5G4OA

Crystal structure of the p53 cancer mutant y220c in complex with a trifluorinated derivative of the small molecule stabilizer phikan083
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
196
structure length
196
Chain Sequence
SVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKLFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERCSDSDGLAPPQHLIRVEGNLRAEYLDDRNTFRHSVVVPCEPPEVGSDCTTIHYNYMCYSSCMGGMNRRPILTIITLEDSSGNLLGRDSFEVRVCACPGRDRRTEEENLRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords CELLULAR TUMOR ANTIGEN P53
publication title Harnessing Fluorine-Sulfur Contacts and Multipolar Interactions for the Design of P53 Mutant Y220C Rescue Drugs.
pubmed doi rcsb
source organism Homo sapiens
total genus 48
structure length 196
sequence length 196
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00870 P53 P53 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 5g4oA00
5AOLA 2ADYA 3KMDA 2J20A 1LJMA 2PCXA 4IBQA 4LOFA 3D08A 2J1WA 2IOIA 3WU1A 3TS8A 5AOMA 4IBWA 3WTSA 1YCSA 3WTXA 3VD0A 1HJCA 2BIMA 4GUQA 3D09A 3IGLA 1IO4C 2IOOA 1H9DA 1GZHC 5LGYA 2GEQA 5BUAA 2AC0A 3WTWA 1CO1A 1KZYA 2RMNA 1HJBC 4HJEA 4QO1B 1T4WA 2FEJA 2BIOA 1EANA 3WTVA 1TSRA 1CMOA 5A7BA 5KBDA 5AB9A 3QYMA 2IOMA 1HU8A 2X0VA 4G82A 2XWCA 4A63A 2VUKA 4MZIA 2J1XA 2X0UA 2BIQA 4IBZA 2YBGA 4AGLA 4IBTA 4LO9A 3WTTA 3Q06A 2OCJA 3Q01A 4LOEA 4AGNA 2WGXA 4GUOA 3QYNA 3KZ8A 3D05A 4IBYA 2AHIA 3VD1A 3D06A 4AGPA 3D07A 3WTUA 4KVPA 5AOKA 3WTYA 5AOIA 2MEJB 4IBSA 3VD2A 2J21A 5G4OA 5G4NA 1EAQA 4XR8C 4IBUA 4L0ZA 2XWRA 3ZMEA 5AOJA 2J1YA 2J6WA 1E50A 3Q05A 4MZRA 3US1A 4AGMA 4AGOA 4L18A 4IJTA 2BIPA 1EAOA 4IBVA 5LAPA 3EXJA 1GZHA 5ABAA 1TUPA 5G4MA 4AGQA 3IGKA 3US0A 1UOLA 2ATAA 4G83A 2X0WA 3EXLA 3D0AA 2P52A 2BINA 2J1ZA 5ECGA 4L0YA 2H1LM
chains in the Genus database with same CATH superfamily
2DH2A 4FXKA 4M7JL 3N6YA 4Z3HA 4Y8DC 2DWEA 4HD5A 3S37L 2C9XA 3BKJL 4G80A 4TUKH 1N0XL 1I8AA 2OQJB 1UXSB 3UERA 3WUWB 3L3KB 4L3CB 2VLJA 3VFMA 1DVQA 2ZSVB 3ZO0A 4F24A 1NBVH 2Y1YA 3HNTH 2BS8A 1RZPA 4W9IC 4PJBA 1G9MC 3ARGB 3NRFA 4ZPTA 3ZDYF 3T3MB 4XBPA 2HG5A 1KLUB 1MRFL 1KLFB 2XC8A 1XR9A 3EJJX 3NZHH 4RESB 3TWYA 4X6DA 5F21B 4GXFA 3ARFC 3UTQB 1HZHL 2BNUB 3JTBA 2QMKA 4HD9A 4JDVA 3TZVA 3RDTA 4A66A 1I3GL 4E36A 5B1KA 1BLNA 1OAZL 4QRPE 1TLMA 2EH7L 4LKCB 3MLPA 1DL7H 1TEFA 2Y5EA 5I1DA 1BD2B 3THMH 1YNTA 2UXFA 2Y7LA 4ZDHA 1E9PA 2ATKB 4PH8A 3NUKA 2KMWA 1IM9A 5HJBA 3N43B 4JFTA 1PJWA 1RSFA 1F90H 4LLMA 4HS6A 4LZKA 3REWB 2E6PA 1GW6A 3BUIA 4U1KA 1O6SB 2F5BL 3I6GA 4DNLA 4QHNB 4QDGA 5J11B 2QPUA 1BCIA 1FCCA 4P5TC 1LWRA 3HLKA 4FXGB 4FJ6A 3I75A 1HVXA 5T1DH 3T6QC 4G1MA 3BPCB 1GOFA 1MJ8H 1Q9OB 2L04A 2ZXQA 4RFEB 4N8VB 1ZA6A 4ODTH 3W37A 1KUMA 3MREB 2P5EB 1MI5A 1K6QL 1T83A 4JN2B 3ZDYB 3IBOA 3N1PC 1KWGA 3NT0A 1II4E 5DJDA 4W6YB 3ZYZA 3SGJA 1RZ8A 2H6UA 5IB2B 2AF2A 2GAZA 4UANA 3WN5A 5JTWA 1JVOA 3CE1A 4IBSA 3S8WA 3DSFL 2D7QA 2B7DT 2NCEA 4E9XA 1IEAB 5G4NA 4XVOA 2ZOUA 4HOMA 2XBZA 4H7VA 1AP2A 5JMRA 3D0VA 4HX1A 3FQWB 5BPPA 1NCJA 2UY6A 5CJBA 2Y1VA 4PEEA 3FBKA 1HSBB 5HDBF 1A1OA 2JIXB 4LVOB 4KFMA 1J0ZA 3M17B 5I8CA 1I9IH 4NO3A 4Z7VA 3RFZC 2R29H 4N2KA 2UYLA 1JPFA 1E5AA 1IM3B 2F58H 4C4KT 4JZOB 1J0IA 3ARYA 4BFOA 1FGNL 4IM8A 4YO0B 5LDSA 3ZKMD 5DEZA 2YRBA 3D85D 4KV5E 2R39A 2WC7A 1ZAGA 4NFBA 4NJ9H 4V1DB 4XPFH 2Z34A 2YPVL 4M6MH 4ZTEA 3OJVC 1L7IH 3HAEH 2AK4A 4PJXB 5SWSB 4YDMA 3MJ9H 5FECA 2ENSA 5CGTA 2ZWZA 3JV4B 1RJLB 5F3BB 3T6VA 4TUKL 1A4JB 3QH3A 4RIRB 2HTLC 1Q72H 3L5XH 1D5BA 3GEWB 5TJWK 4K23H 3U9UB 5JLZB 3MR9A 1NBVL 3MRNA 3HNTL 4WWOA 1WBXB 4F8LA 4U6VL 4NO0B 3MRFB 5KG9B 1P1ZA 2JSFA 2WP3T 2MOQA 3BUTA 4HUUB 2ZKYA 5F7NC 4ZMOA 2EDYA 4QRAA 5ESQB 1WYJA 5ILTL 3HE7A 2Y22A 5I0ZA 4C55A 3EADA 1P84J 4WWNA 3GK8H 4FQXA 3L3JB 3NZHL 5GRUL 1QPPA 2BVQA 4XN2A 1FYTE 5D7EA 2OTWA 2CGZA 2XA3A 2NLJB 1OE3A 4L8DA 4HZLA 4LLUB 3THML 4N90D 4F2EA 4Z5RB 1W6LA 4U1SB 3TIDA 4Z7AA 1XGRB 4UIKH 1ORQA 3T2LA 1F90L 2FJHA 4I0KA 5I16B 2ZP8A 4B9ZA 4E0RB 1T2QH 2R0ZH 3QNZB 4MNQA 3L7FB 1SM3H 3EH1A 3NESA 3WNNA 3KLHC 1J48A 3M8OL 1V10A 1M2OA 2VWEE 2E4FA 3BI9X 3KBFA 4GKZA 1NOLA 1O6TA 3QRLA 3RGBA 1TTAA 5T1DL 1IL1B 2W0FA 5K1VA 1IC0A 2FZ3B 1UWGH 4ODTL 1XXDC 3QZMA 3KPSA 3PWJB 2DLHA 4MLIA 3SQRA 2H5UA 1HHHA 5K9JH 1BDYA 1ACYH 3M45A 5T3XH 1NKRA 1Y18B 3V5HB 4ILDA 3FOMA 4J8RA 1HTYA 3VACA 4BZ2L 4Y19B 5KBKA 3ZKQD 5EEXA 4OD2B 2FX8L 3MV9B 3CZLA 1QNIA 2CBOA 5FM4A 5TDOB 4D9LL 2NR6D 2BDNH 3U6XA 2JXMB 4YDJA 1PY0A 3FQXA 3TT1L 2OR8A 2B4CL 5A40E 3O6FA 5DLLA 4B60A 2VW7A 2MRYA 3AFLA 3CN2A 4RAHA 5D7LB 1E6OH 1FNGB 5EOCH 3VFTA 4A6YH 4WZ9A 3IE4A 1FZMA 4I5BB 4M7ZB 5ETUB 5G4MA 5JW4Q 5IHZA 1DZBA 2A6DA 4NSKB 3IETB 1KTDA 5IBLC 3H9SB 3POHA 4Y4KD 1KTCA 5FHAL 1UB6B 1F41A 1GJWA 3C6LD 4MZ3A 4TYUA 5B8CA 2KZKA 4NRYA 1I9IL 2VMFA 4UQ2A 3R1GH 3EXLA 5K5YA 2R29L 1GS8A 1ZWIB 3D0AA 1XCQB 5F96L 3U36B 5JW3H 5L8LB 4Q6IB 1E4WH 4XMKH 4LAJH 4HUXB 2VLJD 3HZYB 3WD5H 2HLAA 3WDIA 4NJ9L 1SLUA 4WTZA 1B9KA 2GK0B 3QJUB 2BOLA 4OZFB 1L7IL 3E8UL 1JYWA 1MAMH 3MJ9L 2NY4B 1YVLA 3RIFK 3ELQA 1JMXA 3GTVA 3LX9A 1FCGA 1ZS8B 3PWVA 2GITA 3DRQB 5C0JA 4U7MA 5ITFB 3NCXA 3QQ4A 1Q72L 4D3CH 1AS6A 3GJFK 1NBQA 3EYQC 3KYOA 2JKRM 3OGCA 4Q9RH 4I3RL 3TZVD 3RDTD 3VA6A 1T4KA 4WEEA 2X3BA 1YAIA 3QXUA 1JPSH 1UM5H 2B14A 3JV5A 5C0GB 1OCCB 4FKEA 4AYID 5IFJA 1JUFA 1MFDH 2XKNB 4MKTA 1QEWB 1J0HA 3X14B 1IM9D 3H7BA 1SUJA 1T0MB 2BZCA 2N1TE 4NO5B 3GK8L 3EDJA 4FD0A 1QFUH 4KTDH 3ZX1A 2WSKA 1UB5B 1IKFH 1MFAL 2QVKA 3RKDD 4A39A 2YJLA 3HE6A 4QRSA 4YHPB 3QDHA 5C0RH 5DYFA 2A73A 1N3NA 2C1OA 2ZUWA 1FL6A 4ZFFA 3CLEH 4WFHD 4U0RC 2DLTA 4A63A 3VH8A 4ZPVB 2MTAA 4OZIE 3FTUA 4LCVA 3FT9A 4GMSH 3UG4A 1MI5D 5E70A 4ZK8A 1UVQB 2R0ZL 5A2FA 1RK1A 2VC2L 1R3JB 3AW5A 1YLBB 1SM3L 2OMTA 3IJSB 4HKJA 4YSPA 4ZNEA 5E6IA 3OAUH 4HQQH 2AHIA 1UHVA 2ED7A 2NSQA 2JQMA 1Z9NA 4IBLT 1UWGL 2WIIB 3FB8A 2K4AA 4AV4A 2H26B 4PRIB 4OFQA 4LPUA 3WXVH 5K9JL 5GIRB 4KWUA 3ULUD 5DO2C 3ZZQA 4PV1C 5T3XL 1Q94B 1S9YB 5F7MC 1I8IA 1I85A 4IRSA 5SV4A 5ISZB 4F8QA 3L9RB 1E50A 1RZFL 2W91A 2Z65C 1JWMA 3QC6X 4G42B 3EYVB 4DH2A 3OPZH 4OFKA 1OB1B 1WLHA 1NGZB 1ZHNA 2ZUXA 3LRSA 3TJHC 4QXTB 5D1XA 4AYMC 4IMLB 5DK2A 4KRPC 5EOCL 1CD9B 1UKTA 1QRNE 1URIA 1FVCA 2OYPA 5ALCH 2IV8A 4TNGA 1BSIA 1LP9E 4NDMB 1HQRB 2AK4D 2X7LB 3PIQA 4P46C 5DA4A 3GSRB 4UIMA 3BP5B 4UQEA 4TUOA 3G5ZA 4ZYKA 1AQKH 2XJLA 2IH9A 1UA3A 2P8PA 1SQMA 2QHRH 1E4WL 1LVEA 1ZDQA 2D8KA 2W80C 4XMKL 3NJJA 5F6IC 3VFNA 4X6CB 2FJFA 1QUPA 2D4DA 2CHDA 3WD5L 3AY4A 4QNPE 2N4IA 4NC1C 3WU1A 4QRRE 3P3UA 2IAMC 3BHBA 3SDXE 5F6IB 3C6EA 5L4IA 3CN0A 3ESUF 3TCTA 1MDAA 1W15A 5IV2A 1WITA 5CMAA 4N9GB 5BZXA 4APQA 4YVUA 1JK9B 4G9FD 4D3CL 4Q9RL 1CI3M 2J2ZA 5DD1H 1KBWA 1EO5A 2VSMB 5EV7A 4Z3GA 1JPSL 1UM5L 3FBQA 2C3VB 3V8CA 2PWEA 1MFDL 2BIIA 1A14H 2W0LA 5IW3A 4N0UE 3VXTB 1CCZA 4JKKA 1SXNA 4RRPM 4ZS6D 2NTFA 1ZIAA 3QUZC 1M7IB 1QFUL 4KTDL 4MNQD 3T6ZA 4CGTA 3QJHB 1G6RA 3WFZA 2AKRB 3QUKA 1IKFL 3ZL4L 2WV3A 3WKPA 5C0RL 3W0WE 3RLSA 2PCPB 5IMKA 3CLEL 3W11C 1X5IA 3SGDI 1FFTB 1UXWB 1YPZE 4A2GA 1OTSD 1G7PB 3N91A 2HJLA 4GMSL 3PWPE 2CJSA 2Z1KA 3NFSL 4B5ZA 3QYNA 1I8UA 4ZMWA 1JZ8A 2FL5B 4AEEA 1SJVA 3AB0B 5DTFA 4NHUB 5DS8B 2OR9H 3OAUL 5EG6C 4HQQL 4OBRA 3ZY7A 4PVBA 1SMDA 4E9VA 3GBDA 3SE3C 1BIHA 1PYWB 1FV1A 1AOZA 1M05B 2NW3B 3D48R 4K3DL 1JJUA 3QFJB 3HN5A 1QAWA 4NN5C 3O6FD 3UROR 3VXOA 1HOCA 5IM7B 4NUMA 1KCSH 4HG4K 4GQZA 3WXVL 5CJ8A 5AZEH 1S9WB 4B9GA 4C56A 5J1SC 4KVNH 4Z7OB 4JFYB 1BZ7A 5MHSE 4PJ7B 5CZXC 5I1HH 5HI3D 3UTPE 3OPZL 3ZE2F 3REVB 1GGUA 4Z7NB 1HQ4B 1ZHBA 4UT9A 3KM2A 4HIXH 4AI7A 2QVTA 2A9BA 3JV6B 4PP2B 3C5XA 5F7DA 3ISYA 3E9TA 1ILSA 3MBEB 2C9VA 3RY5A 2X6BA 4ERSH 3B7TA 1UWYA 1XMEB 5ALCL 5IW1B 1P6WA 4UOQA 1BW8A 2R1XA 4Q4EA 3VXUD 4LE8A 4ODWA 2IWEA 4DK3A 1AQKL 1A6ZA 2L7EA 5DHEA 4G8EB 1KTKE 4WO4B 2QHRL 4PLKC 1IJNA 2G4EA 4MVBD 1J11A 1WWBX 3CVCA 3LEXB 2X4QB 4O2FA 2VCOA 4WUKH 5FO9A 5IR1A 5L0QB 5A2LH 5DGQA 2ERJB 4PJAB 3D09A 3DO7A 2ZCLH 4OZFH 1SXBA 2AVFA 1A3RH 3GI9L 4UBDC 1N18A 2X2IA 5TE6L 3EH5B 2OZ4A 4UV4H 4J1UA 3DJRA 1KGCD 3E0GA 3QIWB 4NAQA 5GGUB 4TKWA 2VN6A 2BIOA 3F7LA 3HZMA 5DD1L 3HE6D 4AKOA 4KKNA 2XN1A 4NQTA 2DTMH 4JFEE 4NOBA 3OMIB 4DO6A 2IADB 4JQIA 1OL0A 3HUJB 3MRRA 1PCXA 3MLTA 3NK4A 1IC1A 5DUPL 3ZYOA 4BELD 3KGRA 2IF7A 5EUKB 2BP8B 3CCHB 2W9DL 4MJ5A 2C4XA 2F7QA 3K8MA 3SGDH 5HPMB 4LLWA 3FONA 5E1IA 1YJDH 2SODB 4KJPD 4L0PB 4NQDA 2Q8AH 3MLZH 2QQQA 4OCMC 5DEGA 3WNLA 1H5BB 4NQSB 5E6ID 1DYZA 2Y6SC 3BEVA 5GGTH 1DN2A 2VR6A 5IVXF 5FGCE 4WNSA 3BDYH 4ECNA 2E46A 2FVNA 1IB5A 1KCUL 4AV5A 3MUZ1 5MEOA 4TL5A 4F57L 3TPKA 4IRSD 5ERWA 1NC2A 4TPRH 1JZFA 1EZUA 2K7QA 1AYOA 1A66A 2C7UB 2EVIA 5J89A 2WXPA 2JKNA 3E6HA 4NUQA 5ICXB 5LBSA 2G5BB 4FLSA 5D1XD 1TQBC 2P5WA 1LQSR 1KCSL 4GXVH 4QO1A 5TGBB 1CE6B 2IAND 1UWXK 3IS1X 3RURA 5HVWA 1FDLH 1XB3A 3ARRA 2V8MA 1UKSA 3US0A 2WUCL 1AXSB 1UOLA 5T3XE 4KVNL 2BNRD 5I1HL 5J1TC 3HRZB 1DQDH 2K8QA 3CHSA 3BJ91 1GGIL 4GBXC 2PP9A 3HHRB 3EIFA 4XTRD 5JHAA 1JNJA 3VD3A 3UC0H 2DMBA 5TK4A 1AFVH 3LS4H 3DX9B 4M5YL 4PCTA 4YLQT 3FUHA 3QI9A 4PWGA 4XP9L 5CS7A 4W9FC 4OLZL 4GBXB 1QP1A 2IH1A 1GVIA 2YLHA 2BWDA 3PY9A 1CDJA 4DZBA 4PWJA 2A9CA 5AW7B 3RGVB 1HH6A 1DJIA 2VUYA 4APQD 2WJ5A 3LKSB 1DANT 1VFAB 5L7XH 3HG2A 2UZPA 4WUKL 4HGMA 1AHWC 2DRUA 5BS0B 1OCRB 1GR7A 1OTTC 3W3BA 1TOXA 3FTZA 3TJPA 4DN4H 2G3NA 3PREA 4L3EA 3IS0X 3PGFH 2V2TA 4IRZH 3ALXA 1A3RL 3LNHA 3P0GB 4AVIA 5HSFA 1EGJH 3HI6H 1AHWB 4DK6A 1IAIL 3S96A 3ULVF 4K55A 2JJVA 5ESVA 2V7HB 2CPCA 2DTML 4XMUA 1S9KC 4R7VA 2IXQA 3CX5J 1J5DA 1IGML 5DJXB 3MRMA 5JHLH 1D5XB 3FRPG 5FDWA 4OGXL 1SYVA 2WZAA 1YEDA 2J55A 2VQ1B 2MMXA 2K45A 5L6YH 3GSNB 3DNKA 3S35X 4PS4H 1FNLA 5AYTA 4FTDA 4B7IA 3T3ME 3H1ZA 4KUZH 1YJDL 2Q8AL 4ACTA 2BVUA 1BMGA 3A4DA 3QQNA 4H26A 4G6AC 3CU1A 4LEOB 4LCIL 4U1IA 5GGTL 1EXGA 3HS0B 3P2TA 2WNWA 1ODAA 3TA3B 4B96A 5EZJA 1HZLA 3EFOB 2V2WB 2X6VA 1YYMH 5KYWA 5G4OA 3PAVA 2AV1B 1H8OA 3MZTA 4FE9A 4E42B 5A1AA 1XGYH 4C56D 5DJCA 4EIGB 4TPRL 1NCWH 3ATEA 2VE6A 2Y7NA 2EE3A 4AGOA 4KKBD 4NQCA 4L18A 1I7ZB 5KUKA 3PWNB 2VLRB 4Y5XA 4HIHA 4C4KO 1MJUH 2CZNA 1KNOA 5CSZA 2ZXAA 4GXVL 2QELA 3BGFB 1HSAB 1E2ZA 1V54B 1L6ZA 2EIZB 3MACH 3BQVA 3P0VL 1FG2B 2P5EE 3TX4A 4XO8A 1MCCA 3L9EA 3N2JA 5CBAB 1DEEB 2XTJB 1MCKA 4NGHH 5I19H 3NRPA 1LO4H 1DQDL 3UZQA 4U2ZA 3V4VL 4YAQB 3AUVA 5HHVH 4HHWA 3IK2A 2QQKH 3U30C 3UC0L 1WAAF 3N1GC 3QP3A 2VZSA 1QEXA 3AAZB 3LS4L 3V0EA 1BBJA 5D9SB 1KIQA 4R96A 3MKGA 3K72B 1MW2A 1TTGA 4G9DA 3IU3A 3FMGL 4GRMB 3K6SA 2MNJB 3FDWA 3DVFA 3NCJH 4N8UA 4RMWA 4LLQB 4GOSA 4IGBC 4WUUB 4M1CC 3RVVD 1GHFH 3GM0A 3D4ZA 3L1EA 2JB5H 3PPSA 4PHXA 4QLWA 1DE4B 1I8MB 1FL5B 5T1MA 1I1YB 4MCZA 3EOTH 4CN6A 3VRIA 4GIPD 4X9IA 1S7XB 4ADJA 1K8DA 3VRJB 1S7WB 2AFNA 1RXLA 4IRZL 3CZKA 3O41B 3V0VB 4DAGL 2XV3A 5T1KA 3UXFA 3WY2A 2HLEB 1EGJL 4NRZA 3HI6L 4PJXE 5SWSE 4XPBL 2Q86B 3MA7A 4ZSOA 1OT2A 1RJZA 2NY1D 2X0VA 2L7UA 2V9RA 1J10A 1FZJA 4NQDD 1L5GB 3ZTNH 3QPQD 4HOWA 3UTOA 3S9DB 4NXSA 3MRPA 2GIXA 4TLTA 5F72S 5IK3B 1KJVA 1TZIB 3FFCB 3PE9A 5JHLL 1GAFH 1BVKB 1LL1A 2GSMB 2G2RA 3NCYP 3S5ZA 2ICWB 1JZ7A 3QWRA 3BVVA 1HCFX 5BXFA 3WIIH 4OJYA 4KUCD 4U4BA 4Z0BH 4KKRA 4PS4L 5IHWA 4JHUA 3OC5A 4BINA 4NPKA 1NC2D 2A77L 2HZHA 4PLJD 1U30A 1SY6A 2DQGL 3ET9F 4BWWA 3ZHKA 2Z7UA 3Q6FB 4ATWA 1IU1A 1HNYA 3ZT6A 2FWUA 4JFDB 5JHDB 2X1XR 4I7ZC 4L37A 3RPIB 4FQHB 3VFOA 4XHQA 4FLRA 1L9QA 3MRHA 4HEPA 3L9BA 5ID0B 1F42A 2FEEI 4ELKA 1RZJC 3MLUH 1RZ7L 2YUXA 3WY1A 1ZK9A 1XGYL 3LZOA 4JN1H 3S37X 1NCWL 2O6EA 3I85A 2OMXA 4F8TA 3TONA 4G1EB 3HKFA 2RB8A 3UEZA 3HG4A 1EA9C 3ZE0F 3FB5A 2AQ3A 5A6IA 3LDBB 4JRYB 3ZSTA 1A7RH 4ZAKA 1BVOA 4L0YA 2A9AA 2Z0BA 4MYWB 4AMWA 3FU8A 1JF1A 5EB9A 4X7EC 3H6JA 4DPBX 2VITB 3PF2A 1B0WA 2NY5C 4NGHL 2GJZA 1IIKA 5JOPE 2OPCA 3H9HB 5BRPA 2JK5B 2PKDA 3NJGA 4Y19E 4HWNA 4ZFOA 5CFAA 3DSNB 3CFDA 3MV9E 4PJGF 3ZKMC 2OV0A 1Q9KB 4KDWA 3FN0H 5HHVL 5EPMA 5F7WC 2J5WA 2QQKL 1IFHL 4XZ4A 3D3VA 2P8LB 2R0LH 3GINA 4NNXA 5ENWB 5AAMC 2ADIA 4I18C 1L4IA 1USQA 5D7LE 2CE6A 1WWWX 3JZ7A 3LPGA 4PJHF 4L3ED 2FIKB 2CALA 3H9SE 4ORGA 2XN9A 1GHFL 3L17A 1P4UA 4BH8A 2OW6A 4BSWB 4EIZC 2JB5L 2CMRH 1P4LA 1PDKA 2A99A 2V9UA 4XMLH 3TPUB 5B3JF 3EOTL 5I2IA 2IPUK 4URKA 1NIEA 2GTWA 4F1SA 4WNQA 3IXTA 3P73B 3FW6A 5B3NA 5LGJB 1EEQA 1DBJL 4S2SA 1C16B 1LM8V 3RL2A 1TTBA 3UTTB 3LV3B 4GP5B 2PYFA 1DQTA 1WHOA 1FNEB 2AXHA 4ZUWB 1MVYA 4XAKD 4WW2F 5F7HA 3ZTNL 1BWWA 2OCJA 3HIZA 1JZ6A 1ET5A 4GB9A 5KOMC 4L9LA 5IMMB 5EIQA 1GAFL 4NUPA 4GW1A 4RMRA 1KCVL 2X10A 3ILDA 3WIIL 3SDDD 3LN5B 1QSFB 4Z0BL 1HI6B 3AT8A 4GS7C 3VGEA 2W59A 2X87A 4DO5A 3GSNH 2R2CA 2C4FU 2QT6A 2PPEA 3AG1B 3WHXB 3KDPB 5F9AC 2BK8A 1J5IA 1NGYB 2WINA 3RWIA 3ESMA 3LKPB 2ICWI 4BWTA 2WJ7A 4UOW0 2J1YA 4DSYA 1H3XA 2N3JA 1PZUB 1B0IA 3MUGA 4RMQA 1LDPL 1CB4A 3MOQA 4XMPH 4XH2B 3MLUL 2ITCA 3IGKA 2JJSA 2NR6C 4JN1L 3C9NA 4UILH 5INCA 3SKOB 5KJ7E 1AS7A 4BZYA 1HK6A 4M3JA 2V7NA 1J05A 3T3PF 4QRTA 4NKIH 2N56A 5CKGA 4PBXA 5C0CA 2XQYG 4S1QH 4XC1H 5AW4B 1VGKB 1A7RL 2NUPB 5F9JA 1VERA 3L3HA 2A9NH 3PWLA 4N68A 5EU7C 4ZXBB 2G2NA 4Y4KC 1J8HA 5E8OA 3O11B 4Q8BA 4PRIE 4URTB 4XC3L 2NRDA 4FXKC 5B1JA 4LSUH 4A38A 4ZMAT 3GI8L 4RAVB 4IBWA 4EQ3A 1N0LA 3EYOA 3U4AA 5I76A 2F54B 2WLIB 4QEGA 3QHTC 2Y4SA 5E8DL 4DP4X 3FN0L 4X5QA 4HMDA 2Z93A 4RMUA 3GUTB 3ZRFC 4N86A 4KI5F 1AJ7H 1KEMH 4A7QA 3PHQB 2G0LA 3N1MC 1LE5A 2X3CA 4FADA 5K9KA 2YHGA 1O9ZA 3DOIA 3CDCA 1FE8L 4H40A 1GC1C 1HDMA 3QIBA 3FQTA 5T1KD 2BERA 4BXVA 3FUKA 4DP7X 1S7RA 1I7TB 2WLMA 3I6LE 3T3PB 4R4FH 1KLGA 2J3SA 1E2WA 1UACH 2X9WA 2CMRL 3A0OA 4ONGH 5T3ZD 4XMLL 1JZ5A 4MJ6B 4X6CE 1U95B 3BGMA 4K9JA 1A9BA 2YPLB 5HHQA 3COOA 4FNLL 4WU5B 3SDAA 3KPRA 4FN0A 3QWRD 3OXRB 1HL9A 5D71L 3QEQB 3RKDC 1MWAA 4HJJH 4HK0B 3T2PA 3TF4A 1TYRA 3L3OA 4F7MB 4PS8A 1OGAB 3ARZA 4WSGA 4POZD 4BGLA 3IAGC 3VXPA 5AFAA 3ZKSD 2P7TA 4JAMA 2W60B 3FUMA 1E3FA 4QHUA 1UFUA 2DJMA 3HHSA 4N0YH 1XEUA 3DK2A 1OKEA 2AEQH 4FHJA 2LFEA 2BZDA 4OKVB 3SKNA 4X42A 1K2DB 5DU7A 1AR1D 3VTMA 5J13B 4G6JH 2J7LA 3IFLL 3ECVA 3SGJC 1JWSB 3GSNL 3ZHNA 4PJIE 1T89C 4H13C 3HNVH 3EBHA 1F45A 5EU4B 3S88H 4OD3H 5AVUB 1V5JA 2FEEL 3RDJA 3RWEA 3ZIYA 1Q9WA 1ES0B 5C0AB 1RZIA 3EGDA 5DDHA 3KPQA 2V5MA 5J12C 4PG2A 4PGDA 3CFBB 4PIBA 3ULUC 1PS3A 3QFGA 1ZDSA 2YR3A 3LN4B 2HAZA 4ZAKD 4XMPL 4J6RH 3E8VA 1S8DB 2JELL 5JOFB 4QJ3B 4JREC 4PFEA 4LPTA 4MJIB 2MNUA 4UILL 3UYPA 4ETQA 4ZX4A 2QLVB 5KBNC 3M86A 3FN9A 4YHZH 3ESNA 4B9IA 4EKXA 1X5GA 1UA7A 5F3HB 2NX5D 2UWEF 4GO6B 4KXAA 3B9AA 3RI5F 1KV3A 4Z6AT 3BP4B 4S1QL 4XC1L 4FHBD 4JG9A 2CCWA 1ETZB 1EPFA 3D3VD 4FFYH 3WFHB 4F37F 2MHAA 5IY5B 1UD6A 2V5TA 2A9NL 4OZHB 1WQVT 1EAJA 3EGXA 3DOHA 2CG9X 4TM9A 2R69H 5FA4B 3O81A 4LSUL 2X40A 3L3GA 5EOTB 1EO8H 3JTTB 1SJEB 4Z7OE 1OQXA 1UD5A 3ZKND 2XN9D 3QA3B 4PJ7E 1FFOB 2CHZA 4YLBA 3II1A 1U8MB 3U4EA 5I5IA 1B0RA 4MA7H 2EE0A 1WUZA 3HLAA 4Z7NE 3GKWH 5I75B 2FT6A 1KEML 4RQQA 3U0WH 5A6LA 2ATPA 4R4BA 4HCRA 5DI8A 4MD5B 4MSWA 1GS6X 5F8RC 1Q9LB 4UWQB 2NTSP 4IHOB 5DRZB 4HUVB 2I07A 3IRPX 4YR6B 4CVWA 4R4FL 4X5WA 5BJTB 3HC4L 4LVEA 2QGEA 1UACL 4RZKA 4ONGL 3QJZA 1FHNA 3W39B 5G5DA 1AZBA 4JL1A 2ITDB 2KPNA 1R46A 1IIIA 3U6RA 1TTUA 2EDDA 3NIDB 1JCVA 4N2DA 4PJAE 4XX5A 3DRTA 2NY3B 3LKNB 4DETA 1E7UA 4LNRA 4YDNA 1QBAA 2XPGB 3HN3A 3V9EA 5BV7C 3GIVA 5ACLA 3GLZA 1TTRA 1OTSC 4AQ8A 12E8H 1SXZA 1SFDA 4AIXA 1V27A 3ZMNA 1X5YA 1MVFA 5BW7A 1HCYA 1NC4A 1SYSA 1X6LA 2AEQL 2V5YA 2DEYX 2J4WL 4MRBA 1AD9A 1K9TA 3HUJE 4O02H 1C08A 2BCKA 3QXWA 5CJOH 5DYOB 2NY7H 3ZR5A 1G7QB 4XP1H 4IOSA 2D31B 2J8UB 1F1DA 3NSFA 4WGVB 5T1JA 3EJCA 3KWVA 3J7HA 4FL4C 3CH8A 1BOGB 5KS9A 1EDQA 1IKNA 2QZQA 1DQJA 3LMJH 2VSKB 1ODUA 4P48A 1NM9A 1DBKH 4H8WH 4PS3A 1CG9B 4Z9KB 1T5XB 5IJVA 1QA9B 1SGKA 4HJUA 3BAKA 3GSQB 4OD3L 4GRLD 4MD4A 2OCFD 4X8CA 3O6FC 4UDTA 5FYJD 4YZFF 5JW5B 2D0FA 2BY3A 5C0CD 4Z7WA 2P52A 4ZUVB 4HU2A 5C3LD 3DURB 1PSKH 3DPBA 4LCYA 1J9QA 2XTSA 3F7VB 3GMPB 3RHWK 5F89B 1M57B 3KPPA 4J6RL 4DGVH 4YIQB 2Y07H 1J8HD 1F02I 3BUYB 3MSPA 2HN7A 3OAYK 5HI3C 3LS5H 5L2JA 2PCXA 3KS0H 1Q4NX 2YSSB 4P2RA 4IDJH 5EC2B 5KTEH 1JGUL 1PL3A 4LT7A 2QBWA 1RZJL 5GGRA 3GLAA 1NIBA 2FRGP 3I3BA 3VD0A 4PCKA 1JNNL 1WTLA 2VL5A 1F00I 4RGMB 3CSGA 2HWZH 3DPDA 1QVOB 2WB1A 3FCGA 1E65A 1UZ8B 4AL8C 2R69L 1E4XI 3QUMB 2WLLA 2ADJA 2WK2A 5DZVA 3BZEB 3IDNA 3NCYS 1BWMA 4KJYB 4Y16B 1EO8L 3QIBD 4ZUSB 1MREH 1P6AB 2ED9A 4UQ3B 5T5NG 4OLEA 3ARDC 1G6VK 1A7PL 2EICA 5LUMA 1U8JB 5DVLA 4MA7L 1P6FA 3ZU8A 2COVD 2CRMA 2JE8A 3AQYA 2O61B 3IWUA 3GKWL 3K4ZA 2DMKA 5LXGH 3BIKA 1XGQA 3UAFA 5M95B 3ARDB 4J3OG 5ADOL 3MN8A 3U2IA 3Q9PA 3SDAD 4UZSA 5SWZB 3KPRD 5KZCB 2NYKA 1ZJBA 1JE6A 1PD1A 4L9DA 5EU5A 2XRAL 3NFPA 1R0AH 1X44A 3NN8B 2MCG1 2EDFA 3HE6C 2WUBH 3ZTDC 5KYXB 3NIGB 3F6IA 1OP4A 3F7YB 4LCCA 3KXFA 5IQOA 2JI1A 2LAGB 4BYHA 1BG9A 4Q2ZA 4KBPA 2BC4B 1EEZA 1MJ7H 4BH7B 5I6XB 5J4MA 1X7QB 1U92B 1TZHB 4X98B 1IFGA 2YXWA 4TVPH 5AAPA 3WKQA 1FIGH 5BS0E 3MNZA 3H4FA 4NC2B 1WIPA 1WS8A 3QQ3A 4Z7UB 2X6CA 3RVTD 5IKCB 1ZGLP 5IVNA 1VZIA 3B5TA 5D70L 1EEYA 3EG9B 4KJPC 1OTUC 5E6IC 4HMCA 3UFIA 1KELH 4WI3A 3BZDA 3DUSA 3PUUA 4LLVB 4KQ3H 2BSBA 5F7LB 1YC7A 2NXZD 3QIUB 5MI0C 1RZQA 1JGVH 12E8L 1DO5A 4P2AA 3VQ1C 3NZSA 2NZ9D 2GT9B 2OP4L 4BGDA 5CJOL 3GZKA 3N42F 4O02L 3QDJE 2KZ1B 1EJFA 4XP1L 5C6WH 5JPNA 5FDYA 3FFDA 1I85C 3FUDA 4IRSC 4M61A 1TMCB 4N6RA 1WPCA 3LMJL 2WN3A 1SDDB 4G7SB 1TJMA 1SXCA 4Y2NA 4H8WL 1GY2A 1UQSA 5CD3A 5ECGA 3QNXA 5D1XC 4X4XA 3VCLB 3VFPB 3CSFA 3VXQB 3VGHA 1NEZG 2ZX6A 3QXTA 1PSKL 4M4PA 3SBRA 5FO8B 4ZBJA 4DGVL 5CGBA 3O3DA 5B7EA 4K71C 4GUCA 1Z1WA 2W65B 1ZHKB 2Y07L 3W5NA 1AO7E 4UM8B 4MMXA 3DYPA 3IDMA 3LS5L 4PR5A 5E4OA 2X09A 3UBFA 2GJPA 2ENYA 4GNKB 3S3DB 5AB1A 1PKOA 43C9B 4WEMB 5C07D 1G7HB 2XZZA 4IDJL 5D7IF 1UM4H 4XTRC 1CD0A 3ZDXF 5KTEL 4ADGA 1M71B 1XCWA 4F7EA 1N5YH 4X4YA 4XNMB 1E4XH 1A1NB 5KVDH 2PW1B 4BKTC 1OOWA 1NWOA 2VLRE 2ZUYA 2YAOA 4X5LA 4JW3A 1CGSH 4OJFH 4AK1A 4HCGA 3BFWA 4M48H 3ZPDA 4TNVK 3MA9H 5I17A 3CDZA 3HC0A 2N0MA 1HYSD 2B8OT 4L8BB 4APQC 1GXEA 5EIIB 5HGBA 2N7BA 2EIMB 2CDEA 2FO4A 4QT5A 3TFKC 2XTJE 5DK3A 3K6SB 2NW2B 2DI7A 4R4ND 3RWHB 1FBIL 3DV6A 4RCAA 2VXQH 4R2GB 1N9PA 1IKOP 2LLNA 1VKXA 5CWSA 4JFQA 4E2OA 5LXGL 5PAZA 2AITA 3N04A 4YK4C 3ZYIA 4JZJC 4H44C 4GFTB 2XIIA 2XWBA 4Y9GA 2FIRT 2OMWA 3WDHA 4JJ5B 1R0AL 3ZDXB 1KJ3H 3K2MC 4GW4B 1J9TA 1N4XH 2PTUA 2WUBL 3CZSA 3FTGB 4WUUE 1RUKL 1CURA 4F58H 3QFDA 4FABH 4NQEB 1MJ7L 2OCCB 3Q2CA 3LYRA 1RIVL 1TVBA 2DLEA 4WHTA 2E6JA 4TVPL 5IF0A 3WMSA 1NC4D 3GRGA 1E8YA 3D18A 4RWYH 4JPKH 5JPMA 4Y4HB 4YL4A 4F2MA 4FX5A 4IOSD 1MNUH 2XBDA 1QQDA 3IDGA 4TMPA 2ICEB 5GS2H 3ZRCC 4QGYA 1XIWD 2UZYA 3E2HC 1ORSB 1D5ZA 3VI3F 5SWQB 1KACB 3VRLE 3BW9A 4L8SA 4KQ3L 1B4JH 3FS9A 2BVPB 3WIHA 3QEUA 3S36H 3A4FA 4F8NA 1JGVL 5FW8A 4D0BB 1J7VR 1OE2A 3E2HB 3P4MB 5EOQH 1J0YA 4EXKA 3RJOA 5F7YC 1OF0A 3CPUA 3BP6B 4PI0A 4QTIH 4AVHA 5C0EB 1A5FH 4KKBC 1XL4A 3QHZH 1E6JL 4P2RD 1RJYB 5CJXA 2D7PA 2GSGB 4R5VA 3IGAB 2VISB 1TNNA 3HG0A 3AG2B 3EZJB 2B39A 3QZWG 5J9PA 4UNUA 3NCCB 5L2KB 4JFDE 5IBTL 1C12A 1NICA 2C9PA 4WDIA 1HJCA 2X4TA 3PUCA 5J0BA 4J39A 3TBBA 1DN0A 2KZBA 4K4KA 1G84A 4F5CE 2A9ML 3OKMB 1B0GA 3ULUL 1UM4L 4NKDB 3VVWA 4HP5A 2G75B 2W1NA 3P4OB 3MNMA 3LN9A 3L4ZA 4MX7A 3FT2A 2CHXA 4YXKL 4AQEB 4YHYB 1FFPA 5JZ7D 4GSUA 1CGSL 1ADWA 3GMOB 4OJFL 4MXVF 2DYPA 3BAWA 1F4HA 2GC4C 4M48L 2Q7AA 1S7SB 3MA9L 3J2PA 3WFDH 5H37A 4IS6A 3QUMH 3RVVC 3TVMA 3ATDA 4GKNB 4AITA 1TFHA 3GGWA 2FBJL 3QULA 5BOPA 2X0UA 4PJFB 4CVXB 5LVEA 2VXQL 2CGYA 2P3YA 2IWKA 5CAYB 2HVKB 2E5EA 4K94C 4I88A 2WKOA 2WZ6A 1U91A 2ZF8A 4AGNA 3FQYA 1PVHA 4AWJC 3EFDH 1AHKA 2NY1C 1DBML 3DX8A 4LPYA 4GW5B 3CH1B 4FTVB 3JTSB 2QGBA 1PX3A 4OIIH 5C0IA 1KJ3L 4JE0A 3P77B 1N4XL 2EQDA 3QPQC 3SDYH 2E7MA 3BVUA 3KJ4B 3UJTH 2XFXB 1G9NC 1N67A 4F58L 5I6LA 1KIUB 4FABL 3RPBA 3RWJA 2RTTA 1NTDA 4LIQL 3X1BA 4WI0B 1FSKB 1NKGA 2XWRA 1TCRA 4X8XA 1YMMB 4RWYL 1VSCA 4FZEH 1T1WB 5I1EH 2ENJA 1MNUL 5HGDA 3U0PB 1JF5A 1AQ8A 4PLJC 3O4LA 4QYOB 4NQVB 2WNKA 3DK0A 5E2UH 4U6XA 3WDJA 1E2VA 3UTTE 4MDIA 4HEMA 1NCUA 1XH3B 3S36L 2B2XH 4NLHA 2HKHL 3BO8A 5JQ6H 1IQDA 2GTZA 5KYYB 3CXFA 2XI9A 4RISH 1WT5A 2CO1A 3LRLA 1QW8A 1IEBA 2JLLA 1JXKA 4OU3A 1U8LA 2BP0B 3MRGB 3KBPA 5IVXA 1MF2H 4QTIL 3GKZA 5TDPB 3VB8A 4CMHC 3IJHA 1WIOA 2DQEH 1A5FL 2DQ6A 4ZUTB 1QSFE 3QHZL 2WQRA 4LHUA 4NQXA 4IBQA 1W72B 3F5WB 3FQ1A 4P4KB 3CVHA 3VNYA 3BVDB 2CSPA 1BF2A 3DX0A 3IMTA 5TK2A 1MLCB 5TFSH 2DPKA 1HKFA 5EU6B 4P04A 5TDNB 2WMPB 3TS8A 2HX8A 5D8JH 5E7BA 4K3HA 4MNGB 2P42B 3K2UH 3ECWA 1TZ8A 5DHDA 9PCYA 5JNYA 4LSDA 5IQLA 5T5FA 2NT0A 4FQ1L 4BQ8A 3CD4A 3AY2A 1R5VB 3SJVB 3K71A 2VNCA 1W9XA 3KNBA 5AUMB 4MXWH 3BSHA 3OG6B 2JKTM 5H35A 3L5IA 1HEJC 4OCSH 3OF6D 1IZKA 4TTGA 3ZQ9A 1N59A 2C3XA 1PKQE 1OAQL 1WVZA 3E1F1 1KXHA 2IGFH 2OMVA 2VDOL 4HWZB 3ZBMA 3W38A 2DQFA 4N0FA 3DIFB 1SLWA 3RTQA 5FA3B 4OLUH 3BEWB 4QRPA 4YPGB 3WFDL 4LQFL 1WRFA 2ZXDA 1KWKA 2BIQA 2HUHA 4ZFQA 3DGDA 3NH7H 3SOBL 3BQUB 3T04D 4Y5YB 3VSUA 4AL8L 5EU7E 3LEVH 3GZQA 2F54E 3BUPA 1GH7A 3IF1A 3O8XB 5DK0A 4ONHA 5SV3A 2R23B 3O9WC 2PYEB 5IB1A 1HKLH 3BWUF 4PP1D 3SE4A 4PJ8B 3KYMA 1D6EA 3AGWA 4GO9A 5AVZB 1HH9B 1OIOA 3EFDL 4IKKA 1M56B 3O9WB 1JGDA 4OIIL 2WQUA 1M3JA 4MB5A 4OLXH 5CP7B 4B97A 3SDYL 5HBBA 1AGDB 1HHJB 1O9VA 4DIXA 3MX0A 3TNMA 3UJTL 4MB4A 1PEZA 1EJ8A 2BHYA 4KVCH 3AJ7A 1HC1A 1WFNA 2YD7A 1M42A 2HX9A 3SDDC 1PAZA 2F53D 4TVPE 2YPLE 4FZEL 4KMTH 1A6WH 2IFFL 3VFSB 5DMKB 2VRKA 1XXFC 3ATBA 1USZA 1QOKA 3V0GA 2C9UA 5E2UL 4NJAH 4OIAA 5JQ6L 1J5CA 3MMEB 3MRCB 5TF1H 1WH0A 1IEHA 2Y2WA 5K59E 5EA0L 4RISL 3S5YA 4CSSA 5D7KD 3FH7A 3BLPX 2CU9A 4X8JA 1NFAA 4J6IA 4XOAA 1MF2L 3SGKC 4OGAD 5HHMD 3UYOD 3MGAA 1ZHLB 2FJUB 3CXDL 4DP8X 5AOMA 1I7RA 3K4AA 3D39A 4HW6A 1HS6A 3B37A 2ZJSH 3EJUA 2OSXA 4RSYA 1CXIA 2UZXB 3KHOA 5TFSL 3EYSL 1J1XH 4BKLB 4JMXA 3CXHJ 2A83A 3N41F 5D8JL 4E41B 4QHKI 2ESVB 3RQ3A 1XEDA 2BP3A 5C0AE 3K2UL 4AQAA 4Z77A 4JL2A 1AZCA 3T77B 2DYPD 2GFBB 1T22A 5AYUH 1KBKA 1CF1A 3G7TA 1VJSA 1N19A 5D1ZA 2XQ0A 3WFEH 4JK0D 3SPVA 4ODBD 1M9WA 7CGTA 3VFUA 4MXWL 1NM4A 4MJIE 3V0WL 1QYGH 1H3VA 4OCSL 4ZOBA 4L3FA 3VSTA 2IPUG 4A2LA 4FNRA 2WSDA 4K8RH 5DZOA 3BMWA 3AWEA 5F1NB 5HJ3B 3X3FH 3RZCC 4ALAC 1PY9A 1U33A 3DROA 2OJ1A 3A6OA 5KVDE 1HU8A 3C8DA 4LCWB 1FYTA 3AXHA 4G7VH 1VADA 1B4RA 4W9GC 4X5XA 3R8BB 3GF8A 2AJZB 3QUYA 1F8TH 1KF9B 1OCWH 2EIEA 2FSDA 4OLUL 4OZHE 4GAGL 3RZCB 1BZ9B 2IBZY 1L6PA 1T2XA 3IDXH 4IRJB 4WTZG 1S46A 4ZFZB 1QW9A 1AGFA 3CZJA 4MGXA 3LEVL 4TVUA 3HR5B 4AXWA 3GMLA 4MAYB 1BJ1J 1C9SA 4QRFA 4MZ2A 1HKLL 1X9RA 2J71A 3KVQA 3HC3H 1LO0L 5FCUL 1KXVA 3HNSL 2QZ5A 4WF7A 2EADA 4ODHH 3IDYB 2BSRA 5KN5A 2XUWA 3AT9A 4OLXL 4POZC 4HSCX 5I8EA 4KY1H 1PZDA 1CFBA 2JKSA 3O4LD 1S6NA 4DKFL 3IFNH 2ZSWB 4KH2A 4MASA 2W94A 1BIIB 5E8EA 1MFEH 4KITB 3AGVA 4EN3A 2XG5A 1AGBB 4CW1B 4YOKA 4KVCL 4LRIC 4LSPH 1N7MH 1AR1C 3HPLB 2GHZA 4JY6B 4GJTB 1PW3A 5DRXA 1UD2A 1MCNA 2FX9H 1AZNA 4LIQE 5GS0H 4KZCA 5CIPB 1SZNA 2IDCA 4RSVA 5BVPH 1A6WL 3O3UN 3BWAA 3EYFA 3RIFF 1XBRA 2IH3A 4ONOA 3TBVA 3NIDE 3ARXA 3ZL2A 4HG4J 3ES6B 3VH8G 2Z3FA 2VR9A 5D7SH 3QISA 4LHUD 2D7TH 3UAJA 3KCPB 4PV9B 2PABA 4B6ZA 5E6SB 3NIFB 1EJOH 4NZTH 2CHWA 3W5MA 1AQDB 5DUML 3RX9A 4ZAKC 5DMIL 2HFGH 4HLZG 4UNTA 4PM1A 4BFJA 5I1LA 3KH4A 4WKZA 4BEIA 2CGRH 3FRUA 2ZUUA 3LNGA 5AZ2H 1WBZB 3HPJA 3V4PA 3G08A 15C8H 1KGIA 3ZK0A 1D6VH 2J8UE 4AT6A 2X4RB 5DRNB 1XGZA 4LPWA 1W72H 3BLBA 4NIYE 4K5NA 4UMGA 5DHYA 1V55B 3X1FA 2EAEA 2ZJSL 4NPJA 3WLWD 4UQBA 3BPOC 4KI1A 4QHLA 3QG7H 4KXZI 1J1XL 4DKDC 1M1XB 3G9VA 5HHPA 1XF2B 1UATA 3TEUA 1ZVSA 1XO8A 4AMXA 3K6DA 3RWCB 4LKXB 3JWOH 2D2CC 4LQ1A 3BPOB 2JH2A 4P3DA 4HAGA 1MG2C 3RTQD 2VO5A 1BQ5A 1NUFA 3WFEL 4QRPD 3SD5A 1E5UI 3GIZH 4L4TA 4E5XB 1E8ZA 3F00A 4HV8A 1QYGL 2DWDB 1S7QB 3VWJA 3F01A 2G5UA 3GXDA 4JY4A 4XCNA 5B1BB 5ICZB 4K8RL 4P23A 3X3FL 4YFLI 1WBYB 1P9MA 5HDQL 1WA0X 2H2PD 3PHOB 2X6AA 1W0VA 2TSBA 2WTRB 1F2XK 2QR0A 4G7VL 1KPRA 4H1LA 4UUJB 5EBGA 5LN8A 5IJKA 1A21A 2PTTB 3DGGA 3IDXL 4OZIA 3D05A 3VD1A 5DGRA 1G7JB 4MMYA 2Z91B 5AOKA 4OW6A 4OAWA 3VXUE 1TITA 4PY7A 4NYLB 4IDLA 4L9LC 4XXDA 3ECBA 3LPWA 5I66B 1P5VB 4G8GE 1GSMA 4PVLA 5ID1A 1H0DA 1M1SA 2HPTA 3VYPA 4PRHB 2O6CA 4ODHL 2N0KA 2YOAA 2YPKB 3B2MA 3IJYA 5C09B 3T0WA 1MRCH 1LTXA 4R6UA 1AOHA 3FO0H 3V2AR 2ZX7A 4IJTA 5SWZE 4U1NA 5MEQA 4PD4K 3IFNL 3FB7B 4G8FA 3M7OA 4GP4B 4K94L 3LD8B 3V4UH 5I1IH 1MXDA 1N6QH 2EVFA 3OG4B 2VDLL 3NIGE 3IEAA 1WTGT 1Y0LA 4BRVA 4LSPL 1N7ML 4AZ8B 1DQIA 2YAMA 3QUXB 5D2LB 1VEOA 5EUOE 5GS0L 1C5BH 5BVPL 1NBCA 4JKPH 2CRIA 1G9NL 5DC4B 1Z6JT 2JJSC 4Y4FB 2IG2H 3B9KA 2NNCA 5E95B 1KC5H 1T6WA 4Z7UE 2XHNA 2YWZA 1QRNA 3FUFA 2WXLA 4GSQA 4GRLC 2D7TL 3VFWB 1PJ9A 5GS1A 5LBGA 3VG9C 1A7NH 3O2DL 1EJOL 4NZTL 4XPAL 1KULA 2A6IA 3L2NA 1LP9A 5T5NF 4HJ1A 2K4WA 2HFGL 3ZT5A 4DTGH 1MH5A 3D8MA 3MKKA 2CGRL 2UZIH 2OSLA 4AYFA 3FPYA 3V52H 1GIGL 2YXFA 1CDIA 5AZ2L 2Q2EB 2VLME 4KXZH 4E9SA 2L3BA 2DQTH 2WYTA 5DRNA 4ABVA 1D6VL 3ARSA 2Z7YA 4P57B 1PZAA 2EKSA 4CC0A 4Q9QH 5KVFH 1CICA 1SMAA 2Y2YA 1VIWA 2XDHA 4QRRA 5IEHA 2X6MA 3SDXA 2YPVA 3QAZB 5GSRA 3BRFA 2FEJA 3EGSA 2OK0H 3QG7L 2ZPKH 5GSVB 2PP7A 2W38A 4HETA 3UPAA 3JWOL 1MOEA 5C08B 1FYTD 5DZ9A 4AC2A 3ZW3A 1IGCL 3HZKA 4GAYA 4ZS7H 3QUYD 3QIBC 4JG5A 2MPAH 3RU8L 3G5YB 3GIZL 4NENA 1WAEA 5I73C 3T0VA 1TFPA 1BQHA 1JRHI 1FLRH 4K3JH 1K8IB 4MA1B 4V2CB 3WTTA 3GXFA 2E86A 5I73B 2YAPA 4HALA 2ZQKA 2IDQA 3GSWB 2BNRE 4NUGH 1T7WA 4J3SA 2J44A 3V5KB 3MCLL 2KI6A 3R7QA 4OJEH 2ZXGA 4QPEA 3SDAC 2IDSA 4NWTL 2XG4B 2XOTA 1AIFA 3W0WA 5I6KA 3DX4A 4Z3EA 1YPZA 3L3OC 5EZLB 3QXDB 3FULA 2NNAA 1TVHA 2PPCA 4S1SH 4YDVB 5HHOB 4M5ZL 3PWPA 1VFBB 1D5IH 2KYIA 3U2SA 2XFGB 1EX0A 2ADFH 4EN3D 2R2EA 2WBJA 1KGXA 2W8CA 3C6SA 3GLDA 5DRWB 2WB7A 1U2HA 4TQEH 3L95A 4KQ0A 2YD8A 3N40F 3RIKA 3RVTC 4F9LA 3ETBJ 1FNAA 5DUBA 1OARH 2XZQL 3MRIA 3WHE1 1FH5H 1YY8B 3EH2A 3V0IA 2H4EA 3MQIA 4MQXD 2JI2A 3BH9B 2DIAA 1MRCL 3BZFB 3K2IA 4M4RB 3FO0L 1G94A 2Z7WA 5C3IA 4ZFGL 2NXZC 1R4XA 4ZW5A 3UAJD 4Z76B 3V4UL 5I1IL 4KKLD 2NZ9C 3GBML 1N6QL 2F74A 3I9GH 4OFDA 3N1QC 3HB3B 3LZPA 5MP6H 4WI9A 2AJSH 2ADYA 5GRJH 3FCTB 4UOJA 4OIFA 3SE8H 4BZ2A 5E5MA 2OI9C 2W0PA 1NCCH 3QXAA 4P9HH 2HA1A 2ZXEB 4WW1A 1C5BL 4JM2D 3LQZB 4D94A 4JKPL 1EDHA 5CIPH 1HHIB 4WCYL 4ZX6A 1F3RB 3EF4A 1OPGH 4OJDH 1O0VA 1KC5L 5H2BA 3STZB 1NGPH 5L9DH 1HCZA 1MVUB 1PX8A 5DA0B 5E6RB 4MQ7A 4YSEA 1ZY9A 1A7NL 3CDFA 3G6JF 1E4JA 5LWYL 5LNGA 3FU7A 1P7KA 4GI8A 3UP6A 1U6AH 4ZTPH 1NEZB 4U3SB 1O7SA 4TTDC 3HZVB 3UTSB 5IQ9B 2UZIL 3L7EA 1YEFH 2M26A 4FXLA 1G0XA 5IG7B 3E7JA 2R29A 4U1HB 1KJ2B 1F6AA 2NQCA 2BVOA 1P0SE 2YGVA 2DQTL 4X6EB 2FBOJ 1P5UB 4NBXB 4Q9QL 2AXGA 2VMJA 1INQA 4OGZA 4UT7H 4YDIH 5LKNA 2GG1A 4YBLB 4R9HA 4XB8A 1LNUB 43CAB 1T20A 4N5UA 4OCXH 3BP7B 3VWJD 3HAEA 2ZPKL 1Q0XH 4P23D 2K78A 3MJ9A 4CC4A 3U1QA 5T1LB 1JRHH 5J57B 4P9MH 3TURA 5L2KE 1HYSC 4ZS7L 4PTUB 4JFEA 2OJEA 2R7EB 2YEVB 1JFQH 4DZ8B 5KBLA 2A2QT 2FECL 2OS7A 2VLKB 4FQQB 1RUPH 1D5MB 2YGNA 1OD9A 4R4NC 2NUTB 4TLKA 1FLRL 4K3JL 1SVCP 3IVKB 3CZFA 4Y2DB 2WLZA 4ZUUB 2YD5A 2ICES 5C0FB 4ZMTA 4KVPA 2P5PA 1CFTB 3GS4A 4Q4IA 3EOYG 1ZT7B 3MOBH 1A9EA 5DQDH 3QYCA 1KJMA 1IBGL 4ALAL 2PXYA 5E2VL 3IB4A 3PL6A 2AAVA 3STLB 5F0PB 1BFVH 4S1SL 5EBMA 2JKJA 5CLXA 3V6FA 3EBIA 3IDJB 2CDFA 4X80H 4A7SA 3IXAA 2N59A 4PW9A 1AKJB 4AQ8C 1D5IL 2F2HA 1DLHA 4M8UA 2BH0A 5BW7C 1E8XA 5FUZH 1IAOB 4PJFE 1KXQE 4TQEL 5DZPA 1NCDH 4PJCF 5I8OH 4F7TB 3DTXB 3DVNA 5F9DC 1OARL 4B9YA 1FH5L 1QSVA 3ARBB 3HRPA 3C8HA 3FH8A 4PY8J 4P2OB 1MSPA 1XIWC 1IKNC 3MCKA 3APNA 3PQYB 2V3DA 5B38G 3B9KD 3Q06A 1T5WA 1FAIH 4NPYA 1QRND 4FTVE 2AQ2A 3QARA 3WO4C 4HK3N 1G4RA 4PRNB 2K70A 3BIBX 2PWHA 4EDXA 2YA2A 4AQZA 4KKCD 5D5MB 3I9GL 3LKRA 2AJSL 1UD3A 5GRJL 5HDRA 3SE8L 1Q0EA 4R0LB 2CDGB 1NCCL 4P9HL 1P7QD 3MPCA 4HJSA 3WO4B 2WWOA 3CZEA 1Q0YL 2YEZB 3VI4F 2LU4A 2DQIH 3E38A 1YMME 4MNHA 3S0PA 1OPGL 4IU3A 2XNAB 5L9DL 1QR4A 5B1CA 2H3XC 4A6YA 1CICD 1DANU 2ZNWA 5CLYA 4QRRD 4ZQKB 32C2B 1NIDA 2HJFB 3V6ZB 1H8NA 3IWVA 4HJEA 3TBSA 1NBZA 2XVKA 4PJCB 4JFFB 3LKOB 4WFGE 2AEPH 1ZLSL 3SOTA 2UUDK 1YEFL 4J28A 1CT8B 3BAJA 2I5YH 1F3JB 4R7DB 4DQAA 2VZTA 2X2JA 4UT7L 3G5XA 1PG7H 4YDIL 3QDGB 2JKWA 3N0AA 5I1GH 5D4JA 1J9CT 5FHBL 3ETBF 2VDNB 4YX2H 4PJBF 4OCXL 2IO5A 5JZ7C 1A7QL 1TDQA 1Q0XL 4FAAB 1YEKL 2H3KA 2J1XA 4HFWB 1HAUA 4M6OH 5I1KH 5D6DA 2L7JA 1HL8A 8PAZA 5EU6E 1IE5A 2YRPA 4AGLA 1JRHL 4MNGE 2YD6A 4X6DF 4A7UA 4GYBA 2OQJA 1UXSA 3UO1H 3B43A 3W0WD 1JFQL 3AMKA 3NCWA 2ZSVA 1RUPL 4XN8A 3QQDB 4MCMA 3QR1A 1RP8A 2B1AH 4X7TB 4LCCC 1DO6A 1ZSDB 1YNTF 3PWPD 4WFFE 1ECYA 2WCPA 3ARGA 4X6BA 2WQAA 4A37A 5FF6B 1PQZB 1KLUA 2WBJD 1KLFA 3QQXA 3G04B 3MOBL 2Q7NA 3RB7A 3I9IA 5HVGB 5J3HD 5D7JD 3UTQA 2BNUA 2WZ5A 3AQXA 2RCSH 4J3OH 4RAUA 1ITBB 5E8PB 4DUVA 3NDZE 1MIMH 4LKCA 3ATAA 1MFVA 2VXVH 4YQXH 4PJBB 5EWIH 3S97C 3EXJA 4KTEL 3ARFA 2NXYC 3CLFH 2ATKA 4K7FB 2CIKA 4ZPTB 5HHNB 1DSFH 3REWA 1M6OB 2G30A 1AMXA 2HG5B 2JCCB 5HY9A 2DIJA 3UJIH 1CYWA 5I8OL 1O6SA 5JPNC 4QHNA 4PJ5D 3UTPD 1AXIB 2PYEE 3PJLA 1BVLA 4GSXA 5HDLA 3TZVB 3RDTB 3KMDA 3ROOB 5E99L 1BLNB 1UADC 3GBNH 4YEEA 3T08A 1MW1A 1Q9OA 4RFEA 1FAIL 4N8VA 1K4CB 1ZLVH 3MREA 3NVQA 3K5RA 4P5TA 1E9PB 4NN7C 4U49A 1U8KB 4EIBA 3ULUF 1CF8H 2X44D 1FFRA 1JGEB 3F85A 3EFFB 3H9YA 2Z6FA 5TF0A 3KDMA 2HFFA 4Y5VB 5EBWB 4WNJA 3IPEA 5IB2A 1MAJA 4Z7VF 5FW7A 3QJXA 4MMXC 1H9DA 2H8PB 1RL1A 1YQVH 2OMBA 1E4KA 2FWLB 1ZA6B 3B83A 1OM3H 4X8GA 4YXHL 1HHKB 5D93B 1NGXB 2WBXA 4EJ1C 2AJVL 4L1HA 3FQWA 5KJRH 3GC3A 2CCLA 2H0EA 5K39B 3ENEA 3TYFB 2AQ1A 2AEPL 2VABB 5FX3A 3N40P 5FYJL 3WLBB 1KJ2H 1IM3A 4PJDB 4JFED 4YO0A 5FV2A 2E27H 1O5DT 4UAOC 1PG7L 3EOBB 5I26A 4MJ4A 1NDGA 1R3IH 2WXMA 3RFZA 4M6OL 3IRCA 5CR8A 3VJ6A 4YUEL 4PJXA 5SWSA 4UAOB 4M8QB 1XTMA 4NNYB 3OMZA 4XX1G 3JV4A 4E41E 1RJLA 4NO3B 2ESVE 2ZX8A 5F3BA 4Z7VB 3KZ8A 3GTNA 5E8NA 4KRMB 3UO1L 5BZDB 4RMBA 2PXYD 3D9AL 3LXCA 5DCCA 3HG1E 3PL6D 3UCRA 3MXWL 2IGTA 2WD0A 4PRPA 1WBXA 3DX3A 3FSAA 3MRFA 3S36X 5GJTH 2E76C 4HUUA 2K3HA 3FTWA 4KK8C 4IBUA 3EO1B 2AK4B 1G0DA 1B90A 1UYWH 4PP1C 3VW3H 4QHMB 5FECB 4FI7A 2CAKA 2NY2B 3L3JA 3GXTA 3KEDA 3OB8A 4NOFA 5JPMC 4LCWE 1D5BB 2BHZA 3P4LA 2RCSL 4JHZA 3MFFB 2EVJA 4GKSA 1MIML 3PV7A 3X2QB 3R0MA 4BQ9A 2VXVL 2RALA 2WPGA 2H32B 4DPAX 2DQHL 4HZ1A 1XGRA 4R8WL 4WGWB 5C92A 1DSFL 2EEBA 3BLKA 1U3HD 4JB9L 3HE7B 1CGXA 2Q1EA 5T3XD 1TQCC 1MDTA 3Q9QA 3UJIL 4FQXB 3WMQA 3L7FA 4NM8H 3K1DA 5FKAB 3OLEA 2OTWB 3UG5A 3IYLW 3ZSSA 3VA2C 4H4NA 3MV11 3GBNL 3OC8A 4AEHH 5JOEA 3P3RA 1IL1A 1XSKA 2FZ3A 4HZLB 1DCEA 1LGVA 4OFYA 3PWJA 3MVSA 4KROB 3TIDB 4JZNB 2CKBB 3B8YA 1CF8L 4M7LH 1DVUA 1JWUB 2F19H 2BNQA 1INEH 1Y18A 3V5HA 3UX9B 2YMOA 4Y19A 4XNXL 4OD2A 5TDOA 3MV9A 1XVSA 2EYRB 5DD6B 5DVPA 5C9KA 3POCA 5FO7A 4GKZB 1EJ6A 2VT0A 1THAA 3U4BL 1H3WM 1NLBH 5E2TH 2EEAA 4Y2OB 1WZAA 3GSUB 3ESVF 3F62A 2R56H 3KPSB 4F3FA 4HMEA 5D7LA 1NZRA 4AYEC 2CO6B 1U9KA 4FQPA 2K6ZA 3Q43A 2V17H 4I5BA 5ETUA 5LB1A 5KJRL 3NIFE 2VDKB 4NSKA 4PB9H 2FDBP 3IETA 3FOMB 3H9SA 2AXFB 2UV3A 3NJVA 1HYRC 2DM4A 2ZP0T 1EHAA 1UCTA 2H47C 2XT1B 5IMLA 1KJ2L 3GSXB 1URLA 2FQEA 1XCQA 3U36A 4Q6IA 5IW6B 2EVGA 2E27L 4HUXA 3VWKC 3VFTB 2VDRB 3BUBA 3UABA 1R3IL 4LDOB 2Y25A 4O58H 2VDNH 2B9AA 4OZFA 2A6DB 3ARGD 2EC9T 1RAMA 3VWKB 1E67A 3FL7A 1KYOK 3S2AA 5B8CB 3DTDA 1CFSB 3ABLB 4NRYB 3D2UA 3GT6A 3WTYA 1ZS8A 3DRQA 2ZG3A 3PPEA 4KY2A 5A16B 3UPCA 5ITFA 1CDBA 4IEFA 4FA7B 4EZLA 4WO0A 3AXLA 3CPLB 2X88A 1I7UA 3BCFA 2HLAB 2Y0SA 4AM0A 5C0GA 4KQ4H 5GJTL 3N44F 1BD2D 1EHLH 2GYSA 4NHCL 4NB7A 1UYWL 3X14A 1YUHB 4KRLB 3VW3L 4NX0A 2QTEA 4J3BA 1CR9H 3NPSC 1T0MA 5D6CB 1N2RA 3A6BH 4U1GB 5GGQH 5IB4A 5TE7L 3PWVB 1BOYA 3AABA 4PGEA 2MCPL 5FOJA 4G5ZL 1UB5A 4XO3A 5JIPA 1NQBA 3V6OE 6PCYA 2WANA 4YHPA 5GGTA 3MRJB 3T4YA 4JM0A 2AQQA 3WFBH 2DWSA 1ZCRA 3JWNC 5BRZB 1XL6A 2XZAL 3B7UX 3VYOA 4Q7DA 2DBLH 4RETB 4ZPVA 1JUFB 1IUZA 1JZJA 1X4YA 4ZODA 2P5ED 3VX1A 3ZT7A 1UM6H 3TV8A 1TJGL 5I71B 1UVQA 3VE0B 5JDJA 4FERA 1SN0A 3FQ2A 1PNDA 4PI2A 4HUKB 5CUSH 1JF6A 3L6FB 1FO0B 1UJ3C 3NK3A 2BW5A 2Y23A 2NMSA 4DKAA 2EUWA 1FL6B 4PRHE 4AEHL 5IJDC 4GUQA 4J5VA 5C09E 1GSKA 2WIIA 4LXFA 3FT1A 3GMQA 4X99B 1UJ3B 4QCIB 1X5ZA 3GNML 4PRIA 4PREB 4YHKH 4CN4A 4M7LL 4HBCH 4S0HA 3DHJA 2F19L 5GIRA 5DMYA 4MS6A 1INEL 1Q94A 1HJBC 4RWHA 4HKJB 5I6OA 1T4WA 5ISZA 3L9RA 1DBBH 2OX5B 4G42A 4UI2A 5D2LE 1Z9SB 3EYVA 5FOBB 3X11B 1MCWW 2D9QB 2LFGA 1IM3D 1NCTA 1NGZA 1DBAH 4WI7A 4QXTA 2A7BA 2R56L 3WLWC 3X3GH 4UTBH 5AW5B 5AB9A 4V1DD 2C4FT 1JHKH 3C09C 4M7KH 4B53A 2FGZA 1EZVY 4L8CA 3QDAA 4EI5B 1MW0A 2LVEA 4HIIB 4PB9L 4TXVB 3DBSA 4BD4A 4MJ2A 4LRNH 1HQRA 2BOCB 2D7MA 1UASA 2X7LA 2A6KB 4NDMA 5SWSD 3GSRA 2WKGA 1OSEA 4N24A 3RTQC 3UACA 3C09B 4K3EH 3D2TA 1MAKA 5FYJE 5KYNA 1ZHNB 4EI0A 4X6CA 1AZVA 4P46A 3W81A 1OZTG 3U1SH 3LVEA 4O58L 1BXAA 5MENE 2GBUA 2H2PC 4NM4H 4IRZA 4KOCA 2X4PA 2VXTH 1DEDA 3PIQB 4X5PA 4BZ1L 5IJBC 2Z35B 1EGJA 4J3WA 4N20A 4PB0L 4UIMB 3B3IA 3F7QA 4JFSA 3MC0A 1J86A 1JK9A 4L1TA 5C08E 3VFNB 4RGOL 3CFNA 4S0TD 2XJKA 5JHLA 3DMMB 4R83A 4Z8FH 2C3VA 4R97B 3KPNB 5IMOA 2BWQA 4M3KB 1EHLL 3VXTA 2P4AB 2DS4A 3Q13A 3D69B 1CR9L 2EEDA 4WHCA 3A6BL 4PJIA 3C60C 2R0KL 4JEGB 1EXUA 3NFNB 1M7IA 1YQ2A 3TIEB 3QJHA 2AKRA 2VYRE 3D51A 3T9WA 4JCMA 1N26A 4HKBA 5I1AB 2H6OA 5ICYB 5H4YA 2VZVA 1JZEA 3ASNB 1UXWA 3V0DA 1XQ4A 2DBLL 3NJFA 4OFYD 1G7PA 3HN8A 5HHOE 1YN7B 3WJLC 1BXVA 3OVUB 2H32H 4IJ3C 2PCYA 1WA1X 2NTFB 4LCUB 3AG3B 4BFBD 5IHHA 3IAPA 2QJDA 2FL5A 3UGEA 4DEWA 4Y19D 3QUKB 3O6KL 2EIDA 3MV9D 2ZYRA 5DS8A 4IJ3B 4AYSA 2ZUQB 1F4YH 2YIHA 5ICUA 4WV1C 4X50A 4OLWL 1PYWA 4DHLA 2QADB 1M05A 2BVTA 3QJFB 5IHUH 3ZGIA 3QO1A 5DR5H 5FLVA 5IM7A 1OF2B 2AV7B 3AU0A 5D7LD 4FFTA 2VN3A 2CKBH 1WGVA 2P49B 2FWOB 2R2BA 3WTVA 1S9WA 2F8VA 3QEGH 3RY4A 3LZLA 3CZNA 5EO9B 3H9SD 2VRQA 5CCKH 4JFYA 5DTFB 3CDGB 5EU3A 4G8IA 4PJ7A 2KKQA 1R5WB 3VB9A 3LB6C 4F27A 2O6DA 3F12B 2EE2A 3REVA 1DBAL 4HSQA 1F6LL 4Z7QB 3QWOB 4NRXA 4UTBL 5FM5O 4PP2A 3OKLB 3JV6A 2AS5M 3BVXA 1JHKL 1BJMA 3MBEA 1AZZC 4Q74A 5E4AA 1OB0A 1KIRA 3Q2NA 4LOEA 4LRNL 2VDKH 2XWTB 3E6FB 3TYGH 2NY4D 1BZ7B 4CADB 4PRAA 4K3EL 4G8EA 4U33A 3UTSE 4AM0Q 3IJ7A 1KDJA 4WO4A 4C47A 4OQTL 5BUGA 1ZHBB 2HJKA 3LEXA 3MRBB 4KX7A 3VGFA 4BJLA 1Z7JA 3U1SL 4OZGB 4JDTH 2A74C 1GGCL 3C5JB 3N9GH 4PJAA 1HXMB 3ILPB 1X5HA 4NM4L 4W4OC 5KSBB 2YMTA 1FQ9C 3ESOA 4PYGA 1SJHA 2VXTL 4LGRB 3FYEB 3TFBA 2J6WA 5KAQG 2VWEC 4MZRA 3VQ2C 3US1A 3WNIA 1A6ZB 5CJQH 3ZQXA 1K5NB 3QIWA 1NL0L 3ZE1B 1JAEA 2XWEA 1RUAL 4UV7H 1I4FA 2EUVA 4O2FB 2IADA 5IR1B 1PLGH 1IC5H 3HUJA 5DQ9B 3V7AE 5FO9B 2VLKE 3LTVA 3KG5A 4EN3C 1D3CA 5AKVA 2J8OA 3FOLB 5EUKA 5EFIB 1T1ZB 3MLYH 5TH2A 4KUCF 3CCHA 4L2YA 4HXAL 2P26A 3L1FA 5GZNA 3HA0A 4LP5A 1RK7A 3ILEA 3S7GA 3RUGB 3M1BA 2QV2A 4N2CA 4MQXC 4QXUL 4ISVB 4YMPA 3WNOA 1J8SA 1H5BA 1MQKH 3DKHA 4LOFA 1L9SA 2O5ZH 3GS7A 4LOUD 4NQSA 2YJQA 2MFNA 4RVBA 4CMMB 3MRRB 4FQLH 4KKLC 4EBQL 3T2NH 3PV6A 3DUHA 3QCTH 3AADB 4IIQC 2COQA 4GPVA 1U8QB 1WS7A 3PGCA 4PRID 1IAMA 1SN2A 4LLWB 4JM2C 4FCAA 4EF3A 2BJMH 4IIQB 3T2QA 5ISZD 2XXMB 4NQDB 3CBRA 1KZYA 2RMNA 1BECA 3AACA 1XFPA 3PXLA 1FO0H 4M43H 4ZMZA 1AC0A 2KDYA 3UO8B 1BZOA 5IHUL 5DR5L 5FM5M 5ICXA 3PQYE 3CIAA 5A43C 5TGBA 4EKJA 1CE6A 4MRCA 1QFOA 2CKBL 4V33A 1BZDA 4X5RA 4E9TA 1CXEA 2ROYA 5MEOB 1N8OE 2CNYA 5E1QA 4W9EC 1DHKA 2OMUB 3QEGL 5D5ME 5GS3A 1FRGH 3QYMA 1AXSA 2DEXX 2QVFB 5CCKL 1NC2B 4LP8A 4HLZH 1OSZA 1KYUA 3EDKA 3I6LD 4GRWF 2EYSA 1P7BA 3HCVB 2C9QA 3WJJC 3ARVA 3EJPA 2DLFH 1W6WA 2QKIC 4S1DD 4FRWA 1K4DB 4FG4A 1A6TB 4P46D 3WAJA 2P5WB 4KHTH 3VWJC 2ZWNA 3DX9A 3Q2WA 5ESAA 1RIHH 1P9MC 3JBG7 1NGWB 1RHFA 3P40A 4GBXA 4HKXB 3FO2B 2IBZX 4GI9A 4E68A 4UINH 1GPOH 3KL0A 3RGVA 3SE6A 1ZE3C 3PXHA 4JFFE 1MFCH 3SCMB 4GAAA 1ZLUK 4FA6A 3GUFA 3DVGB 5IJKC 3LKSA 2GIMA 4N22A 4U3CA 1VFAA 3CFCH 2GI7A 5F7AA 3PXJA 3ABKB 4JDTL 1I1CA 5BS0A 3QI9B 2H3NB 2GQHA 3N9GL 1NGQH 3QDGE 2H9GA 2IH1B 4EIUA 1H6TA 5J56B 3EJRA 4MMZB 1GL4B 4HIEB 1AHWA 4N2LA 5GPRA 4GRWB 4DGUA 1HH6B 5CJQL 1SXAA 3MU3A 2V0AA 4OBSA 2AJXL 2V7HA 1JTPA 4G83A 4UV7L 3M88A 3V79C 1VGEL 1T3FA 3WS3B 3C5ZC 1PLGL 2FD6H 2YGOA 3FTYA 5DJXA 4H8HA 3QDJA 3BZ4B 1D5XA 5GJSL 4A2HA 2VQ1A 1F1GA 1H19A 1S3RA 1A4CA 2V2TB 3NEOA 1REIA 3KJ6L 1N10A 1BM3H 3C5ZB 3GSNA 1KIPB 2IDTA 3W11D 5JIDA 1ASQA 2EEFA 4TQHA 5DLMH 4TNVF 3WNKA 2P9RA 3DTUB 3ZTJG 1CDGA 1HIMH 5ESVB 1F6FB 4HULB 1MQKL 2KDGA 2O5ZL 4LEOA 4LU5H 4OFIA 5A2CA 5HXMA 3VDAA 3HS0A 1NMCB 3TA3A 4C4BA 5B38B 4FQLL 3K6OA 3T2NL 4KKCC 3IGLA 1SYVB 3EFOA 1PLAA 1YEDB 2V2WA 3H6AA 3QCTL 1BFOB 3WL9B 5C7XL 2C5DC 1AO7A 3LXBA 2AV1A 4N1CA 2ODHA 3KR3H 4OGYH 4TUUA 4V2BA 2YBRB 2JCCE 2BJML 4RFNC 4HC1L 4LASL 3CFQA 1U8CB 3SDCC 3ZQWA 2J72A 3PAUA 3CHQA 3PWNA 4M43L 4QYAA 3I74A 3NQIA 5HDOA 2VLRA 1CICC 3H85A 4GUPB 3R19A 1ZPUA 5EZJB 2OMYB 2ALWA 1G43A 1KDIA 1R3KA 3K5SA 4IKLA 2DM3A 3RWFB 3MBED 1WEJH 3UZVA 3CSYB 3V9FA 1FG2A 1YYLH 4AX3A 3OQRA 1OLLA 1FRGL 2DJSA 5CBAA 1DEEA 3CIQA 1WE5A 2WAHA 4A1RA 1EFXB 4NQCB 2CJ3A 2DLFL 5AW6B 4YAQA 4WO4D 4Y5XB 1O7DE 3QHFH 1CXHA 2DTSA 3CMOH 5GRWA 2ALAA 1T6VN 3MODH 2G9HA 3R4DA 4NZRH 4KHTL 3AAZA 1UA6L 4Y8AA 2VL4A 2VR7A 3WTUA 5T5FL 1Z9PA 1RIHL 1X3DA 4Y1AB 3ZHFA 1XCTA 3K72A 5F8QC 2DWYA 2JWYA 3PRZA 3F58H 3OHXC 4XT1C 4JRFA 4XCFL 2UY7A 4LLQA 1FG9C 4WUUA 1MFCL 2LTQB 1AXTH 3ECUA 4P3WA 1LK3H 3MO1B 3QIWD 4BA0A 3O6LH 3OHXB 1PTZA 5DEJA 1HNGA 1IBBA 4PJDE 3UP1A 1DE4A 1GZQA 1I8MA 1FL5A 1I1YA 1BBJB 4IGBA 3BE1L 1KIQB 1NGQL 2MWCA 4G9DB 1CL7I 4QKTA 5H37G 1A6AB 2WBJC 3O41A 5JIQA 2HRLA 1F3DH 5GZND 4XP4H 5HGAB 2J5LB 3AREB 5D7JC 5J3HC 3W9DA 4P99A 4XMZA 2Q86A 2BRRL 2YQGA 2ZP9A 3U9PH 5HVHB 3FO9A 4LBAA 1TNMA 1YC8A 4NNPL 5BZWB 1L5GA 3OKDB 3MNWB 1IARB 1FHGA 3LZFH 6PAZA 2FD6L 4MCZB 2IMNA 3ILQD 5IK3A 1LJMA 1TZIA 2OW7A 1BVKA 1WD8A 2VM3A 3NRQA 1K8DB 3G6AA 3RYMA 1CVSC 4IIZA 3U1PA 2X53A 5GZOA 1BM3L 1CD8A 4F3FB 3MA7B 4ZSOB 3I02B 1YEIH 4MXQD 5DJYB 4EXPX 1HIML 4HXBH 4KZ0A 4LP4A 1FZJB 1H3TA 1L9OA 4LU5L 2J25A 5KSUB 3O2WH 1QLEB 3CFMA 3MRPB 2GSIB 4JFDA 2XLLA 5IHLB 4XOBA 2BFVL 4FQHA 2X12A 3O2VH 5BXFB 4HZAA 1QBBA 3TH2T 3CC5A 4L29A 5ID0A 5F71A 3KR3L 3S3SA 3LXUX 3IJ9A 4F5CA 1MFUA 5FFOA 1GYUA 4OIBA 2X4NB 2E9BA 3SHSA 3DIDA 3WENA 2VZ1A 1BQKA 3BIAX 1X5FA 4G1EA 1WA2X 4CVUA 1BGXH 4DOHB 2IFGA 1DDHA 3GD1C 3V0JA 2LHAA 3HI1A 4HISA 3BOVA 2F53E 1J12A 4L37B 4FFYA 3S3BB 4IBZA 5K9QI 3VFOB 3HEIB 3AU1B 4WU7B 5E6YA 1WEJL 5EZOH 4CC4C 4ELKB 1YYLL 2R69A 4G6KH 2VITA 4GBXD 3P2BA 4BUQA 5D96B 4K73A 4LHUG 4GY4A 4KKQA 4U1JA 2P44B 3EBAA 1BQSA 2EZ0D 2KS0A 2WXFA 3IT8D 3RGVD 3K3QA 4AYBA 5IT2H 3FB5B 1Q9KA 2X4SB 3UTZA 2XA8H 3QHFL 4OY9A 4R7XA 5J06A 4GAJH 5EEZA 1E0OB 3A21A 3MODL 2P8LA 3G6DH 4NZRL 4WK0B 4N0RA 4OGQC 4PUBH 5KUMA 3UC2A 1HCVA 5BS0D 3KPSE 3DUUA 4YXLH 1CGWA 1SNRA 5AKRA 5TE4H 1EO7A 3F58L 1N5AA 5GHWH 1I9RH 2VO8A 5DEFB 4F80A 4JPVH 2GJZB 2O5YH 4EVNB 3W57A 4DW2H 4ZFOB 4H88L 1AXTL 5AAMA 2PXYC 5K9OB 4GG6F 2DIEA 2X1QA 3O6LL 4BSWA 3A6CH 2OMNA 3I6KB 1FFQA 1LHZA 3TPUA 3QR2A 5E5LA 4AYGA 5F70A 2XPYA 3QDJD 5E94B 3AVEA 5CFHA 2YC1B 4IMKA 4ANWA 1PCSA 1NFDB 5LGJA 1PZBA 3H42L 1OCZB 1C16A 1CLYH 2AI0H 4ZW7A 3VXME 4R5TA 3U9PL 3UTTA 3LV3A 2XN9B 2B15A 2BSCA 1FNEA 1MJJB 1TYJA 4BH8B 2E59A 4ZUWA 2DN7A 4W81A 4E9YA 1P4LB 1PDKB 2J1WA 3IFOB 5AAWA 5IMMA 3TA3D 3L1OH 1CIUA 1RJCA 1SEQH 3SO3B 4O02A 1U3HC 2PNDA 1RSYA 1QHOA 1D7DA 1JL8A 1ZXKA 2R4SL 4G6AD 1TPXC 3NGBB 1AO7D 2KLRA 1QSFA 2WQWA 1HI6A 5F9WB 2EDJA 4E9RA 4Q0XH 4D8PB 1YEIL 3H8NA 4WLCA 3GS0A 1GGYA 3G9AB 4HXBL 5F1OB 2AJUH 3QJOA 4HHAB 3WHXA 1RLBA 1CYGA 4TQPA 2NDGA 1NGYA 3L5WB 3NZUA 1BEYL 1C7SA 1PG7X 1U93B 3LKPA 3NABH 2CQVA 2VLRD 35C8H 5IFHH 1U3NA 4OZ4A 5C3TA 3U6XS 5BRZE 4PWKA 2J12B 3BKMH 3AT0A 4FYTA 3FHEA 3IPFA 4XH2A 1CGTA 1CU4L 4TLSA 5DSCB 5IVOA 3EHBC 3BRGC 1OAKH 4YNYA 4YHML 2B0SH 5DHVH 1WWCA 3BPLB 3FF8A 2H45A 3ZKXB 2XTJD 3SKOA 1J9SA 2CBTA 1PIGA 4PBWD 1CDCA 1BGXL 1PKQA 4BV1A 4N26A 1LD9A 4YGVB 2D9CA 1RIUH 1VGKA 1V7ML 2NUPA 3VFGH 5DJ0A 4FFZH 1NDMB 4UDUB 5GGSA 4EEEA 2IV9A 4R3SB 5CLZA 5D6DC 5EZOL 5KEZA 2AEOA 3O11A 2OAAA 4FLOA 1DSYA 4YDLC 4I4WB 5INCB 3ZR6A 4IOFD 4JDEA 4O00A 5IWLC 4YHIB 5IT2L 1I3UA 4WUUD 2F54A 5JW4R 3L4CA 4QRTB 4ZNEE 3RL1A 2XA8L 3CHRA 4GAJL 4PJEB 4YDLB 2WKLA 4I0CC 3G6DL 2FEDD 5F9JB 4PUBL 3L3HB 2QPEB 2F0CA 3ARGC 4IGBD 4GG8B 4M1CD 4YXLL 4H5SB 1J18A 4DCQA 2AVGA 5E8OB 5F93C 1IBHA 3ME0B 1F11B 1ZS2A 2EP6A 4W9KC 1I9RL 3MLXH 5GHWL 5IEKA 5AENA 3OD3A 3VM5A 2O5YL 1NBYB 3OJMB 5J6HB 4A2EA 1T21A 1I7TA 1WZ1H 1SVBA 1EUTA 2YFNA 1CTMA 2Z93B 1EH9A 2APXA 4F9PC 4MJ6A 2R27A 1U95A 3PNRB 2YPLA 1INDL 1FGVH 4CNIA 5ACZB 4P4RB 4HLJA 3OZ9H 1E27B 5K9KB 1YECH 4PD4J 4P07A 5GZOD 1HDMB 3FQTB 2X89D 5J11C 2AI0L 3GMNB 4HK0A 3TBWA 3KW8A 4ZX5A 4F7MA 1ZLWH 1KSRA 1KLGB 3C2SA 4FXGC 2WOYA 4QRQB 4N5ED 2W60A 1X7SA 4RBPH 1HN1A 3BGMB 1SEQL 4JFDD 5JHDD 2G0KA 4QHPA 4OKVA 1GZHC 2V3EA 1K2DA 1NFIB 2IVFC 4D7PA 2MOGA 2RBLA 1JWSA 4HGWB 3V6BR 6FABL 1QATA 2K3TA 5DJAB 4TULL 4M8RA 2AJUL 4Q89A 2OYLA 3GMRA 4G6ML 4QXWA 5EU4A 4S0SD 1E4KC 3BSZH 1MCOH 4JAMB 2VDMB 3NABL 3OX8B 2EKJA 5T3ZH 1FP5A 5C0AA 4XGZA 35C8L 3HHSB 4KTGA 5IFHL 3EBGA 3WGVB 2CM5A 3CU7A 1T89A 3CFBA 1HHGB 3BKML 3FSOA 3LN4A 1S8DA 5JOFA 8FABB 2WWKT 1OAKL 2JKXA 2OL3B 1UTDA 4LVOC 2AERT 1OWRM 4MJIA 4L1DA 5C0BB 2GCYA 7FABH 5HYIA 5CR1A 3U4KA 4O9HH 2CWRA 5EF1A 5F3HA 1DJZA 1SY6H 2CA3A 2DQMA 5K1JA 3OQ3B 4X83A 1AH1A 1RZIB 5D1QB 4RDBA 3EGDB 1NAKH 3BP4A 4WEBL 4XN5A 4BFFA 3VFGL 4AKPA 4JDZB 4FFZL 3WFHA 3W2DH 4OZHA 2BW4A 3BRDA 2AXJA 2I24N 4LGPB 4BCXA 1UZ6E 2XKSA 3FQNB 2FAUA 5FA4A 4K7PY 1DVFB 1UURA 3JTTA 4U6HB 1YNLL 3H2QA 3UADA 1B9ZA 2VR4A 4M6NL 2XX0A 4TLUA 3QA3A 1AY1H 1FFOA 4X6FA 1J0KA 1I8KB 1JVLA 2VXQA 1U8MA 3L9YA 2LE9A 3CFKB 1ERNA 4Z7QE 1I8LC 1T66C 1CFVH 4LMQI 3EGXB 1G9EA 3N85H 1FI8C 3SZ6A 4HVBA 3DHMA 1Q9LA 3L3GB 1ID2A 5IOPB 4IHOA 5DRZA 1ZIBA 4HUVA 4ZW3A 1AR2A 3UBXB 3FZUD 1B6DA 3CQFA 1WZ1L 4YR6A 5HDBB 3UTTD 2YOCA 1BA9A 2GC7C 5BJTA 1U21A 3BVTA 1U8OA 4OV6F 3HLAB 4G9FA 1KGJA 3W39A <