZUL 5EOTB 2RHEA 3QJFA 5IIEA 4WUUD 4E41A 3DLQR 3AS0A 3QWRA 1VADA 1ND0A 3C87A 2G60H 4HS8L 5ANME 1NAMH 3MRIB 4U1NB 4U1IA 3MJ9A 1G7PB 4XPTH 5B39G 1BZQK 1DLFH 1AGBA 3QNXB 5HPMB 3QDMB 4O2CB 3W0WE 1HCFX 3O8XC 4GXUN 1EXUB 5IHUH 4FMKA 3RWIA 4BZ1L 4GRWF 4IS6B 3N1GC 2H9GB 5E1HB 3VXMD 2Q8AH 4YIQA 1IC5L 3HMXA 1JZ7A 4U1LA 2C7UB 4LKCB 5DWUH 4EUPA 2ZJSH 2AJVH 4JDZB 2OX5A 4MQ7A 4GW1B 4G42A 2L4OA 5B38G 4GMTL 2P24B 3WLWD 3PDDA 1PLGL 2YC1B 1V8HA 4GAYB 1JYWA 4C56A 1RK1B 3ZKQD 1LO2L 4UAOC 15C8H 1P4BH 1G7MA 3RWDA 2WAHA 3DRTA 4OLYH 4Z0BL 1CDGA 3BD3A 5A40E 3MBXL 1K9TA 5EU7C 5T1LA 4P2OA 3HLAB 2G9HB 4QOKE 2BVTA 3QNZB 4DVRL 4K7PY 1XFPA 4BUGA 1BVLB 4QF1B 4LLVA 4LCWE 3O4OB 2Q76A 5TDPA 1IJ9A 2UYLB 1OARL 3O8XA 3RVTD 3QUZC 4MAYC 4MSWA 4P9HH 5IEHA 1RUPH 5JW4M 5DHVA 2Q7NA 1YEHL 3NN8B 4HFWA 3NABH 3WJJC 3WIFA 4WDIB 5F3HB 5EH1A 3V7AE 3CCHA 3F5WA 4OCNC 3RGVB 3O2VH 4HZLA 1KNOB 5I1KL 1MIML 3KPSB 4K94L 4HK3J 1ZANH 2H2PC 1A3LL 1JWUB 2NXYD 3BH9A 3OX8B 2DIJA 3D3VB 2XTJC 3K4DA 4Z5RA 1CF8H 2R1XA 3KYMB 5FKPB 1LEGA 1EH9A 4XMKL 1YJDH 2Y36H 1FVEA 4NOFA 5F88B 3IDMA 1KN2L 1TZIA 1HN1A 5IFAH 2HT3D 4P4KD 4JGUA 2WNGA 4P5TC 4S1DD 3ZO0A 1MCLA 3A0OA 2E6PA 5E00A 3L3HA 3JV0A 1H8NA 4OZ4A 1FZMB 4HF5H 2NY4D 2A0LD 4GS7B 3QUZA 4MAYA 3EDFA 3MNWA 4G9FE 4MA8H 4Y16C 1A7OH 3EYOB 4HWBA 3WJJA 4GG6A 4WY7L 4PJ9D 3GB7B 5D70L 4R8WL