5G4OA

Crystal structure of the p53 cancer mutant y220c in complex with a trifluorinated derivative of the small molecule stabilizer phikan083
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
196
structure length
196
Chain Sequence
SVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKLFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERCSDSDGLAPPQHLIRVEGNLRAEYLDDRNTFRHSVVVPCEPPEVGSDCTTIHYNYMCYSSCMGGMNRRPILTIITLEDSSGNLLGRDSFEVRVCACPGRDRRTEEENLRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Harnessing Fluorine-Sulfur Contacts and Multipolar Interactions for the Design of P53 Mutant Y220C Rescue Drugs.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords CELLULAR TUMOR ANTIGEN P53
total genus 48
structure length 196
sequence length 196
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00870 P53 P53 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 5g4oA00
1GZHA 4IBQA 3D09A 2J1ZA 4MZRA 4LOFA 4XR8C 4G83A 1TUPA 2BINA 4AGPA 3KZ8A 4A63A 1HJCA 3WTTA 2X0VA 3WTXA 4L18A 3QYMA 3D06A 5ABAA 4GUOA 5G4OA 3Q06A 2J1XA 2YBGA 3D0AA 1T4WA 5AOKA 5BUAA 4IBVA 4AGLA 3WU1A 2P52A 3D05A 4HJEA 3D08A 3KMDA 5KBDA 3Q01A 5A7BA 3WTVA 4IBWA 2XWCA 1CO1A 2ATAA 4MZIA 2PCXA 1CMOA 4L0ZA 2MEJB 5AOJA 2IOIA 5LGYA 4AGQA 5AOMA 2BIQA 4QO1B 3D07A 1EAOA 3WTWA 4IBZA 4LO9A 3Q05A 4G82A 4IBTA 1E50A 2BIPA 3IGLA 3ZMEA 1HU8A 5AOIA 1TSRA 2WGXA 2RMNA 4AGMA 2XWRA 4GUQA 5ECGA 2X0WA 3QYNA 3IGKA 1LJMA 3US0A 3US1A 2IOOA 3VD0A 2ADYA 4LOEA 3EXLA 5AB9A 1KZYA 2H1LM 4IBUA 3WTYA 5G4NA 1H9DA 3EXJA 2J20A 4IJTA 3VD1A 4IBSA 1YCSA 4AGNA 1GZHC 2J1WA 2OCJA 2J6WA 2BIMA 3TS8A 2IOMA 4L0YA 2FEJA 2BIOA 1UOLA 2AHIA 5AOLA 4AGOA 2J21A 2X0UA 1IO4C 5LAPA 5G4MA 2J1YA 2GEQA 1EANA 4KVPA 4IBYA 3WTUA 1HJBC 2VUKA 2AC0A 3WTSA 1EAQA 3VD2A
chains in the Genus database with same CATH superfamily
3VXTB 4AI7A 2AEOA 1S7WB 1TEFA 1CU4L 2FBOJ 5DUBB 1E30A 4AYEC 2ALWA 1V5JA 3NCYS 4L18A 2QKIC 2QZ5A 3T2LA 3GRWH 4JG1H 1EO7A 1NMBL 1WFIA 4OZFB 2QSVA 2ITCB 4H1LA 2CJSA 1TZGH 1DEEB 5KBPA 4WHCA 1QABA 5KWYC 3HPJA 1WZLA 3H2PA 4M9PA 3WO4B 3UBXG 1JHLL 3CUPA 2EDKA 2XWBA 2ARJB 4G1EA 1LYQA 5F8RC 4AK1A 1FYHB 1TG8A 4BFKA 3W11D 5HGHB 3CV5A 3ZTNH 3TBYA 2NY4C 3TEYA 3N40F 4CJ1A 4OZHE 1D5IH 3S3BB 3SJVA 1ETB1 5HVHC 2IQ9H 1XGRB 4NKQB 1WJ3A 3U9PH 4I3RH 5DVPA 1ZE3H 1UCTA 3L5IA 3CFNA 3L4VA 3OM3B 5E5MB 4CUCA 4F2EA 4UB0H 4PJEB 3DUHA 4JRXD 4J6RH 1SMOA 4LCCC 1Z3GL 2OR8A 5E9NA 2P46B 1CURA 4BQ6A 3OKKB 1KUMA 1B3IA 3PQYA 1SVBA 4GSXA 1QFPA 4XMZA 5IOKA 5I15H 4Q97A 5CMAA 2EQDA 1R3KB 3CBJB 3CFBB 4LVOC 2GSIB 1QLFB 2ALAA 2C8NA 3CN4A 1ICTA 4XVJH 4Y16A 2V17H 1AXIB 1PVHA 1QHOA 2ICWB 2W9EL 4XPAH 5CN2A 4D0CA 1CYWA 1TETL 3Q6GH 5DDHB 1KJ3H 6CGTA 4JM4L 4TOYL 1LNUA 1VA9A 1OVZA 4HD5A 1UZ8A 5EEWA 3PE9A 1WAAF 3I75B 4YAQB 2OMXB 4WJG3 4WFEE 3GQFA 2QLYA 3MROB 5BW7C 1DVTA 1KCVH 2VDPB 1B4LA 3EHBB 3SE4C 2R1WA 1EERB 3RFZA 5CILL 3QIWA 1I9RH 1U58A 5FM5M 5DK0B 4ZDHB 3S98A 5C0RL 4P5SA 3ZKXC 3MV8E 2Z1KA 2IADB 4QF1A 2XV0A 3ML9A 4NKDA 5CEXA 3KPLA 1H3XA 4HT1H 2NQCA 4PS4H 1MZYA 1S7XA 4GLRI 4EI0A 2R7EA 1VGKA 1D9KC 2YRBA 3MO1A 5FCUL 3MA7A 3ESOA 1MJ8H 4Z7WE 3UZEC 3NBNA 1A9EA 3QDJE 3QJUB 2V6HA 1L0PA 2HMIC 3LZPA 3X12A 3UTZB 4P8QA 3IPBA 5LG6A 1P9MA 5I73B 3BIBX 3ULVC 4N2CA 3RWGA 5D9SA 2UVFA 3V4VH 5GS0H 2VR6A 4X6DB 4ZO9A 4F3FB 2CPUA 3X3FL 3UIZA 1IBGL 4TSAH 1MJ7H 2HT2C 3BQUA 4XAWH 1YMMD 2HTLC 3CDGA 3MR9B 4TNWF 3UBFA 3MJWA 1KGXA 1Z3RA 2O6CA 5F7DB 4LASH 3VTMA 3ZE0B 4U6YA 3GB7A 4RGOL 2VW7A 4GKOA 4PJ8A 1QFWI 5JMOC 4PJBB 2QHLA 2PYEE 2ZWZA 3HS0A 1FGNL 5C8JA 4YGVB 4PTUB 2IH3B 1HXYA 1LEGB 4RFOH 3N06B 4HEPA 1H19A 5JORA 4LLWA 1TCMA 4HQQL 4OGAD 1T04A 2P7TB 3MR9A 3HUJF 3B2PA 5F9DC 4POUB 1CE6A 1W8OA 2N4IA 3HZVB 2EVGA 5F89B 5HHQB 2JJUA 4PJGE 4X9HA 3GSRA 4OCYL 2ENJA 2XWZA 4JFDE 3X11A 4A6YL 2X4PA 5E4EC 5JW5B 4P23D 1DQIA 4XHJC 4N5ED 4FMVA 1XR9B 4JFOA 3L1FA 3Q2NA 1H8LA 1RZ8B 3B9VA 5IK3A 3CVCA 1IKFH 2P5WD 1BQHA 3O2DL 5HJ3B 4G8AC 4G70B 5F6HJ 1AI1H 1E5YA 3OAUH 2CMRH 1ZKAA 4URTB 3DVNA 3RWFA 5MERA 1EGJH 1HWWA 1I9IL 1L7IL 4Z7VA 4PJGA 4JAMA 3V0HA 4Y4FC 2EDMA 1T7VA 4KITB 4OGZA 1LO3L 2A9ML 1JVLA 2VJXA 4P5KA 5KS9B 4MXQD 3A5VA 3GMMA 3GSWA 4Q4EA 4JO3H 5AB2A 3S36X 1ECYA 1FC2D 1PMYA 3EOAA 1YDPB 1IGYA 3EUDA 2XQ0A 4HAGA 3FTGB 4N2IA 3UEZA 1T5XA 4CRPA 4QRRA 1IEBB 4P5TB 1Q9LA 1UOLA 2KC0A 2HCZX 4N8UA 2ZOLB 1GY2A 1WICA 1IC5H 5FF6A 4M5YH 4OCRH 4UAHA 3JT0A 3L5HA 1IEHA 5I1HL 2GSIA 4J4PA 2KQMA 4QRAA 5DRZA 5I76B 4N8PA 5IT2L 2O6DA 5JDJA 3I6SA 2C4XA 1ZSDA 5DC0A 3U79A 1MELA 3VD2A 3PP3K 5DQDH 4MMXB 4X5WA 3NA9H 5EDXA 1YMME 3QG7L 4Q89A 1CZ8H 2BSED 1FVCA 2WQ8A 2VLMD 2HLFD 3AW5A 4XR8C 3U1QA 4AK2A 2K8QA 4Y19B 5GGQH 1IAKA 3EDKA 5EUOE 1NEPA 4RCAA 1MUJB 2QL1A 3CSFA 3DOHA 4ONGH 4Y16B 3E7JA 2RIKA 4TRPL 4UT6H 2AJUL 2DYPA 1Q90A 3K4ZA 5KSBE 3UIYA 1F6LL 3PJNA 3E80A 4WV1A 5EU7E 3RIKA 4DFIA 1WFJA 1MXDA 3OB0K 2YARA 3WL9A 3ZDZF 1OLLA 4HK3J 4N2OA 5EU6D 3CPUA 3B56A 1IM3D 3QI9D 2Z8RA 2D31B 3MODH 1NOLA 3JUYA 2ZUQC 3Q3GB 5DRWA 1YMMA 5AVTB 1HC1A 3WKYA 3ROLA 4EBQL 4Z78A 3QQDB 3BAEH 2Z4QB 1K8IA 1WFTA 4JR9L 1FG2A 4KAQH 1AOZA 4KNQA 1VKXA 1IQWH 4LPTA 1EX0A 1CXHA 3IJEA 3EYFB 2UXFA 3EG9A 4PWEA 5D2LA 2QGEA 3MJ8A 1GYAA 1KN2L 3MA9H 4DERA 3OZKA 4GBXB 2OSYA 4MVBC 5JPMA 4UINH 4ES8A 5JIIA 1HSBB 3O3EB 5HGGS 1OP3H 1ETA1 4XB8A 1XMEB 5BRZE 5AALA 1D7FA 3FCUB 4NS0A 1A9BA 1CD1B 1UJ3B 2QPUA 4MCYA 2A9DA 2HT3C 3T0VA 3JT2A 3ZMEA 3N1MC 4FQLL 3MRLB 4FABH 1F58L 1TYJA 1A7OH 2VQUA 4L37A 3AG3B 4ETQB 4QTIL 4F92B 3IE4A 1QMUA 1V7MH 1CWVA 1JXDA 3UYPB 4ZFGL 3NACL 4KJYA 4FYTA 4DQOH 3VI3A 4OZFA 3T8VA 1DSWA 1N7ML 2AK4A 4JRYA 3VB9A 2MHAA 5ID1A 1OCWL 4QRTB 3WUWG 1LO5B 3CFJA 4PJCE 4WY7H 5EUKB 2DW5A 2D03L 2X2UA 1FF5A 2YBRB 2NPLX 3JWNC 5MEQB 1I8MA 1MIMH 4YEFA 2NNAB 3MGOA 1NPJA 4JPIA 3MLRL 1T5XB 4QRRB 5TE6L 2OI9B 1ONQA 3WJLA 2WSDA 4LPCA 5JIDA 3ZRCC 1VCAA 3UO1L 1NBYA 4FFTA 2H0EA 1JMZA 4FX5A 1ZPUA 5E94A 4NCC2 2A73A 3UP1A 5C2BL 3WE6B 2ZOLA 3P3SA 1DVYA 3J8F7 4K3HA 5EUKA 3S5LG 3GRBA 3TCLB 5C86A 2Z7ZA 5F7YC 2PUQT 1ANUA 4ZPVB 1MWAA 2CLZB 2VM3A 5E99H 5SWSD 1MLBA 4AE0A 1Z5YD 2XOTA 3Q6FA 1E8XA 3QRGL 4TQIA 4ABUA 3CZUB 2IANA 5FHBH 3BEVB 3WSQL 5ACZA 5HY9A 4JFXA 3L4CA 3G08A 1RZ8A 3JXAA 5AW5B 4BQBA 1JFQH 1ETZB 4GEJA 3L3KB 4DO5A 4WFGD 3QGVA 4R0LA 1S7VB 5JXEC 1KPUA 4L8DA 3VD9A 3WFHA 2VZTA 1AS8A 4XOBA 4PIRF 5D1ZB 5FGSA 2KERA 1MCEA 2QQLH 1H3WM 5ALBH 4JQVC 4P3DA 5EU4B 1KCSH 2X4SA 1ET7A 1SOSA 4PPTA 3PQYB 4GRWE 1MFBH 4WU7B 3T3MF 2VH5H 2H7WA 3GMMB 3WU1A 2P52A 1QWHA 3P40A 4YFEA 2ZOKA 3ECQA 5CD5D 5AVRB 4I1NB 4KKLC 2B59A 2FR4B 3DYPA 1OZTG 4ABQA 3TX4A 1PZUB 2PXYD 5HDOA 1UD2A 2F5BL 1BEYL 1F6AA 4Q6IA 3NAAH 2XCMC 2FJSA 5AOMA 1R33A 3PPEA 5AG9A 2C9RA 1AZRA 5TE7H 1MJUH 3DK2A 4UOJA 5IHBA 4UUJB 1E6OH 4L1BA 1QWNA 3CXHJ 3A4AA 4X5WB 3TTSA 1FL6B 1QASA 2JSFA 3DGGB 4WU7A 5IBTL 3RX9A 4AGMA 1RHHA 2Y4SA 3GBDA 1A9VA 1AZVA 3FQUA 3NPSB 3IXAB 1MI5E 3BOVA 3GTVA 2ZUUA 3S35H 3U7WH 2GC7C 2YRZA 1BLNB 3VWKA 2OYMA 2YUXA 3TF7C 1W8EA 3U30B 4KOCA 3T4YB 1THCA 1FL5B 3D3VA 1KXQE 4UZSA 3VXTA 1FE8H 4Q7DA 5A2AA 4JO8A 4JG5A 1JYXA 1U93B 3QRLA 5E24E 3ASWA 1KTDA 1QPXA 3QCUH 5DZPA 4TVPD 3ILEA 2QGCA 2V9QA 4Y88A 4ZAKB 1H15B 4K3DL 4F5CE 5FYKU 3VFNA 2DL2A 5LLIC 1J1XH 1F4YL 4QRBA 3WIHL 3QQ4A 5K9OA 1UOWA 3T5WA 2OS7A 3TCLA 3NZ8B 3KGSA 2NSMA 5C0CD 2BCKB 1T1YA 1PBYA 1RK0B 1JDCA 5JW4R 2C3VB 4ODBD 2YJQA 1IL1B 1Y1DA 1AH1A 3OX8A 4XB7A 1FNSL 5BS0B 3BZFB 1KLGA 4LDCA 3GXDA 3E8UH 1QACA 4AW4A 4JJOA 1CBJA 1KG0A 4F5CA 1G7HA 4N2LA 5BOZG 5F7AA 1WDAA 1INDL 2VAAB 3L13A 1BQHG 4GIAA 4NHUA 5D55A 1N0LA 3O2VH 4ZZFA 3L5JA 5C70A 1J5HA 3Q1SH 2LQRA 1W0WA 2QR0A 4ODTH 1TJGH 2J1ZA 4L1SA 3HS8A 3MRBA 4EDWL 4YLCA 1X44A 2BCKA 1BZ9A 1GIGH 2CHZA 1ZJAA 1PNCA 3QPQD 3VX0A 4ZFOA 1RFDH 1ZMYA 4K4KA 2F8XC 4PJGB 3WY2A 5E94B 4FMKA 2NDFA 2FJFA 1JXGA 2CGZA 4IYKA 4PJCF 2HSIA 1CLCA 5CKAA 1OOWA 3FXIC 3WNPA 4XC3H 4XMLH 2J5WA 1WAAA 3K0YA 1C16A 4E41B 2PCYA 4BHUI 5IFJB 1I9RL 4P2QD 5IW1B 3ZR6A 3KLAB 3PWUB 3FQNA 4HZLB 3RUGA 2GTWA 4HEPG 2Q86A 2DLHA 2C3HA 4EIUA 2CIKB 1A3LL 5KZCB 4NQQA 3DMMC 1VAHA 1CF8L 1UWGL 3CFEA 3R7RA 3N85L 1JGVH 3UJIH 3AMLA 3BIAX 1IBDA 2NY0C 3OXSA 4XNQA 1KV3A 4NQCE 1S7RA 3P30L 3D69B 3TEWA 5EA0H 4NPJA 4WFHE 3V4VA 3FF8A 4CMMA 2NY5L 4D7PA 5IMKB 3KBEA 1ASPA 1IU1A 4FG4A 4Q9BA 5JOFB 5I0DA 2MMXA 3GS4A 3CIQA 4FHBD 5TF0A 4HG4K 1CGSL 2A5UA 1E27A 1JCVA 4P3CL 3U0TB 2TSBA 3S97C 4RMSA 4XAWL 2EIBA 4YLQT 3GMOA 1DZBA 5EUOA 1Q9KB 1QUNA 2XXMB 1HSBA 5FV2A 5DUPH 1IFHH 1UD8A 4NI6A 2I7SA 4NQCA 4OV6F 5C0IA 5I6KA 5CGYD 1XZ0B 3BP5A 4FNQA 4R90L 2Y6SC 3RPIB 4YL9A 2Q76A 1A4JB 3WTYA 3J2PA 4XNXH 3H8NA 2Y5TA 3MACH 3UTTE 1T4KB 4EVNA 1O7SA 1OGAD 1VFUA 3F85A 1I3VA 1RK1B 3B1UA 4FLHA 4Y2DD 1OT1A 4P2OA 1IGFH 1ZHBA 1T1WA 3KGUA 2VKXA 5FA3A 1JHTA 4L05A 3BLKA 4MXWL 5DK2B 4MNGA 1A6WH 5KW9H 2BSSA 1EUTA 4LQFH 3BWAB 4OZHF 3BGAA 1GGTA 4HEME 2XPYA 4UT7H 2YBRA 2VISA 4G7SB 5A2BA 4V2CB 2C3VA 3WEXA 3MUY1 3INUL 5GGRY 2FT7A 2OZ4A 2LU5A 1UD5A 4U1NA 2AV7A 5EB9A 2LU4A 3MRGB 5GIRA 3TASA 1Q4NX 3NRQA 4YC2C 4AQEB 1I3RA 4AL8H 3MLYH 1NLDL 1BOYA 1QSZA 3SOBL 3U4EA 1XD0A 4FXKA 4F7PB 3FK3A 5GRWA 4QRUB 4Z7OE 2YWYA 2WXPA 1KGJA 4JFQA 4Q56A 2AGJL 1P7QB 2XQBL 3O8XC 2QSTA 4G43B 1I8LC 5C09B 1UURA 4FFYL 5AW9B 1KY7A 2CLZA 5AZEL 3EO9L 1MHCB 4NQDA 1RZKH 3JQOB 3KYNA 3QE5A 2Y7SA 4RZCA 5DHVB 3V0DA 4C59B 5AB0A 3QZMA 1A4KA 4OZ4A 2G4EA 3HC4H 1GGBH 5C6TH 5IJKA 1G9NL 4IDJL 5DJDA 1YEDA 4B0MM 1A5FL 1EEYB 2WTRB 4GRLC 4JN2B 1AKJB 3SGKC 1JZHA 1B2WL 3GO1L 4YHKH 3IJHB 1OGTA 1KXTB 4OJAA 1YN6B 1KYOK 1S7TB 2GY5A 1XGZA 2PPEA 4PP1C 3VCLA 1IC5L 5J8OA 3VXQA 1JPGB 2IBZX 2ZYRA 4PS7A 2H1XA 5AFAA 4JAMB 2MHAB 1Q0YH 2EACA 2MPAH 3G9VA 4XWGL 3SCMA 1XD1A 3ECWA 4PJEA 4U4BA 1C5CH 4ZXBD 4E9VA 2CLVA 3ECVA 3QW9A 4MCMA 1I7ZA 4JKWA 5KTEH 1AKJA 5E1GA 5JHAA 1HT6A 3ETBF 5DMKB 5BRPA 3KVQA 3VMOA 1G7JB 4OD1L 4GLRH 2AEIT 1RZIA 3N9GH 2VUOA 3ZKSD 1NIAA 1ID5I 4DGIL 1ZY9A 1HWGB 4CW1A 4XE5B 1DJSA 3BPOB 3D1MC 2IFFH 2BDNH 5B8CB 1IEAB 3OAWA 3SE3A 3JWOH 1S3KL 3QDMA 2EKSB 5ICZA 5KN5A 4ODVH 3W39B 2WZ0A 5DRZB 2ZKWA 4ATWA 3CQFA 1CIUA 2FZ3B 2YAPA 2YRPA 6PAZA 4YDZA 4M7LT 4N25A 4Z76A 3V9FA 5I26A 5F3BA 3QORC 1CFTA 5J1TC 2EH7L 2O5ZL 3KLAA 3PWUA 4WVRA 5FWRA 3KCPA 2DIJA 4OAWB 3DX6A 2AV1B 2IBZY 3NIDE 1T5KA 5I76A 2PR9A 4Q4IA 1NKGA 1WBZB 3D30A 4M8UA 2BP8A 4GW5B 4OGQC 4PJDE 3MLTB 4PG2C 4DO4A 4UANA 3GD1C 4QRPB 1UM6H 3BUPA 3IEAA 4QHNB 5B4MC 3MJ9L 4JQXA 1TITA 1QSVA 3VI3B 5ITFA 1A9EB 3LVTA 4AX3A 3AWGA 4C56D 1HWHB 3FT3B 4EQ3A 1ACXA 4NQXB 4D8PA 5C9JA 3WTSA 2MTAA 3K2KA 2F6AA 2WAQA 2CQVA 3LB6D 5GSVA 3DSFL 2D03H 3WG7B 1P7BA 3CZFA 3CBKB 3Q44A 2ZICA 1A7NH 3TT1L 5FW7A 5I1AA 1D5ZB 5TE6H 1AZCA 3BUTA 3GXFA 1OAQL 3KPOA 5DJ2A 4GKNA 3RRQA 5EOCL 3UO1H 1NOAA 3I50L 1NFDF 2X87A 5D2LB 5CEZH 2YFNA 1EZLA 3L6FA 3OR6B 3ABGA 3UMTA 5CLYA 3C2AH 4MA7H 4ERSH 1R3IL 3OKNA 4XPHL 2CCVA 1YQVL 2GY7B 2DQUH 3H9SD 1DBBH 1Z9OA 3L9RA 3MLUH 4G11A 1R24A 1CD1A 4MCYB 5KJ4A 4NQVA 2EE9A 5J89A 4PLKD 3HZVA 2VLJE 5C71A 3ULVD 4O2FA 4GO6B 5D72L 3LH2L 1AO7D 5MHSD 1JFQL 5D4HA 3T71A 4QJ5B 2IWFA 4YDJB 4U05A 5BV7H 3NFSL 4LOUD 1A3RL 4HIJB 4K7PX 1J9QA 1R5WB 4NIKB 1AZUA 4QO1B 3C75A 5F96H 3EYSH 5DZ9A 1EAOA 4JFYB 3SE9H 4Z7UF 2E75C 3JWNE 2QQLL 4RAUA 2X3CA 4RISH 1N0LB 2IG2H 3NJGA 3Q2WA 1AR2A 5GZND 1NUDA 3IB4A 3ZDYB 3LZQA 3C08H 1UHVA 2Y3AA 4KRPD 5KVDE 2IOOA 2DWEA 3DARA 1NMBH 5B1KA 3OJDB 3B9AA 4KMTH 1YNLH 3NFNB 3GMRA 4ICXA 2X3BA 1HSAA 3D2UB 2I27N 2XQYK 4KTYA 3O6KL 5E4IA 5H4YA 2VLKA 4LU5H 3DJ9A 1W15A 2VW6A 3R0NA 5JLZA 4U1HB 3FDWA 5T1JA 3JTTA 2DQEH 4LPXA 4LSDA 5E7FA 3BWSA 1R5IB 3K4AA 2IANB 3FMGH 2G2NA 1ZSDB 5EU4A 1HKLH 3T2PA 4D9RE 1J48A 1Z9LA 2I07A 4KC3B 2Q5BA 1OP3K 1OPGH 1X5FA 1JK9A 4YPJA 3BRFA 2A74C 4TUOB 3FUDA 2FQFA 3ARDA 4XC1H 1XB8A 4B5ZA 3FL7A 4IOSA 3VFWA 2QFRA 1P4BH 1VEOA 3A4DA 3SDDD 5MERB 4LPYA 3JZYA 3BAIA 1S78D 4QHMA 1NCWH 1ZLSL 3RBGA 5KS9E 4DKAA 4DPRA 1T5WB 5KVFH 2QQNH 5HGBA 1O5DT 3L3OC 1QR1B 5GGUB 3DJTA 4P5KB 1NGZA 3VXMB 4ZMTA 4LNRA 1M53A 4GUPA 1EUUA 2BINA 5DWUH 4LHUG 2XN0A 4YXLH 5FO8A 2F58L 3QZPA 4YSOA 4YSRA 4J39A 1DUZA 5B7EA 2DQGL 2FWUA 2K70A 1F02I 3N44F 4J1UB 5B1CA 1FNHA 4HCRL 3IFNH 1XAKA 3ISYA 4FQXD 4LSSL 3KCPB 1ZVSA 1DQQA 1PKQB 2CKBL 4W9HC 4WU5A 1MPAL 1SY6A 1W8NA 4NUPA 3NSDA 1MVUA 2JJSA 4F80A 1SLUA 3SPHA 5D1XA 3HE7A 2EILB 3GB7B 2VLRB 4WK4B 2F08A 2J5LC 4YZWA 4KKQA 5DJ6A 1C7TA 3MX0A 2I9TB 3PHQB 4JFEB 4CNIB 2WO2B 5JOPE 2WYHA 3II3A 5J6HA 1B0GB 1HL4A 2MQ0A 5GRUL 2YUWA 4KKPA 4WW1B 4P5RA 5E08H 3FU5A 3QSKB 4IBTA 1PZBA 1J0KA 5D7IA 3L7EB 1XBRA 4M7JH 2VZOA 2AVFA 1ZVSB 4NJ9H 5FS5A 2DWXA 4XC3L 3V4VL 3T2OA 1JZ2A 4LCWA 5D5MB 2R2CA 3TYFA 4G2AA 5T33L 4XN7A 4MA1B 4QTFA 3BZ4B 4R84A 1MJ7L 3FCSA 4WNQA 1PZ5B 5BZWA 1Y07A 4XNAA 4I85A 3ZK0A 2BIIA 4HDIA 2W95A 4HUWA 4RQQA 3MREA 4KJPD 2JFCA 5D1ZC 4I0PD 3TN0D 3C60A 4DAGH 3JTSB 3U6RA 5B38A 4FFWC 4UDUA 2BOBA 2OX5A 5D7IE 3TPKA 3ARFA 3ARGD 3RWCB 3LSOB 5F72S 2IMMA 4K7PH 1DLFL 4ADIA 4DESA 3HHMA 3VM7A 3ASNB 3TEUA 4EPSA 3SYCA 2PTTB 5FB8A 3IK2A 2YAMA 1ZLWK 4M1CC 2HFEB 2YEZB 1NBVH 1LWJA 2GKIA 3DXAB 1LEKB 3MZTA 2ZUTA 2J1YA 4WZ9A 4DKTA 4WWID 1Q9LB 4EN3A 5MP6H 3OJDA 4A6YH 2QEJA 3LEVH 1I4FB 3W37A 1G94A 4J3BA 2AP2A 1QEWB 3V4UL 1KFGA 1KOAA 1XF5A 4JKKA 3CSGA 3OBAA 4HFUL 4HW6A 5BXFB 4G6JH 2CO7B 5L7XH 2CMRL 3HTLX 4FJ6A 1QLEH 3UC0H 3LB6C 2R29H 3VVVA 1DUYA 3NSCA 3FTVA 4GMTL 4Y0GA 4JFFB 2OCFD 1DQTA 4ZD3L 1FZJB 3RL1A 3QUZB 4A7QA 2D73A 2HX9A 1OB1A 5GPRA 5E8PB 3OG6B 3IBOA 4XBMA 5H2BB 1MCOL 1P9MC 2OSLA 2K7PA 3UCRA 1GTFA 3UBGA 1IAIL 1U8MB 2EH8H 4L3AA 3D05A 1PIFA 2VM4A 2DB8A 3D85D 5JW4N 2TAAA 1BF8A 3OKOB 4PQXA 3C6SA 2Y5TB 5FV1L 3T0XA 4MTMA 4CC1A 4HG4J 3MLZL 3ZZSA 1JNNH 3OWRA 1DL7L 1TZHA 2HVJA 1QFWM 2BW5A 4X7SH 1AD9B 1MHPL 3BUYA 3FQXA 2X9ZA 4J23A 4JO4L 5E8EB 1UVQA 1UEMA 1ZOXA 3SPIA 4Z3HA 4FZ8H 5CO1A 4NO2B 4M02A 2OXGB 4A2EA 3ZOAA 5FW8A 2X89A 5GSVB 4HSCX 1FDLL 1G7PB 5I1KH 3T3PF 2ICCA 2VCOA 5E51A 3S37X 1UM4H 4GUQA 1EZVX 1FVEB 2X7LA 2YK1H 2R2BB 2BVOA 1KBBA 3V0JA 2GTZA 3IXTB 4HWEL 3LKRB 4H1LB 3KWUA 1A3ZA 3VD0A 5FA4A 4LOUC 4GKNB 3M46A 3MI6A 3TWYA 5MI0C 2AABL 2R8SH 1KXQA 4OM1H 4P04A 1Q0YL 3GBEA 4FQ2L 2WVVA 4XWGH 3RHWF 1MHCA 2OK0H 1URLA 4QCIB 1CI5A 4KWUA 3F7KA 4UYPA 1KENH 3ZYOA 4BFIA 1FSKC 4KO6A 2NNAA 2YMXH 3MGOB 4PJ9C 2EDEA 2XNAA 3PAZA 4ZUTB 4OIBA 4J5VA 3RGVA 1EAPB 3RWGB 4LLDA 5LAPA 5IQLA 3C09B 2UWEE 1DVFC 2YD6A 3C5ZB 4LOVA 3PUCA 2EIKB 5FA4B 5AZ2L 2VT0A 4ZUVB 1S8DA 4HYTB 1X7QB 4L1TA 1H3GA 3QDGD 4F9PA 4FABL 4FQQA 4I0CC 2DQHL 5IHUL 5GS1A 3GI8L 5B39G 5HHVL 5ID0B 1JWMA 1V7ML 4AVIA 4I2XB 4UDUB 5E0FA 4RMRA 1MWAL 3VM5A 1KLFB 1M71B 4HULB 3OB0H 3BYYA 4G83A 1KYOJ 3VRJB 4WHTA 5C08A 4XPFH 3UAJC 1DP0A 1KGCE 2NR6C 3Q8FA 3TPUA 3BIKA 5ACLA 4AEIH 2LU3A 1TTBA 1FRGL 1ZEAH 2R56L 2YN3A 3M17A 3MBXH 3X1EA 3N41F 1OL0A 1MIML 2Z7YA 4MJID 1U3NA 3GIVA 4NQUA 5DS8B 4XP9H 5JLZB 1NINA 2BOBB 1D5RA 2OX5B 4XPGH 4P5TC 4XX5A 5DLMH 2W59A 5GS1C 1GMIA 2P5EB 5AW7B 2FD6L 3TBTB 3CZLA 4X7DC 3QH3B 2ITFA 1J11A 3KMDA 3NJHA 4XWOC 1EXGA 3T0EB 1V10A 2IH1B 2OMZA 4F20A 3NESA 3NJNA 4Y4KD 3A6CH 4JDZA 3S5LA 3U6XA 5HVFB 2Z6FA 3P0VH 4K94L 4HBQA 3JV4A 4WRLA 4ACPA 1C5DA 2JI2A 4JFSA 5DA4A 1GW0A 3TZVD 2H26B 1NSNL 1QFOA 5L0QC 4IMLB 1OP4A 2C4FU 2ZCHH 5EUOB 1AQHA 2DEXX 2NYKA 3TM6A 4LCUA 4P0DA 4OCSL 1BGXL 1L5GB 3DSNB 3QR0A 2D3VA 1M6OA 5F8QC 1QR1A 1SVCP 3Q3GA 2LFGA 4LESA 2OJZH 1TU2B 1WVZA 4N2AA 5SX4I 3IGKA 4NQSA 4K0OA 4NO3A 4ZODA 3U7YL 3CD4A 4ZFQA 1QX1A 1F6FB 3EH3B 1PX3A 5E5UB 3UTPD 5HJDA 1YQVH 4Z7AA 5IMMA 2X1XR 1UB5A 5FF6B 2AK4E 4JRYE 3O4LB 1NKRA 3FFOA 1IC4H 3GRWL 4JG1L 1HAUA 2UUDH 1OCZB 1PKQA 3Q43A 3GXTA 1PD6A 1ZJBA 3KPMA 2P49B 2ARWA 1E9QB 2H32B 2OQJB 2OMXA 4MWFB 4PCTA 5C0FB 4KJWC 2NX5E 2HPTA 3EADA 3LHPH 2VIRA 4Z95H 3UPAA 2X88A 3O0LA 1KYAA 5CGMA 3ME0A 3POHA 2WUBL 3EF7A 4AGOA 3IU4L 5IB2B 1UFUA 5J1AB 2N56A 2LVCA 3QUXC 5A3IC 1NCTA 1RP9A 2VDLH 1IKOP 4L8CB 5LBSH 1MJUL 4NQDE 1CLOL 3U9PL 1P53A 3MV01 2IGFH 5C0GB 3BAKA 1PKQE 5FOJA 4QHKI 5J6GB 3OZ9H 1LEIA 2I25N 4N26A 1XF4A 4NRXB 4Z3FA 4HS3B 3QO1A 1FP5A 3WJMB 4JPVH 4M00A 2ED9A 3BZFA 3D52A 1NL0H 1RIHL 4IRSC 4PGEB 5SWZB 3OX8B 3S4SB 4V1DE 3KBHE 1ZHBB 1KXVA 2BSTA 2DLGA 4ZQKA 3KZ8A 2P3YA 3H42L 4GRLA 5T3XE 3W81A 3ZZQA 2DQEL 4JFDB 1M56B 1YUKB 4RQQB 3I9IA 3IFPB 3SYPA 5I15L 1T80A 1O7VA 3R8BB 4N0CC 5HGAB 2VDOB 3VXRD 2A0LD 3L54A 4G80A 3AAZA 4TV3A 2ZPKH 2J2ZA 1J5OH 4YL4A 1NUNB 3UJTH 3IJ9A 3GS0A 1FZOA 3VXRE 4FNTA 4AMXA 1U8LB 1M9SA 4TOYH 5HGDB 2IV9A 3IRCA 3SQRA 1UT2A 2E7LC 3FQNB 3R1GH 4QYOB 5SWSA 4A2FA 4XRCA 3EFOB 5CZRA 1BFSA 1HYRC 5T3ZE 3WTVA 3AU1B 4DZBB 4HUCA 1MCSA 3MTXA 4LLMB 4PY7A 5KVFL 1NWOA 4BDVB 1X5LA 1AGCB 1JI2A 4F7EA 1CL7H 2ROXA 4RWYL 3QEQD 2WYIA 1OIOA 2EEAA 5FO8B 3KDMA 3OXSB 1TCRA 3NCXA 5DWUL 3HLAA 3FH7A 2BWQA 4KX8A 2M2DA 1VACB 1QR4A 1EDHA 2F58H 5CR8A 4X4YA 3O2VL 4YLBA 3U46B 1T0MB 5TJWK 5ENWA 4XBEH 3BMVA 4CU8A 3TCXA 5FCUH 1CL7I 5SWSE 3SZ6A 3ZE1B 1HINH 4U6HA 1FFTB 2CZNA 4P23C 5SV3A 2JKLA 4Z7WB 4GP5B 1QBMH 1U6AH 3O0RH 1D9KB 3B5GA 3QHTC 2YFOA 3GKWH 3QDJA 2UZYB 3ZY7A 5HYQB 4NRZB 2GIXA 1HTYA 4JM0A 3HKFA 3B9EA 2GYSA 2G0LA 4YHNB 2KZ1B 3RAJH 4MAYD 4LNRB 1E8YA 1EHAA 1EEZB 2FATH 4G7VH 4YZFE 5SX5H 3VXUB 4L2YA 3W0WE 4LASL 3DUSB 3B1TA 5HHME 5CAYB 4O02L 2WLIA 1AQDB 3L1OH 1MAKA 1WIOA 4JFTA 2YGOA 4Z7OB 3MBWA 3KPRB 1FGNH 5DHMC 1CK0H 2EJ1A 1LTXA 2D2CC 1MFDH 3SN6N 2XZCL 2AERT 5LGKA 3CN1A 4W93A 1PNDA 4EKXA 3DX8B 4URKA 4CVXB 2CGRH 4NKIH 5D71H 3POCA 1L9PA 1AXTL 3B2XA 4UTAA 5FYKE 1QFUH 1KTLB 2DKMA 2VO5A 4ETQA 1RURH 2MH4A 1HCVA 3ZRFC 3JTSA 3U6RB 4EJ1C 2FX9H 1CR9L 1YN7A 4S0HA 1YO4A 5IOPB 4QY8A 4ZI8A 5DZAA 2VYRE 4MJ5B 5DS2A 2B77A 4AYFB 3VI4E 3RWEA 1A14H 1AHWB 1HEJC 1LO5A 1DFBH 3CFJB 1I1AD 1FVDA 3CU1A 1DVFB 5FWQA 3B37A 5FB8B 1X4ZA 3PWPE 1BV8A 1WTGT 1Z9SA 4HIQA 2XTLA 4JG0L 2P24B 4AUYA 4GUOA 5K39A 2CO1A 4WO0A 4X42A 1TYEB 2YBGA 4ZFZA 1PPIA 3HE6B 4NNXB 2VLJB 1JPFB 1AP2A 1BOGB 2Z4QA 5IG7A 4Y5VC 1PCXA 2VAJA 3H6JA 1HIMH 2A9MH 4UOZA 3ET9F 4CJ0A 3LEVL 1F4HA 4UT7L 5HHNB 5FLUA 5DMGD 2WAHA 4M8VA 3WNMA 4PLNC 2APFA 3KYOB 1ZVNA 3UZQB 5B1JC 2HAZA 4OUUA 4F7EB 1CO1A 1YEFH 4FL4C 3GYRA 3O3EA 4HFUH 4YK4B 4AL8L 4TKWA 4F2FA 4K5OA 2K8MA 4U1MA 1CMOA 3GZOA 1J5IA 2WWMD 3P77A 1NM9A 5F6IC 4PREB 4QUOA 3UTSB 4GMTH 3SCMB 2VE6B 5F1SA 5CCHE 3ZUCA 5FDWB 1XR9A 5F6IB 2OMZB 4PS8A 4MA3A 2WCPA 4R0LB 1C08A 1BG1A 4ZD3H 1RU9H 4NWUL 5GS0C 1JNHB 2V3EA 4WNJA 1E6JL 4JGJA 3CFMA 3LH9A 1U8QA 2Q3AA 4LGSB 3W9DA 1XDTT 4E42B 1G9NH 5F2FA 1CZ8L 4XGZA 3IFPA 2VNCA 3M17B 5I66B 3AU1A 1Z32X 2D9CA 1JNNL 4JPQA 4N2DA 5KS9F 1DUYB 3SYOA 1W0YT 4QNPF 3CZGA 4WTXA 3S5YA 1LO2H 3VI3F 5JIPA 5GS2H 3O41A 4QHMB 3DGCR 1G6RH 5FUOH 4JLRA 2WM0A 4FI8A 1C5CL 5T1LB 4C55A 1DQKA 1I8LA 3ATDA 5CIPB 5AEAA 3CMOL 4O2EB 4CBPA 5EU5B 1UWEH 4HH9A 1A4JA 2W07B 4IBYA 2BVUA 1KB3A 4G42A 4TVPL 4MHHG 1MW3A 4RGNC 4EUPA 5MEPB 2VN4A 1D6VL 4JRXE 2AQ1A 1GGYA 2FUQA 2QDWA 4KRMB 2VLKB 1PGRB 5ESAB 1ORQB 4K3GA 2ORBL 3P9MA 1XH2A 4QRPE 5EFIB 2GIYA 5JPNB 4LHJB 4QRFA 3NCJL 2QKIB 3TTYA 1VZHA 4KJQD 5K9QI 3CDFA 3L08A 4AQAB 1CLZH 1UENA 1BFVH 1YY9C 1DQLH 2W38A 4MD5A 4ZNEA 4FFVD 3ZN6A 3DUUA 3VJ6B 2Z31C 4NQDD 2J56A 3MX0B 2ZSVA 4R4NC 1WV7T 1H5BB 1T4WA 5ICYB 2OQJA 1JHKH 1CPUA 5BS0E 3BGMB 2DJMA 1ZE3C 2NY4B 5J12B 1NLBL 4KK8D 5CEZD 3R06A 5AKSA 4LSTL 3W38A 3BKYH 5IUSA 1CUOA 4AEFA 5IMMB 2FL5A 4X6DF 3LIUA 3N1QC 2PPCA 3ABKB 4WCYH 4BKTC 3CDCA 1A6ZA 1U33A 2OL3A 3P77B 4NWTL 3EGXA 4KKLD 4NQVB 3X13B 3UTTD 4IKLA 3MLVL 2BNRD 5CHNA 4WEBL 3O8XB 1IJ9A 1MI5D 2FB4L 3VU2A 1A2YA 5D7LB 1HQRB 2WB7A 3FUHA 4IGBB 3HMXL 3DSFH 3FFDA 1L3NA 5ICYA 5DS8A 5JO5B 1QYGL 1RK7A 1MFEL 3HPJB 3SJVE 5ESVB 3FPXA 3PRZA 1YYML 4IRJD 3FUMA 5EOTA 1E65A 5D1QA 4HIEA 3WV0A 5EOCH 4Z7NF 3QULB 3RGVC 3QUXA 5DHYA 1MG2C 1ZTXE 3MNVB 5IVNA 4EF3A 5BQDA 1GGCH 1M4KA 2OMVA 1TKWB 2ODHA 4TNFA 3DTXB 3TBYB 3I3BA 3WN6A 3OWEA 1UC6A 3LDBB 3FUFA 2XLLA 4Y9EA 2YUZA 4UYQA 1WBXB 4U1SA 4UTBH 1MNUH 3V95A 1TEGA 2XG4B 3SQBB 2VH5L 1OWRM 1E5BA 4UCFA 1KCRH 2IOMA 4IHOB 2WCSA 4YMPA 1EVUA 3T77A 1EFQA 5BQ7B 1XF3B 3TA3A 1OCOB 4ZPVA 1QG3A 4NAMA 2E7HA 2Y7OA 5EU5A 2HKFH 5IBLD 3B2UC 3DO3A 3NFSH 1TKWA 4BM7A 3BT2L 4P2RA 4KTDL 1SXCA 4GKZB 1U92B 2DDQL 5T1KB 3PREA 4AYMC 1R9FA 2R0WL 2OW7A 4K7PY 4WEUD 4YHPB 1MW0A 5CGTA 2ZKHH 1ZVYA 1NCHA 2O5YH 4MXVF 1NMAH 3HG3A 3A22A 4ZPTA 3EO0A 4RNRB 1XX9C 3W9EA 1IC4L 3KPMB 1LXMA 1CVRA 4H44C 2BP3A 3QORA 1QRNB 1B0RB 2KI6A 3E0GA 3FFCB 4X0NA 4GQPH 2VDKB 1D7BA 4IRSA 1BBJB 2FIKB 3DROA 3UMNA 3GHEL 4C83B 5KZCD 5CBAA 3ILPB 3MNDA 3T6VA 2DICA 1P5UC 3S8FB 5CR1A 1WWWX 4HKBA 3RY6C 1P4LA 2EP6A 4K5LA 3MRMB 1E2ZA 3FMGL 4APQB 5E70A 1FFOA 1VSCA 3CFEB 3M1BA 1ZHNA 5LBSL 2ADJB 5JUEH 3QCUL 2E7CA 3VXSA 2CDFB 4A2HA 5GS2D 1L5GA 2FGWH 1YJDC 1ZT7B 4WUUD 1EAJA 1KFAL 1TLKA 1LP9E 4OVVA 5LGHH 3ARBA 4M6OL 1HH9B 2D7MA 3RI5K 4DPBX 1GAFH 1OW0C 3CK0L 5D2NB 1VHPA 1C1EL 1E4WH 3RIFF 4FCAA 1KPRA 1LO4H 3FB6A 4Z3EA 5IKCB 3HNVH 5D2NC 4U0RC 4HUXB 4FI6A 4GAAA 4H8UA 3CXDH 3FU6A 4PJXB 4DW2L 1VF5C 4G5AA 3WCYA 3ZSSA 4FQHB 4LVHC 5ESAA 4PJCB 5KANI 4PRAA 2WW8A 3OF6A 4Q0XL 3MRMA 5BOJA 4PREA 1KIUB 4U7MA 2KL6A 2SEBA 2R39A 4H25A 4XXCA 4MX7A 5LQBH 2ZKXA 3EYOB 3L45A 1QZNA 2BY1A 4OB5H 1WAPA 4RGND 5DI8B 3QFDA 2N0KA 5T5FH 2L7JA 1PYWB 3IDXL 4N2GA 2X4NA 3STLB 4APXA 2AMGA 1XH1A 4KKNA 5A16B 1U8KB 2EIMB 1EAPA 2CIIB 5GGSB 2JELL 4WQOA 3U36A 1JPGA 3KLHC 3SO5A 2B4CL 5D7JA 1FZMB 3CU7A 5E56A 2DAVA 3D5OF 2DQIL 5KEZA 5I1DB 4WDIB 3VO0A 4EQ2A 1XF2A 4NZUL 4G59C 3ASOB 3ZHLA 1MCCA 3MV9B 4NRXA 2X6VA 2FEJA 3OAZH 2ADIA 2BNQA 4U1NB 1HK6A 2CCLA 4S2SB 4F33B 1MIEH 4JHWL 2E27L 5CN1A 2X0UA 4I89A 3KJ4C 1CICB 2YGPA 2HA1A 3DMMB 2PTTA 1VEPA 3WXVH 2ZYSA 2VR3A 2CDGA 4JFQB 3DTDA 4WDIA 3FO2B 4PJAB 3V6FB 1U9KA 1IEAA 2HH0H 4PB9H 5AW2B 2OKMA 1CGSH 3UAJA 2XXFA 3UACA 4MQTB 1HI6B 1H6FA 4PSRA 1SMAA 3LX9A 4WO4B 4KQ4H 2NMSA 4UTCA 2EXWD 3SDAB 4TQPA 4QLWA 2EZ0D 2FWOB 5IBUB 3GMLA 5EORH 3MBWB 3BRDA 2VDRL 1KYDA 1L9OA 4P5TA 3SDXE 3OTTA 2OTPA 4U6HB 3VRIB 2QBWA 1FGVL 2MIZA 5TK2A 2R2EA 2X38A 5IQ9A 4X2UA 1XCWA 3P9WB 1F4AA 5HD8D 3RWHA 5IVXF 2Y06L 4RAUB 3VW3L 5B3JF 2Z93A 3D08A 2NR6A 3DSNA 4HALA 3IJ7A 4N2NA 1AE6L 4IOSD 3ZHNA 3GDBA 1U8MA 2XJKA 1PJ9A 5D2NA 3P02A 2Q8AL 3ECBB 1DLHA 1L6XA 2VERA 1IT9H 4QWWC 4B3VA 4UAOC 4XVUD 1FVDB 1YPZF 4KI5F 4BCYA 3WO4C 3G5VB 1N6QL 1INQA 3T3MB 5FOBB 4O51B 4YDIL 1LD9B 1L7TH 5A2IH 1J7VR 4LBEB 4HKBB 4JGNA 1FNGA 1QSFD 1TSRA 1NBZA 1R19A 5FECA 1PLGL 5C3LD 1JPFA 1TMCB 3B9KC 1CTOA 4L4VD 4DEPB 2Z64C 4XPBL 2FQEA 1K85A 3UGXA 4C4UA 5I24A 1N8ZA 1Q8MA 5AZEH 3KWVA 3MCYA 3VJ6A 3BH9B 4ZMLA 3QT2A 4M5ZH 2W9DL 1K8IB 1KELH 4B9YA 4IOIA 4ODXA 3ROLB 4H88L 3BHBB 4G8IA 2NTFB 1MN4A 1MCPH 4FKHA 2J20A 2QMKA 1EBPA 4P46C 4Y9CA 1A5FH 4DTGL 2CXGA 4HKXA 3KLKA 5ETUB 3IM1A 3QWOA 3D3VD 1OEZW 4U0QB 2VN6A 2VJ8A 3RURA 4Z7OF 1NCGA 3WLWD 3MLZH 5JNYB 1EFXB 4JFEE 2ZXBA 2FWLB 3X1FA 3KGRA 4F1ZA 3E6FB 2HP4A 3CXHK 3LNFA 2I69A 1C5BH 3O6FB 4HUNB 4QXUL 5LHDA 1MCWM 1UZ6E 4ZYKB 4NWUH 4OZGB 3E1F1 1ZV2A 2P48B 1Q94A 1RL1A 2WSPA 2PPDA 4N1EA 2AQ3A 3P0YH 4RLDA 1BD2A 3VFNB 3IPFA 3V55A 2EDNA 4J3OG 4F15B 3JVGA 4K3EL 3FH5A 5L2KD 1L3WA 4OGAC 4UV7H 1INEL 3RWCA 1RUAH 2NQ3A 1MCLA 4R5VA 2ZCLH 4OJCA 5GRYA 2ZYIA 2EIEA 1LK2A 3WJJC 5ADOL 5DHXB 1I8MB 1B9KA 1ETJA 2F9BT 3O3UN 4KO5A 2WIIA 3AXHA 5EPMB 1V27A 2XPGA 3VGEA 4GQZA 5IMLA 4LSVH 3BC9A 4KXCA 4E9LA 4GRLD 3BAXA 5L9DL 5K69A 1JIBA 4P23A 3VUAA 2DKUA 4YDKH 3MRRA 1RUPH 2BCMA 5DD0H 3R18A 3OHXA 4N9GA 3VGBA 5E2TH 2DH3A 2X4RB 2YPKA 1U36A 3NUKA 3TVMC 2EH7H 3CVBA 4A7GF 2LFEA 1BYNA 4X4YB 4ALAH 1OT4A 1OKEA 5JW4M 1OSPL 3W2DH 3B34A 3DX0A 4KKBC 2KLSA 5BVJB 1U21A 5GISL 1D6VH 4R7DA 2PCXA 4DHLA 2YD4A 3KLSA 3AROA 3BWZA 1BX2A 3K8MA 4JDZB 4GI8A 3IMVA 2G3NA 4DKFL 4LSPH 2FEDD 4XX1E 3S36H 3QAZC 3L81A 2FSEA 3ZTJH 5FYKH 3PPSA 1CFQB 4U6XB 4H7VA 3TNNA 3WTWA 2BHZA 3OQ3B 3HB3D 1NGZB 3BVXA 1Z0NA 3C6LD 2EO9A 3DRTB 1CFVL 1NC2D 2PWHA 1W0VA 2VJ0A 3ULAB 3FU3A 3QPQC 5D1XC 1BIHA 4Y4HA 4QGTA 4LL9A 1YJDL 5E2UL 2GG1A 1JGDB 2TRHA 2FWOA 2UZXB 4C83A 4NKDB 1IM3A 4Y1AA 2Y6TE 4PJDF 4BHUA 5J3HD 1XHHA 2LABA 2FR4A 2FECI 3JV6A 1IAIM 2ZOKB 2KYIA 1PEWA 3IAGC 3JWOC 4YSAA 2D7NA 2XJLA 4LLAA 2G2RA 5CEZL 1GXEA 4X5PA 2YPVH 4Y5YA 4X7FC 3TH2T 4ERSL 1R3IH 2BZ7A 1BVZA 2H32A 1JUFB 2X4OB 1E9QA 4OT1H 5CS7A 1DDHB 1JN6B 4DGYL 1PG7L 4HGMA 1IM9B 2ATKB 2DM2A 2YD2A 3K6SA 3OGOE 2VITA 3JV6B 5GGTL 3PAVA 5KVDH 5JPNA 3RLSA 4HX1B 1NCIA 1ZA6A 2UWEA 5GSRA 3F65A 3FUNA 2UZXA 3QULA 4FTDA 1YYMH 5KBLA 4X80L 4PJ9A 4G8FB 3FN9A 2A1WL 1LWHA 3TVMB 5FFLA 3CX2A 1HCYA 2E7MA 2WNWA 4PRNB 1ZT1A 4KK6D 2FVNA 2IJ0C 3U4BL 3WJLC 3CPLB 4PJFE 4XO4A 5BV7C 4HC1A 4N2MA 5IMOA 4BH8A 4G71B 1TMQA 4WI2A 2LT9A 2H6OA 3CDZA 3BZDA 1AACA 1IC7H 3FO0H 4JHAL 4ORGA 5CM1A 1TPXC 3O8XA 4IRZA 3UG4A 2H2SD 5TQ2H 3N50A 4KJYB 4R2GC 1R0AL 1AYOA 3UYPA 1Q1JL 1UH4A 2H41A 4KMTL 4R2GB 1RZKC 2WYTA 3GHBH 5E00A 5C08D 2APXA 4IJ3C 4D8OA 3AFLA 3Q8AA 3EO1A 4HJ1A 1T66C 5IK3B 4JPKH 3BZ5A 4I0KA 3L2MA 3IJSB 5DGQA 3PAYA 5D7LA 1G7IB 3FTYA 2NYZA 4U1LB 3IU4H 4ZMPA 5KVEL 1U30A 4J6IA 4IBWA 4F37F 3RVXC 2VXUL 3B8SA 2Q7YB 3MJ7A 4C54A 2VDLL 5GQBA 5I6LA 4ODSH 4OKVB 3A23A 4Z7NE 2HFGL 3EFOA 2PWEA 3N41B 3HG1B 2Q2EB 5DT1H 3LCYA 5CLTA 4RBPH 4JPVL 2V9TA 4XCNA 3QS2A 3FQTA 4K71C 4Z23A 3CN0A 5CCKH 4IM8A 5CZVH 4HJGA 4ZFZB 4JFZL 4I7ZC 3OKDB 1USQA 3FHAA 5ECGA 1TTGA 4GY4A 1FZJA 2F2HA 3RL1B 4K3JL 3SDXA 3PUUA 5BO1L 4ZNCD 2YEVB 2ZZUT 3WMSA 1IQDB 3WY1A 4A6YB 2BNUA 1OHQA 3MV8B 4Y4HD 3T04D 1D2PA 1YMHA 4O2EA 4IW4C 5EO1A 3X3GH 5LGHL 3UEQA 4NRYB 5KOMC 3LJ3A 4JFVA 5T1LA 1U8PA 2C3XA 3NEXA 4XBGA 5DQ9B 4NSKA 1HXKA 3TO4B 4AVJA 1ODUA 1L4IA 1U2CA 3QEQE 5MEPA 5DJ0A 2OJEA 5J12C 4MS8C 3VNZA 4Z5RB 4IKIA 1O6VA 4M93C 3VFWB 4PN6A 2OAAA 2QQKH 4LEOA 3UOAB 4GNKB 5HDRA 3MC0A 3K8LA 1AG6A 2CH8A 1RJZA 5L8KB 1R5VA 1T21B 4HLZH 3ARUA 1NANI 3H3KA 3SE3C 5I6XB 4FHKA 1G0XA 4RDBA 1ZLWH 3IWUA 3FB8A 4YR6B 3K2IA 4PJ8C 3PV7A 2CR6A 1PTZA 3QUZD 4WI6A 2WXIA 1OSZA 3V0IA 5ISZA 4ECNA 2AFNA 3SDCB 1V7NH 4F57H 1IBFA 1ND0A 4G5ZH 1HHHB 3G5VA 1HJCA 1IM3B 4WSJA 1TZOA 3DV6A 4P4KD 1KJMB 4Z5RA 2BNQB 4NZUH 1D2OA 5DC9B 3A4EA 4DOHB 3F58L 3UZVA 5I17A 3CCHB 4MNGB 3PJLA 5KYYA 4CU7A 5EIVA 2EYRA 1YEIL 2OMTA 1NMCC 2JCCA 4HXBH 2D7PA 4Y8DC 3QIUA 4PJEF 2OBGA 4DN3H 4UNIA 4KTEH 1BHGA 3VXRA 3VFOB 5IJDC 3WXVL 3SKOB 1JZ8A 3GK8L 4GXUN 1CGYA 4HS6A 2XZCH 4KROC 4PJAE 2Z92B 2OV0A 4XI5C 3QIBC 5JR1L 5E5MA 2WXFA 5IJKC 2OXHB 1G0YR 2RB8A 4NO5B 5LNEA 3SY0A 4P46A 4YXKH 3FT4B 5LVEA 1AXTH 3HRPA 3EAKA 3S88L 1U41A 1IBZA 5FK9B 3TFKC 1R17A 3DV6B 1BVNT 3KYOA 3D9AL 4K5NA 1NDGB 5KAQF 5DHVA 4LARH 1HVXA 2JKSA 1GCYA 4MQXC 4QT5B 5DO2D 4E9WA 5BJTA 5HP5A 3ZSTA 3GPEA 4XNMA 2FUTA 2O1AA 4EDXA 3NEOA 4KMQA 2AXGA 3I9GL 4PGCA 2P5EE 3HAEA 1COBA 4NCDA 1KXTA 1EH9A 3EBIA 2CDGB 4I18B 1JD9A 2B4CC 4QIRA 1KIQA 2XN9B 3FONB 4NKOB 2NSQA 5E2WH 5C0DB 3LKOA 3L95A 2ICWJ 2HJKA 3RZCB 3DX9B 1AQ8A 3CSBA 4AEHL 3E9TA 4FA7B 5LKNA 5ESQA 5GGRA 2IC2A 5E6UB 1KYUA 2AKRA 1LILA 1XF4B 2A9NL 3FTGA 2QMJA 1T3FB 3QUZC 2O26U 3BDXA 4PJIE 2JTYA 5IB3A 3TBWB 5ACZB 4DSYA 2Y7LA 1QO3B 1X6NA 1DUZB 3MV7B 3L3DB 1R47A 1AGEB 2WNGA 3L16A 3ZTNL 2WLMA 3BP4B 4KFZC 2JMRA 4H26A 4ABVA 4AQ1A 3FW6A 4EN3B 2NCEA 4S0TD 4CGUB 1ZCRA 2FJHA 2VXQL 5KJRH 3BH4A 1DL7H 4R97C 5CSBA 4NNPL 43CAA 2A83A 4K15A 1HYSD 1X9UA 2D7TH 4KVPA 1R5IA 2APVA 3WNLA 2AXFB 3TJPA 4LF3A 3P4NB 1R1CA 1DVUA 3EIFA 4XP5H 5EN2A 1JBJA 4KI1A 1U8PB 5D1ZI 5B1JA 3H2WA 1WFUA 2NYYD 4HX1A 4L4TA 4DTGH 4IKNA 2FJUB 5I1KL 3VFSA 2YOAA 1QLFA 1B0GA 5I18H 5IIEA 5AD0A 3ZKMD 1S5IL 3L3DA 1XF3A 4HWEH 4N5UA 4PR5B 2ESVD 5JMRA 3F7VA 1F4WL 2VMCA 1A3QA 1ZT7A 5KOVC 1ML0A 4YGVA 5B8CC 5E9DA 4FEIA 3MRKA 4JN1H 1GPOH 1NUGA 2ZOWA 4UM9B 1BLNA 1BM3H 3AM8A 4N8VB 3VWKB 4J3TA 4EI5A 1J9TA 3QVAA 4BCXA 5AUMA 1OGAA 2W80C 4B97A 3A3YB 1EGJA 3KPTA 5AAWC 4HETA 4RRPM 1KPVB 3QQ9C 2QADB 3EGSA 5DVMA 1SJXA 4EN2A 2H2PD 4RGNE 3PWJA 4TTDC 3BEWB 4AYBA 1IILE 5E9DB 5HPMA 1IKNC 1JXKA 1B90A 5E9DE 1BZEA 2YPLD 1AP2B 1BOGA 3OKLA 4P46D 3WDJA 4ADJA 3V0AC 3RB7A 3B2DC 5C3IA 1AFVL 3GNML 4M1GL 1QSFE 2X4UA 4TSCH 5DHVH 2Z9TA 4DP1X 4J3SA 1RJLB 5D8JH 4I77H 4G8GD 1T0NA 3MBED 3PABB 1A1NA 1EXUA 4PJ9B 4AM0B 2NLJA 3LKQA 2ARJQ 3IYLW 4UM9A 2GI7A 2X40A 3AB0B 3AC0A 2ZIDA 3L4YA 3VXNB 5G4NA 1G5AA 5D7JC 3UAEA 5B7MA 2X5PA 4MJ2A 4J2QA 3DOIA 4QJ4B 1OSPH 3E2HC 1LMKA 1B6DA 1UA6H 2DRUA 2Z8SA 1FRGH 1ZEAL 2K6ZA 1KBGL 5TFSH 1FL3B 3CDZB 4GW1A 4KHXL 1TQBB 3DURB 1KB9K 1D7CA 5B1AB 4HHAA 2WVSA 5K59E 4B7IA 1KTLA 3K5SA 5IB3B 1QBLL 2VXSH 4XVUC 3S96A 3QJHA 5EZLA 3QHFL 3UBHA 5F7NC 1N0XH 2DWDA 3UBXI 5HHPA 1XIWD 4ZTOL 1NCJA 1KIPB 1V55B 5DWPA 5DJXB 1HOEA 5J11B 1PCSA 2WZ6A 1ASQA 1RUMH 4OZFH 1MQ8A 5F7UA 5HDQL 3KXFB 2FB4H 3SPCA 3ABMB 4P99A 1FH2A 1KIQB 2XN9A 4NKOA 5C0DA 3U25A 4AH2B 5I9QC 1YJDH 5E2UH 4ZW8A 4DQAA 1NSNH 4TVSa 2HJLB 2XWJB 1ASOA 2VR7A 4Y4FB 1XGPA 3VACA 4OD3L 4RA0C 4TS6A 3ZDYF 2EABA 1U0QA 2IBBA 3ZKMC 3N5AA 2ATPA 4LDOB 4FLRA 4L8SA 1RJZB 3D51A 3DBXB 3LKPA 1UASA 5FIEA 2UXTA 3KEHA 3TNNB 1G43A 4Y1SA 1IQDA 3FONA 4TNVK 2XTSA 4BEIA 2YPVL 4Z7VB 1AGEA 2X53A 2XYBA 3U7YH 4J2XA 2VO8A 3AG1B 5JIHA 5KN5B 3KL5A 3WEAA 2HT2D 2MQCA 3ULVL 2X3AA 1XFPA 2OTUA 5HI4C 1JGEB 5DC4B 3RGBA 3GKZA 2H9GB 4LEXH 4KX7A 1OARL 2Y7QA 3T0EA 1T2QL 2QVTA 3WBDA 3APNA 4M8RA 1LO3H 1CFTB 4JCLA 1NA8A 3ZT7A 4NUMA 3FCTA 4J4PD 4MDRA 2L8AA 5FFOA 1BECA 3U9UA 4GS7B 1FPTH 3QAQA 5DRXA 4FRWA 1BSIA 2VW4A 4NOFA 25C8H 2E6QA 2FRGP 3ZKQD 1N10A 3JTBA 4YDNA 4JDTH 4XBPA 5BRZB 4KZEL 4QRPD 4OLWH 5LJYH 3MRIB 2FEDC 2E9GA 3EJUA 2O5YL 2ZX9A 2DMBA 1EO5A 1TQBC 4F37K 4M5YL 4OCRL 4Z78B 1HCFX 3F00A 2X09A 5KSAD 4KV5E 2NY0B 2UYLB 2F74B 4W4NA 4XHJD 1R0AH 2XHNA 3H6AA 3MUZ1 3MQIA 3QG6B 4N86A 5D1XE 2ARJA 4G1EB 3SYQA 3G04A 3T6ZA 4HWZA 5C9JB 5GZOA 4MJJA 4FFZA 1JHLH 4BZ1L 2PCPB 2UWEF 4ZUVA 1RXLA 2WNKA 2NT1A 3PP4L 4WKZA 4YSDA 1ZLEA 3SKJH 4AW7A 1NICA 1SVZA 3V0WL 2FEEL 4GB9A 4KXDA 1D5ZA 2RFXA 4FP8H 4LCYA 1UH2A 1ZTMA 2TRYA 1BDYA 3ROOB 5L6YL 4MQXD 4DP2X 4ZYKA 3BPCB 3IETB 2AQ2A 3SKNA 1AOHA 3PGFH 1NGWB 4MAZA 1R3LB 3BN9D 1FORL 3VFTB 1AVAA 2DY2A 3H9SB 1CDCA 5GZOC 1FNEA 3DX7A 3ESPA 3ZDWA 5BZDA 1LE9A 1U8NA 3UTTA 5AYUL 3RVTC 2BNRA 3Q0HA 3CN3A 2YD0A 4GAFB 4FHJA 5EZOL 3U48A 3D25B 4BIKA 2ZUYA 4ORGB 3CXDL 2GHWB 2ADIB 4X99B 1T89C 2GUOB 3P9LB 3F04A 1IEBA 4JO2H 1E4XH 2EDOA 4DCQB 1PD1A 3GS7A 3MV7A 4U33A 1NBYB 3TBCA 5F44A 4BFIB 3C5XA 1WBXA 4Q6IC 3U7AA 4JY6A 4KUZH 3MRLA 4L3FA 1IB5A 4V11A 3CG8A 4BGDA 3WFBL 4M7ZB 3D09A 4F9PC 1NCBL 1JWSB 2ZWYA 4PJ5A 2EXWC 3KL3A 4H8VA 1G84A 1BA9A 5T5FL 2F5AL 2BXYA 2OI9C 5CP7B 1E3FA 4PM1A 3AG2B 2VLJD 1NGXA 3ULVE 4LFHG 4ZFGH 1QQDB 2EXTA 3ETSA 4FTVD 1E9OA 2WLJA 3ABLB 1RH8A 1KCVL 4Q74A 2H32H 1L0XA 1QRKA 3MLWL 4GKLA 4ANUA 4ENED 4MASA 3K91A 3ZKND 5HHNA 3AUVA 1HQRA 3FBQA 3BQUC 1A02N 1ZA3A 2FATL 3V6OE 5K1VA 1HNFA 2CLRB 2EDHA 4JW3A 2WKOA 2OR9L 4PBVC 3L1OL 5EZPA 3L3HA 3V5DB 1BZ7B 5D5MF 1LP9A 2RTTA 1G7LA 5TK4A 4MNHA 5CLWA 3OHMB 2AQQA 5E6SB 2NYYC 4WTZA 1I3GL 2N01B 3DWTA 4F57L 3GSNA 5I71B 4KJQC 3KLHD 3OAYK 3BWUF 1OV8A 4L4TE 4HKJA 3IDGA 1T7YA 1CF1A 2JXMB 4YO0B 3F58H 1CGXA 3BVTA 1JWUB 3MNWB 3D4YA 1X5ZA 5C6PB 3VXMD 1WHOA 1V3MA 1OALA 3US1A 4UZUA 3LZOA 1PX4A 2C9VA 2J57A 4R8WL 4CDHA 4DN3L 4LVNB 5LN8A 2YGNA 5KVGE 4G1MA 5FKPB 3UTQB 2HX7A 4OLEA 4R5TA 4LVNC 4KUCF 3WEXB 1UGKA 3RBSA 1P69B 2GJJA 3FSWA 3ZW3A 3DHPA 3AS0A 5T5NG 3U9WA 1GZHC 1OD7A 4QDGA 2OM5A 2OCJA 1MFBL 1V3LA 2JCCF 5AAWA 2G9KA 2LLLA 4M7KH 3D9AH 4PJ8D 1A65A 1QFWL 3MRHA 1DQJA 1ZIAA 2XWTA 1MCJA 1WAEA 4NC1C 2R0KH 1L6PA 3WHXB 4KOBA 2AV7B 3GIZL 4JZJC 4WTZG 1CYXA 1T22B 3CZEA 4X6FA 1B6UA 4OFKA 1AI1L 3OF6D 3C5ZC 2FSDA 5EBWB 2C1OA 4ELDA 1RUKL 5HJ3A 1M1SA 1PLGH 4RIRB 1BQ5A 3EYQC 5JZ7D 4YSEA 4YDVB 2Z7WA 5C1MB 4L5FL 2EEBA 4RSYA 3H56A 3KDPB 4AEHH 3L9YA 3GINA 1L9RA 3KPSA 3ZO9A 3PWJB 3GZKA 4M5ZL 1TCRB 4ONHA 1O9WA 3OQRA 1B4RA 4AYGA 5HYJA 1DDHA 3ARFD 1NC4B 1WPCA 2CDEA 3NIFB 3FKUS 4YWGH 5JHLL 5A2LH 4BE6A 1E3ZA 3TN0B 1I1CA 2WD0A 3JYCA 5AVYB 3CQQA 3JBG7 3D34A 1HXYB 1LEGA 3CZJA 4U1KB 4POYA 3NK4A 4WI7A 1LDPH 1X5YA 4H1LG 3V7AG 3ZE2B 4JFYA 1SLXA 3GXPA 4XVJL 3OJ2C 1C5BL 5FLVA 2X4PB 3LKOB 2AS5M 1XCTA 4N24A 3HMWH 4A7VA 3HG1A 4MNHB 4MZIA 5F89A 5HHQA 4KNUA 2WBKA 3V4VB 3WIHH 1PSKL 4F7KA 2I32A 3QHZL 4AGQA 1DANT 1JI1A 2GJPA 5IIEB 3SODB 2BS8A 5CKGA 3II2A 4KRPB 4LKCB 4F58H 4M62L 1RUAL 3FQWB 4ONGL 4WI9A 4XCEB 3QXDB 2WQXA 5CILH 4NHUB 1NIEA 2V5RA 3NCFB 1CFNA 1OPOA 1I1RA 2NNCA 5I1LA 3ULSB 1KCLA 4HT1L 1ZHKB 1WS8A 2EINB 4G6KL 4YSPA 3B2VL 1F86A 3IMUA 4WI4A 3BKCH 4XODA 2F54E 2IDUA 3BSHA 1GIGL 3HZMB 4KDWA 3R4RA 4PJHA 2B0SL 3T0EE 4OGYL 3QDJD 4JR9H 4PRPB 3RWDA 1N5AB 4L4VA 3ZHDA 3QH3A 1N3NB 3TT3L 3BVDB 2XKNA 5EU6B 2G0KA 1AMYA 2J5LB 2BJMH 4H5SB 3HRZA 5TH2A 3KWXA 3TIDB 1MRFL 5AVXB 5T1KD 2O5XH 5GISH 4OR1A 3MUGB 3T9WA 4K71B 4I87A 1A3LH 2BIOA 5DDHA 5C0BB 5EULV 3AGWA 3FU7B 4X83A 5JW3H 1MDTA 3SDAA 1NPNA 3MRGA 1UCBH 2VQ1B 4PJHE 3VVWA 4AQEA 2E6PA 3FTUA 2C1PA 2DJUA 4Y2LA 5DFAA 4KX9A 3BH9A 5I82A 4XOCA 3LRHA 2F7RA 1NGPH 1TT6A 5FGBC 4CDGC 5IM7B 4I77L 3B2UD 3N40P 5JHDD 1K4CB 3WS3B 1JGLH 3BWAA 4ZS7L 4D8PB 4LDLB 4FFZL 5H37A 2A6DB 2Z31D 2EUVA 3U4KA 4IEFB 5ETUA 4PEEA 2MOQA 2A38A 2ZAGA 4W9DC 2V2TB 4H5SA 5K9KA 4FADA 4JDEA 5ID1B 3H4FA 4OCYH 1MW2A 3NA4A 3BEWA 2QQQA 3LV3B 2NXZB 1SMDA 6TAAA 1CFSA 2QV4A 1IBHA 4LE8A 4FG0A 1A22B 3K2UL 1S9VA 1WZKA 4RRPG 4A38A 4FQ1H 5EG6C 2ZOOA 1SZNA 5I1DA 4KRNA 1GGCL 4HJEA 3NFPA 4N0YH 1JNLL 3O6MH 4IK6A 4WWKD 3OKKA 4PY8I 2O5NA 4LL4A 5HHOB 4UTBL 5HI4D 3ZLQC 2G75A 1ES0A 2DQTL 4MBOA 5HPMB 3WXWH 4A04A 3T6WA 5FKAA 1I53A 2IDCA 2VRKA 1WGOA 2J12B 2A0LC 3K6OA 4PB0L 2VDML 3BD3A 4YDJA 4AC4A 2FX7L 4XVSH 1OP5H 2Q7YA 4HJUA 3M1CA 2PWDA 3QC6X 5TPWL 5D1ZA 5I1AB 4NM4H 2NY2D 4EDXB 1XTMA 3KD4A 3QDGE 4PY8J 3JVFC 2JKIS 3CHXA 1CDJA 4IBZA 5L2KE 4BA0A 3D48R 4WO4A 1N64L 5IW3A 4CADB 5HHOE 1MXGA 2H9GA 2EYRB 5LGJA 1WA0X 1RMFH 2JI3A 1FFNB 4FQQB 3PWLB 4KFMA 3TBVA 3S9DB 5CNHA 1CQYA 1MHHA 4Z0XA 3ESMA 1JZ5A 2QSQA 3WIHA 1XIWC 2LLGA 1CYGA 1HHKA 4AYID 2O61A 4A68A 3BIKB 4YQXL 1F13A 1MHEA 3HC4L 1KJ2A 3BN9C 3QDGA 5F3HA 5GJSH 4PP1D 5ALCH 4HP5A 1YCSA 4B6ZA 1SQ2N 2CO7A 3VCLB 2F5BH 3P9MB 5EFIA 1VFAA 4OLWL 4FNUA 3MV9A 1JZGA 5KBKA 1GKOA 1AGDB 3ULUD 3TBSA 3S0PA 1CICD 5IESH 1QI3A 1S5HA 1UH3A 2E8YA 1XGYL 2HTLD 2B2XH 4G6AD 3O3DA 2ZXGA 1BYPA 4X4XA 4ZX6A 1MLBB 1XSOA 2RH0A 1X5JA 3NCMA 5DMIH 2VWEC 3RTQD 5FYLH 5A6MA 4EBQH 2UX6A 7TAAA 3QEHB 2ZUWA 3CH1A 3MRHB 1IQWL 3WTUA 5DYFA 12E8L 2BVPB 2WXHA 4ANVA 2IPUG 3WKQA 4GSDH 4P9HC 1LM8V 1CXIA 4QOKB 2XIDA 4B95C 2F8IA 4K8RH 2DTMH 1UJ3A 2GK0B 4HLEA 4I8DA 3T4YA 3QP3A 2VXTH 2ATKA 4XCFL 2PWGA 5C0BA 2RQEA 3O3DB 4ODVL 4DZ8A 3M45A 3HR5B 2Z8VC 4G9DB 3APDA 1QNIA 3ZXAC 1ZAGA 4C8XA 1F58H 2KPNA 4I48B 3WFEL 4CBZA 4PV9B 2IH9A 4PMEA 5EZOH 2DMCA 3LDBC 1SBSL 4NX0A 3T08A 1VADB 3KYMA 5JQ6L 2GI0A 1ZV9A 3L5WB 2W81C 2B4CH 4JO2L 5H35A 4LCYB 1DDTA 3QIUB 4OZGF 3TJHC 2ETWA 2YPLE 4R7XA 5CGYC 1N19A 4S1DC 1RSYA 2E74C 3IJHA 3QI9C 1AYRA 2VKWA 1Y0LA 3DVNB 5FYJU 5C0CB 1YECH 3HS9A 1I85C 4K55A 3CX5K 1AD0A 1TJGL 1DJXA 5AKVA 1A7RH 3EYFA 1M9WA 3RWEB 4ZUWA 5BV7B 3VWJB 4WUKH 1B4JH 3ARDC 3LS4H 2EO7A 4B9PA 3ZR5A 3Q8EA 1YEJH 5SWZD 2X6UA 4E41A 3GSRB 2BY0A 4R4BB 1D5MB 1JZ6A 2YPLA 2IAMA 1W72L 3ZYZA 2W60B 1LGVA 4LPWA 4K9JA 1OTUC 3QRGH 5D6DC 4ZMOA 4DCQA 4NC2B 2ITCA 3QUKB 5JORB 1EBAA 2YQ3A 4JKNA 5KSUA 1UXSA 4JANA 1EFXD 4ODUA 2N1TE 2JKRM 1S7QB 3V4PA 4F8LA 4PJ5B 5EOCJ 3P4OB 1P4UA 4OJDH 4I1PA 2NUPB 4XNDA 1CBVH 1GZPB 3HG1E 1UOVA 2CO6A 2CM6A 3QC5X 4FXKC 4JJ5B 1KLGB 1JF6A 1E9PB 1XF5B 3GSVB 3LQZA 4XPHH 1NC4A 4AMWA 4YXHH 5EZJB 1BBJA 1UXLA 2DQDH 2FIKA 5KS9A 1TZIB 1DBBL 2X70A 2NUTA 1Q94B 3DXAE 2QPDB 2VDQL 4OIIL 4KI5C 3SGKA 3ZYIA 3DX4A 5D96C 1KEMH 1I7UB 4ATTA 5L4FA 3CLFH 4ISVB 5D72H 4GQ9L 2W1NA 1LE5A 3RKDC 4PRHD 3RPIA 1IFHL 3NZHL 4Z77B 2CO6B 1FLRH 2DKSA 3FPYA 3NRFA 4GPVA 1N6QH 4G6ML 1T83A 1F3JA 3EW3B 3SE9L 3P4OA 3GSWB 1CTMA 3B7RL 1BMZA 4GKSB 4OJFL 3V6OC 1RUQH 1RJCA 4GKZA 1E5AA 1EHNA 3ZO0A 2Q3XA 2Z1PA 1CQKA 4U3HA 4BZ2H 3BE1L 4PW9A 4F7CA 1IE4A 3LPGA 2NRDA 4XN2A 4WUUE 4NRZA 2W0LA 4WW2C 4M9OA 1QFWH 4WI0B 4AJVA 1OCRB 5IJBC 2KLRA 3P0GB 3ARDD 5TH2B 2YGVA 1H0DB 2D0HA 1EA9C 3VXOB 2VGLM 5L88H 4HFWB 3WYRA 2HG5B 2FIRT 3BSGA 4P4RB 4YFLF 3QO0A 3MCLH 4PJHB 4AIZA 3C60C 2BMKB 5BMFL 1BX2B 1ZVHA 1XB3A 3HB3B 4GG6B 3FQXB 4R0LC 2IIJA 3ILPA 4JFEA 4WI0A 4UILL 2XQBH 1WGVA 2YSSB 4NPYA 2CAKA 2HVKB 3EJJX 1VERA 3KJ4B 1DVQA 3B4NA 4XVTH 4CN1A 1VKXB 1P1ZB 3EG9B 4FERA 4PWGA 4ETYA 3WNOA 1GGBL 5C6TL 4UDTB 1UXMA 3UTZA 3VA2C 5HPOA 2ZOUA 3L3OB 2EEFA 2H6PB 3WFZA 1J5DA 3JSSA 3QCTL 4WFFD 4BQCA 4OF3A 4WJKB 5JHLH 1P2CB 1MY5A 3GO1H 1IBBA 4PG2A 1EHLL 2ICEC 4NUGH 2YSSA 5DJDB 1I8IA 5E1HB 1DANU 3K7UA 2XVBA 1LK3H 3E1ZA 1U8IA 2PW2A 1SHWA 3PJSB 1AHWA 1J0YA 3SDYL 5I1IL 3EDDA 3ILQC 1F4WH 4X4ZA 3BZEA 2EICA 4AKQA 4N0RA 1PW3A 3HMWL 1QTPA 2J6EH 3GMNB 3L3GB 4PG9A 4OFDA 5LCVH 3HE6D 1YPZA 2CJTA 2DQGH 3BDYL 2DEWX 2IGLA 2BRQA 5LNDA 3QHZH 4B9IA 3FB5A 2TSAA 1RAMA 4RDQF 5IQ7H 2C1OB 2CDEB 5TQ0L 3G6AB 2N7AA 1JFHA 4XMLL 2P42B 3SD5A 5FGCB 4ALAL 1G4MA 2WQUA 4LLDB 5F7FA 4PVLA 3UPCA 3VRJA 1HEZA 3BRGC 2AJZA 4DT2A 1MRDH 1K2DB 3TONA 3MRPA 2ZKMX 3JWOL 4AVHA 1EANA 2PW2B 3V0GA 1Q9OA 4ES9A 5EOTB 5IBUG 4YHYB 1IAII 3BKCL 2ED7A 3VU1A 4M6NL 3WN5B 4ODWB 3WY4A 4CL7A 4P2AA 2B0SH 3ZGIA 1TQWA 2NUPA 4KJWD 4UTAH 4DP7X 5MHSE 4NO0A 2J72A 1CFVH 1TQVA 3UAJD 4N2BA 1OXYA 3KLQA 4WNSA 4P2RE 2ICWA 4WK2B 5FM8A 3MXVL 5KSUB 1TZIA 4XGZB 1WBZA 4E42A 3C6EA 3CFBA 2OXHA 3L4UA 1FI8C 4KO7A 4TL5A 3JV4B 3RJQB 3U2IA 1AR1D 3NZUA 3HN5A 4X6EB 5DUPL 4ACTA 3ULSA 2YOCA 4PSPA 1UCBL 1P84J 2AQPA 4OTXL 1JOIA 1I8KA 1QVOB 2COQA 2FO1A 3ARWA 1XGTA 5KVEE 4R26L 1SDDB 5KBDA 1T03H 2NXYD 2Y69B 3PL6A 3FT0A 4N0UB 3AWEA 2OMWB 5DMKA 4AIOA 2R0LH 2Q9OA 4TQ8A 5J57B 1BJMA 4M03A 2K9UA 2H3KA 4F2ME 1UKTA 4MNQB 4NN7C 5E8OA 1PG7W 3STZA 1NGXB 2NZ9D 3TT1H 3VFPA 4CW1B 4ZS6D 2CWRA 2HFFA 2VTFA 3LKSB 2MCG1 3BAYA 3VXSE 5C0EA 5EEYA 4ZUSB 2YKKA 1QHQA 2XWRA 1CIDA 1RIVL 2BERA 1PQZB 4QHLA 3BQUB 4XP1H 2IDFA 3BD4A 4IOFD 3QEHA 3DHJA 3HR5A 4PLOB 3EXLA 2BHFA 3F8UB 3PL6B 3F6JA 4N0UA 3L4WA 2ZX7A 5E8DH 4X6DA 4NQDB 4AQAA 4F24A 2NQDA 2YEQA 2X28A 5K9KB 2BZCA 2ZP8A 2EDLA 7FABL 1HH6A 4P5MB 1VADA 4DP0X 3QIBD 3MYJA 3FT9A 3LH2H 3LNDA 4J3VA 4Q6KA 3CVIL 1YEGL 3ESNA 4IOFC 5DSCB 1I31A 1JS4A 1TIUA 2XTJB 5DQJB 5K9JH 2NX5B 2F8OA 2RJMA 4PJFF 2A77L 2QZQA 3SKNB 3EFDH 4X9IA 1DVFA 3RDTD 3OKEB 1TPXB 1HEZB 1N64H 4X6CF 4OF5A 4Y19A 4MQ7A 4J28A 4JJHA 3IE9A 4FYRA 4JRWA 3UTSE 2AK4B 4JRYB 1EHXA 1BVKA 3T8MA 5F7MC 2BNRB 1SEQH 1P7QA 2WQVA 5I1GH 4NPKA 1JPTH 5EZJA 2MPAL 3QO1B 4MMZB 3SQOH 5DQJA 1I1AB 4L37B 4P4KB 1U93A 4R4BA 5KTEL 1MREL 1HN1A 2GUOA 3P9LA 1I1AC 1ORSA 2CIIA 1X5IA 2WMPB 2OMYA 3MCKA 4HIHB 3CLWA 3RX7A 4AGPA 1U4EA 3V0WH 4JREC 1UM4L 2FBJL 3FB7B 4QNPE 5GRJH 4HAKA 2BM3A 3UTSA 4BK5C 5L6YH 4GEIA 2NY3B 4W9ZA 1UYWH 4A1RA 3V6ZA 3AREC 3IDMB 1R75A 4BDVA 3HBGA 2J8OA 3W39A 1FNLA 3ORJA 2CUMA 1NCDL 1I9JL 4OM1L 3TBVB 3ZZ1A 4YSSA 3VE0B 1SY6H 1G7IA 1KEGH 3U0TA 4QTHA 3JWNG 1KBWA 3ARTA 2B1AL 4IRJA 3R4DA 4LKCA 4W6WB 4ZAKC 5FM5O 4MA3B 3DX1A 3MREB 4QRSA 4YX2H 4LHUA 4A7TA 1C8PA 4PLJC 4M29A 1XZ0A 3FRPB 2HRLA 2V3DA 3OXRA 1Y6MR 4K8RL 1BZ7A 3QIWD 4KVNL 4JFDA 5JXAH 4Q2ZB 2NY1B 4B9ZA 4XP6H 2A4CA 4YFLI 3NJVA 1MCIA 3BKMH 3G6DH 1MCFA 4M6AA 3H3PL 3D4ZA 4JPWH 1BPLB 1VZIA 2VDQB 4ZG1A 4OLVH 2DQHH 2H26A 2R4SL 3SGJC 3T0AA 1Y18B 4JX0A 4P2RD 3KAAA 3VRIA 1NCCL 3CH1B 4M5TA 5IROA 2CKBH 2FK9A 4UNUA 4XO3A 4UMSA 1SYVB 3T0EC 4NP4L 4PD4J 1QRNA 2P45B 5GIRB 4PJBF 3M86A 3T65B 4MYPA 3QUYA 4LIQH 1C12B 1OP9A 2YXVA 3N42F 4XP9L 4YPGB 2WLIB 1FG9C 3HZKB 2XZAL 4CGTA 2C34A 2J8UE 4WHYH 3ZE1E 2N7SA 1LO0H 3OZLA 3MNZB 4Q9QL 5EBMA 5BZZA 2BOCB 3LS4L 1R5VB 3GXUB 5HJGA 2WWKT 4XT1C 2E4FA 4JDEB 4LSQH 1J8SA 1DQJB 2BHYA 4BUHA 2R83A 1W72H 4H2AA 3V0EA 1MFCH 4HS8H 3P4NA 5EN2B 2VDMB 3GJFH 3QR1A 2XV6B 2FT8A 4LCWB 3TYFB 4OW6A 2X4UB 4O4YH 5E9AA 1MW1A 4X7TA 4OCSH 3VGGA 3QUYB 4HJ0D 5D1QC 3RVVD 4G8IB 4L8CA 4PJXE 4IOIB 4PTTA 1UACL 2JV6A 4PJ5E 3KBPA 4AMKL 1CBVL 4RGNB 1F2XK 1HAWA 5I1JL 4UAOB 5LO7A 4F8TA 5KSBA 2IEPA 3A67H 3DVGB 5TE4H 3RL2B 3T4AC 1WT5C 3FUJA 4YXHL 2FEEI 1A6ZB 2DQDL 2OL3B 4M7LL 3FH8A 4ZXBC 3QFJD 1WSST 4JM2F 2C3WA 4ZAKA 1W91A 1UKQA 2AANA 1TSHA 1U42A 1J05A 4EEEA 1IGMH 1OF2A 1NDMB 4NZJA 4ZUWB 1SJMA 3A0OA 3TWCL 1JYNA 2ZXQA 3IDNA 4V1DB 3U0WH 2PP8A 1AJ7H 5K9QG 5DFTA 2AAAA 1MLCB 3COOA 3NN8A 5DHYB 3GIZH 4OGXL 9PCYA 4G80B 2C4FT 5D7LD 4L4JA 2F15A 4NQED 5E00B 1HZKA 3IXAA 4FQIL 5L7XL 1EMTL 4JM2B 4NKMB 4ZO6A 4YH6A 2Y22A 5CWSA 1XCXA 2R29L 1DO6A 1PLCA 2D3NA 4F7CB 2ZG3A 1RUKH 3D0VB 3KM2A 2V2WA 5BUPA 5I2IA 2N59A 1CLOH 1X3DA 4QYOA 5DA0B 3VI4F 2ADFH 1WS7A 1KLUA 3IJSA 4Y2OB 2BIPA 4NZ8A 3UYRL 4KI5D 4NCC1 4NUJB 1R5WA 4XAKD 3PS6A 1XTLA 3DVIA 1G1YA 4UQ3B 3QWRA 1S8DB 1U95B 4JFFD 3GSQB 3PF2A 2PLTA 1KWGA 1F5WA 4AC2A 3P3RA 3H42H 3WFHB 1WA1X 2QQNL 1H9DA 4EO5A 3D12B 1D5IL 2MKLC 1XL6A 1WCQA 2GBUA 2R1YB 3THMH 3MROA 4Q9RL 5AW4B 3ZHKA 2X4QA 4M43H 4ONFH 3PYCA 4LKXB 3FQ1A 4OH2A 3FU8A 4PAZA 4DWHA 3BAWA 4J6RL 3P73B 3HRZB 3CVHB 5DRNB 2R51A 5HYFA 4JFFE 4Y5VB 1TQCB 1Q38A 3AQXA 2Z91A 2XIBA 1PSKH 2H47C 4NHCL 1E2WA 4JN1L 43CAB 4PBWD 1IVTA 1K4DB 4Y4FD 5CP7A 1VFBB 2QKIA 3DX3A 1NCOA 5FX3A 3GFUA 1LHZA 3FOLB 3DO7A 4QOKA 2OJ1A 4XCCL 2VN7A 2QSCL 3BVVA 1FVEA 1GOFA 2PCFA 3BSZL 5FA3B 1H8OA 4X4ME 4OM0L 3C87A 3JWDL 4XPAL 3RP1A 1BIIB 1Q9WB 3PDGA 4JL1A 4ZMAT 2WTPA 3DECA 2OK0L 3VGDA 4GXVH 4CKQA 2YAQA 5SV4A 4JM2C 1GW6A 4HUVA 2IDTA 1VLXA 3MHZA 5B22A 5JA8B 1CXEA 3GKWL 3MRJA 3CWGA 4QOKE 2X1QA 3BGFC 3IJYA 4L3CB 1DCEA 4X5RA 3NMEA 4M48L 1JL8A 2A6KB 35C8H 2IWEA 2O5XL 2B59B 4QEGA 1KBGH 5TFSL 2K6WA 3IFOB 4KXZI 4PJDA 1IGCL 1RZJH 3ZRSA 1UZGA 2PYEA 1AC6A 5CIPH 3H7BA 4N0CD 2Y36L 1SLWA 2BY2A 2XWCA 4DAGL 1JRHH 4MHHI 3T2NH 3D50A 5JYMA 3IMWA 4KKRA 4WFGE 4KH9A 1D6EA 2X7LB 4ZFFA 3UJJH 4NDMB 4W6XB 5HYJB 1MF2L 5D1XB 3FUIA