5G4OA

Crystal structure of the p53 cancer mutant y220c in complex with a trifluorinated derivative of the small molecule stabilizer phikan083
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
196
structure length
196
Chain Sequence
SVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKLFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERCSDSDGLAPPQHLIRVEGNLRAEYLDDRNTFRHSVVVPCEPPEVGSDCTTIHYNYMCYSSCMGGMNRRPILTIITLEDSSGNLLGRDSFEVRVCACPGRDRRTEEENLRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Harnessing Fluorine-Sulfur Contacts and Multipolar Interactions for the Design of P53 Mutant Y220C Rescue Drugs.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords CELLULAR TUMOR ANTIGEN P53
total genus 48
structure length 196
sequence length 196
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00870 P53 P53 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 5g4oA00
2BIPA 5G4OA 2J1ZA 4L18A 2J1XA 5A7BA 5G4MA 3D0AA 4IBVA 5AOLA 3WTWA 1EAQA 4QO1B 3Q01A 1LJMA 3IGKA 1CMOA 4IBYA 3D08A 5LGYA 2BINA 2J6WA 5AOIA 1EANA 2J1WA 4GUOA 3Q06A 5AOMA 2J20A 5AOJA 5KBDA 4L0ZA 2XWCA 2H1LM 4IBTA 2BIMA 4LO9A 4AGOA 3TS8A 1HJCA 4IJTA 4MZIA 3QYMA 5AOKA 4XR8C 2YBGA 4IBQA 2BIQA 1IO4C 2BIOA 2J1YA 4LOEA 1GZHC 5AB9A 2X0WA 1HJBC 4IBSA 3KMDA 1UOLA 4IBZA 5ABAA 2FEJA 1TSRA 4L0YA 2IOIA 2X0UA 2OCJA 1KZYA 3ZMEA 3D09A 5ECGA 1EAOA 3EXJA 3WU1A 2GEQA 2IOOA 5G4NA 2IOMA 5LAPA 2ADYA 4IBWA 1E50A 1CO1A 4MZRA 4AGMA 4AGNA 2XWRA 4IBUA 2X0VA 2ATAA 3WTVA 4A63A 1YCSA 4AGQA 2AC0A 3QYNA 3WTSA 1GZHA 3IGLA 5BUAA 3KZ8A 2AHIA 2J21A 4AGPA 1T4WA 4G83A 4G82A 3VD0A 4AGLA 3WTYA 3D06A 3D05A 3WTTA 3WTXA 3US0A 3US1A 3VD2A 3D07A 4LOFA 3EXLA 4GUQA 1HU8A 4HJEA 2WGXA 4KVPA 3VD1A 2P52A 2MEJB 2PCXA 1TUPA 3WTUA 2VUKA 2RMNA 1H9DA 3Q05A
chains in the Genus database with same CATH superfamily
4I1NB 3SDAD 5HTSA 4WTQA 1YMHB 43CAB 1EO7A 5TF1H 5DUPH 3SDCD 4NT6A 3WAKA 3EYOB 2CKBL 3RGVA 3NJFA 4BSVB 2DMBA 3N43F 5EN2A 5EU3B 1QX1A 1BD2A 2EIJB 2R8SH 1ZPLA 1BXXA 3RG1C 5K33A 5SWZE 2JCWA 1PYWA 2ATPA 5DJ6A 5HGAB 2CUMA 1A4KB 2YXMA 4S1QH 3OKOA 1ZJAA 3A6OA 2NDGA 3PNWA 1EXGA 2H0PA 2EIZA 1I3UA 2EDWA 1AOZA 1BSIA 1DJYA 2PR4H 2XWCA 3LS5L 3ENEA 3M1BB 1DVSA 1EGJA 2J55A 3SCMC 4PJXA 3MRIA 3OTTA 5DWUL 1O6VA 4NAQA 3BMWA 3BD4A 4U3HA 4LSQH 2EZ0C 3C75A 1JJUA 1PNDA 5F7DB 4LSUL 4HOXA 4C56A 1XIWD 1NFDB 3RPIB 1E9OB 2TSAA 5AG9A 2Z64C 4S0HA 1OCWL 5C6PB 1BEYH 5DLML 4XZ4A 2WINA 3GSRB 5C09D 4MQ7B 2E74C 2D0GA 2YWZA 4PJ5B 4QMEA 4ZS7L 4PJHB 5F1IA 3VG9C 3A6CL 1ZS8B 4IOIB 3DRQB 1T04A 4H88L 4JW3A 5ECJE 3HI6H 4M6NL 4A7GA 3S35L 2AQNA 2MQCA 5J8OA 3IJSA 5F9OL 1BF2A 2HT3C 4IQHA 4IYKA 4ONOA 4V1DD 3QG6B 3QEHB 4L8CB 4JS7A 3QH3B 2BMKA 1K8IB 4ZZFA 4BFBD 5E8EA 1RSYA 2ZKXA 2RCSL 2D7QA 3GRWA 1CG9B 3Q5YA 1ZA3B 1S8DA 2GAZB 1XGTA 2W07A 3HVDA 1R9FA 1INQA 2W0KA 3QAZB 4L8SC 4MCNA 5EIVA 1NC2B 4H4NA 5DYOA 2DW5A 3QB7C 3RU8L 2EUXA 3QIBA 2CRMA 5ACMA 4OLEA 8PAZA 3IFNH 3TZVC 4OLZL 5CLZA 1NOAA 5E1AB 1PZ2A 1F3JA 1ZT4B 4ODHL 5DD6A 3FTSA 1ORQA 2RQ8A 2UVEA 4M02A 2D4FA 2VE6B 5F7EL 4PD4J 3C8KB 3BPLC 3CFQA 4XP5H 4LCWB 3V9CA 1FNEA 3I85A 3WNLA 4NNYB 1BJ1H 5LXGH 4QXWA 4UDUA 2NTSP 3O8XB 2PTTB 2DWTA 3BXNA 2EE3A 4FHBD 2H1XA 3OB0H 3V4PH 2HT3D 5FM4A 4QRUB 1JPGA 3BQUA 3MCKA 3VXUD 3N41B 5IWLA 4DZ8A 1T21A 1T0NB 1JXDA 1GIGL 4NUQA 3V4PA 1NZRA 2XZQL 3MYZA 4XP5L 3ME0A 1NEZB 4ZOBA 4P9HH 2BO0A 4K94L 3SDXF 3KXFD 1I8MB 4UMSA 3BGAA 3CH1A 3D30A 3N1PC 1I9IL 5IJCC 4M00A 3S97C 2EZ0D 5C0DA 3GC3A 1QFWL 1FG2A 4I3SL 4G6AD 4AKPA 3NACH 4H8PA 4LKXA 4TULL 1UADC 4JKPL 3THML 2EXSA 2P8PA 4OSUL 4GBXA 3KXFA 1MEXL 2XFGB 4Z7QF 1D5IH 1PFCA 4TULH 4X7CC 4LL4A 1T1WB 1XL6A 4NB7A 2I60L 4RDQF 3PV6A 3R8BB 2CO6A 3VYOA 4EN3D 4ZMPA 2IAMB 4PJFE 1IX2A 1GGBH 1W72B 1PLCA 4X4YB 5LLIC 2DKSA 3T5WA 4KFMA 2DQIH 5D5ME 4DKEH 3PL6C 5C6TH 4JPKH 4GSQA 1MCEA 1Q1JH 4JM2A 5H37G 4QAWA 1CE1H 2OW7A 5T1LA 3D4YA 3AWFA 3MUJA 4NQED 5IJBC 4TNGA 2G9KA 3P0YL 2GJJA 2VLJB 4OFVA 3NMEA 3DO4A 3QQ9D 5D1QC 2LVCA 2D3NA 4ONFL 3WIIL 3C5JA 3PGFH 4M8QA 1QMUA 4TUJB 3MRDA 3OQRA 1J05B 1CFTB 3VI4E 2IBGA 2BW5A 2YAFA 1FFPB 4GRMB 5E2UH 3UG5A 3V0FA 4UM9B 1J9CT 3FT2A 1NUNB 1ZVSA 2E56A 2GG1A 5L2JB 2Y9RT 3ZO9A 1PKQB 3OKYA 1OQOA 1QYGL 2C5DC 4KY1H 1ZIBA 1KCUL 5DVMA 2A83B 5KVDH 1OCCB 1P7HL 1PD0A 2XA8L 1MQKH 2NLJA 3PV7A 3PQYB 2L7EA 3SQBB 3IFNL 1U2YA 1QG3A 5IIEB 4OFYA 3FQ1A 2YKLH 2A9CA 4FYTA 5I1HL 1S9WB 3DO7A 3VFSA 2WO4A 2EDOA 3X3GH 1A5FL 3ZDXF 3IJHA 2DOCA 5IQMA 5I71B 1L0QA 1F42A 3VFNA 1JNLL 2A74A 2EDBA 3LRMA 4OFIA 5JXEC 3EH2A 4DGWC 2VLRE 1DQTA 1PCSA 1V7NL 4MD5B 1T0NA 2YD4A 5I75C 1NCWH 2OBGA 4AXWA 2LOEA 3ZOAA 3S35H 2VDPL 3HI6L 3ZDZB 4Q6IB 1KT2B 2Z31C 1KXVC 1OF2A 2PP7A 2X10A 3T3ME 3LN9A 2H2SD 1NFDF 4U6YA 3OGCB 1FE8L 4XWGL 4ZUSB 5J13B 5JR1H 4M3JA 2W80C 3PWVA 4EI6B 3NQKA 4N0CD 1GSMA 1FNEB 1OAJA 2ZT9C 4CJ1A 1QQDA 2OCFD 1G7PA 2MTAA 5C92A 3DX9A 4TVSa 3ECWA 2H6PB 1E5BA 4YSQA 1WBZA 4MA1B 2F18A 4HWZB 3T0BA 5EU7E 4OZHB 3T09A 4BKSC 3TBYB 5FEBA 3H42L 2JKJA 5I24A 4CN6A 4K23L 1ILUA 4LT7A 3C60A 1I3VA 1JRHL 2M2DA 4W9KC 5JW4N 1CD8A 1ET8A 1NC4B 3KPTA 5E9AA 4P9ML 4EN2A 1RK1B 3B5HA 3SE6A 5EBMB 3KGUA 3D4GA 3LTVA 4AM0A 1HILB 5L0QC 1AACA 1ZANL 4NZDA 2N7BA 2FL5A 4XRCA 1PG7W 3A6BL 3PF2A 3WYRA 5E08L 1ORSB 4YE4H 4N5ED 1OSZA 3MBEA 4F15B 2A9BA 4PJ5A 5BS0E 1XF1A 1JGIA 4HULB 2VM4A 4IOFC 3AXLA 1L7TL 4JFQA 3DRQA 3FFCE 2APSA 4ICXA 2BHYA 4YHOH 4W9CC 4NGHH 2VKXA 3BAWA 2FO4A 2ZX7A 1OAXL 3PV6B 1L3WA 4XWOC 1K3ZA 1JF5A 3IDMA 2AI0H 1F2XK 4IRSD 4OM1H 1D3CA 5GRZA 5EU6B 3MU3A 1MAJA 4RMBA 1F11B 4IHOB 2VDLB 4KKQA 2BVPA 1UJTA 1X4YA 3V6OA 3H9ZA 3T1FB 4AGNA 4JFOA 2XWRA 4GSUA 4GAGL 4HKJA 1JWSA 3FO1A 2D0HA 1OT1A 4HUWA 4CUCA 1WWWX 1AG0A 1LEGA 3MV8A 4R3SA 2IFGA 4X6FB 4OCSL 2JQMA 1T66D 4IRJB 3VNYA 1AP2A 1UXMA 1BAWA 4EUPH 4Y9CA 2E4FA 3TJHD 2MSPA 5IB1A 1AYRA 1INDH 1CGUA 3BFOA 32C2A 3CFMA 1AZBA 4DH2A 3TIDB 1NSNL 1QW9A 1YQ2A 4YBQD 4HWEL 1J0JA 4WEUD 3FH8A 5IMLB 1WK0A 3L08A 5EU4A 5C08E 1I7RB 1U41A 5D7IB 1K6QH 2VMDA 1K85A 3V0EA 1R3IL 1FNHA 4AG4L 2Q7NA 3AY4C 5D7HA 3F7KA 4GAAA 4KI5D 4AL8H 3B2UC 3GDCA 4P4KB 4FAAB 1FORH 2OI9B 5D7JC 3UTZA 4QTHB 3FRUA 1TO5A 3P54A 5BVJA 1H5BC 1LNUB 4IKJA 3HNTL 5L8JB 2DEWX 3BN3B 3NZ8A 3DYOA 4PGZA 2YD9A 1ET5A 2J5WA 3C08H 5FF6A 5BZWA 3L4VA 5A2IH 3FTZA 1DBJH 4P5SA 3KPSE 1QBBA 3SGJA 3MVSA 3EGXB 4LPWA 4PY7A 3V4LA 1QSFE 5HYIA 3EHBB 1JZIA 4MWFA 4ZFOL 5MEPA 1HL8A 1SJEA 4YGAB 1FNFA 4QXVA 2O5ZL 4JJ5B 4P57B 4EZJA 3TH4T 3PRZA 1ZGLP 4G42B 3LKSA 2QQLL 4DJMA 4P4KC 4X7FC 4P8QA 3C5SB 4APQD 3FRPB 3Q6FA 5E9DA 1ACCA 4KROC 2CGZA 4FQXA 1BW8A 3NFPB 4N2OA 4DK3A 4W4NA 3MRGA 4OQTH 1S7UA 4JAMA 1QPKA 1WWAX 3LPGA 5HSFA 4R7NB 5J89A 2KHAA 2VIRA 4PJDA 2V3FA 4LZKA 1RJLA 4D8OA 3NRPA 1A7NH 1Y6NR 3I6SA 3MJ8A 5I0WA 1SVBA 1QHPA 2WMPB 1G1OA 1BQHB 4E9QA 3T0XA 1F1DA 4ZMWA 2VUYA 3FT4A 3APCA 1N6UA 4FKEA 5HY9B 1HNFA 3DOSA 4LSDA 2ICEB 4BZYA 3L1OL 2WXGA 1WG3A 1RK1A 4JPWH 4NQCE 3ARZA 1U91B 2XSKA 4H0HB 4KZEH 4UCFA 5L0QB 1A3LL 3U4AA 2EEBA 1CFSA 2FX7L 2V0AA 2XG5A 3BP5A 2YPLA 4CADA 5INDB 1EXUB 3CUPA 5H94B 2VH5H 2ZE0A 1PAMA 2MKLC 3BUBA 4LOUC 1KCKA 1JYNA 4ANXA 1IC1A 2GVYA 1NMBH 1UJ3A 2MH4A 1EMTH 2NY7L 3HCVA 1Q8MA 2VW4A 4HUNB 5HHME 4EUPG 3R1GH 3CN4A 1T7YA 1BM3L 3PCYA 2BNRD 3I75A 5MEOB 4PJDF 2PCFB 3MREB 1PLBA 3PWNA 4OQTL 1QFUL 5E8PA 2HVKB 5DGRA 4NQVA 4HWZA 1CK0H 3LKRB 4XVUC 3QI9A 4L9LA 2ITCB 5TFSH 4C58B 2OJEB 2PMZA 2BNQA 1EDHA 2GK0B 4KKBC 3TFKC 3VD1A 3EYSH 1XB8A 4NQSA 5D7IE 3RDTB 3UZEC 3KPRE 1TCRA 4BGDA 1T5WA 4EDXB 3F65A 3QHZL 2XG5B 5INDA 3GSNH 3KWVA 5TJWK 3QI9D 2X3AA 1INEL 1UA3A 4U6YB 4ZUSA 5IQ9B 4P49A 4BQ9A 1MFCL 1NGWB 1E9QB 4GIOA 1ZV5A 1HKFA 3GKWH 4JRXD 4L29A 4A2MA 1WT5A 4NWTL 4JLRA 5L88H 4UINH 5I75B 4WI7A 4MXQD 3MV01 4APQC 1FLTX 1CMOA 1UCBH 4F2EA 3RVXD 4LBEB 4G43B 4QRQB 5EU6D 3UC2A 4D3CH 3L3IA 2OTWB 5AAWA 4LHJB 1IQDA 1GCYA 4U0RC 2R4RL 4NZTL 5EPMB 2DI7A 4QRSA 2NPLX 3RY5A 3FUIA 3CFUA 4IHBA 3X17A 3I9PA 3N44B 2IFFL 2OTPA 3RB7A 5ETUA 3MRGB 5EIIA 1BQHG 3CZJA 3V6OC 4UIKH 4N2FA 3B7RL 1QACA 1EEUA 5IMKA 2J88L 1NFAA 1ZHKA 1NBQA 2L3BA 4LCCB 2VR9A 4D0BB 1UD2A 4YDNA 4PCSA 4ZOCA 5DFWH 1R3JA 4UZGA 4JKNA 4MNGB 4BFEA 4OFQA 3HI5H 5AWNL 2DEXX 2YR3A 5E5UB 1SJEB 4DPAX 5A40E 1RZIA 3G6DL 1RZGB 3FQYA 3KEDA 1MFEH 3A22A 3I84A 5ESQB 1CI5A 4WHDA 4XXWA 4WNQB 4JFPA 1WFNA 2DH2A 4PWFA 4XN1A 2R2BA 4GAGH 5ISZE 3VFWB 4JG9A 4P5MB 1F6AB 5IFJB 2VDQB 4HS8H 3IFOB 5SX4I 4UTAH 2VQ1A 4N2MA 1MVYA 2QQKL 3DHMA 1SLVA 2BVTA 1TJGL 2H1PL 3EIFA 4GP4B 3M45A 4L2YA 4QTHA 4PS7A 4RFEA 1AGDB 3ZE1F 1NUDA 4KI1A 3PIQB 5CLYA 3SDCB 4HSQA 5E2TH 5HHMD 3UAJD 1U9KA 2CGRL 4GLRH 1JZEA 2WXPA 3O3EB 3FRPG 3KCPA 2LAGB 3IMRA 4TNWF 1O7SA 2MTPA 4MASA 4OLXL 3UTTB 3WXWL 4JHVA 1MFAH 3D4ZA 3L13A 1F3JB 5JIPA 3WIFB 1TEYA 1Z9LA 3ASOB 4O5LH 5CS7A 4BEIA 4HUVB 1CGVA 2O72A 4XHJD 4N2HA 1UJ3B 2A4CA 5CGYC 3GJEA 1VFOA 4MZ3A 2FH6A 1OPGL 4GSDL 4FC3E 1M7IB 2HKHL 2X4TA 4MCYA 2GJ6B 2EVIA 1CFSB 2W9EH 2CIIB 3MLUH 5J6SA 5IHHA 2ADIB 4NCC1 1FYTE 1MCNA 2XZAL 3MV9D 1TZHB 5LCVA 3NCJL 5DK0B 3RB5A 1TUPA 2XWJB 3CVBA 4JO1L 4LSRH 3QXAB 1NEUA 4ELMB 2DIJA 3S2AA 4HEPG 4L3ED 1YEGL 2R69H 4FS0A 4P5TA 1EFXD 3MV9A 4KZEL 1K2DB 2Z4QB 5EO0B 3A24A 4JR9H 3I50H 2VIRB 1GOHA 2N7AA 1WICA 2Q5BA 5C3TA 3RNKB 2C1PA 2HJLA 2ZNXA 3BIKB 3GB7A 3GBNL 4N24A 3N55A 3SBRA 3II1A 1WSST 2QL1A 4P4RB 2BINA 4P5TD 4PJHF 1ACYH 1E4XL 2Y36H 3FTGA 5DO8A 3LS4H 3KL0A 1DFBL 2EXWC 3H9SE 4Z18A 3CK0H 5GRWA 1HNGA 5HDRA 2CDEB 5AD0A 1E5CA 1IBZA 3S2CA 1KDIA 1JOIA 2GFBA 1OLLA 3FQ4A 4RGND 1GRWA 3LXCA 4XO9A 2H1LM 5ID0B 5AVXB 1RL1A 4AWJC 4YFDB 4H5SB 3DTDA 5T5NF 4HJ0D 4B9PA 4HIHB 1M1XA 1U8MA 5CJBA 5E8EB 4EI5D 2ATPB 3ORJA 1K8IA 3PXJA 3U4KA 3UEQA 5A2BA 1DLFL 4YHML 5JUEH 4I2XE 2V7HB 4TUOB 4XNYL 4ZFZA 1DEEA 3UG4A 4IIZA 3CPLB 5E94A 5I5RA 5CN3A 5CZXC 2F8VA 4GG6E 2WBJD 1FH5L 2DTMH 2FTAA 2P5PA 1JV5B 3EJCA 4L5FH 3D09A 5EZIH 1A25A 4KKNA 1UYWH 1OARL 2VR6A 5FW7A 4OZIF 3L4WA 1F4WH 2BS9A 3BUYA 3IGAA 1NBVL 4IM8A 4QHKI 3GIVB 1K5WA 2NR6A 5ADOH 1E7UA 3F5WB 4HH8A 1XH2A 5BRZA 1U8JA 4NJ9L 2OMUB 5I16A 3CDGA 3VXNA 2ADJA 3P0YH 4KX8A 2QHRH 4NZRL 3QYNA 3CAFA 5GPRA 4AQ1A 3IGLA 3LXAA 1A6TB 3T6VA 4XPAH 4J2QA 1IKFL 1S9XA 2BY3A 3KNBA 1AKPA 3MRLB 1E4WL 4JM2F 4M03A 4IJ3B 5DD0L 4NIKB 5I6XB 4JY6A 1Z9OA 4GRWF 1GGCH 4WVRA 4AGLA 4L4VA 4LU5L 1PEZA 4YX2L 1GGBL 3B5TA 5BVPH 3RZCD 1ADQA 2ITDB 3DYMA 5BZZA 5MERB 4MAYA 4HUVA 5DJZB 4DP0X 4QHNB 3LDBB 3EXLA 3B1UA 1U2HA 1QP1A 3SKUD 5BVPL 5I18L 1WCQA 4HJEA 1GS6X 1FNLA 4Y5VA 3SPVA 2NOYA 3N91A 1NDGA 2I26N 4FG2A 4P2QB 4XMLL 5FWRA 2ZKHH 3KH3A 3LJ3A 3REWA 3SE3A 4Y4FA 5T3XH 4HOMA 1FFPA 3W9DB 2MPVA 5C9JB 1I7ZB 1HH9B 3GT6A 4AC2A 5D70L 4XMTA 3PWLB 6FABH 2XWBB 3C5JB 1N0XL 5JNYB 2DQUL 4JO3L 2PYFA 1MVUA 2HSIA 1G7JB 4DN4H 1AHKA 1XGYH 5DHDA 4LAJH 2D0FA 2WD0A 3GWJA 2C4XA 3QZOA 1P1ZA 3LN4B 3QG7L 2Y7LA 5AKVA 3NT0A 5J6GA 3L54A 2YGOA 2NY1B 4R4BB 3WKYA 3SDDA 3V6OE 3D3VD 2PPFA 3IRPX 3B34A 4F7TB 1BG1A 1FVEB 1DVFD 5FFOA 2OR9H 5E08H 4F37F 2XKNA 4HC1H 2JJSA 2PPCA 2FYYB 3P4MB 1IARB 4BH8A 2A9NH 1K5NA 3EJYD 3QYCA 4ERSL 2CLRB 2AJSL 3TTSA 3SDDD 2VZ1A 2X4RB 2B5IC 4Q56A 3AXHA 1E3XA 3D85D 5E5MB 1KJVB 4K5OA 3BDBA 2HFEB 1XH3B 4DUVA 4XCFH 1YN7A 4W6WB 5HD8C 4YFLI 3LH8A 4HEME 1QSFB 1M71B 1FVDA 1MFBL 1UB5B 1VJSA 4E41B 4JQIL 3F6LA 2ICWB 3OGCA 4XE5B 1GPOH 3BIBX 1IC7L 4HMDA 2XN9A 5GGQH 3KL5A 4GKNB 3T0EE 5DHVA 1H6EA 4MXWL 5FDYA 3GBNH 1GKOA 3EGSB 3HPJB 2VQ4A 3V6FB 4UT6H 4YWGH 4G3YL 1Q9OB 1OGAB 2A74B 3FUFA 2VISA 4QRUA 3MV7B 3WMSA 4M1GH 1MFEL 3ZYJA 5C08B 3WTVA 3DBXB 2P80A 4LLDA 5HHQA 4DAGL 3BH9A 3DX7A 5TPWH 1CFQB 5DQJA 3BVWA 3K72B 3BP6B 3FSVA 3H55A 3TVMC 4ZMQA 5L4MA 1T1ZB 1D5MB 2BFGA 3NCJH 1R3LB 2V2WB 2Q0ZX 3ARWA 1IT9H 5IMOA 2QMKA 3DC0A 3UPRB 3B8SA 4Z7WB 1MREL 4DKFL 1JWMA 2IPUK 3CQQA 4N2GA 5EU5B 3WO4B 4F92B 3WTXA 3QCVH 4U6HB 2XWDA 4TQ8A 2QHLA 1MLBA 4QLWA 3BHBB 2ZAHA 1D7BA 3OKDA 4OVVA 1TETL 4Y1SA 4OD1L 3LKQB 5DJ2A 3G6JB 4HT1L 5KVDL 3QDGE 4JPQA 2IG2H 3U9PH 3VD3A 4D3CL 1IEAA 1PX4A 3O6ML 2QZQA 2ZXQA 1PJWA 3VFMA 3CDFA 3QO1B 4KHTL 4PN6A 2C9PA 3ARVA 1G9EA 5AB2A 1XR9A 1NBYB 2KI6A 1T5XA 4H8HA 4OD3H 4XAWL 3TV3L 4XVJL 2YIHA 4CC4A 4UU9A 5DQDL 2Z93A 4ONFH 1LJMA 5L6YL 2R9HD 2HLAB 5D9SA 5LBSA 1GJUA 3Q1EA 4HIJB 4BK4A 1YNTA 3QAQA 4R0LA 3BVXA 5F72S 1T1YA 4QRPB 3ARGB 3B2MA 3TYFA 3O4LA 4LPYA 4WAFA 3WUWA 4J1UB 2NW2A 2CJUL 1X5XA 2FHCA 2DZEA 2CLZA 3QR0A 5D72L 1WBYB 2C1OA 3BKMH 2YAPA 4I8DA 2Z3FA 3HE6D 2YFNA 3NFPA 1QLFA 3CCHB 1S7WA 3RIKA 2X53A 3N40F 5E94B 2G30A 1G1YA 1BPVA 3TURA 3ZE0E 3OKOB 5JHAA 3PFUA 2JI2A 1KFAL 1S7XA 4WFGD 3CDZB 5I8EB 1FHNA 3B9EA 4RH4A 1QSEE 4L0YA 4I3SH 5KYWA 5J11B 2DQEL 4QNPE 3MUY1 2HA1A 3FU8A 2DYRB 3L4TA 3W2DL 2KLTA 1BOGB 2DQFB 3E8UL 3IFLH 1FZMB 4HIXL 4J8RB 2DDQL 2X41A 4JVPA 1JZFA 2F19H 3DV6B 4FLOA 5CCHE 4PRBA 5F1SA 1DUZB 5DXWA 5F88B 2YPVH 4F20A 2V9RA 4NP4H 4FGMA 4P2OD 3KS0J 5C0CE 5KYXB 2I07B 3MJ9L 5K9QI 3VWKB 5I15H 3TPKA 1YEIH 1R0AL 3ALPA 1I7RA 1J8HE 1U8QB 3GMMB 3D2TA 2GITA 1E4JA 5D6DA 2ZJSL 1SY6A 4RRPG 4AV5A 2LW3A 5MEND 2VDLL 3FZUD 5E1AA 4AW7A 3WTYA 1RIVH 2K3HA 4S10A 2WSPA 1W0WB 4HHAB 5KYWB 1R4XA 1QD0A 3O6FA 3DI2B 2QQLH 3JVGC 2P42B 1XGTB 2QVTA 3I3EA 4JZNA 1JHLL 4KAQL 2WKOA 2XQYG 1PLGH 4OB5L 1LP9E 1RUQH 2GI0A 4OFDA 2P24B 2DI9A 3DJTA 4PRHD 4R3SB 4ZW7A 3FJTA 1DR9A 1MCLA 2RB8A 4PWJA 4J3BA 5K39A 1NMBL 2AJVH 1U92A 3D8MA 1RZ8B 4PJHA 5F1IB 4E5XA 1N6QH 1A6VH 4GXUN 3S4SA 2NW2B 4AYFB 3CVCA 2CMRH 1M6OA 1P69B 4IU3B 4A7GF 1QBML 1U3HD 5JW3L 4A6YL 4FQQA 4WKZA 5ACLA 3AU0A 1E9OA 3T0AA 4EIUA 3V7MA 3QNZA 4KO9A 3RNQA 3US9A 1U95A 3TVMD 4EEEA 3U36B 1WEJH 2XJLA 3FN3A 4AG4H 2X4QB 1XMEB 5AVVB 3A67H 2QPUA 4X9FA 5IQLA 1JGLL 3NABH 4WFEE 2EADA 3CE1A 5B8CA 2MCAA 3M1BA 5IEHA 4YDLC 2LABA 3LNFA 5EWIH 2FT8A 2WYTA 3FFDB 3CSPA 2EEDA 1OSYA 1Z9NA 1NAKL 2E6QA 3FSAA 3BEVA 5KBMA 4YGVA 4WWKB 3ZMRA 4QTIH 3SOTA 2A5UA 2CGYA 2CHXA 4H26B 2H6UA 5DHMC 5GJSL 2ZPKL 1TIUA 4M3HA 2J5LC 2BP0A 3MGTB 5AVZB 4NKDA 1I9RH 5FA4B 2R0LL 1BZDA 1FGNL 4Y5YA 3RL1B 1AC0A 4ZFOA 4WW2C 3GUFA 3CN3A 3KDMB 43CAA 2ESVD 5L8KB 4JFFD 4Z7WA 4Z7OE 1NWPA 4HAGA 4BA0A 4OD2B 1LD9B 1TVBB 2QPDB 2V4LA 3K2UH 4NSKA 4KV5F 4U6HA 6TAAA 2YJLA 2KZ1B 3BAIA 1IQWH 3RWGB 4EMZA 2VXSH 4PG9B 1HQ4B 3F00A 4G7YL 2E59A 2BPBA 5G5DA 1N3NB 1OP3H 1B4TA 4BSWB 1JZHA 5BV7L 3UTQA 5EO0A 6CGTA 1ZLDA 4WFGE 3L3IB 4XXWC 2DQ6A 1DVFC 3GMQB 1M05B 5AW8B 2NR6C 3QNXA 4XP9L 5I23A 2HLAA 3MZGB 4ADGA 5JPMA 1LE9A 4AL8L 4QAMB 4XVSH 4GG6F 3O2DA 1MCHA 5MHSE 4OJDH 5I1KH 2RFXB 3EG9B 4GO6B 4Y4KD 4GEIA 3D48R 2FQEA 3I9IA 1OW0A 1UKQA 3NAAL 1FDLH 4JRYB 4L5FE 1HSAA 4ZX3A 4JFHD 1IMHC 5FYLH 1A6ZB 4A2EA 1SEQL 2C4FT 2R2EA 4HKXB 2XG4A 3L8QA 3LH2H 3J7HA 4NPKA 5DA0B 3U1SH 2KKQA 2FX8L 3AADB 3MLVL 5B39G 2DJMA 1FVDB 2UWEA 1RZKH 2YARA 4EDXA 1C1EH 3GSWB 4U6XA 4FQHA 4GS7C 2BJML 4HIIB 3T6XA 2ICWA 5D4JA 1PKQA 3LPOA 3TVMB 1E9PB 3EDFA 4OBRA 4Z7NB 4G6KH 2NDFA 2XWXA 5BOJA 5JHLH 2Q10A 2EDQA 4AJWA 1E42A 1O6SA 2HX7A 3TZVB 2VLKB 4P59H 2ZYHA 3TONA 4YDJB 3HS0A 3VFUA 3WS3A 5E2JA 4NZJA 1OL0A 5L2KA 1OAQH 1RU9H 1V05A 4Y19B 1AGDA 4X4KA 4R4ND 3KLKA 1KTKE 4LFHG 1U8IB 3MRMB 4ONGL 1E30A 1ZLVH 1CB4A 3CFDB 5ANMB 4HBCH 4QRRD 5I1KL 2GBUA 4NNPL 1YSOA 1BDYA 5AB1A 3MFFB 4QGTA 1PZ5B 3QPQD 1IGML 4GI9A 4BINA 4JG1L 4PIRF 4GRLA 3GSQB 4IBTA 3VM5A 4DVRL 4NO2A 2UY6B 1XF2B 4XNZB 1QRKA 3Q8BA 1K3IA 1WIOA 1WZKA 3C6LC 4KKLD 2VLKA 5GJTH 4XTRC 1MRFL 4OVUA 5AVWB 3TA3C 2K7PA 2FSDA 4NDMA 4GQZA 2FWOB 1HZHL 2GJ6E 1J8RA 2G5RA 1D5XB 1N18A 4WQOA 5I73C 2BVUA 2YUZA 4HISA 4AZUA 3TBTA 3QUZD 1UJ3C 4O2EA 1TEGA 4BUHA 4HJTA 3HZVA 1H9VA 4HH9A 1J9RA 2HG5B 5TH2A 5AZ2L 3OJVC 4BHUI 4N20A 3TA3D 4FZ8L 3HUJB 3RVTD 4EVNA 4M1CD 4FJZA 4Z0XA 5I8KL 2VABB 5CLXA 3T8XB 2N56A 4CU8A 5FM5O 2ZOTA 3AGWA 4MB3A 5CUSH 4OKVB 5IJKA 3MXWH 4JRYA 1JVLA 1WHOA 3MX0B 1O9WA 4FMFA 2B2XL 5HPOA 5I71C 4LRNL 2O61A 4N2AA 4Q4IA 5B3NA 2YK1L 5JPMB 2I24N 2CO2A 2UXTA 4FG0A 4TVUA 1IVTA 3G5YB 1ZHLA 1JXFA 1WD8A 3T0DA 1U8OB 2PYED 4TQIA 4A63A 1EEYB 2VN7A 2EILB 1CLCA 1WDAA 3CFEA 1S7TB 2YA0A 1UASA 1U8QA 4HLEA 3P2DA 4WF7A 3E1F1 1TNNA 1GVIA 1NCWL 1H3GA 3P3UA 1J8HA 3BQUC 2UZPA 3PHSA 1RUKH 2X40A 1BFVL 3IMWA 1W6WA 2E7CA 1EO5A 2Y2TA 3ESPA 3B56A 5ERWB 4N5UA 1KEML 1KB9J 2W92A 1KBWA 3UABA 5JPNA 4M93C 3THMH 1X6NA 1J8HD 5FYJU 2FBRA 3Q43A 1ODUA 3B6SB 2XA8H 1BGXL 1KG0A 3IXTA 1NCCH 3ASNB 4LPUA 3LQMA 1JV2A 1MWAA 4JRWA 3MJ9A 4MHHG 3FOMB 5DJDA 1HXKA 3F64A 3T6QC 3NEOA 5LBSL 2Q76B 2WBJB 4EDWH 4X50A 4C56D 3MRLA 3IU3A 3KPPA 2VC2B 3HBPA 3C6LD 4PJ9C 3FQRA 3QH3A 3D9AH 2H2PD 4LE8A 3RY6C 1CICA 4JRXE 4A38A 4W4OC 3ZSSA 3U36A 3ZDZF 2QSCH 2GBAA 5TE6H 2FLMA 1Y1UA 1TDQA 2C1PB 3BIKA 2NT0A 2ZSVA 3GB7B 3IF1B 5DS8B 4AM0Q 3D9AL 3LKNA 3VJ6B 3QZWG 3IAGC 2W1NA 1KTRL 2E9WA 2ZUYA 3WL9A 1CE1L 1EHNA 1FPTH 1AOHA 4AEHH 4AITA 2FNBA 4LBAA 2IALB 3CLEL 5J13C 1G9MH 3BT0A 4DKEL 1YEJH 4WFHD 4FNLL 5DRNA 3GTVA 1NLDL 4Y2DB 2B1OA 4MNHA 3EH5B 5FHAL 2DLEA 2XKUA 3L4YA 3F83A 3JWOH 3D25B 4QDGA 2I60H 2F53A 3QXDB 4OJAA 4TQHA 1JMXA 3KPPB 2YGNA 1CICC 1FO0B 3T8MA 2J6EL 4Z7NE 2ARJQ 2CCWA 4D9QD 4DZBA 3FH7A 2Y7QA 3ATDA 5KWYC 1SYVB 1E2VA 2GSMB 1M7DB 4HCFA 1DQKA 3IETB 1T5KA 1VFUA 1X5IA 4FKKA 4JQIH 1KB5A 4BSVA 5IB4A 3VSTA 4BQBA 5TGBA 1WFOA 1PLGL 4OB5H 2B16A 3BKYH 4PJGB 5GS3A 3HLAB 3NZ8B 4Q2ZA 1UKSA 3PWPA 2BSSB 3V0IA 1ZLUK 1F4YH 1QI4A 4M5ZH 3UJJH 3EOBB 3NBNA 3GF8A 1OAZL 2ZKMX 5EZPA 5I30L 2K9FB 2JKIS 3HB3B 3V9FA 2XQ0A 2FSEB 3V0AC 3RP1A 1TO4A 4JE4B 4UMGA 1ZGLB 3WNMA 3ABGA 3O4LE 2ORBL 1RLWA 2YC1B 2BXYA 1ZPUA 1DVFB 2GW5A 1UT2A 3MLRH 3RWCB 1X5ZA 2CIKB 2KDGA 1M2VA 2NYKA 3L6FA 5LBSH 2FBOJ 5CJQL 1SMAA 3GI8H 5DK2B 3T2LA 2E76C 4MAYC 1SUJA 2WGXA 5AZ2H 4F37K 3TGXA 4P3CH 4B0MB 2AEPL 3VM7A 2ALAA 4N0UA 2ERJB 3DXAB 5GGRB 4I0CC 3OLEA 3ZHFA 4I5BA 2C3HA 3ZKNC 2OMTA 2CBPA 5HYQB 4TSAL 3VRLF 3J2PA 3HUJA 4EVNB 2BVQA 4NUGL 2DBJA 1WIUA 4P3WA 3S96B 3HUJF 1IT9L 3TBTB 2VLRD 3SIKA 4C8XA 5D71L 4OGQC 2R1WA 1ETJA 3QJSB 2F7QA 4MJ5B 5I5IA 1KCLA 5T1LD 3QZPA 2K1MA 1UGNA 3BD3A 3MLPA 1GOGA 1YMMB 1Y0LB 4LEOB 1DSFH 2ZCLL 3TBWB 1TZGH 4H88H 1T4KB 2ZOUA 2AAAA 3C5ZC 4MMXB 5C0BA 4AIZA 2MNWA 4XO4A 1A1OB 2F8XC 1J8SA 3F7YA 5KBDA 2BK8A 5IQOA 2Z91A 4PV9A 2DBLL 5IHUH 4D9RE 4D0DB 1RU9L 3EADA 4J3VA 2NYZA 3K91A 2GB2A 4UDTB 2GTQA 2K9UA 3A4EA 4KOBA 5F7NC 4PRHE 2J44A 2E86A 5GGQL 1MFNA 4KZDH 3VNZA 4AENB 2K6ZA 1AC6A 3MXWL 3CHPA 1EVTC 2CO4A 3L5JA 4JY4B 2PW2B 4I85A 2BNQB 1IEAB 3UYRH 2ZOWA 2YZ8A 5ABAA 3UTSB 4LCWD 1EEQA 3NCEB 4FI8A 3KJ6L 3RDTA 1G5GA 1PU0A 2JFCA 3CSGA 3GSNB 4N8CL 1CL7L 2GIMA 2Y1ZA 3O3AB 5FCUH 5A6IA 2VLJE 1JFQH 3Q3GB 3JSSA 3HG1A 5HYJE 3BFQG 1S46A 1UM4L 4NFCA 1J9TA 1BZ9A 5AUMA 3UPRA 2X6BA 5IMOB 4GG8A 4Q9QH 4HWBH 4YH6A 1NBCA 1E50A 4UT9A 5C0ND 1OP5K 4ZXBD 4RX4D 2GJZA 4J2XA 4MZRA 4HUKB 2ISDA 1OE1A 2WNXA 2GI7A 2W94A 1HN1A 2UYLA 1ZRUA 1YMME 3BP5B 4EOWH 4FMVA 1FFOA 4UT9H 1AO7B 4TLTA 4X9HA 1DLHA 2FQDA 5J7CC 4KNQA 1Q9OA 2WWMD 3GJFB 4MKMA 3EFDL 5BS0B 1OM3L 2NY0C 3F2LA 3MV7A 4HGMA 4NNPH 4RX4A 3UYRL 4ZXBA 3AWGA 1M3JA 4JLRB 4JY5L 3VD0A 4PB0L 2MOVA 4X0KA 2WLIB 5IB5A 1SJHA 1CXKA 4H7VA 3NGBC 5HDWA 1MOEA 2R23A 5CSBA 4N2EA 5CCGE 1JN6A 4LF3B 5DRZA 3RWEB 3MV7D 1AAJA 1F3DH 1LEKB 3LRSB 1T83C 2R0LH 3UH8A 2JELL 4WRLA 4P59L 1NM4A 1ZE3C 1MAML 1UWXK 4DO4A 1YMMD 2P46B 1MW1A 4HUUA 3ZRFC 2ZCLH 2J72A 5J3HC 5IOPA 2G3NA 2XPZA 4NLHA 2X2HA 5FA4A 4OCWL 4W9ZA 2OZ4L 2NUTB 5GRXG 3DK0A 3QUXC 5E5MA 4GG6A 2J88H 3DMMB 3ILQC 3RWFA 3RWJA 1J18A 2B9AA 1MG2C 2OJZL 5C07A 4WK0B 1J05A 4OLUL 5EWIL 4IOSD 3K71B 1UM5L 4OTXL 2VLJD 4JFED 2WV3A 1BOYA 2CG9X 1F6FB 3DV4A 4JFZL 4Q97A 3RE0A 1N0LB 1TLMA 4E0RB 3CU7A 5CEYA 1S7SA 5HI3C 3LHPH 4NQDD 2VQTA 4R8WL 2QELA 4BJLA 4DTGL 3QUYC 4JPSA 2VR8A 5JIDA 3IEAA 3UJTH 2QTVA 3DTUB 1P6FA 5JW3H 5E4AA 3WIHA 3MBWB 3O8XD 3L9BA 4MDJB 4MMXA 1RJYB 5DO2C 5EA0L 5C0BB 1KXVA 2Z31A 5FDWB 3L5HA 1D6EB 5JIMA 3RNKA 1YRKA 1OP9A 2JK5B 2XYCA 3IYLW 1QI5A 3DDFA 1YAIA 2NYYD 1M6OB 1PG7X 1UOKA 3I6LD 4IU3A 4MJ5A 4QY8A 4NENA 2VW6A 4LQFH 5HD8D 3SDYL 1HJBC 2Z7ZA 1LP9A 4V1DA 5IMMB 5EOCJ 4ODXA 2DQGL 2HT2C 3KXFB 1M7XA 1ITCA 3CZEA 3SDDC 4LK4A 4Y8AA 3SZKC 1XGPB 4QHUB 2BVYA 2FJHB 4XAKD 2X05A 3CIQA 3BPOC 3OPUA 3RAJL 1DP0A 3CDZA 1QSEA 3CSTA 1MHCB 1S7QB 4FXKB 4JX0A 1N7ML 2H41A 4OGXL 3ULUE 2XQBH 3ZGHA 2QQNH 4L8BB 3MRCB 1DQLL 1ZSDA 4FFVD 1QNZL 4AE1A 1PQZB 4G1MB 4LP4A 1RJZB 2X0VA 1YECL 4XCCL 5E7BA 2ATAA 3WFEH 3A3YB 1W8EA 4N0RA 2DLIA 3WI9A 1ZS2A 3AMLA 3B7YA 5D1ZB 4EIGB 1BF8A 3U83A 3MCYA 2VDOB 3IU4H 2QLYA 4ODXB 4JN1L 5H2BA 5C0IA 1KPVB 2ZP8A 3LZFH 1SN5A 3COOA 5D55A 3FH5A 5J6HA 3GHEH 3UTSD 1BVKB 2HLFD 3QIUA 3RIFF 5AW5B 4YO0B 5GGTH 3GRBA 4EXPX 1Z6JT 1NDMB 5D5MA 2VQ1B 5IVOA 2HLEB 3U9UB 3CD4A 2C3WA 4Z7UA 2ZXCA 4Y5XB 3WNIA 3X3FH 4RA3A 5AVYB 5DEZA 3WTUA 3LV3B 4W9EC 5E1GA 1UYWL 4A1RA 2RACA 3P3SA 3P02A 4Z77B 4H5SA 5CHNB 1CXIA 5EU7C 1T20B 1KNOA 1XGRA 2HVJA 4FQXD 5AQ0A 3D18A 2WIMA 4JFXB 4PWGA 4NQCB 4AV0A 1SLUA 4X6FA 2X1QA 1J5OH 3OV6A 4H2CA 2QPFA 4K7FA 4OZHA 4Z23A 4HZAA 3HHMA 4HD9A 2OKMA 4HKJB 4LLQA 4CSSA 5DUBB 5IV2A 5IVXE 3CC5B 3POHA 5A3ID 1QFOA 4Z7VE 3FTGB 1J5DA 4QI3A 4LQFL 1KIUB 1E5YA 4HF5L 4PJ6A 1JYWA 5LN8A 5IJVB 3RWDB 1G9NH 5GGSY 1DFBH 2J8UB 1ZA6B 5IWLC 4LHQB 2L7QA 1IBBA 5IB5B 3PS6A 1A9BB 1SZNA 4HS8L 4LCWE 4WZ9A 1GW0A 4LSTL 2R23B 3QRFM 5K5YA 4BFRA 2QVKA 1KBGL 1Q9LA 3K0YA 4H8WC 2IG2L 2BNUA 5SV3A 3U9PL 5BS0A 2CJSA 2Y1YA 4KO7A 2CDGB 5B22A 1TU2B 3ZU8A 2HT4C 1WBXA 5EBMA 2GQHA 2BNRA 1YY8A 2OPCA 2EIZB 2IANE 2Q3ZA 3UBXG 3EHBD 3HI5L 2OCJA 3AS2A 4KKLC 2VZ3A 2MCG1 4AYDC 4PI0A 4IRJC 2VABA 3T8XA 4JO1H 4LSRL 4U1GB 1RUAL 1ESOA 4N0YH 5G4NA 1KOAA 2ZYIA 4XMXA 3U7WH 2ZWZA 2NX5E 4F2MA 5JIKA 1EJOH 5D96C 3SD2A 4G8IB 5EN2B 5EU3A 3VXPA 5D7KD 3EYOA 5B3JE 2XXGA 2Y5TB 4NDMB 5C7ZA 2E6JA 1FFNA 3QDHA 4M6MH 4ZO9A 4JFFB 1NBZA 3QDMB 3X14B 2UY6A 2IIJA 3MXVL 2Q7YA 3HMWL 1QVOB 5D6CB 3B7SA 4TV3A 1F1AA 2O5ZH 2A7BA 5I6NA 1I3RA 5CJOH 4HLJA 4OIFA 4XC3H 1KLUA 4S1SH 4DQAA 1TYEB 4PJFF 2ED8A 3FAWA 4PJXF 1DBJL 5F0LB 4Z76B 1OT4A 4WEEA 3GKWL 2Y1VA 4DNLA 3CZLA 4G6FB 2MCPL 1J5HA 3GIZL 2PETA 3IAQA 2BCMA 5BMFL 2CWRA 1U8LA 5DZPA 4FFYL 2I7SA 5GZND 3FT4B 4D0BA 5E8OA 5D2LB 2GTWA 3OKLA 4Z95L 3M7OA 4GP5B 1UB5A 3CG8A 2EVHA 1WRFA 3ARGC 5DR5H 4X8XA 1R3IH 5E99H 3BPNB 4UWQB 4ONGH 5JMOC 2HFEA 3WY2A 7FABH 4JFZH 1NL0H 1T1WA 4PRIE 1QSFA 3A47A 3QEQB 1HHKB 4J3TA 1RI8A 3GSWA 4YSTA 5IVZA 3AJ7A 3ZDYB 4RDQG 4X6EB 4DETA 3FC8A 1GSKA 3VB8A 5KYNA 4HGWA 4LBEA 5DYFA 3AG4B 2WO3B 3QC5X 5JA8B 3H9SB 1IQDB 2VN4A 1JVOA 3CZSA 5JPNC 1SYSB 3NIGF 4YZWA 3QP3A 4BV1A 4FFZH 4D7BA 4DAGH 4ODBD 3PJLA 3BISA 4TPRL 2NY4C 4K3EH 3V4PB 3BH4A 1P9MC 4FFVC 4KTEL 2HRPL 4Z7AA 1NGPL 1EHLH 1B2YA 2YN3A 1T0PB 4LLWB 5EC1A 5T1JA 5MEQB 3LZFL 3NJLA 4U1NB 2IAAC 5J1TC 4M7LT 1E9QA 2ZOLA 5FYLL 3VX0A 1KY6A 5AZUA 2VGLM 1RSFA 4AH2B 5LQBL 4PG2A 4BXVA 4E36A 1SXBA 3ZE0B 2WTRB 1JXGA 2BDNH 3JVFC 4G1EB 4WNJA 5I18H 1HXYA 4X5XB 3OF6A 4WLCA 3X14A 3P4OA 3VQ1C 5BV7H 2C3XA 5IJKC 2XLLA 3PWNB 4IBWA 2AJZA 3MV8D 5AYTA 4I77L 4NM4L 3L1EA 4MXVF 4CC4C 3KWTA 3BESR 3QUMH 5CU5A 2FBJL 3RWIA 1YEWA 3LKOA 3ULSB 1BHGA 3QFGA 4FQLH 4L3EA 1NA8A 4MB5A 4NI3A 3ZTEA 4MVBD 4QHPA 5KUKA 2AITA 2GIXA 5J1AB 2F53B 3QXDA 2YPLB 4CADB 2BVOA 2HJKA 2UY7A 4FNTA 5SWQB 4G83A 1T66C 2VXVH 2ICEA 4KK5D 5DURB 5AYQA 4MNHB 4Q9CA 3N85L 1JAEA 4QTIL 4U7MA 1T04B 3WTTA 1K4DB 3DX4A 3KBFA 4QHKJ 2CM6A 1TQTA 1HIMH 1U8PA 3CLWA 2HKFL 2I85A 4GUQA 2BSDA 4TNVK 4MNQB 5C0GA 4LHUB 1WWBX 5I6PA 3BZEB 2CHWA 4DEPB 4GP8B 2Q8BL 3NSYA 5IJVA 1JVKA 5FGBA 4PHXA 4Y8DC 5AKTA 5AZEL 5FLVA 1CXHA 4P5RA 4X0NA 2N59A 3MSPA 3SKNB 4Q58C 4I18A 1BWMA 2D7MA 5K59E 4RAUA 5A2AA 3CVHL 4NQCA 1CICB 1Y18A 1D5ZB 2WVSA 4KH9A 1IM3A 5I9QB 2CNYA 3JTSB 4LOUD 3C8DA 3WJMB 1E4KA 1WE5A 4GUPB 4F9PA 2WBJA 4K4KA 5KYYB 5JIHA 2DIEA 1JPFB 4PTTA 2P4AB 3IPEA 1TQSA 4L1SA 5LVEA 4PJEA 3K4ZA 5AD0B 2OR8A 2L04A 1W91A 2DQGH 1LE5A 4KY1L 3VD5A 4HEPA 2P44B 3BPNC 1MCSA 3GMMA 2APBA 1LYQA 5L4IA 4K94H 2YZ1A 4MJ6A 4IJTA 4DVBB 2C7UB 3SPHA 1HDMB 3BRFA 4PJAA 1IBYA 1QQDB 3E1ZA 1DYZA 4X4XB 5IEKA 3FU6A 2BSTB 4PJ9B 3B9VA 4Q9RL 4YPGB 1WFMA 4KXCA 2EE6A 2EECA 1J7VR 3QI9C 2UX6A 3MUUA 3N04A 4NYLB 4RIRB 2KZKA 3D0LA 5ELIA 3QXAA 4N0CC 1F02I 1I7TB 4S1RH 4P5KA 4ZOAA 4P5TB 3CC1A 1KLGB 1RPKA 4MBOA 1EAOA 1HSBA 4HS3B 5C86A 3UJJL 4GSDH 3TO4C 2XDHA 3SBPA 2YPVL 5ESQA 2MIZA 2QKIC 4F33B 1AQKH 3QR2A 4YHMH 4JN2A 5LG6A 3QORD 1IIIA 2DQIL 3QUYB 1R3JB 4OCNC 3GKZA 4LLUA 3OKKA 3AZUA 2DI8A 4R97C 3OKNB 2PXYC 4E42B 4L1TA 3DOIA 4QF1A 2XN0A 3MC0A 2QSTA 5DJ8B 1M3IA 4G80A 1QPXA 5E8DL 3ZQWA 2G2RB 4B9JA 3FULA 3RU8H 4AL8C 4D2NA 3FB7B 4PJIB 4XPTH 4WNSA 3A4AA 3DETC 4ABVA 1KENH 2FGZA 1DEDA 3FU0A 3CZFA 2NY5L 3P3YA 3KM1A 3RVVD 4NQDE 4KKAC 2F7RA 5GISL 4G9FA 5T3ZL 4JKLA 3OBAA 1IV8A 2BM3A 2HRPH 1XO8A 3PY9A 4U1MB 3D3VA 5CMAA 1Q94B 3VRIB 2AK4A 5D2NB 4PRBB 1KBKA 1HILA 4UOZA 1FPTL 4EI5B 1P4BL 2OM5A 3CDCA 5D1QA 1NAML 5HHNB 3ULUD 3WNKA 1OB1A 4ZD3H 5CKAA 3CHSA 1MFVA 4HVBA 1HHJA 4TNFA 1YEDB 1RUPL 2J8UE 2IADB 5DRWA 1A5FH 3BDYH 4PJ8A 4LGSB 3CTTA 2J1XA 2VR3A 1Z5HA 3O45A 1G4RA 4PJ7F 4CVWA 4QO1B 4I0PA 3FN9A 5EDXA 3VFRB 1ZAGA 2R4RH 4NZTH 4M7JL 2WZPA 1JNNL 4U1JA 4YDIL 4KHTH 5E6UB 5D8JH 2XN9D 1WQVT 2WY3B 2ZXGA 3Q9PA 4XBPB 3U0TB 2YEQA 1HTYA 5EEWA 3NDZE 3OAUH 4HT1H 4JFTA 5FYJE 4KRMB 3UPCA 1B4RA 1VADB 2R0ZH 4PS4L 1QUPA 1I31A 4OKDA 1EFQA 2MQ0A 2VXQA 3I74A 2FK9A 4PJCF 3GMLB 5JDJA 3QCVL 5GS0L 1JERA 4OQTA 4WO4A 3MRJB 5G55A 5AFAA 2OLDA 2QQKH 1CDYA 1R3KA 4HJIA 3T6ZA 2X2IA 4PMFA 3QWOA 2KH2B 2RFXA 1MG3C 5TDNB 4JFEE 3V6ZA 4BRJA 3HMWH 1SDDB 1RURL 4PREA 3VI3B 4OZGA 3TEUA 2ZIDA 1FFOB 1HE8A 1D5BB 5AALA 3SCMA 5I1AA 3NEEA 1MVFA 3V4UL 5K9OA 1KZYA 1U93A 3B2PA 1SDAB 5I6XC 5CJXC 3KPQB 1AZUA 3CLFH 3VXRE 3NIFB 4RGMC 5GS0D 5BQDA 1PX8A 2WMPA 5LJYH 1G5AA 4OIBA 4YBQC 4BCYA 4DWHA 3K6SA 5D7LD 3DLQR 1UATA 1N3NA 1A7BA 5DEGA 1HCFX 3BYYA 4FLRA 4N0YL 2VDNL 2GY7B 4QHMB 3UBXB 3QI9B 2DICA 3C12A 2Z65C 1IC7H 1FNAA 3O3BA 1IEBA 1GTFA 4HCRL 2JCCB 5BUGA 1X5FA 1HWGB 3EH1A 2AMGA 4X6DA 1WD9A 4YLQT 1QSZA 5DMYA 1C1EL 5I1EL 3G3LA 5F9WC 1MAKA 4WW2B 1CUOA 1OB0A 1XSKA 3GPEA 2EDYA 4L37A 5D93B 3VWJB 2KPWA 4BFFA 3LH2L 4ODUA 5EUKB 4JJ5A 4YGVB 1X9RA 2A74C 3NIDF 4GFTB 4WI3A 1IILE 4BDVB 1RK7A 4YSSA 3BSZA 2BIIA 2IDSA 2C3VA 2WVVA 2AV1B 4QT5A 5KVEE 4ERSH 3US0A 3DX0A 6PCYA 3QEHA 1OHQA 2BVEA 1P1ZB 3TO2A 3D1MC 4UT7L 3PGFL 1A1OA 2IH3B 1A7NL 1N9PA 2CKBH 4Y9EA 2L0DA 3WSQH 1MWOA 4XVSL 2N1TE 3O6KH 4KJQD 3N0AA 1NWOA 4D0DA 2NY3B 2YD6A 2CSPA 1TZIA 4EJ1C 3PWUB 3MRFB 1CVSC 2OTUA 1QUNA 4CBZA 2IGFL 4F7EB 3MJ8B 4G8GA 1MXDA 2NQDA 3KG5A 3U48A 2EKJA 5EO1B 3KPSD 4ENZA 5DCCA 3EFOB 1BQRA 4O00A 4WKXA 4PJBB 4P9HC 1X7QB 5SWSA 1OAQL 1AXTH 1KJVA 3D08A 4J4PD 5HVFB 4C57C 2OXGB 2EVJA 2AZAA 3OKKB 3V5KB 2OL3L 4QF1B 4KUCF 3OX8A 3QT2A 2H8PB 2LAAA 4G8FB 1P7BA 4PJEE 2R2CA 1ZXQA 2IQ9L 4DZ8B 5KAQG 3ML8A 2ED9A 4OLYL 4Z77A 3GSVA 3UYPB 3CDGB 1QWNA 2DS4A 2P8MA 3MRKA 4NHUB 2Y3AA 1ZEAL 2OK0H 3L1OH 1SEQH 1V55B 4AQ8A 1OGAD 5FUZH 2B08A 1PGRB 5J5EA 1Q94A 1Q0XH 3NEXA 1MHPL 3V0HA 1OY3B 4JRLA 4ZUVA 1UUSA 1TSRA 3LNGA 3EFFA 2YEVB 4RMUA 3FRUB 1IEHA 5FECA 4F8NA 4M29A 4XCCH 4G9FB 3B5GA 1RJYA 3VYPA 4A6YH 1QNZH 1KPVA 5H2BB 5C0IB 3LKPB 4IBLT 2K8MA 2DJSA 4A6YA 3IETA 4NCDA 2IBBA 1P6WA 1F4WL 1CO1A 1KB3A 1GYAA 3HNSL 1ZK9A 4J4PC 4PSRA 3ILPA 5DD1L 2ZWSA 4M6OH 3MR9B 1JSYA 3W82A 5H37A 4F8TA 5GSVA 1INQB 3QUML 4QRTA 4OM1L 4AYSA 1P7QD 4OLZH 3HBQA 3FK3A 5CR8A 5SX5H 4TTGA 2BMKB 3CCHA 1JI1A 4PY8I 4KDTC 1MUJB 2IALA 4CW1A 2ICES 1BG9A 1X6LA 2ZYSA 3BZDA 1TPXB 4DT2A 2JI1A 5B21A 5GGUA 1MW2A 2ATKA 4UOW0 3X11A 1OEZW 3DNKA 4F3FB 1ZHNB 4W6XB 2EAEA 2OMXA 2QSQA 1L5GA 4I13B 4L1LA 5FYKU 4A2DA 5C97A 1TTUA 1YNTB 4R0LB 5HVWA 2HH0L 3EZJB 5HDLA 4HSAC 3Q2VA 2C9QA 4BQCA 4KNTA 1YPZA 4ZYKA 4UU9B 4A2GA 4N6RB 3AACA 3QCUL 3X12A 5GRJH 5IBTL 4YAQB 3DIVA 2AJYH 3MJ7A 4HWEH 2HTKD 4AIXA 1CL7I 2Q76A 2R29L 2XVKA 3VGAC 2C3VB 4JRFA 3KW7A 4MGXA 4PVBA 2IH3A 5ALCH 4Y0GA 2IQ9H 3OR6B 3BPCB 3RJDA 1F6LL 3BJ91 4G6KL 4JB9L 3TJEL 2YAMA 2WWKT 4MCMA 1ADWA 3QIWD 3WO4C 2F74A 3B9KA 4JQVC 4ZPTB 1Q72H 1PW3A 1B0GA 2A6JA 4L8DA 1G0DA 4Y4FC 3VU1A 3CX5J 4GQPH 2R29H 4H1LH 2R7EB 1IGTB 4RA0C 3HG1B 4WDIB 4DEPC 3DTXB 1BCIA 1FZKA 5HHOE 3O3BB 5GS2D 3QIWA 4JGNA 4X5LA 1U30A 1FV1A 4HX1B 3LXUX 3VB9A 4DP5X 1CFTA 2QVFB 4I3GA 2P47B 1RZ7H 3QUMA 5TDOA 5FECB 2FO8A 3UAEA 1TXKA 1KN4L 4K55A 2ZUWA 1T1ZA 4V1DE 5DMJB 1P9MA 1SJXA 4UT9L 4PJ7A 3O9WB 4FQ2L 2CA4A 1YEIL 2FEDC 4LSPL 3ZTJH 4ELMA 4YHNB 3EYFA 1J0IA 1SXSA 4OAWA 2RHEA 3TBVA 3WGUB 4N1EA 25C8L 3UJIL 4DPCX 5SX5K 4NP4L 3TA4D 3CJJA 2ZX9A 1LO2L 3BVUA 3GFUA 3R0NA 1MJUH 5EO9B 2W8CA 1G7IB 3RY4A 3UGEA 1UD8A 3SQRA 4PH8A 4IKLA 3IK2A 1A7PH 4C55A 3VGGA 1QYGH 3AGVA 2RTTA 1OHZA 4FNQA 2AP2A 1F58H 4D9RD 5FCUL 2QGDA 5H35A 1CL7H 2VMJA 3QPXL 3WHXA 3PDGA 1RQ5A 2DQEH 4HJSA 4NS0A 3HNSH 2BRRH 1VCAA 5HYSG 4WSKA 2CRYA 3S96A 3WDIA 4CN1A 3WIFA 2G0LA 2MHAA 4DPRA 1BJ8A 1H5BB 1LGVA 3KDPB 3VFOA 3IJYA 5C09A 3T3PE 4PJBA 3D06A 2R56L 3D05A 5FKAA 2VDMB 3BWUF 5C0JA 4I4WB 3ZRCC 3P4OB 5I76A 1ZY9A 1RPQA 3BAJA 3ZE2E 1NJ9A 2DAVA 3FCBA 3RGBA 3VRJB 4GRMA 4N2LA 2HJFB 2YD8A 3L7FB 4MHHI 3TTYA 2EIBA 1MHPH 2QBWA 3NABL 3GK8L 1GGUA 2WKLA 3OXSB 4B0MM 2LFGA 1AG6A 1SVCP 4FEMA 1FDLL 3QORC 5FUZL 3U2SA 4I48A 4HCRA 4M1GL 4AYID 3WXVH 5E2WL 3VACA 2YEZA 1AR2A 3ZL4H 3TU6A 4XE0A 1KJ3L 3J27A 4DERA 5GISH 5LGKA 4AVIA 3KPLB 3GXFA 5HPMB 4MRBA 1BZQK 4PIBA 1F5WA 1KTLB 1P84K 1EZSA 1TOXA 3O4LD 4ALAL 5CR1A 2OL3H 1CGWA 1H8LA 4ZW6A 3TA3A 3LZLA 5I6LA 5HYSA 4QXUH 2ROYA 3IBOA 3PAUA 2P9RA 4TNWK 3DARA 4MVBC 3PGDA 1IGTA 2P48B 1KCVH 1MJ7L 1KELL 3O2VL 4U6XB 3PAYA 3IWVA 3DWTA 3QJRB 2BS71 4GKSB 4CKVX 2V2XB 1I9RL 1SEBB 1IGYB 2GHWB 1L9OA 2JSFA 1VEPA 1Y1DA 3K80A 2VAAB 3VXTA 5GJSH 3ZE2F 2UWEB 4L4VB 2Q3AA 2YGVA 5GGVY 1YUKB 3OR6A 4PJEF 4OJCA 4UQDA 1EJOL 1PL3A 3FSOA 4LOEA 4J23A 4GW1B 1L9NA 4Z3HA 1A6TA 1T7XA 2MNUA 1F90L 2B59B 4ZPVB 3SDAC 1EDYA 1N59B 4FQJL 4G70B 4QCIA 3T6WA 1JXJA 3NIDE 3AG1B 2DMHA 4M5ZL 3DX8B 1WC7B 2VH5L 4JPKL 3BCFA 2AJ3A 5AL8A 5D7KE 1H6TA 4PCKA 2G5UA 4TNVF 5I1IH 3IGAB 4M7LH 5JW5B 4H1LB 4PAZA 3QIWB 1KBGH 1MRDL 1HH6B 4NKMB 3UX9B 2C7UA 1QBMH 4HU8A 3RWGA 2P5WB 1A6PA 5T3XL 3GEFA 2IAND 3TWCH 4Y5YB 2H32H 1R17A 4Z7UF 1MEXH 1LE5B 4ISVA 3VXUE 1QEXA 3HJ0A 2CNZA 3LKSB 3WMPA 1YHPA 4LASL 4YPJA 4ATWA 3EO9L 4K3DH 3N41F 1Z3RA 2EDDA 1GYCA 1M1XB 1DQLH 2F74B 3B9KB 3BQVA 3DI3B 4K3JH 4OIIH 5CEZE 4HD5A 2UWEE 1NGYA 5FHAH 4DO6A 5E00A 3CLFL 4LIQL 4YSAA 3SPCA 1A4KA 3L7EB 1OP5H 3VXSE 1C16B 1AIFA 4PU2A 3T77A 4X80L 5BZWB 4IJ3C 1H3WM 1FGVH 2TRHA 4L1DA 4FABL 4HBQA 5I66B 3PABA 4U1SB 1MLCB 1EZLA 5BZDA 3D25A 4RSVA 3O4OC 5A16B 2Z8VC 2BXZA 3NCYP 2P5WA 1KY7A 2Y5EA 1IC4L 3NZUA 1R1CA 3BSZH 3RVVC 5CWSA 4WU5A 1JUFB 1XD0A 3O6KL 5T5FA 4XNZC 2VXQH 1KTBA 1BLNB 5CCKL 1CYGA 2BSEA 4RGNE 1A66A 5F7DA 2FEEI 1U8PB 5DJYB 2P3YA 3LS5H 3T2NH 5ENWB 3CZFB 2EUVA 4Y1AD 1ZT1B 1WTLA 3PHOB 4MA3A 1U8OA 1S7UB 5I1CL 5FWQA 3QORB 4NIYE 5HGGS 3PAVA 5F7KC 2V5YA 3MCLL 4K7PX 2BZDA 3PNWB 3MI6A 1L6XA 3QJTB 4W9IC 3SGKA 3SKMB 4RWHA 1ZSDB 3VG0H 3BLBA 4NBZB 4FFZA 3Q1SH 4Q8BA 3ZK0A 2NZ9D 2F61A 3RWIB 3ULSA 5KVFH 4WV1A 1KCWA 3IDJB 1SEBA 1BFVH 2RGSA 2B4CH 1UFUA 4KTDL 2UZYB 1MW0A 2B3RA 5F7BA 3KYNA 4GKZB 4KK6D 4H1LG 4ZW5A 4H8WL 3PQYD 1TZAA 2I25N 1TQBB 5JHMA 2IANB 4HK0A 1E28B 3UMNA 2X0UA 2UZIL 1W0YT 1MCOH 4R7DB 1NIBA 1BVKA 1T7VA 3BZ4A 2MJWA 4UT6L 5EEZA 1QUNB 2EDFA 3I50L 1KPUA 1AXSB 4JR9L 3F8UB 4QRRE 5EN3A 4K3EL 3HKZA 2CD0A 3KPLA 5HPMA 1S5HB 3HE7C 2JQZA 3PHAA 3D7PA 5IBUB 1FZMA 4J8RA 1MFMA 3SGDH 3D52A 4UQ9A 2XHNA 1BBJB 4B3EA 1DJIA 3AQDA 1OARH 4FZ8H 5J06A 1NCDH 5E8NA 3WTSA 4F9PC 4G7VH 2OMWA 4OI8A 4UF7C 1IAKB 4WW2A 1Z32X 2VITA 3SO3C 5F3HA 1NUGA 3FKUS 4HWBL 4N4YB 5C0JB 2F9BT 4I77H 1E40A 1P5UA 4PLJD 4A37A 1SJMA 2CU9A 2BLFA 3OKMB 2CXGA 3EO0A 4PJBE 5DEJA 4EN3B 5C0CD 2DD8H 2TSBA 2C1OB 3BUTA 5DZ9A 4RQQB 1EBPA 4RLDA 5IVZB 4H44C 3L5XH 4PJCA 3W0WB 3KJ6H 2E4TA 2OTWA 2QGBA 4AKOA 3VXQB 1RULL 1YN6A 1WFJA 5C70A 2X4UA 4ABQA 3V5DB 1FLRL 4MX7B 1U8LB 4G8GB 4AMKH 2Y36L 2AQPA 5IT2H 2R59A 1MAMH 3L3OC 1U8HA 2A6KB 2H1PH 2V5MA 1TCMA 1YYLL 3ETBJ 2JKWA 1NLBL 1ZLEA 3BP4A 4L8SA 1J0KA 2WUBH 4WI0B 4ZMTA 2YN5A 1ZMYA 4CU7A 3O6LH 4FHJA 4BDVA 4GRLD 5B7FA 3ULVL 1QATA 1R3KB 2FRGP 4OI7A 1KJ2B 3T3MF 1SHXA 2WVVB 2WWKO 1D7DA 5DVOA 2F54D 1HXMB 2MQGA 3CH8A 2E46A 5D7LE 4GUOA 3W57A 4H8WH 3UTSE 5TK2A 4B9KC 3H2QA 1EAJA 5EUKA 1O5DT 3SGDI 3ARBB 1NUFA 1EEZA 4QOKA 4ZW3A 2Q7YB 3ARDA 2AERT 4XBPA 3RVUC 4WUUE 2XWTA 1G94A 2H5UA 2IPTH 3VXPB 1E6OH 3TXAA 3PGCB 3IDYC 5IROD 3MREA 1X5KA 1ZWIA 1WUNT 1H3TA 2O6EA 1A14H 5A3IC 4M8UA 1LO4H 1ZTXL 3MGOB 2HVKA 3O2DL 1OPGH 4O58L 3VWJD 2AJSH 4KRPC 3NN8B 1C5DA 2Q8BH 2X4SA 3CU1A 1MHHA 4JRYD 5IB2A 3KPQA 4P23A 2WBJC 4HC1L 3V10A 2N01B 3RL2B 3STZA 1YY8B 4NJ9H 1KJ2A 4PGCA 2WYIA 4AH2A 3SY0A 3Q2CA 4GUCA 2EVGA 4ZFFB 2B0SH 4JFWA 3SCMB 5I1AB 1UXLA 1HSAB 1EK3A 5E2TL 5EBWB 4X8JA 1REIA 1QLRB 3QG7H 5CCKH 2W95A 1O7DE 3ULUL 1O6TA 4J6IA 4XMWA 3FU5A 2ZP9A 2G75B 1YMMA 2DTML 2IVFC 3NH7H 2NY2D 1U95B 5KSAC 3UGUA 4K15A 3MOAH 1CGSH 4K07A 4LVOB 5KBPA 2EC9U 5FM5M 4QPEA 4WY7H 2VMFA 1E5AA 5KVGL 3D2UD 1TMQA 2OA9A 4M6ML 4UYQA 4G82A 3F7RA 3EDJA 4IOSA 1NOLA 5I1GL 4X6DE 5KJRL 1YO4A 2F5AH 3RTQA 4YR6B 3Q3GA 3K3QA 3O3AA 4XXCC 1S3KL 4NAMA 1KZQA 2W9DL 5HXMA 4MMYA 3CK0L 3N9GH 4P46B 3CSFA 2CXKA 4NAJA 1FFRA 4PBVC 4OF6A 3L6FB 5HHPB 5LQBH 1EUUA 5CGMA 5KSAB 4A7QA 3NK4A 5GGTL 2GJRA 4YK4B 1SUHA 3NPZB 3PL6B 4UIMB 1WH0A 2AEQL 4HQQL 4JPWL 2WBXA 2X7LB 3N6YA 4GW5B 2PYFB 1U4EA 3OGOE 4MJ2A 4TPRH 3GI8L 4ZOEA 1M42A 2HKAA 1QAWA 1T4KA 2XZQH 3VWKD 1XV8A 1LNUA 2J3SA 2DM2A 2ED6A 4HK0B 4I7ZC 1QZNA 1JCKA 1GCFA 2ZF9A 1TJHH 2WQUA 1G9NL 5AOIA 4HV8B 1MFCH 1T80A 3R7QA 3HS8A 4R7DA 2PKDA 1F90H 2BNQD 2J20A 3MRHB 2IBZY 4ZX5A 1BLIA 2OMVA 4P2QA 1B0GB 4L8DB 3IDXH 3EGDB 5IP4A 3HLAA 4JO5A 4AGOA 3IDNA 1BFOA 4IRJD 4PJAE 4XNYH 4NM4H 3X1FA 5BQ7B 1J10A 1NGQL 2AQRA 3FOLB 5AW9B 3EO1A 4ZFGL 2HT4D 3RZWA 4WI4A 5J12B 4LIQH 1BYOA 5CBEA 1MJ7H 1VZGA 2JB6A 3E6FB 3E7JA 1I7UA 4LLUB 2IBZX 3E6HA 3MUHL 1IL1B 1BGXH 2H0JA 2W88A 4IRJA 3ES6B 2WYZA 3SJVE 2JCCE 2O26U 1LEIB 4K3DL 4K8RC 5E6IA 3HE7B 1IM9A 5I15L 4UOW1 2DYSB 4KQ3H 3ULUF 2AF2A 4HIEA 2BDNL 1ZS8A 4IOIA 4KPHL 3L3KB 4NBXB 2G2PA 3MTRA 1WUZA 4R7LA 4Y16D 5GHWL 3HC0A 3ZTNH 3ZKQD 4I9WE 4AEIL 1G6VK 2WK2A 4X4XA 5IEKB 1DANT 3IMTA 4LHUA 5JHDD 2JXMB 1AE6H 2WLHA 4ZMOA 3MO1A 1AXIB 5CLWA 5D1ZI 1OOAA 1HYSC 5GXBB 1A9VA 1E2ZA 3P4NA 3D85B 1HKLH 3F58L 3MV7E 2RAMA 2Z4TA 5EZJA 1B4LA 2Q9OA 2ZF8A 2BERA 4WGWB 1KYAA 4B9IA 3ALXA 3GK8H 4Z7NF 4MMZC 5D2LE 5IV2B 4UQ3B 3BVTA 4WTWA 3ROLB 3W9EA 1Q9KA 2J6EA 5IESL 2QKSA 3FPYA 1OSZB 4FQJH 1CIUA 2OJZH 2EINB 2Z92B 3U7WL 4JDEB 2HN7A 4KZ0A 4UIKL 4ZQKA 5GSVB 3R0MA 3V8CA 3HMXA 4GUPA 5FYLE 5KYYA 1RY7B 3Q0HA 1U6AH 2OZ4H 3P77A 1AGBA 4OCWH 4XX5A 4X7SH 4DGYH 1MFDH 2K0RA 5DWPA 3FCSA 1OP3K 1NL0L 1XGZA 1KIQA 5K9KB 1FL6B 2WVTA 5KVGH 4XGZB 3IWUA 4U1IB 5B3SB 4O5LL 43C9A 1ASOA 1LO5B 3DMMA 4U2YA 2VLRA 1BZEA 3AXIA 4CGTA 3LRLA 5BMFH 3QIUC 3RTQB 2YOAA 4AC4A 1OAKL 1LO2H 4U1KA 5I26A 2OS7A 4PYHA 3K72A 1HHIA 4N1HB 4F58H 1Z66A 3HB3C 1JN6B 1MI5D 4LF3A 3DURA 4QHLB 1TJGH 3WN5C 4LLDB 2RR3A 4P4KD 3ABLB 5I5JA 4C47A 4OLVH 5L9DH 4ES9A 1AGEA 3G5YA 5D1ZA 4X5WB 4OCRL 5LUMA 1KJ3H 1OZTG 2G75A 3LHAA 3DDGA 3V6ZB 2DIAA 4PJXB 1CPUA 1RZ7L 4MTMA 2GHZA 5ACZA 2WQWA 1QLRA 5AKSA 5JLZB 4X8JB 1J5OL 2EIDA 2WXOA 3OPZH 1DZ0A 2VERA 5D1ZD 3U6XA 5EF3A 3D12B 4MA8L 5ICXA 4LLVB 1MHCA 1S7QA 4FXKA 4PG2C 3S88L 1JRHH 2B3IA 1N8ZB 1QRNA 4Z78B 5DJ6B 5DUJA 3AW5A 4BM7A 5KG9A 3EJPA 5DJ2B 4LRNH 1X5JA 2NXYD 2FWUA 2EACA 1KACB 2IPKB 4RNRB 2H45A 4YJZL 5JPNB 3BAYA 4HH9B 4CGUB 5CUSL 1CXLA 2FHFA 2FX7H 5EOTA 4BKLA 3F58H 1QRND 2LR4A 1PZDA 3GZPA 1PZCA 2XOTA 4NC2B 3JT2A 5DQ9A 1K5NB 1IRAY 2X89D 3O0LA 5IW1B 3P4MA 2EDXA 3P0GB 4MD0B 3NIGE 1CD9B 2JK5A 1D5MA 1FNGB 1MF2L 4IU2B 2DM7A 1OQXA 2Y7NA 3MOBH 3QCUH 1NFIB 4IMLA 1YEDA 1DJHA 4Q74A 3AS1A 1D7CA 3I3DA 2A6IB 3Q6GL 4PHZA 2X6VA 1A22B 1OWWA 3QCTL 4MNGE 3X13B 1OB1B 1TZGL 4UQIM 1PZ5A 3IN0A 2WXRA 1FNSL 4MMZA 4BFOA 2I27N 5KYUA 4JHAL 4HF5H 5I2IB 3G9VA 4FQ2H 2L8AA 4WNQA 1OCZB 4DF9A 1MVUB 5A2JH 3MROA 5GGVH 1XTLA 3F01A 1ETB1 4RDBA 5ESAA 4OGXH 1DSWA 4YSDA 1JF1B 5CEZH 3WEXB 4PY8J 5T1MB 1YLBB 4MFHA 3WEMA 4IRSC 1TJIL 4APXA 4F7KA 1B0RA 2VZOA 5EU6E 1GW6A 4QHMA 2VDQL 4WO4C 2HG5A 5TH2B 2W0FA 1QFUH 2O93L 2FIRT 1PMYA 4POZD 3RYMA 4LCUA 4OZ4A 5I82A 2HX8A 1YN7B 2PCXA 3G08B 1FG2B 4Z5RB 4Z7QB 7PAZA 5D1XC 5HHXH 5ICYB 5JOPE 1B2WH 2VUKA 3V79C 5JW4M 4LCYA 1OAYL 5JHDB 2AFNA 2P8PB 1TSHA 4Z3GA 1TJHL 1JI2A 5ITFA 5K9OB 1ETZB 5AVSB 3VSUA 1I8MA 3WJJA 1JGEB 2WQXA 4TNEA 4PB9H 4X6CB 4GT7A 1A3LH 1FORL 4Q6IC 3VAEA 4ODSL 1JD7A 5DK2A 3UTPD 4R8WH 2WJ5A 3JTBA 3NJXA 2N0KA 2ENSA 2GC4C 4KGLA 1IAMA 4PGEB 4WO0A 1JD9A 3F6JA 4ZXBC 4L1BA 2VZUA 3KXFE 5FGSA 2HXAA 1A64A 1I3RB 5BOZG 3T9WA 1K9TA 3I6GA 3KVQA 3CN0A 1T5WB 3OMNB 4IRSA 3SPGA 4YE0A 1RFDL 2KS0A 3PWPB 3ISYA 4PRPD 1HHIB 3N5AA 1Z5LB 4FTVA 1DVUA 4TN9A 4AUJA 4L9LB 4UBDD 2EO9A 4BA8A 1L0XA 4ZMZA 4GLRI 4FNSA 3DUUA 2I9TB 3W0WE 1UM6L 4A2LA 4AMWA 3QEUA 4JKPH 1WZLA 1RHFA 1ORQB 1KIQB 2DMKA 2IGLA 2ZCKH 3BH8B 1Z9SA 4S2SA 4BWUA 1M1SA 2JV6A 5C7XL 3HG3A 2WXNA 3Q8FA 4NO5B 1V8HA 4PJDE 5IVXF 3QUZC 4G11A 4KC3B 3IJEA 1M7DA 2HRGA 3DKHA 2OMYB 4MKTA 3A0OA 4ORGB 4RFNC 5EIQA 1YEJL 3EF4A 4PR5B 5CN2A 3ATFA 5K69A 4JY6B 1QFHA 1X5GA 4XPFL 4CMMB 1I8AA 1OO2A 2PTVA 3IGUA 3C5ZD 5LDSA 1UG9A 2B9BA 4IGBA 2BNUB 4AYMC 1Q9LB 2R2HB 1NGXA 1VZHA 4FFTA 2ZJSH 2JTYA 5F89B 5I8CA 3OLIA 4RZCA 2MFNA 4POUB 3UJTL 2E8YA 4AYFA 2XA3A 2OMXB 4F2FA 1Y0LA 3FDWA 2DTSA 4ODWA 2I7OA 1C12A 4IGBD 1F4YL 2ITFA 3VXRB 5EORL 3TCXA 2UZXA 4G6ML 3IDIA 1BLNA 4OD2A 2BOCB 5HJGA 3SBWC 3E80A 3CFCH 4PRAB 3SSGA 4WI2A 3PP4L 5ESVA 3M1CA 4XB8A 1CDHA 4OLYH 3TYGL 3FQ2A 1BFSA 4F7PA 3AITA 5KN5A 4XGZA 3ARUA 1IM9B 3DJRA 3DXAA 1N6QL 4N0UB 3T77B 1MKFA 2GJ6D 3EBHA 4ES8A 4ZW8A 4B97A 4NHCL 4WJKB 2DIBA 1A1MA 1NCNA 3OR7B 1IKOP 3KWXA 4KX7A 4CL7A 3FQNB 2RA1A 4HZLA 4JUTA 4LVNB 2XBTA 3EOAA 4KJWC 5D72H 5IHUL 1W15A 3QA3B 5FUOL 4XWGH 5JR1L 5I1IL 1QBLL 4N22A 3I2CH 1S5IL 4Y2DC 1MCCA 4UAHA 1IBGH 4FQ1H 3W5NA 4HIQA 3MA7A 1PSKH 2QGEA 4P4RA 5KAQF 4I18C 1L7TH 3NCCB 4Y4HC 5CFAA 5IMLA 1E28A 3LZQA 4F15C 4OIAA 2NNXA 4D9QE 2QSCL 1QOKA 5IQNA 1OK8A 4YE4L 1C5BL 3X3GL 5A7EA 3HMXL 5ID1B 3AY2A 3OMIB 1HL4A 1NCOA 4WU7A 4PBDA 4YFLF 2YPLD 3MRKB 4NHUA 3PJNA 3NJGA 3QBTB 2KZWA 4EDWL 2XV6B 2Q2LA 1TZHA 4ZSOE 5DC9B 5IOKA 1OTSD 3O6MH 1JFQL 3MRRB 3QXTA 2BFVH 3GPSA 1JWSB 3UROR 4K23H 1CFNA 4LKCB 1X5LA 2OXGA 3GHBL 4I18B 3JT0A 1RZJL 3U0PB 1IFRA 4ZAKB 4JHWH 5IOPB 5IVNA 3FFCB 1IB5A 2BP8B 4GBXC 4MRCA 5FGCE 3VXRA 4MQSB 3HVNA 1X5HA 3E2HB 4JKWA 4PRIA 1WV7T 5ISZA 5KVMC 1E27B 1C5BH 2AK4D 5DUPL 4UQBA 3ARBC 4LLMA 5EZLA 5J4MA 3AT9A 4QY8B 3LY6A 1VKXB 1RUKL 1OAZH 4O2FB 4PTUB 2CHNA 3SPJA 1CT8A 4GAFB 3I02B 5AYUL 1FG9C 3ZYOA 4HBCL 5DJCB 1I8IA 4E9VA 3MV8E 4LLYA 2OJ1A 4PJXE 5LNDA 4RFNB 4BE5A 5CEYB 2I32A 2BWDA 1XBDA 2YPKB 3WLWC 1XGUA 4G3YH 1LO0H 5B8CC 2B39A 4ZFFA 3GXUB 4XNMA 4PS3A 3DX6A 3TO4A 4BYHA 2X28A 4OZGE 1B4JL 1UT1A 4HLZH 4EIBA 5JHLL 3MRMA 1ULVA 2ZWKA 5I1HH 4XAWH 2J6EH 3TV3H 1WAAA 4OD3L 2SEBB 1Z3GH 2OYPA 3C60B 2QQQA 1XBRA 4PRDA 3INOA 2PR4L 2HJFA 5I1DA 2G3ZA 3QEUB 1FH2A 4P2OA 4M5TA 1H9DA 4PJ5E 3QQXA 3V0VB 3F6IA 4AQEA 1E9PA 4WO4D 1RUMH 3LNIA 2Q86B 1KEGH 4QNPF 2JF1A 5DJAA 4AEHL 2XWTB 2XG4B 5MENA 2Q2EB 3V2AR 25C8H 4I88A 2Y07L 3FZUC 3UJIH 1CTMA 4FQHB 4J27A 2ORBH 4GS7B 3SGEH 5I6MA 3S5ZA 3W37A 1ICTA 4U3SB 1FSKC 3SCMD 3V4PL 2OR9L 4KO5A 2VISB 1EHKB 1S7TA 3CBRA 1EANA 3ZKXB 4Y5XC 3QUYD 2CDGA 3LDBC 3GTNA 1QLEL 3KPMB 1OCOB 1Y6MR 4X0KB 1B3IA 1NPJA 3H2WA 1J12A 3MNZB 1W8OA 1CD1A 4KKPA 2G3XA 4NN5B 5D7LA 4ZS6C 3I6KB 5DJXB 4JE0A 4FJ6A 1O75A 4YHIA 4S0TD 2VDNB 1EUTA 3BP4B 1IBGL 4OZFB 2J2ZB 5DMGC 5KVEL 1GJIA 3MX0A 3S3CB 3H9YA 2VJ0A 3WNJA 3NJIA 5KSBE 4N1CA 1RZQA 3HRZC 3RL2A 5T3ZH 1TZOA 1UQSB 3D2UB 4ZBJA 5GZOC 1U3HA 4YDZA 4PEEA 3VMNA 4IBSA 5B38G 5MENB 3D69B 5T3ZD 4Y19D 2HTLD 2BP8A 1RHHB 4NZFA 3G04B 2JTDA 5CINH 3Q8CA 3KHQA 2NXZD 1VSCA 3QXUA 3S37L 1A9EB 1OE2A 4DESA 3AMKA 1F13A 3H0TB 3DRTA 1CFNB 2VZTA 4YHZH 1RJCA 2O1AA 4ALAC 3ZDXB 4Y4HD 2WW8A 3PJSA 1G4MA 4KTGA 4PRHB 3ZDWA 1E8WA 3G6AA 4O51A 4R4BA 3A67L 4F7TA 2WQSA 3QARA 3NRFA 4JM2B 1CZ8H 3TESA 3AS3A 1JNJA 1WEJL 1V3JA 2AC0A 1I8LC 2XBDA 4KI5E 1G1CA 1H15A 5D1QB 4YNYA 5HHNA 4JANB 1XCTB 2YMXH 1QABA 2FEEL 2VMCA 2P8LB 1BVLA 4I3RL 3D3VB 1AGFB 3VRIA 1S9YB 4RISL 3RWHA 4HLZG 4LLMB 2AJVL 3VXSA 2VDKH 2VXVL 3HFFA 5LN4A 5B38A 4O2FA 3MRPB 2D9CA 4E41A 1XGYL 1B2WL 1B6DA 3BWUC 4J28A 3IKKA 4KVPA 3MACH 4KJYB 2X5PA 2Z0UA 4KKZA 3QQ4B 4WFHE 1A3RL 3L2LA 2VW7A 4O02L 3S8WA 1LK2A 5HGHB 1CS6A 3BVDB 4KXDA 2IPKA 1I1AA 4M6OL 1FGNH 4QXUL 2ZCKL 3QW9A 2LFEA 1TJIH 3P4LA 2OMTB 3RPKA 3BUPA 1PFOA 4XMLH 4MJIA 3C08L 3EH4B 4XPGL 3BP7A 4Y4KC 1T2JA 2XX1A 5IZ7A 2K7QA 3FCUB 3CQPA 3ZL1A 1GTNA 3W1ZA 3R18A 5IBLC 4I89A 4YDKL 5BQ7A 4PVMA 4B3VA 2GUOB 3IRZA 4P46D 5FUCE 3DSNB 3VGHA 4JHAH 4UOJA 1F18A 2H32B 3OQ3B 1ZT1A 2CO1A 2E7LC 3EYUL 4DKDC 3OG6B 2UZXB 5DD0H 1K6QL 2NNCA 2P5EA 3BE1H 3BWZA 4KHXL 5BUPA 3RWDA 5FK9A 2WZ0A 4HV8A 1V27A 2X1OA 1A02N 2GITB 4OZFG 4HC1A 1HJCA 5BRZD 5F88A 2WZ6A 4OU3A 2IJ0C 3FNKA 4AJ0A 2WN2A 3BZ5A 2RALA 3R7RA 2B2XH 1EX0A 1Z1WA 2AS5M 4ZTOH 3K1DA 4EQ3A 4Q2ZB 4U1IA 4FFZL 1XGQA 1GS7A 1NBVH 5FB8A 4ZFZB 2VLRB 1G7MA 3AY4A 3MGAA 1E4KC 3QDJA 1XB3A 2BJMH 4NN6C 4BCZA 3GSUB 1PF3A 1MLCA 2A9MH 4J8QA 2XZAH 3GJFK 4JVWA 4TM9A 3QPXH 1LWHA 3OR7A 4AT6A 3ZBMA 4AIOA 5E00B 1T6VN 1NGYB 2QR0A 3S3DB 4BIKA 3U6RB 5E2VH 1C16A 4MAYD 4Q0XL 4NOFA 5IY5B 2KL6A 4MQTB 5DHVH 1I1CA 1JHTB 5E99L 4NQEB 4FYSA 2BC4A 5GJTL 2NZ1A 4DGIL 4Y4FD 2VLKD 3GRWH 4BZ1H 3ROLA 4ZI8A 1PZBA 1SXAA 3WXWH 3WMQA 4MZ2A 1ETA1 1HFUA 2Y1AA 3PHOA 1Y6KR 4MA3B 2DQHH 5L9DL 4IHOA 4LSSL 2MCPH 5DS8A 1EHAA 2CGRH 3B7UX 3PWVB 4EI6A 4F93B 3T0ED 4G7YH 3T0WA 3P2BA 5E0QA 4F58L 3QNZB 3ALWA 1HI6B