5G4OA

Crystal structure of the p53 cancer mutant y220c in complex with a trifluorinated derivative of the small molecule stabilizer phikan083
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
196
structure length
196
Chain Sequence
b'SVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKLFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERCSDSDGLAPPQHLIRVEGNLRAEYLDDRNTFRHSVVVPCEPPEVGSDCTTIHYNYMCYSSCMGGMNRRPILTIITLEDSSGNLLGRDSFEVRVCACPGRDRRTEEENLRK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CELLULAR TUMOR ANTIGEN P53
publication title Harnessing Fluorine-Sulfur Contacts and Multipolar Interactions for the Design of P53 Mutant Y220C Rescue Drugs.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 48
structure length 196
sequence length 196
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00870 P53 P53 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 5g4oA00
2BIMA 3WTSA 5ABAA 4AGLA 2ATAA 2AC0A 5G4NA 1EAOA 3D07A 3D09A 4GUOA 3TS8A 2J1XA 5AOJA 2J6WA 1EANA 4IBZA 2IOOA 2GEQA 1T4WA 4L0YA 2XWCA 2BINA 2J1ZA 3D06A 3KZ8A 3D05A 1TSRA 2H1LM 3Q05A 1GZHA 2P52A 5ECGA 4IBYA 2AHIA 4LOEA 3D0AA 1EAQA 3US0A 5AOLA 2X0WA 4QO1B 2FEJA 3VD2A 1HJBC 4L18A 4AGQA 4AGMA 1GZHC 4G83A 2WGXA 2RMNA 5BUAA 5KBDA 3WTYA 3US1A 4G82A 4AGNA 3WU1A 1TUPA 4GUQA 1HJCA 4HJEA 2PCXA 1E50A 4IBSA 1YCSA 4MZIA 1UOLA 4XR8C 3VD0A 3WTTA 5AB9A 3KMDA 2XWRA 4IBVA 2J21A 2ADYA 2VUKA 1H9DA 5AOKA 4IBTA 1KZYA 4AGOA 3QYMA 3EXLA 3Q01A 2J20A 3IGLA 5G4OA 3VD1A 2BIOA 5LGYA 4KVPA 3WTVA 3Q06A 2IOMA 2MEJB 2BIQA 4A63A 4IJTA 1IO4C 4IBUA 2BIPA 4LO9A 2J1WA 4LOFA 2X0VA 4MZRA 3WTUA 4L0ZA 3WTXA 3EXJA 2YBGA 2IOIA 4IBQA 3WTWA 2J1YA 1CMOA 5LAPA 1LJMA 2X0UA 5G4MA 1HU8A 3QYNA 3D08A 4IBWA 3IGKA 1CO1A 5A7BA 4AGPA 5AOIA 5AOMA 2OCJA 3ZMEA
chains in the Genus database with same CATH superfamily
1H9VA 2GUOB 1AXTH 1I9IL 2QSVA 3SY0A 2XUWA 2O61A 1UB6B 1CU4H 2WO2B 1HZKA 2ATAA 1EJ8A 5LHDA 4E0RB 4KZDL 5IROD 4JCMA 1R3LA 2ZUSA 2H2SC 1XT5A 3RFRA 2K6YA 2BIHA 1WWCA 1G7HA 5CGYC 3IWUA 5EUOF 3RJOA 5IT2H 3CSYA 1QMUA 1TOXA 4NENB 4TULH 5E1IA 3PY9A 5JNYA 4X99B 1KYFA 3QUZA 3BLKA 3EO1B 5ESAB 1J0HA 2YKKA 3HB3C 2GJJA 4ZZKA 2NY0D 2R2HB 2Q3ZA 2XTLA 3D30A 4GI8A 3D87B 3BO8A 3IDYC 4J6RH 5IREA 4HIXH 4KMLB 4KXAA 4X8JB 1L6ZA 2BY3A 2FSEA 1T2XA 1B4JL 5I6XB 1E8XA 3T6WA 1MQ8A 1ZAGA 1L6PA 2WGNB 3G3LA 5FYLD 1IBHA 1X9UA 3GMMB 3POHA 5SV4A 4PVBA 4HIHB 3BDBA 1F8TL 3UTSA 4OLUH 4QOKE 5IB4A 1ZSHA 2XV0A 3V5HA 3T0XA 5FEBA 5BUAA 1JHLL 1D5XA 1CXFA 2JWYA 4GQPH 3ISRA 3NCMA 4TSBH 4AGNA 2MSPA 4F7EA 5HVFB 5BNXD 1PW3A 4GRLD 3HLAA 1NCAL 4FQQA 3OLDA 3P4NA 1M6UA 3B9VA 1D2PA 1D7DA 3O2DH 4FMFA 2PKDA 3HC4H 1MOEA 3APMA 4GXFA 4RWYH 3BKCL 2CDEA 2OTUA 4NFDA 2VDQH 5BXFB 5I19H 1KYDA 2DQJL 4L8DB 4WHCA 2YD6A 5C6TL 4KZ0A 3RUGE 4ZNEE 3C60C 1YN7A 3ZL2A 2IO5A 3QJOA 5JDJA 5I71B 1PDKB 3BSZA 3OKKB 4LU5H 4Y1SA 1KLFA 3GSWB 3H9SE 4N2LA 4Z7VA 4MD5B 1BIIB 4P57B 4PRHB 1Q94A 3HIZA 1NOAA 1KTRL 4QMEA 2EEFA 2FO8A 5DVKA 3ZT5A 1UYWL 2PTVA 5LAXB 1WVZA 3UP6A 1INDL 3WJLC 5CUSH 2R51A 4DGIL 2CLRB 2VLKD 5A16B 3EDJA 3Q8CA 2ED8A 5AZ2H 4ODWA 2VWEE 2AK1H 2NR6C 4LFHD 1QPPA 2W9EH 3AS0A 2R9HC 4X7EC 2YJQA 5DJXB 4LCWD 3VDBA 3MRCA 5D2LF 1AZBA 1V55B 2IH1A 4AUJA 3M1OA 5B7MA 4G6JH 3PWVA 1XGTA 1PZ3A 4QAWA 2IWEA 3FTSA 1CTNA 3QWRD 2W07B 5EORH 3NAAL 2ZUUA 3FQ1A 3HUJA 1WZ1H 3WDHA 2B5IC 4QI3A 3ULVH 5DYOB 1BX2B 3BT0A 1RUKL 4XN1A 4QR7A 4Y16A 3X12B 3S48A 3KYAA 3LSOB 2D3NA 5B39A 4MAYB 4PREA 5EFIB 2C7UA 2I85A 3T9WA 2C7FA 3E80A 3KDMA 4K3HA 1CQKA 3NJMA 1UKQA 4W4OC 3RP1A 3FFCE 4LASH 1U8KB 3PV6A 3PAVA 4GG8B 4P5MA 1LLAA 2Y07L 2FAUA 1U8LA 1DVSA 4GW5B 4NQUA 4UT6A 3DX6B 1EA9C 2P5WA 1GKEA 3I3BA 3MA9H 4LCWB 5BS0D 1FQ9C 3HVDA 4HC1L 2V33A 4KX7A 2ZNXA 3C5JA 1E28A 3DBSA 2QBWA 3OZ9L 3PFQA 3QEQA 1A21A 1CD1B 4JO2H 2LHAA 4LHUD 3NA4A 5LKNA 3WO4C 3P40A 1WE5A 4F57L 2J12B 4NOFA 4PRID 1AGEB 1NZRA 3PHQB 4JM2A 1M3IA 3LKRA 3KPRE 2HX7A 5ESVB 1EAPB 1DEDA 1MW3A 1A14L 1NMBH 2YO3A 5E2WH 1K2DA 1WO2A 2P8LA 2WQWA 5GPRA 4OJDH 3RWIB 1N8ZB 1OGTB 1Y18A 1P1ZB 5DHEA 5AD0A 2VJ8A 1BPVA 4YO0A 1XDTT 1YMHA 2V7NB 1BQ5A 1JWSA 4MZIA 1IAKB 5IUSA 4GQRA 3FUJA 2VDNH 5DZLA 2C3WA 3V8CA 1QLEH 3KLSA 3FTVA 1PX8A 5E9DB 1ZVSB 1DO5A 4P2RA 7PCYA 4OD1L 3PXJA 3HHSB 1YMME 3ZVVA 1JPGA 3QC5X 4YVNA 4E9WA 3IMVA 5GGUB 4FKEA 3OKNB 1IJNA 4YZFE 2O4EA 4Q9RH 3WE6B 2NNXA 2GYSA 3RWHB 2XC8A 4LP8A 4TQEL 2IWFA 4QHLB 1CICA 4LHUB 1SLUA 1BCIA 4PFEA 4POZC 4KZCA 4ZYKA 2XXMB 4UM9D 5DJ8A 4DKEL 5D2NB 3RWFB 2X6CA 4XP1H 5CEYB 3L3HA 5IOPA 1OHZA 1RI8A 3WTUA 1KTKE 2X70B 1E7UA 2FTAA 4NRZB 3S5ZA 1A6AA 1NBVL 4WWKC 4ESKA 4J3VA 4KHTL 1OPGH 4OLZH 5DHYB 4FJZA 4JR9L 4QUOA 4F20A 1JI2A 1KPVA 3GSNL 5LXGL 1GPOL 1I1FB 5DJCB 4JRWA 4R26H 3FW6A 1ML0A 3UAJA 5IMLA 5D8JH 3MCG1 2YBRB 3MV9E 3PWPD 4FQIH 1PLCA 5B8CA 2AXGB 4GQ9L 1FCCA 4UAOC 4APXB 4ZTPL 2CGZA 1TZGL 2G5BA 4GUOA 5I0ZA 4BQ8A 4OCXH 4PLOB 3C12A 1M2OA 4M1DL 4BKLB 2F58H 1W6WA 4XZUB 3L9RA 5MEPB 2C9RA 3WS6A 2KLSA 4IJ3C 4GAFB 3I6KA 5CZVL 5FYKL 1Y07A 2I9TA 5FFOA 1J0ZA 4NT6A 2OTWA 4HIJA 3IXAA 3HBPA 2ZPKL 3FMGL 1FVEA 3P4OB 3G6DH 2B08A 2WW8A 1I85C 4F8TA 1VADB 2JJTC 3KLLA 4TSAH 4TYUA 4YEEA 1G5AA 4MCYB 4AXWB 2CLVA 4F1ZA 4YFLI 2EVFA 3RIKA 3E6HA 5T33H 3HNVH 4QRTA 5G2NA 3PWPB 5H35A 1EVTC 3BHBB 1A8JH 3O3EB 1SJEB 2XTSA 2ETWA 2BNRA 5L4IA 1QLFA 4PCSA 2OJZL 3HI1A 1ACXA 4JX0A 5CCHE 4AMKH 1SDDA 5T3ZL 4N8VA 3QORA 5IB5A 3TNNA 1UM6L 3Q1SL 1QEWA 2A83B 2D31B 2DEWX 3B3BA 4JAMA 5F70A 5F7UA 2HWZL 4GUQA 1DN0A 2IJ0C 3D52A 5IVXB 5GRUH 1KCSL 3L4CA 4AUUA 4EF3A 1BVLA 1A66A 1I75A 2DYPA 5CHNB 4HAFA 5LJYH 1KC5L 1GKOA 4IMKA 5DR5H 3PV7A 5GGSA 4M4RB 3WJMA 1NBCA 1TQWA 5JORB 1P84J 4YUEL 1Z5LB 4XMTA 5AKSA 4IBTA 3V7MA 1A4AA 2FLRT 3DYMA 1KENL 1TVHB 2BY2A 5FHAL 3LQMA 4R4FL 4TNVF 3OX8A 4GMSH 5FXCH 4PV1C 3CLFL 3EYQC 2NCEA 5DTFA 1LILA 5TH2B 2HJKB 3SDCA 4FNLL 3Q06A 1M1XB 1J1OL 1RURL 2D0FA 3UDWA 3OAYH 3DIFB 3CBRA 2ZAIA 4ALAC 4GRWE 1SYSB 4DGWC 5CGMA 2AQQA 2EYRB 1KXTA 2BPBA 1WISA 3LKSA 2UV3A 1DDTA 1FA4A 4FG2A 1UXWA 3GSRA 3MCLL 1LE5B 1IU1A 5DVLA 3BT2L 4WUUB 2QKIC 3TF4A 4NO3B 3DECA 5KSAD 3X13A 4BK8A 2XVBA 3HI6H 1VFBA 5F9DC 1KLUB 2YQ2A 1ZLSL 1VJSA 3MBEC 4EQ3A 4LL1A 4YSOA 5AOIA 4KAQL 2OCJA 3H42H 4XBEH 3KYMB 1N5YL 4MXWL 1D9KA 3D9AL 2J57A 3P3TA 1D7BA 3BH8B 3U6RB 5LDUA 2BVPA 5JUEH 3BP4A 1X7QB 3LHAA 1NMCC 2FX8L 4XB3A 4BDVA 1XH2A 1WAPA 3A6CL 2GCYA 2R0KL 3EAKA 2VWEC 4KMTH 4CU6A 4GW4A 1TNMA 3LKNA 4WW2F 3QA3B 1CD8A 2V5MA 3VQMA 4DVRH 4M5SA 5T1KD 5K9KB 1AZZC 2X4TA 3WIFB 5KS9B 1N68A 1YQVL 1LO5A 2R0WL 2JKXA 4QHNA 2W94A 1AY1H 1JDCA 3RLSA 3G5VA 5BRZE 2QGDA 5KSAB 1B3JA 3CN0A 1EHLH 3HNTH 3BAKA 3MV7E 4RBPH 5E03A 4ZMAT 4CSTA 1NCWL 4YN3A 4NZUH 5DGRA 4NQEE 2EDNA 1YNTA 3IB4A 3KYKL 5GJSH 2FWOA 3B4NA 1CGUA 3IFPB 3CDCA 1ECYA 4WI8A 2WKLA 1SEBB 2KKQA 2F5AH 4Z18A 5IW3A 4JCLA 1OM3L 4LSUH 3UAFA 1IBDA 3PAYA 2YZ1A 5BO1L 4W9FC 2PMZA 1PKQA 4B7LA 4L3EA 3RYMA 1NEZA 1OAQL 3DV4B 3V9CA 1DFXA 1FNLA 1IM9B 1QYGL 5F1IB 3W0WE 5T1KB 1N0XL 4M43H 5CJXA 1FE8L 2DOCA 1LP9B 3QIWA 5AYUH 3WUZA 2OK0L 1N3NB 1FV1A 4LQFH 1T20A 3MMEB 3TO4D 3K72A 2Z93A 2XQ0A 1YPZE 1A65A 3U0WH 4KHXH 2A6IA 1MFBH 2FJUB 4FZ8H 4PW3A 1U8JB 3C6LB 1DQML 4KKQA 4V2CB 1U8MB 4LLDA 4F9LC 2APBA 4KX8A 2NTSP 4K3EL 2OXGA 4ZW8A 4UDTA 5BZXA 1PZAA 5C0GA 1T03L 2F54D 1CGSH 1TTAA 3UADA 5HYEA 5L2KD 4JKPH 2ORBL 4X6CF 2GBAA 1PPIA 4Z95L 3GK8H 5B1JA 5I9QB 4K07A 1WH0A 1NBQA 1FNEA 4P2OA 1D5MB 5JO5B 4HUUB 5JOPD 5DFVC 4G6KH 1DLHA 7FABL 3HC3L 1BQRA 4Z3TA 2WY3B 5B21A 1QFPA 1OAYH 4P06A 4MKMA 4QCIA 2AVGA 2L7EA 3CHRA 1FNGB 4YDZA 3ARBD 2WCGA 2R0LL 2YEZB 4JKNA 1KJVA 5DC0A 1J87A 1XH1A 2ZXCA 4WCYH 3HG2A 5FCUL 3SOBH 3MV11 3L13A 3PQYB 1CE1H 3TF7C 1J1XL 3QXTA 3PHOA 2GSMB 5AOJA 3V0IA 1ZMYA 1JGVH 1IBBA 1S4IA 3IETA 2PN5A 1DVUA 4XAWL 4JO3L 4LLAA 1X3DA 4N0UE 4RGMB 3CDGA 1YDPB 2XIDA 3AACA 3FULA 1S7WB 1GC1H 2P80A 2F54B 5I15L 4U1SA 3TIDB 2X10A 3BISA 4D8PB 5I0VA 3AUWB 4EKXA 1L9NA 5T5FA 5F21B 4BXSV 5IY5B 1IGFL 2J8UA 2F18A 3A47A 5FGSA 2L3BA 3SDXA 3TPKA 2BCKA 1A4KA 3O11B 1MFVA 3QJZA 3M86A 4R8WH 3MLYH 1HHGB 4WDIA 3VM5A 3S8GB 4IBYA 1HCVA 4OGAD 4D0BA 1N64H 4XWOC 4NBXB 4PI2A 3S5LA 1UFUA 5ICYA 2MQCA 2YEVB 1YAIA 1NSNL 3AROA 5A6MA 1KY6A 3MA7A 3FCBA 43CAB 4NZRL 7PAZA 4F24A 1DBJH 3BD4A 4L3CA 4TLKA 4HWBA 1KJ2A 4PJGB 4X2UA 2PO6B 3U2JA 4JY5L 3LMJH 4KKBD 3T6ZA 4G83A 1J8HB 1RJLB 1V3KA 3FO2B 2H32H 3VWKD 1YY9D 4W9GC 2VQ1A 3WOVA 4YBHA 1F6AA 1HJCA 4Y1TA 3NG5A 5FYKD 2B77A 3UJJL 3L7EA 1E50A 3SKMA 2EILB 4L4TE 4X98A 1GAFH 3L8QA 2HG5B 5IQ9B 3R1GH 1CG9A 3LN5A 1S5IH 3UYOD 2EDEA 4LHJB 1NBYA 3UBXG 5J12B 3BIAX 2FATL 2VQTA 4H26A 3AXHA 1BJMA 3L3DB 3GB7B 3MRJB 4ZX5A 1KOAA 3HMXH 3F6JA 4FXKC 4H8WH 1ADQL 4KDVA 1N10A 4JJ5A 5EO1B 4HUVA 3VYPA 4ZX6A 4JQIH 2WOBA 2XIIA 5C2BH 4XZ4A 3PL6A 1AP2B 3GMNB 2HRPL 5JHLL 2LTQC 1E90A 4OF8A 1UASA 5DZ9A 2XKNB 4C4KO 1TJGH 3HZYB 1ZGLM 4NI6A 1WAEA 1TJMA 5KSBF 4ZTOH 1NLDH 1X4XA 3RIFF 2CR0A 3NK3A 4CADB 4KKRA 4WTZA 4JFXB 3VXNB 4IRJD 3JWOC 5HI3C 1FN4B 1YEHH 1I3GL 4NNYA 4S1DD 1QFUH 5DJ2A 3BAYA 4E2OA 1UUNA 3TTSA 5I6NA 3WLWC 1XSOA 2J72A 1QSZA 3IRZA 3QIBC 5HHOB 2AEQL 4Z5RA 3I84A 5F3FA 3CAFA 5FOBB 2ZWSA 1A1NB 1H3VA 1IQWL 2VM3A 4WSJA 4ZQKA 5EIQA 2OMNA 2VDPB 3HB3B 2NW2A 2CHNA 3HG4A 1IZKA 2B59A 4FTVE 3VW3H 3IDYB 5EU3B 3DK0A 1WT5C 4GBXA 2X2HA 3HZVB 1RY7B 2D3JA 4J8RA 4HVBA 3B2PA 5FUZL 4PJIA 3S88H 3FTGA 1NC4B 4HK0B 4B9JA 1FHGA 2NYYD 3SGJC 1ZDQA 4HPOL 4NUJA 5ETUA 4HJGB 2CE6A 4OJFL 2DTSA 4P04A 2KDYA 1MRCL 2EDJA 4PJBE 4ZAKC 3CDFA 2NX5A 2VDMB 3WKQA 2A6KA 1A5FL 4ZK8A 5A2CA 1EHNA 5IP4A 1MCQA 4MJ2A 5DHMC 3ZQ9A 5CJOL 3UG5A 1F11B 2V2TA 3D05A 3FN0H 2ZXEB 3KL3A 2BZDA 4X7FC 1UZ8B 3KJ4B 1HOEA 1KGCE 5FYJL 2W91A 1FFRA 5CCKL 4PB9H 2O30A 2H3NB 3SIKA 1QSEB 4F3FB 1O7VA 4NZTL 4PJ7A 2F19H 2OULB 4XNYL 3QNYA 3WHE0 3AABA 1JV5B 4B41A 1H3PH 5F3HA 5FGCB 3AG2B 2WQXA 3KM2A 4OTXH 3C60B 4ZPTB 5HJ3B 1BOGB 5AAWC 3FQNA 4QNPF 1AE6H 1RZJH 5LN4A 3UG4A 3HN8A 2Y1AA 4OFIA 2DW5A 3L9BA 2P7TA 4TRPL 1H5BC 1O6SB 5GGQL 3NSDA 5GGTA 5C0FA 2XIBA 2J71A 4MCZB 1KB5A 5D1QA 2OL3B 3MACH 1TITA 1IAIH 2COVD 3UX9B 5TFSL 4LLWA 2AABL 4WO0A 3DGGB 3UPRB 3Q2NA 4DGYH 4IMLB 2E76C 4DNLA 4G59C 4OJAA 3W5NA 5E6IA 4XN4A 4L37B 2FCBA 1MVUA 3BXNA 4JREB 2X2UA 3E2HC 2PTUA 2HPOA 2NLJB 3D69B 5EN2B 2ADGB 3PNWB 2ADJA 4UBDC 4UUJA 2X1XR 3BVUA 4XPTL 1I53A 3WMSA 2WXFA 1P6AB 2DQTL 4FS0A 5IW1A 1I9RL 1OCWL 2YPLB 4Y19A 1RJZB 1DE4B 3KYOB 3I2CH 3WDJA 4QRRE 4EDXB 2EDDA 2B1HL 3ARDD 2DL9A 2Y7NA 1JV2A 3WNMA 4XN5A 3N9GL 3DX8A 1OD7A 2YHGA 4N0FB 3T4AA 2HFEA 3K2UL 1BXAA 4K2UH 4BSWA 3UAAA 3EIFA 6PAZA 2VDRL 4FYQA 1F00I 1CFQA 2F8IA 2GJ6D 3F58L 3FRUB 4Y8DC 5FLUA 4NC2B 4R3SB 4MJ4A 4OU3A 1YN6B 1E6JL 1FNAA 2AC0A 1O9WA 5SWZE 3DMMA 4R0LA 3VXQA 4FE9A 3FUKA 3F05A 2CO6B 1M6OA 3P0YH 2DWTA 4Y1AE 5AWNL 4C56E 4Y7MA 4GPVA 3WO4B 3ME0B 3ZGHA 3OWRA 4MMXA 4NN6B 4P9HC 4YHNB 3UIYA 3VWJC 1DQJB 3HN3A 4ENZA 4K7PL 4MA1C 4WU7B 4J3OG 5HDBB 3JTSB 4MQTB 5BRQA 1YEIL 1QRNA 2QLYA 3NCEB 2P5EA 5DYFA 4NKIH 4FHKA 3UZQB 1MI5E 4AQAB 4MB1A 1MH5A 1E9OB 2Q2EB 1OQOA 4XRCB 5FHBH 4DGVL 1JWMA 2D7MA 5IK3B 1F45A 2ICCA 3GRWA 2R69A 5BZWA 2D8KA 1KGYE 3S5YA 1TU2A 1JZ6A 3NFNA 4KK8C 2DWDB 3DHUA 3FFDB 4DK6A 8FABA 4NM8L 3M45A 1SJVA 2GJ6B 3FQWA 4XBGA 5DLML 4FQXC 1RZ8B 2WXOA 4XPAH 1JERA 3DBXB 3QUXD 4MNGE 4N1HB 4W9CC 3RVXD 3RWDA 1GCFA 2JJVA 2ISDA 4F8QA 5EOCH 5IVZA 1FH5H 2AXJA 4YVUA 4R90L 5E1GA 1KCRH 4O02A 2V2WA 1J12A 4HG4K 4IU3A 2FECL 4IIQA 2DJUA 3QJSB 4J3XA 4FLSA 2BX5A 3MLVH 1UKSA 3TEYA 3HNSL 3VAEA 3M17B 3JV4B 2K9FB 4QHKJ 3AQYA 4WWNA 4Z7WB 3CFKB 4HDIA 1NIDA 4WWKB 1T0NB 4A7VA 1DVFD 2NSXA 1LO3L 3QG6A 3Q01A 4HOWA 1VGKA 1XGZA 1BQLL 3HHMA 1KG0A 5IBUG 3VGGA 5DJYB 5GS0H 1KV3A 5J5EA 1BF5A 3EOBB 3RGVD 4O5LH 1OE1A 1S7RA 3MNZB 5F7FA 3B43A 3OV6A 4IIZA 3SBQA 4WIQA 4UAOB 4UQ3B 4Z7QB 5KAQF 1A9BA 4BEIA 2Z1KA 1USQA 1IGYB 3QNFA 2P9RA 1P4IL 4ABWA 1Q8MA 3PPEA 2E47A 5E8DH 2OZ4L 4LT7A 5K59E 1LVEA 1HILA 4IOIB 3RPKA 3T1WA 1RIHH 3H0TA 4LLUA 4IJ3B 3U36B 1AYOA 2ZOKB 2ZCLH 2WCPA 4F37K 3ZHDA 2W0PA 1DVFB 1H8NA 4G3YH 1CDUA 4H88L 3CK0L 2I27N 1CLYL 1E0OB 1U33A 4NQCA 5KZCB 1D7FA 4MVBC 3IN2A 1S9WA 2FYVA 1SXSA 4NWUL 3CZGA 3RGVB 4F7MA 4LLMB 1MRFH 1CLZL 4PGDB 4U6YA 4TNFA 2LLLA 1ESOA 2F74A 2VAAA 3FU9A 4IRSC 3O0LA 4R7NA 1RZGA 3IN0A 2YA2A 3AADB 5EZLA 3MRFA 1D7CA 4D0CA 5L9DH 3I50L 1LO0L 2XZCL 4QY8B 3F7LA 3RTLA 2VR8A 4JDZB 3IMRA 3IU4L 4XGZB 5K9QG 1XGRB 4UM8A 3D0AA 4UWQB 3JWDH 4OVUA 4GY4A 2XV3A 2ZJSH 1Z9MA 2LQRA 4LE8A 2DJSA 4I18C 4MA7L 4OAWB 2AAAA 2IPKA 1R24B 1KCUH 1I82A 4XNXL 4CSPA 2OTPA 3U7WL 2FGWL 2P8MB 4G72B 3WFEL 1J8SA 4BZ1H 4ZFGL 4LGPB 3D5OF 3AM8A 1JJUA 3HZMA 3OKMB 3PGFL 3P2DA 3SQBA 4Y5YA 2ADIB 3GMQB 2FIRT 5EO0A 2NXZD 3UJTL 3M88A 4U0RC 4D7BA 2DYRB 3CVIL 5JW5A 1XCTB 4Z78A 3FUEA 2QVFB 3CPUA 5GIRB 2K6ZA 2FJFA 2NSMA 4H25A 3SBWA 4Q9CA 2ZXBA 1MHCB 3OG4B 4YXLH 5GGSY 1QFOA 4UTAA 2FJHA 4JFFD 1S7XB 4FFZL 3KJ6H 5CSGA 5HHPB 5AEAA 3TCXA 3N1MC 1JNLH 4FEMA 3ABKB 4X9GA 2YAMA 3Q8EA 2XZQL 3VFNA 3RUGB 5I30L 3K91A 2AW2A 2WINA 3E8UL 2IBBA 5DMGD 4F92B 3H55A 5J1TC 1RJCA 4OZ4B 2JIXD 3B9KA 3H9SB 3MBEB 3O6FD 4H2CA 3HCVA 3AT0A 3KPPB 3MRHA 1G9EA 4S1QL 3GJEA 4JHZA 1W8OA 4N9GA 4ILDA 2X4NB 1JBJA 1CB4A 4JM4H 5D7IE 5K9OB 4OCNC 1FRGH 4JK0D 2CKBA 4KO7A 4X5WA 1PG7H 4KXZH 4XPFL 1FAIL 1YC8A 4I3SH 2CUIA 4JB9H 2ZNWA 2GK2A 2GIMA 4PWFA 1RSFA 3APCA 2I60H 3NT0A 4FLOA 3UROR 3V4VL 4UT9H 2GIYA 3ZMEA 1T1ZB 4KJWC 5I23A 3LQAH 4P8QA 3H3KA 3TT1L 2H2PD 2X3BA 2XA3A 5GRZA 4WJG3 3C2SA 1AGFB 3UFIA 3D09A 1A6VH 2JIXB 4PJ5E 2GBVA 1WBYB 2HT2D 4YSTA 1AHWC 1IKNC 3DO7B 4ZFFA 5KYUA 4A66A 5KANG 1U8PB 2CO1A 1VERA 1T4WA 3AQZA 3LV3A 3QW9A 1EBAA 1MCWM 2ZAHA 3G9VA 3H7BB 3ZKMC 4LAQH 5EBMB 5LGHL 2PP7A 3SO5A 3U46A 1F90L 1T21A 1YEKH 3HAEA 5I5JA 4N87A 3F12A 3FFCB 4TS6A 4FMVA 1WCBA 3KXFA 3CFUA 1CXKA 4YQXL 2V9TA 3UBGA 1NL0L 4JANB 5GSRB 2CO7B 4EUPB 5EPMA 1FWXA 1EHAA 4M7JH 1RUML 5GZNC 4YDKL 4KV5F 3INOA 4KK6D 5GSVA 3WAKA 3D39D 5I8CB 1FFNA 2YXWA 1KF9B 5IVXF 4XX1E 1WA0X 3TBWA 4NKOB 1KXQA 4HF5H 4N2NA 4OLVH 3I3EA 3VFPB 3MYJB 1O9ZA 1OAUL 2DQUH 4PJCE 5FLVA 4TSCL 1SOXA 3KPRB 4CILA 2MKWA 1GJUA 4S1RH 3ZBMA 2WJ5A 1SYVA 3C5SB 2GSGB 1UOWA 1CFNB 5IB2A 2VMJA 3TBBA 1YEJL 3V6BR 4Y4KD 1JZHA 1C1EL 2BSRA 3HE7D 1NA8A 5AVZB 4HKZA 3OJVC 2Q8AL 1CL7I 5B22A 1A7BA 4M7LL 5T3ZE 4RISH 4PJ9C 4P4KC 4A68A 4OZFA 3QYMA 3TBVB 1YMMB 1A6TB 1BFVH 3FUHA 2APWA 3LZRA 2LU5A 4PRAA 1EZVX 4GXVH 4YDJB 3D85B 3V4PA 5SWSE 2FX9L 4MD4A 4DQOH 5DD3L 1WPCA 3GZQA 5HHME 5D1ZI 3AMKA 1UGKA 2AGJL 2NPLX 1JG9A 2XG5B 1R5WB 1EZSA 3HOGA 2R1XB 4DH2A 3S36X 4MQSB 1XXFC 2AQSA 2AV7B 2AQPA 3O3BA 3OG6B 4ISVA 1JFQL 2OYKA 5C8JB 4KKNA 2DH2A 1IGMH 1EZVY 4RSYA 2YC1B 2RFXA 4AQOA 1KIRB 4WHDA 3REWA 1KJMB 2UWEB 3BP7B 4Z7NF 3L45A 5IMOB 2OMXB 5KG9A 2EABA 5KYXB 2YD2A 5E8NB 5IM7B 4WF7A 3C8KA 4XMKH 1WBZB 3MBWB 4CW1A 3EADA 1NBZB 2XPZA 1IC7L 3SDDA 3BQUD 5CLXA 4MS6A 4JPSA 5CLYA 4OLYH 3T0VA 4M03A 1MHPH 3NYKA 1NWOA 2EH7H 1NAKH 2QGEA 3OGCA 3TXAA 3S9DB 4N0YH 1R3HA 3JTTB 4HJ1A 1HCYA 2Y5TA 4E41D 1NCNA 4KRPD 1I1AC 2W8CA 5E4OA 3EJCA 3OF6A 1HH6B 5I6LA 1U6AH 5DD0L 4FCAA 4P4RA 2WUBL 2X1OA 4FQ1H 4KNSA 4Y8AA 1BBJA 2DM2A 3DETD 2D73A 4EO5A 4LKXB 1ZSDB 1I9EA 3ATFA 3KPNA 4XP5H 5CGTA 5AYTA 5K1VA 2GHWB 1HDMB 2ICWJ 2MOQA 2JFCA 4WGKA 3VTTA 5D1XD 1AR1D 4WV1B 5D7EA 4EKJA 4EZJA 5F7NC 3MJ7A 3RURA 4PR5A 5TE4L 3MO1A 1SXCA 1NCTA 2DAVA 4HMDA 3I3DA 3UTQB 3UYPA 1A7NH 4ELME 2AJVH 4LSSH 3SCMA 3OXRA 5FYKU 1UJTA 1XB8A 4PY7B 5I0YA 3HLKA 1PY0A 5EZJA 1KBBA 4FXKB 1AD9B 1F3RB 5ABZA 1C5DB 5I8OL 3CN1A 2GC7C 5DQJA 2VDLL 1LP9F 1X7SA 4BA8A 1QTYT 4X9YA 4NHUA 2AJYL 1Q1PA 1RSYA 3ZR6A 2LTQB 1UWXH 1CDHA 3NCJL 4ZUVA 5L8KB 3A6OA 5E5MB 4ZT1A 1E6OL 4DJMA 3BDYH 1BVOA 2KH2B 2HMIC 1AIFA 4OLWH 3F04A 3QQ9D 5JZ7C 3UAEA 3O9WA 2VISA 2TSBA 4QTHA 4R83A 1T04B 2W60B 3BGMA 4RGOH 2NY5C 1THAA 1MPAL 3QIBB 2E0PA 3EYOA 4YSPA 2L7UA 2CZNA 4Y5XB 1AIZA 2CWRA 2L0DA 3IJ9A 2C3XA 1Y7VA 5IQNA 1NCJA 4P23C 3WUWB 4NZ8A 2DM7A 2NY2C 5DZJA 4A7UA 4B5ZA 3F7KA 2K1MA 1OTTC 1ZA6B 3EO9H 4E9LA 4PWEA 4MZRA 3VFSB 4J4PD 4NQVB 3PABA 1SMOA 2DZEA 3RRQA 3STLA 1ACCA 3V6ZA 4J3OH 3OKDA 3N0PB 5E51A 1TKWB 2YAHA 4DZBB 5CEZH 4FQJH 3N2JA 4BUHA 1XZ0A 2R23A 1A4JA 3B2UD 3QHFL 3CFBB 3E9UA 2X1PA 4EIUA 4NM4L 1FZOB 4H44C 4JZJB 3UTPD 1SBBA 4Z76A 2GAZB 3MLUH 4I0PD 3PJSB 3RX5A 4X8CA 1BREA 3B5HA 1QA9A 1R34A 1J11A 2CALA 1SJMA 1HCFX 3CQPA 2VXUH 4B9KC 5I1DB 2XN9A 3S35L 4AOFA 1AQDA 4KPHL 4EBQL 3BLPX 1JMXA 3Q2CA 2WWKT 1JHKL 4OIBA 3ZDXE 1QUNB 3SKJL 2WWOA 4MX7A 3KDPB 1NLBL 3SO3B 3ALWA 1KEMH 1G9HA 3NJGA 4TUKL 4WO4C 3FTXA 2VZ1A 2DLFL 3V4LA 2XG4A 3T8VA 2NZ9D 4PPTA 5ACLA 4K94H 2IDQA 2WHVA 2F68X 3CDZA 4WTXA 5HYJA 4PJGF 4PJXE 3W1ZA 1YVLA 1YUHA 3AAZA 3TWCH 3F6LA 4XAKE 3IAGC 4YGVB 3S8FB 3NCXA 5F6IC 3DGCR 1A2YA 1GYVA 3A67H 3W81A 1JZIA 5DD1H 2ZOLA 3O3DA 3RDTD 1C7SA 2X4OA 3QDJD 1B0GA 5D2LA 2EC8A 3MV7B 1G7MA 2E46A 5IHUL 2C9VA 4S0SD 4LEOA 4NQEB 3CFDA 4N6QA 4UQBA 5IIEA 4AENB 4YBQC 1JZEA 4ANXA 3RNQB 3Q8BA 3CSGA 2E8YA 3E2HB 4KUZH 3V6FB 2H6OA 4PUBL 3VRLF 2WP3T 4GT0A 2VDPH 4P2QA 2ZTBA 3GC3A 3W11C 4YHMH 3LD8C 3T8XA 4HUWB 2XTJD 2XWRA 5C0CD 1UCTA 2I32A 1BD2E 4U1GB 3DUSA 5C0ND 3FU6A 5AG9A 3O3AB 1A6UL 4OF5A 4XI5C 3WFHB 5HHXH 1AKJA 2CA4A 2FBJL 2UY7A 4TXVB 3WEAA 5TF0A 1KEGL 1MZZA 2VDMH 2XQBL 3PJLA 3LKPB 5HYSB 1YPZB 2VLJE 4BWWA 5FM4A 4KO9A 1BA9A 2X4PB 1HKLL 2K7QA 4RRPM 3V6OA 1IBGH 3C9NA 4ZSOA 3T2LA 4HS3B 4U1LB 2BOCB 1H0DA 2NQDA 4XPGH 2AVFA 4XPBL 4A7GA 2YXFA 3FT2A 1OAXH 4G5ZH 5T3XH 1XGUA 3CFMA 3U1SH 2FJGB 4P46C 3RA7H 3V10A 3WS3A 5LUMA 4ZDHA 1DQDH 1G7LA 5HHQB 1LNUB 1CBJA 4G43B 2ATPA 2JJSC 4JPIA 1I3RA 4KXCA 1NGPH 2IPUG 1XMEB 4G7VL 5D93C 1ZHLB 4BK5A 4KJPC 4I77L 1G0XA 1SHMA 4NQDD 4X42A 1U3JA 4PJEB 4G1MB 4LMQI 3WTSA 2F7PA 5DK0B 2CHZA 4PS7A 1G1KA 3G6JF 2G3ZA 4QRPA 4L4VA 4P3DB 2Y06L 3BWAA 5ICZB 1E4XL 5H94A 4FHBD 3TYFB 4M48H 4FQXB 5AL0A 3TBTB 3O4LA 3CLEL 4N0UB 4L4TD 2FD6L 2X5PA 2A73B 2VLLB 1TJHH 1JZDC 4ZMPA 1B6DA 3HE6A 3FT3A 4B7IA 4XN8A 1T2QL 3OSVA 1CFSA 1OEZW 2FHCA 5AB1A 5LLIC 4M3JA 4JPVL 4ZUUB 4HEPG 4ZZFA 3ES6A 4KNUA 2IXQA 3ZY7A 3MRQB 5FECA 1WFJA 4MA8L 1S3RA 3EBAA 1CR9L 3EKCA 3VMNA 2ADFH 2BC4A 2R2BB 1ZDSA 2F61A 2I5YH 4IGBC 4P3CL 4RFNB 2JCCF 2AK4A 3CHPA 3PAUA 4M6OL 1UH4A 5HGDB 4MBRA 4RNRA 1EH9A 3UTSD 5JPNA 2UZPA 4NWTL 4OCYL 3BAIA 3ZE1E 1QI3A 3WFBL 3DK2A 1FPTL 2J2ZA 5I17A 3QO0A 3P9MB 1W72B 1J9QA 5GS3A 5C0EB 4OIIL 4L4TB 4LCYA 3HFFA 3KWUA 4OB5L 3S34H 1E4HA 3VXUE 3NA9H 4CRPA 3CXHK 1CDGA 1WK0A 2Y6TE 1S9YB 3ZRSA 1PMYA 4A7TA 1QFHA 1NPJA 3BD5A 5TGBA 4X6EA 5CJQL 5D5ME 1RULL 4YNYA 3QJRB 2XSKA 4LKCA 3MJ9H 1XL4A 4WI6A 1R3KA 5E8OB 1DCLA 2AFNA 3ZZLA 4R5TA 5KVDH 3MUHL 3S2AA 3ZKND 1CFVL 3EG9B 3IDMB 4I3GA 5DHXB 1YEEH 5FX3A 2BOBB 1LD9B 1M2VB 4FA6A 4OZHE 4E9SA 3KS0H 2XWBB 1SJXA 4PJHA 2YPKA 4AV5A 3W9EB 2DQCL 5T1JA 4IHOB 3K6FA 1UZ6E 3QUYA 2E9GA 4LARH 1ZLDA 3TN0C 2I9LA 1M4KA 1NDGB 1ZV2A 2CHDA 4QRUB 4FD0A 2NY4C 5I28A 3Q13A 3X2QB 4OSUH 1X5IA 3M6DA 4JN2B 4MQXC 4P49A 2R4SL 1R3IL 4WHTB 1E9PA 1R3JB 4ZUWB 3IM1A 1RK0A 1RMFH 1UZGA 2VXVL 1KBGH 3VFVA 2CIKA 4GQQA 4FTVB 2YSTA 1ITCA 2HXAA 5HDBF 4KITB 3RZCA 1WCQA 3QUGA 5DWUH 1OGSA 3RU8H 3KPMB 3O6KH 1UEMA 1OD9A 3AG3B 4Y16D 4PTUA 3REVA 5CP3H 1HESA 1MKFA 3F6IA 3D4ZA 2ITDB 1T22A 2RCSL 3T65A 4LSTH 4PJBB 3V0GA 1TETH 4XMXA 2J1ZA 4MXVF 5AG8A 2CRYA 1ORQA 4K9EL 2VO8A 4BWTA 5JXEC 3AS2A 2HKFL 1OF0A 3QUMA 1IC0A 3VQLA 1ROCA 1JGUL 1FVDA 2PYEE 4UT7H 2P5WD 4U3CA 1E9QB 1IKFL 3IFNH 4N5UA 3IMSA 1KYOK 3KGRA 3GKWL 4JFWA 3SKNA 3LXCA 4EXKA 4H2AA 2O6CA 4GUCA 2FYYB 3QEQD 4RESB 4TQ8A 1N2RA 2W5PA 4HUCA 4ZMYA 1NCBL 2WZ6A 1ZPUA 2NUTA 2EQDA 3APNA 4DEWA 4JFZH 3EFOB 1X5FA 5GRVL 5FYJU 3VXOA 4G9FE 1TENA 3N1QC 1RFDH 4IBSA 4AKQA 1MHEB 3IS0X 5EU6E 3QUXC 2WKOF 1TQTA 2Y36H 1IC1A 2EICA 1F3DH 4FYRA 4OQTL 1RZPA 1OGAD 5AUMB 1HINH 5I18H 5HYSG 4Z7UE 3BJ91 1YYLL 3T2NL 5DQDL 1UM5L 1OVZA 4Z7QF 3OL2A 4FQ2H 1ACYH 2BSEA 1J5CA 5IV2A 3HA0A 5SWZD 3MOAH 1EMTL 4M93B 4OIAA 1A9VA 4XPHH 4R7VA 5TDNB 5A2KH 3I6LE 4FL4C 3MKKA 2VABB 5FK9B 2DM3A 4LRIA 4XBPA 3TASA 3F83A 1A7PH 5IJBC 3GRGA 2AJSL 1CXIA 3D25A 1CDJA 3BUYA 4GFTB 1KUMA 5B3SB 3KM1A 2Z91B 2BWQA 4LCIH 4JFQB 1NGXA 1AHWB 4X7CC 3PU7A 4QRRB 2A6DA 3EO0A 3QI9A 3D0LB 1ZEAL 3IGUA 1OAZL 1JRHI 2CJSA 3FONB 1QFWL 1JZ5A 1T66D 3AXLB 1KXVC 5AZUA 2EINB 1OGAB 1RJYB 1UH2A 3O2WH 3T71A 5DUMH 3V7AG 3VX0A 4FDWA 4FNRA 4IQHA 3UAJD 4MBOA 3S6CA 2AJXL 1BGXL 4Z1PA 5E08H 4OM0H 3ATAA 1PCXA 4U3SA 2JKTM 4N2DA 1AXSA 4ONHB 2HJLA 3BLBA 3OC8A 5E2UL 4GAJL 5SWZB 3RX9A 1QBLL 4U1NA 4HIPA 5ITFA 3ZL4L 4Y1AB 1EDYA 1T1YB 2CUAA 2IPTL 4D7PA 4C56B 1YYCA 2BDNH 1KJ2L 3GTTA 5E8PA 1BDYA 4AVHA 1M7IB 4DZ8A 5JPMC 2ZUTA 3ZHLA 4HPYL 4LLYB 4FFTA 1K72A 3ZUNC 4HFWB 2N0KA 3GPEA 4FNTA 3NSJA 4N25A 1P7QA 4NNPH 4G7SB 2ZAGA 5C0RL 3U2SA 5IFHL 1NQBA 5C3TA 2ZOUA 1J5OL 1F4WH 3MUY1 3KLKA 4X6CA 1MI5B 3CBKB 4HGWB 4QEGA 5CSZB 4IK6A 2WLHA 5K9JL 1EEYB 3VXRA 4O2EA 2QHRH 1L9PA 5BOJA 4PRPA 3ETSA 5AVWB 1YEDB 4MB4A 4ZMWA 4PJ9B 1JS4A 4P4KB 2WVSA 4FXGC 5A2FA 3DSFH 4P9ML 1J18A 3ZRCC 4G80A 2DQDH 5DJDA 5I75B 3BX7C 5I1GL 3MVSA 4MNGB 5EWIL 2BNRD 2P42B 3WTYA 4OZGE 5DRZA 1NCDL 1HSAB 3IAPA 3MU3A 1BMGA 1SUJA 3WEXA 4Z6AT 5A2LH 1N0LB 3QORD 5AENA 2R0ZH 1FC2D 3L48A 3OJDA 3VTAA 1GMIA 4ZS6D 3RUGF 1B4RA 1RK1B 4AG4L 2PW1A 5KSVB 1S9KC 2FZ3A 3HPJA 1DBBH 3UP1A 2VL5A 2B0SH 5EZIL 3ENEA 3ULUL 1TCRB 2QVMA 2GPZA 3LPGA 2J20A 4MXQD 4F8NA 3JBG7 4M5ZH 2MQGA 1MCIA 3P54A 1LHZA 3ZHNA 3GXUB 3BC9A 4FGMA 1K4CB 1HHKA 2ZWNA 5T1LA 3X11B 1RZQA 5E24E 4PLKD 4HWNA 1XTLA 2Z8VC 4TTDD 3TGXA 3DUHA 3NIDE 3GPSA 3R18A 4WNQA 4AW7A 1IVTA 2IAMA 5DD6B 5AFAA 1A3RH 3SYPA 3WSQL 3O6FC 4YXHH 2BSBA 3CVHB 2HN7A 3FH8A 4UIKH 3QEGH 4LSRH 1I1AB 3ULSA 1MG2C 3BRDA 1BYOA 4NNXA 5D7LE 2XNAA 3K6DA 1ZD6A 3M8OL 2IADA 4GIAA 5INDA 2OW7A 4BJLA 2X4UB 4YHPB 1RKRA 3BAEH 3R4DA 3QZWA 2XWTA 5LWYL 2PW2B 4ANKA 2JB6A 2Y2TA 4LSDA 4PD4K 3AVEA 5ALCH 3STBA 4ZPVA 5ITBL 4DQAA 4Q97A 1KCVH 3IFLL 3RI5F 1D9KD 2CBPA 2V17L 4XN2A 3G5XA 3GLZA 3NABL 2AI0H 3H6JA 1ODAA 3P4LA 4P5RA 5F96L 4BSVB 2WBJC 3MV8A 5DS1A 5E5RB 4Z3EA 1UB5A 5DF0A 3GUTB 4ZD3H 3GSXB 4S11A 1TIUA 5EEYA 1MY5A 4QYOB 2H32A 3HFML 4QHMA 4OLXH 4ZXBC 5E4AA 4I2XE 5KSBA 4EVNA 2PLTA 2PYFB 3PREA 5GGTL 4YHOH 4EN3D 3MOBH 2YD0A 3UPCA 3J2PA 5KVMC 4MNQA 1KB5L 3ZTEA 2HA1A 5KYYB 3VFUB 5A40E 2A4EA 2H3KA 2LVEA 3DTDA 3MX0A 2X0WA 4JCWA 4L9LA 2FO4B 1VAHA 2F6AA 5TDPB 2ATKA 1JF5A 2YUVA 4ONFH 3V0AC 3JV6B 3SPJA 3SE3A 4KQ0A 3KGUA 1SJHA 4BYHA 1FL5B 1OAKH 4LIQE 3DVFA 3LTVA 1CTMA 4M62L 1URZA 4E5XG 3TJHD 4PJ8C 4P23B 4DKFH 3AY4A 5IF0A 1W0VB 1DSWA 2NY2B 2W9LA 2FX7L 4V1DE 5F71A 4GAAA 4A6YH 3LH8A 4ZOBA 1R1CA 4YZFF 5FO2A 3EFFA 5I1JL 3FO9B 1UWEH 3L3OC 3MZTA 4WFED 1ZPLA 1JZ4A 3TV3H 1OHQA 1WG3A 5CSBA 4JFDE 5HJBA 3L1OH 4X50A 4D9RE 1S8DA 1C12B 4ODUB 5HY9B 1YEGH 4XO9A 3TO2B 3ELQA 1TPXC 2OMTA 1DQQA 4LSPH 3GI9H 4NDMA 4ADGA 3QIWD 4QXTA 4HK3N 3FB8A 1KFAL 1XEDA 3DJ9A 3H2QA 4F7PB 3BVVA 5A2IH 4PMFA 1CTOA 2J88H 2VH5H 5DC2A 2HLFD 1AG0A 3X14A 1NFIA 4L48A 2IQ9L 2UWEF 3T77B 1HEJC 2B7DT 4R5XA 4UV4H 1XQ4A 3IGFA 3WFDL 3GHBL 2QZ5A 3CX2A 5D7IB 1ERNA 3V0FA 3FPYA 5EF3A 1SDAB 4M61B 4Z0XA 2LABA 5DA4A 4UQ9A 5F44A 3IVKB 5F9OH 4NP4H 3GMPA 3ORJA 3Q5YA 3TCLA 1NMAL 1UM4H 3VXME 4AIZA 4WO4B 1F1GA 1XV8A 3C5ZA 3ESMA 3LEXA 4P2OD 5DQ9A 5AOMA 4K5OA 3VFOB 4IOFC 4KZEL 3OKEB 1LWRA 1E67A 2BSTA 4GS7C 4KKAD 1KPUB 2VSMB 3GRWL 3H9HA 1AO7A 3DUUB 3EJYD 5D7SL 1JP5A 1AMXA 1K5WA 1KBWA 4EI5C 1HQRA 4PJ5B 1A7QL 1DSFL 3JWOH 4BK4A 2WLLB 1LQSR 1XO8A 1OWRM 4H13C 4F33A 5I74B 1J0IA 4IW4C 4GH7B 3IJHA 5D1ZA 1ZLWH 1EQWA 1N70A 4KRPC 2YGVA 4O02L 1E8YA 4OV5B 3OHXA 2AEPH 4GIOA 4I1NB 3LD8B 2GUOA 2ERJC 4FQPA 1WAAF 4Y5VC 3RWJB 3STZB 4LVNC 1SVBA 2PR4H 1UB6A 2R2EB 1SNRA 2G4EA 2H0FA 5IQOA 4E0RA 2X3AA 1BFTA 4HKJB 5F6HI 2DJMA 4GRWH 4JFHD 3MNWB 4JDVB 1SQ2N 3RQ3A 2DQIL 1GYWA 3ZQWA 4XVJL 1DBMH 4PBWD 3OPZL 1D6EB 2RMNA 4NENA 1F4XH 5DT1H 4NOBA 4PJCB 4MFHA 3FK3A 4HD9A 4X99A 4QPEA 3EO1A 1G6RL 5ESAA 5IQLA 5DJ6B 3S0PA 3N44B 2X6BA 1IEBB 1RXLA 2OZNA 2R2HA 4JW3A 1ZGLP 4O2FB 5H37G 5DU7A 3FS9A 2WOYA 1LGVA 1WF5A 4X8JA 1HC1A 1CDYA 3IDUA 4FLHA 3R19A 5E6UB 3UTOA 4LOVA 3NBNA 2X6UA 4GEJA 1GGIL 4P46B 5IVOA 1WA2X 3VVVA 4PRBB 1F2XK 1BZ7B 2Z35B 4HALA 4YOKA 1GR7A 1GIGL 1BBDL 3GMMA 3KL5A 5JIMA 3W39B 1DBKH 3RAJH 4HIHA 3PAZA 4Q58C 2B16A 5L88L 2EXYD 4JQXA 5C08E 5SWSB 3T0BA 3ULAB 4X80L 2VJXA 5M95B 5HHMB 1LEKB 1WTLA 2LAAA 3GI8H 3PL6D 4J3TA 1Z9NA 5GGVY 1OB1B 4EZLA 4X7TB 3SBPA 5I1HL 2UZXB 2V4LA 1GGBL 2KT6A 2MHAB 3BUPA 4LCCC 3UIZA 3D4GA 2NY1D 5BXFA 3MLZH 3OKLB 4L8DA 2VN3A 1HU8A 4PGEB 3KLDA 5CF3A 2Q8BL 2X9ZA 3BN9D 5TQ0L 3TT3H 4XX5A 1NPNA 4Z7IA 4XVOA 1JPSH 5AQ0A 1PDKA 3KBEA 1UXLA 1UENA 3OKKA 3GSWA 3V0VB 1L9QA 3FPXA 2O5XL 1FJ1B 3B2UC 1X6NA 1FCGA 4MD5A 4B60A 1BIIA 4P57A 1WP6A 4PRHA 1ZHBB 2L7JA 5FA3B 4GBXD 5LAXA 5I1CH 3CZFB 5F8QC 1E40A 5DJ0B 4G8GE 3ZZQA 2CLRA 4DOHB 5A16A 1LE9B 4KVNH 4AM0Q 3RTQB 4MAUH 3IAQA 4BUQA 2AQ1A 4WKXA 4PVMA 2NX5D 4P5KB 5DJXA 5HDRA 2CRMA 1MJUL 1P5UC 1OL0A 5F7EH 4FQCH 1C9SA 1Z3GH 2B1OA 3F00A 1Z9LA 1OT4A 2R4RL 4L29B 5CFAA 2ZSVB 4ZFQA 2W07A 4ORZC 1C5CL 3DNKA 2VMEA 4AEHH 1EERB 5DYOA 1BX2A 3VGHA 3QGVA 3X12A 3LSOA 3CQFA 4ELMB 1CGXA 1HI6B 5EFIA 3QEUB 4JY4B 3FOMB 4P59H 3AREC 4P9HH 4P2RE 3FCUB 1QWHA 4MJ6B 5C7XH 3CMOL 1BEXA 1U8KA 2HKHH 2R83A 4QWWC 3SGEI 4GG8A 3HI5L 3VD0A 2BRRH 4R84A 2E4TA 4GW5A 1CT8B 2C5DC 3QNZB 1MCPL 5JHDE 2IH9A 3DX6A 1HX0A 3GXFA 4UINL 1I7RB 4LCWA 4GAGH 4ZOEA 5D1QD 5F2FA 3FSOA 1HEHC 3X3GL 1OAJA 4ZX3A 1CD1A 3CUPB 4IKNA 5E5UB 3IJSB 3WI9A 3LZQA 4UV7H 2XTJC 3QWRA 2IV9A 3L1FA 1AGEA 3DOHA 4WEBL 3PHQA 4XHQA 1J1PL 1PLGH 2NY4B 5ESVA 4N2BA 4NJ9H 4C59B 1EAPA 4MS8C 5KVEL 3MRMB 1IGCL 3VFGH 2E8ZA 3EDFA 2BS8A 4U1MB 2BSCA 3N04A 4ODTH 3RWIA 1N8ZA 1OGTA 4XC1L 1P1ZA 2J1WA 1QUPA 5F7WC 2V7NA 4K8RL 4NO5B 3I9GH 1IAKA 2DKMA 1T1WB 1WHPA 5E9DA 1ZVSA 1YECH 4PG2C 4PJEF 4Z0BL 2FH8A 3HHSA 3VD3A 4N1CA 5GGUA 3OKNA 2GFBB 1N4XH 1S7TB 5J57B 1Q9KB 3WE6A 1HNGA 4PJDB 2DBLL 3RWHA 2WO4A 4LDOB 4L8CB 3QCVL 4QHLA 1IC5L 3U7YH 4LHUA 4PS4H 1E3ZA 4YJZL 4JRXE 5G4NA 4PRIA 1JMZA 4K23L 2E7LC 3VSTA 5D2NA 3RWFA 5CEYA 3UMNA 3LKOB 1D6VH 2N1TE 3X1GA 2X70A 3E8VA 4NRZA 4H0GA 3R06B 3ZDXB 2FEDD 2D2CC 5E00B 4KQ3H 3WIAA 2ZCHH 3QWQB 1RIUL 4IDJH 3WE1A 4OGZA 3WEMA 5DHYA 4CKQA 2PWFA 1XCWA 3CXDH 3SE6A 1I1FA 1NWPA 5DJCA 1F58L 4K5MA 4KFMA 1NIBA 2N56A 1BD2D 2WWNA 4JFYB 5HXMA 3IMUA 4MYWB 1QRND 2YBRA 4M3KB 5I5MA 4PJ6A 5DURD 1E30A 3NIGE 2AXGA 2QPUA 4BD4A 5TQ2L 4UZUA 1DLFL 3MLPA 3QUZC 3QFJD 4APXA 2NQCA 5E0QA 4PLJC 5T5NF 15C8H 4X5XB 4ATWA 3FSZA 1INEL 3B56A 2QGBA 4X9BA 3V4PL 4K71B 5FUCC 4M6NL 1URLA 4WRLA 4BKLA 1ULVA 3N06B 4XZUA 1V7NH 5MEPA 1OXYA 5AYQA 4XMPL 2WUCH 2DQGH 4OJCA 2DQHH 3FQRB 3P4OA 3AC0A 5TF1L 3SE9L 4AXWA 4MCYA 1JXFA 1BD2B 2GJZB 2VDKB 4TQHA 3RHWF 1MREL 4Q7DA 3DTXB 3HRZB 1P4BL 1TTRA 3PWPA 1S78C 3BHBA 4OZIB 5DEFB 2ICWB 3O3EA 1SJEA 1ZTXL 1MJ7L 1JNNH 2JJUA 3A24A 4XCYB 3QFJB 1KN2L 4UT9A 2DQ6A 1EO5A 4IJTA 3WD5H 4LO9A 2A83A 5IESH 2D31A 4D3CL 4Q9QH 3MN8A 5IVXA 2H1PH 4CVUA 5B38G 4JGJA 2A9MH 5CHNA 3MRPB 5CFHA 1OSYA 4AQEB 4M4RA 3NZ8B 5JORA 3AJ7A 1Z5LA 3GS7A 1PTZA 4HU2A 4KVCL 3ZKNC 4AYDC 2IQAB 1CGWA 4JL2A 1M7DB 3BPLC 1T7YA 1AHMA 1TTGA 1TVHA 1Z5HA 2Y22A 1BXVA 3QRGH 3C09C 3KLAB 3NOIA 4FG0A 5TH2A 3QDME 2HJKA 4X8XA 1PZDA 5C09E 2PUQT 4GKSB 2ZXQA 3IFOB 4PJBF 1N5AB 1YYMH 1M1XA 1UWGL 1V5JA 3QHZL 3VI4E 4AEFA 1GGUA 5DS8B 2VNCA 3V5DB 3DIFA 3LNHA 1SYSA 4NQCD 5CINH 2EYRA 4RAVB 3I74A 2DV6A 1BQSA 4XNUH 2MCG1 4FXGB 3W2DL 2NW3B 1W15A 2XACC 1V7ML 1LE5A 3BE1H 1E4WH 2ZF8A 4KTDL 4WUUA 3GJFH 3H7LA 4EDWH 1DL7H 4YHZL 2EVJA 4NO3A 1MSPA 3BRFA 2P52A 2HFGL 4G42B 1FLRL 1S9VB 5A6IA 4PS8A 3BUQA 3G5WA 3KYMA 4PP2B 2CD0A 2H9GB 3HUJF 1ET5A 3HMWL 4K3GA 5HGAB 3SDYH 3BH8A 3U6RA 1EO7A 3HS0C 3WLBB 4JHAL 5PAZA 3UCRA 5GS2H 1X7QA 3T5WA 3B7SA 3K4ZA 5C7ZA 4XHJC 3C6SB 1HTYA 1SXAA 3DHMA 1AH1A 3EHBC 3PPSA 1UH3A 4BSJA 3QA3A 2APFA 4APQC 4D9QD 5JTWA 2CJUL 4G6AD 3ZE1B 4N0CD 2RACA 1AXTL 5K9KA 3E7JA 3EGDB 3WIFA 3MGTB 5KS9A 1AKPA 1CU4L 1QWNA 4JM2C 4B95C 5J7CC 2EEAA 2Y7OA 3CZEA 3J7HA 2XRAH 2XWDA 1HOCB 3BEVB 1H9DA 5KSAA 3VXUB 1IRAY 3BD3A 3QDGD 2WSDA 4HJJH 5IT2L 4AJ0A 1WIOA 3E38A 5EU7E 4B9ZA 1QQDB 1HAUA 4DCQB 5JIHA 3NTCL 7TAAA 1Q0YH 2F53E 2NY7H 3MLTB 1F3JB 5D5MB 1J8KA 3TA3C 3IFPA 4AEEA 1IC4L 3DARA 1SEBA 1I9IH 1U3NA 1CGYA 1K3IA 2LFEA 3C8HA 3B9KD 4G6FB 5HI4C 5KJRH 4CU8A 3QRLA 1BIHA 2HVJA 2J1YA 1KYUA 3DV4A 4JJOA 2V0AA 3GBMH 4OZHB 1CICC 1IM9A 1BZOA 5F1IA 1X9LA 3K81A 5T1KA 5A3ID 1UD5A 3D08A 4DP2X 1LP9A 4B9IA 3L08A 1N3NA 5B1BB 3FB5B 3MMEA 4WGVB 2ESVE 2WN3A 3TLRA 1H3GA 2Z8WC 3ILQC 3QDGB 3SSGA 1U8CB 1V3LA 1B4JH 1MHHB 2KMWA 5DVPA 3C6LA 3HC4L 4RDQG 1T66C 2Y69B 1U8MA 4GO8A 2BO0A 2WIIB 3KPLB 2R29L 1BAGA 5A2BA 5I73C 1MF2L 3K0WA 1XF5B 2OSYA 2QADD 2D4FA 1ITBB 3ZKSD 4FP8L 1MJJB 1FL3B 3KYNB 1M42A 2JB5L 4F9PC 5CKAA 5JXAL 2R8SL 1D5MA 4C47A 5JO5A 2EDBA 4HUUA 2YUXA 2X05A 5EOCJ 1Z5YD 4EQ2A 4ETQB 1JD7A 4ZO8A 4A2LA 1HQ4B 3BKCH 3KXFD 1GYAA 3ZTNL 5CUSL 2VUYA 4ABVA 4CDHA 4TOYL 1FNGA 3R4RA 3WS6C 5JOEA 5AVYB 2YEZA 3L3OB 2PYEB 3ALPA 5C6TH 3GDBA 5SX4H 4JMXA 3PQYA 5AZ2L 1MQKL 2K6WA 2AK1L 2C1PB 1BQUA 3DYOA 3VB9A 1NM4A 2GSIB 3QRBA 4A04A 4OM1H 2JKLA 1DP0A 2K3HA 3EYUL 3MRLB 4UTBA 1YDPA 2BVYA 3LZFH 1S7WA 2F54A 4DP6X 4WFGE 1OE3A 1ORSB 3TIDA 4D8PA 2VRAA 2GTQA 4G9FB 1INDH 1VZIA 1DZBA 4DGIH 5EU6B 4TNWK 3O11A 3BEWB 2J21A 1KULA 1HHGA 3U7AA 3OGOE 1U3HC 4L5FE 1AFVL 3B9AA 1MWAB 3EXLA 5LVEA 4AWJC 4LESA 3F5WB 2LR4A 3GLEA 5IJKA 43CAA 4H4NA 1JD9A 4Z7UB 3QB7C 1JDDA 4PJGA 5KSUB 2PO6A 1O6VA 4QAMB 5D6DC 1J8HA 1RJLA 3FO2A 4CL7A 3GSVB 5HPMB 2K4AA 4PI0A 4EIGB 3FCSB 1RUKH 4GS7B 1RLWA 3MA9L 3ZDZE 1L5GB 3ULUE 1Q0XL 5IQ9A 1FO0B 2HG5A 3ARWA 3PDOB 1TQCC 3EXJA 2H26B 4JO2L 3KCPB 4QRFA 4C58B 3QHTC 3D50A 4L3AA 5LNDA 2NDGA 3SDCC 4DKTA 3QISA 2XY2A 4FI8A 2XU9A 5KVGL 3L3DA 3GB7A 3MRJA 3UDWC 4CA4A 2ROXA 2QPSA 2W1NA 1JNHB 2Y07H 4XC3L 2NY5H 3TCTA 2OSLB 2CDFB 5EO1A 4G6ML 4HC1H 4KRNA 2VDNL 4WNSA 4NRYB 1AP2A 3GMNA 4O58L 2F9BT 3OZ9H 2EXWD 4UMSA 5GISL 2XKNA 3SDDD 3HZYA 4LVNB 4PWGA 4F57H 1YSOA 4BHUI 2FWSA 4CADA 1RZ7L 1F4YL 4JFXA 3PUCA 3P30L 3VXNA 2FUTA 4V33A 2QKSA 1FN4A 1A14H 1XF2B 1FORL 1HXYB 1TJIL 4OD2B 3TURA 3FHEA 1QABA 3OF6D 2CMRL 5HHOA 2OMZB 2B4CL 4Y9BA 5FOBA 2RQEA 1KIQB 3QH3B 1A1NA 2HT4D 1U3YA 1A0QH 2NNCA 3K2MC 5M94B 2A9CA 3VH8B 1KB9K 2V8MA 4OD1H 2IPUK 4ODHL 4FA7B 2WYZA 5EU3A 2J55A 2EC9T 3Q0HA 5BUPA 3HZVA 3OAUL 4KTEL 5F7AA 4MB5A 1U2HA 2VR7A 1NC4A 2VDOB 3SDAC 4HK0A 4PHZA 4OLZL 2MPVA 2O72A 2H1XA 1QHQA 4YXKL 1UA6L 2X1QA 2OJEB 4TQEH 4OCLC 1OP5K 3ARYA 3B83A 1JZJA 4HJGA 4E9YA 1ES0B 3DSNA 3H3BC 4OCWH 4X6DE 4AYFB 1NC2B 3LB6D 4WJ5B 5CKGA 2QPFA 5D8JL 4OZGB 4FQIL 3TH4T 4DKEH 2PWEA 3LZLA 3TIEB 1AHKA 1F11A 5J8OA 3T0EE 5MHSE 1UZ8A 1MFUA 1S7SB 1NBVH 4TVPD 3QFDB 4KK5D 2H3NA 4HWZB 1QSEA 4F3FA 2IDTA 5JW4N 1UC6A 3QQDB 3PCYA 4KHTH 3VI3E 1CFBA 3OAZH 4JR9H 4OCXL 1BZDA 4K9EC 4LCCB 5LXGH 1HXMB 1GPOH 1QI4A 3G9AB 4L23A 1JV5A 4U0QB 1BAWA 1RZFL 1YNTF 3O9WD 4PAZA 1QKZL 5D7IF 1KDIA 1LDSA 3GO1L 4YDMA 3C60A 4ZPTA 5HJ3A 4CVXB 1BOGA 4E36A 1NDTA 2JKNA 2FT8A 4GQ9H 4B9GA 1Q4NX 5J0BA 2CLZB 3G6DL 1H19A 5SX5H 3QIWC 1O6SA 1KSRA 1TZGH 5L6YL 4TSAL 1XB3A 3BYYA 1F97A 4MCZA 2GTWB 3H3PL 3NIDB 5DC9B 1INQB 1I3UA 1PD0A 2OL3A 4P5TD 4YSCA 5HHNB 4M1DH 3RL2B 1G9NL 3ZSTA 4ZMQA 1MWOA 3DGGA 3NJJA 5CZVH 3UPRA 3OLGA 3S36H 2FEEI 4R6UA 1X6LA 3CH8A 2JI3A 2NR6A 1B9ZA 4G8FB 4IMLA 5D7LB 3FMGH 3ZKQD 1QRKA 4L37A 2HT3C 4RAUB 4ADJA 1C08B 4Z77B 3QC6X 2ZUYA 3QUML 5KUKA 2NLJA 3D69A 2WBKA 2WLZA 1WFOA 3DWTA 2RB8A 5EN2A 2ADGA 2A0LD 1J86A 3PNWA 4LLVB 5C07E 1FZMB 5DR5L 2BHUA 1I8IB 2EZ0D 3BAWA 2XN9D 3IDIB 4U05A 3CFTA 3GIZL 4JKLA 3AWEA 2YPLA 2P5EE 3KEHA 1RJZA 5L2JB 1DE4A 3KYOA 3NCYS 3V4VB 3SGDI 4H0IA 4EDXA 5T3ZH 3BMVA 1UM6H 1TMCB 3AREB 1MFDL 4P5TB 1MXGA 2HWZH 4N0FA 1KCSH 5F1KC 4JFDD 1A6ZB 4I2XB 1KC5H 3TP4A 4D9RD 2EDFA 3FRUA 4ENEC 5AKTA 4R3SA 4YUEH 1Q0EA 1YN6A 3AS1A 5CBEB 4P5SA 3MFFB 1KENH 5FHAH 3GF8A 4FFWC 1P2CB 4QO1A 2CO6A 4R4FH 5ISZD 3CLFH 3UH8A 1AMYA 3ME0A 4LZKA 2WBXA 3DVIA 3MJ9A 1DQJA 3HI6L 3UZVB 4OJEH 5LQBL 4WU7A 1J1OH 3H42L 1RURH 2J8UF 3JTSA 3ISWA 3BUBA 2FB4L 3DVGB 2XVGA 3T0DA 2AF2A 3DHJA 3GBDA 3UZQA 4AQAA 4ACTA 2ZYRA 3KH4A 5C0JB 1E9OA 5DVNA 1NFDE 5JUEL 4XRCA 3ESUF 4I87A 4IEFB 5IK3A 3D3VE 3MCLH 1AZNA 3CMGA 4JFDB 3BT2H 3TJEL 4QRQB 2DWDA 3FFDA 4HUMB 2QL1A 2HG0A 2GJ6A 5DO2D 4EXPX 1RZ8A 3I6GB 1ZLSH 4FNPA 4C4BA 2B39A 3DBXA 3LRSB 1N5YH 2JQMA 4KAQH 4N28A 1AKJD 1MW0A 1EJFA 4MXWH 3CFIC 4N2MA 1MFMA 3D9AH 4YIQB 5KTEL 5ISZB 4EN3C 1FG9C 4NERA 4K3DH 5LXVA 2FX8H 3HNTL 2OS7A 3WTWA 2EDKA 3ULVD 3Q44A 4LPXA 3JVFC 3F7RA 4R7LA 2PCYA 3M17A 3JV4A 2YFNA 5CP3A 5G4MA 2VGLM 4PM1A 4Z7WA 3CFKA 3QDAA 5GJSL 3WV0A 3ZE2E 1T0NA 2XY1A 3AU0A 3EOTL 2DIJA 4HT1H 4NUGL 1SVZA 5JDSB 1F42A 1T5XB 1DCEA 1YQVH 2WKOA 3RFZC 3VXMB 2R0WH 2ZF9A 5IR1B 2Z4QB 2GBTA 5SV3A 5DJYA 3SYCA 3EOBA 3TEUA 2PWGA 2IH3B 2YAEA 3MNZA 4DTGL 4ZMVA 3ULUC 1NCWH 2MTAA 5I1KH 4UQ3A 4L4VD 5AYUL 2EUWA 3KYKH 5GXBB 2BZ7A 2CUMA 5LN8A 1IGYA 1MCCA 3JYCA 5FGBC 3TM6A 2DD8L 2BINA 3BVNB 3VH8G 4GBXC 2WVUA 3O4LD 4KHXL 4IOIA 3U36A 2CXKA 3DRTB 4K5NA 3ZYOA 1CLCA 2YQ3A 5F88A 4AUYA 2ZOKA 3ATDA 3HE6D 3LPOA 3E1F1 4ELMF 1R19A 1XCQB 1OAQH 1DVFA 1QYGH 4TL5A 3W9DB 2DEXX 3LN4B 4CBZA 1I85A 1G5GA 3L1EA 2JJTA 5F93C 3V5HB 5IQ7L 3ZE0E 1AJ7L 5EEXA 3MLXL 3VD2A 1BVKB 2IANE 3FC8A 2ZIDA 4L3FA 4J27A 3RGVA 1QHOA 3UABA 4LLMA 4PGDA 4PCTA 1ZT4B 1Z3RA 4G6KL 1PG7X 2Q6WB 3KLHC 1G6VK 1SHXA 4X5LA 4HJEA 3SKOB 1NGWB 4NCC1 1N18A 1I7ZB 4MAZA 1DQMH 4OUUB 2P47B 1ANUA 1MAKA 1ACZA 1T03H 2P8PB 4U1IB 4NN5C 2W9DL 4LVOC 3GD1C 4QY8A 2ORBH 4JDZA 4RGNE 4WCYL 5CXPA 4AZ8B 4XGZA 1KZYA 1XGRA 5AW8B 1WJ3A 1L4IA 2CNYA 2VMFA 3E9TA 3FQTB 4OAWA 7FABH 1LK2B 2BP8B 1R24A 3HC3H 1LEGB 3BPLB 3ZSSA 2I07B 1UKTA 4XVUD 1QLEB 4Q74A 1XAKA 2A77L 2P8MA 3NFSL 3OVUB 2Y23A 5C08B 1PYWB 1GVIA 3C09B 2R0LH 5CR8A 3OKMA 3T0WA 5FCUH 4G8GD 2ADIA 3GMQA 3T0EC 4HH8A 4LF3B 1J1XH 2UYLB 1XCTA 2ZX9A 1NH6A 3QULB 4WK2B 4PJDF 5DJZB 5E6IC 5GIRA 1ILUA 2HX8A 4X5QA 4JO3H 1DYZA 5T1DL 4N0RA 5KVEE 1MHCA 3DURB 3EH3B 4ZUTB 2UZIL 1S7XA 4DP4X 5HHPA 2NNRA 1F6LL 2P1YA 4HZ1A 2GT9B 1IGFH 3T2QA 2CBTA 3QUYD 3RUGA 4ZNEA 3ZDXF 4GOSA 1CGVA 5GS1C 4W9HC 4OZ4A 4NRXB 3MBEA 3H9SA 3R1GL 5CBAB 1WFNA 2EO1A 1CD9B 4R7DB 3KBFA 2X4NA 5DZAA 4X6FB 3CX5J 1NSNH 1F0LA 5DVMA 4DP5X 5K9OA 1TYRA 1MFEL 2DLEA 4NZRH 1IB5A 4I4WB 2EIZB 3HS0B 5EIIG 2ZZUT 3GXMA 3KVDD 3MZGB 1SQMA 4UU9B 4G8GB 5HVGB 2VDKH 4QKXB 3QO1B 4WENB 4Y4HC 3KH3A 1RCYA 3FH5A 2OR7A 3GSOB 3DMMC 3UJJH 4C83B 3ECWA 2YKLL 4Y4FD 3CV5A 3NQIA 4APQB 3PP4H 5CJBA 3T3ME 3QQ4B 1T1ZA 4BFKA 1OTSD 1OTUD 2ZX6A 4MMXC 2AQRA 2W0FB 1AGFA 1YEHL 1VKXB 1AGDB 1QFUL 1A1OB 1IGJB 2JIXA 1ADQH 1W6LA 1WBYA 4HU8A 4AGQA 3M7FB 1R0AL 3TBSB 2ZONA 4KRMB 5CEXB 1UD2A 3DO7A 4NN7B 1X4YA 2VXSL 1U8PA 3H7BA 5JYLA 1EV2E 5EBMA 5JHLH 2MH4A 3P0GB 4PB0L 3TA3B 3H4HA 4JBSA 5FWRA 4GG6B 2ENPA 1DJHA 1FI8C 2C3VB 2HTKD 1TXKA 1BQHB 3FFCA 4OZIF 3QWOB 3AG4B 3QPXL 5E4IA 3KMDA 4LRNL 4JO4L 1O7SA 5GSRA 4JANA 1I4FB 1PX3A 2CO7A 4EUPA 5CD5C 3S88L 3T0AA 1IFHH 4GSXA 3VJ6B 2QELA 5JHDB 1REIA 4KC3B 3A4AA 4Y4FB 4HCGA 3OQ3B 5HHVL 1JZ8A 2VM4A 5I8CA 1KTCA 2GJPA 3B7UX 2MOGA 4GAYB 3VA6A 4C54A 3MRDB 1IQWH 4XNQB 4NKOA 3VFPA 3MYJA 5HD8D 4GP8B 2OP4L 3A3YB 4ICWA 1BFOB 4XXDB 3KPRA 3WHXB 5IGXH 1QBML 1OARL 1WD9A 2I69A 4PB9L 4YWGL 4KROD 1W0YT 3C5SA 5JW4Q 2GSGA 1CFNA 4HUXB 3M07A 3WIIL 3U1PA 1ZTXE 1T0MB 1LTXA 2KI6A 1V10A 4HPOH 4WU5B 4YC2C 3BZFB 5ICXB 4OJFH 3U0TB 1MRCH 3DJSA 1H3PL 2BNQD 1A5FH 1JDAA 3ROOB 3CFCL 5K5YA 1ZS8B 3BWSA 3TBVA 5CJOH 1YMMA 3GJFK 2FE0A 1A6TA 3NEEA 4ZW6A 3B2XA 3QI9D 3VD7A 4YDJA 3NGBC 2JKWA 3D85A 4KI5E 5HI5D 5FYJH 5BW7C 5FM5O 4LPTA 2XWEA 4S1SL 4NZTH 1XEUA 3NJHA 2XG5A 3ZKXB 1R5WA 1UD3A 5DWPA 3N55A 1G9MC 4JRXB 1EXUB 2R1XA 3HN5A 4GSUA 4ODXB 2AV7A 5CCGE 3AGWA 3KR3H 5C8JA 4O4YL 2NOYA 3WYRA 1SXZA 2ZXDA 6PCYA 2YC1A 3ZHKA 4DPBX 4FAAB 4R2GC 4CGTA 3SPHA 1OKEA 2O5ZL 1KIRA 4XTRC 1KJMA 2UWEA 3BP7A 4TRPH 1UWYA 4ZODA 5I1AB 5GGQH 1I7TB 2OMXA 3QXDB 5IMOA 2QLVB 5KYXA 2CO2A 5E8NA 5IM7A 3BSGA 3Q2LA 1DVYA 1DJWA 3IJEB 2AHIA 1WBZA 3I75B 3MBWA 1J9RA 4L1SA 5KOMC 3TH2T 4AY0A 1NBZA 2DLHA 5TFSH 2AABH 4TLUA 2VQUA 4B9CA 1N6QH 4AT6B 4WY7L 2GTZB 3NIGB 3I2CL 1K6QL 5EZOL 2M26A 3VXRD 1U3HB 3JTTA 1QW8A 4BFNA 4RMUA 4GXUM 5KEZA 1NGZB 4RCAA 3ET9F 3MJ8B 5EUOE 4G82A 2B3IA 1HH6A 4ZOAA 1RP8A 3GM0A 4XMZA 5CR1A 4C57C 3FQXB 1TZAA 3FZUD 3ZYJA 1IEAB 4LKXA 1ZSDA 3N43F 1DSYA 1I9RH 1OCWH 3PP3K 1HDMA 5GRJL 1TQCB 4AV4A 4KH2A 4WV1A 3BZ4B 3KS0J 3PLYA 1U93B 3UTQA 5D7JC 2DI7A 3N9GH 4DAGL 1B2YA 4HBCL 2WZPD 1FC1A 2A9BA 3K2UH 4M1GL 4N5EC 3L1GA 5T1MB 3X3FL 2QT6A 3HZKB 2XYCA 3ZDYF 4PY7A 3BQUA 2VDRH 1NCHA 1BZEA 2MFNA 3GZPA 5EC2B 1JL8A 2XXFA 3P9LB 4GNKB 4FXKA 1AD9A 3F58H 4OZHF 3SBWC 1C5DA 1VIWA 2PTTB 2Q7NA 5E9NA 5FYLL 5ENWB 1NANI 2KC0A 2EYSB 5FHBL 4A7SA 5C86A 2IBZX 1U91B 5T1LD 4ZTEA 3F7PC 4F7CB 1AYRA 4RGNC 2WPGA 1CF8H 1J05B 3ARPA 3H2WA 2QVTA 5E5MA 1OCOB 2FRGP 4K7PH 3GMOB 4W9LC 4YHKH 5B39G 1T04A 2W60A 4TVSa 1L6XA 2WLJA 4EPSA 2FT6A 4JDTL 5T3XE 2W80C 3QIBA 3TH3T 4Y5XA 2IBZY 3T1FB 2ZOWA 4U33A 4DGVH 3F84A 3WUWA 3ZIMA 3V0WH 1NKOA 3AB0C 1QR1B 1PZBA 1ZA6A 2LE9A 2PR9A 3QDMB 5HJGA 3WCYA 1H8LA 5C09B 3WNLA 1SVCP 2IF7A 3VFSA 3EJRA 1PBYA 1RLBA 3NJKA 1D5RA 4NQVA 3VI4B 3VRIB 2I7OA 3QPQD 4DEPC 1TKWA 2XPYA 3SDAB 1FFPB 2PCFB 4DZBA 5HYJE 1MNUL 4K55A 5IOKA 1R4XA 4W9ZA 1MWAH 3SGJA 2DWYA 3MV8D 1THCA 4LAJH 1JVOA 3BCDA 4M02A 3CFBA 4FMKA 2IFFL 1FZOA 3KWTA 4K8RC 4R90H 3S3DB 4JZJA 3F2LA 3JV5A 4Y2OB 2GAZA 1S9XB 3PJSA 2JJWA 1X44A 2ZE0A 2VXTL 3NPZB 2CIIB 2ROYA 3E3QC 4O5LL 4X4ZA 2PXYD 3IDJB 3HNSH 1SDYA 2J4WL 3QWNA 5C71A 2JLPA 4OGYH 2DI8A 4W1TA 3FAWA 2O5NA 3NUKA 3RWGB 3TU6A 2F53D 4F80A 5I1DA 1KFGA 1RERA 5KJ4A 1LO3H 1VFUA 3FT4B 1TSHA 1QUNA 5E8DL 4B9YA 1R9FA 1BQLH 4ZFZB 1RIHL 4WWPA 1BQHG 2JH2A 4LOUD 3H54A 3NZHH 1TUPA 2XYBA 2LFGA 3VCLB 4J4PA 2A9AA 2P43B 3EJQA 5AAWA 3H2PA 4MYPA 4NUMA 4R96B 5E6RB 5AB0A 3EH2A 1R5VB 3LEYL 4Z7UF 1GGTA 1DJGA 3PRZA 1CI3M 3QZBA 1MY7A 5DRWB 2EE9A 4JQVC 5EG6C 4NAJA 4YGVA 5J06A 1P4IH 2WV3A 2K8MA 1IL1B 1Y6NR 2OZ4H 3RVVC 4XNAA 4HOZA 2PXYB 1LO4L 1TQBC 3MV7A 1SFDA 5HDWA 2VZUA 1MCJA 3GMRB 1BM7A 3BGAA 4NQEA 2F53B 4LLDB 3B9DA 3IJYB 4AENA 1ZIBA 3RNQA 4LVEA 4J2QA 4WI3A 3CK0H 3P11L 2PWDA 3V6FA 1JTTA 1GA2A 1CLYH 5C9JB 5IG7B 5C9KA 2XQYA 1JPST 4I1PA 2XVLA 3JWDL 4NWUH 2ZUXA 4HUWA 1CIDA 1HL4A 2ZXAA 1W16A 3T4YB 5JA9A 2AQNA 4BCZA 4AKOA 1U36A 4DP8X 4M1CC 1PIFA 3O3AA 2ARJA 2WTPA 3ARFD 1EEUA 2G2RB 2X4RB 3WFHA 5J56B 5I5IA 3MUGB 1LO0H 2XZCH 2Y25A 3C5ZD 3IU4H 2ESVB 5IJDC 2AANA 3LKPA 5HYSA 1YPZA 2E4FA 3VDAA 1CZ8L 2YRBA 5D96B 2ZKMX 3NCCB 1QSFE 4U7KA 2X4PA 2F7QA 4HYTB 2NZ1A 5KVGE 3NRPA 4MA7H 3C2AL 4HS3A 2BOCA 4U1LA 5EV7A 1AO7D 4XNXH 1WC7B 2WLIB 2F8OA 4M3HA 1E3XA 2FGWH 3U7WH 2FJGA 1OV8A 5AVSB 4WZ9A 5EU4B 2VCOA 3WFEH 3G08B 5HHQA 4ZFGH 1LNUA 5B1AB 4KY2A 3PGFH 4M5YL 4G43A 4LLQB 3LRKA 4TQIA 3CZLA 1G7QB 3UJTH 4KI5C 2A9NL 1BWWA 1ZHLA 3GMLB 3W57A 5E6YA 5DUBB 4ERSH 3QIUD 4PJEA 4G1MA 4YK4C 3ARFB 1SLVA 4XN7A 5AW1B 3RBGA 1KT2B 3PWJB 5DK0A 3B2VL 4FFZH 1CXHA 1U42A 4OZGF 2CM5A 4F27A 3OR7B 2C9PA 3SD2A 1PG7L 4P3DA 4XMWA 2NQ3A 4Q2ZB 5ICZA 5I30H 3E8UH 2F5BL 3TYFA 5ADPL 4FQXA 3TBTA 5KWYC 3BGFB 2EUXA 5F88B 1D5IL 2K4WA 5ITFB 4N0UA 4S1QH 3GT6A 2A73A 2ICWI 2VLLA 1NIFA 2XFGB 2JXMB 3BKYH 3SCMC 3SPIA 2VITB 4DPAX 4EN3B 4F2ME 1J7VR 3DO3A 5DC4B 4ZUUA 1GSKA 3MTXA 5EEUA 1VGEL 3S3BB 2GVYA 3KPTA 2WB7A 4XPFH 2E5EA 3MRQA 2B2XL 4JFEE 4N68A 2XN1A 3IMWA 3WAJA 2EIMB 2C1OB 1IQDB 3HBQA 1JXKA 5FO8B 4G7YH 3QIUB 2R2BA 5PCYA 2XT1B 4LAQL 4ZMZA 3QJUB 3CNKA 2AEWA 4KK5C 3Q5TA 3NIDF 3V4VH 4ABQA 4W6YB 3WTVA 3HS8A 1JVKA 2HRGA 5HGDA 3ZOAA 1HAWA 3RFZB 3ALXA 3TZVB 3TT1H 3RVTC 2AMGA 1KTJA 3G04B 1XBDA 1OZTG 1ZT7B 4OLEA 1U92B 1NCCL 5F9WB 4M7JL 1JIBA 3P9MA 1W72A 3ZDZB 3EDEA 4NQSB 1YNKL 5C0EA 5DMYA 2HVBA 4L4TA 1LEIB 1MFNA 3DX3A 2J8OA 5LGHH 5TPWL 3TESA 3QJXA 5I16B 1F90H 1BG9A 1S9YA 2WQAA 1B4TA 2DQUL 2H6PB 2JVUA 1QATA 4OF7A 5E2TH 2VLMD 5GRXG 2G5RA 3TVMD 1NL0H 2YPVL 1L9SA 2QQQA 2GK0B 3LNEA 5E8OA 3DX9B 4LIQH 1RUMH 3ETBJ 5MENE 2QQNL 4JFPB 1J48A 3MJ6A 4L8SB 1BAFL 4K9JA 4PRHD 3EG9A 1MW1A 3IDMA 3OXSB 4G8EB 4ZI8A 3S4SB 3AUVA 2BOBA 1LD9A 1M2VA 3GS4A 2OPCA 4R7XA 1L0QA 5HYQB 4LSVH 4X6BB 1OAUH 2XWBA 4WFHE 4TSCH 4JM0A 1H6FA 3W9EA 2WO3B 2B1AH 5E7FA 4IHOA 5E8EB 5G55A 3S3PA 5DD5L 4XNZC 4P07A 2LW3A 2FHFA 5EEWA 1NDGA 2YARA 4QRUA 2R1WB 4N2GA 2A4CA 3V2AR 1UT1A 4JN2A 3VXPB 2Q8AH 4WHTA 1WIPA 1R3JA 4ZUWA 3FN9A 2YD9A 4M7LH 4JZOB 4NN5B 1SZNA 1Z1WA 3LS5L 4Y2DC 5D72H 3TVMB 1KB9J 5IZ7A 3V79C 2CO4A 4FTVA 4GW1B 2GJRA 2EXSA 5ANME 3CPLB 2Q1EA 3KPMA 1NEZG 2ZD0A 1NIEA 4W70A 2FX9H 5C0BE 5TK2A 2LU4A 5DD3H 4MAYD 3S37L 2ITDA 1CURA 2EECA 2ODHA 4WGWB 4PJBA 3ARGC 1LWJA 2WMPB 4X6DB 2O93L 1FH2A 1A6PA 1KACB 2Y4SA 1UOLA 4LHQB 4XVTH 2NXYB 1ZA3B 3IK2A 3OM3B 1JYXA 4U4BA 5GS0D 1KGJA 3RVUD 1JFQH 1N7MH 3SJVE 3OB0K 3T0EB 3QAQA 1NAKL 1WUZA 2BNUB 1X9RA 1FYTD 3B7RL 2ZYSA 2CCVA 1E9QA 3VO0A 2C8NA 3VI3B 2BJML 5TK4A 2MNWA 5M7QA 4F5CE 1AQ8A 1V3JA 4E42B 2FYYA 3VD1A 4AC2A 4TTGA 3U9PH 3N41F 4FQ1L 4LCUB 3BPOC 4U49A 5C07D 3EFOA 2VW4A 5GGVH 4HCFA 4JG9A 2E9IA 2WLNA 4CNIB 3D6GA 5GS1B 2VN6A 5J11C 3K80A 3LKQB 3TV8A 4F58H 1BHGA 1MHEA 4JG0H 5FM5M 1ASOA 4PP1D 2DDQL 1XF1A 1AGCB 3DIDA 5IHZB 5J6GB 3KE0A 2YRZA 3BUDA 3K7UA 4G7RB 2VOTA 4LSSL 5CLZA 4LEBA 5BMFH 4M7KL 1HYSC 5E9DD 5ES4B 1SBSL 1BOYA 5AUMA 2WUBH 4MHHI 4K3JL 2VERN 3P4MA 3P1VA 4Y4HB 1G0YR 1FYTB 3QXAB 4NYLB 4PBDA 4FFVD 3WENA 2WZAA 5AW6B 2CJ3A 5TDNA 1B2WL 1L9MA 4MWFB 2VABA 4ONGL 3I9PA 5FK9A 3ULVF 3BDYL 2NY6D 2V5RA 5C07B 4A7GF 1CC3A 2E9WA 2YAQA 4CMHB 3MREB 1EJOH 2VN4A 4OF0A 3ABLB 2Z31D 3IBOA 2QFPA 3K1DA 2X88A 2DQEH 3E6FB 4B53A 3S5LG 2AEIT 2D03L 2Z91A 2BOLA 1JRHL 1JXJA 2KYIA 2VDLH 4JFQA 4MMZB 1AHWA 4QRRA