5I26A

Azurin t30r1, crystal form i
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
128
structure length
127
Chain Sequence
AECSVDIQGNDQMQFNTNAITVDKSCKQFVNLSHPGNLPKNVMGHNWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEGEQYMFFCTFPGHSALMKGTLTLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Azurin
publication title Determination of nitroxide spin label conformations via PELDOR and X-ray crystallography.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Metal binding protein
total genus 30
structure length 127
sequence length 128
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2016-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 5i26A00
1NWOA 2IH8A 2HX8A 1URIA 1MZYA 3EH4B 2QDVA 2XX0A 4HCIA 2HRGA 5F7AA 4KNUA 2IDTA 3S8GB 4YVUA 2DV6A 4GY4A 1HFUA 2P80D 1W6WA 1TEGA 2UXFA 1WA0X 1FWXA 3CVBA 2PP9A 1SJMA 3QQXA 1KYAA 1JXGA 4A67A 2FT8A 2XV0A 1OE3A 2YXWA 3SBPA 3FU8A 3N2JA 4E9RA 1L9OA 1BQKA 3QJUB 1F56A 2EIKB 4AKQA 1NIAA 2EIJB 4E9YA 2PCYA 1ZPUA 3JT2A 4AI7A 2YQBA 1J9RA 4BXVA 1PZCA 1AACA 1RCYA 4A2DA 1AS7A 2VW4A 1A8ZA 2IWFA 2WO2B 1PLAA 2A3TA 1IC0A 1AZRA 2BO0A 3OQRA 2WO3B 2XX1A 3FQ1A 2EINB 3FU7B 2UX6A 1JOIA 1NIEA 3FQYA 3FYIB 2ZXWB 2AZUA 5A7EA 2FT7A 4JHUA 4G7SB 2BP0A 2IH9A 4HZ1A 3CVCA 1J5CA 1NIDA 4CSZA 1ID2A 4CSPA 1HAWA 2JXMA 3S3BB 1W6LA 4EF3A 2GSMB 3ZBMA 3NJFA 2HZHA 3NJMA 2FT6A 1GS7A 1NICA 3EH3B 1PNDA 5ANHA 4YSUA 3X1FA 1GR7A 4QLWA 2PPCA 3TA4D 3NJGA 4KNSA 1OOWA 4F2EA 3ZDWA 2IAAC 3S3CB 1L9QA 2H5UA 4YSPA 4DP4X 4DPBX 1CUOA 5I6KA 1A4CA 4A68A 1RZPA 3T71A 3WNIA 2J57A 1TU2A 3QJTB 2QPDB 2WSDA 4DP6X 3NYKA 3WKPA 1L9TA 3T9WA 2XV3A 4BK5C 2B08A 2XUWA 1XB6A 2N0MA 3OM3B 2CALA 4DP7X 1GS8A 2X87A 2VM3A 3ASOB 3S3DB 5PCYA 1XMEB 1E30A 1V10A 1M56B 2I7OA 1WS8A 4KOCA 1TKWA 1BQ5A 4Q89A 1QNIA 1GY1A 3DKHA 1AS8A 3FSWA 3H4HA 1YLBB 2J56A 2BP8B 1AZNA 1KBWA 2CUAA 6PCYA 5TK2A 5LDUA 1ZV2A 2IDFA 4A2FA 4YSSA 4YSRA 1ZDSA 3X1EA 1JVOA 1GYCA 3AZUA 1SFDA 5AFAA 5B1BB 4E9TA 1E67A 1JXFA 1NPJA 3ABLB 4BDVA 4BWUA 3FQ2A 2GHZA 3EF4A 4KNTA 5I5MA 3AG3B 5D4HA 4W9ZA 1OCRB 1X9UA 1JZGA 1BYPA 2Y1AA 4AX3A 1NPNA 3HB3B 3ABGA 4DP8X 1BAWA 2IWEA 1V54B 3HEIB 1AIZA 1T5KA 2OJ1A 1WS7A 1N68A 4M3HA 1AANA 3CDZA 1SFHA 4G7RB 3OMNB 2FJSA 2J5WA 4UANA 5PAZA 1E5YA 1JXDA 1ASQA 2ZWNA 4E9SA 1PZBA 2QDWA 1PLBA 2Q5BA 4GP5B 2H3XC 6PAZA 2QPEB 1PLCA 1JERA 4AKPA 4F2FA 3X1NA 1AG0A 3IN2A 5I26A 3JTBA 5TK4A 2OV0A 3FYEB 1ZDQA 3S8FB 1DZ0A 3AW5A 3GXUB 1KCWA 2XVBA 1NINA 2IDUA 2BW5A 1ASPA 1J9SA 4GP8B 1AS6A 2AFNA 4ZK8A 3V9EA 4YSEA 5IY5B 2BZCA 2MRYA 1AAJA 4MFHA 4YSCA 1A4BA 4X4KA 2JFCA 3CZUB 3UAAA 1SF5A 1RZQA 2YARA 2UXTA 1BXUA 1N70A 1SDDB 2I7SA 2FNWA 5B7EA 2RACA 4NERA 2XWZA 1FFTB 1CYWA 1SHXA 2B3IA 1ILSA 1AZUA 1RKRA 2EILB 2PPDA 1BYOA 4BWWA 1ASOA 3FT0A 2R7EA 1XB8A 1NIBA 1PY0A 4DP2X 9PCYA 1WA2X 3D12B 3T6XA 2EIMB 2PP7A 2VM4A 2ZOOA 1IKOP 1OCCB 3PXLA 2PPEA 3H56A 3GDCA 3UADA 1R1CA 5I6OA 2PCFA 2YAQA 4RH4A 4F7KA 1A3ZA 1AZCA 3DTUB 3NJKA 4GYBA 1ET7A 4DP5X 2HRHA 3NJNA 3WIAA 1JZJA 1XB3A 2PP8A 2UXGA 2X88A 2BHFA 4G70B 2CAKA 1VLXA 3PLYA 2QT6A 1BXAA 3QJVB 3UGEA 2VW6A 2YAPA 1TEFA 8PAZA 3NJJA 1BQRA 1PF3A 3NSDA 1HAUA 1JZIA 1KDIA 3MX0B 3UACA 4YSQA 3TASA 4N4YB 3DIVA 4FAAB 2DWTA 2MTAA 4YVNA 5FC9A 1EZLA 3T6WA 3TBCA 1PCSA 2P80A 3UAEA 1PZAA 2GC7C 3WI9A 5B3SB 2ZONA 2PPAA 2FQDA 3NSCA 4WKXA 4A2GA 2HXAA 2NRDA 4K9JA 2GB2A 5B1JC 4DPCX 3SQRA 4M4RB 1ILUA 4A66A 1OE1A 2FQFA 1PAZA 3SBQA 3NJHA 2GI0A 4YSOA 1ADWA 2I85A 2BP0B 3FPXA 1JZFA 2BWDA 2BZ7A 4E9QA 1PMYA 5I6LA 1AQ8A 1BXVA 1E65A 2Q9OA 1JZHA 2XLLA 4HALA 1MG3C 2W88A 4PAZA 3X1BA 3FU7A 2HX7A 4G72B 1SNRA 3KW7A 3OMIB 2CJ3A 4DP9X 1SF3A 4KO5A 1OCZB 3AG1B 3UABA 3ZX1A 4G7QB 3TBBA 5I6MA 1E5ZA 3AG2B 2OCCB 4HHWA 1AZBA 2XV2A 4YSAA 4HIPA 2GBAA 1X9RA 1AOZA 5B1JA 1J5DA 2DYSB 3NT0A 1IBYA 1J9QA 4N8UA 4G71B 4HHGA 3G5WA 3AY2A 2TSAA 4P5RA 1CURA 5AKRA 3KW8A 2YAEA 5B1KA 2XXGA 2PPFA 3NSFA 4A2HA 4ENZA 2UX7A 1M9WA 2FQGA 1B3IA 1IUZA 3PPSA 4WTQA 4UF7C 1SHWA 5I5IA 1ZIBA 1JZEA 2IWKA 4E9WA 1OCOB 1ET8A 3SBRA 2YAOA 3C75A 1ETJA 4DP0X 1AG6A 3NJLA 3N55A 3FS9A 2VN3A 1OV8A 2PLTA 2VSKB 2IDQA 3MBWB 5I28A 1EHKB 2XXFA 4JHVA 2J55A 2DYRB 2TSBA 3WG7B 1WAEA 3FSZA 1GS6X 3BQVA 1KV7A 5I6PA 3PAVA 1L9RA 1NTDA 2BP8A 2UXVA 3WKQA 4BDVB 1GY2A 2CBPA 1MZZA 2LLNA 4E9XA 3FU9A 1A65A 4DPAX 3CVDA 3X2QB 1PNCA 2DWSA 3T6ZA 1BEXA 1GSKA 3IBOA 4HCFA 3QJRB 1IBZA 1NWPA 3T6VA 4HCGA 4BXSV 7PAZA 4L0PB 3CDZB 3NP4A 3H4FA 3EH5B 4GXFA 4W1TA 5E9NA 2BW4A 2FWLB 2AZAA 4KO9A 4E9VA 4UAHA 1NZRA 2JKWA 1OF0A 4KOBA 4A2EA 2BWIA 1W8EA 3U25A 3NJIA 4JKNA 1DYZA 2W8CA 2FQEA 1CC3A 1WA1X 5B7MA 2YAMA 3PCYA 1M57B 2HLEB 5EHFA 5D4JA 1AR1B 3QPKA 2YAHA 4YSDA 3IN0A 2HX9A 3GYRA 5B7FA 7PCYA 2YXVA 3NSYA 2XYBA 3PAZA 5I6NA 1KDJA 5B1AB 1QHQA 2H47C 4YSTA 5F7BA 2VMJA 1NDTA 4PCYA 1MG2C 5I5JA 2VW7A 4HAKA 4AZUA 4Q8BA 3WNJA 3X1GA 1JVLA 1A4AA 3RYMA 3ASNB 4NAJA 1L9SA 2AVFA 2XU9A 1QLEB 1UATA 3QJQB 1FA4A 3PAUA 3ZIYA 2DY2A 3FPYA 2FTAA 1CYXA 3IEAA 2GIMA 4KO7A 4TXVB 1ET5A 1L9PA 3V9CA 3EHBB 3QJSB 3CG8A 3L45A 5D4IA 2R7EB 1V55B 3ABKB 2IDSA 1OE2A 3AG4B 3BVDB 2E86A 4KO6A 4YL4A 3NP3A 5AZUA 2AANA 1SDDA 1MDAA 3ABMB 2CCWA 2GC4C 1ZIAA 2Y69B 1KCBA 1J9TA 1I53A 2VSMB 3OMAB 4DP1X 3OD3A 3TU6A 1NIFA 2YAFA 4BWTA 3FSAA 3ERXA 4NB7A 4GP4B 4QKTA 1KGYE 3IE9A 4FA7B 4P5SA 1GW0A 1KBVA 4AKOA 3FSVA
chains in the Genus database with same CATH superfamily
2IH8A 3UEQA 3UBXG 1ZA6B 5LKNA 4ZFOB 1B0GB 4LU5L 3HR6A 4OZIA 2WLKA 4GKSB 1FG9C 1BF5A 1TFPA 3QR1A 4Y4KD 2F53B 4N6RA 4M43H 1JYVA 4AQ1B 5KSAC 4DGIL 1FVDB 2X7LB 4KDVA 3MMEB 1VERA 4HJUA 5HP5A 3QQ4A 4HJ0C 4OI7A 1NAMH 1U58B 4PLKC 4AZ8A 3OMZA 5L6YH 1FZKB 3RUGF 1W0VB 2FT8A 4KAQH 3F58L 4E9RA 1A22B 1XHHA 3N5AA 1QBML 4OZHF 2EIKB 2UWEE 4EPSA 3T3PB 4LQ1A 3TLRA 3FUKA 5I1GH 1J9RA 4MNGE 2E6PA 3TVMB 4EZMA 3OVUB 3QIUD 2JKNA 1MI5D 3CTTA 1ICTA 3EOBB 3UAJC 2VSCA 3ENEA 4XNYH 3GJEB 3ULUD 1E2VA 4FXKB 4IRSD 2VITB 1TTRA 3B3IA 3FAXA 5JMRA 2QQNH 5KVDL 4P2OA 1IM3B 2LR4A 2P49B 4KJPC 3QCUL 4M4PA 1UM6H 3B9EA 1RVFL 3FU7B 4QJ4B 3I50H 4LPXA 4R7VA 1CYGA 4JO3L 4LOVA 2X10A 4OLZH 5MEPB 3VE0A 4HCRA 3ZTNL 1NAMA 2QKSA 4FQ1H 4AVJA 2ZCKH 2ORBL 3BZDA 3SGEH 5MERA 1PLGL 3I9GL 2JXMA 4LCCB 1H15B 1W6LA 1ZPLA 3GMOA 5EUOE 1RH8A 5DFWH 3HI5H 3QUGA 4OCYL 1QO3A 3U0TB 1FZOA 4M5YL 2X3AA 4OFPA 5CD3B 5I1KH 5KAQF 4P4KD 2GSIB 3TA4D 1KCUH 3AU1A 5T33L 1JE6A 1MCPH 5INCA 1EWHA 1P4IL 3BRDA 2OSLA 3T4AC 2EECA 5DLMH 5AVRB 3NGBC 2DYPA 1ZHKA 2J1YA 3TPUB 1JPSL 1HWGB 4JN1H 2PTTA 4HKBA 1FFOB 1NAKL 3EBAA 1XL4A 3B1UA 4NQEA 3AQDA 4K15A 1ZLVH 5DMKA 4EQ2A 4Z78B 1A6ZB 2IADB 4ZXBD 2ZP0T 3SKOA 4RISH 3C2AH 4L29A 1QLFB 2X87A 1LO0L 1N5AA 3S3DB 3PGDB 1MW3A 2V0AA 4Y4HC 5HGAA 1T80A 1AXSA 3HW7A 2BFVH 3CSFA 3T0BA 1HZHL 3GRWL 4F58H 2O5YL 3LXBA 4LIQE 4U3HA 3VSQA 2G2RA 3ZMEA 1BM7A 4IBWA 3TBYA 1Y1UA 1E5AA 4MZ3A 3WE6A 2Z7WA 4L5FL 3MBWA 1M4KA 1JBJA 1ZV2A 5FCUL 3HMXL 1J88A 3PP4H 1EHAA 2DRUA 2OQJB 2W07A 4LCIL 3KYMA 4M93B 1T7XA 4GRLC 3K91A 1XBRA 1SFDA 1U95B 1ZXQA 5FUCE 3BJLA 2CLZB 3LKOA 4ZOBA 4BKSC 1J8KA 1LP9E 1U8OA 4HETA 2LVEA 3UMTA 3VFNA 4EEEA 5BRZA 2HTKC 1XCWA 1Q9OB 2NUTA 3SPVA 4DCQA 2GITB 4DP8X 4DUXA 5IB4B 1NGXA 3QO0B 1A9BB 3ELQA 2NY0D 2Q1EA 3BQUA 4X80H 5JXAH 3FSOA 4W9LC 3I3DA 4G7RB 2R1WA 1B4TA 4L9LB 3LNEA 1FV1B 3QJXA 4WI8A 5GGUA 3DI3B 2ZF9A 5TDPB 2ZCZA 3G6AA 4UYQA 3VMNA 5BS0E 4PD4J 2C7UB 1PY4A 2QDWA 3C87A 4GKNB 4G6ML 2VDNB 3F6LA 4BFIA 2NY7L 1F11A 3MX0A 4Q97A 4S1RH 4JFXA 4ONGH 3G3LA 1RSYA 5D7LE 1IQDA 3VFUB 4AQEB 2Q87A 3B7SA 3AGWA 4KUCF 1QZ1A 2XQYK 1AXIB 4IJ3B 4NO2B 3CWGA 1MCCA 4N8VB 4NENB 4GW4B 1RJYB 2GHWB 4GNKB 4ZJ9A 4F33A 1CLCA 1N5YH 1KENH 4XE5B 1H3GA 1XF2B 1EQWA 1ULVA 1HEHC 4TQEH 2E9WA 3TFKC 3F5WB 1L9MA 2OXGB 1CXIA 1B6DA 1E50A 1P69B 4OM0H 1KOAA 3FQWB 3MJ7B 1E6JL 1NA8A 4JY5H 4L37B 3GDBA 1Y6NR 3LPPA 1BXUA 1SDDB 2I7SA 2FNWA 5GGSA 3IDUA 3TIDB 1T4KA 3X14B 1TQSA 1SBSH 3N40P 1OTSD 2X2UA 3GHEH 4XPGL 1XCTB 3KXFD 5TF0A 2A6JA 1AJ7H 1I3RB 2JCCA 3NAAL 1PSKH 5EMYA 4Z7UA 2IAMC 1DJXA 4PHXA 3GXFA 2NCEA 4PY7A 3E6HA 3FCBA 2DQUH 4D3CL 4WNQB 4ZNEE 5B38B 4FEIA 3VXRE 2J1ZA 3KWTA 2AP2A 2AXFA 1PFOA 1A6UL 1R1CA 4U1SB 1X9LA 3X11B 2I07A 4LNRA 4QLRA 4ZBJA 5CSGA 2DICA 1AC0A 1UD8A 2VDQL 1A6VH 3SDXE 4JRXA 1CB4A 4AYGA 4AL8C 5MI0C 3H53A 1JHLH 4I77L 3VFRA 3HJ0A 3BDXA 5LBSL 3S4SB 4ADIA 1TTBA 4MWFB 4H88H 3HZYA 4A39A 2OJEB 3ZT7A 3FCSB 5EOTB 1CFMA 4HXBL 4MXWL 1BQRA 4A63A 1DSWA 2CCLA 1S9XB 5AZ2H 4WTZG 3AS1A 3MODL 3TASA 4NQXA 1EDYA 1ZCRA 4I3RL 5EPMB 3TC9A 4KQ0A 4EI6A 5IFJA 4Z7AA 5TE7H 2WKLA 5DFTA 2VZOA 4PJAA 3TJEH 4NPYA 1J18A 4NKMA 1UWXK 1KTLB 4QCIB 1A7RH 1QSFE 1QBLL 3TA3C 2G0LA 2OX5B 2OJZL 5TGBA 4AK1A 1RUKL 2FECI 5FGRA 1G5GA 1NSNH 4H26B 4UT9L 1NC2B 2CBOA 2Y7MA 2ZOWA 4LSPL 2VLKD 1UM5L 1ZAGA 5C09B 4PRBB 3PL6C 2ZZUT 4X4XB 4KY2A 3ARPA 3OR6A 2GPZA 1QFPA 3C5ZD 4X4YB 3GUTA 1VAHA 5EN2A 4CN1A 1RUQH 1M05B 2MKWA 1ZLDA 3BW9A 3MRLB 3MJ9L 5DRWB 4TL5A 4XVTL 2CKBA 5MENA 4HX1A 3LHAA 3KCWA 3ZDYE 2EIZB 4HH9B 4YHYC 3VFGH 2KDGA 1XGYH 3B8SA 3GBDA 4OD2B 4G6JL 4OTXH 3UABA 4BSWA 2AC0A 4OZHB 1JDDA 1FPTL 4KKCD 2COVD 3P11H 1E5ZA 3P02A 5EBMA 2O30A 2OMVB 1QOKA 4MMZC 2FJUB 4YHLL 3CQFA 4OLUL 5EO9B 2GBVA 1M1SA 1VEPA 2HKFH 2ZNXA 3EOTL 4D9QE 1AVAA 1FJ1B 1J5DA 2PO6D 3HZKB 5I18H 1I8UA 4N9OB 3MNZB 3VSUA 1KPUB 1LO4L 3CQQA 3GI9L 4WU7A 4X4MA 4UUJA 3T0DA 1B6UA 4EIUA 4GG6E 1ZK5A 1F3RB 2OMYB 3BAKA 4KNQA 1K9TA 4PYHA 2BVUA 4L0YA 1IGYB 4NYLA 4F15B 3WXVH 2GCYB 2WLLA 3ZYJA 2P3YA 2ZSVB 4PG9B 5I74B 4PWHA 1G7PB 3G6JF 4H0IA 4G8GE 5CSZA 5ACZA 3QO1B 3BPLB 1ZIBA 1JZEA 1N3NB 5B39B 1MJ8H 2DTSA 5JDSB 1XSOA 1CR9H 3C75A 3GMQA 2NYYC 4G8FA 3MRDA 5AG8A 5AL0A 4FTVA 1EHXA 1Z2KA 3VD0A 2BLFA 3P9WB 1NL0H 2NY5L 1F13A 3ML8A 5IK3B 3VXME 5KBNC 3MREB 5MP6L 2WNXA 2XXFA 3CLWA 4XO9A 3OR7A 3VVVA 4A55A 3FN3A 1DHKA 5HTSA 3VRLE 1OGPA 2G4EA 2DLEA 1UXMA 3HG1A 5BOJA 2BP8A 3VWKB 4F7PA 2NLJA 3MRFA 1P9MC 1YN7A 4N8VG 5IHHA 3BP5A 4C55A 3C5JA 4OI9A 3STLB 4LPTA 1IJNA 2EADA 5E8NA 5HDOA 3EFDH 3JBG7 4BEIA 3BC9A 1MVUB 1I8LC 4B9GA 3AWFA 4KMQA 2X05A 3CSYB 2VZ1A 4XVJH 4PJ5A 4XP4H 2AKRA 4RMWA 5E7BA 3ISRA 2BDNL 2P5EB 4CADB 4N22A 2X2JA 5ADPL 4LPUA 1WICA 3NIGE 3L08A 4E9VA 4F9LA 4PJ9B 4ELME 4LHUA 2A9ML 1OF0A 3U79A 3DV6B 3OJDA 4QI3A 3MLYH 5HGBB 1RURL 3ARGD 1CLOH 1JV2A 5KSBF 1HQ4B 1M57B 5D4JA 1ACYL 2HAZA 3GD1C 3MXVH 4JZOB 4K7PH 3QDME 1TZIB 5B38G 4HJIA 4B5ZA 4L8BA 5DEFA 2K70A 5GGTA 3O8XB 3AM8C 4K3HA 4X5XB 4ODWA 1EBAA 5GSVA 3VRIA 1KGCD 4Z7WE 1CLYH 2IVFC 3A6BL 1A1NB 3EGDA 2ZCLH 5FYJD 5F9JB 1CGWA 1L6XA 3S4SG 3FQNB 1JXKA 5J12C 2J20A 1HINL 4ZQKB 1FNAA 1S78D 4YIQA 2R1YB 3FPYA 4MAYC 3ZRSA 1BZ9B 2CGRH 2FTAA 4R26L 4BZYA 3DVNB 3K1DA 4O58L 5T8IA 3MRCA 4BE5A 2EUVA 2VXTH 5D4IA 1QSEB 3ZQ9A 1NEZA 1UM4L 2CO6A 5AZUA 3U2SA 2PCPB 3O9WC 5T3ZH 3QGVA 1ORSB 4UINL 4N0UE 2Y69B 3T2NH 1TQBC 3PQYE 4A7TA 1QR4A 2WZPA 3KJ4C 2KYIA 4AGMA 2IALB 1ZV9A 3S97C 2IH1B 5KYUA 4J12A 1RIVH 3S88H 5E94B 5HVWA 4O51B 3GXMA 1IFRA 4LDCA 1TTFA 4G5ZH 4JG1H 4BSVA 3EJSA 3ARFA 4G43A 3UZQB 3H9YA 1BEYH 1U3HC 2XX0A 4YDJA 1GC1H 2OK0L 2YEVB 5HBBA 4KRLB 1YEIH 3BEWA 1JGVH 1MFDH 2VDKH 5KG9B 4GY4A 2BS71 1U8JB 1QYGL 1W6WA 4MJ5B 4QY8B 2GT9A 2QMKA 5CR8A 1F4AA 2AQNA 3GMNA 4ODXB 3L7EB 1KLFB 5AKSA 4PRDA 1OGAE 1AGDA 1VJSA 1U92B 2GJ6D 4RX4D 5H2BB 4KDWA 3RIFK 2XOTA 3PWPB 1ZPUA 1IC7L 4NAMA 2H6OA 3BPOB 4JFFE 3S35X 1M2VA 1MPAL 2XCMC 5D7IB 3BRGC 1YQ2A 4XNZB 1IBGL 3NFNA 4Z8FH 4YK4B 2WO2B 3MRBA 4NLAA 4X6EA 3ZHKA 5F7YC 1NLBH 3RWDB 5HDRA 3L3OB 3ABZA 4XE0A 3S2CA 1U42A 2R29L 3TESA 3DURB 4QKXB 1DCEA 1G1OA 3VNZA 2EVIA 3ZSTA 1CTOA 3OQRA 4RESB 4O2EB 4NZDA 5B39G 3TNMA 1GA2A 1EJ8A 2BY3A 5GZNC 1N4XL 3B9KD 3I3EA 3QNXA 2CR0A 2WIIB 1J8HD 1Z0NA 4RGOL 3QUXB 3B2DC 5DJYB 2IH9A 4CC4A 2IANB 4G11A 4OLYL 2BY0A 2Q8AH 1X5JA 4WLCA 5CEYB 5C70A 4M9PA 1MCNA 4JQIA 4AK2A 1XGTB 4ONOA 1ZSDA 1RUMH 2QSCL 1SXCA 2EIDA 5EDSA 1SXNA 1Q1JL 5EZLB 2CDGA 2Q6WB 4NZRL 1FZJB 1U2YA 2FT6A 3WTUA 1PNDA 1BWMA 4PGEB 4GAYB 1T0MA 2XKUA 2XWJA 1AHWB 5IJVB 5C07B 4YAQA 3O2VH 5ID0B 5FUOL 4C54A 3GMLB 2RFXB 1JD7A 3S3CB 1F02I 4IHOB 3K72A 1UD2A 2JJWA 5IFAH 5DVLA 4NQQA 3REVA 1RZPA 1BFOA 2MQ3A 2A9DA 2QPDB 4LLWB 1TQTA 1XTMA 3WOVA 4XR8C 4JJ5B 2D4FA 4Q6IA 1QP1A 1XCXA 3FQRA 1G9HA 1RSFA 5DJCA 3H7BA 1KEMH 4AMKH 1IVTA 1OSZA 4L3EA 4XPFL 4DQOL 3W9EB 5IBUB 3DSNA 2R0WH 2C9AA 4GBXD 5KBLA 1LWRA 3I75A 3V5HB 3U30C 1KXVA 1JDAA 3PXJA 1U8HB 3IFPB 4FL4B 5ISZA 3EXJA 5JOPE 1F1GA 4X6CE 5F7DA 1NGYA 5FIEA 3IXAA 4POUB 1TF4A 3B3IB 3H4HA 1CGYA 3U9UB 1V8HA 5KVFL 4A2FA 3T1FB 1VESA 4WFGE 3PG2A 4HIHA 1O9WA 2E5EA 4I3SL 1T0NB 4RRPG 2B9AA 5HHOE 3U1PA 1AR1C 4PJBF 1W8OA 4QWWD 1CDIA 3B83A 4ATTA 1QZNA 2P1YA 4E9TA 4ZD3H 1JXFA 1UYWL 4UBDC 3G6JB 4RAUB 4ODSL 4NIKB 3S98A 3SN6N 3HB3B 2MCMA 5CGMA 5IQNA 3CFNA 3GMOB 2A74A 5SWZA 1OK0A 4WO4A 4QT5A 4DH2A 4CGUB 1HHIA 1H8SA 4JCWA 1ZEAL 3CZNA 3GM8A 2FJSA 3WHXA 5AG9A 2XN1A 1FNEB 3DBXA 4JJOA 1MHPH 3SCMA 2Y9RT 3LNDA 4APQD 4AUJA 2XIIA 1L9NA 2JIXA 2ATKA 2Y2TA 4P5TC 4RAHA 2LU5A 1RZ8B 1CD9B 4HIXH 3OAUL 5IWLA 5D1XA 3FZUD 3GSOA 3RB5A 4FG4A 1PLCA 5GISL 3L5WB 3Q44A 2JWYA 2XIDA 1P6AB 5CN3A 4XBPA 4G1MB 3WJMB 2NNAA 5GS1C 4AH2A 4CW1B 1UGKA 5C0CE 4LF3B 1H3PH 4ABWA 2H0EA 5AVZB 2VRQA 3CLFL 5HGAB 4GRMB 1S7VA 3INUH 1NFDF 2DQCL 2N01B 3CGTA 3T2PA 3V95A 1RZKH 5A6MA 1T22B 2OI9C 1SY6L 3O3AA 3VI4F 1KYFA 4NP4L 4MMXA 3FN0H 4BE6A 5E2TH 1PKOA 3V0IA 1I7UB 4OGYH 2C3WA 1WZAA 3WGVB 4YWGL 3HPJB 9CGTA 2FB4H 3D9AH 4AITA 5KVEH 1NCDH 3HZVA 3FTVA 4HLZH 1E7VA 2OL3H 5KW9L 4M1CD 2W07B 2QGBA 5KSBB 3U0PA 4PTTB 3TO4C 2X0VA 4URKA 4LARL 2EILB 5EN3A 1LQSR 4BWWA 3R4RA 5TDOB 2JK5B 2OSWA 1LMIA 2HJKB 4X7TB 3HKFA 3CHXA 2A5UA 2PXYC 2VLKE 1G9NC 5M7QA 3HC4H 2EIMB 3JV5A 2VM4A 4Y4FC 3OLGA 4Y1AE 1BD2B 5FW8A 1OCCB 1DTUA 1NFAA 3VXTB 3N91A 2X2HA 4P5MA 1F6AA 5CD5D 2B5IC 3OKOA 3MU3A 3B2XA 3I9PA 3RGVD 1O6VA 2R1WB 4H5SB 2CHNA 1JZJA 5D7SH 5FLVA 5GGUB 1PKQB 3LXCA 2IMMA 1TNMA 3ZIMA 3D4CA 4IBSA 3H42H 4Q14A 2OL3A 1DO5A 1XD1A 4JHBA 1SJHA 2XQBL 3G5YA 1JAEA 1F11B 1F8TH 3MX0B 4XVUD 3VUAA 2DJSA 3IPBA 3QFGA 4JFXB 4XNUL 1XVSA 3L4CA 5IFJB 1FFNB 1IIKA 2XWBB 3M86A 3GJFK 3RWEB 1EZLA 1DLFL 2WC7A 3IU3B 2ITFA 3ZTDC 1JK9A 1U8QB 2NY1C 5DZAA 4KKLD 3LIZL 3H3BC 4NQUA 3HR5A 3O3BA 4DGVH 5DD6B 3CD4A 3KBHE 4U4BA 2CRZA 2A1WH 2MOQA 1YEEL 5D93C 2AQ2A 4IRZH 5EIIB 2J8UF 1NOFA 2J8OA 4MDRA 4WUUB 1S9YB 4HAFA 4JHWH 1EEZA 3GMMA 4L05A 5IBUG 5JHLH 1WH0A 1T4KB 5LQBL 5JW5B 3PP3K 3O2DA 2UVEA 1M7XA 4PS4L 2QQKL 4BQ6A 1JYNA 5D1QB 4MNQA 1BMGA 4D0BA 4LCYB 2W81C 3T77B 3LN4A 2E6JA 3BP4B 3KW7A 4F9PC 1RIUL 3G5ZB 3MBXH 4C57C 1HXYB 2JCWA 5EBLB 3WIFB 1O75A 5E5UB 3STZB 1E8ZA 3UJJH 4L48A 4MJ6B 1RMFL 1QLEH 1CFSB 4HHWA 1OLZA 1OT4A 3A23A 4I2XA 4PP2A 5EU3A 3VXPA 3OKYA 3QULA 3SGDH 2I27N 4XT1C 4X0NA 4OQTA 1MCRA 1X9RA 4KH2A 5B1JA 2OCJA 5HYJD 3F04A 3THMH 2PYEA 3CFDB 4N28A 4OBRA 2X1PA 4DK6A 1MCLA 1RPQA 4G71B 1BVNT 4KI5D 5B3NA 1CURA 3QORC 4UTBL 2AAAA 2MEJB 5B1KA 3FQXA 4AJVA 2CUMA 2WINA 3RX5A 4QNPE 4N5EC 1OP3K 3A21A 4XTRD 4P46A 3FOLA 3N44F 4GKOA 4NQXB 3PXHA 3ZZQA 2BP5M 3MBED 3HUJA 2FECL 5TQ0L 5FECA 4PI0A 1IKFL 4RGMB 4JAMA 4FZEH 3FFDB 2ZUVA 1RHHA 1RZGA 2QHLA 3UOAB 2DS4A 3PHQA 4MVBC 3FS9A 4M5ZH 2PLTA 4Y16D 3LVEA 5TGBB 1KJ2H 1AGFA 3BMWA 1CDUA 4NRYB 4X6DF 25C8L 4FTDA 4NIYE 1EJFA 1A1MB 1DQTA 3MUZ1 4AQ1C 2Y6TE 3HG3A 3Q6GH 3M1BA 2L7QA 3GSRB 3GUTB 2QMJA 2AABL 1YEGL 2YBRA 4X42A 3PAVA 1PU0A 4PM1A 4BDVB 5HYQA 5C6PB 1OTUD 1KTBA 3MJ6A 3GTTA 1IT9L 4L1TA 4DPAX 2ZPKL 4HX1B 1MNUL 3U9PL 4QJ5B 5HJ3A 3U1SL 3QT2A 5TFSL 3W39A 3MRMA 1I31A 1JRHI 1IBZA 2Z65C 4PS7A 1F97A 2CRIA 2DEXX 2JLLA 2AMGA 3EFFA 3QQ3A 2CDEB 2ITDB 4QRRD 5FO8A 4J1UA 3ILPB 4NN5C 4WZ9A 2QADC 1NBVL 3NZHL 4P3CL 1NZRA 2WBJC 3J7HA 2B0SH 3BVXA 3K6OA 4YDVA 2LLGA 1RD6A 1SMDA 5C2BL 1KJ2A 3QHFL 2ESVD 2C9VA 2BVOA 1UJ3A 3A22A 3DX2A 1CC3A 2G5BA 5FHBL 1X44A 4LVOC 5K39A 2E75C 4F92B 1N18A 2YAHA 2ALAA 3AUWB 3DETC 1DQDH 3AS0A 5F1IB 4XP6L 4UB0L 4JFZL 1NCTA 4U1LB 3CFTA 4WFFE 5B1AB 4PJBB 4RLDA 2F53E 4U3SB 5F7BA 1F4YL 3K6NA 1SEBB 3GIVA 5E99L 3AWEA 3UC2A 3VWJB 4NKQB 2D9QB 5KSAD 3MRDB 1E27B 3CZGA 3UJTL 1T3FA 3C08L 4K9EL 4NUGH 5FOBA 4FTVB 2EDWA 4XCYA 4EVNB 3T0VA 4MLSA 3F7KA 4A6YB 1UATA 4HJ0D 3WTTA 2Q76A 2WUCL 4PLKD 4H2CA 1FGNL 3S5YA 2NY6C 3GLAA 1QNZL 3HLAA 4LQFH 2GJ6E 1YAZA 3FW6A 4JKPH 4N2FA 3RI5F 3DK0A 4XVSL 3EJYC 3QWOB 5CCKH 1ES0B 1WFJA 1DVFC 4PVLA 5CJQL 1RZFL 1UUSA 4HFWA 2X3CA 3BP6B 2DLTA 1T04B 4HEME 2FYYA 2NLJB 3UAJD 2LQRA 4M56A 4IM8A 1HL4A 4AQ8C 3HS0A 4ZMTA 1KCBA 1YMHB 1J9TA 1BGXH 1KIUB 4UIMA 4KX8A 1M6UA 4GAAA 3L5IA 1NM9A 3PHOA 4CVUA 4XPAH 1W16A 4KJPD 5I8EA 1I4FA 2Y25A 4X5WB 5IHZB 4XAWH 2FSDA 5EIIG 1BMZA 1YEKH 4UU9A 4AJ0A 4QKTA 1B2WL 3SQBB 1Q0YH 2YD3A 2DB8A 4HT1L 4P3DA 1NFDB 3FCUB 2YHGA 3G04B 4NC0B 4J3OH 1DLHB 1FYTA 1ZOXA 1Q9WA 5F7AA 1DBJH 3GINA 4YHOH 4S0SD 2FX9H 3VI4B 1KEGL 4KH9A 4PBVC 3NABL 3U4EA 1Z32X 2VQTA 4YL9A 3WGUB 2EVHA 4XCCL 4M93C 2Z31A 2V33A 3TP4A 3L1OL 5DGRA 1JNJA 1PG7H 3P30L 2NY3C 3KE0A 4LESA 5DEFB 3UH8A 1MVYA 5DS8B 5MEOB 5ECJE 1KPVB 4XP9L 4XI5C 5EZOH 5T1MB 3OAYK 3UPRB 4XC1H 3NH7L 4FXGA 1BX2B 1U8MA 2VO8A 4UM9A 3INOA 4PJDF 4W4OA 2G2NA 2Y36L 3CX5J 1FGVH 4F7MA 4TUKL 1ORQA 5ALBH 6CGTA 1IEHA 2H2SC 4J6RL 2PKDA 4KJQC 3SSGA 5JZ7C 1FH2A 5GS0C 5DRXB 1NQBA 4PJ8B 4X8XA 2X9WA 1IRAY 1TZGL 1GGCL 4TF4A 1N19A 3TH2T 2FEJA 3TL5A 5DO8A 1IC0A 4CDHA 1BOGB 5CEZD 5IP4A 3GT6A 4IOIB 3O4OC 2JTDA 5JPNB 3ZO0A 1J05A 3DV4A 1Z9PA 4Y4HD 1F4WH 2HA1A 3RTQB 3QIWB 4XBGA 4ZUVA 1ZT4B 5BV7C 2NPLX 3T8VA 4M6OH 2XVKA 4DW2L 3BX7C 4PJGA 5T5NF 1YY8A 3BFOA 4Y2NA 5A2LH 2KKQA 3L16A 4M62H 4UI2A 2CIIB 2BNUB 1HAWA 2K6WA 4Z7OF 4GB9A 5E9DB 4Y19B 3S9DB 1FL3B 4M7ZC 4JO2L 5D6CB 3UBHA 3VX0A 1J0IA 4LU5H 3NJMA 4GRLD 1MQKL 1PZ5B 2HPOA 2Z1PA 3CVHA 1HQRB 3L3DB 1HL9A 2WQXA 3DMMC 5BUAA 1S9WB 4DGIH 5JXEC 4F8LA 3ZDWA 2J44A 1UZ6F 4PJEA 3ORJA 1AGBB 2H3NB 4EQ3A 5HI3C 3RFZB 4RMUA 1XCQA 5CZRA 4N2NA 1KACB 2HTKD 2X4UB 3BEWB 5FO2A 1JD9A 1W91A 2J8UB 3PNWA 4ORGA 3RIFF 1XR8A 3F58H 43C9B 1DBML 4I0CC 5JUEL 1QBMH 1C5BL 5F3BB 1YNTB 1IMHC 2XV6B 5F9AC 2H0PA 1C7SA 4G6FD 1JP5A 4PJHF 3WSQL 5JHDA 3EYQC 1GZQA 4Y5VB 5HI4C 5ICZB 2AV7A 1A7OL 5I5RA 3AC0A 1V10A 3BLBA 1EEQA 3SOBL 3CAFA 4U6HB 4FQJL 5KVDH 1JYWA 2WTRB 3LKSA 3UC0L 1EFXD 1MJJB 3QCUH 4HWEL 2OZ4L 1RVFH 2R4RH 3DKHA 3MO1B 4PWEA 3CPLB 1EO7A 3CC1A 4GKZB 1NCAL 3S96B 3KL5A 1ODAA 4GG8B 4JO3H 3KWXA 2YMXL 3PABB 4Q9BA 1NCWL 3HE6C 5EU7E 1YMMD 3DJZA 3ZTNH 2VDKB 2VLME 5E8OB 2ORBH 3BIBX 4YJZL 5BW7A 2EEAA 3G08A 3I9GH 3QYCA 3TFKD 4D2NA 4HOXA 4OCYH 3N44B 4M5YH 3SGJA 4MJJA 2EXSA 3TT1H 4FNUA 1V54B 4NWUL 5T33H 1XEUA 2H9GA 5T1LA 4JFDA 3WHE1 4GI9A 1YEHL 1P4IH 3ZHFA 1MRDL 4RDBA 4D8PA 1JPSH 2IAMD 4HWBL 2GUYA 4EN3D 1P4UA 1SOSA 2ZKMX 3BP7A 1HYRC 4N5UA 1LILA 4X6DB 4AMWA 1NAKH 3APMA 3D18B 1HI6B 1K72A 2J4WL 4OB5L 3QEGL 2Q5BA 3G7TA 1HJBC 4XMPL 3KR3L 2D0GA 2AITA 3ULUL 1LO0H 2ZOKA 4RMRA 2BNRA 5LXGL 4MA7L 4IKJA 4YFDB 2W0FA 4GT7A 3RQ3A 1G7HB 1HZHH 3GRWH 2O5YH 3QNZB 4DEWA 3U36A 1DZ0A 4YXKH 1KCWA 1BLNB 3KPRA 3SY6A 1NINA 2JKLA 1E5CA 1E8YA 4L5FH 4W9CC 3W0WD 4OJYA 3K2UL 1TQCB 5FCUH 1Y0LA 3HMXH 2R4SL 4LCIH 4HUMB 3WFDL 4JG9A 1RZQA 1W0WA 2QHRL 4PVNA 5FYLD 3W2DL 4DO6A 4K3GA 2YGOA 5D4QA 3UFIA 5I9QB 3FFCD 1A4JB 2WGNB 3IDXL 4RWHA 3DX3A 3TA3D 3WUWA 5I1HH 5C09E 2XZQL 5DI8A 2Z7UA 5JW4N 4AIZA 1X7SA 1D5MA 1SXZA 2AV1B 2EC8A 3TYGL 3VD2A 3PL6D 3BD4A 2FZ3B 1IKOP 4Z0XA 2NCMA 3BZ4A 4QXTB 2R2EB 4PIBA 2A73A 5SWZB 2YAQA 2YGNA 2FWSA 3PAYA 1HHIB 3WS6A 3SKUD 1AP2A 1FL6A 1U8IB 1M7IB 4GYBA 1TTUA 4YX2L 3RUGE 5I1CL 3JV6A 3WHXB 3HG4A 2X44D 2X88A 2XQYG 2HFTA 5H37A 3SCMB 4G6MH 3EOAB 4OZHE 4G70B 1R9FA 2NY7H 7TAAA 2GJZA 1KTDA 4TSAL 1QEWA 1F41A 2QT6A 4UDUB 3KH3A 4IU3B 3IDMB 2HFEA 4JANA 5F7EH 2Z4TA 2WLHA 5T1KA 1XF5A 2AQRA 3GMPB 1R19A 2OKMA 4IGBC 2PW1A 2WVVA 3IXTA 4BYHA 3BUYB 4FAAB 4NC1C 5HYJE 4N1CA 1VKXB 1WQVT 5F72S 4NWTL 4M7KL 3E6FB 4YHML 2YD7A 3WLWC 1AGCB 2KPNA 1E6JH 2C9XA 3CU1A 1KNOA 1QRNB 4OVUA 2ADIA 3PWUA 5HJBA 2YD2A 1UD6A 1D7CA 1WZ1L 1OP5H 2X6MA 4M4RB 1RJCA 4YPGA 1Z5LB 4FQLL 3UL4A 5KBDA 5MEQA 4X99A 2FD6L 1XF1A 4HGWA 4Q2ZB 4R2GC 3FPXA 3O45A 1FE8H 4Q9RL 4M03A 3IBEA 4OFYA 1TJHL 3FCGA 3MAWA 3NAAH 5F7FA 2X4QA 2IJ0C 1ZTXL 2P52A 3IDIA 2BOCA 2AJXL 3K5SA 2ETWA 1MG3C 3X1BA 1B88A 4D3CH 1E9OA 4U05A 4V2BA 2F0CA 3NMEA 3QIBA 4PSPA 3DUUB 4G72B 2ZWSA 1A6UH 4HKJB 1NUNB 4PGDA 3SO3B 3FU0A 3RIKA 4KK6C 3OXRB 4A2LA 2UV3A 4DSYA 2YSTA 3D3VD 2VDQH 4PJDB 2XBDA 3M1CA 3QG6B 1HTYA 5I2IB 2N7BA 3NDYE 4PJFB 3SPHA 1HKFA 3CC5A 3ARYA 3UIYA 4AGPA 3ZGHA 4I77H 1CJYA 2XZCL 4J3OF 4N0YH 3D48R 4EJ1C 5LBSH 5DC0A 4XOAA 1YC7A 3UYRL 5JIPA 1S46A 2AK4A 2DKUA 4JX0A 5CM1A 2Z0BA 1ZHNA 3TIEA 2HVJB 1QX1A 2P5EE 4HXBH 4MXWH 3EXLA 4TPRL 1ZVSA 3FRUA 4P5RA 1CL7I 3MODH 3VM7A 4OVVA 5J6HB 2YC1A 4I3RH 3V9FA 3L4YA 2UZXB 3FT4B 2R69A 5LGKA 4XBEL 5CHNA 1FVEB 3V55A 1DJGA 3HC0B 3OZ9L 2ESVE 3AABA 2VKWA 4PIRF 1KG0A 2W65B 1OCOB 1QBLH 2HFFB 1P5UA 4KQ3H 3UYOD 3T8XB 2OJZH 4UQ3A 1RUKH 2UZIL 1JK9B 4UT9H 5KEZA 3R06A 1TLKA 2V7HB 3IETB 4LSPH 4QOKB 4Z7OB 1UM5H 1P4LB 5I8CB 2FHFA 4FF9A 4CKVX 4N8PA 2R27A 3SDAB 5KJ7E 3VW3L 1LEGA 3W3BA 3GM0A 3N42F 1NPUA 3MJ9H 4BUGA 1OKEA 2DWYA 2X4SA 2CRYA 5C0DA 2X1QA 5GRJL 5JA8B 4S2SA 4HS6A 3GMMB 4PR5B 1QFWM 4QYAA 4TQIA 4PRID 4OLXL 4G6JH 1KXQE 4ANWA 1FPTH 3O11A 3KLDA 3LN4B 4AEFA 5H35A 1AD0B 5FUZH 1GGUA 4WV1B 4MAYD 1I7TB 2P46B 1QSEE 3HZMB 1M7DA 4PJHB 4OLUH 4YHIB 5D72H 4JFOB 3X12B 3UPCA 4JM2F 5DYOA 3EOTH 2KZBA 5DLLA 4XNZC 4C4KO 3DVGB 3FH5A 4R83A 5E4EB 1LO4H 2OMTB 3O9WD 3KPNA 2QKIB 2AXJA 1JPFA 2IQ9L 2FQEA 4BQBA 1TTGA 2EDKA 2EIEA 4UOZA 3D33A 3RFRA 2X38A 3MTXA 4GAFB 1O7DC 2JMRA 3LB6C 2Z8WC 4GIAA 4I4WA 2WHVA 2UZYA 4H1LA 4R7NB 2HP4A 4WI9A 4XOBA 5KBPA 3GIZL 2EDXA 2WY3B 3HRPA 32C2B 4HA1A 1U3HD 3E0GA 3S37X 2VMJA 4HYTB 3HUJB 3PWLB 1M9SA 4NQCB 1S5IL 4XGZA 2NY5H 5I5JA 4BZ1H 3ZKQD 5KZCD 1UQSA 3WNJA 1JVLA 2BS9A 2NY4C 2WWOA 3PHQB 5MP6H 1CDHA 4PW9A 3WN5A 1QLEB 3QUKB 5TDNA 2HCZX 4YLQT 5EFIB 1N6QL 5C0JB 3PWPE 1N2RA 3H0TA 1Q9LA 2Y7OA 4MCYB 4CN6A 3SYPA 3KYNB 3TF4A 2V5MA 1ANUA 1JWUB 3V5DB 4U6XA 5SWSA 4X5QA 4WW1A 4Y1SA 2WZ6A 2IDSA 3F7YB 4PI2A 1JRHL 3RL2B 4KO6A 4LBEA 5HYQB 3KNBA 1ZLUH 3MV9D 2FDBP 5IJBC 4EDXB 2BDNH 4PJIF 2CCWA 2VMCA 2H7WA 5ADPH 3Q8CA 2NX5D 3W39B 3OD3A 1G6RL 4LEOA 3JTSB 5B1CA 2JI3A 3FRPB 2HTLC 2A9MH 2RHEA 4URTB 4ZUUB 4ZO9A 4BZ1A 3QQ3B 4A04A 5GZND 1RURH 5JQ6L 2IANE 2Z4QA 1XIWB 4G2AA 4AYID 2X41A 1MZYA 5AVSB 4P2OC 3O41A 2CLRA 4WNJA 4NKOB 4GSQA 4YNYB 1ZK9A 2Y24A 5E4AA 3WTYA 5I1DB 3V4UL 4EI5A 2FO4A 4YEEA 2XTJB 1T89A 2YPLA 4XB3A 4EI0A 2YGVA 4X6FA 5C07E 3LEXB 1OSEA 4Z0BL 2E8YA 2HRLA 1ZA3B 1BYNA 2EC9T 1JXGA 3CN2A 2CE6A 3A6BH 3M7FB 4NO3A 5DQJB 3BESR 3C8DA 3AB0B 3FU8A 1OALA 4LMQI 1TITA 1HXMA 3HB3C 2ICWI 4PW4A 2EUZA 3AXLB 4AI7A 4PJCB 4PV9A 4K3DL 4W6YB 1YNKL 3ATFA 3D25B 4ZFFA 4IDJL 3BVNA 1O6SB 4RMTA 5HXMA 4LDLB 5KSUB 1TYRA 5J8OA 4P05A 4QRTA 4R26H 1A8ZA 4HLZG 4O58H 5D55A 1JZ8A 3MV7A 4BKLA 1E0OB 2VERN 1MJ7L 1UM4H 3WFCL 2OMZB 2WYHA 2UY7B 2GY5A 3CFJA 4UINH 1O6TA 4WHTB 5T5NG 2ID5A 3KPMB 4RDQF 1MJUH 3VXSA 4EE2A 4XZUA 1MHHA 4J3XA 5ESAA 4XMUA 3KD4A 1I82A 2SODB 5IB5A 1J5CA 3L3JA 3VFSA 3BZEB 3EYUH 2CKNA 3ESMA 3WY2A 1RP9A 1F1DA 4AMXA 1I1CA 3BISA 5A16A 1R75A 4GI6A 1MRCL 4L4TA 4OY9A 2XG5B 3QZMA 5E8PA 2GW5A 4DK3A 2OK0H 2DQDL 4JDEB 1OZUA 3G6JE 4MZRA 4BCZA 5EC2B 1ZMYA 2VCOA 3D4YA 3DIFB 4L8DB 5I16B 1QYGH 1ITBB 1MF2L 2F7OA 3QUZA 4UBDD 5JPMB 4K5LA 1KGUA 4JQVA 3T09A 3VRJA 3QARA 4O9HL 4O00A 3T71A 3D39A 4QHLB 4B9JA 3PUCA 1TU2A 3FOMB 1U3YA 5FYJL 4FKEA 1VADB 3W9DB 3ESUF 5CLZA 5CBEA 3H85A 3DRQB 1IC7H 1T20A 3FB6B 4IMKC 2HG5A 1B0WA 1UACL 4JO4L 5FA3A 5IFHL 1D9KA 1MPAH 1X5AA 1DDTA 3OBAA 1D7FA 2JELL 1C5CH 4NQDA 1IBGH 2ZOTA 3VI3F 2C9PA 3DHUA 4LLMB 3TN0A 2DI9A 4P5TD 1YG9A 3DXAA 5B3JF 3PWVB 3BQUC 3EH1A 3MKGA 1QPPA 4P59L 4B95C 4F2MB 3I6SA 2R29H 1P7HL 1KFAH 3NEEA 2X5PA 3AJ7A 2BOBA 4KZ0A 2O5NA 1NCCH 1C1EL 4ZOCA 3ARSA 1UB6B 3HNTL 5D2NA 2V5SA 2CUAA 4MD5B 2JJUA 1KCLA 3W57A 1KN2L 1L7TL 3SKMA 3SDDA 4CMHB 2XKNB 1AYRA 3BWZA 3KLAB 4NQVB 4M5TA 1T03H 4OLYH 3QUYB 2FIKB 4G3YL 4XBGB 3UTSD 4ZAKB 2ICEA 3DJRA 3IF1A 3QCVL 2APVA 2EICA 2OYLA 5F7HA 1HH9A 2VRAA 2QSCH 2XICA 1B9ZA 2IF7A 3CQPA 2CPUA 3N1GC 4QF1B 3H9HB 1WZLA 1Q1JH 3QXAB 4HD9A 5F96L 4W9ZA 4XP1L 4I87A 5KSBE 4HUUB 4F7CB 1I9RH 3BGFB 1PIGA 2A9NL 5FUOH 4Y7MA 3TO4D 3EO1A 4WDIB 1S9VB 4N2HA 2C1OB 1K8DA 3CDZA 4P2QA 5F71A 4HC1A 1AY1L 3DGDA 1E3XA 4ZT1A 1DVZA 2JI1A 5I17B 2PXYD 1UKTA 4Q56A 1BD2E 1URLA 1WAAF 1JWMA 4YQXL 4W9IC 3BH9B 4UAOC 1IM9A 2P5WD 4QRPB 4XWGL 3A0OA 1SDAB 2WMPB 1BZ7B 4Q9QH 5CP7A 4XN2A 4TQPA 3QXTA 2WKOA 3EJTA 3FRPG 4XPFH 2YMOA 1G7JA 4DQOH 3MLPA 3L3KB 3U4BL 3DBSA 1S7XB 1BQLL 1YYLL 1CQKA 5EB9A 4TTDC 1PKQE 4Y9FA 5KYNA 1IAOA 1EXUA 2CO4A 5JHDB 5E8EB 2HT4C 2EEDA 1HHGA 3HE7B 4JVPA 4ZPTA 1EX0A 1IEBB 2AV7B 4MKTA 5E08L 4OCLC 8FABA 2NSXA 4JM2B 1X5GA 1MY7A 2V8LA 3BUQA 4J3BA 1YN6A 3UYPA 4CU8A 5KVFH 4LEBA 1DJZA 2BZCA 4P2RB 5D2LA 5FM8A 5K9QI 3BJ91 4I3SH 1U3JA 3DECA 4ODUA 1SF5A 4P9ML 4U0RC 2EAEA 4I18B 5C0GA 3EJUA 3LN5A 2OULB 1GMIA 2EYSB 3QWRA 1KUMA 2XA3A 4JGJA 1QR1A 2WXJA 2IEPA 2NY1D 2V7NA 5D1ZA 2FIRT 3C8KB 4Z18A 5JYMA 3TH3T 1UYWH 1VSCA 2Y1ZA 1VFOA 1NC4D 2YA0A 2E8ZA 3IM1A 5DWPA 1AD9B 3C6LB 2MHAA 2A6KA 1VACA 1QTSA 4E41B 3NACL 2ED6A 4WUUE 2O93L 3IJEB 2DIBA 4E42A 3B1TA 3PREA 1A6AA 1ZEAH 4JDVB 3LVTA 1Y1DA 4ONHA 4P57B 4AYFB 1E3FA 5D1QE 4Z7NF 3LNGA 5JOFB 3BKJL 1DVSA 3MJ8B 5IM7B 3O3EB 5K9JL 1OAUL 2NUPA 2VISB 1MCFA 1NMCB 3OAUH 4PHZA 3BFWA 4MS8C 4OIBA 5E1AB 2D2CC 4BINA 3V5KB 3BP7B 5GISH 1PQZB 4JR9L 2BP3A 3D3VE 4KX7A 1FNLA 5C0FB 3NJJA 1JZIA 4F20A 4FEMA 4PRHA 2AERT 5E5MB 1U30A 2BNRB 3CLFH 1U8KB 2OR7A 3DX8B 5FC9A 2DQCH 1PCSA 3WDIA 2MNWA 1HHKB 4PJIB 1PYWB 1T1ZA 2GK2A 4K73A 1SY6H 2GC7C 3U36B 1OANA 3LQAC 4G9FD 3QORD 4RBPH 4V1DB 1AQDA 1J87A 2VO5A 4GMTH 5GIRA 2BSSA 1QHOA 1XGZA 2ITEA 4YWGH 4N5ED 3B56A 4UOW0 2BMKA 3JUZA 5KW9H 3QUML 5DD1L 5JW3L 1LK3H 5CZVL 1VCAA 4LARH 1AIFB 4X9HA 3NJHA 1A8JH 1DCLA 2W5PA 1NLDL 1PMYA 5I6LA 4MVBD 1NFIB 3HCVA 1E65A 4JKKA 1JNNH 1LO2L 4F91B 1H3TA 4HALA 4PAZA 3ZZ1A 1QUNA 2EYTA 4O02L 4QHMA 1A9EA 1WWAX 4NRXA 2J43A 3PGFL 1NMBL 1OCZB 3LZFL 5DJ6A 5I15L 3FB5B 4JY6B 4J3OG 1SLWA 1HIML 3H9SB 1DQKA 7CGTA 2R15A 3RRQA 2OCCB 5L9DL 3M88A 3OZLA 5F1NA 3FMGL 4ZS7L 4N24A 4HIIA 2EO7A 5CN1A 3MN8A 1VIWA 4DOHB 3ZE0E 1WHPA 1J5IA 1W80A 2UYLA 2OAAA 1RU9L 4OT1L 2XQBH 1E4XI 3MJWA 3SB3A 3O4LD 5AKRA 5EEYA 4XNUH 2JI2A 2P42B 2YAEA 2EE2A 1AH1A 4WWKA 2AJZA 3LKPB 4Y5XB 3NSFA 2QADD 1DLFH 5AVUB 4FQCH 1INDL 4CVWA 2WBJD 4I5BB 2UWEA 5T1KB 3ZPDA 1FHNA 2PW1B 4EKXA 4MNGA 5H94A 1A4KA 1E6OH 1OVZA 3S6CA 4I88A 3TNNA 3SODB 3IGAB 1XAUA 4OCSL 1M6OB 4PUBL 1FIEA 1YEEH 3NJLA 4L8SA 4F9LC 4X6BB 1HU8A 3DETD 4GQ9L 4FQHA 3FO9B 4DKTA 3C5SB 4PJBE 2UY6B 5DJ0A 4OUOA 4H0HB 5ERWA 1QBBA 2ADIB 3U0WL 1K6QL 3WKYA 3H3KA 5LQBH 1JUFB 4TVPD 4NHCL 4OCWH 2Y4SA 5MEQB 4UZUA 1JV5B 2VR9A 4PS4H 2QQKH 2O1AA 3GHBL 1ADQL 2XWTB 4YDKL 5C0IB 4AQAB 1RIUH 1F1AA 5DZVA 2OTUA 2LGNA 3I02A 4OIAA 2EH8L 1TOXA 2ZKHH 2NY6D 5EUOA 4Q58C 3ZKMC 4L4VB 1M1XA 1RMFH 3LYRA 3EJYD 1RI8A 2TRHA 2VMFA 3ZTJG 5TE4L 1JF5A 4KK5C 3NFSL 1DVFD 1DR9A 2F58L 2WQVA 1YRKA 4MZ2A 1CL7L 1VFAA 4JFPA 2VDOL 5J1AB 1WIPA 4UT7L 5D7EA 2YUXA 3TIEB 3L1GA 3CFEB 3QS2A 2F54B 1OD9A 4FABL 2C9UA 4N2EA 4JFYA 3GSXB 4KJYB 3AGVA 2FWUA 1Z6JT 1G7MB 2YC1B 3DPDA 4KU1A 5KSVB 1NFDE 4UOW1 5F21B 5TQ0H 2VGLM 2YXVA 5IQ9B 4JO8A 1IKFH 1I7ZA 3VI4E 3WFEL 1UZGA 2CXGA 4TUOB 1TDQA 3L48A 3GBLA 1UXWA 4IKLA 1FYHB 2G30A 3GZOA 5SV3A 1XF4B 4FXLA 1SXAA 4C4KT 4RZKA 1QI3A 3SDCB 2APWA 2KS0A 1H8NA 1Q94A 2VDQB 5E2UL 5F1SA 3TEZA 4NAJA 25C8H 3ARFC 1VENA 2NY3D 4CN4A 3GSNL 3QDGB 3QISA 3NFPB 1C08A 1E3ZA 4L1LA 4GSXA 4YDZA 5DUBA 5LWYH 1AQKH 1LEGB 4XI5D 2AABH 1YEGH 5AW3B 5CMAA 2X4SB 4TNWK 2G75B 4N2CA 2VYRE 12E8L 4RA0C 4XWOC 4Y2DA 3EHBB 3DGGA 3QJSB 2GTQA 2ZPKH 2R7EB 1MNUH 2H2SD 3U9PH 2ZOLB 4KJQD 3U1SH 3C6SB 5TFSH 5JZ7D 1LP9A 5GS0D 3D06A 3GF8A 2Q7AA 5AD0B 1SM3L 3IS1X 1OQXA 1FSKB 5EUKA 1U8NB 4BZ2H 4J23A 2WLJA 2A9CA 1SLUA 4P3CH 3NZHH 4KGJA 1CI5A 2Q10A 3CUPB 5C2BH 3QHFH 1KGYE 2A4EA 4KKAC 4Q6YA 1TQVA 5BS0A 3QI9A 1QASA 1R4XA 3KWWA 5CJOL 3ZQXA 2QDVA 3V0VA 2WOBA 1NANI 3HI1A 4HCIA 2FVNA 3I6LD 4JHZA 4HWNA 3O0RL 5HPOA 5E9DE 3CFKB 1RK1A 2X1OA 4Y19E 2X1WL 4UT6H 1WFOA 4UB0H 4JFZH 1A7PL 4L3FA 2WM0A 1CQYA 1WF5A 4MA3A 1F4YH 4JFEB 2D31A 5E99H 3UTTD 4KROB 1JN6A 3HAEA 3DMMD 3BAXA 4CC4C 4H25A 2C4FU 1IE4A 1T6BX 3EGXB 1EANA 3KAAA 3OAZK 3UJTH 5JXED 3C08H 4K9EH 1J11A 4TOYL 2H4EA 5HI3D 4BZ2A 4E9YA 3IFNL 4JW3A 1A1OB 3M17B 2WUCH 4FLOA 3QWNA 1A2YB 1BWWA 3IAGC 1QNZH 2FNBA 5DRNB 2NQDA 5ITBL 3G6DL 5T3ZE 2ENJA 4XVSH 2FSEA 2E7LA 2PMZA 2CK2A 4GXVL 4Z7NB 4WF7A 4TNVK 4E0RA 3Q3GB 1J12A 4JB9H 4PREB 1DFBL 5CJQH 3FUEA 5DHYB 1CE6A 1YJDL 4GMSL 1D5BA 3EYQD 4OF3A 5JORB 2Y2YA 3ECWA 4RDQG 5HI4D 2VN5A 4HZLB 4UT6A 2D03L 4KRMB 1RPUA 3QEUA 4K7PY 3QFJB 4JDZA 1HDMA 4B7LA 4Q6IC 4G7SB 4KTEL 2EDFA 3W81A 4U2YA 5C0NC 3VAEA 3D4ZA 4ZNEA 4FFVC 4W68A 1K2DB 1JPST 1NGZB 3VXRA 4KXAA 2P24A 2VXSL 3D7PA 4OF0A 3HBZA 4WU5A 2A6IA 3BXNB 3FUDA 1B2WH 1Y18B 2F1BA 3ESVF 3GXNA 4HT1H 1KXVC 3HE6D 4EF3A 3D2UA 3QZWA 4X4ZA 2IMNA 4NJ9L 5LHDA 2NY2C 3SDXA 3MV11 1TR7A 1KEGH 5FDYA 3UTSE 4TVSa 4M6AA 1HYSD 4QR7A 3NABH 4DN4H 4FNPA 3ZHDA 4XCCH 2YQ3A 3LS5L 1OOWA 5B8CA 3L1OH 2CLRB 1HZLA 4JN2A 4DP4X 3C5XA 3P30H 5I75C 2AW2A 4R7DA 4J6IA 1AI1L 4XP9H 4DGUA 4G42A 1TZHA 3T2LA 3GLEA 4BFNA 1LEIA 3NH7H 4Z7QB 3VXUD 3T0WA 3WKPA 5DJ8A 3T9WA 2Y36H 5IGXH 4OF7A 4FYTA 4TUKH 5FM4A 3MYZA 1I7RA 4J6RH 4NO3B 4QTIL 4R0LB 4X6DE 4X7SL 3WAJA 3W38A 4F80A 5C3TA 3DOSA 5C0BD 2A74C 3WO4B 4WO4C 4L23A 2OTWA 2P9RA 1TZGH 1DN0A 1GGCH 1QLRA 4QDGA 3R7RA 1D6EA 4OSUL 2IH3B 5CP3H 2B1AL 4ZYKB 4Q89A 4HUVA 3SCMC 4HQQL 3FSWA 4FLHA 4KHXL 2AJUL 4YUEL 3MOAL 3BPCB 3BWUF 4BQ8A 5IWLC 3ES6B 4P23B 1LMKA 2Y6SC 4XAKE 1IGML 4MJID 4ZAKD 5D1XC 2RJMA 3HPLB 4IRJA 5CGBA 4DW2H 2XN9B 3H54A 4HU8A 5DVMA 4M6ML 3VXSB 2OA9A 1E67A 1V7MH 1NPJA 4R4BA 3MLTA 4JO2H 1X7TA 3OKEA 2V2XB 3EGSB 3KJ6L 3VFSB 1MQKH 2X70B 3PNRB 4Y5YB 3QC5X 3BLPX 2R0KL 3TYFA 2E4TA 3CH8A 1BG1A 3ARBA 1GGBL 4NQTA 5F8RC 1CCZA 3B7RL 3L4TA 5F93C 4MMXC 1OARL 3AREA 4UANA 3VX1A 5DA0B 4GG6A 4I9WD 1JMZA 3JSSA 1DBMH 5AVVB 1BIHA 3NRFA 1C5BH 3VRJB 5I0ZA 1CICA 1PLBA 4G8GA 3WSQH 4AT6A 2WXFA 2Q3ZA 1F3DJ 1OO2A 3QQDA 2YPVH 4WWOA 1A7OH 5CNHA 1AFVL 3HC3L 5L2KD 4BH8B 2M1KA 3MYJB 5FA3B 1L0PA 5DQDL 5I26A 3SOBH 4XCEB 3CJJA 5CEZL 4FQJH 1I1AC 4LLYB 1OWRM 4PRAB 3EUDA 4Y0GA 3UC0H 2H6UA 5TH2A 3D85B 1VGEL 2OZ4H 4HWEH 5FPIA 2XZZA 2BVTA 1ASPA 1NCAH 1AS6A 4K7FB 4GW5B 4RZCA 3V0EA 2YMXH 1NCWH 4MFHA 3UDWA 4IGBD 5HHQA 2ZXAA 4JRYB 3QJHA 4RMVA 4NT6B 3WENA 1HSBB 2OMWA 2QPFA 5C0EB 5JO5A 4FG6C 2A9BA 1N70A 1NUFA 3SDDB 2J1XA 3WLWD 1R5IB 1O9VA 4M8QB 1QRNE 2VE6A 1AZUA 4ZMWA 3IF1B 2CHXA 3PGCA 3NRQA 4ZFQA 1OAQH 1NIBA 2ZP9A 2YPVA 5ES4B 4DP2X 2GEQA 1QA9A 4N0FA 4NWUH 3D0VA 4UQDA 5DZOA 2C1PB 1E5UI 5IHBA 1P0SE 5L8LB 3GZPA 1YEHH 4ELMA 4R2GD 3EYVB 4R97B 2F74A 1MRDH 4PY8I 4I0PA 4Q4IA 5E6IB 5HHMD 3D4GA 2VQ1A 3JTTA 1X6LA 3MXWL 2YZ1A 4F7KA 1DDHA 4HWBH 2HVKB 3DTUB 4N2IA 4LXFA 3LX9A 1UH3A 2OW7A 4XNMB 4CUCA 3PDOB 4OB5H 3N1QC 3QEGH 4Q52A 2MQ0A 1JWMB 1I3VA 3QDMA 2GFBA 4PJDE 3ZRCC 1ZANL 4KK6D 4XMPH 2QVMA 1X5LA 3LXAA 3ULUH 4JEGB 4POZC 1BJ1J 5E03A 1Z3GH 4MA7H 3R4DA 5D9SB 3P9MB 1S7WA 4HPYL 4U1JB 4HUXB 2P45B 1QSVA 3GEFA 2ITCA 4N4YB 3MNMA 1EEYB 1IAOB 2P5PA 1EXUB 4GLRI 3T6WA 3N0PB 5KVEE 2HSIA 3OHXA 2J2ZA 1TVHB 5EA0L 3GXPA 1X6NA 3K2UH 5L8JB 3O4LE 2Z7ZA 3BUPA 4OQ1A 2C3GA 4Y8DC 3EG9B 1CDBA 2R4SH 4LAQH 4U6YB 1ITCA 5EC1A 3N0AA 3VG0L 2FUQA 3NPSC 1IBFA 4WFHD 3WFDH 1MEXL 3K3QA 3ZL1A 3K6SB 2QHRH 2I5YL 4FJYA 4HWBA 4ZO8A 5B1JC 3RDTA 2IWGA 3E3QC 2BC4B 3IMVA 3VACA 1DUYA 3DX9A 3NK4A 3IKCA 1OE1A 1S4IA 1ED3A 2YD9A 3IDXH 1F6FB 3B3BA 3BO8B 4QOKE 4Z7OE 5IUSA 5ABDE 1LK2B 3KYOB 1U8CA 3TCLA 2GTZA 4LDEB 4FHJA 5AB2A 4N0UA 3TYGH 1DQVA 5HI5C 3WD5L 3PQYA 4P46C 3TWCL 4YC2C 2N0KA 2R2HA 4MQ7B 2HX7A 5HYEA 4A7UA 1BSIA 5FV2A 4HEPA 1UZ6E 3L1FA 3B8YA 1TENA 3ZOAA 3BHBB 5I6MA 5K93A 4KUZL 4YX2H 4KDTA 5I1CH 4KFZC 2ZX7A 3NZSA 4K2UH 3A5VA 4ZO7A 1DQQA 4TSAH 3DO4A 1U91A 2ZUXA 5C86A 4LKXB 4K5MA 2NUPB 4PJHE 2DOCA 4U1KA 4AL8L 1BAFL 2F1EA 5AALA 4YZWA 2QGDA 1A64A 2XFXB 2DQFA 1OGAA 2XXGA 3V8CA 2Y7QB 3UCQA 1T5WB 2VAJA 1I1RA 5I76B 1M9WA 4NWTH 2FQGA 4QHUA 4M7KH 4HLJA 1MCWW 2WJ7A 3ARDD 4YHMH 2WZAA 3QPQC 4YGAB 1CTNA 3RZCA 5C0AD 3MRPA 3BZFB 4JFFA 1L0QA 1UC6A 2BSBA 2QL1A 3RPIB 5FYLL 5C8JB 2HN7B 4S1SL 4PPTA 1WZ1H 3VD4A 1W9XA 3I6GB 3BH8A 4FQLH 2NSMA 5LDSA 4JMXA 2DMGA 3PJSB 2FD6H 1UJ3C 5J7CC 2WP3O 3OGCB 4Q9RH 4HBQA 4NQCE 1TJHH 3C60A 3PF2A 1SDYA 5EO1B 1KB5A 2AJXH 3UGUA 4P04A 1T4WA 5F9WB 5K9OA 1LD9A 1X5FA 2K3HA 2NY4D 1P7KA 3LV3A 1Q0EA 3HCVB 3NA4A 5CFAA 3WMPA 4IYKA 1JJUA 3I3BA 2IGLA 4I3GA 3BVVA 5F6HJ 1USZA 5FX3A 3BPNC 4R96A 2WZ5A 2WIMA 3VGHA 2XZCH 4YZFF 5HDLA 2DAVA 2I9LA 3UYRH 4WI0B 3VQ2C 3ARTA 1MCKA 5F9DC 1E4XL 3KM1A 4LP4A 3BMVA 3PV7A 4TPRH 1AHMA 3U25A 4GS7B 2ROXA 4LT7A 3IJSB 3B9VA 1D5RA 2DQHH 3VFOB 1RK0A 4OD3L 4RWYH 2HTLD 1PZ2A 3EYFA 3QW9A 3LRMA 4XBEH 3ZTCC 2HLEB 4LCWB 4Y1TA 4ZMOA 1A25A 3EJQA 2CMRL 3OZ9H 1Y7VA 1Q72L 3IN0A 1UADC 4WJKB 2YOCA 4FQXA 3MCG1 2H6PA 2UWEB 2UZIH 3HS0C 5I6NA 1AYOA 2BPBA 4P2OD 5AOJA 2Y07L 4K71B 3Q5TA 1NH6A 3T65A 5KTEL 3I6LE 1LXMA 5LBGA 2A83B 3BSGA 2W80C 3P0VL 2XTJE 3NZ8A 3CHRA 4Q8BA 4X6CA 3IGKA 3U9WA 2MWCA 1WD8A 3ASNB 3QSKB 2AVFA 3ELAT 3MRHA 1QMUA 4F7TB 3CN4A 3SOTA 3IDGA 5J6SA 2LE9A 2EDQA 3E9UA 4TXVB 3IEAA 3ZZSA 1S7UA 1F42A 5HHOA 2ZUQC 3V9CA 2Z31C 5J57B 3ROLA 5A3IC 4PWKA 1U8LB 4LLDB 2E86A 5KOVC 3OKMB 4HJJL 4R9HA 1HILA 3FQUA 3TX4A 4HUWB 1KC5H 4WJ5B 3VGAB 5JQHC 4UTAA 4FXGC 1N8ZB 2AXGB 3IFLL 1BCIA 1TJGL 4W4OC 2W9DL 2XWDA 3IFOA 1H3UA 4W9GC 1TO5A 2DYPD 4NNXB 1NBQA 2VWEC 3DX0A 2O61B 1X5MA 3OG4B 4J2QA 3CZEA 2IQ9H 3RX7A 4ERSL 2VLJB 1T1YB 4K4KA 4NQED 4P5SA 1DL7L 3FSVA 3FT3A 4JPIA 1RJZB 3ATDA 2YA1A 5SX5K 2HRGA 1BMWA 1S7SA 2CIKB 3CBKB 4U1NB 4N9GB 1CFTB 3CZFB 3HHSA 2APTA 4CNIB 3PDGA 4QPEA 2ZYRA 1P7QB 1ZVHA 4WWPA 3GMRB 2BHZA 3L6FA 3DJ9A 4G6KL 1PX3A 1DQJB 1ECYA 2V9QA 4JE4B 1I7ZB 1S5IH 2YEZA 4JG0L 5C0CA 1J86A 2X4OB 4FHBD 1HK6A 2CO7B 2YXWA 3I6KB 5AW5B 2GQHA 5SX4H 3LKRB 3SO5A 1DO6A 3RJQB 2YQBA 1N6QH 5E1IA 3FDWA 3Q0HA 1CDGA 1WFNA 2ZWLT 1AOHA 3DJSA 3HJEA 3RPKA 2BVQB 1I1YB 5DQ9B 3RWHA 1PLAA 3SE9H 3WU1A 2JB5L 2X4RA 2WKGA 3E2HB 1JRHH 1D6VH 2ADFL 5BRZD 3V4VA 1OAZL 1AZRA 3CPUA 2WNGA 3ILDA 1WO2A 3QFDB 3QFJD 5E7FA 2XX1A 1SXBA 4ELKB 3DGGB 4F2ME 4JLRB 5E00A 4NN6C 1FNHA 2DLHA 3SPCA 1ZGLA 3BQUD 1GIGL 3WJLA 1KLGA 1I8IB 5JIKA 2WANA 5DFVC 5ABZA 3WNNA 4Y1AA 3EBHA 5JTWA 4QTFA 4LLVA 3UBXA 3VYPA 4A7QA 2P48B 1K8IB 3RP1A 1OAJA 2LTQB 2VR3A 5JQ6H 3BKYL 5FFGA 1NDGA 3MNVA 1A02N 4JFWA 4MJIE 4UM8A 3IWUA 2FWOB 1WFIA 3EH3B 3ECUA 5AB0A 4AY0A 5CF3A 5K69A 3RY6A 2XDHA 4QXWA 5ENWA 3KWWB 2PYFB 4OFVA 4FE9A 3V0VB 1TCMA 1RAMA 3HI1B 4MD0B 1KYDA 1WZMA 3ULUF 3WNLA 2AEOA 4Z0BH 1LJMA 1NBYA 4NRZA 4OR1A 5BW7C 4B7IA 5D7LB 3MRQB 2E59A 4NNYB 4UQEA 1T2JA 5EZIL 5KYYA 4I48B 4K3DH 4QRPE 5AKTA 3VXQB 4DZBA 4JFSA 2CALA 3SGJC 1G7IB 2X42A 4FFWC 1C12B 1I9EA 1CFNB 1TVBA 4IEFA 3QXDB 2Z92A 4BHUI 3GXTA 4BH7B 2KERA 1I1FB 3HRZB 4NEHB 1IO4C 1MJ7H 3WFCH 3FTWA 2WBWB 5H4YA 1TKWA 1BQ5A 5DC4B 4TTDD 4E0RB 5L2KE 1FL5B 1W72A 3DGCR 4K94C 4QJ3B 4ZW5A 3WEOA 2HJLA 2HT4D 1KBWA 1TVDA 5K9OB 5TK2A 1P1ZA 1AKJD 2BNQB 4F8QA 1ZDSA 3OJVC 3QDJB 4NC2B 2VQ4A 4JDZB 3WLBA 4P2RE 4Q74A 3N43F 2Y22A 3CSPA 4X7CC 3GBNL 4JRXD 3OLIA 1A6WL 5LAPA 4HSCX 5I5MA 1MRCH 2Y1AA 4AX3A 4X98A 2QPSA 1MW2A 4HS8L 4K0OA 3MR9B 1D5XB 1MF2H 5FKPA 5TPWL 4MQTB 3JVGA 4M00A 4Y2OB 4E41E 4O9HH 3V79C 4GPVA 4FHKA 2J5WA 3H9ZA 3S8WA 3HTLX 2VZSA 1CPUA 5FYJH 5INDB 4LE8A 2YEQA 4XMKL 3TZVA 1WDAA 2FH6A 2P8MA 2EKSB 2V5RA 4PWGA 5GRZA 3BDBA 1UACH 4JO4H 5HHME 3V6FB 3CXFA 6PAZA 2C4XA 2H3XC 4M8RA 5F6IB 5IFHH 5KVDE 1BZOA 2JELH 1R24A 4GXUM 4ZUSA 1MN4A 3NCFB 4OZ4B 1JPGB 4XPBH 4MS8D 3GSVB 3FYEB 3CCHB 1QSFB 4JKMA 2YXFA 4MASA 2BCKA 2PTUA 3RWIB 4AV5A 1C1EH 1QLRB 1MH5B 4MJ4A 3WS6C 1FUNA 3HNTH 4LL9A 4A37A 2X53A 2Z35B 4AYMC 5MEND 2P8LA 1J9SA 1FRGL 1KN2H 1L7TH 3V4PL 4PJIE 1OB0A 2MQGA 2Y3NA 4NHUA 5KJ4A 4YHPB 2DQEL 4IS6B 2VDPH 4H0GA 3F8UB 4G3YH 4V1DE 5D7JA 4D9RD 5C0RL 3FUJA 1KJVB 4Z3TA 1CXKA 4PV8A 3U6XS 3NQKA 3BUIA 4IRJB 5JNYA 3AUVA 1ILSA 1BYOA 1LHZA 1O5DT 3RNQB 5J6GA 4XP1H 1WBXA 3II1A 4MZIA 4OJAA 4LKCB 4GQQA 2NXYB 5HGHA 2A9NH 2F9BT 3MLTB 1HJCA 3FB8A 3JWOC 1XGRA 3RIAK 1MRFL 2H45A 1OLLA 4G59C 1AY1H 3QJFB 4QAMB 3QZOA 2PCFA 2R56L 1JDCA 4YQXH 3KBPA 4EDWH 1PDKA 4XWGH 2UZPA 3L3GB 3EOYG 3AAZB 3WS3A 4GRWH 4RAVB 2IV8A 3LS4L 4LSTL 4U0QB 2M26A 3WIAA 1TCRB 2IXQA 1MUJA 2VM9A 2VJ8A 4TLKA 5D96C 3MFFB 2F7IA 3H9SE 4PCKA 3U4BH 1RZJC 2ZD0A 3V10A 1BQLH 1ZA6A 4ZFOA 1B0GA 3TBSB 2K78A 3IJ8A 3T0EB 4ZQTA 4GKSA 2YD6A 2F53A 4DOHE 5ESQB 3FQTB 2HH0L 1FVDA 2DL9A 3QIBC 5JR1L 3MMEA 1F3DH 3E1ZA 4U1IB 4LCUB 4X8GA 4DGYL 1NBZB 1REIA 4FI6A 4ETYA 2EH7L 1U58A 1FZKA 4XXWA 1W0VA 2ERJC 3O6ML 1BPVA 3HG1D 2EP6A 1CGTA 5TH2B 3VXMB 2NMSA 4EZJA 4P9MH 4Y9BA 3TVMA 1M71B 2GB2A 4HJ1A 4UQIM 3GZQA 4DJMA 3EOBA 4QRFA 3SQRA 4A66A 4PJ5D 3SBQA 5J9PB 1IGTB 4NUPA 4HEMA 4FXKA 2VITA 1IM3A 2ZX8A 5EU6B 3X3GL 1XH2A 3NACH 1GVIA 4LHUD 1ZE3H 1IBHA 3FU7A 3B5HA 1KIPB 1NCJA 4XMWA 1G9NL 1P5UC 2VRKA 4LOUC 2G3NA 3SJVB 1B4JL 5MEPA 1TJXA 4BFGA 3BKJH 5F7WC 2ZX9A 5IVXF 4I0PB 1JWSB 2VQ1B 2D7OA 4M61B 4LCCA 1DDHB 1H15A 1I8AA 3ECQA 4PRPB 4YEFA 3QG7L 4WTZA 2XRAH 4JR9H 5HDQL 1S5HB 1LNUB 1OSYA 5LAXB 5IB1B 3ZKMD 3BKML 2GSIA 4L1BA 4UQCA 1EDHA 3VI3E 2YSSB 1QW8A 1EAPB 1A5FL 3ARXA 4FMKA 5B3JE 1VA9A 4KK5D 1Y6MR 3SPGA 5BO0D 3BFQG 4HJSA 1KFGA 1BJ1H 1CXEA 4ENZA 3P3TA 3TPUA 4Z7WB 4Y4KB 1FFOA 3GUFA 2F54E 4PRNB 1K5WA 2IWKA 2XC8A 1H3XA 2ARJQ 2EDTA 4DP0X 2JJVA 4Z78A 1A6ZA 2IADA 3P4MB 3P0YL 3QUMH 5DD1H 5JW3H 4CL7A 1QLFA 2J6EA 5CZVH 3VTTA 4AW4A 3PGDA 4YXLL 4JO1L 1S7QB 5A43C 1GPOL 1ZTMA 4D0DB 3ET9F 2BXYA 2WZPD 1OB1B 3QDHA 1NLDH 3IU4L 4XN7A 2DYRB 2TSBA 3ZW3A 1TQWA 3EDKA 3QIUB 1LO2H 4BK4A 1MI5B 2GAZB 4N20A 1NCOA 1ZS2A 1A7QL 3WV0A 3PWNB 3QDGE 3R7QA 1G94A 4IRSB 2D0HA 2G60L 2AHIA 1OCWL 4BIKA 1QRKA 3LZFH 5CIPH 2OQJA 5I15H 5D70L 1QABA 4AGNA 1HIMH 1YUKB 1WAAE 4TRPL 4BFRA 5L9DH 1P53A 1U95A 2IBGA 3FMGH 2CLZA 3FU3A 4ZS7H 1UWGL 2HLFC 4XWOD 1OM3L 5IF0B 3BYTA 3EH5B 3CFBB 3FH8A 1TMCB 3EYSH 3TFBA 2QJDA 3WN5C 1RU9H 2J88H 1Q9OA 4OT1H 2CPCA 1JFHA 3QJZA 2BWIA 1Z9LA 3Q6FB 4PBDA 3QO0A 5IB4A 1A9BA 1JSYA 1R3HB 2OMXB 3FXIC 3LD8C 5GRXG 5D6DA 1WA1X 2NYKA 2I25N 5CLYA 1PJWA 4L9LA 1FV1A 2N7SA 1G87A 2GVYA 3HI6L 4P4KB 4OF8A 4GFXA 4ADJA 2X4NB 1FO0L 4KHTL 4QO1A 2C7UA 3MGAA 1KBBA 2XYBA 4KKAD 4NQEE 4APQA 2WYZA 4JKWA 4GKNA 4LCVA 2VABB 1QHQA 4PUBH 3N43B 3OXSB 4Z5RB 4GQ9H 2BJMH 3SYQA 1KBGL 1PZUB 5IJCC 5DU7A 4AIXA 3VQ1C 5E8DL 3F12B 3VFUA 4AQEA 2ED7A 4JFEE 2QTVA 3NCYP 3GNML 1A4AA 2I69A 1Z3RA 1K6QH 3P77B 4NO2A 4G1EB 5DD5L 4NHCH 1ROCA 5DD3L 4ZXBB 4N8VA 4NENA 4GW4A 1RJYA 2CA4A 4H20L 4FADA 5I30L 2ZXGA 4UQBA 2JJSA 4JZNB 3SDYH 3GHBH 1ADQH 1MCBA 1FNGB 1XF2A 1YEJL 3Q7JA 3F5WA 2OXGA 3ZXAC 4EI5C 3LJ3A 4DEPC 4XCNB 3FQWA 5CJBA 5F0MB 1T89C 4AENB 2EH8H 4L37A 4KXCA 2H3KA 4Z7NE 2D3NA 5FK9B 2HMIC 2YIHA 1SDDA 4NCC2 3GRBA 1F3JB 1F2XK 1U3NA 2C26A 5TE4H 3TIDA 3X14A 3VDBA 2GC4C 1NGPH 4IBVA 3NFSH 3KGTA 5GGVL 1T0OA 1XCTA 4ORZC 5IBTL 1OZTG 2F58H 1FZMB 1I3RA 3N9GL 3NJXA 4HF5L 5T3XD 3E38A 4KKBC 4W6XB 3MLRL 3QFJE 3BT0A 4HUNB 2XFGB 2VDOH 3K71B 4NO5B 4UT7H 4Z77B 3ZK0A 3ASWA 5B38A 4WNQA 5T1DL 4ISVA 4FA7B 4FABH 4FFVD 4U1SA 4L3ED 1CDCA 3QQ9C 3OX8B 4PU2A 2A6DB 4L0ZA 4KNUA 4NN7B 1KCVH 1MWAL 4LVNB 1IAMA 3MLZL 2SEBB 2NY0B 3WFEH 2CK0L 4PGCB 2P7TB 1HFUA 4YGVB 2QR0B 5FFLA 2MOGA 5ISZD 2JF1A 2NY2D 1D3CA 3S4SA 1II4E 3NIFF 3OKLB 3UEZA 4E5XB 3ML9A 3LRGA 2OJEA 1HHJB 5TTRA 3FCSA 5EOTA 4X5RA 1OE3A 3FBQA 3ZZLA 5CGTA 5E2UH 3QJUB 4TVPL 1S9XA 3WIHL 2Q86A 5IIEB 3GSNH 5EPMA 3NZ8B 5LVEA 4NCC1 2F61A 4IKIA 1WCQA 1RCYA 3OKNB 2FGWL 3WFHB 4W9FC 12E8H 2VH5L 4NZUL 4EKJA 2XBTA 1KTLA 3HHRB 3KYKL 4QCIA 5D5MF 5E4OA 5HYSB 1FVCB 3HNVL 3QUZC 4JQVC 2OX5A 3Q8AA 5H4ZA 2KI6A 5HHXL 4F3FB 5DC2A 4H26A 3UZVB 1NC2A 2ZYHA 4AYDC 1IGCL 3V4LA 5C09A 1BIIB 1EZVX 2F19L 4WO4D 3ZKXC 1B3JA 1SM3H 4X4XA 3WE1A 1JOIA 3FQYA 3OC8A 4MAUL 1CXLA 4X4YA 3QUHA 4U31A 1M05A 4I8DA 5DRWA 3MRLA 4AVIA 5I0WA 1D9KC 3F83A 3BSZL 3IAQA 1SQ2N 3ZE2F 3UXFA 2JIXD 3TN0C 1E28B 4MCNA 3S5ZA 4UV7L 2YOAA 5K59F 2EIZA 4HH9A 3KXFB 5KYWB 3DTDA 2Y6SD 4GO6B 3GSNA 3PJLA 1BG9A 5CJOH 5AW9B 5FWRA 4B6ZA 4BK8A 4OD2A 1MLBB 1HOEA 4MMYB 5I6XC 4B0MB 3O0RH 1PPIA 3M1OA 4YSUA 4OZHA 4GRWF 2PPCA 2XQ0A 3SGEI 4BSJA 2OMVA 5D2NC 4KNSA 2WV3A 3FF7A 4JPIB 2FBOJ 4ZFGL 2ZG3A 4YSPA 5EO9A 3NN8B 3NTCL 3P9LB 4NQSB 1FJ1A 4MA8L 2DQ6A 1A0QL 3HZKA 4MHHI 1ND0B 1DUZB 3MNZA 2WSDA 2ICEC 2WO4A 4QHKI 4Y9CA 5IQLA 3S7GA 2VXQL 5DEGA 3U7WL 2ATPB 2XV3A 3IFNH 2OMYA 2XUWA 4FZ8L 1GYWA 5HY9B 3IJHB 1IGYA 2N0MA 1U93B 2GCYA 5ITBH 1TIUA 2ZSVA 3G6DH 4PG9A 1JNLH 3JV4B 1G7PA 4GXVH 3GRGA 4PGZA 1N3NA 3GPEA 4OF5A 1DFBH 5B39A 4KXZI 1YJDH 3BT2L 4GMSH 5JDSA 5GS0L 5IVXB 3UJIL 4CU7A 1KCRL 1OGTB 2D03H 3B2UC 5AOKA 3D07A 5KVGL 4KTEH 1I1AD 4WI7A 3MREA 4Y16A 2Q3XA 5JIMA 2EYRB 1FC2D 1JCVA 2VAAB 2F68X 3X1EA 5T1JA 2VLKB 5BV7L 3A4FA 4OGZA 5B1BB 4BJLA 3LCYA 4JCLA 4DTGL 4FCHA 3VGDA 3VWKA 4LLVB 3UBXB 3O2WH 3C5ZB 4OM1L 1WLHA 3ZN6A 4NJ9H 3AWGA 4FG2A 3REWB 1J0ZA 4CVXB 4WAFA 5D4HA 3STLA 1GZPB 2PABA 4DEUA 2YO3A 4X2UA 4FG6D 1MCJA 3LS5H 1AIZA 3CSYA 5EULV 3H6AA 1IGIH 2NDFA 2VLRD 2P5EA 3FUIA 3OMNB 2DMCA 2LU7A 2RD0A 1ZLSL 1AI1H 2VDLL 3A4AA 2ILLA 2WXQA 4X4ME 5DMJB 5D1ZC 3GXIA 1TETL 4WKZB 4QTIH 1RXLA 4X7SH 3GC3A 1EAQA 1HQ4A 1D2PA 2PO6B