5I26A

Azurin t30r1, crystal form i
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
128
structure length
127
Chain Sequence
AECSVDIQGNDQMQFNTNAITVDKSCKQFVNLSHPGNLPKNVMGHNWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEGEQYMFFCTFPGHSALMKGTLTLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Azurin
publication title Determination of nitroxide spin label conformations via PELDOR and X-ray crystallography.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
total genus 30
structure length 127
sequence length 128
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2016-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 5i26A00
2GBAA 1AG0A 2VW7A 1WA0X 4KOBA 2BO0A 4A68A 4KO5A 4G71B 5B1AB 1ILSA 2CUAA 2EIJB 4CSZA 3H56A 1RZQA 1BYPA 1IUZA 4BXVA 4DPBX 1YLBB 2IWEA 1JZJA 2QDVA 5B1BB 1OE3A 3SBQA 1M56B 4E9VA 3BQVA 4YVUA 2BW5A 1OOWA 5TK2A 3CG8A 5FC9A 1FA4A 1AACA 1OCCB 1JXDA 3GYRA 3HB3B 1NIDA 1AS6A 1PF3A 3AG3B 4HHWA 1WS8A 1ETJA 5AFAA 5I5JA 4UF7C 3SBRA 1NIEA 4DPCX 4FAAB 5PCYA 3QJUB 2DWSA 4E9WA 1V54B 2IH9A 4BDVA 2UXFA 3EH3B 3NSCA 1E5ZA 5AKRA 1N70A 4YSDA 3T9WA 3NSDA 2FQFA 3NJHA 1XB8A 3G5WA 2ZOOA 4YSRA 1JVLA 3CVBA 1GW0A 2GIMA 3NJFA 1NWPA 2WO2B 3L45A 3T6WA 1AZNA 1WAEA 1HAUA 2OCCB 1J5CA 2IDSA 1TEGA 1E65A 1JZGA 1QLEB 5I6OA 1WA1X 1ADWA 3ABLB 1NIBA 4ENZA 5EHFA 4NAJA 2YQBA 3QQXA 3QJQB 2GSMB 3SQRA 1FWXA 4E9RA 1A4BA 3PXLA 1OF0A 2JFCA 4NB7A 2PPDA 2XX0A 4DP1X 2HZHA 3FS9A 4A67A 4NERA 6PAZA 1NWOA 3CDZB 4HAKA 4F2EA 1OE2A 2GHZA 3JTBA 3ZX1A 1NPNA 3C75A 4GP5B 3GDCA 3AY2A 3EH4B 2I85A 4E9XA 3SBPA 1PZCA 1W8EA 2AZAA 2PPEA 1A8ZA 4A2HA 4HIPA 2H3XC 2UXTA 4KNSA 9PCYA 2FQGA 3DIVA 3OM3B 3PLYA 1BQ5A 2AVFA 2PCYA 1NPJA 2VW4A 4G72B 1JZEA 1R1CA 4KO6A 1AANA 2BHFA 3MX0B 3ABKB 3T6ZA 2PPFA 4HCFA 4A2EA 2PPCA 5I6KA 4KNUA 1A4AA 1ASPA 1RZPA 2DYRB 2NRDA 4DP7X 4L0PB 1KCWA 2FT6A 2GI0A 1KDJA 1SDDB 1NIFA 1XB3A 4GP8B 1TEFA 2UXVA 1KBWA 3OMAB 3N2JA 3FU7B 3IBOA 3H4FA 3HEIB 4JHVA 2IWKA 1QNIA 1BQRA 1OV8A 1ID2A 2QT6A 1JERA 2IDFA 2YAEA 4GYBA 1I53A 1J9QA 3AG2B 4G70B 1WA2X 2W88A 3S8GB 1TKWA 3QJRB 1ZV2A 3S3BB 3S8FB 1A65A 2FTAA 2B3IA 3TBCA 1F56A 1W6WA 3U25A 5I28A 3WIAA 5B1JA 4WKXA 3NT0A 3WNJA 1J5DA 4GP4B 1AOZA 2QPDB 1B3IA 1KBVA 1NINA 3WKQA 4P5SA 1L9QA 1UATA 3FYEB 4BWUA 1EZLA 2BP0B 1AR1B 1ILUA 1PLBA 3PAVA 4YVNA 2BP8B 3TA4D 2XX1A 3WI9A 1A3ZA 2BZCA 3IN2A 4E9YA 3NSFA 4JHUA 1NZRA 1T5KA 3QJVB 3X1EA 3FQ2A 3X1BA 2R7EA 3PPSA 1AAJA 1JZHA 4YSAA 1OCOB 2EILB 3MBWB 2DWTA 3ABMB 4YSQA 1VLXA 1EHKB 1XB6A 1NICA 3T6XA 3NYKA 1ZIBA 1GS7A 2YAPA 3X2QB 2BWIA 2HXAA 1MZZA 4QKTA 5IY5B 3AZUA 4G7QB 2Q5BA 1AQ8A 1AS8A 5AZUA 3FSWA 3PAZA 1DZ0A 1MG3C 1OCRB 4YSCA 4YSOA 3OMIB 5D4IA 2XXFA 2X88A 1SNRA 1BXUA 3FU7A 4AZUA 2TSBA 3NP4A 1KGYE 2MRYA 1DYZA 2QDWA 2IAAC 2XUWA 5I5MA 1V55B 1PCSA 1CYXA 3FU9A 2HRGA 2TSAA 2X87A 4ZK8A 3T6VA 3UADA 2J55A 1AG6A 1ET7A 4AX3A 1GSKA 1SHXA 1MZYA 2YAQA 3UAEA 4K9JA 4DP8X 3UACA 4BWWA 1L9SA 5TK4A 2XYBA 3CVDA 2PCFA 2VN3A 3ERXA 1J9SA 2XLLA 1AZBA 1JVOA 4N4YB 4G7SB 3FT0A 4YSSA 2Y1AA 4E9QA 2XVBA 2OV0A 3AW5A 2HX7A 2YAMA 5D4JA 1L9PA 4QLWA 1ET5A 1PMYA 4M4RB 2IH8A 1E67A 2BW4A 5B7MA 1ET8A 2BP8A 2IDQA 5LDUA 2FJSA 1V10A 4YSTA 1XMEB 3T71A 2ZONA 1PZAA 2I7OA 4HCGA 4YL4A 4A2FA 1AZCA 4KO9A 4BXSV 2XV0A 5I26A 5B1KA 1PNDA 4TXVB 2PP9A 3OMNB 2N0MA 1ZDSA 5I6NA 4AKPA 1FFTB 1KV7A 3FPYA 2VMJA 4GY4A 3X1FA 1W6LA 3ZDWA 2CJ3A 3NJMA 2YXVA 1RKRA 2CAKA 4KOCA 3NP3A 3EF4A 4PAZA 1URIA 3FSVA 4BDVB 1AZUA 4G7RB 4GXFA 2Y69B 5I6PA 1PLAA 3TU6A 1BEXA 1JOIA 1PZBA 3V9CA 2MTAA 1JZIA 1CUOA 2J57A 3FU8A 2FT7A 4Q8BA 2PLTA 4KNTA 3ZIYA 4WTQA 3AG4B 4HZ1A 3WG7B 1PY0A 3NJIA 4FA7B 2HRHA 3CDZA 2HX8A 3NJNA 3NJKA 4UAHA 1J9TA 1SFHA 1CYWA 5F7BA 1X9RA 2W8CA 4X4KA 5ANHA 1ASQA 2FNWA 2Q9OA 3X1GA 1GY1A 1PAZA 2P80A 4E9SA 2IDUA 1BQKA 1KYAA 4YSUA 1GY2A 3UGEA 4Q89A 3IE9A 3IN0A 2J5WA 2GC4C 3FYIB 1MDAA 2HX9A 2B08A 2YXWA 2YAFA 1E30A 1MG2C 2DY2A 4AI7A 1BXVA 2J56A 6PCYA 2WO3B 4CSPA 4RH4A 3WKPA 3QJTB 1ASOA 3OQRA 2BZ7A 3PAUA 1BAWA 3TASA 2UX6A 3IEAA 1BYOA 1PLCA 1JXGA 3QPKA 4PCYA 4BK5C 1SF3A 1X9UA 4DP5X 2A3TA 2AANA 1SDDA 2HLEB 4P5RA 1NDTA 4HALA 4AKOA 4DP4X 2JXMA 2UX7A 4E9TA 2YAOA 4MFHA 4A2DA 1IC0A 2ZWNA 5B3SB 3RYMA 1PNCA 3OD3A 3KW7A 7PAZA 5I6LA 2FWLB 2XWZA 3ASNB 1RCYA 2FQEA 4N8UA 1M9WA 3X1NA 4DPAX 2DV6A 2XU9A 4AKQA 2EIMB 1AZRA 3H4HA 2OJ1A 2RACA 1N68A 5B7EA 2EIKB 1GS6X 2PP8A 2VSKB 4F2FA 3KW8A 3V9EA 5PAZA 2GB2A 5D4HA 4JKNA 4DP2X 2AFNA 3BVDB 4HHGA 5B7FA 1AIZA 3NJLA 3UAAA 1GS8A 1HFUA 3NSYA 5I6MA 3FSAA 4W9ZA 4A2GA 1ZPUA 4A66A 2XV2A 2LLNA 3N55A 3PCYA 2FT8A 1IBYA 3JT2A 5I5IA 4F7KA 2BP0A 4UANA 2QPEB 1BXAA 3FQ1A 1SF5A 5E9NA 3FQYA 3FPXA 2YAHA 3QJSB 4KO7A 3D12B 1KCBA 2E86A 2FQDA 2GC7C 2IDTA 4DP6X 2AZUA 2DYSB 3EH5B 2CALA 2PP7A 3FSZA 2VW6A 2I7SA 2VSMB 5B1JC 3S3CB 2VM3A 1AS7A 1CC3A 1JXFA 4YSPA 8PAZA 1QHQA 2WSDA 2H5UA 2JKWA 1IKOP 1KDIA 4EF3A 1CURA 1NIAA 2CCWA 1L9TA 2R7EB 4DP0X 3TBBA 1A4CA 3ASOB 3DTUB 2XXGA 1NTDA 1L9RA 2PPAA 2ZXWB 1SJMA 4W1TA 3DKHA 3AG1B 3ABGA 3UABA 1IBZA 1SHWA 1GR7A 4HCIA 1GYCA 1ZDQA 2YARA 1M57B 3CVCA 3WNIA 2BWDA 5F7AA 4BWTA 1ZIAA 3GXUB 2CBPA 1OCZB 4M3HA 3EHBB 2IWFA 2H47C 1JZFA 3ZBMA 7PCYA 1TU2A 3CZUB 2EINB 1HAWA 2XV3A 5A7EA 3NJGA 1OE1A 4DP9X 1SFDA 1L9OA 4YSEA 3NJJA 2UXGA 1E5YA 1J9RA 2VM4A 3S3DB 2P80D 1WS7A
chains in the Genus database with same CATH superfamily
2P3YA 5DUBB 5DD6B 5DEJA 4KOBA 3S88H 1Z9MA 4FFWC 1JMZA 3GSRB 3LNIA 4GAGH 3JUZA 5EG6C 5B1AB 3PQYA 4UINL 2VN4A 4MSWB 2ZKYA 3SOTA 3KLHC 4I89A 1OPGH 4DAGH 4NFBA 3QDGD 1BAFH 1IM9A 2YPVL 4MJJA 3KPOB 4HHAA 1M56B 4OZIB 2Y06H 1YUKB 1RLBA 2A99A 2HB0A 2HT3D 1URLA 4WI5A 5DRZB 2DM2A 2WQ8A 4FXKC 1K72A 4HX1B 2RR3A 5HI3D 4FX5A 3BMWA 3QXUA 2C9RA 3KDPB 4J3XA 4N6QA 3AG3B 3HI1A 1J12A 1TJHL 4JPKL 4PGBB 3VH8A 5LBGA 3FRPB 3DYMA 5ETUA 1A66A 4L4TE 3CFJA 3IJHB 1V54B 4YDMA 3S5LG 5FYKL 4O02A 1CLZH 1BGXH 2O6DA 5FB8B 4ZUVA 3FTSA 2N7AA 3KLLA 4J2XA 1RZFH 5D1ZD 1IAKB 1VZHA 5CD3B 1FL3A 4NUMA 3ZHLA 1EDHA 5I0WA 5T3ZH 1ZHKA 2GIYA 2R9HD 3WE6B 3ZDZE 5I8OH 3BAYA 3EGSB 3BPOC 5L4MA 1F6LL 4L29A 4OGZA 4GRMA 1N0LB 1FVEA 4EI0A 5IHUL 4GKZB 4KTYA 3A4AA 4YHZH 4KY2A 1C8PA 2GK0B 1UOWA 4YOKA 2GY7B 4JFYB 4LRNH 1AKPA 3FFDA 4K15A 3QQXA 3RA7L 3OLEA 4D9LH 4KK5D 5KVFE 4HAFA 3SGJA 2R1XB 3G5YB 3SDXE 5IVXF 5C08E 1TZAA 1AGEB 3AMKA 4RNRB 3CZNA 3TN0A 1DJIA 4D9RD 5I17B 3OKKB 3KPNA 2DQDL 6PAZA 1UM5H 3CDZB 3WS6A 4L4VB 3JBG7 3SB3A 4FCAA 4L3EB 3X3GL 2O6EA 1MCFA 5I1LB 2XQ0A 2ADFH 4MXVE 2VC2L 1K6QH 4JFOA 3PUCA 2H3NA 4WW1B 4EN3A 4HJ1A 4AL8L 1K8IB 4FI7A 5DVNA 5L0QB 2FLRT 1M53A 1PEZA 3C5JA 3VFPA 1EVTC 3J27A 3VFVB 1Z0NA 5C07E 4F9LC 1UH2A 5DT1H 3UFIA 3QDGB 4GQ9L 4Y4FD 2OMWA 4ZXBA 3QPQD 1MRCH 4PBDA 4JPVL 2VT0A 2F18A 5CCKH 1DQDL 4Z7VF 5FCUL 5IQNA 1J7VR 3JV6B 3S5ZA 1KLUA 2Z1PA 5HHMB 3O2DL 4XOAA 4PHXA 1WZKA 4PRIA 4O00A 2NY7H 3Q8BA 4BEIA 1LD9B 1FO0B 1KYDA 3MACL 2GI0A 2X9XA 1SDDB 4RAUA 5DI8B 4EZMA 4DKEH 2JXMB 3UTTE 1X5ZA 3KPMA 3QJHB 1KZQA 5E4EC 3O6LH 1PG7X 3TYFB 2G9KA 3WTTA 2D7TL 4JLRA 5IB2A 3HE7D 2JI3A 3OJDB 4G5ZL 1QNIA 1AGBB 2VDOL 5GSRA 5D1ZB 3ZKND 2CKNA 2BSRA 1SBSH 4QHPA 3VB8A 1Q0XH 5EBMB 2BMKB 4Q97A 4QY8B 2OCFD 3C6EA 4R90L 4XI5C 4D3CH 4GQQA 3B56A 3QDJA 1Z2KA 3QJRB 4JFFE 1TMQA 3MRRB 4N3UA 4PJDB 2W95A 3RWCA 3BZ4B 1AZVA 1UCTA 3L3HB 4OLWH 2K70A 1SDAB 5B1JA 3OKDA 5KYNA 3UBFA 5CN2A 5BW7C 2HRLA 1T1WA 1JJUA 1KXTB 3KPRE 3QFJB 3FUHA 4JM2C 4PRAA 3G08A 5IJBC 3CMOH 5JHMA 2F2HA 3E2HB 4XODA 5JORA 4GKNA 3CHRA 5JIPA 3U4EB 2NXZC 1ZV9A 1K3IA 4XP4H 2HVKA 3RP1A 1MLCA 2V17L 2WXPA 4QRRE 4PJ9C 3WI9A 1A3ZA 1AE6H 3GBEA 3L3OA 3NSFA 1MHPL 4HEMA 3QJVB 3BH9A 3K2UL 3WAKA 4YHOL 3V10A 1DVFA 5KYUB 4HKJA 4KKBD 1OCOB 1MFCL 1DJSA 1GGTA 5D5MA 5E8DH 4PUBL 5J6SA 1RIUH 5LBSH 2HLAA 3SQOH 2DWTA 1OD7A 1D9KC 1WO2A 2CHNA 4A6YH 3CBKB 3NYKA 1T1XB 1AQHA 3FT2A 1JNHB 3BP6A 4X8XA 3D08A 3D34A 4A7VA 5C2UB 2JQZA 1WZ1H 4HUVB 4IDJL 1KGCE 4Z3IA 4KHXL 5EIIA 4W68A 5E8NA 3FH5A 5AW7B 1TVBB 3B8SA 4MX7B 3HJEA 4ZX4A 1EEYA 2JCWA 2VLKD 2ZKHH 4ODWA 4Y4FB 5DS8A 2QMKA 5LXGH 1DYZA 4M61A 1C12A 4TNGA 1JGLH 5HHVH 1S3RA 4WK2B 1VCBC 4ZFOB 1E27B 2GQHA 1XGUB 1K2DA 4KK8C 4WI9A 3BFWA 1KCUH 8FABB 4UT6A 3U6XS 1KEML 4ZUTB 3H42H 3UAEA 1DVZA 1ZHNA 2BHZA 3UACA 3BGAA 3F8UB 1ODUA 2D9QB 1L9SA 2WIMA 3VMOA 4MMZC 3W0WE 3VE0B 3KM1A 1CXFA 1JHKH 4GKLA 1I1AC 3PWUB 5E2VH 3S96A 3GMQA 2J88L 2V5RA 2K4AA 3QEGL 4E9QA 2OV0A 3MJGX 4OIIL 3P77A 1D6VL 1FVCB 2WSPA 1ZHBB 5D93B 3R4RA 4NPJA 4WI8A 5D7LA 5FYKD 4GSRA 4M4RB 1MFAH 2AMGA 4ZNCD 2BW4A 2D03H 3LS5H 4OLYH 3PDOA 1OEZW 4JREC 4Z77B 3OG4B 3STLB 5D8JH 1XTMA 2VERN 2XACC 5D1QC 5MP6L 1K5WA 1CDYA 2ZX5A 3BHBB 4R0LA 1HHHB 1X7QB 2X9WA 4A7TA 1S7TB 5J11B 2ESVA 1CBJA 3BDYL 1OL0A 4TVUA 1OP3K 2WZPA 3SGEI 5DJ2B 3EYVA 4G6KL 4IU3B 5FM5O 4PJXE 5FO8A 1HWHB 4JFVA 1TZOA 4E5XG 4JAMB 3KVQA 4K9EH 2GJ6E 2N0MA 5I0XA 1KV7A 5E1GA 5J3HC 1DFXA 4I4WB 1J0IA 3IMTA 5DEGA 5DF0A 3I9GH 5JQ6L 3B7SA 5C70A 1VZIA 3N1PC 1Q4NX 4AYDC 5DC0A 1DCLA 3NP3A 3MRKB 4E41D 2CO6B 1CFQA 3OXRA 1MKFA 4D2NA 1UKTA 1LO3H 2XIIA 5SV3A 4G7RB 1LP9A 5JDSA 4OUUA 3DGCR 2FIRT 4BKTC 4GAJL 4F7CA 4GIPD 3MJ9L 3V6OA 2MTAA 3DTDA 1IV8A 1U8KA 4KI1A 4FTDA 2YD5A 1RZIB 3CSYA 5JNYA 1PVHA 2EYTB 3BUYA 3RWHA 1D7DA 5EC1B 4WNJA 1CR9H 1XH1A 2B8OT 1KSRA 4UQ2A 1DDHA 5AB1A 1E6OL 3KYOA 4ONHA 2WN2A 4PY7A 2HRHA 3HHRB 3JVFC 4M9OA 3DLQR 4Y5YB 4ZODA 3TH4T 4KZCA 3LKRA 3V0VA 1UJTA 3NPSC 2VLKB 5T1KD 1QLRB 3DC0A 1IFHH 3W82A 2E7HA 3ZVVA 4UCFA 3X1GA 3SBWC 4ELDA 1ZPLA 5EZIL 2GY5A 3LKSB 3Q2CA 3X12A 3TBSB 3QEUB 1TCMA 1X5YA 2IDUA 4D0DB 3U6RA 4OGAD 3QH3A 3KWWB 3IN0A 4OW6A 2GC4C 3HS0C 1YN7A 4UTAH 5T5NF 1A8JH 4QTHB 1GC1L 5I6XC 3AQYA 3VXNA 3AAZB 3ILQD 3WEOA 1NCHA 1S3KH 2OM5A 3GF8A 1U3NA 2GFBB 4Z76B 1BJ1J 1XGRB 1W0WA 3QJTB 4KVCH 1KCKA 2OBGA 4P2QE 3RWGB 2CBQA 3W9DB 3ZT6A 5KVDH 5IWLA 2ED6A 3GBMH 2R1WB 4OFPA 1JXGA 3FO9B 5DJ6B 5C7ZA 3ZSSA 1QASA 3MBEC 3BSZL 4QEGA 3VA6A 3ARGD 3EZJB 1NUNB 3PABA 4AGPA 4R8WL 4G8EB 4ALAL 4ZO8A 3MLRL 2NLJB 1XR8A 2IADB 3PWNA 4TVPH 1RCYA 1AQKL 1NEZA 1P7KB 3ARBC 4I3SH 3GLAA 4Z7NF 3WLBB 4CNIB 5LUMA 4HSCX 1VFAB 4YO0B 2UZYB 4OR1A 5JHLL 2EDWA 4DN3H 3ROLB 3L4ZA 2J1YA 1ZHLB 1LDSA 2YD6A 3MUY1 5F88B 5LQBL 1E0OB 1S5HA 4QGTA 2EABA 5EO0A 1T0OA 2JJTC 4UV4H 3KAAA 1FFPB 5I82A 1G4RA 4E41B 2ZYRA 3EYFA 3QHFL 4HHGA 5ISZA 4H8VA 4CBPA 1YDPB 4PLNC 1AIZA 4Q4IA 5DJYA 1TF4A 4HS3B 4UM9A 4NZDA 2CK2A 1ES0A 4Z23A 4AJYV 1TQSA 3L2LA 1E9OA 1F2QA 5F8RC 4GS7C 4MD4B 1C5BH 3JT0A 4PI2A 2GBUA 3RL2B 2PTVA 1CXIA 2XWTB 3NACL 5T3XE 3FQYA 4PTTA 4KQ4H 3M07A 4S2SA 1HHJB 2CMRH 2YA2A 1XH3A 1S9KC 2P26A 3L3DB 4IRZA 2VC2B 3APCA 4XRCB 1DVXA 2AZUA 2BSSB 5JXED 3MJWA 4KY1H 3NIGE 5T1KB 3LTVA 3MLZH 3FSZA 3Q48A 4M6NL 3S6CA 1EMTH 3SGEH 5J6GB 1NFDF 3BAKA 1F4WL 3VM5A 2H2SC 5H94A 3LHPH 3LN4A 1DFBL 5SWZD 1OGTB 1UZ6E 3Q2NA 3ZY7A 3CDYA 3WFHB 4OBSA 5F2FA 2KZKA 1TG8A 3Q6FB 3BN3B 1H3UA 3IETB 4X6FB 4JY5L 4QPEA 5GGRB 3NUKA 5CZXD 4FHBD 3Q13A 3ZE0E 4ONGL 5CJBA 3DTUB 4FQ2L 1XF3B 5JR1L 2KERA 1NTDA 2ITFA 4OCYL 3N9GL 2EO1A 2GPZA 4UUJA 1SHWA 3O6KL 1D3CA 4UQCA 4RGOH 1U42A 4MQXD 3S8WA 5E08H 4BA0A 1ADQH 1T2XA 3AWGA 3AY4A 5F93C 3N91A 3P11L 3X14B 3S37H 3P0YH 4XPGH 2WVTA 5C7XH 2XV3A 4K55A 4APXB 1CF1A 2NR6A 5DFVC 2VDOB 3BIAX 4RGNE 1XXFC 3LPPA 4L2YA 2WYIA 4K23L 5C0BE 5IG7B 1TEYA 3ARFC 4Y4HD 1KEGL 4WW2A 1EAJA 3WUWB 4ODSL 5FECB 2VLJD 2FSEA 2GBAA 3RWEB 3E0GA 5F6IB 3L3IA 1UYWL 3QBTB 1KN4H 3MV7B 2DJ4A 4XVOA 3D69B 2HTLC 2CUAA 2YPLA 3D50A 3NA4A 2R2EB 4IKLA 4P3DA 5C0DA 1RP8A 2FEEI 3IMRA 4LLDA 1MN4A 1RIHL 4JL1A 4LPWA 5DVLA 4N0CD 1G94A 1UG9A 3Q8AA 3MUGA 3VWKA 4CU8A 1LMKA 4XNMB 1BBJB 3QORC 4RMWA 4N2NA 4J3SA 3PHQA 3GYRA 2AJYL 5LGHH 2EE3A 2CO7A 2DLFL 1YYMH 1PF3A 4WSJA 5I9QB 3O4OC 2AV7B 4XPTL 2KT6A 4ZX6A 1Y1UA 1AO7A 3UPCA 5C07D 1MCKA 4F7TB 5MEND 4HISA 4QRPE 2F5BL 4B9GA 1OANA 1IKFH 3B2UC 4KJWC 1L7TH 2HJKB 4HA1A 3P2BA 4M48L 3HC3H 5I1HL 2Z34A 1AFVL 4N24A 2NQCA 2X4SB 4F1ZA 4KXZI 3LH2H 5G4NA 2QVKA 1DANT 4NN6B 3WOVA 1HL8A 2OSLA 4RRPA 5SWZB 3NJFA 2FBJH 3GLDA 3QXTA 5CIPA 1J8RA 1OM9A 3MRNA 1LNUA 3CPUA 2P47B 3L5XH 1K4DA 4EQ2A 4L3AA 3IDJA 1E65A 4KMTL 5AVWB 2VAAB 4J27A 2KBGA 1GGBL 4AQOA 1BBDH 1SJEB 2J1XA 4HFUH 3VFNA 2X1QA 1NGXA 1TSHA 2E3VA 3CFMA 5KJRH 2C1OA 3SCMB 1KXHA 5CKAA 1U36A 3CJJA 3HR5B 3H3KA 4NFDA 1HWGB 3OQ3B 1S9XB 3LDBC 2R0WL 3UJIH 5D2NC 1G0XA 2F8OA 4S1DC 3V9EA 4FG6D 3L16A 3SKNB 2DQIL 4XB7A 2EAEA 4JDEB 5IR1A 2DIAA 1NWOA 7TAAA 1R3IL 1T22B 4PI0A 2K45A 4Z7IA 1MNUL 3ZX1A 1LGVA 1E7UA 1FNSH 2H6PB 3GRWA 3VWJC 4Z7VE 1VESA 3NQIA 4Y4HB 5BZWB 1W8EA 1B88A 1O7DE 1H9DA 4GXUN 4C83B 5GGUA 2H3XC 3RAJL 3MLTA 5FYLE 2IMNA 1AI1H 4MAUL 3D0VB 2E4TA 5E2UL 1QTPA 2NZIA 2UZPA 1T7YA 2WJ5A 4M9PA 2A6JA 3Q9PA 3FQRB 1WTGT 4OCLC 1CLYH 3TBWA 3MLSL 2OXHB 1P4IL 1TO4A 5EDXA 4E2OA 5J5EA 4F57H 4L8CA 3QUZA 3MODL 4H8UA 2QELA 3QC5X 2ZUXA 1E28A 2HT4D 4WO4C 4ZG1A 5CGMA 3BWAB 1JPEA 4IBLT 2X6BA 4MLSA 3I6KA 4O2FA 1WUZA 4X4XA 3VD3A 4KWUA 3CUPB 4OF0A 3A23A 4M7ZC 2BSTA 4NWTL 5MENB 2X4PA 3TLRA 4JHAH 4GG6F 4LZKA 1K8DA 1BQLL 1R0AH 4LP5A 4OY9A 3MSPA 3R7QA 3ARQA 3SPGA 1XFPA 4CRPA 4WWKD 2CRIA 1NAML 4TSAH 2APFA 4JFSA 4K8RC 3H53A 2NW2B 2YHGA 4KZ0A 3WTWA 3J07A 1LEKA 2VSCA 3NZUA 2BX5A 2QVTA 3KYAA 2D7NA 2WUCL 4NUJA 4EZKA 4J4PC 1XEDA 1B0WA 5DZNA 5AVSB 2WGNB 1W6WA 1FZKA 1OM3L 1P5UC 4JFUA 3EO9H 3WIAA 5F3BA 3NT0A 4LEOB 4TULL 3PWJB 3TYGL 3MA7B 2N0KA 3AU0A 2XYCA 3HG2A 3MRFB 4O4YL 5D6DA 3QDMD 4HV8A 1NCJA 4HSAC 3VFTA 2Q76B 3O8XA 4Y2DA 3KYNA 3ASWA 4E0RB 2UWEB 4YEEA 1KPRA 1XWVA 1Q72L 2BVTA 3EGDA 1GOHA 2G2RA 5C09E 2OQJA 1LL1A 1IBGH 2QSTA 5LDSA 1TITA 3WTUA 3VI3A 4WV1C 1T5KA 3X1BA 2A38A 1QBAA 2CIKB 5JW3L 2R7EA 3T0EB 1KY6A 3VFGH 3NA9L 4PVMA 2YXFA 2VZ3A 2OZ4H 1S7UB 3QUYA 1A7NL 5JPMA 4OQTH 1XB6A 1JYWA 4PB9L 4MA7L 2XY2A 1I3GH 4W9KC 2VN7A 5EF3A 3D48R 1NM9A 4QKTA 3MOBH 5DTFA 4FMVA 3TTSA 3P3RA 2C8NA 3C5SB 3JWNC 5E94A 2A5UA 2C4FT 1QP1A 3HZKA 1B2WL 4HD9A 1KPVB 4XVUD 4YSOA 4WFFE 5TE6L 2KPWA 5HGBA 3VFUA 1OSPL 4TYUA 3L7EB 1E4KC 4H8WC 2EEAA 1XBDA 5I5MA 1F1GA 1IZKA 4RAHA 3T2LA 3ZQWA 3I75B 3QNYA 3BD3A 2Z8WC 3GHBL 3PNWA 1JYXA 5D1QE 3FQXA 1RUKH 4LBAA 4XP1L 4YDVA 2UYLB 1THAA 1IL1B 3CFQA 1IRAY 2YAQA 4G8FA 4XPHL 5LB1A 5DJ8B 2P5EA 4DKAA 2J8UB 4WU5B 1BMWA 3MLVL 1QKZL 2V2TA 5DJZB 3OAUH 3QIUA 2ZG3A 1N9PA 2IOIA 4HCRH 2FX7H 4F7EB 1FLRL 1Q9OA 3UZQB 3LIUA 4X6CF 3DVIA 1MF2L 3UIZA 3GTTA 3AADB 4MNGE 5AOKA 4JRYA 5ITFB 1A4JB 4CSTA 5A16B 5IZ7A 2ZT9C 2YD8A 5IKCB 1N8ZB 4FQCH 5GGQH 4XGZA 1RMFL 2FATL 4LVNC 4YL4A 3EOTH 2VR7A 4PHZA 4UTCA 4PLKC 4PWHA 4WNSA 1NMBL 1SUHA 1HSBA 1T20B 4MJ4A 4P2QD 3HI6L 5KSAC 3BAIA 3B8YA 3QDMB 3K8LA 5C0JA 3VRJB 1ITBB 2K0RA 5LGYA 1Y1DA 1RZ7H 4POZD 5I1CH 4DGVH 4EI6A 2FGZA 4HJ0D 1DN0A 3GI9H 2XZQH 5L2KE 1KJ3H 4GLRI 4CVZB 1OKEA 1NUDA 2QSQA 3H0TB 2IQ9H 4HS6B 2EXSA 5LBSA 1PZ5A 4WGKA 5GRWA 1BMGA 3RGVD 3J8F7 1E8WA 4DTGL 1BEXA 3MNWB 4A6YA 2FK9A 4MZ2A 3EOAB 4JB9H 3NIDB 4HJGA 5FHAH 3U0PB 3E8UL 1QSED 4GBXA 4XN8A 1A3LL 3Q1SL 3IJSA 4GKOA 4P9MH 2BNRD 2FBRA 1Z1WA 1GHFL 4BZ2H 1YEDA 3CQQA 1MREH 3AABA 3DUSB 5TQ0L 3SGKA 3NCYP 4GRLC 3FU6A 4V2BA 3MKGA 4U3SB 2QFRA 4NCC2 2CU9A 4FZEH 1VPOH 3WELA 1F2XK 3CNKA 2AQQA 2QKIB 3MKKA 4EO5A 2G9HA 1IAIL 2Z4QA 3FMGH 2DQGL 1JXKA 1ZT1B 3H8NA 4MJ6B 2PXYB 4Y4KC 5DHEA 1KYAA 43CAA 3M7OA 4QWWD 3RG1C 4Q6IA 1OF2B 5IBTH 3UGEA 1OW0C 1BVLB 4LLQB 1B6UA 1P5VB 4GQRA 4N28A 4P2RE 2AXFB 1IJNA 3NN8A 3ARWA 1NEPA 4Z7NE 3ARYA 1IM3A 2RA1A 2FECL 2V37A 4FS0A 3ZKMD 1HQRB 5DFAA 2PETA 3M1BA 1ZGLA 3KXFE 5SX5K 3RJOA 4AEIL 5ADOL 4GSXA 2MCG1 3WJLA 1OB1A 1MEXL 3DSNA 4XC3L 3RVXD 3VVWA 3ZTJG 4P4KA 5AW5B 4UMSA 4A2DA 3GMNB 5DHXB 3VRIA 3RUGF 3RLSA 1SN5A 3EUDA 2BSCA 5I8EA 2YWZA 4JDZA 4IRSA 3QPXL 4DPAX 3U9UA 3VCLB 3GO1H 1WT5A 4X7SH 3IKCA 3EJRA 3KLHD 1MVFA 1WSST 4UOZA 1N68A 3A4DA 4W9EC 3U9PL 4E42B 3MJ6A 3HNVH 2K9FB 3KYMB 4XAWH 2NDFA 3RZCA 1TYEB 4PJ7B 2DI8A 5FUOL 2ZCHH 4JK0D 2BVUA 4ZPTB 1SDYA 1BZEA 1AXTH 1UCBH 3FQTA 1N6UA 4CW1A 1GS8A 4YR6B 1JZ3A 3BX7C 1NFDE 1WBXB 1EA9C 4OZHA 2AJVH 2XV2A 3M86A 1QSEB 1PLGL 4AEFA 2PF6A 5E6IA 1I7RB 4AH2A 5I1DB 4KGJA 5JXAH 3T4AB 2QPEB 3LNGA 4JO3L 2DTML 4AMWA 4YLCA 5CEZL 2BNRB 4XVTL 1G0YR 1W72L 3FQWB 4ONFL 5E7FA 1KCBA 5HGAB 3VD7A 3WFBL 4O2EB 3V5HB 2WBJC 4XMLH 5DD0L 3SY0A 1SXNA 2CBOA 1TQUA 3CH8A 1X5JA 2QQLL 3PWPD 2ZWLT 4XO5A 1R75A 4ICWA 4WUUA 1MJ8H 3DHUA 1NEZG 4NQUA 2YSSA 1W2KT 4UTAA 3K2KA 3DYPA 3G6JA 3HFML 5GRZA 5LO7A 4MNHB 1JXFA 1J0ZA 3F7QA 4P2CG 4AJVA 1B4TA 1S78D 1EEZB 3T2NL 2NYKA 4UDTA 2IQAB 4L8BA 2WYHA 1E5UI 1YY8B 4BCXA 4WRLA 2L8AA 5IFAH 3GXMA 1MPAL 1I9IH 3AG1B 1CD1B 4L2LA 3UABA 1IBZA 2AMUA 5FGRA 4HCIA 3MN8A 2GSIB 3ZYOA 1GYCA 4H8PA 5DO8A 4I9XA 1YMME 2BRQA 4XH2B 5E5RB 1F18A 3O45A 4LSUL 1SMAA 4F2ME 4BH7A 2FWSA 2GK2A 4QT5A 3AREA 3Q0HA 3QT2A 3T65A 1KNOB 2J44A 3NCYS 4A2LA 3CX5J 1NAMB 5CJQL 1OE1A 5AAMA 2R4RL 3DECA 1A7RL 2YPVH 3EJQA 5E23A 1N59A 5FA3B 2FO4A 2R23B 3Q7JA 2NNCA 4Z0XA 2NSQA 4O51A 2XY1A 3RY5A 3IGAB 5J7CC 1K9TA 5A2JH 4FADA 5KJ7E 3SDAB 1HH9A 1TJHH 4OD3L 5IMOA 5LGJA 4A7GA 1BYPA 1G43A 1NLDL 1FG2A 3MRDB 5FYKH 3TEXA 4WQOA 1UD6A 2JCCF 4YVUA 4DUWA 1ONQB 5JW5B 3RVVC 5FC9A 2XTJC 1AGDA 2EE9A 4ZQTA 1U8HB 3L3GB 3BOVA 2EDEA 3MUHL 5HHXL 4ZFZA 3GTVA 1UUNA 3SDDD 3DRQA 2H3KA 1JNNL 3C8DA 1C08A 2O5XL 4PJCA 4YHIB 3EJTA 1WC7A 5D2LA 5IHUH 3MVSA 2OMVA 3BP5B 5ANMA 2ZUQB 1ZKAA 2XKNA 5AKRA 2WTOA 4PGZA 4YSDA 2XWBA 3MRQA 5D2NE 3PWPB 3NJHA 3RA7H 5JIKA 3UEZA 3BPOB 3TNMB 2EZ0D 2ZUWA 4JFTA 4PWKA 3RDTA 1ZVYA 3E9TA 2F7IA 3DRTA 2EDRA 4U6TA 4L1DA 3QI9D 1DVQA 4G42A 4LGSB 1IEAA 1M05A 3TZVA 4FTVD 1TEGA 1IBFA 3OJ2C 3QQ3B 1XCWA 4JM2D 3K0YA 1CXHA 4PJBF 4EVNB 5AD0B 5FF6A 1MCIA 2P8LA 5J8OA 4ELMA 3X3GH 2FJUB 4XCEB 4OFVA 2DM4A 3I6LE 2NXZD 1NBVL 3IFPA 2VC2H 3U7WL 4XXCA 2A2QT 1Z3RA 2BVOA 1BD2E 4AL8H 1ADQA 1OF0A 1ZA6A 2JFCA 3C12A 4HIXL 2DBLL 2G30A 4NERA 4G8GA 3EYOA 3RIFF 4LQ1A 1EIBA 2ZUTA 5LG6A 1HXMA 4GQ9H 2ZNWA 1ZXKA 5ADPL 2DEYX 1UUSA 1IGYB 4TNFA 5KS9B 5I8KH 4JPVH 1O6SA 3FOLA 1DQDH 5FCUH 1PZCA 2JB6B 3P9MA 4LDEB 5JTWA 4KBPA 4JFHE 2YKKA 3FUFA 3MLYL 1VERA 2CHWA 2XWXA 3G04B 3O2DH 4RRPG 3HC2A 5C09D 3OZKA 4C8XA 4R96B 3TS8A 1IAOA 1NMAL 2AGJL 4NC0B 3MACH 3N3EA 1PEWA 4XAKE 2VQ1B 4JFED 1D7CA 1R1CA 1HOEA 4ODXB 4PJAF 4Y9GA 5JPNA 4GG6E 2VUOA 4XP5L 3UTSD 1P4UA 4KK8D 5GZOA 2D7TH 2DQFB 3AT0A 4F1SA 4G5ZH 1UB5B 2VDOH 4KAQL 4CVWA 4IRJA 1FFOA 1A4AA 1I7ZA 4AQ1A 2B59B 4PWEA 1XF2B 2EDQA 4U1HA 4PY8J 4QIRA 4R90H 3SDDB 2C9SA 4OLUL 4C56A 2FX8H 3BWSA 4WFFD 4LCIH 3ZHFA 4AZ8A 4PD4K 5IOPB 1U95B 4NZUL 1G7QB 3LS4L 3TPUB 4WKZB 1Z7JA 1GW6A 4RDQF 5C9JB 5CEZD 1G9EA 4LCWA 2Q20A 2CO3A 5KVEL 6TAAA 5IMKA 2WXRA 3F5WA 4AM0Q 3F58L 1SM3L 3RIAF 1I53A 1CFNB 3QI9B 2V17H 1CFSA 5IBLC 2Q8BL 3FULA 3PAYA 5IHHA 1SYVA 2FTAA 3LN5A 1MHPH 4JM2B 4QO1B 3U25A 3K2UH 4UZSA 2FD6L 4YHOH 3RTLA 1MFCH 2XN9D 1JWUB 4PUBH 4F5CE 2NXZB 3A21A 4I13B 5FX3A 3H9SA 1JYNA 2AV1B 3MJ8B 1G5GA 4NZRL 4RAVA 3UYPB 1A1NB 4RBPK 4IDJH 3FB5B 3GMRA 4KHXH 1MJJA 3NZ8A 3SGJC 1B0GA 4DQOL 5EFIA 5GS0C 1YN6B 3CC1A 1E5BA 3L95B 5KSVB 1WF5A 5D7SL 3AXHA 2FEDC 1NZRA 3I9AA 4U49A 1GGCL 3X1EA 2Q3XA 2NTSP 4AVKA 2H8PA 1NDMA 1BIHA 4CBZA 1QBLL 1I4FB 4ZDHA 5C0RL 3WS6C 4P9HC 4CC0A 1VLXA 4R7NB 4HEPA 1NICA 3CXDL 4IK7A 3T0VA 4ABQA 3IF1B 4KV5F 4LNRA 1NMCC 1GPOL 4PRPA 1FRGL 1C7SA 1KEMH 1VGEL 3AB0C 4U6HA 4JFEB 3VNYA 2JIXA 3ZE1B 4LGRB 3UTSB 5HVFB 3DOIA 2H32B 1CFTB 5CHNB 5GSVA 5HHNB 4I18B 3ZK0A 3QQNA 4PJ8D 2J88H 2IAAC 1MI5A 3QEGH 2W9LA 1PCSA 1CYXA 1D6VH 4OIIH 4ZXBC 1NJ9B 4MRCA 3N44F 2WV3A 2VO8A 5DUBA 1F58L 5DD6A 5JW4R 1X4XA 4MAYD 3GSRA 1KGWA 4HJEA 1A6TB 1MW1A 1RZ8B 3LH9A 2EDNA 4GH7B 3IRCA 1H0DB 2QKSA 4K9JA 5E2JA 5E4AA 1PQZB 3F65A 3KGSA 3BDYH 3O4LD 4G6KH 2FH8A 4OZIA 3KPOA 3ZHKA 1W91A 4I1RA 4NP4L 4Y1TA 3MBED 2Y1AA 4XN2A 4TQ8A 5GGSB 1W72B 5C0AD 5DRZA 1RSFA 2DKMA 4QLWA 1L9PA 4K94C 5DZVA 4NRZB 3CVHL 4ZUSB 5JQ6H 1MW2A 1TTUA 3VJ6B 2J1ZA 4PGBA 4ZOBA 1H6UA 4J5VA 3FRPA 5BXFB 2ZXQA 2WXGA 4HMEA 5T1LD 3ARBD 1U8CB 3IJHA 1IQWL 1J86A 2AERT 2OMNA 1F42A 2XN9B 5FB8A 5E6ZA 4ADJA 2JJVA 3MJ9H 1H6EA 4HETA 4R4FL 1IAKA 5CD3A 1NC4D 4JRWA 3DX3A 4K5LA 3U1QA 4NWUL 2NY1B 3MMEB 3X1FA 3ZHNA 2CIIB 4KPHL 3WE6A 4YH6A 3EGSA 3S36X 2DOCA 5JW4M 1N0LA 1E6OH 2RB8A 2Y6SD 1URIA 5D96C 2ITCB 1CG9B 4NKMB 4CC1A 3HLAB 2F8IA 5IW6B 1AZUA 4GKZA 4XE5B 2FUTA 4MTMA 2GK0A 1JOIA 1GMIA 3L3OC 3K6SB 4WI7A 5D5MF 4HLEA 3QZMA 1DJHA 1DVFC 2ZCZA 5EZIH 2PWEA 5DD1H 2R1XA 3B7RL 3G5YA 1T04B 2HYMA 2CR3A 1N67A 4O58H 1AGEA 4KUCF 2C9VA 1CL7L 3TXAA 5KBPA 2A83B 5I17A 3OKKA 4LVOB 3G5VB 3OSVA 2H2SD 3CDZA 1G7IB 5E00B 3ARSA 3HG1E 4L4VA 2P49B 3NJKA 2Z8SA 4J3TA 1CYWA 3P9LB 4L3EA 4NQEA 5F7BA 4Z7OB 4FKEA 3NTCL 3VXRB 5I1LA 5EU6E 4GINA 2Q9OA 4PJ8B 5ALCH 3ZOAA 4ZTEA 1ZLEA 4WW1A 1WGOA 3UCRA 3T0BA 3KEDA 1K8IA 2DQHL 2IPUG 5JZ7D 5C86A 4MAYB 1GY2A 4NGHL 3BSZH 3VDCA 2B1HL 4M3JA 3U46A 5ESQB 2BRRL 1ZLDA 3W37A 4FQJL 3VFVA 4ZUUB 3RWJB 4IEFB 2J56A 1E2ZA 4R8WH 1D5ZB 4ZO6A 3RUGE 3V4UL 4ALAH 1JBJA 3MLRH 3QDGA 1OP3H 3O4LB 4CU7A 2A9CA 3FTVA 5DMIL 2OPCA 4XMWA 1AQKH 1TQTA 1A9BB 3RWFB 4KRPD 5C0AB 3JV6A 1GRWA 2NY0D 2Z35B 3TV3L 2WOYA 2Y7QB 1G4MA 2V9RA 2RCSL 2MQ3A 1G9HA 1A64A 1LD9A 3GBDA 1FO0A 5H37H 5HYFA 4DP5X 3HB3C 3ARFD 1SDDA 4QJ4B 2KKQA 1CS6A 1UZGA 3QHFH 2XQYK 5DI8A 2B0SL 1KBPA 5T1LB 2JXMA 4E9TA 3TYFA 4MVBC 4U3CA 2NY2C 5K33A 1CWVA 4IOIB 4PVBA 4FFYA 5D7JD 3OJDA 4R0LC 3LRSB 1AGBA 1FGNL 3DJ9A 3HG3A 5D1ZA 1KCRL 5B39B 5CZVL 4HXBL 3NACH 4S10A 2XWJB 5KVGL 2BMKA 2X4QB 2L7EA 4QY8A 4MB4A 2LW3A 5K59F 3MRRA 3IDIA 1XGTB 4OZ4A 3BZ4A 2QR0B 3L3HA 5EEUA 1LP9F 5CCHE 5HJGA 4M6NH 4WTZG 2A7BA 2X2IA 1AY1H 1KXTA 1F4WH 3QFJA 2C9QA 4W9ZA 2FHBA 4BZ2A 1DFBH 4P4RB 4M7LL 3GC3A 4KJWD 3QQDB 3B2UD 3GSVB 1BXAA 3U4EA 5CJ5A 2D31B 3L8QA 4XPAL 1ZVHA 2YAHA 1U9KA 4MNQE 1J48A 4XX1G 4JY5H 2C3XA 3SKOB 5F9OH 2MSPA 3PREA 4ONGH 5JR1H 1NUGA 2DS4A 2IFFL 3CN4A 4AW4A 4LCUB 4OCYH 3N9GH 5AVQB 1BIIB 3O6KH 2E9WA 3UTQB 1MVYA 4Z3GA 3CVIL 4X50A 1T1XA 4Z3JA 1JNHA 1CC3A 1U33A 3P54A 4XMXA 3DV4B 4HUVA 4CJ1A 2JKWA 3OKOB 5FGSA 4L48A 5A2FA 2YD4A 2CCWA 1CD0A 1OTUD 1TVBA 3B9DA 3HHSB 2R39A 4MX7A 5FDYA 1M1XB 4JFPB 4K23H 1JZDC 4S1DD 3PPEA 4Y4FA 2JJSC 1ZT4A 5GS2D 1KEGH 3KG5A 1H6TA 1GR7A 5CGYC 4ODSH 3VW3L 1OAQL 4KRPB 2W38A 1PZSA 4F7PB 4ZFOA 1E27A 2NY0B 1XGUA 4M3HA 3V4VL 1H15B 8FABA 2WD0A 3FO2B 3SSGA 1WFIA 2X42A 3IT8D 5IWLC 4AUUA 3ZBMA 3ARFB 4ZUTA 1CFMA 2XVLA 1RIHH 3C60D 4JKMA 5K9QI 3GT6A 3DUHA 2JCCE 4GOSA 4PRDB 3EBHA 1KTRL 3OGCB 3VE0A 1KXQE 4XB8A 1HCFX 4XN9A 3KGTA 3PWUA 5D7JB 2HPTA 3IKKA 2PNDA 3HAEH 3IDGB 2FDBP 2AJYH 1VFUA 1LILA 1FVCA 2DLFH 1N6QL 1ZHBA 4Q14A 3R8QA 4XPTH 4M4RA 4YHMH 5JIIA 2PTUA 4FLHA 4GG8B 4MD5B 5C3TA 4Z77A 3V4PL 1ZS2A 4N90E 3STLA 2F5BH 5FEBA 2AJZA 5IFHL 4WO4D 1HHHA 1SQMA 1X7QA 1S7TA 3FC8A 4M48H 3AQXA 5DJ2A 4IU3A 4Y5VB 5I1HH 1AFVH 1OOWA 3O4OB 3CG8A 2BIHA 1MAMH 2ZWSA 5BS0D 3NG5A 3KDMB 4KVNL 4A7SA 4KDVA 1FH5L 1VIWA 3GKZA 3MYJB 4I4WA 4I0PC 3LY6A 1SYSB 1KXVA 4KMTH 4PJBE 1GGBH 5DFTA 5PCYA 3QJUB 4GIOA 3BIBX 3MRKA 2CO6A 1WFMA 2IH9A 3ZKQD 3O2VL 3UMTA 2BS8A 3C9NA 5F1OB 2AJ3A 4N8VB 3VD5A 1UWGL 4YSRA 2HTKD 1IARB 3A67L 2R0WH 1LE5B 3QZLA 1RZIA 1RY7B 1HDMB 2EYTA 4TQEL 2ZICA 2DQIH 1SRDA 5EC1A 1YRKA 2WQVA 4FDWA 3FUMA 4MA8H 5I6OA 2PW1B 1U4FA 2QFPA 1FIEA 1R3IH 2NCMA 4LCCB 4Y5YA 4OB5L 2ERJC 1MNUH 3D09A 1HINL 4PQXA 1SLUA 2VLKA 3DPBB 1QLRA 3WE1A 3VUAA 4AE0A 2BNQE 1UKSA 1XV8A 2GJRA 2UZIL 2IV9A 2E4FA 1ZJAA 3DHMA 5F7DB 1FWXA 4L23A 5M94B 4I9WD 3LKSA 4MAUH 1PAMA 3PXLA 3QEUA 3TBSA 2VLRD 2OTWB 5EF0A 4HKZA 1L3NA 4H2AA 1SLXA 4LSTL 3KWWA 3PQYE 4IBZA 1KOAA 4XXWC 4PJAE 5DO2C 1GZQB 5E2UH 3DUUA 4X83A 1RULL 3KPSD 1NOFA 4QTHA 2FYVA 4N9GB 5AB0A 3C60B 3AAZA 3AY4C 4Y1AD 5C0IB 4IM8A 3OAWA 3MLSH 2GFBA 1P4IH 3CVHB 4M03A 5LAPA 4Z76A 1XGRA 2NR6C 2ZYHA 5CLYA 3RWGA 1XDTT 4HIPA 3S48A 5EZOL 4WW2F 3W9DA 1T7XA 1T5WB 2IPKB 9PCYA 1WZLA 4IBSA 4WW2C 2WKLA 2R1WA 5IB1B 1KGIA 3FO9A 3N1FC 3PJSB 5DJ6A 4L9LB 4ZW3A 2KDYA 3APMA 4NRYA 3HZYA 1SN0A 1TJXA 3LKPA 5HYSG 1BQLH 4XNYL 3ZE2F 1BVNT 1UGKA 2VDLL 4G8EA 2PPFA 2O26U 2NLJA 1NAMH 2PWGA 2IADA 1I8LA 2FHFA 2X89D 1P7KA 1E8YA 1RJLB 5BS0B 3WLBA 4CNIA 1VFAA 4YO0A 4KKCD 2UZYA 4M7ZB 1UWFA 3VWKC 3RWIB 3ROLA 5F88A 1ZHLA 4DP7X 2WUCH 3IB4A 4YE0A 1T66D 5LVEA 3PYCA 1FFPA 1JPTL 4E41A 1OM3H 3OMAB 3VX1A 2ITDB 1YDPA 2DKSA 3FU7B 4PV1C 1HNFA 2DF3A 3H4FA 4TULH 3TYGH 5IJCC 1AHMA 4HS3A 4O4YH 5AUMB 1UT9A 1XVSA 1IAII 1PY9A 3D39D 1BQRA 2QT6A 3V6ZA 4NP9A 3VXPA 4N2HA 1PX3A 4LEXL 2GSGB 1Q72H 3QYMA 4MD4A 2F7OA 4OCNC 3VGGA 3RL2A 4PW9A 2XWTA 3P69A 4TL5A 3QJFA 1BWWA 1R19A 2EIBA 3CSBA 5KSAD 1HHJA 1CDGA 3BT0A 3L3DA 2IBZY 3SGDI 4F24A 5FKPB 5JW3H 2Z8VC 4XRCA 2ORBL 2BSSA 1HL4A 3VXPB 3NA9H 2RQ8A 4IBWA 3IE4A 4XN4A 4NUQA 5T1KA 1J5DA 2G5RA 2FECI 1A7NH 5J6GA 5F72S 3B1UA 2F53D 4PB9H 4MA7H 4PGEB 3ULSB 5HGHB 1IGIL 4PMEA 3SHSA 2EYSB 3FYEB 4KV5E 2HFGL 3AXLB 3WEAA 1OGTA 4N3TA 3W57A 3WFHA 2Y36L 2Z0UA 3BKCL 1FGVL 2J12B 3NEEA 5IBUG 3Q6FA 3L4CA 1HZLA 1B2WH 3FOMB 4Q9RH 4PR5B 5E4IA 3IETA 4X6FA 4OTXL 4YBHA 5GGRA 5T1DL 3K4ZA 5TE6H 5JHAA 4LAQL 1OSPH 1XF3A 1II4E 3O2DA 3NABL 2X2YA 3ARPA 4JN2B 3T6XA 1HC1A 4X99B 2R4SL 2EIEA 3GHBH 5DK2B 1G6RL 3OJVC 4PRIE 4XP1H 1ZWIB 2A4ZA 5FOJA 5HHOB 2VERA 3FN9A 4KNQA 3N85H 4XPHH 3GSXB 1H3PH 3ARGA 3TJHD 4APXA 4XVSL 3HNTL 4RSYA 3MLVH 1FBIL 1QKZH 2AEQH 1BXUA 2XJKA 4KQ3L 4W9CC 2VR9A 1IBDA 5IG7A 2FRGP 5JOPE 3MLPA 3QQ9D 5LNDA 3RBGA 1FLRH 1V55B 5AWNL 3WUWA 5D7IB 5C6TL 1MF2H 3QULB 3RWEA 1RJYA 2NPLX 4EJ1C 1I3RB 3IPEA 3QUZC 3UADA 3HN8A 3D69A 1ZTXL 2NY6B 4M93C 3FTYA 1GSKA 3QDJE 3BC9A 4AG4L 3AGWA 2R2EA 3HG1D 3POHA 2WP3T 1RMFH 2AI0L 2FATH 3D3VB 3BAEL 1NMBH 4UV7L 3HI6H 5A6IA 2WO4A 1C7TA 2XBTA 2LU7A 4XNMA 1BBJA 5I66B 3VGEA 4HEPG 5D4JA 1KJMB 2E47A 3DNKA 2JI2A 2DBJA 3Q6GL 4YGAB 1GKOA 3QZPA 1B4JL 3R19A 2ADIB 2AV7A 1LE9B 3REWB 2Y24A 1ZMYA 2KI6A 5KSAB 2ZXEB 3BCDA 4JFDE 4F7TA 4ZUWB 5JO5B 4HEME 3M6DA 1XL6A 3B37A 1UACL 4X6BB 3WKNA 5JXEA 2HJKA 4NBZB 5D5ME 1MLBB 4UTBL 3GZPA 4ZRGA 5B1KA 3A4FA 3E8UH 3UROR 3GS7A 1KC5L 1UT2A 1A3LH 2F53B 5E8EB 1RK0B 5SWZA 1JV5B 1UXMA 5C0ND 2R8SL 2CJ3A 3BN9C 1GHFH 5A2CA 3ARTA 3O8XC 3SQBB 4D9QD 4TKWA 3EF4A 4LNVA 2YN5A 4Y0GA 5A7BA 1SJEA 5I6PA 2Y69B 3VI3F 1GJIA 4CGTA 1EHLL 1WE5A 4OCWL 2EDDA 3MAWA 5DC2A 2VLMD 3V4VB 4XCCL 3WKML 3BLPX 1IAIH 2LVCA 4H88L 2DQGH 2UY7B 1S9XA 4EAEA 4WHYG 3QQ4B 4FLQA 3CFIC 2R0ZL 3TTYA 4XMPL 3K80A 2OP4L 3QUYC 1I9JL 3ZKXC 1I8IB 2Z91B 4N2AA 3SKNA 1PL3A 1TXKA 4JDEA 4FA7B 1DVYA 1XGQA 3FRPG 1T22A 3EHBC 3KWUA 1O7VA 2KLSA 2H6PA 3QUXB 4X4KA 2F19L 3HS8A 3VD9A 1TVHA 3OR6B 4Y4HA 1H3XA 3ATBA 5BZWA 4YXLL 4IGBB 4C83A 4PTUB 3MV01 1TPXC 2VLJA 5BRPA 5D7LE 1RUML 4W4NA 3D0VA 5GS0L 4NPYB 4OD1L 4PV8B 1V3MA 1MEXH 2B08A 1QR1B 4FERA 1EJ6A 1RK7A 2Y2WA 2DY2A 1BXVA 3DX2A 1J10A 1XGZA 1GAFL 5EOCJ 2ESVE 4DKTA 2A9BA 4P9HL 5B8CB 2OXHA 3QPXH 4HWBA 2H32H 4Z3FA 4YBLC 4I0CC 3TASA 1U8IB 4Q6YA 2VDMH 3CQPA 3U9PH 3VFOB 5K59E 2BLFA 2MPVA 4WU7B 3EFFB 2XA3A 4DN4L 4WEUD 1NKGA 5FUOH 3CUPA 2EEDA 5MENA 1LP9E 4S0HA 1UD8A 4CC4C 5I6LA 2OK0L 2XWZA 3V6OE 1ACCA 1PLGH 1S7QB 2DV6A 4ZMTA 2VRQA 2NW2A 4JO3H 2W9DL 2DTMH 3SDCC 5CEZH 4ANKA 2JB5L 4XVTH 4Y9CA 1W72H 2A9ML 5KTEL 5L2JB 4ONFH 2WYZA 3BPCB 1J0KA 1TU2B 3BGMB 1PYWB 2WWKO 1YC7A 2GB2A 3KW8A 2XTJD 4RX4D 2I32A 5AOMA 5PAZA 3RVVD 3UBGA 3WFBH 1YA5A 1Z0MA 4K71C 3R18A 5DD0H 1PZ2A 4ZZKA 1J05B 1X5AA 2UVFA 2QQLH 4LEOA 3WEBA 3PWJA 2XN2A 3MA7A 3UZEA 3MRFA 5I6MA 2M8XA 1OD9A 1OPOA 2C26A 3E6FB 2XC8A 2Q76A 3IJYB 4UANA 2UWEA 3II2A 3FQ1A 3ULUL 1SF5A 4U0RC 2MOVA 1LO2L 2DWYA 4GBXC 1M42A 4KO7A 3D12B 4BH8B 4U7KA 4HXAL 4U33A 5D55A 3T2NH 2PABA 2D3JA 1KB9J 1F3RB 1BVZA 2WXLA 2Z31C 3SGKC 3V0AC 5JLZB 2DN7A 3H9ZA 1MPAH 4PJHB 3T0EA 1ED3B 1YEFL 1TQWA 4LDCA 4OZFB 2YD7A 1QR4A 5KANG 3RU8L 5KEZA 1NGQL 1S7UA 1PY4A 3VRLF 4DGIL 5E6RB 2HP4A 3DROB 3BSZA 3WSQL 5F71A 3I9PA 3TVMB 2BCMA 1A6VL 2Y7NA 3VXTB 2TRYA 5SX5H 1YHPA 2VDLB 4W4OA 4B0MM 1MCPL 3C5SA 4UOJA 3GJFB 4H0IA 5CJQH 2DWEB 1KPVA 4FNPA 43C9B 2R4RH 4Q6IC 1A7RH 4HZLB 3SO5A 1EZUA 2PPAA 2YJLA 1XIWD 4G6JL 2X3CA 4NS0A 5JHLA 2NXYB 4F27A 3LCYA 4KITB 1YSOA 4H40A 4BCYA 3A24A 1AD9B 5H37A 1FCCA 3I75A 3GXUB 3TCLB 2IEPA 4OD3H 4WSGA 5DK3A 3FCBA 2UYLA 3BYYA 1URZA 3L9BA 1IL1A 3EYQD 1NLDH 1A6UL 1WISA 2B2XL 3O2WL 5DJ8A 2LVEA 5ISZE 2J8UA 4WU5A 2EE0A 4H5SA 2DWDB 4BQ6A 2LV4A 1TZIB 5DJZA 2XFXB 5DJDB 5ITBL 4P4KC 4F7EA 2BC4B 4K9EC 1BFOB 2XIDA 3UZQA 5BNXD 5HHXH 3F7LA 2VW7A 4C4KO 3KBEA 4OLEA 3PQYD 4IRSC 1UOLA 1JNNH 5ITFA 1A4JA 4JFFB 5A16A 3NIFF 2O5XH 3BRGC 5IKCA 1N8ZA 1YLBB 5A3IC 1R9FA 2W59A 1YCSA 2K7QA 1KFAL 2BW5A 4AW7A 1T20A 2XVGA 4JR9L 1NGPL 2OULB 3PV6B 3QDMA 5GS3A 2OXGB 3VRJA 4OZHF 3TEUA 1WIPA 2ZX6A 1KLFB 4XVJL 4ZMYA 2NY4C 5E6IC 1QBML 4W9IC 5T1MB 5TTRA 3T8MA 1QEWB 2OMUB 4CVZA 3QJZA 4RCAA 2GKIA 3H0TA 4HS6A 2ZSVB 1FC2D 4DWHA 1BX2B 3MNWA 4IU2B 1NBVH 4B53A 3L1FA 1FZMB 3U7WH 3QP3A 3EJUA 1G6RB 1NDGB 3EOAA 3UC0L 1XCTB 3U0PA 1KB3A 2H1PL 3NK4A 4FKHA 1EQWA 5ERWB 4BGLA 4WI2A 2EADA 1WLHA 1BVNP 1AXSB 3FO1B 2CG9X 3L45A 3DTXA 4HIXH 2DBLH 1VGKB 2H0JA 4X5WB 3R7RA 3T6WA 3CN1A 2IDSA 2ZIDA 3DUSA 3G6JF 2Q1EA 3FU5A 4B95C 1A02N 1XL4A 4X9HA 4N87A 5FWQA 4H4NA 4KK6C 3U4KA 2P5WD 5ADPH 4N0FB 3SPHA 4EBQL 5BOJA 1IO4C 4S1SL 1DQQB 1XIWB 1DQML 2ED8A 2KZWA 1LK2B 3HRZA 2QKIA 2PO6B 3MLYH 4FD0A 5GS0D 5C0CD 5IUSA 4N22A 3UBHA 4U1NB 2FEDD 4Z1PA 1FVDB 4G43B 3DO4A 1JK9B 3MYZA 4MJ6A 2PXYA 1NMAH 2AGJH 3VSQA 3ILEA 2DM3A 2OW7A 1OF2A 5HYEA 5IQ9B 5E99L 1BVLA 4LLQA 4XP5H 3BKML 3ZE2E 5AVVB 5FO7B 5IVOA 4GSDL 5EWIL 3I85A 1P5VA 3VXUD 3AREC 1GGIL 2AXFA 4I2XB 2MQGA 1MQKL 1V5JA 4KAQH 5BV7L 4S0SD 5AAMC 2EE2A 4PIBA 3TF7C 1HQRA 1A9EB 1CBVL 3H2QA 4KNSA 4FG4A 3KWVA 3T09A 1JTTA 2OYMA 3QRBA 4OLUH 1OB0A 1OP5K 3MU3A 1AKJD 3QWNA 1AO7E 5A1AA 4A7GF 4NZUH 5MEPB 3MX0B 1HT6A 4M1CD 2VZSA 1G5AA 3LS4H 4PRHD 3ZRFC 1I3VA 3GMNA 3ZIMA 4DH2A 3B9AA 1BV8A 2JJUA 3TO4D 1BJ1H 1M7IB 1D7BA 3BJ91 4OFYD 4P23B 4KNUA 4BFGA 5KVEH 1UVQB 5HY9B 2D4FA 3F58H 2YKLL 1SM3H 3VCLA 5D6CB 2DYRB 3BUIA 3DGDA 2NRDA 2EDHA 4OT1L 4OKVB 2TAAA 3KYMA 4IS6B 4MCNA 2Q8BH 3FFCB 1TEFA 3HHMA 4PJ7A 1JGDB 4PJCF 2ZUSA 2FD6H 4BD4A 5D2LF 3TGXA 4ZPTA 3WDIA 2DLGA 5CR8A 1RPQA 3RGVA 2X3AA 3CZLA 5F1KC 4YR6A 3ULUD 4IJTA 1CN4A 2O6PA 2WM0A 3BZ5A 1WBXA 2HJFB 3QGVA 1QSEA 1CDBA 5HDOA 1S9YB 4NZRH 1I7RA 3Q3GB 5I1DA 3KLKA 3T4AA 2I07A 1FN4B 3RDTC 1QPKA 2BNRA 3MDJA 4DQOH 4MCYB 4QTIL 4UU9B 4YNYB 2X1PA 4GEJA 3S8GB 1ZV2A 4LLVB 3LNHA 1KIPB 3BPNC 3FQWA 1U2HA 3M88A 4ZOEA 5JOEA 3VD0A 5SWQB 1GGCH 3TZVC 4U1GB 5HGAA 4O2EA 3V5HA 2P5WB 2V9TA 2ENQA 1QBLH 4N0UB 4ELMF 1CI3M 4JCLA 5C0RH 1KUMA 4NDMB 1I8AA 1A6ZA 1XR9B 1AP2B 4RGMB 3DX9B 1L0YA 3CXDH 1CVSC 3KE0A 3Q44A 1BQHB 2N1KA 3NQKA 5C0CB 2CGRL 5MHSE 5EZLB 3H2PA 1YECL 1GPOH 4MNHA 2PW2B 2X1WL 1FRGH 2BP8B 1VGEH 3CLFL 3QO0A 2BZCA 2DDQH 4KJPC 2OMYB 1EEZA 2CO2A 3OV6A 2IQAA 1UTDA 2KQMA 1T2QL 4G80B 2OAAA 4X9BA 5EDSA 4YSAA 5CJXA 1YY8A 3VXUB 3MBWB 3ATDA 4PG9B 3TCXA 1ZTMA 1CD1A 2AW2A 4OF6A 1FL6B 3B5GA 5GGTL 2GSIA 4ZFGL 1UA6L 4XH2A 5J0BA 1GGYA 1O9WA 5GS2H 4GO8A 4W93A 1WBZA 5IB3B 1AKJB 1A6PA 1AS8A 2FB4L 3UAFA 1KNOA 2DIEA 1NAMA 2EH7L 5AVXB 5DRNB 4PRHB 5FA3A 5JPNC 1ZSHA 2R23A 4NP4H 3VQMA 3TO4B 2VJ0A 3MOAL 5T3ZE 3IGAA 4FOMA 4LVHB 3BEWA 4QF1B 5DD5L 3CVHH 5I74B 3H9HB 2WYTA 3SDAA 4ZK8A 3T6VA 4NN5C 3WO4B 4IRJC 4JJ5A 4XN5A 2OL3B 3VG9C 5IEKB 2NW3B 5MERB 2GIXA 1IQWH 1ZS8B 2E9JA 2X9ZA 3MRDA 4QJ5B 3ERXA 3EDKA 2K6YA 1J9SA 3PL6C 3F6IA 2IO5A 1QRND 2HG0A 3QRGL 4P05A 1JZ5A 1ONQA 5JW5A 1VADB 4IOFC 3VMPA 3HB3D 2HAZA 3L3GA 4NWUH 1ET5A 1ZVSB 4KPHH 5D7HA 2ZNXA 1S7WA 4RBPH 3V6FB 4D8PA 5F9WC 2YUVA 1JHLL 2NUTB 1UXWB 1RZKL 4YSTA 5LBVA 4N68A 2ESVD 1PD1A 3BP5A 2ARJB 3NIGB 1IU1A 5TQ2H 4JPIB 1X5LA 2EKJA 2WXHA 3VG0H 4HWUA 1LLAA 3T5WA 1DLFL 3PWPA 1VA9A 3QZWG 5AOZA 3QA3B 3TNMA 1BSIA 1EFXD 3QYCA 4PEEA 1FFTB 4NM4L 2WWMD 4TTDC 1KTBA 5IJVB 2ID5A 2G0LA 2QQQA 4GY4A 1CL7H 2ZWKA 2YMXL 3NH7L 2LT9A 4GW5A 4PAZA 3QQ3A 1ODAA 1E7VA 4EVNA 5AD0A 1ZJBA 2AITA 1V7NL 2Q8AL 4ETQB 5FW7A 1FDLL 2YUXA 3PDGA 3APNA 4WLCA 4XCEA 1MCEA 2Y2TA 3NTCH 1G1KA 3BVVA 5KOVC 3N41F 1TJGL 4ODUB 5D71L 3VU1A 5BZDB 1CUOA 2HG5B 4JPQA 5AYUL 2QBWA 3D7PA 5EU7E 2DQHH 3ZIYA 4WJ5B 1JDCA 5K9JL 4NGHH 1Y6NR 5LKNA 1CDJA 2B1HH 2Y7MA 1LO4L 3HI5L 1GXEA 2DD8L 3BQUC 3ZPDA 2BRRH 3AG4B 3QAZB 5AKTA 3FCTA 4FQJH 5IP4A 4RGNB 3L08A 4XWGL 1QMUA 3V4UH 2P5EE 1XF5A 4FNUA 1J9TA 3S4SG 4R97C 2BHYA 5DMIH 3K91A 1EVUA 5KS9A 1NC2B 2JB6A 4DT2A 15C8L 4HU2A 2B1OA 1GY1A 5I1GL 3TV3H 3G04A 4B9FA 3OLDA 1N3NB 1PPIA 2RCSH 4PG2A 4JRYE 4YSUA 4K3DH 3V9FA 4R96A 2YLKA 3JWNH 2FIKB 4HW6A 4C47A 2VQ1A 4QXWA 5DLLA 3VDBA 1KJ2B 4ODXA 3P0VL 2DYPD 2B0SH 1WCBB 5CGYD 4AI7A 4Y9FA 3ZQ9A 3IM1A 1U8NB 4W9GC 4BFFA 1QRNB 2DQFA 5CGTA 1QHPA 4OZIF 1UB5A 5F7LB 1FC1A 1FGNH 3IJ7A 5GZND 3PAUA 1KCRH 5JUEL 3D30A 5CZVH 1R34A 2B59A 1XF2A 4HXBH 5KVGH 1HKFA 5AQ0A 4MDJB 4FFTA 2ZXCA 3STZB 1PZ3A 2CE6A 3AVEA 3MRIB 1J8HD 3SDDA 2XHNA 4QRPB 2HLEB 3MLUL 5IOPA 3WMQA 1SUJA 1U95A 1G7QA 3B3IB 1R6VA 2ZCLL 3MNDA 3TPUA 3CN0A 7PAZA 1FV1B 4IK6A 2VXSL 4G1EB 5C9JA 4N2GA 4L5FL 4JCWA 3AUWB 1DVUA 4ABVA 1EFXB 4M7LH 3D85D 4TLTA 2BP5M 4EPSA 3ZTCC 2QGBA 4XPAH 1CFNA 3QI9A 4F2FA 5FYJE 5D7KE 3UG5A 4FTVA 4JZOB 2X9YA 4JM2A 3RI5F 1DBAH 4JGJA 2H45A 4MCZB 4QO1A 5C92A 3WTYA 2IFFH 3UAAA 2RBLA 2XTLA 2FL5B 4I0PD 1GTNA 4BCZA 5I1IH 3QRFM 1R5IB 3VRLE 4NAMA 1G1YA 2V5SA 3ATAA 1ZRUA 1HEHC 3CVIH 1JFHA 2AV1A 3WN5B 3MJ8A 25C8L 3WAJA 1A1NA 4ENED 3FB5A 4OGQC 5F7KC 3JYCA 1ZANL 2CLZB 1YN6A 2YGQA 3L95A 3MNVA 4DP6X 5BV7B 4BFRA 2JMRA 1MHEB 1TZGL 1I4FA 1QSFD 3VW3H 3FT9A 3FQUB 4R7NA 4NYLB 4X5RA 3GWJA 3IF1A 3V4VH 4G2AA 4IMLB 4A38A 1H3TA 1SEQL 3T77B 3TO2B 4PJGE 4JFEA 1WWBX 5L0QC 2DYPB 3UTSA 5IB4B 2ZX9A 2H32A 1CFTA 3IGUA 4G6FD 5FLVA 5CHNA 1PU0A 1L9RA 1XCQB 2WCPA 3QIWB 4NQSB 5ENWB 5HHNA 1OCWL 3L4WA 4I18A 4BKSC 4KHTL 1TQCB 3FUJA 4ODTL 5DO2D 2OSYA 4W6WB 1NL0L 5FFOA 1N6QH 1NJ9A 3P0GB 3B2VL 1PSKL 3NIFE 4MMZA 1A6TA 5LWYL 1RZ8A 2COVD 1J8HB 2OLDA 3HZVB 3RVWD 3V4PH 4JS7A 1R33A 5GRXG 4M00A 1H0DA 1SPDA 2O30A 2X7LB 5HI3C 5IFHH 3FB8B 1PQZA 1M3JA 5F7MC 1WWCA 2DLHA 3MNZB 4YXKL 4X9IA 4R3SA 3ILDA 3L3KB 4Q56A 3S3DB 4OZHE 4KVNH 5GGSA 1W72A 2D2OA 5F0MB 1WA0X 3D85B 5I2IB 4NRZA 4N8CH 1IC7L 4ZUSA 4G71B 2I9LB 5A6MA 2YPLD 2G75B 2EIJB 3VJ6A 3H56A 1IUZA 5BXFA 4W9JC 3UDWA 1U8CA 2R9HC 5F0PB 3O2VH 4PREB 5CSBA 1MELA 1FAIL 3CDGB 5K1VA 3BQVA 3H54A 3DHJA 2XN9A 4WWID 4NQCD 1UWGH 3L9RB 3A67H 3GK8L 1JXDA 4WUUE 1HCYA 1IGFL 1T6VN 2ARWA 2PYED 4Y9BA 4Z3HA 2H1XA 5H37G 4TQEH 3G6JE 2CIIA 4HHWA 3JWOC 3SJVD 1GJWA 1HXKA 4PLOB 5I5JA 3NCEB 3E2HC 5DSCB 3KPTA 1FNAA 3QXAB 2ITCA 2F54D 1CG9A 4NKMA 3HLAA 5IW6A 4OB5H 2UY6B 3LV3B 1CDUA 1HINH 2OTPA 2AK4D 2MNJB 5KVDE 3K6SA 1E4WL 1FSKB 3U1SL 1JVLA 2UZIH 1QSFB 3F85A 4L37B 2AS5M 1J88A 4LKCA 1T04A 2WTRB 3TJPA 1WAEA 1ZSDB 4LSTH 2OCCB 4J3VA 4UIMB 5DMGC 2EVIA 1JGUL 2A83A 5KBNC 4KZDL 3S7GA 1ADWA 1QQDB 3ABLB 3G5VA 3SBWA 4FABL 5JDJA 1G7IA 4TVPE 4X2UA 4G6FB 3P9LA 5EHFA 3HBQA 1BWMA 3CDCA 3GBNL 2P28B 5ECJE 4WFHE 4BA8A 4PJ8A 4YDLC 5F7UA 5EZOH 1UH4A 1QAWA 4OZFH 4Y4FC 3QPQC 4DP1X 4LK4A 4MAYA 4PCSA 5ESQA 5IREA 4MAZA 4ZUUA 1GYVA 1OE2A 5FYJL 4Y5XB 1CVRA 4XNYH 3RWJA 4IEFA 5CN3A 1D5ZA 3G5ZB 4HUNB 2VDLH 1T0MB 1NPNA 2ENPA 4GP5B 4YPGB 3PHOB 2Z65C 4ORGB 2ZXAA 3O4LA 2MKLC 4JHZA 4U1JB 4TNVF 5DC4B 3MCLL 1A8ZA 5HXMA 1A9BA 2HN7B 2NNRA 5C0AA 4G6ML 2Z35A 5DLML 4BRJA 2Y7QA 3T0AA 1G87A 2VW4A 4PJCE 5D93C 5D2LE 1JPTH 1DQJB 2L7JA 2BHFA 5ANME 3ARBA 1UURA 5T1LA 4BFBD 2GJPA 1V7MH 3O3UN 4IBQA 4IOIA 4NQCB 2ED7A 1S4IA 5J11C 3LRSA 2JJTA 1F13A 1NC4A 4LEXH 2PYEB 1EXUA 3O3BB 5B39A 4OKDA 3HNSL 2XWJA 2EEXA 3SJVB 4AITA 4L0PB 3Q01A 3SE4A 3ZO0A 2X4QA 3DURB 1INDL 1MFBL 3GXIA 4QRBA 1FFNA 1BHGA 2VM9A 5BUGA 4MKMA 2P45B 1XGTA 3EH1A 3L4VA 2F54B 2QR0A 1KXVC 2G4EA 4GAYB 4ELME 1ZGLM 5KZCB 3HEIB 5EOCL 3HAEG 2AK4B 4JZJB 1DUYB 4AENB 3NFNB 4DW2L 5MEOB 2N01B 1OV8A 4AGQA 4QHMB 1IGIH 5DR5H 1JERA 5HPOA 2HFGH 2IDFA 4P4RA 2IXQB 4MZIA 5FOBB 3MROB 3QQDA 4BFOA 3GSVA 2Y36H 3BKCH 1FGVH 2D31A 3CSFA 4QGYA 1A65A 3LRMA 3BLKA 4G8GE 1F56A 2M26A 2Z6FA 4OTXH 5GGVL 3VXSD 5T1DH 3WDJA 3GSNB 2DH2A 4AYEC 4LAQH 2BS9A 1MRFL 4RQQB 4NNYB 4F37F 4LHQB 3ATEA 1B3IA 2HWZL 3NABH 4Y5YC 2DKUA 3UTQA 1E4XL 4M8UA 1JHTB 2R4SH 1A21A 4FLOA 1BZ8A 2CHDA 5SX4I 1G6RH 1CZ8L 5L4FA 4HMDA 4IIZA 4Y1SA 5D4QA 1PS3A 2A6IB 2CJTA 3DV4A 3TA4D 4BFEA 3OKOA 4XCFL 2AEWA 5BVJB 4A55A 4AT6B 4FQXB 5I8CB 1BZ9A 3HHSA 4XVSH 1RFDL 3HNTH 1FBIH 2D0GA 1AQDA 1M1XA 4KQ3H 3QUYD 1F5WA 4JFPA 1U8LB 2XV6B 3L5WB 3OPUA 3KD4A 2CM5A 5AWNH 2LHAA 4K7PL 5C6TH 3P9WB 1CDCA 1BPVA 3HA0A 4F7PA 1OK0A 3CXHJ 4FC3E 4OU3A 1X5IA 4HKBB 1H15A 4Z9KB 4C56E 4AG4H 5ESAB 1DZ0A 3ARFA 4HIJA 2WK2A 2NNAB 3BAEH 3FCGA 1Z9SA 4UV7H 4PRDA 3EXJA 3X3FL 3OGCA 3IDMB 4UAOC 4CUCA 4Y88A 2XUWA 5D7JA 4JDTL 3DX6A 1YEKL 4F93B 2APBA 1KFGA 2ADJB 1DVTA 3IDGA 2HRGA 4LMQI 3C8HA 1EUUA 4G9FD 4RMRA 3Q6GH 1I8LC 1CD9B 1B4JH 1ERNA 2ALAA 1HEJC 4GG8A 4MD5A 1GIGL 4F9PA 3QCTL 4GUOA 1OAKL 4Z95L 5DFWH 4P99A 4LL1A 1UACH 3CFEB 5ICYB 2YA0A 4Z78B 3MRHB 2DIBA 1HCZA 4UTBH 1LMIA 1EANA 4Y5VA 1IKNA 1KC5H 3H9SE 1I8UA 1HE8A 3KDMA 5BMFL 4X7DC 2R8SH 3MYJA 3LB6D 5I15L 2KHAA 1SYSA 4GPVA 5DEZA 4PWGA 4ZMZA 1R47A 2FJSA 1V10A 3B4NA 4B9CA 1JUFB 2Z7WA 3VXSB 3IRZA 3RL1B 3LQAL 5J57B 1EHLH 4OCWH 4TUOB 3SDCD 4DCQB 1RI8A 3WIIL 2DQCL 5BJTB 1VDGA 1WHOA 2EKSA 4XCCH 3MQIA 4N8VA 3WKMH 4H88H 3ETBF 3T6QC 3OMNB 5I6NA 3CLEL 4FNQA 1LE5A 2R0ZH 3LHAA 3DVNA 3ZN6A 1I9JH 4HJJL 1HDMA 3NJMA 3ZMEA 3RFZB 3U4AA 1P4BL 2Y23A 4PRPE 4UQ3B 3DIDA 1AZZC 1PKQB 2IOMA 1GYUA 2WZ0A 2X70B 3ECBB 4MXQD 4E9LA 3G6DL 3I3EA 4BDVB 2PW1A 3FB6B 2XCMC 4GXFA 1OALA 4OCXL 4LCCA 4OGAC 2K4WA 2ZWYA 2JNZA 2F19H 3DPBA 1HS6A 1G7JB 4GBXD 1LTXA 1PZBA 4YXLH 1MI5E 5B38G 4FHJA 4WO0A 2F68X 5F7DA 3IBEA 4Y16B 2A6DB 2Z31D 1RUMH 5FYJD 2OTWA 4F8LA 5GS0H 3GXFA 4OD1H 4JKKA 1GZQA 4OQ1A 4OJFL 3MRBB 5C0EB 2ZYSA 4FXGC 2F5AH 1WDAA 1GAFH 4N9GA 5F89B 1QO3B 3C60A 2BSDA 2NQ3A 1INQB 4M8QB 5C0IA 2WCGA 4OZIE 4P9HH 2W8CA 1SVZA 3CVHA 1HU8A 3PP4L 1MCWW 1K5NB 4E9SA 4G9FB 4HUKB 2IPKA 4KXDA 1IGCL 3O6FD 4CVXA 3PJSA 5IW1B 1OY3B 4DN4H 2X09A 2VSDA 4L9LA 5F6IC 5TJWK 1ZE3C 3W2DH 3Q05A 2DWXA 4JG9A 5F96L 3DXAD 4YBLB 2X4RB 3F7PC 1LO5B 4JE4B 1U8MB 4WO4A 3W5MA 5HGGS 1E3ZA 3FO0L 2OK0H 2ZP9A 1CF8L 5I18L 2I27N 3SYPA 1RJLA 2RJMA 5BS0A 4M6OL 1BZ7B 2W9DH 2UX6A 3GEFA 3MLWL 2JB5H 5DK0B 2KPNA 4JVUA 2O5YL 3RWIA 5KTEH 5FFLA 5BZZA 1M2OA 1XD0A 3PGDB 3B7TA 5ABDE 1X9QA 1CFBA 4B97A 1BW8A 4NKQB 5I9QC 2J43A 2OCJA 2ITDA 2CDEB 4AYSA 5I0YA 1HN1A 3KEHA 4KKPA 4IRSD 4P5MB 1EHAA 1ORQB 5AUMA 1XSKA 1JIBA 4N9OB 4WTXA 4K94H 5EZJB 1NKRA 4AKQA 1U2YA 5GRVK 1IE5A 1QTYT 5E1HB 3ULUH 2GSGA 2IFGA 4GT0A 1LO2H 2X05A 3LXUX 1W8NA 4HXAH 4NN6C 5FGCB 4ADGA 3S5LB 2GAZB 4JKNA 3UP6A 3GIZL 5F70A 1LWJA 3QW9A 2LLGA 5B7FA 2V7HB 2ICWJ 5FKPA 4IKIA 1D5BB 4L4VE 3S5YA 5F9JB 1F4XL 1GZPB 1MJ7H 1YEFH 4L3EE 4NQEE 1EEUA 4PJFB 4RFOL 3IRPX 4ZAKB 3RU8H 4BQ9A 1NGQH 3K4AA 4GAAA 1H19A 3B2XA 4A2GA 4DGIH 2DMHA 4FEMA 3DO3A 3ULSA 1IBYA 3QDHA 4F15C 4FMFA 3SCMC 3AXLA 5AW0B 1BG1A 1U30A 2Z31B 1A7QL 2VLRA 3QJSB 3SY6A 2BOLA 1MCPH 2WVVB 2E86A 2J73A 1DQKA 1FHGA 4PR5A 1OT2A 3KPSA 4R2GC 3SO3B 3HG4A 3QDGE 5IROC 1QYGL 4G6JH 2M2DA 1U92B 1T1ZB 2HKHL 3QVAA 4W9DC 4JDVB 3S3CB 2NT1A 4JN2A 1LWHA 4FG2A 4X99A 5HHME 3RX9A 5DK2A 1U6AL 2CBTA 5GISL 4Y4HC 1T03L 4JG1L 1ZWIA 2FGWL 3O6FB 3P2TA 5B21A 5HHOA 1UENA 5F7NC 4V2CB 1HOCB 1A6UH 2P8PB 3GSXA 4Q7DA 3O2WH 1R24B 2G4GA 3HVDA 3TJEL 2X2UA 3NJVA 2RALA 2E6QA 3CXFA 2KC0A 3DXAB 3FZUD 3FTZA 4GMSL 5ITBH 2W0KA 4QHLB 1ZDQA 2X89A 4H8QA 4ILDA 5D7IA 3DDGA 1ZIAA 3QULA 4J1UB 4N0CC 2I9TB 4LPCA 3TC9A 1KTLB 1I3RA 5I1AB 4U1SB 4EUPG 1JZFA 2FCBA 4PS3A 3LN9A 3CZUB 2EINB 2QADC 3ZL4L 2AJXL 1ZXQA 1CGUA 1KFAH 4ANWA 1X44A 3HMXL 4JR9H 4C57C 1MCLA 3EADA 4BKLB 5EV7A 5I66A 2EJ1A 4ZW8A 1HESA 1BVOA 2ALWA 4KO5A 5GRVL 1KJMA 4XVJH 5BOZG 4IKNA 3OJMB 2CCVA 4I77L 3VXMD 2P24B 1QBMH 2ADIA 3REWA 3NRQA 2CR0A 3OC8A 5KSAA 1SXSA 3ZZ1A 3DVFA 4D9RE 3AS1A 1VAHA 5IQ7L 4PJ5D 5JO5A 3KPPB 3OXSB 2W60B 4E9VA 4MJID 4LIQE 4X6BA 1NPUA 1MLBA 3UC0H 3HG0A 2DLEA 4EI5B 2H1PH 2ICEB 5FAAA 2Z7YA 4P57A 2F53A 2CJUL 4IBUA 5E8EA 3MTXA 1RK0A 3LPGA 3UZEC 1JV5A 4ABWA 2L0DA 2WQWA 1NBQA 4R7XA 5TFSL 2UWEF 4DPCX 3SQBA 2DWSA 1GC1C 4KZEL 2FEEL 3V6BR 4FG6C 4H26B 3GKWL 1JRHI 1AR2A 1GZHA 4S1SH 1DQMH 1XB8A 3CSTA 3V4VA 3SD2A 3T0EC 4KDWA 2UY7A 1ETB1 4F80A 2LFGA 3QQ4A 1QWNA 2YD0A 3G5XB 4HSQA 4NSKB 1I8IA 2XZAL 4PGCB 2Z91A 2XQYA 4LSVL 5E99H 4I1NB 5TGBB 4AV4A 3BKMH 1WEJL 1WA1X 2XPYA 4J6RL 1FZJB 4KUZL 4GSDH 2FLBT 5EWIH 5IVZA 5DYFA 1GGIH 1YZZA 3D0AA 4W4OC 4WEBL 1MQKH 3QUXA 1TVDA 4JPSA 5BV7H 2M1KA 2D73A 2EACA 1A7OL 4PGDB 3OR6A 3BEVA 3MPCA 5DJXA 4IGBA 4PTUA 2A74B 3HVNA 2GTZB 3QUKB 2EE6A 4L18A 4NPYA 1TTRA 1KJVB 4PV8A 1QR1A 1KTKE 5JIDA 4XNXH 3X11B 4TUUA 4OH2A 5E51A 5HDWA 5BO1L 1J5OL 3E7JA 1B6DA 2JI1A 5IIEB 2D3LA 2J8UF 3T8VA 1DEEB 5B8CA 2AZAA 4HJSA 5FO2A 1UD2A 1TNNA 4K3JH 4OCSL 3SKUD 2QTEA 2YKLH 1U8IA 2VLLB 2EVFA 4OT1H 3TV8A 1KB5B 2LU5A 2PCYA 3VXMB 4WU7A 3EFFA 2GITB 1ROWA 3LZQA 2K8MA 4MYWB 1KCSL 1AANA 4X0KB 1SLWA 1DEDA 1V3KA 2H6UA 4PJ5B 1I1FB 1A14L 3FBQA 4MJIB 1EX0A 4LDLB 1NFAA 2FHCA 1SOQA 1S7QA 5IQMA 5AW1B 3N0AA 1TIUA 2W91A 5DS2A 3PL6D 1F6AB 2CNZA 2X10A 3A4EA 5H4ZA 5T5NG 5L2JA 1KDJA 4M02A 3BPCA 3H6AA 3BGMA 1PYWA 1JF1B 3I84A 2F61A 2CUHA 1FO0L 4KU1A 1ROCA 2QLVB 3O9WD 1J05A 2C7FA 2VLKE 4LCWD 1F02I 5CLXA 5C3LD 1HZHL 4I48B 4AMXA 3E6FA 2CGRH 3U7YL 5TDOB 4FFYL 3NIDF 3IJYA 3ARUA 1YECH 2CRYA 3X13B 4G70B 4L1SA 1WA2X 3CLFH 1LQSR 4R4ND 4G6AC 1DBJH 4BH8A 4EXPX 1B9KA 1HEZB 1T2QH 3H7BA 4TTDD 3P1VA 2CCLA 5JLZA 4R26L 4I5BB 4XNQB 4PJHA 5EU6B 3W81A 1ED3A 4OZFA<