5G4OA

Crystal structure of the p53 cancer mutant y220c in complex with a trifluorinated derivative of the small molecule stabilizer phikan083
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
196
structure length
196
Chain Sequence
SVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKLFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERCSDSDGLAPPQHLIRVEGNLRAEYLDDRNTFRHSVVVPCEPPEVGSDCTTIHYNYMCYSSCMGGMNRRPILTIITLEDSSGNLLGRDSFEVRVCACPGRDRRTEEENLRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CELLULAR TUMOR ANTIGEN P53
publication title Harnessing Fluorine-Sulfur Contacts and Multipolar Interactions for the Design of P53 Mutant Y220C Rescue Drugs.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 48
structure length 196
sequence length 196
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00870 P53 P53 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 5g4oA00
3QYMA 4IBUA 2X0WA 4GUQA 3WU1A 4MZIA 4KVPA 4IBWA 3WTUA 3WTYA 4AGNA 4IBSA 3KMDA 1GZHA 3US1A 1GZHC 2H1LM 1T4WA 2IOOA 4LO9A 3WTSA 2BIPA 3D05A 1YCSA 1IO4C 2AC0A 4L18A 5ECGA 4AGMA 4XR8C 2YBGA 2X0UA 3WTVA 4GUOA 4L0ZA 3D08A 1CO1A 3WTWA 5A7BA 3EXJA 2ATAA 5G4MA 1EAOA 4IJTA 3VD0A 2PCXA 3Q01A 4AGLA 4AGOA 4IBTA 2BINA 2J1WA 1HJBC 4HJEA 3Q06A 5ABAA 4G82A 1H9DA 2BIQA 4AGQA 3ZMEA 2P52A 4QO1B 5LGYA 2AHIA 2J1XA 2RMNA 5G4NA 3EXLA 5AOMA 2WGXA 3WTXA 3VD1A 3WTTA 3US0A 3D06A 3D09A 2GEQA 2IOMA 2J6WA 5AB9A 2FEJA 2ADYA 1LJMA 5G4OA 4IBZA 3VD2A 2X0VA 2XWCA 3D0AA 4A63A 1TUPA 2J1ZA 3KZ8A 2BIMA 1UOLA 4MZRA 3TS8A 4IBQA 4IBVA 2XWRA 2J1YA 1EAQA 5LAPA 2J20A 5AOKA 3D07A 4IBYA 5AOIA 5AOJA 5BUAA 4LOEA 4LOFA 3Q05A 2OCJA 1E50A 1EANA 4L0YA 4G83A 2VUKA 1CMOA 1TSRA 2J21A 5AOLA 1KZYA 4AGPA 3IGKA 2IOIA 2BIOA 1HU8A 2MEJB 1HJCA 5KBDA 3IGLA 3QYNA
chains in the Genus database with same CATH superfamily
4HIQA 1FZMA 2W92A 1SMAA 1PG7X 3ECBA 3OZ9H 3QS3A 3VYOA 2E7MA 4KJWC 4CC4C 3C6SB 2IGFH 2KC0A 2LU3A 1TVHB 1OTUD 1BFVL 4KKRA 3L7EB 3KPNB 5C0AB 1FYTA 4XP1L 2CLVA 5KSAA 5L2KA 3GMNA 4JPKL 1A1MB 4RMRA 4XZUA 4OVVA 3ZRCC 4RBPK 4GG8A 3T8VA 2P3YA 4DUWA 5IHZB 1GYVA 4FG6D 5EIIA 1I7TB 2BVQB 3V5KA 2OMNA 1QFOA 3WXVH 4ZUUA 2EJ1A 1G1KA 4IM8A 3UPCA 5E2UL 2X4UA 1KYDA 4YVUA 3GSQA 1IZKA 1RZQA 3PWLB 1A14H 1DQIA 4LCCC 3TBVB 1JXFA 3WLBB 3IJSA 2ZUWA 2AXWA 1XH1A 4PV9B 3B9AA 4AVIA 4RQQA 2N01B 4DGYL 5AYUL 4GRWF 1JNHB 3FQNB 3BFQG 1CLZH 4ODHH 3WL9A 3TEZA 8PAZA 3C5SB 3N50A 3K4DA 1SHWA 3KBFA 1NTDA 2VXQH 1OF2B 3CDZA 4PJBE 1WFMA 4MJ5B 3U9UB 5F7YC 2RB8A 3CSBA 4PJCE 3T2LA 43CAA 1MWOA 3GBNH 1OV8A 4ERSH 1A6VH 3FB8A 3CXFA 3QJZA 5AB9A 5CKAA 5HY9B 5I24A 1GS6X 2A6KB 1CFQA 1P4LA 2WXMA 3NRPA 4PJXF 3MRIB 4BIKA 1G7IB 1U8OB 4DP0X 1EDHA 4FTVA 4L48A 4QRBA 3T09A 5I5IA 5JPMB 1MHHA 2WINA 3STLA 4A39A 4PSRA 4A2LA 5FR3A 2EXWD 1QBAA 3MUZ1 5KWYC 2FRGP 4IOSA 3EYOB 2FWUA 3U9PL 4DKTA 1B9ZA 2LR4A 5D1QA 4IBQA 3DI3B 1S5IL 5TE7L 5C09D 3Q6GH 4M1GH 1OAKH 4LLQB 1F8TH 2WLZA 4X4YA 1BZ9A 4IRSD 4U6HA 3L16A 3V0JA 4Z78B 2B16A 3RGVD 1P2CA 3ARBA 4N85A 4NC1C 4M61B 3HI6L 1FYTB 3IFLH 1R3IH 4AYMC 4ZMOA 2NMSA 3RVXC 3VWJA 5KSAB 2NNAA 2ZKMX 2A6IA 3B7TA 4KX8A 5H35B 3UERA 4XZUB 2VAAA 5T8IA 3MCLL 3ES6A 5EOQL 3JUYA 5I6NA 4JE0A 1ED3B 3NBNA 4K7PY 2FATL 3SE8H 4K9EC 2QELA 2F68X 3H7BA 4V1DB 3DXAA 1H3VA 3AC0A 1G9NH 4N28A 4QHLA 3GSQB 4B0MM 4XPGL 4H25A 1DVQA 1T04B 3EH2A 3IJSB 1T6WA 4Z3TA 2H2SC 4KZ0A 4LPXA 4O58H 1OGAA 2CO6A 3MBWA 1E30A 1ZT7A 3AB0C 3M8OH 3RHWF 4WHCA 3TBTA 2ADJA 3WL9B 3QDHA 4HVBA 3NIGB 4B9YA 1WWWX 3VJ6A 3CDZB 1DDTA 1ZS2A 43CAB 4M9PA 3BVDB 4PN6A 3MNVA 3BPLB 3FB8B 5E1IA 5JXED 5F3HA 2EIBA 4WK2B 4YWGL 1KEGH 2QDWA 4YN3A 3KPPB 4YHIB 4WKXA 3SHSA 4F5CE 3IVKA 3UBHA 4PYHA 1A3QA 1P4LB 5KVGH 1DL7H 4U3HA 3WFCH 5CZVL 4FQIH 1VFAA 2FSEB 3COOA 5JO5A 1FSKC 3STLB 1SF3A 2R2BA 3MRMB 4AJYV 1AO7E 3KJ4C 3V6ZB 2KH2B 2E76C 2I85A 2FECL 5MEPB 5BVPL 2P5WE 3PPEA 3LIUA 3RQ3A 1E2ZA 5K59E 2HAZA 1BZ9B 4RMUA 3EH3B 3RWFB 4ODSH 3TP4A 4AYGA 3PHQA 2CDEB 4XC1H 3ENEA 1IFGA 3MO1B 1QO3A 4N2OA 5F7KC 3DHMA 5F7WC 1R5VA 4ELME 2D7PA 2UWEA 5FW6A 1EHLH 1TQUA 3NT0A 2B7DT 4HXAL 2V3FA 3TJEH 2EDDA 3ES6B 4F27A 4PJBF 2R1YB 3P1VA 4AMWA 4U2ZA 3M6DA 3F12A 1WDAA 3H7BB 1BVLB 5I0VA 4UI2A 1UB6B 4N0UB 2PO6A 4FQCL 4KX9A 1RIVH 2ICWI 4HJSA 3AQYA 5B3NA 3MCYA 2XWTA 3BDXA 4LCWE 1G6RL 1OGAB 4L4TD 1O7DE 1NDGA 1N5AA 1VACA 2NNFA 1T7VA 2CO6B 3AG1B 3GZQA 3MBWB 3B7YA 3GMOA 1K5WA 2OI9C 2ADJB 4O5LH 3CN3A 1NM4A 4N87A 3ZTJG 1IBBA 3Q2VA 1HKLL 2A74C 2H0JA 5E6SB 2A9NL 3V4UH 1UVQA 4I3RH 3KLHC 3N44B 1V7NL 3FNKA 1OTTD 3T71A 4E5XA 3IDYB 4QCIA 4RGMB 1F4WH 4JKMA 1RMFL 3IVKB 3Q1SL 1QAWA 4JR9H 3X13B 5TGBA 1E8ZA 1CD9B 3BP6A 1KDIA 5E6IA 4G7RB 1DN2A 5JO5B 3WTSA 3CFEA 1MJ8H 4PS4H 1BYOA 1X5HA 2R7EA 2ZCLH 5B7EA 2GJ6D 2DKMA 3LN5A 3PP4H 4HIPA 4DK5A 5FS5A 4G5ZH 5D7IA 3VFWA 3PWUA 2WUCL 3BT2H 2OR8A 4YL4A 3E38A 2IAND 4NHCH 5B8CC 3OHMB 1UA3A 5TQ2L 3FAXA 2W0KA 3R1GL 1O7SA 3FL7A 1HCVA 4Y4HC 2CO1A 2OTWA 2UWEB 1GS7A 1R75A 4MJID 3SJVB 5HYJB 1MCWW 3CFMA 3ZL4H 4YE4L 1SNRA 4KKPA 5E2VL 1JBJA 3HRZC 1RZ7H 3FFDA 3MLWH 3WNIA 2XRAL 1NOLA 1S9XB 4ABVA 3PG2A 2WY3B 1UT2A 3AU0A 5FYLE 5KYUA 2QGCA 2XQYG 2ZOWA 1S78D 2PO6B 3Q5OA 5DRXA 3DRQA 4IIQA 3VAEA 4WWNA 3MLZH 5DS8A 2FH8A 1XWVA 3WNKA 4PRPA 2FH6A 3L5WB 4Z7QE 4M4PA 1AR2A 1P1ZB 2VDPL 1NDGB 1N5AB 1OAZH 1HWWA 1NFAA 1VACB 4FP8H 5I75C 4UOQA 1MFCL 1X7QB 5E8NA 3UJIH 4F7EA 1PZUB 4IGBA 1TNMA 1TZHA 3P77A 2BLFA 4K5MA 5C2BH 3SEPA 5C6WH 1D5IL 2AV1A 1IEBA 3QDGA 2FQFA 1ADWA 4G80A 5EULV 1GGBH 3QNXA 1DJXA 3OKKA 2R0ZH 1BSIA 3H55A 4NCDA 5K59F 2E8ZA 1KCUL 4QCIB 4Z7UB 5FUCC 1GSMA 1B2WH 1INDH 1C5BL 3ZKQD 3BQUD 3CZFA 5D1XC 1OB1A 3RIKA 4YDZA 4G6FB 3DI2B 2DIAA 4OVUA 4MLIA 1RERA 1CLOL 3CFEB 1MCLA 1TLMA 2R7EB 4HSQA 3ATDA 5EDSA 5A2KH 3KGTA 1QRNA 2BNQD 3LN5B 3PV6A 3EOTH 3QDMD 4Y1AD 5D7IB 4AYID 1A1OA 1IAMA 3D2UD 1I85C 3E8UL 1EMTH 1SLWA 4LP8A 3PWUB 3T3PB 1LK3H 4PVBA 4ZAKD 4ZFZB 4GBXC 3MOQA 2YJLA 4M03A 4F1ZA 2A4EA 1KMGA 4X6FA 4DKAA 1WYJA 4JRXD 3VXPB 2J8OA 2DWEA 4KH2A 5A2BA 5GRZA 4IK6A 1N2RB 2NZ1A 3FT4A 4I87A 2Q3ZA 2Y7QA 4PVMA 2E0PA 3UJJL 3LRLA 3S88L 1MJ7H 4B5ZA 1MJJA 5JQIB 2XETA 3L3HA 2X1WL 4G8IB 4I0PA 3MLPA 4ODVL 4BM7A 2ED6A 1BBDH 1AJ7L 1YNLL 3VI4F 3UTTA 2VTFA 3VU1A 2H0EA 5KN5B 4RISH 1A0QH 3RDTD 4XNBA 5DRXB 2A0LC 3V0DA 2XPGA 3DRQB 2HUHA 3E80A 4IIQB 3PIQA 2FD6L 5DS8B 3WTWA 2ITCA 1MI5A 5L2JA 1UKQA 1OP9A 4LOVA 1JYNA 3GRWL 3O3AA 4OLVH 5E6UB 2Y1VA 1U3HC 1IL1A 2WKOA 2R4RH 4Y88A 2JJWA 2QPDB 2MH4A 4IGBB 1TZHB 4PD4K 2M1KA 2N4IA 3A6CH 2LTQC 3PE9A 2QV4A 4HMDA 5ESAB 4JM2F 3WGUB 5J7CC 3QUYA 4G80B 4WSJA 5AYTA 2BCMA 3ECWA 2A3TA 4PGZA 3TJPA 3M1BA 5HDBF 1KLFB 1LO0H 1QASA 4UTBA 1DVTA 1X7SA 4U1KB 4WNJA 3MKGA 3V7MA 1JTOA 4EQ2A 3IN0A 2XA8H 1Z6JT 1OB1B 4HXBH 1P6WA 3ULUC 3AT0A 3QEGH 4CA4A 4PMEA 3ARDA 3T8XA 3ARUA 2C9PA 4DPAX 4G6JH 1XB6A 4UTCA 2D2CC 4HUUA 4LSVH 2JTYA 1QRNB 2EDBA 4QYOA 5DC4B 4XP6L 2FSDA 3II2A 4GSXA 1A1OB 5JNYA 3P3UA 3DV4A 4KI5C 2OMXA 4J3OD 4LP4A 4X6FB 3BZEB 2WBJD 3QE5A 2W38A 1WWCA 1FRGL 1EXUB 1RZKH 1MHCB 2DWEB 3O0RL 3QQXA 4L1LA 2R51A 4F57L 2X3BA 5ICXB 3FT4B 4HUNB 2MQ0A 3IF1A 1S9WB 3FTYA 3S34H 1RUKL 3RIFF 4IBYA 3FB5B 3L3HB 4I0PB 1BAFH 4KPHL 4GKNA 4Y4FB 2C9AA 3NCJH 1LVEA 2AEPH 3AY4A 4GAYA 4KO9A 3QGVA 1N8ZB 2FQDA 3G6DH 3UTTB 4GMTH 4QWWC 4K5OA 3ILPA 1JFQH 1UWEH 3Q5TA 3VXMA 1YMMB 4JKWA 2R0LL 3EYUH 1S3KH 3OR6A 2XPGB 3MRGA 5FYLL 3RTQA 3VQMA 4YSEA 2COQA 5A2LH 4AVHA 1PLCA 2VDQL 4L37B 4MNGE 5L2JB 5IV2A 2N1TE 3PJNA 1EVTC 5EN2B 1IGFL 3PWVA 5EU6B 4OV6F 4P9HH 4WHYH 5DQDH 2F1EA 3MRRB 1H19A 5IGXH 5MEQA 1PEWA 4GUQA 3L4CA 1DLHA 2VLME 3PABB 1PIGA 4WY7H 1LE5A 1H6TA 1KC5L 3RWCA 3UBFA 2WN2A 1M2OA 3KS0J 4P2RE 3C8DA 1JHKH 4TSCH 1C16A 2HT2D 4XGZA 3LZOA 3M1BB 3E6FB 3D87B 3LPPA 3A5VA 1J88A 4OZHE 1CC3A 4I5BB 1SDDA 4OLXH 1U4FA 1PL3A 1ZK9A 4FQXC 3ZGIA 3VSQA 4U0RC 2VWEE 4M02A 4R90H 2YQ2A 3V7AE 4HPYH 3ATBA 2WWKO 2J71A 3IEAA 4QY8A 3P9LA 3ARDB 1AZNA 3QP3A 4XNZB 1OAXL 4NNPH 4UTBH 4KROC 4U2YA 5LBVA 2YAHA 4UV7H 4AGOA 5LXGH 1BP3B 4UUJA 1R3HA 1C12B 4Q6KA 1BIIB 1T5XA 4JFFA 2JJTA 2JB6A 4DKDC 5JNYB 4ZS6C 3DV4B 2DOCA 4WFGE 5DLLA 3LD8B 5AOZA 3OB0H 2CK0L 2HA1A 4R0LA 1NLBH 3K6FA 3UTSA 5FUZH 4N20A 4C56D 1MFDH 4KK8D 3VH8A 1HI6A 3HR6A 5CFHA 3UTPD 2VN6A 1E3FA 3IF1B 2XYCA 1BWMA 2GSGA 2AXJA 4Y2NA 5ABZA 4LLUA 4GKNB 1HYSD 1UGNA 4IJ3C 3GI8L 2HKHH 1YEGL 3WUWA 1GH7A 1AKPA 6FABL 1I9JL 2Y07L 1E4KA 4R7NA 4ONOA 5E56A 3ILPB 3U30C 3OR6B 4JK0D 2N3JA 3RE0A 2X6AA 3L3KB 4X8GA 4OFYD 3TZVC 1J0YA 4HIIB 3U46A 3T0EB 4P5KA 5IV2B 3JTTA 2WAHA 3BZ4A 4JDVA 4KKBC 5GGSY 1F41A 4OLWH 3O3BA 4FYRA 2EINB 2FJFA 2OP4L 1ZVSA 4HJ1A 5DD1H 3DVFA 1DLHB 4G5AA 4ZZFA 1MCEA 1Q0EA 1LE5B 2ED8A 2EILB 3M88A 3EOAB 5EBGA 4G72B 3DIFA 3BN9D 1QUPA 3A6BL 1MNUL 5F9WC 3OPZH 2GK0A 3AGVA 1SDDB 4OCRH 1CICB 4J3UA 5I0YA 2WUBH 4Y5VC 2PPEA 4GIAA 5E99L 1H3UA 1NC2A 3SBWA 3RKDD 1GMIA 1KTCA 4QY8B 4GSDH 1VLXA 1A7RL 3MCKA 1EA9C 2PP8A 4JJHA 5I2IA 3I2CL 1Q9WA 4IKNA 1C5CL 5L9DH 4CC4A 3ZX1A 2BFGA 4UUJB 5C97A 1XB8A 1T5XB 3IB4A 3DWTA 4FNQA 4JFFB 2JB6B 5FYKU 5IMKA 2BRRH 3QR2A 1BGXL 5HHPA 2PTVA 2Z3FA 1MREH 1RZFL 4XN7A 4R0LB 5JMOC 2WLLA 4GAJH 3UTSB 4JHWH 3FUHA 4K73A 3VH8B 4E9LA 4YK4B 4YX2H 1HI6B 4JO8A 4QAMB 4R97C 2KYIA 4ZTOH 3VXRE 2VLKE 1EEQA 2GSGB 5IB3B 1CFVL 2E6PA 1AD0A 4LLUB 1WC7A 4BKLA 1N5YH 5KJ7E 4LEXL 1ETA1 1DE4A 5JXAH 1RUQL 1RZPA 2OSXA 3QXTA 1HEJC 1HHHB 1GZPA 5CD3A 4OZHF 4APQD 5KBKA 4OD3L 4R7NB 5I1EL 3VUAA 4PRBB 2WP3T 3FUMA 1F0LA 3DPDA 3VXSE 5SV3A 5I19H 4ZX5A 1B4RA 2OW7A 1EBPA 2MFNA 5DA0B 4P5KB 1ILUA 3JTTB 4JDVB 4NRYA 4X9IA 4XCFL 1W0WB 3ARGA 1GW6A 3O3BB 4Y16C 2XJKA 2FJFB 3BDYH 3V79C 2O1AA 1I1YB 1ZVSB 3FKUS 1MCFA 1DSWA 5F1NA 3HMWL 1CD1B 4K7PX 2FZ3A 1T5KA 5L4FA 1V55B 3HZYA 1NSNL 3V52L 4FABH 1IVTA 2VZ1A 2A1WL 2R23A 4XAWL 3PGFH 5AW5B 2BDNL 4DT2A 2GK0B 4PAZA 5I17A 5C08B 1ZLWK 1UURA 3RPIA 2VW6A 2YD3A 4EE2A 3I74A 2D31A 1ECZA 5FW8A 1S9KC 2JKXA 1NC2B 4KO7A 5IBLC 4XNXL 1CLYH 3CZGA 4PJFA 2WKGA 5F96L 3HKZA 5ADOL 1BJ1J 2ICWA 1ZPLA 4F3FB 3MRPB 5E8DL 5GS2D 5I1AA 2DQIL 3X12B 4NRXA 3M1CA 1OAQL 4EPSA 1E9OA 3GBML 2GEEA 4K71B 5IMKB 2NY2D 1MHPH 5AZEH 5HHPB 5JHLL 1Q9OA 4G1EA 4J2XA 1Y07A 2E56A 4FZEL 5I1KL 3R06A 1ZRUA 3G6JF 5I8CB 5ANME 2WPGA 1WSST 1P7BA 3CFCL 4MMXB 4AQ8C 4UOW1 1VGEH 2ZSWB 5DMKB 1NIEA 3G5VA 4HS3B 3D9AH 4JFTA 2Q3XA 4MXWH 5K39A 3OZLA 4MXQC 5HHMD 3AROA 4G1MA 2IC2A 2QFPA 1WC7B 5H4YA 5GS0D 5BZXA 2XWXA 4JG1L 1BLNA 1LMIA 3UG4A 1G6VK 5JPNB 3US1A 3BRGC 1DVUA 4LK4A 4TNVF 3JZYA 1XSOA 3S35H 3TBYA 4FKHA 1NC4D 2IMNA 1Q90A 3Q13A 4YSDA 5FA4A 5LGHH 3VFGL 2CPUA 4DO4A 4JLRB 3ARGB 1OHQA 1KELL 1P84K 3ARFC 3ECVA 1KB9K 4XPBL 1PY0A 2XHNA 2Q7NA 1IFHH 3QO0B 5F1NB 4OGXH 2OR7A 2FZ3B 4N5UA 4YSPA 5EU3A 1BHGA 2XV3A 4N1HB 2AQNA 2HTLD 1OP4A 2ZX6A 1FCCA 4WK4B 3QPXL 5A43C 25C8L 2BFVH 3QK0A 1OZUA 2A9ML 4NO0D 4AIOA 3R0MA 2OMYB 4PWKA 1A6AA 1X5IA 2NYYD 5AW0B 3CN4A 5C0BD 2WYIA 4P06A 1C8PA 3P9WB 4Y2DD 4M5YH 3B6SB 4PJFB 5DHVB 1L5GA 2AJVH 4AH2A 3BVXA 3S8FB 5F8RC 3UBXG 5FLVA 1ZEAL 1VAHA 1AXIB 3ZTNH 5DXWA 2ICWB 4OW6A 3W1ZA 1E40A 1C8QA 4CMMA 5I1AB 5CP3A 2FYYB 3MV8D 4NAMA 4NRXB 2NR6C 3BN3B 3DXAD 2ZWNA 3UC0L 5IFJB 1D5ZB 1N6QH 1Q9OB 2W9EH 3VMNA 3TVMC 3R06B 5AKSA 4WI8A 3FBKA 4F15C 2NXYB 4HJJH 3LPWA 1KCRL 4OFVA 3EDFA 2NX5E 4O9HH 3OKEA 3ARRA 4DETA 3G5VB 4OGAD 2WLNA 1DJHA 4N0FB 4ZPVA 3U4EA 5K39B 2BIIA 3DO7B 5C0DA 3WNNA 1P6AB 1JF5A 2AJ3A 4G1MB 3S0PA 2C5DC 5JYMA 1KY6A 1EAQA 1JF1A 3N5AA 1TTFA 3WIFA 2Q0ZX 2WK2A 2FX9H 1XH2A 4RA0C 4BK4A 4GYBA 1VADB 1EUTA 3N2JA 4PU2A 5HHXL 1IEAA 2VO5A 5DJZA 1MPAH 3FQWA 3TBYB 2YRLA 3SOBH 3L1GA 2AJXH 2M8XA 2A74A 2O5XL 3D39E 4YDMA 1K4CA 1Q72L 2ICCA 4EMZA 1KJ2A 2BJMH 2EKJA 3IDXH 3FF7A 1KGUA 4FI7A 4OZGA 2K70A 2CJSA 1LO4H 2G2NA 3MRFA 5EU3B 3RVUC 3QCTH 3ML8A 2I32A 2OCCB 5J9PA 4DTGH 1T1ZB 2Y6SC 1N59B 3EGDA 5CINH 4PJDB 1KPUA 4JFDE 3PDOA 3ZQWA 2FWLB 2QGBA 3GPSA 1Q4NX 1A6AB 4UBDC 3SN6N 5SX4I 4PJHB 1T6BX 1WGOA 2B1AH 5I1GH 1ZCRA 3QRBA 2VRQA 3BD5A 2GT9A 5D8JL 1L5GB 3NJNA 3HS0B 5AL0A 5E9DA 2AGJH 1HC1A 4W1TA 4XN4A 5GGUA 3RGBA 1QABA 1TTBA 1I7UA 1UCBH 2XTJE 4YXKL 1YYLL 4KQ4L 5DC2A 3ZVVA 5L0QC 5D71L 4CMMB 1U93B 3F7RA 3QI9C 3K2UL 5B8CA 3L9EA 4MMYA 4OIBA 2NY1C 4CSPA 5AVSB 4CC1A 3GSOA 2B5IB 4TL5A 2CDGA 5KSBF 9PCYA 2Q7YA 3CDCA 4F33A 3B2VH 3AY2A 1IM9A 1YECL 1A9BA 1XGPA 3H3KA 2OQJA 4OFDA 1H15A 1WT5C 5HYFA 4G8EA 4UINL 2KDYA 3EDEA 5CP3H 3HRZA 4X80L 3U4EB 4ZPVB 2FECI 2QJDA 3C9NB 4JNXA 1RUAL 4OI9A 1IKFH 1UM5H 2NNXA 1NGYA 2VR6A 4QO1A 4Q9QH 2GJRA 3EDKA 2VZSA 4UQ2A 4Z9KB 4MA1C 1F13A 5F9JA 1XTLA 5AOMA 5C0NC 4I88A 3S37H 3EKCA 1JZJA 5HHOE 1JF1B 4Y0GA 1GZQA 2V9QA 4XCNA 3BD4A 1AHWC 1JPSL 2BNRD 3RJOA 4WI7A 3UAJD 5IBUB 3MSPA 5GHWH 2A6DA 3M46A 4FG0A 2WXNA 5F0JB 5JYLA 1LM8V 2A74B 2V0AA 1K4CB 3IRPX 1FQ9C 1KJ2B 1L4IA 4TNWF 4QAWA 1PAMA 1KCVL 2XBZA 3LDBB 1AI1H 1OHZA 3S6CA 2D7NA 1QFUL 5D1XA 3KVDD 5I1LA 2YC1B 3HE7C 1SN0A 2Z4TA 4NI6A 1KPUB 3BKJL 3VWKD 1ET5A 2PR4L 4NPYA 1KJ2H 4S1DC 2BVYA 3ZKXC 1UD2A 4BUQA 4W9IC 4K5LA 2F6AA 1AIZA 2DL9A 2GJ6B 2VCOA 2WSKA 5DS1A 1TPXC 3HFMH 2HRPL 1FF5A 1TQTA 4TTGA 2I7SA 1I85A 1VCBC 5GGUB 1ODAA 1I31A 4BWWA 2O4EA 3VI3A 4GBXA 4F9PC 3F00A 1N70A 1HQRA 5C71A 3OKOA 4OI7A 3LKQA 4MMYB 4DK6A 1FH5L 3B83A 4B41A 1RZGA 3GHPA 2Y2WA 2LU4A 3O4LA 2CDGB 5ENWB 2YEZA 2Q7YB 4F91B 4KRPD 5JMRA 4F33B 4KTYA 4M62H 5KJ4A 5BV7C 1Z0NA 4JFXA 5HHVH 3S3CB 2OQJB 4YHYC 1G9MC 3LNIA 3QDJA 1NFDA 2PPCA 3L5HA 2J8UE 4PR5A 2OSLA 3QZNA 4ZMAT 2RR3A 3GIZH 5IKCA 1IU1A 1SM3L 3SQRA 3M45A 4WJKB 1NGYB 2V8MA 1FIEA 3UO8B 2YPLE 1KY7A 4J12A 4UQ2B 3GK8H 5F9JB 2VSCA 4M56A 3OHXB 4WTQA 4F2EA 4QLWA 1SLUA 3Q2CA 3X1GA 1DQML 1ES0A 3ME0A 4WW2F 1U3HA 2QADD 4XCNB 3U4BL 4GS7B 2ODHA 4QHPA 4X6CB 3HZVA 2DMHA 3HG1E 4ZFGH 1KUMA 5ISZA 1HL4A 4GXUN 2JKNA 3B7SA 2RBLA 4J6IA 3BWAA 4A55A 1JPGA 1L6PA 2W1NA 1MLBA 1JPTL 4MCMA 5DZ9A 3TYGH 2ZKXA 4M29A 4PGBA 3KM2A 3DX8A 4DP2X 1HAWA 3KAAA 3STZB 5M7QA 3BEVB 4FD0A 2DQDL 1UACH 1PPIA 3FTWA 3PFUA 5GISH 2BO0A 4KO5A 4AG4L 2Q3AA 1NMCB 2YPVL 4XB7A 2XWDA 5GRVK 3KJ6L 3QCUH 4NSKB 2Y1AA 3UZVA 4NB7A 1Y18B 1TYJA 1XFPA 2E7BA 4X9YA 3ZDYE 5FFLA 2V3DA 3D2UB 2IFFH 3RWHB 4M7JL 1XCWA 1IV8A 1LILA 1M2VB 1VA9A 1HZHH 2DQHL 2J6EL 3OKOB 5CJXC 3WFDH 3X3GL 2YXMA 3LKQB 4CVXA 5T3ZD 1H8NA 1A5FH 2BM3A 4QRPA 4YOKA 3O4LB 3LRMA 3W0WD 2YEZB 3LNDA 2DDQH 4MS8C 4XVJL 2ZQKA 4HKBB 3FSWA 3QDJB 1ZHNA 3W37A 3FQRA 2EUVA 4PJEE 4YXLH 2OSLB 2PCPA 4UTAA 3SDDC 1UKSA 5GS1C 1RQ5A 4NFCA 5IKCB 1OARH 4LVOC 2HX7A 1I7RB 1NBCA 3CE1A 4G8GE 4U49A 5H94A 3TWCH 3I3EA 4ZXBC 4OF7A 5DJXB 4XO3A 4HG4J 1KIQA 4ZPTB 3EYSH 3NA9H 3SKJH 3IGLA 1TENA 5AAWA 1UATA 3WE6A 4FERA 3HEIB 4HJGB 4BZ1L 2X88A 2VDKL 1HH6A 2NPLX 3LYRA 3HZVB 4YIQB 3N3EA 4PRID 5DMGC 3DHJA 5ISZB 1LHZA 4A1RA 1G87A 3NP4A 1Y6MR 2XDHA 2AEOA 3BWAB 3TNNA 3OAYK 2BZCA 1YEIH 3F01A 4ORZC 3X17A 5LBSA 4AGMA 2H45A 4PGBB 4U33A 3L6FA 4FQXA 2JFCA 5CAYB 1C9SA 4N0YH 2K8MA 2EZ0D 2X2YA 4RNRA 3RWDA 2CKNA 3P4LA 4YSUA 2UZYA 4FDWA 1MDAA 1DBBL 1WCQA 1FFNA 3QORD 4S1SH 1OGTA 3INOA 3UZVB 4NQQA 2YAQA 3H9SE 1MQKL 1J1OL 1A3ZA 2PR9A 1VFBA 4KVNH 3WLWC 4JM4L 2SODB 3FXIC 4EUPB 1JGEA 3FUDA 3GMQA 3K3QA 1ETZB 2O6FA 3H54A 2I69A 2VZUA 3ULUH 3H3PH 4NJAH 5FOBB 1DBJL 6TAAA 4M6ML 1FGNL 4R3SA 1FP5A 5IJCC 4GP8B 5MHSD 1UOKA 2WBJB 4XCCL 4G6ML 2YAOA 1K9TA 2ZP0T 4CVXB 1SVBA 5TDOA 4LPYA 4XHJC 4QRPB 2XN9D 1QEWA 3S3JA 5JW3H 2R2EA 1VENA 2RH0A 4Y9CA 3UJTH 1R3JB 2HVJA 1KPRB 4G71B 2IOMA 1TG8A 3AUVA 1ZHNB 3UAAA 1GY2A 2DQEL 4IMKC 4JFOA 2ARJB 3O3EA 5DD3H 4R9HA 1HK6A 1IKNC 3GMMA 3TYFA 3EBHA 2EIZB 4WGVB 2OL3L 1YYMH 1KIQB 1KOAA 3ZYOA 5T1DL 2VQ1A 3IAGC 3K72A 4UTAH 1M1XB 1PLGH 4NAJA 5HVHC 3GJEA 4WENB 5KANG 1U95A 1HH6B 4A7GF 2E6JA 3QAZB 2C26A 2WQRA 2F54E 4FLRA 1L0QA 3PL6C 3SDAC 4ZMLA 3ZDYF 1BXVA 3Q0HA 4KVCH 3SE4C 2EO9A 1FJ1B 5T3XE 4I48B 2DKUA 3LRKA 4PJGA 4NAQA 5ITFB 5LGJA 2NUPB 4HT1H 3QEQA 1PNDA 3L6FB 5T33H 3PWJB 1SFHA 4G9DB 1A7PL 4XTRD 4XMLH 1UT1A 3ZO9A 1PX3A 4RNRB 3RWDB 2I07A 1UWXK 4Y5VA 5AB1A 2UZYB 3RI5K 3VVVA 1IAKA 1PZAA 3IGKA 4DAGH 4B50A 5GJTH 3MQIA 4O4YH 1OGTB 1QD0A 2DYPA 3ZK0A 3FQ2A 4DN3L 5AW1B 3RL2A 2WSPA 3DOHA 3KPMA 1NFKA 4W81A 4JX0A 5MP6H 1P4IH 1JGEB 1U8IA 3CDYA 4NZTH 2XTSA 4OV5A 3RZCD 3X2QB 4JG0H 5KVFE 4X7FC 3MX0B 4QTIL 1IARB 4R3SB 4WSKA 4AWJC 4XRCA 2B1HH 3EHBD 3GDCA 2ZOUA 2EDFA 4C56B 2VABB 3IGFA 4HS8L 5DWPA 3IDGA 4OJFH 2R2EB 5EB9A 3FMGL 1RKRA 2H32A 2VLRD 2H6PB 2HVJB 4LCIL 5ALCH 4AW4A 2QPEB 1XF4B 2OMTA 1E4HA 3FQUA 3MRNA 2FL5A 1QHPA 3VDCA 3WEBA 5EHFA 2D03L 2YAPA 5D2NA 2HMID 3O3EB 4ZS7L 4FNTA 1JNNL 2XFXB 5B7MA 3OAUH 3GMMB 4HA1A 3CVIH 4TRPL 5C0CE 4JDTL 3TYFB 2WLYA 2PXYC 3QULB 3NCYS 4GRMA 1I82A 3EYVA 3ULVD 1DVXA 3ESMA 3SDCC 4IEFA 1K8DA 4WZ9A 1DVSA 2TRYA 1HH9A 4I0KA 2VITA 3GJEB 1KGYE 5KS9F 1U95B 2G30A 4XPFL 4TVPD 2WANA 5D6DA 3MLVH 1B0WA 4L1HA 3MAWA 4N2BA 5DYOA 5AW7B 3ETSA 3SKMB 4KJWD 4PCYA 3Q3GB 4N25A 3Q2NA 4H8VA 3DUUA 3BGMA 4FAAB 3QEQB 5K9QI 1XH3A 2UZXB 5C9JB 2I07B 1I1FB 1F58L 1IAKB 3WJLC 4X0KA 2O93L 1SJHA 5E4OA 4WAFA 3V7AG 5IY5B 4KOBA 2DYPB 1QSVA 4MCZB 5EIQA 3T4YA 2PW2B 2ZD0A 1VFUA 1KXVC 1S8DA 3RL2B 1IBDA 4YBQC 1CFTA 2GKIA 4OV5B 1PJ9A 1TO5A 3QQDA 1BF5A 1MRCL 3ZE1B 1F86A 5I6PA 1YEKH 1E6JH 5DUPL 2CA4A 4XRCB 1T83C 4B9CA 5IVXA 4UT6L 5FW7A 4AKPA 4AQ8A 2XT1B 2DM4A 4G83A 1T0OA 4G42B 1F1GA 1MF2H 5EORL 3IDGB 5DJ0A 4OZFB 4X9GA 5DEFA 2H32B 1HJCA 2GTWB 5DGRA 5EOTA 2XWJB 3U36A 4MMZB 4NENB 4FULA 1HNYA 2OMTB 2UY7A 3ETBJ 3FQUB 3V5HA 4JGNA 3MRNB 5I16B 1YEHH 4U6XA 1NCCH 3DVGA 5D2NB 1R0AL 4LCVA 4POZD 5J12C 1TZGL 1YEDB 5E2UH 2H32H 5FA3A 4XP9L 1JRHL 5IFAL 1E9QA 1R3LA 4GRMB 2W94A 4QXVA 4TULL 3EYVB 5BJTA 2YBGA 3QJFA 1T20A 3ARFA 3EOYG 3SKNA 4L0ZA 1HH9B 5TF1H 4DGYH 5AYUH 4RRPG 4PFEA 5ESVB 1FGVH 4OLYH 4D0DA 2A9BA 3ZOAA 4ICWA 4TPRH 3U2IA 5DYOB 3TH4T 1OSYA 4W68A 5T1MA 3HBGA 5T3XL 5D1ZC 2WVUA 4MYWB 1OQOA 2NY3D 1L9RA 4PRHA 1JK8A 2OPCA 1XD1A 3QWRA 5J1SC 4NO2A 3ZJAA 2ITDA 3RA7L 4YSOA 3O2WL 1BQSA 3IJYB 3BI9X 4WFHD 4YAQA 3FOMB 4NN7C 2WZ5A 1Q0XH 1A9EA 1SJHB 1UA7A 1BDYA 2JCCE 2BOCB 2JQAA 3ZMEA 3FAWA 4Y4KA 3KHOA 3RILA 1TETL 3WXWL 3FT2B 4Q9RL 2FWOB 1CFTB 5DI8A 4B96A 4E9YA 2IGLA 2NR6A 2EVHA 3V4VA 4DGIH 5D9SA 2NY2B 5KVFL 1S5IH 1CDJA 1LJMA 1FZKB 3TVMA 1FNEB 5ICUA 2TAAA 5TE7H 2WXGA 4FFWD 5JQ6L 3ZY7A 4DOHB 2Z0UA 4L3CA 3T0WA 2FLMA 3ABGA 5BVJA 5FO7B 1RIHL 3QQ3A 1AKJA 4ZSOA 1ZT4B 5DJ0B 3GBEA 3VM7A 5DEFB 2KZBA 3U36B 1H8SA 1O6SB 1R5WB 2QQLL 1R5IA 5HHMB 2AEWA 2QHLA 3ARZA 2UY7B 1ET8A 3V5HB 2KQNA 4AMKH 1PD0A 1G6RA 3MCLH 4GKZA 4H0GA 1CE6A 3GLEA 4J3VA 3DVGB 4U6XB 5DHMC 5H8DA 3V8CA 1F1DA 2FO4A 2QVIA 4DQOL 2VISB 2FATH 3KHQA 4X9FA 4F7PA 1DJZA 3HNVL 1XTMA 4DP6X 5FA3B 1NC4B 1E9QB 4WUUA 4XPGH 1T0MB 1Q9LA 1T20B 1WA1X 3SKNB 4PJCA 1X7TA 4URTB 2BERA 2NNRA 1A7OH 4EXKA 5HVFB 4M93B 5DF0A 4XOBA 1OXYA 2B59A 3AT9A 4E36A 4D0DB 1KDJA 2E59A 3U4KA 1XIWD 5CEZL 1QTYT 1FG9C 2YMTA 2Z92A 4UILL 4X7SL 5DRNA 4MZ2A 5T1MB 3WTUA 4UQEA 4ZNEE 5LG1A 2IWEA 4IDJH 3MCG1 5SWSE 2QKIC 3CVHL 3K91A 3WN5C 4NO2B 1WK0A 4GXFA 1CN4A 4Y2DB 4V2BA 3SO3B 4NQEA 1GIGL 4GW5B 1URIA 5EEUA 1ACXA 2DF3A 2K78A 5AYQA 4Y4KB 1AQDA 1IIKA 4H4NA 5CMAA 1UTDA 2AJSL 4JPIA 3B9KA 2GUOB 4N5EC 1SBBA 3F62A 1XGUA 3MV8B 2Q20A 4KJYA 3V5DA 5GGQL 3V4VB 3WFHA 4NNYA 5BVPH 3EZJB 5TDPB 2WNXA 4AXWB 2EDKA 2X2HA 5CILL 4DKEL 5D1ZI 2JSFA 4L3CB 3GS4A 2YEVB 3WNMA 1Z9LA 2DYSB 3C60C 2A73A 4ZSOB 2PYEA 4JRYA 3LKSA 5ID1B 5L7XL 3V4VH 1YAZA 3NTCL 4PPTA 4X7EC 3BKCH 1KGCD 1R5IB 3NJLA 1CDBA 3O3DA 4HXAH 2RMNA 5DGQA 1G6RB 3ORJA 1SVZA 3VG0H 1CE6B 3FO9A 5F7AA 5CF3A 4EN3D 3GJFK 5HDLA 4KNTA 1FL3B 2XI9A 4OZIE 4LNRA 1NCWL 1AHWA 4FXGA 1IGYA 5ITBL 4X5XA 4E41E 3HE6C 4FQCH 4WUUB 5CJQH 5ERWA 4WF7A 1DYZA 2K7PA 5K9KB 3ZKSD 2JCCF 3U0PB 1Q9LB 1E4XL 2J4WL 1RSFA 1NBQA 1G6RH 4BSJA 5IEKA 1E5BA 1BQLL 3KH4A 5KOVC 2H3KA 1DQQA 1E90A 3CLEL 2B59B 2MCG1 4FS0A 1L9SA 4WNSA 4F5CA 3DHUA 3AXLA 3QIBC 1JPEA 3WGVB 2A9NH 2VXVL 1MCHA 3HE7A 3V2AR 3PDGA 1U8HB 4FOMA 4JFHD 4ES8A 4H88L 4LRNL 4ZFFA 3AM8C 4NLHA 2Z1KA 5J06A 5IFHH 4G3YL 2VMCA 4Z7WA 4Q97A 1AO7A 1XDTT 3HN5A 4Y4HD 1ZDSA 3S8GB 3O2DL 1RMFH 4NQEB 3Q1SH 1JVKA 3FQYA 3NCBB 2P5WA 2WLJA 3LV3A 3SQBA 3L9YA 3TFKC 3C12A 1AQDB 2VL5A 1BAWA 1O0VA 3S36L 5L0QB 3B9KB 1X3DA 1SXSA 3RVWD 1XGUB 2WIMA 4KJYB 3V5DB 3WFHB 4NNYB 4QT5B 4MTMA 1QA9A 2V2WB 2Q8AL 1FZOA 4DFIA 3QPQC 4OR1A 5HDQL 3ZYZA 2KERA 1N0XL 3PAVA 2VDRB 2ATPA 4PJ7A 1BFSA 2FUQA 2UUDK 2W07B 3GEWB 1YCSA 3GXNA 5TQ2H 4DGWC 4DO6A 1QKZL 4JRYB 3DOSB 3LKSB 4Z76A 3KPRE 1Z1WA 3NIFF 2BXZA 5FO9A 4WJG3 2L3BA 3O3DB 2ZXDA 4B3VA 1H3PL 2VJ8A 5EU5B 3GRWA 4LCWA 2VDRH 4YE4H 1D6EB 3LKPB 2FEDC 3FO9B 3ABLB 4PCTA 5E2VH 5EUOA 1ETB1 3VXUD 4QHKJ 2BPBA 4N9OB 3BJLA 5DMYA 4FXGB 2LAAA 3CDGB 2Y72A 3IJ9A 4AQZA 5JW5A 4JQVA 1IGYB 4X5XB 2YN3A 4I9XA 1HKFA 4N8VA 4NT6B 5ERWB 2YRZA 1TEYA 2DLFL 4DUVA 1HZLA 4A2DA 5H2BA 2BINA 3TJHD 2YQ3A 4OJCA 1IUZA 4OKDA 1A25A 1NFIA 1HX0A 3W9DB 2Z31A 3BAEL 3LEVH 5IVOA 2VYRE 2VM4A 5I1DA 3AXLB 1MWAL 1EERB 1D5IH 4FKKA 2NT0A 1XSJA 4ZTPH 3HE7B 2FT7A 3JYCA 7FABL 5ICYB 3DNKA 3FTGA 3OJDA 2Y5TA 3VWKB 4MLSA 3ZKXB 1M71A 3M07A 1N3NB 4BH8B 2J72A 4Z7WB 1VZHA 2VERA 3MACL 4XN8A 4P23C 1XF2A 5L4JA 3D51A 3LQZA 4UANA 1LNUA 4R96A 4WTZG 2P5EE 4WWID 2F74A 2LAGB 1FAKT 2MPAL 3LV3B 2GHWB 3ERXA 2YPKB 2VL5B 4DVRL 3DYMA 5TFSH 1CLOH 4Z1PA 3WEMA 3TONA 1IB5A 4F37F 2MQ3A 4AQ1C 1U42A 4GB9A 3MRJB 1QA9B 5HGAA 2A2QT 1FZOB 3MA7A 3E8UH 2PWEA 4MA7L 2Y69B 4KRPB 1AGCA 2KLSA 2R56H 1MCWM 4NUJA 1SDYA 1U3HD 3C2SA 5AW4B 3T1FB 4NDMB 4PJ7B 2XYBA 4JFPA 5SX5K 4B53A 2VE6A 4WUKL 4KHXL 4Z7NE 3SDDA 5GS1A 2B2XH 2B0SL 5ESQA 1XL6A 5D2LE 2IH9A 3FFCD 2ZAHA 4N8CL 5D55A 5J57B 3IE9A 3FQXA 2VUKA 1O9ZA 2AVFA 4ZXBA 5BUPA 1TSRA 4LHUA 2APTA 3TO2B 4ODVH 3TGXA 1X9QA 2K6WA 4YXHL 2X6BA 2ZX7A 3ABMB 1NGZA 3QZBA 4K5NA 5JW5B 3HNTH 2ERJB 3LKOA 1XBRA 4IBWA 2CDFB 2GAZB 4JDZB 4EO5A 2YD0A 2F15A 4OCSL 5H2BB 1A6TA 2G0LA 4LEOA 4ORGB 3MXWL 2O61B 3KPSA 1O7VA 4WFFD 1O9WA 4PS8A 1DANT 1TQVA 2Z31B 3JWDL 5CCJA 4FFZL 3CFBA 2PLTA 3GHEL 2EXSA 4JKPL 4DGVH 4KJPC 1F4HA 2XXMB 5GZOA 1JMXA 4I9WE 4QXGL 4OZ4B 3NQKA 3TWYA 1KBGH 2WP3O 1PCSA 1EAJA 1ZA3A 3FTGB 4XI5C 3OJDB 2Q76A 2Y5TB 3QFGA 3KLLA 1M71B 3NJFA 4OF6A 2R27A 4BEIA 4HK0A 1CFNA 3D3VA 3FBQA 5EFIA 2WXJA 5DZPA 4BFEA 5HI4D 3WY2A 1A4BA 1LNUB 3IJEA 4R96B 4JZOB 2X44D 4FQLL 4F7MA 2N0MA 1G0YR 3BWSA 4C4BA 2G5BA 3X1EA 5KVDE 3RWJA 2RJMA 2XBDA 2YR3A 1RLWA 1MNNA 3UOAB 3JUZA 2F53A 2MKWA 4QWWD 1ZWIA 4F2ME 2EEAA 1XSIA 3MV9A 1FVCA 3P2DA 4HWBH 4DP9X 5HGAB 3LSOA 1HCZA 3LNHA 3W0WB 3HZMB 4HKJA 4DZ8A 1AGCB 3WTXA 4YDJA 3IS0X 1S9YA 2IF7A 4NUJB 3TV3L 4L3EA 1CCZA 5ECJE 4ABWA 2IMMA 1FRGH 1R34A 1BZ7B 4P2OC 2AK4D 4LNVA 2APVA 5FO8A 3I6LD 3WHXB 5GS1B 5JW4N 1WUNT 3WY4A 5ESQB 1KTBA 5D7EA 3LH8A 1IKNA 3RVTD 4IOIB 1KJMA 3CFDB 3FZUC 3D18A 3NGBC 3IDJA 3KYOB 1KXHA 4KPHH 4LHUB 3GMRA 1ORSB 3OF6A 4PHZA 3REWA 4L2YA 1A66A 1G7LA 1DFBL 4TQPA 1NL0L 2Z1PA 2VO8A 3RB7A 1GAFL 1GJUA 3KD4A 1JGUL 2E27H 5C0AE 3QJHA 4FLHA 2GJPA 3HAEG 4ZMYA 4ZD3L 3BWUC 3LKOB 5HYEA 1I1CA 4G43B 6CGTA 4PRIB 3CHPA 4LGRB 3PL6A 3SDAA 1A6TB 2XV6B 5T1KD 3FO0L 3MRCB 4LEOB 3SE4A 4P5MB 4KROD 3KPSB 2DD8L 1BZQK 1RURL 2BY2A 4L1DA 1JE6A 3CFBB 3KPOA 4HLZG 1DP0A 4AL8H 1KC5H 4L9LB 4UIKH 1L9TA 3UC2A 1XR8B 2EE3A 1ZA3B 3KPLB 4YZWA 3KLQA 1YMHB 2XZAH 3O9WD 5EFIB 5BRZD 3QQNA 3OAZH 2XVLA 4Z7NF 5BZDB 2IQAB 4R7XA 4UZSA 2YUVA 2QVMA 3NZHL 1H0DA 4LXFA 5JOEA 1PVHA 4LPVA 1OAXH 2OJEB 3OAWA 3BLKA 2F53B 3AMLA 2P24A 1ZWIB 4QYAA 3KXFD 2JTDA 3MV9B 4E9VA 5C2UB 1RV6X 3LSOB 3TZVD 3ZE2F 1TQCB 4AVJA 2E7HA 2E9JA 4DZ8B 2JQMA 4G11A 4KKBD 2EDHA 4YDJB 1S9YB 5B1AB 4XNUL 2BSSA 1FIGL 1T89C 2H6OA 4LSQH 3O8XA 2QQKL 3FOLA 1JV5A 3A3YB 1J8HD 4YHNA 1H3XA 2MWCA 4WSGA 5AALA 3U82B 1AANA 1OE2A 2ID5A 4X6DB 5E2JA 1KV7A 4JN1H 4UM9A 1KJMB 3HHSA 2PXYA 4MNGA 1WWAX 4J28A 2BP5M 2W0FB 3BVNB 4XT1C 3REWB 1Q94A 5DYFA 4D2NA 5F7HA 3CU7A 3F65A 4H20H 5BZWB 4LZKA 6FABH 2YK1L 1I9JH 1IBGL 5CM1A 1FYTE 3L17A 3QJHB 2CD0A 4P99A 2BSTB 4Y89A 5G4NA 2LHAA 4H8HA 3WTTA 3SDAB 2HB0A 3CC1A 3QUZC 5EZOL 2EYRA 2OP4H 3FO1A 4FQ2H 1YEJH 3KPOB 1Y0LA 2DQFB 1HDMB 2HT3C 5E1HB 3WJLA 2K45A 4NN5B 3OXSA 2VKXA 2DZEA 2O6CA 3A6BH 1MNUH 4NZRL 2Q8BH 4ZG1A 1AQKL 1INEL 2YIHA 4MX7B 1MZZA 3QZLA 4BCXA 2E4TA 1QYGL 3BKYL 1F00I 1FHGA 3C8KA 5KVGE 1WG3A 3NIGE 3IMSA 1D9KA 2B3RA 3CN2A 5DEJA 3QEUA 1H0DB 1FAIL 2NLJA 2DWDB 1YZZA 4S2SA 3RFZB 4C55A 3CK0L 3F7KA 4TUJA 3SDYH 1LP9B 3SKOA 1T83A 3I2CH 1C5CH 2VC2L 4LAJH 4GIOA 1WFOA 3PXJA 5CR1A 3T1WA 2ZKHL 2WWOA 5ACZA 2GB2A 1KTDA 1FFQA 4JQIH 5AOLA 1MRFL 4JPWL 3SDXB 3BEWA 1INQB 3VMOA 4N4YB 1S7UA 3LY6A 1RZFH 2BSSB 3D0LB 4Y16D 3QSKB 3QNZB 1WA0X 3WHE0 2CCLA 1ZLUK 4A7SA 3O8XB 2XZZA 3VD4A 4KJQD 5D1QE 2WQAA 2WNGA 1MAKA 4YHNB 1SOQA 4PJ5D 3DX6A 4D9QE 4W4NA 2DQCL 3OLIA 4L8CA 1QPXA 4EZJA 3HLKA 2BCKA 3UYPA 4UM9B 1CFVH 3AU1B 1JXGA 4P2QD 3TASA 4OCYL 1TZAA 1N18A 5F9AC 1MEXL 4LEXH 2JIXA 3VTMA 3UCQA 2B77A 4HWUA 4ZW5A 4OD3H 2X05A 1V05A 1A14L 4C4KT 1LQBC 5A3ID 2G75B 1IGML 2KPWA 5IBLD 1SXBA 5DMIH 1OK8A 2ZX9A 4LQ1A 3N1GC 4JGMA 2XQYK 4XCFH 3GUTB 1THAA 1UD6A 2EYRB 1QX1A 5D1ZA 3FO1B 3VD9A 2FQGA 2OXHA 1BG1A 1Y0LB 4N0UE 1YN7A 1HVXA 4LFHG 5AVYB 3FRUB 3HMWH 3EYFB 4TVPH 4WDIA 5TF0A 4W9FC 1NSNH 3LH2L 4UB0L 1TFHA 2IG2H 3V52H 3U6RB 3OXSB 1OGAE 3GBNL 4OQ1A 4FADA 2BDNH 4ERSL 5FAAA 3KGRA 1OAUL 1ZAGA 1IVLA 2NQDA 2AHIA 1GMEA 3C8KB 3MRQA 3DOIA 3HC4H 1D9KB 3BGFB 1U58A 4EI6A 1Z3GL 5D96B 3TN0C 1MW2A 4JFSA 4XNXH 3P2BA 5F96H 4MWFB 5K5YA 5EDXA 4U1NB 1P7KB 4S2SB 4TUJB 3NZ8B 4FX5A 1GPOH 1KSRA 2JXMA 3GSVB 4WWKC 2YD2A 2X0VA 3FW6A 5E8DH 4O2FA 3EO1A 1OAQH 1U41A 4R5TA 1S7SA 2Z7UA 3GBMH 3Q6GL 1A47A 4I85A 5EMYA 3O6KH 4UYPA 3BEWB 2AQSA 1S7UB 1EBAA 4FNRA 4Q2ZA 2V7HB 3CFCH 4MAYA 2GJZA 4F8NA 2GCYA 4KZDL 1J0ZA 2YZ1A 2OYKA 3IFLL 3OZKA 1R3IL 3DX6B 1U0QA 4L8CB 3VXSA 2BCKB 1TTGA 3RWIB 4HFWA 4BD4A 1ZA6A 3SE8L 3NFPB 3VX1A 2EADA 4N2MA 3QWRD 1L7TH 3UTOA 1BD2D 1P4BH 3DUSB 3MNWA 5AQ0A 2UWEE 5HYJE 3PWPD 1ZPUA 2AQ2A 1T0NA 4AGPA 3LOWA 3GM8A 3L3OA 1K72A 2MOVA 1SJEA 1UENA 4U1JB 3VFGH 2CJTA 2IH8A 1KELH 2NY3B 4POUB 1M9SA 4JKLA 4QHUA 5LDUA 3BPOB 2NR6D 3KL5A 3UTQA 4QRUB 5AVXB 3WN5A 4JVWA 4ONGH 4WDIB 2G60L 4ZOBA 4OQTH 1JRHI 2Y24A 3DGDA 3OJMB 4OJEH 4X4ME 1WBXB 4EDXB 3KBHE 3QPXH 2F5AL 4L0PB 3STBA 3G6AA 3UO1L 1V3KA 2JKTM 4JJ5A 4JKKA 3K6NA 4R2GB 2F7OA 3MRQB 2CK2A 4H5SA 1K3IA 4EBQL 5DUBA 4EI6B 3WEXA 4FQIL 2AMGA 4BGLA 1JSYA 2NY6C 3RBSA 3N1FC 2JI2A 4JAMA 4OUOA 2BMKA 4K94H 5L8KB 4A37A 5I6XB 3ZTDC 4Z7UE 5I76A 4LSTL 3MJ8A 2JXMB 1XEDA 3FRPG 1WWBX 4PWFA 3T9WA 3KM1A 1SQ2N 4FFVD 3EO1B 4OIFA 2CG9X 2MCAA 5BQ7A 1X9UA 1S7SB 1MY7A 3HCVA 1CTMA 1YJDH 4R4BA 4RVBA 4R7LA 4ODSL 5AG8A 1IAIH 1ZTXL 3NACH 1AG6A 4XC1L 4ZYKA 4LPUA 4B60A 4MAYB 2GJZB 5LGYA 5LNGA 4R4FH 2GCYB 5EBLA 2Y5QA 5D7IE 3WUZA 2J5LC 4YSSA 1KIPA 2NSXA 1RPKA 4ZX3A 3T3PE 3IWVA 4PRNB 1YQVH 3TJEL 4HFWB 4BHUI 3BWZA 2HTKC 3CJJA 3BH4A 5D4HA 1F90L 1KYOK 1MVUA 2VT0A 5FK9B 2P45B 2XWCA 2HCZX 3MNWB 5C86A 2R69A 1RIVL 1L9PA 1T0NB 3ISRA 5JHMA 3L3OB 1XIWB 1TZIB 1WS8A 2A7BA 1RZJH 3RIAF 2O5XH 2GBVA 3U1SL 1JIBA 1Q72H 4P2YA 1JZ5A 2F8XC 3QI9D 4QHUB 2D3JA 1NIFA 4O5LL 3DSFL 1EFXA 5DTFA 5L8JB 2NY1D 1MLCB 1S3RA 3P73A 3V4UL 1JJUA 4PRPE 3QG6A 1CBVL 3TA3C 2YXFA 5FGCB 3BRDA 4LARH 4M48H 3G6AB 1FNFA 3FQ4A 1F4WL 1XCTA 1WBZB 5GGTL 4JR9L 1AFVH 1MW0A 1LWHA 1ASQA 3UPAA 1GVIA 4ODTL 4U4IA 3AS2A 3F5WA 2W5PA 4QI3A 3MUY1 5D8JH 2N7AA 2JELL 4R7DA 1YHPA 1MJ8L 1ACCA 2BMKB 1HNGA 2FB4L 1T7XA 2DKSA 1SOKA 2YUZA 4PS4L 2ZCLL 3L9RB 3RTLA 5DURD 4JO1L 4AENA 5I76B 4HAGA 4KQ4H 5GGRA 1JN6A 2GQHA 5D71H 1WFTA 3MGOB 4XNMA 5CHNB 5GGVL 4BINA 4FQ1L 1E5ZA 3QHTC 2D0HA 2F2HA 3BT2L 4NO5A 3NABH 1JWUA 2UWEF 2V2TA 1EZUA 4NWTH 3UAEA 3ZUNC 4ZYKB 1YECH 1QRNE 2EDQA 3QUXC 1H9VA 3T2OA 2R1WB 5EBLB 1J5DA 3CMGA 4NQTA 4AOFA 3QUHA 1K8IB 4FCHA 1KIPB 3CNKA 5INDA 4EN3B 5FYKL 8CGTA 4G9FB 1AGFA 5D7JA 2CKBL 3MDJA 4XAKE 1QLRB 3FT3B 2C4FT 1RUAH 5DEZA 1BQKA 1EZVY 3ZL4L 4G8FB 4AE0A 2AQTA 3BVWA 1BAGA 2JI3A 3CSGA 4YBLB 1RZ7L 3D39A 3MLWL 4S1DD 1MVUB 3AG3B 1YEEL 4FGMA 3GLZA 4KRMB 3E2HC 3JBG7 4IU3A 4LCYA 5I28A 2VXSH 1NUFA 5CSBA 1P53A 5E1AA 1JPSH 3MLZL 5J6HA 3IDMA 1FBIH 2EDTA 4W9GC 2EEBA 2BVEA 5LKNA 1DVZA 4FHJA 1HFUA 1OAZL 2YPVA 1VDGA 4K3EH 3L3DB 3FSVA 3UTTE 2D8KA 4FC3E 4FQPA 4QJ3B 1KCVH 4PIBA 1J10A 1YMME 1TXKA 1EFXB 1KGXA 5DTFB 1MG2C 5C2BL 3EUDA 2R69H 1UD5A 2F61A 3H42L 4S1QL 4WTZA 3VFNA 3OL2A 2R9HD 3DVIA 3QG6B 5DZAA 5EU6E 2R0ZL 3PAZA 1E4XI 3F2LA 3VTTA 1DSYA 2C1PA 1B2WL 4ZOCA 1XCTB 2J6EA 5ETUA 4D9RE 1SN5A 2AK1L 5D7IF 4PJ8B 1V3LA 4CU7A 2HRPH 4KDTA 1JUFA 1T66D 3APFA 3WNJA 5F1SA 3ZKNC 4AENB 2OTPA 1TJXA 3CDFA 4TSAH 4FE9A 2EVJA 5GRYA 3EOTL 3T3MB 5DVKA 3BGAA 1JN6B 1EO8H 4GEIA 2CBMA 4J4PC 5KBNC 4XNMB 1AZCA 3NJMA 5MENB 1ITCA 1FH5H 3JV4B 2XU9A 4HGMA 1LK3L 4NO5B 5BZZA 3NFNA 1LDSA 2SEBB 5I0WA 4YDLC 1MOEA 1CT8A 3OSVA 5E00A 5E51A 5I73C 5INDB 2LE9A 5D7JB 4BZ1A 5D7KD 2AS5M 2Z35A 4JANB 1SM3H 1RK7A 3U2JA 2L0DA 4X4XB 3OLGA 4I89A 4HC1L 1GS8A 4PRAA 3NCYP 4LT7A 5EEZA 1T4WA 3MUHL 1A0QL 2V9TA 4IU3B 2C3WA 3JWDC 4JPQA 4RISL 2YD8A 3U4BH 5E1AB 5J6HB 3VDBA 4WO4C 2EUXA 1TTRA 3PQYD 1U36A 3WTVA 3IMTA 4BK5C 4HWEH 4MQ7A 1PYWA 2X4QB 4O2EB 4CBZA 1JPTH 3TPUA 1I8IA 2ZUQC 4J2QA 4U3SA 2OXGA 2CCWA 3KYNA 4KU1A 3RWEA 3T0EE 5G5DB 2DQDH 4OD2A 1LO0L 3VMPA 2AFNA 4AQEA 4GO6B 4AYBA 5KYWA 4OGYH 1OCCB 1S9VA 1F6AA 3JT0A 3W2DH 2C1PB 2BY3A 2QL1A 4ENZA 1A7NL 2XA8L 2DI8A 4EKXA 5ETUB 1A6PA 1CGYA 3QEGL 1RJLB 3M17A 4HIJB 4GAFB 2CJ3A 5EEWA 1JZIA 5I71C 4LSVL 3K46A 2GIYA 3BW9B 4UAOC 2ARJQ 4N0CC 3WYRA 3LZPA 5C6TH 2DQHH 3RFRA 4JO5A 2J6EH 2J8UA 2FEEL 3GTTA 3X3GH 4M6AA 4P2OA 4LAQL 2DL2A 2D73A 4NX0A 4CW1B 3DECA 5HD8C 2VB5A 4WV1B 1A6UL 5DMGD 4FA6A 4NXSA 2OL3A 3KR3L 5J0BA 2CHWA 2CJUL 2E74C 4J1UA 4XVJH 1ULVA 2J1ZA 5KYYA 2EDWA 3GO1L 4XVUC 1CT8B 4FZ8H 5IW1A 4JFFE 3FSOA 5CLWA 3Q48A 5DQJA 5GSRB 1QQDB 2Z35B 3BIKA 4UDUA 1JGDB 3VGBA 4TSBH 5F89A 5CGTA 3HG1A 1LL1A 3UTSE 4UMSA 3QXAA 3TIEA 4BFNA 1A4KA 5B39A 3EO9L 4HBCL 4PRAB 1SMDA 2N1KA 4G59C 3FSZA 3GLDA 2CZNA 1S3KL 3EYUL 3ZU8A 3OJ2C 4G6AC 4BZ1H 1R19A 1IM3D 4LPWA 4KUCF 5D70H 2VDKH 2ZAGA 4X5WA 2J57A 4JHAL 2YJQA 3MRBA 5DQDL 4QOKA 4R5VA 4WEEA 4MQ7B 3N40F 3G04B 1E7VA 2O5YH 4UQ3A 1Y1DA 4YO0B 1G0DA 4WI0A 3KLDA 5EOCJ 1A3RH 1I8IB 2PETA 5LCVL 1IT9H 2QSCH 5IROC 4U3SB 3RWEB 3KYNB 4P57A 1EH9A 1CU4L 4OD2B 4AQEB 4NERA 5KYWB 4HUCA 1DBBH 1SXAA 5FV2A 2AJZA 4V33A 4YDKL 7TAAA 4Z7VA 1PX8A 1FZJB 1CVSC 1GL4B 2Y25A 3A21A 1KN4H 3ZHFA 1D5BA 3T65A 2HJFB 4K2UL 5D7SH 1MQKH 2AMUA 1J1OH 4HPYL 3HC0A 3L4WA 1S7XA 3M17B 4JM4H 2WBXA 2ATKB 3DBSA 2E4FA 5C08E 3RHWK 4UTBL 5JDSA 2LLLA 2JNZA 4AIXA 4M6MH 3N1QC 4DUXA 2IAMB 4PV1C 5J6SA 2JJVA 2ENYA 1OGPA 2WV3A 3MZGB 1SRDA 2CCVA 1FNGB 2ZG1A 1E3XA 5DFVC 5IQOA 4HIHA 1KXTB 4U1MB 5C0RH 5DRZA 4JVPA 5GZNC 1EZLA 2BSCA 3QFJB 3RY6C 4J1UB 1ZE3C 1MFDL 1FL5A 3D69B 3GMPB 1IE4A 5IW1B 5TDNA 5DQJB 4XXDA 4DPBX 2DQEH 4ONHB 3BIKB 4UDUB 1H3TA 2HKHL 2OL3H 4HF5L 4B27A 2Y23A 3QXAB 2XKSA 3TIEB 5T1KB 3W38A 1YY9D 4QRAA 3DMMC 5T1DH 2UXGA 4NIYE 3UDWC 3DX7B 4L3FA 5GXBB 2EEDA 5ADPH 4HUXB 5E8EB 4FQHA 3ZUCA 4X5WB 1IC1A 1J87A 3FSAA 4CNIB 4OLWL 4QXUH 4QOKB 1OP3K 3N85L 5DD1L 1XGYL 5BW7A 3DBXA 3TO4A 2AJUH 4WI0B 3S3PA 5CJ8A 1YPZF 4P2CG 2G3ZA 2JVUA 3O9WB 5F3FA 5BRZB 3VCLA 5FV1L 5BMFL 3OPZL 3RL1A 2MNJB 3D50A 3LB6C 4BXVA 2DQ6A 3C6LC 3FPXA 1EWHA 4QRSA 2XPYA 5LO7A 3PWNB 4UT6A 2RAMA 2JKIS 2PF6A 4Z5RA 3T65B 5IZ7A 4P4KA 4GSDL 3KXFB 3SB3A 4HGWA 3JWOH 4PLKC 2HFEA 2ZPKL 1OLLA 1S4IA 3IXTA 1DQKA 1W8EA 5JDSB 1CLCA 3SDCD 4QTIH 4GG6B 4AIZA 1Z9MA 5HJBA 1Z9PA 2VLMD 3WMPA 2LV4A 2ZZUT 2BRRL 4P04A 1FV1B 4PJFE 3PJSA 2X0WA 1J8HB 1B0GB 5DRZB 5DJ8B 3LKRB 4P2RD 3AW5A 3EJYC 4GAJL 4RH4A 1MJUL 4LCIH 2IOOA 1IMHC 2JKWA 1FL5B 2N7SA 3D85D 4G7YH 4YX2L 1N10A 1UZ8A 1MFNA 3IU3A 3B1TA 3L81A 5TDNB 3S5LA 4APXB 3O45A 4QF1B 4HZLA 2WTPA 4XXDB 4ZTOL 4NC1E 2KHAA 2WQVA 2GPZA 4ZS7H 1JNNH 1N5YL 2NQ3A 4X8JA 1Q0YL 2F54A 1GGUA 3PY9A 1OAYL 1TU2A 4YZFE 4TNGA 2QQNH 3AABA 5I19L 4FMKA 1NCIA 1SUHA 1I3RB 3JVFC 4FQHB 4P2AA 4M4RB 4XPFH 1QSFB 1X44A 4AYDC 3ELQA 4L2LA 2R59A 1X5GA 4ZUSA 4YJZL 2VJXA 1PZ3A 3DBXB 5D6CA 3TO4B 4LRIC 5CCGE 3MJ9A 5HJDA 2EIJB 1OEZW 4KKQA 4P05A 3G08A 4D7BA 1ORQB 3PGFL 1CXEA 3VCLB 3UZEC 4AK2A 3EXLA 5FB8A 1F58H 5LXVA 2ED9A 1EAPA 1BMWA 2IWKA 4H8UA 4BHUA 3QQ4A 4EI0A 2J44A 2VXTL 4Z5RB 3BQVA 4P4KB 4WWKA 4KQ3H 1C7SA 2A38A 1JTPA 3DX9A 1BF2A 3MOAH 4PJDE 5LQBL 4B5EA 2EECA 1BQRA 5FCUL 3FUIA 1TITA 5JPMC 1ND0B 2OJZH 3D4YA 4KXZH 4LKXA 4PJHE 5DUPH 5E4IA 3UACA 4UT6H 1MHPL 5AZEL 3PJSB 3MLSL 4RAHA 4PJ5B 4HEPA 2Q86B 4OM1H 3NRQA 1PY9A 1YYCA 4FKEA 2QFRA 3JV0A 4ZMVA 4AEIL 1VGEL 4HGKC 1W72A 1ZS8A 5JQHC 1TTCA 1RULL 2Y2YA 1A9VA 1UZ8B 3S5LB 3IU3B 3LQMA 3O45B 3A24A 4KGLA 4HZLB 1G9NC 4KH9A 4GRWB 4NOBA 4L29B 1KB5B 5DU7A 5KSAC 4PHXA 1SEBA 1N4XH 1OM3L 4ATWA 4X8JB 4MVBD 2VR3A 2C1OA 5DDHA 3PNRB 3CIQA 5IFAH 2A77L 2CHXA 3RNKA 2DMKA 3GD1C 2P80D 4MKMA 4P46A 3V4PB 4Z23A 4H1LA 4JZJA 5AB2A 2WYTA 3O4OB 4GRWH 4X8XA 3S35L 3HC3L 3CVHA 3EO0B 3PV7A 5LGHL 3WOVA 4LPTA 3OLEA 4P5SA 1QVOA 4DNLA 4PJXB 4EI5A 3KEHA 3UG3A 4PIRF 2C7FA 4NZDA 3QYCA 3CPLA 1ITBB 5T3XH 1IFHL 1QEXA 2WWKT 5HHQA 3V9FA 1M9WA 3KBPA 5GGRY 5CIPA 5ACLA 3S8WA 3G08B 5A40E 3VXRD 2XWEA 3FO2A 4PJFF 2VLKD 3O2WH 4F92B 5FB8B 2BFVL 5E24E 2ATAA 1EAPB 3BPLC 3QQ4B 4W6XB 3JV5A 2CNYA 1AIFB 1RZIA 1TT6A 3MJ9H 4XO5A 1S46A 2B4CH 3LPOA 4M5YL 4Q9RH 1JV2A 2AJVL 4LDEB 4OUUA 3DDGA 4RAVA 3HFFA 1SOSA 3ZTNL 4N2GA 5FYJH 3W9EA 3PHAA 2UX6A 2XNAA 1FPTH 2ZWZA 3KVPA 3QQ9C 4LIQL 4DW2L 4L1SA 2OMBA 3OQ3B 2GJ6E 3I9GH 2HWZL 2EACA 4KHTL 1TEFA 3THMH 3ZDZF 1N6QL 2ZP8A 4C8XA 4F7TA 4R8WL 3VU2A 2AXFB 3B2UD 4QHNB 5FECA 1YDPB 1ESOA 1X5KA 1W72B 1PFCA 1ZS8B 2K6YA 4YE0A 1UHVA 3KS0H 4LLYA 2ZNWA 3APCA 2O72A 3IPEA 2YXVA 1L9OA 1U3ZA 3C6EA 3HNVH 5HHNA 5A1AA 2C1OB 3X3FH 2BIMA 5DDHB 2IV9A 4Y8DC 3CX5K 3SE9H 5EF0A 3E6HA 1W72H 3X11B 2F58H 2WO3B 4BH7A 4P46B 4H1LB 4N5ED 4JZJB 3IS1X 5AVUB 3CVHB 2AJXL 1Q1PA 1JYVA 1WEJH 1TYEB 1QVOB 3U48A 4EI5B 4PTUA 3AWEA 3O2DA 3RWGA 5CEZH 3IDXL 4UILH 1EZVX 3TA3A 3CPLB 3EJTA 3RIFK 4RETB 5EIVA 5IB2B 4H1LH 3MPCA 3C60D 4PY8J 4X6CE 5CIPB 1AOZA 1WHOA 1RJYA 2X28A 1C1EH 2V5MA 3CVHH 1UA6H 3FN9A 3KNBA 4DTGL 3EIFA 3FO2B 3POHA 3BLBA 4LL9A 5CINL 4A2HA 5FKPB 4E0RA 3KEDA 2D3NA 5K1VA 1PD6A 1D2PA 1GIGH 5F7NC 1JI1A 4HUWA 4ES9A 4IMLB 3IDYC 4G7SB 3TF7C 2B1AL 4RGMC 2AJSH 5FUCE 4ALAH 2OMUB 5CIPH 5SWZD 1JV2B 5F72S 1T1YA 2P43B 5FDYA 2AGJL 2HYMA 3WS3B 5GGQH 1WZMA 5ILTL 3QJTB 3HE6D 4IS6A 4ZW7A 1W16A 4HX1B 4U7MA 4XR8C 2FNBA 1XGQA 4MNQD 3B9VA 3W5NA 3QUXA 1UXWA 1OP3H 5INCA 2H47C 1COBA 5DC9B 3OKMB 4NO3A 5KTEH 2UZIH 2VERN 4F7TB 5IQ7L 2W0LA 2IPKA 1XF3B 4CADB 3NTCH 3NESA 3QIBD 3NEXA 2HVKA 1LLAA 1NDMB 3OWRA 2O5ZL 4X2UA 4LLYB 4JHZA 3VFUA 2GY5A 2CR6A 1MFEL 2DMGA 3O4LE 2P8LA 5CLZA 4S0TD 1JL8A 4Q9QL 5HHNB 2QBWA 2FTAA 3QDJE 1NFDE 1MWAA 5ITBH 3E6HB 4PJIF 1MCBA 3P3TA 2VQTA 3UROR 4QNPF 2X4SB 4U6VL 5DR5H 2J4WH 4RWYL 4OZGF 2X89A 4ZNEA 5JHAA 1U6AH 1U8QB 2R4SL 2UY6A 4R83A 4GUCA 4GRLD 4RGOH 3CLEH 1IAIM 3T2NH 1VIWA 5M95B 3U1PA 4PTUB 2UXVA 1NINA 1KB3A 3QPQD 4K7FB 5C07A 1N6UA 5F1KC 3CHSA 1IGTA 2VXVH 1AI1L 3SBRA 2XZQL 2NX5D 4DP4X 2YD7A 1XAUA 3L2MA 4H88H 4LRNH 4YUEH 1BJ8A 3DURB 3H6JA 3Q8CA 1CE1H 3NPZB 3KNBB 4L8DB 1H3WM 1HHGA 5IB5B 4AY0A 5ISZE 4J5VA 1IILE 1JNLH 1D7CA 2CH8A 5D4JA 3O2DH 2A9AA 1KJ2L 5K69A 2WZPA 4JY5H 2GSIA 4YHOL 1FDLH 2ZCKL 5H37H 3ZN6A 5J56B 3T08A 5IHUL 1JDCA 4J4PA 1E65A 3MBED 3ULUE 1HSAA 1U92B 4DEPB 1I8MB 4AKOA 3LVEA 3O81A 4KKAC 2Q8AH 2IWGA 2BWIA 5BOZG 1VGKA 3WAKA 4M5TA 1XGQB 3UX9B 4I77L 4IOFC 3QUXB 2YWYA 2G2RA 5INCB 4NO3B 5I5MA 1DJWA 4GSRA 1ZHLA 1QKZH 1T3FA 4M62L 2Z4QA 2IPKB 5HHVL 4G7VL 5IMMA 1QFWL 3HG0A 1WCBB 3F6LA 1QLFB 3UMNA 4JFDD 3CVCA 2H2PC 1UADC 2YMXH 2P4AB 3VFUB 2FIKB 4QRPE 3CPUA 3C5ZD 2CLRB 1AE6H 3PS6A 4P23D 2VN3A 4FFZA 5DT1H 1HQ4A 3O11A 3ZZ1A 1E6OL 4JM2A 4ZQTA 1DBAH 1BZ8A 1C7TA 2CSPA 3DX3A 1J8KA 4NQDD 2XTJD 2GI7A 4BK5A 4IBLT 1DCEA 3DTXA 4HV8A 2Q6WA 2UY6B 3JTSB 4BSVA 1BJ1H 4PS3A 4IIQC 4ZFGL 3BAEH 1PS3A 3MGTB 5EC2B 3AREA 2L7UA 3WFZA 3K5RA 3A0OA 5C07B 3CAFA 3ISYA 3BHBA 4R26H 1M3JA 1TSHA 3TYGL 4LSDA 3N42F 35C8H 1EEYA 4AQOA 1UJ3A 4IGBC 1UACL 3DJRA 2IPUG 1IQWH 3I3BA 4QRRA 5IB4A 5EN3A 4K0OA 3VI3F 1EPFA 5I1HL 1WAEA 4XP4L 1HOCA 5HHOD 3QO1A 3SGEI 3N9GH 1MCSA 1RVFL 1N26A 4HK3J 3ARQA 3VD1A 3FTUA 5CD5C 3OKDB 1N8OE 2IFFL 3MUJA 4GNKB 1HSAB 1JFHA 2WWMD 2TSAA 3ULSA 3HJ0A 1SQMA 1AAJA 3K1DA 4HFUL 1NFDF 3WFDL 4CVZA 1SJVA 3VI4B 1A5FL 3OX8B 3KZ8A 2G2RB 2QKSA 1NMAL 3O6FD 4KHXH 2G2PA 4OKVA 1M05B 2Z4QB 3GXUB 4RCAA 2B0SH 2D9QB 3NQIA 3W39B 3BPNB 3II3A 3SCMD 4ZFOL 5HI3C 4LF3B 4N8CH 4YXLL 4LLVA 3BCDA 4FI8A 4XI5D 3ZRSA 1T1WA 4JN2A 5FDWA 4YXHH 5JZ7D 2CIIB 4GFTB 2KLTA 3O11B 4I0PC 4RFEB 5B22A 4JM2B 4Y4FC 3EYSL 1QRKA 4XOEA 3ILEA 1U8LB 2A9DA 4P9HC 1FNHA 3NA9L 5HDBB 5CUSH 3PQYB 4N3UA 4OCSH 4WHYG 3MXWH 5DK0A 2JLPA 2NXZC 3ROOB 4BE5A 4ILDA 3JWDH 3GDBA 5IROA 4FFZH 3LTVA 3AREB 3GHEH 3NCCB 3D2TA 4U4BA 4JKPH 3T2QA 3I6SA 1AR1B 3F7LA 3ULUF 2QQQA 4ETQA 1NH6A 2O5NA 3E9UA 5C0GA 3BHBB 5CGMA 4H8QA 4JMNA 2Q1EA 3VE0B 4C4KO 2ZSVA 1EEYB 1V5JA 4FI6A 1UJ3B 1QTPA 4E9XA 4RX4D 4Z7OF 3NZUA 4J3XA 4E42A 2ADGB 4LLDA 2UVEA 4QRRB 5T1LA 1LK2A 5IB4B 2YPLD 3BO8A 4PJGE 3FZUD 3J2PA 4KI5F 4Q6IC 4TNVK 4H7VA 3CU1A 4JFYA 2YA0A 1HOCB 5IMOA 3B8YA 3QEQE 2CUHA 4FTDA 2VR8A 1E0OB 1FFPA 4YVNA 3N43F 5GRWA 3E7JA 4NJAL 3LNFA 4X0NA 2ZOLA 4XNZC 4Y7OC 4KK9D 5D72L 5BS0A 3X1BA 5D2LA 3ULSB 5GZNA 4BELD 2E6QA 1SDAB 1JPFA 2WHVA 3OQRA 3RY6A 3T77A 4CVZB 5B3JE 4PG9A 2KQMA 4M1CC 1XF1A 5JW3L 4XCEA 5ABAA 3FUEA 1NWPA 3ZE1E 3UJTL 4K3HA 4X5QA 4G6KH 4W6WB 5CEXA 3LD8C 4FNLH 1E8XA 1XH0A 4UT9H 2J1XA 1MFBH 2I9TA 3HG2A 3GLAA 3NIDF 2FEEI 5AENA 5DD3L 4P5TD 1KNOA 1DFBH 2TSBA 3DMMA 3UDWA 1NL0H 4ELKA 1K4DA 1GAFH 2B8OT 1CGTA 3MV7A 3PP3H 4QXWA 4UT7H 4ZD3H 4UOW0 5E9AA 3AY4C 5DD6A 3F84A 5GIRB 4MBRA 2FBRA 1QSED 3F85A 1PLGL 2B20A 5D2NE 2YOAA 2WVTA 3QA3B 2DD8H 3OG4B 1RURH 2VKWA 5FF6A 4IDLA 3SPVA 3T0EC 4ZUWA 4KVCL 5C0GB 2HKAA 4QD2E 2WVVA 1DQLL 4P8QA 2H3NA 4HT1L 2ZSVB 5I82A 3VVWA 1GSKA 3C6LA 2W0PA 5T33L 5J6GA 4U1SB 2XCMC 4MQXC 3TH2T 4E42B 2I26N 4LLDB 5C3IA 3AJ7A 4HCRH 4NN6B 4G8GD 3VFOB 4DAGL 4F2MA 5T1LB 1LK2B 4PS7A 1FUNA 3WG7B 4PBVC 5C3TA 1HXYA 3NZHH 2DY2A 1CICC 4JFYB 2AQQA 2CE6A 4J3BA 1M7IA 5IEHA 1DUZA 1IX2A 5MP6L 3PGDA 3LEYH 4NZTL 5EC1B 3N91A 4JG0L 5MI0B 3S4SA 2ROYA 1QNIA 2X2JA 3DSNA 3KPTA 4PJAA 5BS0B 3WD5L 1OOWA 2B1HL 3QUZD 3V55A 5JW4Q 3A4DA 3V0FA 3C6SA 2VMFA 4GKLA 4PG9B 3C09C 2JJTC 4BUGA 4OJFL 4BFBD 1TVHA 1OSPL 3L7EA 1MDTA 3KPNA 2HT3D 5ALCL 5C0AA 5KUMA 1HZKA 4R0LC 4ZX4A 2D7MA 4DOHE 2WXIA 4W70A 4YSQA 1ZV9A 2IV8A 1RP8A 5F1IA 1GA2A 2HKFL 1R1CA 4YK4C 2IDSA 2BVQA 3VH8G 1I3GL 3H9SD 3ARYA 4BFKA 5EG6C 3GZKA 1K4DB 4FL4B 1IBGH 3MV7B 1V3JA 2C3XA 2RTTA 2WXOA 4K3JH 3TBVA 3ROLA 3NPSC 1GGCL 4PJGF 2WMPA 1GCFA 4MAUH 5FGRA 4LRIA 3FQNA 4WHTA 5FF6B 4HQQH 5C0IA 3FUNA 3SPVB 4ZUWB 4U1GB 2FIRT 4L9DA 1IGIH 1OF2A 3UZEA 4LSPL 4MJ5A 5IMLA 1U8JA 1P69B 2ESVA 2H3NB 4NQCA 4TUOB 3D09A 4NZRH 1G4RA 1G1CA 5HY9A 4KK6C 2ALAA 3IXAB 2VC2B 2A6KA 1G94A 1QYGH 3BKYH 3MVSA 3WJJC 5LBGA 5JTWA 4D8PA 1JZ2A 1T80A 3ZE1F 5JW4R 1U8OA 5BO1H 1M6UA 2KLRA 1HXYB 2DI9A 2PNDA 2Z91B 3FCGA 1NM9A 4PRHE 5JPMA 1FAIH 4ZZKA 3LKNB 2ZKYA 1HT6A 4MAZA 5EA0H 2ED7A 3FYIB 1PLAA 2VC2H 1WFJA 3EYOA 4AUUA 3S4SB 1XZ0B 4KAQL 3DSNB 2XTLA 2JI1A 4PJAB 1E6JL 5F7UA 2H9GA 3QIWD 1CGVA 4P2RB 3OXRA 2C4FU 4LLQA 1MRFH 4JPWH 5IK3B 1SYVB 4UNIA 4Z78A 3K7UA 7CGTA 3D85B 4OZHB 3MV8E 1MF2L 3WJMA 4LFHD 1OTUC 4K71C 4LB8A 4HWNA 4M61A 4K55A 4TNEA 2L4OA 4QJ5B 4HD5A 2XQBH 2DQCH 4QHKI 1V27A 1DEDA 1QUNA 1KYAA 5H35A 2C9VA 2VR7A 3CQQA 4MMXC 2VNCA 4NJ9H 5F3BA 4TKWA 1YEHL 5F1IB 4OCYH 1NCCL 5FM8A 4FG6C 5AEAA 3IPBA 1ED3A 3LMJL 4GQPH 1MEXH 1Z7JA 4ZSOE 3QIUD 1UCTA 5GRVL 2DIEA 1IZJA 1EJ8A 4M7LL 4YDIH 4BV1A 4KMLB 4V1DA 4B7LA 4FYSA 1UXSA 1ID5I 3O6LH 1ZOXA 3ISWA 1GHFH 3TN0D 4GOSA 1IGMH 4ANVA 1T04A 3ROLB 4DP8X 2DICA 5JPNC 4UQAA 1JWSA 2WMPB 3RKPA 4Y19A 4L4VD 4DIXA 5TF1L 1KLUA 5IHBA 4JREB 4KMQA 1MH5A 1FGVL 4NQUA 4OIAA 4OLYL 4WHTB 5C0IB 1F2QA 1BF8A 5JIDA 4TPRL 4M6OH 4WUUE 3EG9A 3ARGC 3PHOA 5IMLB 3LH2H 4UB0H 5D7LA 1U8JB 2ESVB 4NQCB 5DVNA 5A2CA 1BWWA 3L3JB 4N2NA 3FB7A 1OAUH 3KPPA 3QG7H 1HYRC 1L9QA 4N0RA 4YHIA 2QSQA 1Q0XL 2APFA 4FEIA 5E8PB 4TM9A 5F2FA 2FGWH 1X5YA 2JK5A 4PJ9D 5FUOL 3ZYIA 4B3EA 4D8PB 5C0CD 2VMDA 1Z3GH 4CVUA 3G6JB 1UWGL 4XN5A 2FSEA 5IVXF 1A7QH 4NHUB 2RFXA 3MRMA 3V6ZA 4YHPB 4DGIL 4NQEE 2ISDA 1DCLA 5B1JC 5MEPA 2AF2A 2C7UB 2W81C 4W6YB 3ZKMD 4YEFA 2H9GB 3RVVC 3BISA 2PWGA 1CB4A 3QUML 3OXRB 4PBDA 2J6WA 4OCXH 3RWFA 4N8UA 2CDEA 5DD5H 4DH2A 3MO1A 4NC2B 3WJMB 3H9HB 4KZDH 2YWZA 5CGYC 5DJ6B 3LS4L 5EOCL 2BOBB 3QRLA 1QUNB 1CZ8L 2NXYC 4M7KH 5AVTB 2AEIT 5TE6H 5TK4A 1ZLSH 4AMKL 3VXQB 5F3BB 4PB9L 2WO4A 3RU8H 5T5FL 2R1YA 1VZIA 2PYEE 4JRYE 1M42A 4ZI8A 1ZLVH 1YY8B 2A6JB 1BVLA 4I3SL 3R7QA 2DJ4A 1UXSB 1UB6A 4N0UA 4OI8A 2NYZA 1PBYA 1UB5B 4ACPA 3JWNC 2NY6D 3FCSA 1JWSB 3S5YA 4Y19B 2CR3A 1A7OL 1KLUB 1MH5B 3INUH 1M56B 2X40A 1ZIAA 5GGTA 3FB6B 4NP4H 4QKXB 1LYQA 1I1AD 3EG9B 4CSSA 2G60H 3QJSB 2X9ZA 3PHOB 1TF4A 5AZ2L 5D7LB 1KBPA 4BZYA 4IDJL 1DO5A 1TZ8A 3BT0A 1U8CA 5JXEC 2F5AH 3FB7B 3UO1H 4AQAA 3L8QA 3X13A 1M7XA 2JK5B 1A6ZB 4LSUH 4XBMA 4EBQH 1TEGA 3MRDB 1UM4L 1NKOA 5ES4B 5E70A 5CWSB 4Z7WE 1WBYA 1VEMA 2ZE0A 2RFXB 4WK0B 4LSTH 4MB1A 2DLGA 4OFPA 4XX1G 3HS0C 4GT7A 5DZOA 2CKBA 5C70A 2XN0A 2C9QA 1K2DA 1QG3A 2W88A 4UQ9A 5E5LA 1QZ1A 2DTSA 4LHQB 1ZTXH 3IYLW 4Q6YA 2DQUH 3V4VL 2B5IC 1CXHA 3BKCL 3II1A 3IGAB 3SJVA 5HYJA 3C08L 2ZX5A 1L3NA 3Q06A 3VG0L 1DVFD 5EF2A 4PJ7E 1KYOJ 5F97E 3REVA 2DM7A 4FFTA 4PJCF 2XC8A 5A2IH 1F90H 3ZDXE 1S9XA 3H4HA 4U3CA 3L7FB 1EHAA 2VM9A 4L8BB 4E9SA 1IC7H 3ET9F 2LOEA 3BE1H 4PGDA 5CJQL 4MA3B 5I1IL 1WA2X 4LOUD 3FCSB 2CNZA 3L5WA 4X4MA 3HB3D 1P1ZA 3V6OC 3MNZA 2P9RA 3R18A 5EUOE 1QBMH 3U1SH 4KITB 1UYWL 1X7QA