5I26A

Azurin t30r1, crystal form i
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
128
structure length
127
Chain Sequence
b'AECSVDIQGNDQMQFNTNAITVDKSCKQFVNLSHPGNLPKNVMGHNWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEGEQYMFFCTFPGHSALMKGTLTLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Azurin
publication title Determination of nitroxide spin label conformations via PELDOR and X-ray crystallography.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Metal binding protein
total genus 30
structure length 127
sequence length 128
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2016-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 5i26A00
1HAUA 3QJQB 2ZXWB 4YSRA 2XV3A 1GS6X 1PAZA 4QLWA 2AFNA 1ET7A 3CDZA 3S3DB 2YAEA 5B1AB 1SHWA 2DYSB 4YL4A 5PCYA 2DYRB 4A2FA 2IDSA 1ZDSA 4A2DA 1SNRA 3NP3A 1GSKA 2GC4C 2BP0B 3CVCA 5ANHA 3FQ2A 1PZCA 2XV2A 3H4FA 2GBAA 1PNCA 2BZCA 5I5IA 3QQXA 3ZBMA 1NIBA 2FQEA 4DP8X 3X1FA 4AKQA 5D4JA 4Q89A 1M56B 1KDJA 3SBQA 1MG2C 4HAKA 1J9RA 1AZNA 4BXSV 1DYZA 2IDUA 3NJLA 4CSPA 1IBYA 1AZUA 1CYXA 3FYIB 2QT6A 2GC7C 4GYBA 4P5RA 1BEXA 2FQDA 4YSTA 2TSAA 2NRDA 2AANA 2I85A 3C75A 4A2EA 3NJHA 3CG8A 4KO5A 1WAEA 3AW5A 1BYOA 1DZ0A 2UXFA 3DKHA 3NJJA 1EHKB 3ABKB 2BP0A 3H56A 2CAKA 2W88A 1NWPA 2WSDA 5I6PA 7PAZA 2PCYA 4NB7A 1AIZA 1GY1A 2XLLA 3BQVA 1J5CA 4FA7B 1AAJA 2FNWA 2PPEA 5EHFA 1SHXA 3T6ZA 3UADA 1R1CA 1AANA 1L9SA 4DP5X 1L9OA 2XX1A 3TA4D 1NPJA 2HZHA 4E9YA 1WA2X 3DIVA 2IDFA 1E65A 3FU9A 4DP2X 3S3BB 4E9RA 1TEGA 2JKWA 4M4RB 3WI9A 1ADWA 1N70A 4G70B 2QDWA 2OV0A 3N2JA 2EILB 2P80D 2CCWA 3X1EA 3FSVA 1J9QA 3T71A 2VM4A 4UF7C 4NAJA 3ZDWA 2QPDB 2H5UA 3SQRA 5AFAA 1JXGA 4M3HA 1I53A 2E86A 3PAVA 4DPBX 3PPSA 1YLBB 4AKPA 1PZBA 2VSMB 1J9SA 3G5WA 4GP8B 3WNJA 2VM3A 1RKRA 4F2FA 3AY2A 3S3CB 1PMYA 1OE2A 4E9XA 4G72B 3UGEA 2FQGA 2XXFA 4P5SA 4A2GA 1AQ8A 5F7AA 1V10A 2XU9A 2PLTA 1KCBA 3CDZB 2VMJA 1AOZA 2OCCB 1XB8A 2BP8B 3JTBA 1AS7A 1E5YA 5B1BB 5TK2A 3ASNB 2B3IA 3GXUB 3QJRB 4KOCA 3KW7A 4A67A 3NJKA 2GSMB 2MRYA 4YVUA 2H47C 3T6WA 3FPXA 1T5KA 1BQ5A 2VN3A 3T6XA 1JOIA 1CUOA 1PCSA 3CVDA 2FT7A 3TU6A 2YAHA 4TXVB 1AZRA 2YAQA 3EHBB 1MZZA 4GP4B 3GYRA 2GIMA 1MZYA 1ZIAA 1ILSA 2R7EA 5B7EA 5B7MA 2ZOOA 4K9JA 3FSWA 2IH8A 2BWDA 4A68A 4BK5C 5I6LA 3S8GB 3IN2A 2GHZA 3V9CA 2BP8A 4DP4X 1L9TA 1AZBA 2EIMB 1SF3A 2EIJB 2PPFA 2BWIA 4RH4A 1L9QA 2X88A 5D4IA 3T6VA 4X4KA 3QPKA 1BXUA 4DP1X 1SDDA 1AG0A 3MBWB 2J56A 4UAHA 5I6NA 1OCOB 1BXAA 4KNSA 4W1TA 1GYCA 3NSDA 4G7QB 2N0MA 1KBVA 4W9ZA 1GS7A 4GY4A 3QJVB 3X1NA 3EF4A 4DP9X 4GP5B 2B08A 2FQFA 4E9SA 2RACA 3ASOB 2YARA 9PCYA 5I6OA 1NTDA 1W6LA 2HRGA 2XVBA 2YXWA 2UXGA 4YVNA 8PAZA 4KNTA 2AVFA 4DP6X 2ZWNA 2XV0A 2BHFA 1ET5A 3SBRA 2VW7A 3ZIYA 4E9WA 2HXAA 1AS6A 3NT0A 1CC3A 1ILUA 3OMAB 5D4HA 1WA0X 2DV6A 4G71B 1RZPA 3UABA 3FYEB 1XB6A 4YSUA 2IDQA 2LLNA 1JVOA 3NJFA 2UXVA 4HZ1A 1TEFA 4E9QA 1JZJA 3FPYA 1UATA 2DWTA 1RCYA 2J55A 4ENZA 5B3SB 4KO6A 1IUZA 2Q9OA 2JFCA 1MG3C 1PLBA 1ZPUA 2BW4A 3TBBA 1JXDA 3WKQA 1OF0A 2CALA 1ASQA 4YSDA 4N4YB 5B1JC 3FS9A 3WKPA 1W8EA 1KBWA 1OE3A 1PF3A 1A4CA 2YAFA 1ET8A 2PP8A 2Y1AA 1SJMA 1OCRB 2XXGA 1JZEA 2EINB 5TK4A 2MTAA 1BQRA 4G7SB 7PCYA 4JHUA 1IBZA 2TSBA 1NZRA 1IC0A 2YXVA 3FQ1A 4CSZA 1A4AA 3OMNB 3FT0A 1EZLA 1URIA 4DP7X 1WA1X 5E9NA 1IKOP 2H3XC 2R7EB 3D12B 3ABGA 4BDVA 5I28A 2YAOA 2HX9A 3WG7B 4E9VA 1ASOA 2I7OA 2HRHA 3WIAA 2HLEB 4A66A 4HIPA 2EIKB 2AZUA 1XB3A 3FU7A 3MX0B 5B7FA 1M57B 1JXFA 4UANA 1CURA 1L9RA 3KW8A 2FJSA 3FQYA 3NJIA 1E30A 2FWLB 3IBOA 2GB2A 3DTUB 2IWFA 2XUWA 1SDDB 2BZ7A 2J5WA 2OJ1A 2YQBA 2QPEB 2UX7A 4BXVA 2VSKB 4BWTA 1RZQA 3OQRA 4MFHA 5A7EA 1OCZB 1JZIA 2HX8A 1B3IA 1FFTB 2A3TA 1F56A 3CZUB 1NICA 3FSAA 2CJ3A 1PLCA 4HALA 3V9EA 1L9PA 1JZHA 5AKRA 1V55B 2IAAC 1KV7A 3X1BA 3HEIB 1OV8A 4GXFA 4HCIA 1SFHA 1NWOA 1J9TA 3UAEA 4G7RB 2VW6A 3NJNA 3NJGA 1JZGA 3ABMB 3X2QB 2YAMA 1WS7A 1E5ZA 1X9RA 3L45A 1OCCB 1A8ZA 4Q8BA 3PLYA 1FWXA 4DP0X 5IY5B 3IEAA 1M9WA 1JVLA 1GR7A 4KNUA 1HAWA 1OE1A 2QDVA 1ZV2A 2Q5BA 2DWSA 4F7KA 2HX7A 1JZFA 3NJMA 5FC9A 3UAAA 4A2HA 3PAZA 3ABLB 4FAAB 5B1KA 1GS8A 1TKWA 4YSPA 2PP9A 3N55A 5I26A 1NPNA 3PAUA 1NIEA 1MDAA 4KO7A 3NSCA 1ASPA 2FT6A 5AZUA 1AS8A 5LDUA 2J57A 1AR1B 1AACA 4DPCX 5PAZA 1E67A 2JXMA 2XX0A 2AZAA 2PPDA 2XWZA 4AKOA 1OOWA 3H4HA 1VLXA 3BVDB 1TU2A 4PCYA 1KGYE 1A4BA 1GY2A 3T9WA 4YSCA 3ERXA 2UX6A 2YAPA 4DPAX 4QKTA 4ZK8A 1KCWA 3S8FB 3IE9A 1PY0A 3QJUB 5F7BA 1XMEB 4BDVB 1V54B 2IWKA 3CVBA 1PZAA 1JERA 4EF3A 5B1JA 3NSFA 4BWWA 2GI0A 2PP7A 5I6MA 3AG4B 3AZUA 1ZIBA 6PCYA 3FU7B 4WTQA 3AG3B 3TBCA 2WO3B 3ZX1A 1A3ZA 1ETJA 1N68A 1PNDA 1X9UA 4YSOA 2PPCA 5I6KA 2DY2A 1QLEB 3EH5B 2IH9A 3WNIA 3U25A 3OD3A 3FU8A 3SBPA 4AI7A 2XYBA 4BWUA 1NIDA 1WS8A 1BXVA 1GW0A 2UXTA 4E9TA 1A65A 1AZCA 2W8CA 5I5MA 2BO0A 2ZONA 1AG6A 4KOBA 4HHGA 4YSEA 4YSAA 3PCYA 2VW4A 1NINA 1BAWA 2IWEA 1SFDA 3UACA 2FTAA 3QJSB 4L0PB 2FT8A 4KO9A 1NDTA 4AX3A 3NYKA 4YSSA 3IN0A 4YSQA 2CUAA 1BYPA 2Y69B 3RYMA 4HCFA 2X87A 3TASA 3X1GA 1ZDQA 3GDCA 3PXLA 4HHWA 4AZUA 2BW5A 6PAZA 3AG1B 1CYWA 4JHVA 2CBPA 1KYAA 4NERA 1ID2A 3EH4B 2PCFA 3NSYA 2WO2B 2PPAA 1QHQA 1BQKA 1QNIA 1FA4A 1W6WA 2P80A 3AG2B 1PLAA 1J5DA 1KDIA 4HCGA 3EH3B 3JT2A 4PAZA 3OMIB 3QJTB 4N8UA 4WKXA 1HFUA 2I7SA 1NIFA 3NP4A 4JKNA 5I5JA 1NIAA 2IDTA 1SF5A 4F2EA 3HB3B 3OM3B 3FSZA
chains in the Genus database with same CATH superfamily
3FHAA 3AACA 5DD3L 4BZ2A 2R0WH 1RIUH 5HJDA 1QSFB 2CDEB 2MPVA 3GSWB 2XV3A 4Y1TA 2N01B 3V0VA 1FFPB 3F7VA 3RUGA 2R29L 4JRXD 4RFEA 3CDZA 5E8NB 1KCSL 1N9PA 3IKKA 5D6DC 3P73A 4Y5XC 3KGSA 2BSRA 5JMRA 4BINA 2JJUA 3MOQA 3RU8L 5F71A 5FFLA 1FDLH 3G08B 5DHVB 1E4XH 3A4DA 1U41A 3OBAA 4U1JB 4Y7OC 4XVTH 5F97E 4N1HB 4Z18A 3CVHH 1MHHB 3MRNA 4GFTB 4WJ5B 4B41A 3ESMA 2J1WA 3CLFH 4AKQA 2F8IA 4WFFD 5CJXA 5D7KE 1SN5A 2AXFB 2CUHA 3AS0A 3K6OA 2IFGA 3D4CA 1SY6L 1HSBB 3OL2A 4FXGB 1U30A 4NN5C 3RUGE 4WHCA 1G7JB 5DVKA 5GGUA 4D3CH 3VQLA 4FABH 5IFHH 2J1XA 4P3WA 1SJEB 2ZOKA 3P4MA 3ARSA 4FQ2H 1HXMB 1KELH 2XDHA 2RIKA 1Y18B 4D9QE 1EUTA 1WFOA 4AIOA 5FO7A 3TWCL 1TTFA 1D5IL 2UZYB 5IV2A 5AYQA 4U1LB 5EEXA 1IM3A 4FQLH 2W9EH 3DO3A 3WS6C 1DQQB 4D7PA 4XNUH 4V1DA 4TUJA 4JL2A 5B38G 1JF1A 4XMWA 2CGYA 2YJQA 3B4NA 3DJTA 1TVDA 5TQ0L 3GXFA 3VH8G 1FN4A 1HJBC 2K6YA 4E9LA 2R2HA 4Q9RH 1KFGA 1G0XA 2W59A 1ICTA 4B7IA 1URZA 5DUML 5CCHE 1F4AA 1IL1A 1IILE 4P5KA 4QRRD 3R7RA 3U9PL 1SVBA 2G2PA 3BOVA 2WXKA 3BLPX 3D7PA 3LKSB 3MGOB 3RVVD 3VXOB 4AEIL 3UX9B 1DBJH 2NYYC 4JDTH 4NJ9L 5FA3A 4HQQL 2JKWA 2MTPA 4OM1H 3HHRB 4MXWH 4ORZC 3NFNA 1BBJA 4G6FD 3N2JA 4X5RA 3FHEA 3TVMA 1QVOA 4QHLA 3FSVA 1CXEA 1M9SA 1Q1PA 1XMWA 2I32A 2WAQA 4R8WH 3FU5A 5E8DH 1PEWA 4IBSA 3T4AB 3C5JB 1M6UA 4GSXA 5I8CB 2FCBA 4U1HA 4NZJA 3KVQA 3ZMRA 5IESL 5JHDB 2B7DT 2O1AA 5EUOE 1L3NA 1DL7H 3G5WA 1J5IA 4A6YH 2ZUUA 1T4KB 3U6XS 1MVFA 4KRPB 2UVEA 1P4BH 3FQTB 4OTXL 5KANI 2CZNA 3I74A 3CFKB 2E7CA 2E27L 3HE7A 2OTWA 3NCYS 2HAZA 1M7IA 2PLTA 4GQRA 2VMJA 1E2VA 1RZKH 3D85A 2XWJB 3NPZB 3S6CA 2DLHA 2ZKHH 4L3EE 3IKCB 1G1OA 1VFMA 2D7MA 1YUKB 4OQTL 1GC1L 2PO6A 2MRYA 2QKIB 5AG9A 1R5VB 3DSFL 5LN8A 4FQHA 4TTGA 5CP7B 4TQEH 4YDNA 3VSQA 3UGXA 1IFRA 1R3LA 4KQ3L 2YGNA 1XH3A 1SXNA 4FOMA 1WIUA 3KLAA 4P2QD 3WDHA 1TSRA 3CVIL 4TXVB 4NM4L 5D6DA 4JM4H 4GO8A 2V2TA 2WC7A 1PQZB 4H8UA 5D2LF 4A68A 2BXYA 3LD8C 3DUUB 4JQIH 5F96H 4APQC 1CDYA 3O6MH 2EZ0C 1GYAA 1NFDE 2HFGL 3H0TB 4TNFA 3LZFH 3QJXA 2ENYA 3MN8A 2V9UA 1K5NB 4DP4X 2XWDA 1AZBA 5EOTB 3RWCA 4ANXA 3R0NA 5DUBB 1DN2A 3BD3A 3H7BB 4RH4A 2FR4B 3Q43A 3L1OL 4TTDC 4XCFH 2O5YH 2Z7ZA 1FFOB 4XN5A 5DJ8A 1YEJH 2JCCB 5A2LH 4UAHA 5KEZA 1IGMH 1NCGA 2VERN 4XPBH 3OWRA 5C86A 1XFPA 3FMGL 2BRRH 1NMCC 3ISRA 4FQ1H 4G7QB 4Q52A 2P5PA 3IDJB 4TUKL 2WUBH 3QJVB 3P0YL 4MQ7A 2WTPA 5E8PA 4DGVH 4UV7H 2Q76B 2XBZA 4ODSL 4AEEA 1TENA 3VGAC 4W70A 2VC2B 2YXWA 3FTZA 1CDHA 3O81A 5IFJA 3BSZL 1A66A 3WS6A 5BZDA 1D9KC 4TSAL 5SWZD 4CU6A 4HKBB 3QXWA 5AOJA 4APXA 4ZFOL 5F21B 3FCTB 4KK6D 4X7FC 5SX4I 5DQ9B 2RB8A 4PJGA 5AOMA 3LN5A 5D7IA 2ADJA 5D4HA 4DKTA 2FLMA 3KYKL 5CSGA 2XXMB 1URLA 3MRQB 4F15C 4PD4K 2C1OA 1JVOA 5K9KA 4ISVA 1U93A 2I07B 2JTYA 4X5LA 1JMXA 1KCVH 2P48B 2ZAHA 4B95C 1BCIA 1MCRA 2HH0H 2J2ZA 3PWVB 3ARBB 3B9KD 4LL4A 1KIRA 3CMOH 3LMJL 4OF5A 5I74B 4OLWH 4JFTA 4ZX6A 5C0JB 3ESNA 2X4OB 1TZ8A 1CLZH 3G9VA 5FUZH 2ZCKL 3N40P 3DTXA 3JWOL 4KKBD 4PJGE 3TEXA 2R1YA 4NJAL 4WW2B 2I60H 4K3DH 4S11A 2DDQL 5E4EC 4ABQA 1T22B 3KL5A 3LEVL 2JI1A 3MCLH 4J2QA 5IHBA 4PRPD 2XN1A 1KBWA 5DUJA 4ADIA 5KZCB 2ZWSA 4QRQB 4OQ1A 1ET8A 4X6DA 5EUKA 2GT9A 3EJJX 4WI0B 1SJMA 3S5YA 4JNXA 3FONB 4LVNB 3FFDB 3P9MB 1CL7I 1YAZA 2HTLD 1AHWA 5C0BB 4GXUN 4PJIB 1S9WA 4C4KT 3TC9A 3EFFA 1CG9B 2DI9A 4XPFL 4O51B 5F3HA 3RWIA 1E4WH 5I28A 3BFQG 4KVCH 3HUJB 5IHHA 3QBTB 4HWEL 4I3SL 3SDYH 1N0LA 1PTZA 2CBQA 5IMOA 8CGTA 3MAWA 3AQYA 1DDTA 1Q38A 1XB3A 2H26B 3D52A 4GKOA 2MNUA 4HH9A 4NRZA 4PJXE 3RDTC 3T2NH 5B7FA 5C2BL 4WSKA 5FYJL 5K39A 1HDMB 5KAQG 4DZBB 1NAKL 4IBWA 1HYSC 1JE6A 2WGXA 4YXHL 4BCZA 3RWGA 1EAPA 3SQOL 4HUXB 4DEPC 3GMRB 1Z3RA 2VSKB 3NIFF 4X9GA 1H6FA 4B27A 4U1IB 4R4NC 3PL6B 4PV9B 3CIAA 3E8UL 4NC1C 4NXSA 3Q05A 1NUFA 4EUPG 1FFTB 4HIEB 5KYYA 3ZT6A 5DMYA 1L9MA 3UYRL 5I8KL 2APXA 4PWHA 4AL8H 1A9BA 4X6CE 3GXNA 3UDWA 4KKZA 4KMTL 1WEJL 4OAWB 2QQNL 5HY9A 1JZHA 1XQ4A 3WO4B 5CEZD 2R39A 3LXAA 4NHUA 3HEIB 1OV8A 4GXFA 4RWHA 5HTSA 3TJHC 5AENA 1G9NC 2DM4A 5FUOH 2IMMA 2NLJB 3LDBC 3UGUA 2I27N 1RZ8B 5L8JB 1JPEA 4H1LG 4LSRH 3NDZE 5BRPA 2KZBA 4K0OA 1RURL 1DANU 1EVUA 1FNGA 4DP0X 1ZK9A 4LARL 4QRSA 1I9IL 3WIIH 1IARB 3ZVVA 2ERJB 3U83A 5BUGA 2NZIA 2VWEE 4PJFE 5DHYB 3S36L 4ZXBA 3BVNA 5IMMB 3MCG1 5I9QB 3LHAA 4ESKA 2OAAA 3VWKB 5BS0E 2MOVA 1MN4A 1TKWA 1ZD6A 4BZ2H 3DMMD 3KBFA 4WENB 3HJEA 4CN1A 1CF1A 1S9YB 2VABB 2X4QA 1TZHB 3SYCA 3WNKA 4YS4A 4LSVL 1FORH 2J8UE 4PVBA 5ICYA 3MV9E 5ERWB 4NO2A 2X9ZA 2QMJA 4AKOA 5C71A 4KJPD 3HFFA 3Q6FB 5EBLA 1U6AL 4X7TB 5HI5C 3D39A 2IQ9H 4UCFA 4JO1H 5JIPA 3MHZA 1AR2A 1L9NA 2WQXA 5A16A 3HB3C 4RX4D 2YC1B 3AADB 3GB7B 3DOSA 3QS2A 3MRHB 1VFUA 4B9CA 3LKNA 2MOQA 1RH8A 1BJ8A 3BGAA 3CVBA 5EU6E 3UTOA 5C09D 5IROC 3EZJB 1MXDA 4I18A 4QHKI 5HGAA 1XGPB 4Y88A 5LGHL 3WKMH 4RAVB 4E41A 3C5XA 3ZGIA 3VXQB 4OZGF 4TLUA 4U1NA 3DUHA 3MUHL 2HKFL 4MCYA 2X0WA 2ORBH 3AQXA 5DWUL 3T65B 5INCB 5A2CA 5G2NA 3L8QA 3O2WH 2PPCA 4L3AA 3U2SA 4NP4H 4KQ0A 3M1CA 5E2UL 3OKNA 3UH8A 3WMQA 2Z4TA 2BDNH 4HLZH 3I6SA 5LNEA 1JG9A 2QVFB 3QORC 4FXGC 3HNVH 2M2DA 4X4YA 5DQJA 3QP3A 4E9TA 4NWUL 3FN0L 1BF2A 5DRNA 5CLWA 2WYHA 2ZONA 2BFGA 5IVZB 2MHAA 4QRTA 5DK0A 3UZEC 3P1VA 3SDXB 2IWEA 4X9FA 1EHLH 1E8WA 1N3NB 1KTBA 4N0UA 3TNNA 4PJ9A 2FUTA 4UINL 4X8GA 1VEMA 2EVJA 2IANB 4MAYA 3T3MB 3RZWA 2G2RA 3S4SA 1S4IA 4KXZH 1A2YB 1GKOA 1T03L 4U1KA 1L6PA 4ETQA 4JY4A 5JUEH 3EKCA 1Q0YH 4TNEA 1XGRA 2FX9L 2HG0A 3C8KB 3KG5A 4NENB 3VSTA 1T7VA 2EE9A 3CN0A 2Y7NA 4HXBH 1NBZB 2BZDA 4OFQA 3ALWA 1KYUA 3SHSA 3UAJC 4FQQA 3ZZ1A 3WNLA 1KLFA 2PN5A 3L5WB 5D7KD 3RLSA 2GITB 3MDJA 3ATBA 5IQLA 1D6VH 2XPYA 2V5TA 2CBPA 4AITA 4N0UE 3FT1A 4ZJ9A 5CILH 1RP9A 2VMEA 1MH5A 2IQAB 1QQDA 1S9XA 2E7HA 4XOAA 1ZA6B 3CE1A 1FL5B 4NUJA 3I6GA 4U1MA 4Z7WE 4DO5A 1OTTD 4D9QD 2VXVL 8FABB 2EE0A 2GJ6D 3IJ9A 3MFFA 3ETBF 2YWYA 1F90L 3O8XD 1FSKB 4N9GB 3VRLE 1U8JB 2BVOA 3ARZA 3PU7A 4GRMA 4NC1E 1DLHA 4EVNB 2R51A 4G3YL 4J3SA 4P9HC 3NP4A 4ZFGH 4O58H 5HI4C 3DETD 3T4AC 5EIIG 4K4KA 5CGTA 4ZMOA 3IFNH 4MVBC 3MLVH 4R4BB 3PGCA 4ZT1A 3JTTB 2ITDB 3ZE1F 4GG6B 3VXSB 4NQDA 4OD2B 1KJVA 4MA3B 5CR8A 1ZWIA 4HWNA 4YSRA 4OUUA 5I8EA 3GS0A 5CZRA 2Z4QB 4KRPC 5ESVB 5HGBB 4LRIC 5E6IB 4WGWB 1DVQA 3KYMA 5KSAB 1S7WA 3UIZA 2IBGA 3OB0K 3QG7H 4A39A 3Q6GH 2WANA 2Y0SA 1D2OA 1F13A 3F58H 3F5WB 4R96A 3T0VA 4Q0XL 2IADB 2MNJB 4X8CA 5EZLA 4A2FA 4GAJL 1SNRA 3BO8A 3LS5L 1ZHNA 1T2QH 5ANHA 2BP0B 1I8KB 4JJ5A 4JZJB 5I76A 2WLIA 3EFOB 4AYFB 2Z8VC 3QW9A 1X5MA 2XG5B 3DVGA 3MA9H 4ABWA 5SWQB 2RBLA 4HH8A 3VD7A 5JLZB 2MQCA 2ADFH 2QKIC 4ZUTA 4IOSD 1KN4H 5AW7B 1AZNA 2B59A 2WLJA 3CK0H 2XY2A 1VPOH 4H7VA 1IC1A 1KN2H 3AY4A 1QSFA 3CU1A 2CDEA 3QNXA 4JB9L 3T4YA 1KWKA 5LWYL 3GHEH 1TJHL 3MV8B 2C3GA 4P5RA 3ZOAA 5E8NA 5I66A 2E6JA 2A0LC 5CUSL 1ZHBA 1MCKA 2XVKA 3QZWA 1MELA 1RZFL 2OJZL 3LIZA 1EHKB 1E90A 4F3FA 3CFDB 5J1SC 4P2RE 2WSDA 1GJWA 1I4FB 2X5PA 1MHHA 1FG9C 4WJ5A 4L3ED 2ZX6A 5DI8A 2I9TB 4PG9A 4Y2DB 1DSFH 5KW9L 4JFEB 2AXFA 4FXGA 4MSWB 3UADA 1JK9A 1OWWA 1SN0A 2GK0B 3V6ZA 3CDYA 4J7RA 5LO7A 4PV8A 3UZEA 1SJEA 4QRAA 3UG4A 4PJ8B 3V0DA 4NUPA 4OF8A 1PKQA 3QVAA 4F8QA 4G6KL 3L1EA 5E24E 4HUVB 1P1VA 5J6SA 1OO2A 2C5DC 3W81A 2UZYA 3NOIA 1UA7A 2WAHA 5MEOB 2GHWB 3NEXA 5F8QC 2D7NA 4O4YH 2JI2A 5D7JD 3O3EB 3MXWH 4LVEA 2XKSA 4AM0A 3MBXL 5HBBA 3UAJA 1IGIH 5JW4Q 3OF6A 2IPUK 2XPZA 1ECZA 3BDYL 4OLXH 5EDSA 4H8QA 4HG4J 1E9OA 5L9DL 2Y6TE 3BZEB 2WVVA 4XN9A 4ZYKB 1CTNA 1MRFL 1OGPA 3NK3A 5IOPB 1EERB 3L6FB 3OB8A 4P5SA 2IBZX 4A2GA 1GGCL 3CXHK 3G6AB 4M7KL 4DESA 4ZX4A 4OLUH 2OSLA 2X2IA 4MCZB 3ARBC 2BM3A 3TPUB 2OTUB 5HYFA 5JIDA 2WXLA 5I74C 1EJ6A 2EDBA 4OLYH 1JNNL 5D93B 2VDNB 3RTLA 4BFNA 2KC0A 4NNYB 3NBNA 1RHHB 1E5YA 3B5HA 2JNZA 1I9EA 5H2BA 1OZUA 2ZWLT 5ACZA 2WWOA 4WW2C 3T4AA 5C0EB 4M62L 1C7TA 1E4KC 3SE4A 3C2AH 3VJ6B 4GH7B 1DQKA 3HZKB 3T6XA 2CHZA 3JT0A 4HBCL 4GO9A 4JFVA 4PLKD 1D5MB 1T4KA 3IMVA 4LRIA 5DJCA 1GTNA 4FQJH 1I8UA 2CXGA 4LVNC 1R0AH 4PJ7B 1P4LA 4XMUA 2P43B 5B7MA 2LLGA 4WI4A 4YE4H 3WFHB 3TO4A 4YGVA 4KK5C 3CJJA 2X3AA 2ZKMX 1NANI 2D3NA 4ANWA 4CRPA 2JKXA 1WYJA 4EIBA 5JHDE 5IIEB 3FJTA 3FRPG 4HAGA 2C4FT 4AEHH 3K2UL 1AG0A 5GRUH 1O6TA 2DLIA 2MNWA 3DGGB 3HN3A 1IKFH 1X5JA 2V37A 3JWNC 5IEKA 1OAKH 4N8CH 5I1AB 4WSJA 1WCBA 3QZLA 5JR1H 4G5ZL 2OCFD 4L8SB 4N8VB 4ODUB 1OP3H 2WBJA 1K6QL 1KTLA 5E4AA 2YGQA 2NR6D 3WEXA 4L5FH 4XI5C 3PL6C 3VI3A 1GJUA 3ILPA 3L7FB 1CJYA 4XXDB 3P40A 5KVGL 2FATL 2WSPA 1EWHA 2F1BA 4OZHA 4Q4EA 4CNIB 2YMTA 3CN4A 5BQDA 4GKSB 1X7TA 3O3AA 1M6OB 2FR4A 1FH5L 3AT8A 4G8IB 1CS6A 4HK3J 4E9WA 2V9RA 3B43A 3WO4C 4PJEE 4B0MM 4FNLH 1LGVA 1DQVA 3BE1L 1GL4B 1GOHA 2H7WA 4DFHA 3UABA 4PHZA 1XGYL 5CINH 1G0YR 2OJEB 4LGRB 2V2XB 3RL1A 5E8OA 3IRPX 3CBKB 1L6ZA 3WV0A 1RUQL 1KCRH 1UG9A 1BVNP 3CBRA 3FF8A 4M7LT 4TLTA 4E9QA 3K1DA 1TJXA 3AXLA 3ZE2B 1GZPB 3PJLA 3TCLA 5BUPA 2Q76A 4Z3HA 2YKLL 4CAGA 5IQ9A 3RPBA 4DKDC 5FYKL 1AP2A 3LH2L 1TYEB 3FTXA 4Z7UF 1UADC 1G9EA 5GZNC 2A9CA 2ERJC 2K9UA 5SX5K 5HYJA 5MEQB 2JCCE 3OR6A 2BW4A 5FFGA 5I9QC 3OLEA 3CFCL 3QJFA 5E5MB 4XVOA 3VWKC 5L2KA 3D09A 3BZ4A 1HH9B 3D0LB 1ZOXA 2J73A 2H8PA 4S1QL 1G1CA 4FF9A 1DLFH 2H1PL 4FFYH 3CCHA 5B8CA 5A2KH 7PCYA 2YMXL 1MCCA 1X5FA 2TSBA 2YXVA 3ARFB 3DX9B 3GHPA 3VW3L 3MRKA 3UZVB 2AJXH 3QDGB 5DK3A 5I71B 3PWVA 3ARBA 1G6RH 2X6UA 1KXQE 4HP5A 5C0JA 2YPLA 4E9VA 2X4OA 4N0YL 3T0EA 5L4FA 4AG4L 3VXUA 5HPMB 5IVNA 1JF5A 1ZKAA 4M93B 4WW1B 4U6VL 1SYSA 1HCFX 2ZE0A 2AAAA 4MDRA 2X4UA 2DH3A 2OL3A 5D1ZD 3MJ9A 1T22A 4BSWB 3MNWA 1KFAL 5BS0D 3W9EA 3LN4A 4QHKJ 3F7KA 2X7LA 3DA0A 4G9FD 5DVOA 4WI0A 4O9HL 3VB8A 2BZ7A 3GF8A 4C56B 3TBYB 3FFDA 5MEPB 5CN3A 3FT9A 1SHSA 2VR5A 2ITFA 3M45A 5C0BA 5CEXB 3NESA 5C08E 3MV9D 4PJIA 4EQ2A 1OOAA 1OCZB 1T7WA 3SKJH 3GO1L 4O51A 1BFOA 1D9KD 4IDLA 4PREB 4R3SB 3HUJA 4ODTH 3CN1A 4UBDD 3IXAB 4JPWL 3ZDYB 3QDJA 3P2BA 1I9JL 2OCJA 3UZQA 1WBXB 2ICWI 4G43B 5EU6D 3X1BA 1G43A 2ZX8A 3RJOA 3ULUE 4NLHA 4ONFL 4AWJC 2QLVB 5C0BE 5K5YA 2GK2A 1NGYB 2AXGB 3LY6A 4IOFD 2WVUA 3QEGH 4OCLC 3RAJL 1RK0A 3BD5A 5A1AA 2X4NB 3JYCA 4HUXA 3GMRA 3MRRA 3K3QA 2ZP0T 3DVNB 3SKNB 4DERA 5EC1A 4GBXB 3TX4A 4WRLA 1B6UA 3FO1B 3ES6B 3IBEA 2DBJA 4JO2L 2QDVA 5EBMA 4G1MA 1JZFA 4LEOB 2GG1A 3CLWA 2PXYD 3BFOA 5B3NA 4I3GA 4KI5F 2IPUG 1MCBA 4LLVB 3JWNE 1WT5A 2ADGB 2Y22A 4X8JA 5LAPA 4MKMA 1NGZB 3IDXL 1FSKC 2NLJA 1A3LH 1F86A 3ARDB 4U6HB 2AZAA 5ESQA 1JGVL 1TMQA 4OGAC 1L7IH 3TN0D 4M61B 4HZLB 2Y06H 4LOEA 2MWCA 1ZK5A 4YHOH 5T1LD 4BZ1L 1TO4A 5GZOA 1SEQH 2G3MA 1ZS8B 2XY1A 4H26B 1AXIB 3RDTD 1BJ1H 5E6IC 3LXUX 4XNXH 5J89A 2DEXX 3APNA 5DQDH 3RNKA 3VWKA 5KSAC 1WWAX 2X4TA 4LT7A 3WY3A 2GI0A 1KLGB 3UPCA 3VG9B 3F8UB 1YJDL 5EO0A 3FU7B 3O2VH 4C4KO 1OANA 2VABA 2WO3B 1FO0L 3MI6A 2CXKA 4JZJC 4R4ND 5D2LA 2AQRA 1HINL 1QZNA 2ID5A 2IPTH 2EEDA 3MA7A 4EI0A 4F1SA 1HZHL 5F44A 4HIXH 3LIZH 1HOCA 1ZVYA 2QSCH 5BO1H 2IH3A 2CDGA 4WI2A 5KVDL 2QJDA 4XMPL 1UD8A 1SMAA 3RZCC 1ZCRA 5T1KD 4N0RA 1KBKA 4UQ2A 1R24B 2NY4B 5BMFL 1J8RA 1BAFH 3QIUB 5E99L 2DMHA 3ZKNC 1MCWW 4ELMF 2O61B 5E5RB 3ZPDA 2Z1PA 4X5WA 5IB2B 3A22A 1BEYH 2DZEA 4HS6B 4LLUA 4DVRL 2QGCA 3VXQA 5D1XE 4IRJA 5CCJA 3PP4H 3CFIC 4Y4KB 5F9JA 4YHIA 3STZB 4NLAA 4TSBH 1DDHA 3DI2B 3PHOB 1AFVH 3EO0B 1T5WB 5EV7A 4IKJA 2ZD0A 4WY7L 4Y2DC 3DBXB 4WI5A 2BW5A 1DVXA 1U58A 2WN2A 2YUWA 5BJTB 3VD4A 4WO4B 5DVPA 3KGUA 1VB9A 3KGTA 1TUPA 3VNZA 3ME0A 5IVZA 5T3ZE 1YMMA 1FG2B 3X17A 3SDXA 4PJ8C 3H9HA 5HXMA 2YD5A 3UJTL 5C0RL 2IGFL 4L2LA 3A6OA 4DK6A 3VFRA 5ETUB 4X7SH 3HMWL 4PAZA 3JWNG 3OMIB 1DJIA 2Z8SA 1K2DB 2EDOA 1I1YA 5E6YA 5CAYB 4P2RD 3IGAA 4YO0B 2H2SC 2G3ZA 5DGRA 3PUCA 4X99B 1A6TB 2PF6A 3GJEA 3HN5A 1E6JL 2F5AL 3BAJA 3OAUL 4XO8A 3VU1A 1E3ZA 5JPNB 3LNFA 3FFOA 3FTSA 2ZX5A 5D1QA 1HAUA 4JFHE 4HF5L 2XKNA 3SDXE 1Z6JT 1JHTB 3C5SA 4POZC 1WPCA 2P8MA 4UOZA 2GAZA 5IROD 1CD0A 5FUCC 1DBKL 4O02L 1OQOA 2IANE 3QHZH 3CX5J 4N2LA 2FSEB 3T3ME 1ZA6A 1FJ1A 3KNBB 4I8DA 5DRWB 5AVSB 3LIUA 5DD1L 3QG6B 3EYVA 3SGJC 3CZGA 4UDTA 1GSKA 1HHHA 5D93C 4J3XA 3QUKB 5BOZG 4FLSA 5DFWH 4I77L 2GUOB 1WJ3A 3HI6L 3QORD 3BWUC 2YPVH 3TO2B 1UGKA 5F6IB 1BWMA 2X9XA 3U6RB 2YJLA 3HS0A 4BXSV 4R4BA 5BNXD 2ITDA 4GG6A 3VXSA 3QR1A 4LCUA 4OD2A 5A7BA 4OCXL 4RETB 3K71B 2NXZD 2Z4QA 3E2HB 4P07A 5E00B 1BF5A 2GC7C 2AEPL 2X10A 1AMYA 4XN1A 1O6SB 2FQDA 4FXTA 5KSAA 1RK7A 1A14L 1MFMA 3I9GH 1MFBH 4A2EA 1TZGH 2ZWKA 1YEFL 3HMXL 5LHDA 1CL7L 1NSNL 2XRAL 2FB4H 4S1DC 1WAEA 2IADA 4S1SH 1F41A 1DQDL 2BP0A 5GISL 3VB9A 2D7PA 4KHXL 4NN7B 1HE7A 4QJ3B 3VXSE 1PG7W 2VDRL 4Y89A 2GYSA 5D7LA 2YSTA 1UJ3B 3CFUA 4YXLH 2AI0H 1ACXA 4AYMC 4IRSA 2AQ3A 2HUHA 3GNML 5JHBA 3RZCA 1T2JA 1AVAA 1OPGH 5HHXL 3V5HB 2C1PB 4M6NL 4YHKL 4KJWC 5TGBB 5FOBB 3MV8A 3N44F 4L8SC 1YPZB 1FL3B 4DP2X 3IETB 1SQMA 4CVXB 2PW1B 4NCDA 3WI9A 3GSXB 1ORQB 4JJHA 2O26U 3DI3B 5CFHA 5D96B 3FNKA 2EILB 3DPDA 5HI4D 3T71A 2A1WH 2VM4A 5DJ6B 5IVXA 1I4FA 2GJPA 1C5CL 1J1PL 3M1BA 5JHDD 3QRGH 4IGBB 3GSVB 4OFKA 3V4UL 4J6RH 4JHWL 4BIKA 3Q9QA 1J9SA 3LNEA 3ZE0B 3WNJA 4XNZB 1BX2A 4GI6A 4CN4A 3MJ7B 4PYHA 4UB0L 1BWWA 5HDQH 3MJ8A 1QFWI 4XXWA 1OE2A 3QA3A 1OK8A 4HU8A 1QSEB 1HH6B 2NTSP 3P11H 12E8H 5J1AA 4F80A 5I1IL 5IT2H 3HC0A 43C9A 5D1ZI 2FD6L 3LV3A 5HDBF 2QL1A 4K5MA 2LHAA 3D3VB 3V0GA 1YEEL 3DOHA 4XAKE 1VACB 1YA5A 1AS7A 2XN2A 4JFPA 4LNRB 2BMKB 4JFEE 3KW7A 2YD1A 3FPXA 5KYUA 1LP9B 3IS1X 1JHKL 3L08A 4QHUA 2WLHA 1ZANH 4M43L 1JNLL 1F3RB 2VO8A 3PGFH 1R9FA 3KYNB 3UYPA 1PCSA 1A0QL 1COBA 4DPRA 1A25A 5KBNC 4ZYKA 3FQNA 4ZOAA 1IAIH 3SE8H 2OL3H 1M2VA 3MJ9H 3PWPB 2A0LD 5SV4A 3L6FA 3R0MA 2FLRT 1FP5A 2PUQT 4NO3B 1WK0A 4AQEA 4F7TA 1K5WA 4JHZA 3L3GB 3ARFC 1XSJA 1KJ3H 3QARA 1UACL 3TJPA 2QZQA 5I71C 1N2RB 5GJSL 2GHZA 2KHAA 1EJOL 1FAIH 4RSYA 2V9TA 3BISA 1GIGL 1RHHA 4GO6B 1D5ZA 2QR0A 1Q9KB 2EIDA 4WI6A 1F5WA 1DP0A 2IO5A 3GIVB 4M93C 3TIEB 2KYIA 2L04A 1W2KT 1XTLA 3LNDA 3BH9A 2WXMA 1BLIA 3MGAA 5FUCE 5I73B 2HKHL 2Y7LA 4J8QA 5I6NA 3TIDB 2LVCA 4KKAC 4U4IA 3IDGB 2AC0A 4GUOA 1GS7A 3GMMA 4NT6A 2APFA 3ZL4L 3SB3A 1KCUL 4ZFFB 4XMKH 3FCSA 4DP9X 1WGVA 2WXPA 4HKZA 3J07A 3PREA 5JXEC 5I5RA 1S46A 5FK9A 1OAYL 1J8HB 3WTXA 2HG5B 2HRGA 2VQ1A 3HI5L 8PAZA 4KNTA 2B1OA 5JYLA 2R4SL 4BFIA 5ADPH 4V33A 1MREL 5H94B 2YUZA 1KV3A 2FGZA 2QQKH 4K8RC 1AS6A 2Y36H 1YYLH 3BAWA 4FZ8L 4N2MA 1ZJAA 3UJJH 5IR1B 3DGGA 4PJ7E 4F93B 3TH2T 4BM7A 1Z32X 3EO1A 2CKBL 2VQTA 4KDTA 5C1MB 3TJEH 3ML9A 4L8SA 2FEDC 4OJEH 3L9YA 3KVDD 4G6MH 5C08D 3TYGH 5GS0C 4O5LH 1F02I 2M83A 4UT6L 3GGWB 2J6WA 4XP6L 4RMWA 1IZJA 2NCMA 4YR6A 1KXVA 4W9KC 4RGNE 2NT1A 2XACC 3QUYD 1CGSH 1TVBB 1ZT1B 2P42B 1F3JA 1NLDL 1OF0A 2CO2A 1Q72L 2ZCHL 4G8IA 5B21A 2CALA 1UWYA 4YSDA 5B1JC 3WE6A 5C70A 3ULVD 4WV1B 1ID5I 2LU7A 4YHYB 1MVUA 4HGWB 4YHLL 3NABH 5SWSA 3ULUD 2DQMA 4F8PA 4HKXB 2EINB 3BUQA 1TCRB 2OJEA 2H3NB 3RWEB 2V2XA 3PWNA 4G7SB 3ARDC 4JM2D 4DSYA 2VXUH 3ZSSA 3OMNB 3RY5A 5C2UB 5JHLH 3DHUA 4PRAA 2D03L 4Y4HB 1WC7B 5BUAA 1JGEB 4O2CA 4FQIH 1B2WH 2OXHA 3RFZB 2YEZB 2Z92A 2I7OA 4KZEL 3FU6A 3DX7A 4P4KB 4C4UA 1YEDA 5I75B 3U0PA 2KPNA 2V33A 4NQXA 1QX1A 3GSQB 4G59C 4OSUH 3MRPA 3IDMB 1I8LA 2D9CA 5DR5H 2KQNA 3VG9C 4PFEA 1N7MH 3PJSB 5ES4B 2AXWA 3ZE2E 5CSZB 5TH2B 4Z78A 3PL6D 5DJYA 4CGUB 3OQRA 4JG0L 3DX9A 3L4VA 1CFSB 5ICZB 3UTQA 1DUZB 2PYEA 3CPUA 4LPXA 2A3TA 4UTBA 4LESA 3IDUA 1EZUA 2YPKB 4NQED 1EDQA 3MXVH 4G6AC 4NQCA 1X6NA 5CIPH 5JZ7C 4LHUD 1DO6A 2BY2A 2NY5H 2FJHB 2NY4C 4PR5B 3UAFA 4JKWA 1DR9A 1D3CA 1UOVA 4H5SA 1I3GH 1JGLL 2X2YA 5E4IA 2KKQA 1NJ9A 2D0GA 3KLHC 1YUHB 2EYRA 4FG4A 5HHVH 2DLTA 1ZA3B 4BK4A 5LXGH 1KPVB 2DLEA 3NJNA 2WYZA 3SGDH 1B4RA 1IGJB 3TBYA 3QDGE 3PQYA 4Y4KC 1B9ZA 5J6HB 4NBZB 2B77A 3ARXA 4WU7A 2AQ1A 3LQZA 3IJEB 2OX5A 4G2AA 3W0WB 2K4WA 5I6XB 5JXEA 4NRXA 1CT8B 5GZND 2XNAA 1W72A 1YEHL 5F7FA 2DKSA 2HLAB 3H42L 4RESB 5J3HC 5LQBL 1AO7A 5C0FB 4WO4C 3NG5A 3GMLB 2X6BA 2CK0H 2PWFA 3UAAA 1GMEA 5AAPA 4CC0A 4YHZL 2VDPL 1ORSA 3O6LL 2B9AA 4C56E 4UDUB 5DRXB 3ALXA 4XP5L 3NCEB 4XP9H 1PS3A 1AS8A 4HC1A 1T89C 5G4OA 3EDDA 2HTKC 4F7CB 5PAZA 4DQAA 4DQOH 1A64A 2Y7QB 5D1XD 4WWKB 5DU7A 4MRCA 4HS3B 1F4XH 3V5KB 4JY6A 1N5AB 3BPNB 4N8VG 3VRJB 1EDYA 3UO1L 2YKKA 3ZDYE 4GS7B 4OFYA 5JPNC 3FO1A 1ODUA 4N2CA 1IAOA 5C0NC 3IMTA 1TNMA 3FRUB 4GLRH 4ZTPH 4I0CC 4LEOA 4M9OA 2YWZA 4H8WL 4HSCX 5B1JA 1QI4A 2WCPA 3NVQA 4LLVA 5AOZA 2VLRB 1BQLH 1K3ZA 2BSSA 1RJZB 2DWYA 4JM0A 4U7SA 5GS2D 5CJ5A 5E2WH 5EU5A 4XZUA 5EZPA 4K5PA 5DJZB 4J3OH 4PTTB 2LW3A 1TJGH 4ZTOH 1G7QA 4OLVL 4Z7QB 4EN3A 5CD5D 4KXDA 2IVFC 4P4RB 1FGNH 1LDSA 1WQVT 3OD3A 2AJZB 4JKPL 1P7QB 3MRDB 1K4DA 2XYBA 5F6IC 1J88A 1IM9A 1NIDA 2F7QA 1WZMA 1CWVA 2E6QA 4MD5B 3T8VA 5FYLH 1A65A 3FSOA 1AZCA 4PPTA 4ZD3H 3Q06A 1CFVL 2F58H 2P5EE 4JFHD 3WEMA 4BA0A 4YSEA 5DZJA 4H26A 5IBTL 4NO0A 3E2HC 5BQ7B 3PP3K 2FUQA 4ZFOB 2IAND 2DYPB 2OYMA 2R56L 3KPRB 4U6XB 3NQIA 3P69A 3BGMA 5CEZL 3IN0A 2YEVB 2XVGA 4N85A 4CU8A 1G84A 3WXVL 3HRZA 2AK1H 5AYUH 4LOVA 2FJFB 2AABL 4NN7C 2EUXA 1GAFH 3J2PA 2OS7A 4R4FL 1XX9C 1UJ3C 1F6LL 1B88A 2R2EB 5JXAH 3AU1A 3GJFB 5LXVA 5KSBF 1A7QH 4TPRH 2D31A 4MQTB 4KKPA 4ZPTA 4G7VL 2C26A 1LK3H 2XA8H 5ISZA 3L4ZA 4JFOB 5T1JA 3DHMA 4QXGL 1CBVH 4BQ6A 2H32A 4AK1A 3EYFB 1BAGA 2OR9L 4QCIA 2O61A 3QEUB 5FKAB 1RZJL 3RI5F 1LEIB 1QATA 4D8OA 5IB2A 3AG2B 2CLRB 3BMVA 3GMPA 4MJHA 5C07B 2VE6B 3QXDB 4JQXA 3BKYH 2J71A 4HCGA 1I7RB 4LIQH 5D96C 1IBGL 4OGAD 1FZKA 4B3EA 4CJ0A 1FV1A 2KERA 2H0EA 4JAMB 1CDCA 4NOFA 1NIAA 3UMTA 5CXPA 1U8CA 5ENWA 3RVWD 4IGBC 3DBXA 3H53A 3WDJA 3CQFA 1JJUA 3HC3H 3KPMB 3QJQB 4KV5E 4WO4A 5E6ID 4XNZC 3M46A 1OWRM 4GT7A 5D5MF 4FTVD 2AP2A 4YDJB 3L81A 1UWFA 4GSDH 4IKLA 5CFAA 1DE4A 3M07A 2DYSB 1V8HA 3D2UB 3NZSA 1MI5B 1ZDSA 3T2QA 3Q2WA 1IT9L 1XGUB 3GBML 5DS1A 2LGNA 4TUUA 4PD4J 4QYAA 4HLZG 1A7RL 3V52H 4TNGA 5CGBA 3ZBMA 3L3DA 4LEXH 3LX9A 2E75C 4MJ6B 5D4JA 2ZCLL 4I9WD 3VG0H 1JWSB 1E5AA 6FABH 1OB0A 3UC0L 4KTYA 4AH2A 3B8YA 2Z1KA 1OSYA 3OGCB 3EAKA 3QQ4A 4HZAA 1P69B 3E38A 5GRVL 4R5TA 3ZKND 1DVZA 5CU9A 1DBAL 2TSAA 3VI4B 1DEDA 2AANA 3C6EA 3RGVA 4H25B 3T0WA 1G7LB 1TJIL 2AJUH 4H2AA 2FHBA 3NJHA 4OGXL 4K15A 1BYOA 2F53D 2UXFA 4HMEA 4OLEA 4G8GA 3ABKB 4MXVF 4UM9A 1OP5H 2D4FA 3S88L 4XAKD 1X7SA 4LLAA 2WM0A 2R1XB 3QUKA 4JUSA 3CMGA 1ERNA 1OARH 1HX0A 4FA7B 5D8JH 1OAJA 3U6RA 1T83C 2PPEA 3BHBA 1WZ1L 1QBLH 5I73C 3HPJA 4LHQB 4DP5X 1DQLL 4UNUA 3KLLA 4WEUD 1A3RL 4QI3A 1O6SA 3B2PA 1DUYA 1MRDH 4AYGA 4PJCB 1E65A 4YUEL 3ZL2A 2PCFB 3A4AA 5F7MC 5BV7B 1MNUH 3FC8A 3T0DA 3CN3A 5ICUA 5IJBC 3MBED 2ITEA 3JWDH 2H2SD 1RFDL 2HFTA 4UMGA 5C0AB 4OLZH 2H5UA 2CLZA 2JKLA 3PAVA 1XHHA 3MLYL 1YDPA 4OJDH 4POZD 5FWQA 1ZE3H 1BD2B 3QUML 4NSKB 2B1AH 4ANUA 1XZWA 2UWEB 4H2CA 4L4TA 3PAYA 1I3UA 3P0VL 1TQSA 3V5HA 4NKDB 3WFEH 2F08A 1KYDA 3QUHA 2Q0ZX 5DD5H 4LCWA 2DQEH 1KB5L 5FOBA 2FQGA 3GLDA 4F2MB 2NX5A 3EGSB 4URTB 5JA8B 4HIHB 1OAUH 4PJBF 4QXWA 2XU9A 2V5MA 5E95B 5CLTA 2L7JA 4L9DA 2X89D 3GSXA 3LKRB 1JTOA 4O2FB 1CD1A 2JE8A 5I1KL 4X0KA 4M1CD 4N22A 5C0GB 2H47C 1RJYA 1XGQB 5I1CH 3VFPB 2VN3A 1NBYA 4IGBA 4UILH 1FVCB 1GYUA 4WV1C 3ZL1A 1TTCA 4HIIB 1UM5L 4MA1B 2RAMA 4YHYC 2VB5A 1UB5B 1MCNA 3BH8B 3QT2A 1PW3A 4AE1A 1YPZE 5DZLA 2VAJA 3AWGA 4MB1A 1MZZA 2BVQA 2CDFB 4Z3TA 2CD0A 4JVWA 2BWDA 1ZV9A 3AITA 1MF2L 4UIKH 3V9FA 3TWYA 1N26A 1YC8A 1NEZA 3C09B 4Y4HC 4YLBA 4OD3L 3HFML 3D3VA 1XCXA 3WFBH 5L7XL 4LOFA 1VACA 2VMFA 3RFZC 2BNQD 4LQ1A 4NFCA 4P4KC 4ZRGA 3MTRA 2PPFA 5FW7A 5I75C 4K5NA 4RGND 3ZE0E 2FJUB 4UTBH 1LP9A 3GBLA 4L5FE 1HILA 4G1EB 3P4LA 2Y3NA 3N43F 4I3RH 3DXAB 1QSEE 3KYNA 4J1UB 5FM8A 3H6AA 1Q9LB 3SQBB 1M42A 3D3VE 3F64A 3WY1A 4NO3A 2EE3A 2PR9A 4N9OB 1CF8L 3C6LB 2ZSWB 3L3GA 2G5RA 4W4OA 4UNIA 3WFZA 4Z76B 5KVEE 4ENEC 1N59A 3HG4A 4OCWL 3FUIA 3F84A 3R4RA 2R0KH 1NCTA 3QXTA 1BVZA 3QIWA 1XXDC 3AS1A 4OKDA 1INDH 1T5XB 2BHFA 3TIEA 3ZIYA 4AIXA 2F5BH 1KT2B 1PSKL 1W72H 4XCEB 1T83A 1RJLB 2XZQH 5G5DB 1A5FH 3F85A 5D9SA 3N42F 3PWPE 4G71B 3TGXA 3KVPA 3AJ7A 1YY9C 4YDMA 1CK0H 5AVTB 5HHPB 2IAMB 3VFSA 2HCZX 1WICA 3RIFK 3IDGA 1F18A 3L16A 4OV5A 3PHQB 1QZ1A 2F74A 4EKXA 3RWFA 4DCQA 2GY7B 5CIPB 4DW2L 1PIGA 3AMKA 3B2VH 3VMPA 4HC1H 4Q2ZB 5E5LA 1YN7B 5I6XC 5B3SB 5DFVD 5J57B 2OMTB 2VDQH 2HG5A 3VFGL 2LLLA 4QGYA 1OCWL 5LGJB 2BP5M 3N9GH 1TTRA 5DJDA 4ZMPA 1ZPUA 4K2UL 1QTPA 1ASQA 4N4YB 2P9RA 3BD4A 4Z7NF 4ODVL 1IIIA 1CICB 3ZJAA 2ZUTA 4BKLB 4WNQA 5IM7A 1E4XI 5K9OA 4N2OA 2CJUH 3QHTC 1IFHL 1PLGL 1YAIA 4FE9A 3ARFD 4JHUA 4LPYA 4IRZH 2R29A 5BO0D 4WWKC 1T3FB 3QDGD 4NIKB 1J8HE 2IWGA 2V3EA 5J12B 4TOYH 3BPNC 35C8H 3G6JF 3L7EB 3D12B 2HUEA 2CO7B 4JFFA 2EVHA 1DVFB 2DQFB 4JRLA 1IQWL 4GS7C 4TSCL 1WTGT 5FHAH 3O0RH 4C47A 3I3BA 1TVBA 2N56A 4NM8H 4Y5VA 5GRZA 3V6FA 3WENA 1X5KA 3TT1L 3KW8A 3S96B 2FH8A 2R0ZH 5ID0B 3FQYA 3MLRH 5FF6B 4C56D 1E30A 2ESVB 3DTUB 2E59A 4Z7OF 3BW9A 1P1ZB 1SDDB 3KL0A 4FYTA 4KAQL 1KEGL 1R3KB 4AW4A 3KS0H 1H8SA 5F7LB 3GBEA 1QFOA 2X4RB 1JCVA 4LE8A 4FP8H 3IMWA 5GRXG 1QO3A 3CZUB 1NICA 1QWUA 3ZKMC 5C97A 2VZOA 4K8RD 4P4KA 3KM1A 1S7QA 1M1XB 4WK2B 1YNLH 1I3VA 3HIZA 5DYOA 3MKGA 1UVQB 4PGZA 1F58H 4DN3L 3BEWB 3ESPA 1Z9NA 4HCIA 2AJ3B 3GK8H 4KHTH 2NYKA 2O5XH 2V3FA 1AXTH 5DC4B 3PJSA 1N4XH 3O6FA 2WNKA 3ABMB 3M1OA 2H32H 4MJIA 1N19A 2EDWA 4WFHE 4XAWH 4XWOD 3X2QB 4PGBB 1TU2B 4GBXD 3SY6A 1HK6A 3NRPA 1F6AA 1IC4L 3D30A 1SXZA 4QHNB 3E6FA 3DV4B 2AMUA 3B8SA 1H5BB 4BGDA 2F8XC 1QUNA 4ZX3A 4XBEH 1FHGA 3MRCA 5EWIH 2HYMA 1THAA 2FIKB 1JHLL 2P5ED 3S5LB 1FZJA 4NKMA 4PR5A 4RDQF 3TZVB 1UGNA 4KUCD 4XP4L 1NH6A 1ZHKB 1A1NB 1QI5A 4MB3A 4Y9CA 1HTYA 4G8FA 1JTTA 4KO7A 4LBEB 4CBZA 4PCKA 1ASPA 3M17B 1AR1B 5JQIB 3GRWA 4XP1L 3L3IB 3IPFA 4X9YA 4PGEA 3VVVA 3IJHB 1RZIB 4YX2L 1ZTXL 2KLSA 3DURB 3SE3C 3S35L 1UENA 4GMSL 1VFAA 4XCNB 1J48A 4QXUH 3IJEA 3W0WA 4DGWC 5IJKC 1X5GA 3ZT7A 3CXDH 3PDOA 3GJFK 3MRMA 3V5DB 3GMLA 4GIAA 1XIWB 1PZAA 1IGTB 4Z77B 3TA3A 1BQUA 1QFWL 4CMMB 2Y2TA 2CJTA 3V8OA 4Q6IB 1ROCA 4JCLA 3T8XA 3AG3B 1H3XA 1RULL 2JELH 4GAAA 2DAVA 4OCYL 4TL4A 4XN7A 4YHNA 3W0WE 1NA8A 4WWKA 1WZAA 2BIOA 2A5UA 3CXHJ 5CR1A 4D8PB 2FBRA 3LKQB 4I13B 4WUUE 3BWAA 1WBZB 5FV1L 1VGKB 2W8CA 3COOA 2K7QA 5DD0L 2B4CL 2OMYB 3QK0A 3V4PH 3QIUD 2NZ9C 4WWNA 2AJVH 2D73A 1Q94A 4HKJA 4JFQB 3KLHD 3S97C 4OZGB 1LO0H 3W37A 4KRLB 2VLRA 2EP6A 3HI1A 4DZ8A 3STBA 4OKVB 5CKGA 1JGUL 4Y4KD 1YEGL 4YSQA 3LRHA 2L4OA 4BH8A 5KSUB 5F88B 4J28A 4L8DB 4GSRA 5C6TH 2PCXA 1JD7A 4NHCH 4W9LC 4K9EL 2ZPKL 5JNYA 4N6RA 4NOBA 5TDOA 5J3HD 3MRDA 3ZO0A 1OTSC 3GS4A 4AZUA 4DN4H 4JFDE 5K9JL 2R15A 1OP4A 4ZMZA 4F9LC 1PX8A 3DDGA 4N0CC 3MLPA 3BSZA 1KOAA 4UUJA 1HC1A 2PPAA 5EBWB 5K1VA 4MX7B 4PU2A 1BIIB 4ZFOA 4GAGL 2P8LB 1W6WA 2EDXA 4Z7QE 4JBSA 4CVWA 3DHJA 2GTZA 5BV7C 3CTTA 5LCVL 2YK1L 5F7EL 2CM6A 2VN7A 4PJDB 5FEBA 1U8NB 4AQ1A 1DFBL 4XPTH 5FCSH 4XNYH 5IB3B 2IPKA 3MLZL 1S7SA 1DVUA 3MACL 1I8IA 3RX8A 1SF5A 5D2NA 5TE6L 4XPHL 4YDVA 5DJ2A 2Z8RA 4JREB 4PY8I 4JY5H 4ODXB 2R2EA 1UM4L 5F3FA 3UTTB 2PABA 1OXYA 4MNQB 2XXCB 2NW3A 4NNPH 1BZ7B 2YRZA 4HEPG 4JR9H 1IEBB 2ZTBA 3TBTA 3S3DB 5I1HH 3W5NA 1UCBH 1UZ8A 5DZVA 2WQ8A 5B1AB 4QT5B 3BFWA 3RWJB 3KPRE 2NSXA 2K78A 2RALA 3KCWA 3NCJL 2EDEA 3GZOA 5FKAA 1TEYA 1LEIA 2CLRA 4OCMC 2HJLB 5C07A 5L8LB 1FVDA 1GPOH 1S8DB 4BYHA 1OB1A 2QGEA 1G7HB 3KLSA 2VXQH 4TQPA 3CLEH 2FQEA 5IHUH 2V0AA 2CO4A 3ZE1B 4NPKA 5AVWB 4P3DB 3CN2A 1CE6B 3DX2A 1YSOA 4LPTA 1MG2C 1UOLA 3RX7A 5IEHA 1QLEL 1DYZA 3KPPA 4GQ9H 5IJKA 1QLRB 4MWFB 1PDKA 2NUPA 2IGTA 2D2OA 3KPMA 4MA1C 1MAMH 4QAMB 1S3KH 3BESR 3VXMB 1Q4NX 4N28A 4KY1H 3WHXB 5JDJA 1P7HL 2ITCA 2JKTM 3C87A 4S1RH 2FYYA 1N67A 2I85A 3GKWH 4PJAB 5D55A 1LWJA 1XEDA 5EC2B 5FXCH 1IGCH 3CG8A 2CG9X 4ONOA 1OHQA 2ADIB 2BY3A 2BPBA 4ZDHA 5IQNA 5CWSA 3VGBA 3C09C 3RTQA 4BFFA 3P3SA 3KPSA 5E51A 1G9NL 5IMLB 4AGLA 3HBPA 4UNVA 2KS0A 4PMFA 4Z5RA 2Z7YA 4GKNB 4XO3A 5I1GH 3D34A 4AYBA 4XH2A 4XCCH 1JWSA 1OGTA 1EBAA 3PUUA 3B9AA 1F97A 1K4CA 1X9LA 4OT1H 3CHQA 5GQBA 5EG6C 1Z5LA 1G7MA 1DQMH 3OKOB 1VCBC 4X4XA 5JORA 4KDWA 2E56A 5E1IA 3D25B 4NDMB 3INUL 4UQ9A 4R2GB 1MI5E 5FYJE 5EU7C 3GM8A 3VI4A 1U8LA 3NCFB 2XWCA 3V0FA 2EDLA 4F37F 3C6LC 2JB5L 2GPZA 5KYWA 3X12A 1Q9OA 1I8MA 3FT2B 1QTSA 4A7TA 4K3JL 4V2BA 5AZ2L 4IBZA 4EEEA 3L4UA 2Z6FA 5C0CB 1Q9WA 4HEME 2X2UA 3UPRB 4U2ZA 4AKPA 4Z8FH 4D0DA 4G6JL 3NAAH 1UT1A 4F9LA 3SCMA 3ZUNC 2A77L 3MRLB 3HZYA 1QSED 4P2YA 4EO5A 2IAMC 3U0TA 2Y07H 1AE6L 3Q44A 1SM3L 2W92A 3QDMA 1QBML 4W9GC 4QLRA 3X3FL 1U92B 1J1OL 4N2DA 4PJCA 2WCGA 4EOWH 3AXIA 3FU3A 1XB8A 3L9BA 4Y0GA 4BV1A 1ZGLP 3QI9D 2R29H 1FO0B 5CN1A 4UQCA 1KCSH 2BJMH 3NJKA 5HYQA 1ZLWH 1E7UA 1F8TH 1A6UH 3ZN6A 3ZTDC 4CMHB 2QHRL 3LQAL 4GW1A 4K5OA 2QGBA 2CR6A 5HDRA 1H19A 1CICC 3EZ8A 4GW5A 4NSKA 4BK5A 4EI6B 3PWPD 2UWEA 1EZSA 4NNXB 1NKRA 5HDOA 3WHE0 2GSGB 3VXRB 2IH8A 4HIHA 4QKXB 3HBZA 1AI1H 5J12C 4FNTA 5FW8A 5C0AE 3II1A 1NCWH 1HQ4A 3LKRA 1DVFC 5E0QA 4JN2A 2VSDA 4U31A 3HKFA 3JTSB 1I7TB 5T1DH 1HZLA 2KZKA 4TV3A 5F7DB 2HSIA 2X88A 1J0JA 2VR6A 5D4IA 1BD2E 4RBPH 4AW7A 4XOBA 5CEYA 3EJQA 4OZFA 3TWCH 1AGEB 3OAYH 2P8PB 3B83A 1L7TH 1ZVSA 3FU0A 1FVCA 4UI2A 2HLFC 1ZLSL 4HIIA 2WZPA 1IO4C 2WB7A 1UB5A 1SXAA 2EDFA 1F2XK 1NBVH 1YN6A 4F2ME 3VAEA 5JQ6H 1XXFC 4KXZI 3DX6B 4Y4FA 5KJ7E 3B7YA 3L3KA 3PGDA 3CZNA 4HK0A 3G7TA 2CDFA 3MR9B 1KJMA 3W11C 5TQ0H 2BSEA 4ZI8A 1R5WB 3KLKA 5J8OA 1AOHA 5DLML 4MKTA 5EU4B 5I6OA 3RB5A 4POUB 3ZTNH 4M1GL 2R27A 3FO0H 2NY1B 3Q8FA 3U7AA 1NUGA 3ARGA 3ALPA 3IAGC 4JGJA 3L5XH 4OIIH 2F8OA 4Y7MA 3NT0A 2Q8BH 4NQSA 3FOLA 3QIBA 4G1EA 3M7FB 3EYSH 4K7FB 4PBDA 3ELQA 1A1OA 5IKCB 4OJCA 4WHTB 2MMXA 1Q9LA 4F58L 2L0DA 4H0IA 4EIGB 1DBBL 4ELKB 5JIKA 3K72B 1JZJA 2HJFB 3FPYA 4O02B 5BXFB 2MKLC 5B4MC 2ZSWA 4Z76A 3Q1SL 1BPVA 3GRWH 4KKNA 4ENZA 4NQTA 3EYQC 3EOBB 3MCKB 5DEFA 1H5BC 1QNZL 3WU1A 3EYOB 1IUZA 4TLSA 3AREB 3OJMB 3QUXB 3GI9H 1PLBA 4GSUA 2EIZB 2VISA 3EGDB 3PIQB 4ORGB 4Y19A 3T0XA 3DXAE 2DQIH 4LCYA 3TZVC 1RIHH 1GGUA 2G60H 2BC4A 3DUSB 4WFEE 3N1PC 5BW7C 1BQSA 4IU3A 1IBBA 5FECB 3PDDA 5IB1B 4TNVF 4FNQA 3ESOA 5KN5A 2OMXA 4E0RA 3L5IA 4KX9A 4WTWA 3VDBA 5HHPA 3FH8A 1AR1C 4G8EA 1KENH 3GSNA 1GC1H 4RMQA 4D0CB 3V4LA 3WFDH 3FT0A 2XTLA 2BSTA 4NQDD 1R4XA 3U9UB 2R7EB 2RFXB 5EZJB 1F11B 3PV6B 4Q2ZA 1YN7A 4ILDA 3CVIH 4J4PA 1QFWM 3WIAA 2ZYIA 3RKPA 3K7UA 3KXFA 4DKFH 1I7ZA 1JGIA 1OGAA 2R4RH 1DSYA 1XIWC 1JXFA 2VDRB 2WLLB 4M6OL 2FECI 3ATDA 4MJ2A 3B2UD 3NIDF 1VEOA 2ALAA 4LOUC 5FPIA 1GYVA 3NJIA 2P28B 2EXWC 2FWLB 4MMZB 4Q6IC 2GB2A 3WJJC 2VJ8A 2A9DA 4B3VA 4FMVA 5ALBL 2OJ1A 3KWUA 4TYUA 4Y16B 4NO5B 4XX1E 1XD0A 3BAEH 3G5ZB 3H6JA 3KPLB 4LSDA 3P4NB 5ITBH 3FB5B 3KL3A 1TZOA 2YXMA 1RMFH 4M3JA 4ENED 3B5TA 3SPJA 2P1YA 4L8CB 2OXGB 2OZ4H 2J8HA 4JRFA 1ZLUK 4MNGB 2LABA 2UUDK 1Z3GH 2BRQA 3PABB 5F3BA 3P0YH 4H0HB 1PZ3A 3F00A 3F7QA 4RMBA 5TF0A 4OJAA 1FRGH 1AKJA 1XBDA 2IFFL 2MCPL 4Q9CA 2CRIA 2IAAC 5J11B 4NZUH 4HFUH 4ODSH 3S96A 1SFHA 3PWJB 4OF6A 2R9HC 3BSZH 5FF6A 1A3QA 2ESVA 4G7RB 3JBG7 3R19A 1P9MC 1T1ZA 3GSOA 5KJRH 1UM6L 1R3IH 4X80L 4DAGH 3PLYA 3IT8D 5BVJA 3NA9L 4RA0C 1E42A 1RUAL 2APBA 1NDMB 2CGRH 4WUUD 1GR7A 1CR9H 5TPWL 5GGRB 2B2XL 4LASL 5LDSA 4KZDL 4F7KA 4EIUA 3LVTA 4HJJL 4OH2A 5FC9A 1IB5A 1NC2A 3N1MC 1CGTA 4IKIA 5BVPL 1UVQA 1IZKA 3BEWA 1MDAA 2UZIH 4I5BA 1PG7H 5AUMB 1YRKA 1BM3H 2WJ7A 3JWOH 3ULVL 1EJ8A 2XIBA 1JBJA 4KI1A 5GRYA 1GGIH 3RKDC 4QDGA 1OOWA 2DDQH 5GGVL 4ZPVA 1EGJA 5DCCA 5DEJA 1TU2A 2E4TA 2FL5B 3MRIB 1MEXL 3EDJA 3L3OB 4F5CA 5IB5B 3ULUL 5JO5B 1GY2A 1CDIA 4FQCH 4YSCA 1JL8A 2F7IA 4PB9H 4J2XA 3WS3B 4JREC 1H5BA 2WMPB 1QYGL 1YECH 2IBZY 5F1SA 4QKTA 4JFDD 2X70B 3ASWA 4JANB 5F7BA 5FKPB 3T3PB 4XB8A 2D0FA 3LJ3A 2YS4A 4ATWA 3FDWA 1BSIA 4WDIB 5TFSL 4HJIA 1VIWA 4A04A 1S7TA 2C4XA 4LVHB 1DN0A 3NIFE 1C1EL 3JUZA 4GMTL 4UM8A 1U8OA 1IV8A 1A1NA 2X12A 4M5SA 2WINA 3GMOA 1IVTA 1UZ6E 4WTQA 4K7PH 1BZDA 3M17A 3GHBH 2BOCA 4QEGA 1D7CA 3L3IA 1SLUA 3FOMB 4FXKB 3RJDA 3EOYG 4AMXA 4TUOB 4ONGL 3UBHA 1WWBX 1DVTA 1P7QD 3IFLL 5C2BH 2QLYA 1NEPA 1DEEA 3ZKMD 4QY8B 2R0LH 1WS8A 4HAFA 4HIQA 1OK0A 4XX1G 4A7SA 5LVEA 2J6EL 4Z3GA 4MD0A 4RIRB 1OT1A 3OKEB 1NINA 3QCVH 3MQIA 1PX3A 3U36A 1IGTA 5GGSY 3VGFA 4G6FB 4K23L 2DYPD 4DEWA 3L5JA 3NYKA 3KPRD 3ZQWA 3BN3B 3F6IA 2IG2L 1DQTA 3VXTB 3WJJA 1TQVA 4IBVA 1R3HB 2EDTA 5DZ9A 3BP6A 2BS71 1NAMH 2CUAA 3MKKA 1PZ5A 4LCCB 5KS9F 5ACLA 1MCSA 2CKBB 3NIGF 5EN3A 3DRQA 5EEUA 1UJTA 5IQ7H 1HWGB 4OF7A 2C7UB 2J5LB 2Q3AA 1ND0B 1V3KA 3A6BL 4IS6B 5I1JL 2QVTA 3GIZL 1AC6A 1CYWA 1NLBL 1W0YT 2G5BB 3B34A 2DRUA 4LIQE 5MP6H 1AGBB 4PS4H 2XJLA 4HA1A 4OVVA 2V2WB 2W0FB 4ELMB 3OLDA 2OMYA 1DSWA 3CSYA 3RB7A 4YDIL 4R2GC 3RWDB 2LFGA 3WDIA 1H3VA 2OI9B 4XB7A 4OKVA 1AQKH 1N8ZA 3OX8B 5GSVB 3S36H 4HWBL 4AT6A 4QRPA 1AC0A 5KSUA 3H3BC 3IJSA 3F7YA 2DQCL 4LSTL 3SO3B 2ZUSA 4P2QB 1YEIL 4F2EA 2JB6A 5KVGE 3BZ5A 4WWOA 5HYSG 3N1QC 2ETWA 1OD7A 4AENA 3BJLA 3WEBA 3WIFB 2ZOLA 4OZGE 3FT3A 1YMHB 5I15H 4K71B 5CJQL 1CTOA 3D2UD 1XGZA 3GXTA 2A6IB 2KL6A 3KR3H 3N06B 4JRYA 4R97B 5JA9A 3O9WA 3JV6B 1P84J 4L05A 4M5ZH 1LJMA 1FE8L 1ETB1 3FO9B 1YJDC 2GEQA 1UWXK 4PJDA 3QQXA 1GKEA 2FX7L 4LSQH 4GOSA 5IB3A 5IJVB 4PBWD 1SLWA 2R0WL 4DKEH 1RIUL 1MWAA 4C8XA 3MUGB 1KDJA 4UU9A 4CMHC 3WTWA 4HAKA 5C8JA 3UJIH 4Z7VF 1KTJA 3NJLA 4ODXA 5EZIH 5H37A 3UTTA 2HKFH 4XNMA 2NZ9D 4MNQA 1A6ZB 2CPCA 1TETH 3FB6B 3ZU8A 3GLZA 4R7NB 4EN2A 4A7QA 1FDLL 1EEYB 4OZFH 2AGJH 4XBGA 1E4XL 1SGKA 1KLUB 3S5LG 2FWOB 3ZIMA 4PJDE 1MFAH 3BKJH 4XVTL 1WHOA 5SWZB 2BSCA 5I0YA 3CVHL 3VXUD 2X3CA 1J10A 4AQAB 5KBPA 3CLFL 2V5SA 5AOLA 1YCSA 4HUKB 4M5YL 4L37A 7PAZA 1G7HA 4X7CC 4L4VB 3RWHB 1AIZA 2Z93A 3O11B 4GUQA 4I2XA 4K3HA 2JMRA 3REWB 1UCTA 4P3DA 4K3GA 1CE6A 2Y1ZA 4U1SB 5IFHL 2APTA 2FNWA 2VDOB 5L88L 2VDKH 3CSBA 4FQ2L 1QLRA 1KELL 2OMWB 3ARWA 4MWFA 4RZCB 4MJ5B 3LZRA 1EAJA 3W2DH 4F33A 2J8OA 3T77B 3B9KB 2R23A 2COVD 4L1BA 1NGWB 2VDPB 5IBUB 1QMUA 4FQLL 4M4RB 1J5HA 3IU3A 2UY6B 4WTZA 4XNUL 4E36A 3RUGF 3OVUB 5C0AD 3ZE1E 1MHCA 1ADQH 1H9DA 4HJEA 2NY1C 1WG3A 2OR8A 4PRBB 3GXPA 4PRPB 4RMSA 2BVUA 3HG1A 4Y5YB 4M3HA 3P4OB 4Q9RL 1WBYA 1CFQB 4GKNA 4DPBX 2Z35B 4DOHB 5AVYB 2DOCA 3VXME 3VXPB 2A9MH 2F54B 5K93A 4ZUWB 4GP8B 1EMTH 1KTCA 1KNOB 1ED3B 3ECBB 5BO1L 1H8LA 3K1KC 3N44B 4PJAE 4WKZA 1D7FA 4MDJB 1R6VA 4JDTL 3M8OH 3UGEA 2WW8A 4OM1L 3RURA 5FW6A 4MXWL 3VWJD 1EFXD 5F7AA 5HGGS 1BDYA 1U3HA 4U7MA 1D6EB 4R8WL 5E8DL 3WUWG 4OF0A 5IW1A 4JLRB 4QRUB 1H3PL 3GSNH 3FT2A 3MLSH 4JMNA 4GI9A 1I75A 2AXHA 3QJRB 5HPOA 1DQJB 1ZEAH 5KOVC 3AREC 4YVUA 2VRKA 3QUXC 1GJIA 3T6WA 2VXSL 4A6YL 2DH2A 1CN4A 1P4BL 2X6MA 3F83A 1HOEA 1JOIA 1CUOA 3F6LA 1PAMA 2YAHA 2E9IA 3BRDA 4GB9A 1AZRA 3MRLA 2ZKXA 4PB0H 3MRFA 5HDBB 3E8VA 1RZKL 1HSAB 1SBBA 3P9LB 1S7UA 3S8GB 3V0HA 2BVPB 2AEWA 2ZKHL 1FBIH 3BMWA 4TVPH 4PRNB 2XWXA 5EUOF 4PJHA 1FPTH 5C0CE 3EBGA 3WUZA 4ZFZB 2B0SH 2V7NB 2EIJB 2EKJA 2P3YA 2XHNA 2BWIA 4TQEL 2XG4A 5IQMA 4M5TA 3OXSA 1WIPA 4JK0D 1ZSDB 1BXUA 4DP1X 1OQXA 3BXNA 4JPIB 3UO8B 3DXAD 1J1XL 4NYLA 4PJ5B 2H45A 2PYFA 4RNRB 2A6JA 2V6HA 2WLMA 4ZS7H 4W1TA 4MMZC 2APSA 1GYCA 2YD0A 2B1HH 2N0MA 5F96L 2VAAA 3O6ML 4Y16C 5E9DA 4QXTA 4NNXA 3C6LD 3LZFL 4K94H 3CFBA 5I1EH 4F7PB 4RA3A 1A6WH 4X0NA 1KXTA 3L3JB 2LAGB 1NFIA 2WWMC 1ITCA 1QKZH 1WZKA 4XCFL 1CFTA 3JTSA 2O5YL 1I7TA 1YEJL 4RQQA 5AQ0A 3LH9A 4GRWB 5F7DA 1IGML 1K8IA 3VTAA 4G6KH 3VGDA 4UOQA 5KVDE 4XPBL 5E7FA 1AGFB 1EEZA 3US1A 4FRWA 1AGEA 1QPXA 2CRMA 2BRRL 4FNUA 4P2OD 5J11C 2NSMA 1GTFA 2NT0A 4IRJD 2IAMD 5GGSB 1JXJA 2WUBL 3INOA 4DGVL 3VXRE 4QTIH 3ARTA 4HUCA 5IF0A 1KGCE 3KWWB 1QR4A 2NY0D 2VCOA 1C12B 5C3IA 2CHXA 4PY7B 5EU4A 5D6CA 2N7SA 1XSKA 1YMMD 2Q9OA 1EGJH 2JSFA 3C5ZB 3D4YA 3L4TA 1GGCH 2O6PA 1XR8B 1WUZA 1CICD 3BUTA 2BY1A 5F7HA 3N50A 2W07B 2EYSB 4PGDB 1LK2B 2DF3A 3GMNB 1KCVL 3GTNA 1ZGLA 4Z3JA 3KBHE 4OW6A 4R26H 2HH0L 1KC5L 5E1AB 4WHTA 2EABA 4YIQB 3CMOL 4CSZA 4OLWL 2XQYG 1CLZL 1URIA 4DP7X 2NY6D 3KLDA 1DVFD 3L3OC 5E9NA 4HGKC 2AJYH 2WLYA 4K07A 3MCKA 2WZ6A 2I60L 3L95B 4K3DL 2QQLH 3UROR 2NNRA 1LWHA 1YEKH 2VN4A 4KI5C 2AZUA 4XC1H 4JFUA 4UQ3A 3QJHA 1D5XB 3EGDA 5DZPA 2HLFD 1EUUA 1M57B 3O3DB 1XZ0A 4LVHC 5GIRA 2FJSA 1SOQA 3DUSA 4R7VA 3E6HB 4FMFA 5IB1A 4NN6B 4U6TA 2JKIS 3L2LA 2ICEB 3A47A 2VLJA 3ZYIA 4FXKC 4MRBA 4PJGF 1E4WL 2FAUA 5D7IF 1BLNA 1UB6A 2GQHA 3KHOA 3SJVB 3SDYL 2BNRA 3LCYA 4OZ4B 1B3IA 2OMUB 3KPOA 1X6LA 2RFXA 3IDIA 4J3TA 3PV6A 3FF7A 1O5DT 4N5EC 3QEQB 3WY4A 1LEKB 3T2NL 2AERT 4W6XB 1KTDA 3BCDA 2GJ6B 2PTTA 3O4LA 3BX7C 2OMZB 3VFMB 1I85C 5C0DB 5AKRA 1WLHA 1QRKA 5AW4B 4R7XA 1Q0EA 3ZDZF 2E6PA 1KV7A 5AW2B 1NCOA 2WLLA 4G9DB 3OAWA 3BAKA 3H55A 1XF4B 2G4GA 1MVYA 3QUMB 3V4VB 2ICWB 2BLFA 4KXBA 3BLBA 3LB6C 4Z7UE 4LCCC 3CIQA 1KB5B 4P23A 5EEZA 4AXWA 3ZHLA 4ZMVA 3AVEA 4HJ0C 1UD5A 3OKDA 4PJXF 4X6DF 3BE1H 4Y9BA 5CLZA 4AL8L 4D9LL 4L8CA 2A9NH 1M9WA 2J5LC 1YNTA 2OXGA 2ZX7A 4JDVB 1A4JB 1LVEA 1OE1A 1SVZA 2CK2A 2F15A 2MSPA 3GXIA 3SDDB 4URKA 3IMBA 3K74B 1MIEH 3AT0A 1TVHB 3PABA 4IKKA 4MNHB 3LZNA 4ODWB 5D71H 2ZP8A 5FUOL 2YKLH 4XT1C 1CLCA 2OI9C 4LSRL 3NSCA 1AR1D 3ZXAC 4LLDB 1J8KA 1DBMH 2FT6A 3BEVA 3BI9X 5AZUA 2JV6A 3E80A 5IJCC 1EHXA 2E7LA 3BZFB 1EXHA 1H3WM 5ALCH 5LLIC 3MO1A 2GSIA 3WIIL 2APVA 3BP7B 3QUZA 4I89A 4MNGE 3SO3C 2OQJA 4JGNA 1IE5A 3CSFA 4JRXA 5B39A 4RRPG 1JCKA 1MHPH 3S8FB 3I3EA 3D0AA 3M7OA 1XIWD 4WZ9A 3ZYOA 1MWAH 2XJKA 4BDVB 1PYWA 1IAII 1X5XA 3VW3H 4NZRH 4K71C 5H37H 2EXWD 2WLZA 1FORL 3AG4B 1ZIBA 1UD4A 3SDCB 1JYNA 4R97C 4J3WA 4L3EB 1TJMA 3V10A 1GZHA 4IBQA 4U6VH 3TONA 4FA6A 2IQ9L 4D0BA 4JO1L 4HOZA 5C0IA 4RGMB 2HVKB 2KBGA 5A40E 3J7HA 3U25A 4NWTH 1RERA 2FL5A 5B1CA 4XRCB 1MCHA 3RRQA 5IMKA 4O9HH 2WMPA 1XF5A 1H3UA 4A38A 3QZPA 5IUSA 3NA4A 3OAZK 2DMKA 2HVJB 3PCYA 4YGAB 3RY6A 1SFDA 3WKML 1KG0A 4WDIA 1SEBB 1P0SE 3BWZA 4K8RL 2R9HD 4LLQB 3DGCR 2JF1A 2ORBL 4HWZB 4X4MA 1WISA 2ED9A 5D7JB 3O2WL 4DETA 1M7XA 5FS5A 4NP4L 1OSZB 4P57B 2PWEA 3A21A 5AAMC 4MS6A 1HHIA 1I9JH 3FOMA 4M8QB 1WAAA 3HNVL 3FBQA 4WEEA 1E9QB 2KT6A 1J5OH 4OGYH 4KKLC 3WN5A 3S37H 4AOFA 4KI5E 1JGDA 1V5JA 2AV7B 3AG1B 3T3PE 1RU9H 4QRRA 5EFIB 1EHLL 4NERA 3VE0A 4RIRA 2ZJSH 2ZOWA 1I85A 3FBKA 4U0QB 4TLKA 3OMZA 3B9KC 2VLKE 1MPAH 4KQ4H 5HJ3B 2DKMA 3SZ6A 1J11A 1LNUA 4ZSOB 2C9RA 3PHSA 5DZAA 4UT9L 1Q0YL 4HUNB 4OI7A 2ZIDA 4KKBC 3U4BH 3VXTA 1SOKA 4HHAA 4HXBL 1R3HA 3S3SA 1MW3A 4P46B 1G9MH 2ZG1A 2FO4A 4LCCA 1HFUA 3N41F 3RIKA 2CKBA 1P4IH 4LO9A 4H1LB 4S2SA 1AXSA 2QADB 4Y5YC 3WIHH 1D6VL 5KSBB 3IVKA 5AW9B 4ZW6A 4IS6A 3AAZA 4XVUC 4HDIB 3KH3A 2HTLC 4UT6A 4DEUA 1KIQB 3BIKB 1NCJA 4JN1L 3SKMB 4QLWA 1CFNB 2H6OA 2V2WA 4KNQA 2VGLM 4ZMNA 4L18A 1NMAH 1FZMA 3F7RA 4HWUA 1XSIA 3DJRA 5HGDB 2XTJB 1JN6A 3RWDA 3MZGB 4H8WC 4YL4A 3BP5B 2DYRB 5FA4B 3PWLA 4KUZH 2HFFB 2GC4C 3MC0A 4HD9A 4ZFGL 4O58L 1PY9A 2YGOA 4J5VA 4BFRA 3Q8BA 4L8BB 1U9KA 1YY8B 3IFNL 4AC4A 3MLVL 3HAEA 1BZ9A 1CTMA 1FYTB 4PS3A 3EGXB 4P48A 4NXKA 5DK2B 4ZMWA 1BJ1J 3ARQA 5SWSD 3QYNA 4HUWB 3VXMD 4ELME 1Z9SA 5D5MB 2X6VA 5F89B 3WIFA 1U4EA 5F9DC 3Q6GL 1BECA 3RILA 3F2LA 3DGDA 1S5HB 1HINH 1T0OA 3VRLF 4F7MB 1X5HA 4ONHB 4CADB 4YLCA 1T2QL 1R17A 1PJWA 3QNYA 3QISA 1FFNA 2FJGB 3QPQC 2D0HA 3R1GH 3N91A 3MA9L 4X6BB 3CX5K 2GFBB 3UCRA 3P9WB 2ADFL 4P5TD 1JWMB 2X1XR 4HFWB 4P2QE 4BFGA 1KN4L 3OJVC 4CW1B 2G75B 4Z3IA 3CK0L 1NGXB 5DMIL 5E99H 4PGJA 1VPOL 1KN2L 2PW2A 5AOKA 2Q6WB 5HHQB 2CO6B 5J9PA 3QB7C 2FHCA 1SJXA 3GHEL 2K8QA 2VL5B 2X0UA 3FTVA 1IC7H 1TTGA 4ZZKA 1DJZA 3Q5YA 2HZHA 1H0DA 3OPZH 4MA7L 4KX7A 3OLGA 2RGSA 1KLUA 4YHML 1Q0XH 2FWOA 3GDBA 1ZHLB 3VM7A 1UXLA 3HLAB 5SWZA 1N70A 1MCOH 1A7PH 1RZJC 3GC3A 3QJZA 4HCRH 4X6CB 4AQAA 4X9BA 4WJKB 1DSFL 4XWGH 5C0CD 4HPHA 2W5PA 4YMPA 3SPCA 3OR7B 5CBAA 1EO5A 1J9CT 1KCLA 4LB8A 4OZIB 1LE5B 1RVFH 3V7MA 4CSTA 2VSMB 2DI8A 1G7PA 2EYTB 2GI7A 2XN9D 4MJ5A 1FGVH 1LO5B 4ZUUB 3EOAB 1I1AA 2L7EA 4G72B 4E9XA 4LQFH 1A47A 3N5AA 4EI5A 3TOPA 1C5DB 1T1YA 1E6JH 4S0TD 3U1SH 1KCBA 4O4YL 4HF5H 1OSPH 3G5VB 4M4RA 4L4VE 2UY6A 3HTLX 4GW4A 1FQ9C 2CMRH 5LGKA 3DO7A 5D1ZB 2GVYA 5C6WH 1IGIL 3LQMA 3POCA 3ZRSA 1R5IA 3MLWH 3NZ8B 4MDIB 4OLXL 4PRBA 3C5ZC 4GLRI 1LXMA 4PRPA 1KYFA 4R0LA 1DJWA 1B0RB 4G9FB 5D70H 2EC9T 2Z35A 3ETSA 4IOIA 5LUMA 5DD6B 3L4XA 4GSQA 3QQDB 3Q5OA 2JIXD 3UBXB 1BGXH 4OLUL 4PJBB 4MDJA 2QBWA 5B7EA 3FQRB 4ZAKB 3VXRD 4K9JA 3FSWA 5CLXA 1JD9A 3S7GA 5F8RC 4OLYL 3MYZA 3HZMB 1JYVA 2FE0A 3OJDB 5ESAB 3QFJE 2XZAH 1TT6A 3C2AL 1E9PB 4DOHE 5I1LB 3G9AB 3AFLA 2F54E 4MQXD 1A14H 1REIA 3T6VA 5IWLC 2G30A 2XRAH 1HHKB 1U8PA 2YXFA 1JV2A 4FQJL 1T0NA 1R0AL 5E6RB 5GISH 1BV8A 1UWEL 3H8NA 1UZGA 4NN6C 4M56A