5I26A

Azurin t30r1, crystal form i
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
128
structure length
127
Chain Sequence
AECSVDIQGNDQMQFNTNAITVDKSCKQFVNLSHPGNLPKNVMGHNWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEGEQYMFFCTFPGHSALMKGTLTLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Determination of nitroxide spin label conformations via PELDOR and X-ray crystallography.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Metal binding protein
molecule keywords Azurin
total genus 30
structure length 127
sequence length 128
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2016-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 5i26A00
5D4JA 2IWEA 1BQRA 2AANA 1J9SA 2EIMB 2P80D 2VW7A 5TK2A 1JZJA 2IH9A 3AG2B 3NSDA 1V55B 6PAZA 1NDTA 2CJ3A 2DV6A 3NJJA 1ILUA 1A4CA 2GI0A 2XV3A 3OM3B 5I26A 4EF3A 2YXWA 1FFTB 1URIA 1IBYA 1SFDA 2DWTA 2UXGA 1KYAA 2BP8A 3QQXA 1CURA 3S3DB 1E5ZA 5I6NA 1KBVA 2PP7A 3GDCA 1A65A 4YL4A 2GIMA 5I6KA 2LLNA 4G7SB 1HAWA 1QNIA 1JZFA 1N70A 2VW6A 4KNSA 3QJVB 1OCCB 3N2JA 4YSAA 5ANHA 1KBWA 2DYSB 1J9QA 1NTDA 2CBPA 4G70B 2EILB 2PP9A 2CALA 3JTBA 5E9NA 3TA4D 4K9JA 4BK5C 3ZIYA 2I7OA 1HAUA 2VSMB 3CVBA 2QDVA 4UAHA 1ET7A 2VM4A 3PLYA 1ADWA 4CSZA 4YSSA 4G7RB 2VMJA 4NERA 4A66A 2XXGA 5B7EA 3ZBMA 3UGEA 3V9CA 5I6OA 3TU6A 3IN0A 3U25A 1OOWA 4E9WA 2Q9OA 3NSCA 1AAJA 3PAZA 4YVNA 1E65A 4DPCX 2BP8B 4BXVA 2XX0A 3SBQA 3C75A 3PPSA 1DZ0A 2UX7A 1RCYA 3WNJA 1BAWA 5D4IA 2BO0A 1AG6A 2FQGA 2PPFA 1KGYE 1F56A 1N68A 2FQDA 4DP6X 2XU9A 1SHWA 1BXUA 2FQFA 2OV0A 4YSPA 1X9UA 3FPYA 1PZAA 5F7AA 3CG8A 3AW5A 2AZUA 2PP8A 2BHFA 2EIKB 5FC9A 1OE3A 1PCSA 4ENZA 2YAOA 3FU8A 4A2DA 2IDTA 1A8ZA 4KO7A 1J5DA 1L9PA 1NPJA 2DWSA 2N0MA 4WTQA 1CC3A 1WS8A 5I5IA 4YSCA 4L0PB 2HZHA 2A3TA 4G7QB 3DKHA 3ABLB 4KO6A 1GS8A 1ETJA 1PF3A 1WAEA 2WO3B 1XB8A 4X4KA 9PCYA 4YSUA 2I85A 1ZDSA 3DIVA 3UAAA 1V10A 1WA2X 3MX0B 2QPDB 1IKOP 1SDDB 3ABKB 3ABGA 3FSZA 3AG4B 3NJLA 3CVCA 5AKRA 3GXUB 3OMAB 2YQBA 2WO2B 3UADA 1PZBA 3N55A 1SF5A 2PCYA 1IC0A 2W88A 3KW7A 5I6MA 1A4BA 4YSOA 1PNDA 4WKXA 2UXTA 7PCYA 1PLAA 1GY1A 4HIPA 2FT8A 3NSYA 5B7MA 1I53A 1FA4A 1T5KA 4GY4A 1AIZA 3NP3A 2AZAA 2P80A 1JXFA 4DP1X 5A7EA 3X2QB 1GS6X 1GW0A 3FT0A 4YSTA 3CZUB 3JT2A 4W1TA 4NB7A 1M9WA 2YARA 3UAEA 3X1NA 1YLBB 2PPCA 3S8FB 3ERXA 6PCYA 2YAPA 1MZZA 1NWOA 2XX1A 1KV7A 2JKWA 3AG3B 5AZUA 2FNWA 3FU7A 1NIFA 4DP8X 1NICA 4A68A 4KNTA 1AACA 1J5CA 4GP5B 3HEIB 5B1KA 3PCYA 4E9RA 2VSKB 4HAKA 1AS8A 4JHVA 1NIDA 4A2EA 1AANA 1UATA 3EH5B 4N8UA 1BYPA 3NJNA 3CDZA 2TSBA 3AY2A 2R7EB 4KOBA 4AKQA 2MTAA 2OCCB 4NAJA 2IDQA 1AZUA 3NJGA 1SF3A 5EHFA 1ILSA 3WIAA 4BDVA 2IH8A 2HX8A 1SNRA 2R7EA 3MBWB 1L9SA 1RZPA 3G5WA 3FU7B 2YAQA 4BDVB 4FAAB 3NJHA 4DPAX 3ASNB 2PLTA 2XXFA 4P5RA 1XB3A 2DY2A 4P5SA 3EH3B 4DP9X 5I28A 4A2FA 2GBAA 1PNCA 2IDSA 2VW4A 3OMNB 1DYZA 1A4AA 4ZK8A 1BXAA 3RYMA 1MG2C 3FSWA 3NT0A 2IAAC 3X1BA 5B1AB 5B1JA 3CVDA 3X1FA 2FQEA 4AZUA 1BYOA 2E86A 1AZNA 1GYCA 2FTAA 4E9QA 2UX6A 3SBPA 1E30A 3WKPA 1ZPUA 2IDUA 2H3XC 1NIEA 2UXFA 2JXMA 3FQYA 5B7FA 5B1JC 4GXFA 1NWPA 1ZIAA 2B08A 1NPNA 2GB2A 4F2FA 1ET8A 4HCFA 3TASA 1M57B 3ZX1A 2Y1AA 1BQKA 3IEAA 4UANA 2BP0B 1JZEA 1AR1B 1B3IA 1ZDQA 4TXVB 1KDJA 1CYXA 1OCZB 4BWWA 1V54B 4PCYA 2B3IA 3FSAA 2BWDA 2QDWA 1GY2A 1BQ5A 5I6LA 1BEXA 1OV8A 2IWKA 4Q8BA 1HFUA 1EHKB 1JVOA 2HLEB 2XV2A 4DPBX 1A3ZA 1AS7A 1SFHA 1OE2A 1XMEB 3T6WA 1CYWA 2HXAA 1M56B 3FQ2A 1ID2A 3QJUB 1E67A 3IE9A 3S8GB 4E9TA 3L45A 1AG0A 4RH4A 1MG3C 1R1CA 3H56A 1J9TA 4G72B 3CDZB 2X87A 1AS6A 2XLLA 2HRGA 2Q5BA 4HHWA 1GS7A 5PAZA 1ZV2A 1TEFA 3SBRA 5I5MA 3T6VA 1TKWA 3IN2A 4DP0X 4JKNA 1NZRA 4BWTA 4M3HA 1ASQA 2BWIA 3EH4B 1GR7A 2OJ1A 4DP2X 4E9SA 1WA1X 2I7SA 2FJSA 2ZONA 1L9TA 2XV0A 4BXSV 3QJTB 1NINA 3NP4A 3DTUB 2XUWA 1W8EA 2BW5A 5B1BB 1OF0A 1PMYA 4HCIA 3S3BB 1L9RA 3EHBB 3TBCA 2J5WA 2FWLB 2MRYA 3QPKA 3T6XA 1EZLA 2UXVA 5I5JA 1L9QA 2GHZA 1E5YA 5AFAA 2W8CA 2J56A 4JHUA 1W6LA 4DP5X 4DP7X 1JOIA 1OCOB 1KCBA 4A2HA 1IBZA 2CAKA 3NJIA 2GSMB 1SDDA 4DP4X 3H4FA 3S3CB 2HX7A 3AZUA 4BWUA 2GC4C 2EIJB 1VLXA 2XWZA 5B3SB 4YVUA 4YSRA 3QJQB 2YXVA 4GP8B 1MZYA 5LDUA 1AOZA 1XB6A 4HCGA 4KO5A 3NJFA 5PCYA 2H47C 3SQRA 4KOCA 1AZRA 2HX9A 2AVFA 2BP0A 2IWFA 2XVBA 4QLWA 3OD3A 3FU9A 2PCFA 1ASOA 3FQ1A 2RACA 3D12B 2NRDA 2X88A 3PAUA 1L9OA 7PAZA 2YAMA 3FYEB 4PAZA 1OE1A 4QKTA 3TBBA 1AZBA 1W6WA 1ZIBA 4KO9A 2YAFA 3HB3B 2Y69B 2BW4A 3PXLA 1IUZA 3T71A 4M4RB 5TK4A 4G71B 1NIBA 1PAZA 4A67A 1JZIA 2J57A 4UF7C 4YSQA 4GP4B 1QLEB 1JZGA 4F7KA 4AKOA 4AX3A 2ZWNA 1WS7A 2VM3A 2XYBA 3KW8A 3FYIB 3UACA 3IBOA 3AG1B 2FT7A 2AFNA 5D4HA 1TU2A 1SHXA 2ZXWB 1PZCA 3WG7B 4E9VA 3FS9A 5I6PA 2QT6A 4CSPA 3FSVA 3T6ZA 2DYRB 3FPXA 2FT6A 2PPDA 1JVLA 2ZOOA 2J55A 2TSAA 1J9RA 1JERA 3WKQA 2PPEA 1JXGA 1QHQA 4FA7B 1BXVA 4HZ1A 2CCWA 2VN3A 2YAEA 3BVDB 2JFCA 2BZCA 3OQRA 2HRHA 4A2GA 3QJSB 1FWXA 3OMIB 4N4YB 3ZDWA 2WSDA 1RZQA 3H4HA 1KDIA 1X9RA 3V9EA 2IDFA 1JZHA 1PY0A 4AKPA 3T9WA 1JXDA 3NJKA 2BZ7A 2H5UA 1PLBA 3WNIA 1OCRB 3GYRA 1ASPA 4HHGA 8PAZA 2EINB 4HALA 3BQVA 1RKRA 4MFHA 3ABMB 4KNUA 3ASOB 4YSEA 4F2EA 1NIAA 1KCWA 4W9ZA 4E9XA 2QPEB 2PPAA 3NYKA 5F7BA 5IY5B 1AZCA 4E9YA 4YSDA 1TEGA 2CUAA 1WA0X 1ET5A 3UABA 3NSFA 1CUOA 1GSKA 3PAVA 1AQ8A 1PLCA 1SJMA 1MDAA 4Q89A 3NJMA 2YAHA 4GYBA 3X1EA 3WI9A 3X1GA 3EF4A 4AI7A 2GC7C 3QJRB
chains in the Genus database with same CATH superfamily
1EJFA 5JOEA 3ARYA 1KT2A 3WKMH 4A37A 1J9SA 4AL8L 2X5PA 3HG1D 3B2UD 3AG2B 3TT3L 3NSDA 3KL5A 4YGVA 4HWEL 2HTLD 3N91A 4RFEA 1A4CA 2MHAA 4OGYH 3GXIA 4HKBB 1U95B 3RAJL 3V9FA 5LB1A 1B0GA 1KB9K 2A73B 1WEJH 4PREA 3WO3B 4YJZL 2X0VA 5A2KH 3FQRA 1B6DA 1URIA 3LKSA 1CXEA 1JF1A 2UXGA 4IDLA 4PJ8D 5F6IC 2VLJA 3GTNA 2YSTA 1LO0L 3U83A 3EOAA 3NEOA 3MOQA 1GPOL 1OPOA 1U3HC 2W9EL 4HCRH 4MJ2A 2NXYD 3MKGA 1N2RA 1H0DA 4OV5B 1A65A 3F58L 1MHEB 2JCCF 1MFAL 4JRXB 4WW2B 3NFPA 4XHJC 5EBGA 4N87A 3NAAH 3RPIB 1HT6A 4AVIA 2ARJA 1NKGA 2OBGA 4OZHF 2Z93A 4P5TA 4I0PA 4Z7QE 1DHKA 3ZUCA 4NQCB 2I24N 2Z4QA 4CMHB 1YMME 4RGOH 5GGRA 5IR1A 2VABB 2F53A 2VSMB 4FG0A 4DZBB 3VX0A 4BA8A 1MQ8A 1QP1A 5T3ZH 4PJGA 4R8WL 1U3NA 5IFJA 4EI5D 3IMVA 2E9JA 2CKNA 5J5EA 4I9WD 4R7VA 3GPSA 3N42F 4U1IB 3U25A 1XR8B 4XCNA 5C0AB 4B60A 1N6QH 4MXQC 1MJUL 4QRUB 1PQZB 5HVFB 2CDGA 2FIRT 2XX0A 2BIIA 5D5ME 1RZFL 4I5BB 1K8DB 5CJ8A 1BQHA 1CCZA 1KN4L 4NUMA 1A25A 4F9PA 2XWBA 3F64A 3HAEA 5DQ9A 5I8EA 3WL9A 5KANI 3VI4A 1F56A 5IVXB 3B6SB 3QT2A 4Y9BA 5CNHA 2F8XC 3UDWC 3HZKA 3STLB 1OHQA 1QFPA 2Y1ZA 2FEJA 1PZAA 3CZKA 3A4DA 2VLJB 4EO5A 4WU5B 3QC6X 3WIHA 3DBXB 3BKJL 4HV8A 1R47A 3D05A 3LH8A 1I8UA 4C83A 3K6IA 3H3PL 2ICCA 4QXTB 1LO2H 4L0PB 3AT0A 4KQ4L 3LNIA 1I7UB 3ABLB 4WENB 4KRPB 3CSTA 1BF2A 2GT9A 1QFUL 2WYTA 1HSAB 4GH7B 4BA0A 2W65B 3P9WB 5AWNL 4PRHD 1H6TA 4OCXH 3Q0HA 1V10A 3MRCB 3JTSB 4PWIA 1IKOP 4M8QA 4YN3A 1D7BA 3GMQA 2YQBA 1HYSC 2IANE 5CHNB 2B59B 1I9IL 4I13B 2H2PD 3M7OA 1A7RL 3PDDA 5CWSA 4NT6B 1PFCA 1HDMB 5AG8A 2FL5B 3D2UA 1T5KA 1B4LA 4RA3A 1T7YA 2VMCA 3NP3A 4XP6L 2IADB 4DP1X 1C9SA 1LO5B 2V5RA 2Q2EB 1YAIA 4W1TA 1T1ZA 1SEQH 4IBQA 3JYCA 4QGYA 4Z76B 1H3PH 1S7TB 1S8DB 4P5KB 1JL8A 4GG8B 4LVNC 3U0PA 3FU7A 2D2CC 5FUOL 2DM2A 2ZYSA 4LPUA 1TZIB 4KUZL 4DP8X 1NGZB 1WLHA 1Z9MA 3TLRA 4POZC 3PNWA 3L6FB 5EIIA 1KJVB 2GBUA 2NUTA 4E9RA 3H9SB 1O7DC 1OARH 5F1IB 3OV6A 1RUPH 3T77B 2OMUB 4UYQA 3BRGC 1QX1A 2ITCB 1IKNC 3RI5F 1ML0A 1ZA6A 5FUCE 4HS6A 1AVAA 2BSSA 4NQSA 5D8JL 1KB5H 3HJEA 1QA9B 1MFNA 4JRLA 4L4JA 2FH6A 4LB8A 4KROC 1HHJA 3LH2L 4HKXA 4QXGH 2OJEA 5C71A 3G5WA 3ZSTA 3WOVA 5KBMA 4JFTA 4QDGA 2BRRH 4ERSH 3PP3H 2FGZA 3ULVE 4Y2DB 2GCYB 1C8PA 1QRNB 4YDLC 1CGTA 2WUCL 1Z32X 3APDA 4NKIL 5HYSA 2WXRA 4HIEB 3IDXL 3ILQC 4XC1L 3OMNB 3QXUA 5SWSE 4UZGA 1BQUA 3BUQA 4HH9B 5HJDA 1HS6A 3TPUB 4PGEB 1P7HL 1IQDB 1DBBH 3CVDA 3MXWL 3ZRCC 1FFPB 2E86A 2YPLA 4IRZH 4E9QA 3S96A 2ICEC 3EFDH 5CILL 5FKPA 5F7FA 5FW6A 2CQVA 2EYRB 4LGRB 4EUPA 4YAQB 3F00A 4FJYA 3BH9B 4QRRE 1NBZB 4F7CA 5D1ZA 2IF7A 2E76C 4ANVA 1SYVA 4NQTA 2Y36H 2HMID 4UT9H 1UJ3C 4TVUA 4M5YL 2YWYA 1CTMA 2NDFA 1GGTA 3RJOA 5DVOA 5GSVA 3Q05A 2X1XR 2XFGB 3T2NH 5BS0B 3MJ7B 1JMXA 1UM6L 3RVUC 1WYJA 2B4CC 1FGNH 3G6AB 3H85A 5GJTL 1PPIA 2IWKA 4ATWA 2NNXA 1JVOA 2FEDD 4E5XG 3CFEA 4NIKB 3S36X 4M6ML 1S5HB 1OE2A 3G5XA 3JVFC 1MJ7L 4JEGB 3NQIA 4P2CG 2HXAA 2WIIB 3CH1B 1TZAA 1NANH 1EFXB 1E67A 1MSPA 4FABH 2BY2A 1IM9D 5K33A 2DBLH 1LYQA 3HOGA 2DWEB 1XGRA 2EDLA 4HDIA 1DL7L 2HWZL 1JXJA 1CB4A 2ADIB 1A6VL 4JFDB 1FLRL 3B6SA 1CICB 3QDHA 5C0RL 4H0IA 4BQ8A 2ZSVB 5T3ZL 3OKOB 1JS4A 1JWUA 3PG2A 1UHVA 5DZOA 3RWDB 3CVHL 3QH3A 1ETZB 1RERA 4IMKC 4HAGA 1MCIA 2WM0A 3HUJA 3GGWB 2V3FA 4FLRA 2Y25A 5LBSH 3NIGF 2P24A 1I3RB 2VZUA 1OSZA 2EC9U 1EZLA 3D3VA 2CLZA 2F19L 4MASA 4D94A 4X4YA 4CVZA 3WFBL 1QO3A 4PJ5D 1S3RA 3P69A 1U8CB 2J56A 2WB1A 4Z7QB 1XMWA 4G1EB 4IBUA 3P3RA 1X5IA 3X11B 3THML 2XTJC 3U7AA 5IESH 2AQPA 3VYPA 3HHMA 1HINL 1BP3B 3T0EE 3S2CA 3ARVA 3V0HA 1N59A 1EV2E 3VH8B 1IGML 3QIWC 1BM7A 4NZUL 2CGRH 5LHDA 1VEPA 4N1HB 2CO3A 4ZUWA 4LIQL 1ETB1 2H47C 3DO7A 4MAZA 3I3EA 3GJEB 1AZRA 4MA7L 4U1NA 4L3ED 1F4YL 1P5UA 1ZWIB 1UURA 3M8OH 4ORZC 3RVTD 4NN5B 2RAMA 4KHTL 3VXME 4KKBC 3S98A 4WO4A 5T1MB 4DGVH 1OK8A 1KGUA 3FRPG 2R1WB 3IJ7A 1F13A 4U1KA 1NJ9B 2BNUB 3BSHA 4WUUB 2X88A 3PWNA 1L3NA 2AF2A 1DJWA 1KB5A 5C08A 2PXYB 3V8OA 4Z7VF 3UJJL 4O02A 1QLRA 1ZGLA 4PJAF 3V0VA 1G9NL 5TFSL 5JPNB 1AO7E 3HB3B 1AQKL 4XBMA 2H1LM 2CE6A 1PX8A 3C08L 1IUZA 4AT6A 3UOAB 1E2WA 1KJVA 5HYJA 2HLAA 1A1NA 1BQLH 5D72L 5AKSA 1FBIL 4R7DB 4ZFOB 4JO1L 3QIWB 4OCNC 2XTSA 1H8OA 3RX5A 4EE2A 2K4WA 3LQMA 2DQJH 3KBHE 3KW8A 2WVTA 2WXHA 4PPTA 5IBTH 3W9EB 3ZL4L 5K9QI 1LE5A 1E28B 4PFEA 4PJEF 4YHOL 4UDUA 4X8CA 1MF2H 5HJ3B 4XMKH 2ZXWB 3ZZLA 4HKZA 4WEUD 5I17A 4YHNB 4M61A 1NGYA 4YDJB 1LNUB 1UT1A 5F0LB 1UM4H 2XVLA 4AXWB 3VCLA 4O02L 2LGNA 3HPJA 2AAAA 4JJHA 5EULV 2G5BA 2ZOOA 3Q8AA 5KSBB 1EBPA 2V17H 1OGAD 1KXTA 4N90E 3WGVB 4ODSL 1U3HA 5DFWH 1N26A 2DEYX 1IB5A 4QNPE 4DQOH 1CF8H 5DHYB 5I1GL 3FUNA 4FMKA 3VWJA 1D9KC 4ENED 4N0UE 3TJHD 2AW2A 2EADA 2XWJA 2XWDA 1T20A 3QARA 1JXDA 5EBWB 3KYMA 5BQ7B 2C1PB 5I1EH 5F89B 5CN2A 4WUKH 1PBYA 1XL6A 1ZTXL 4IM8A 2ICWA 5EBMA 3GYRA 5F9DC 1UWGH 4HHGA 1KPRA 4PLKC 1T66C 4N8PA 4XO3A 1JFQH 1I75A 4UBDC 5EZOL 1WUNT 2J12B 4PJEA 1JGEB 3W9DA 1KJMB 3CBRA 3BVVA 1H9VA 5BRZE 3BQVA 4O2EA 3TPKA 43CAA 3ECQA 2NTFB 4UI2A 4PV9B 2CDEB 4WJKB 1YPZA 3KYNA 1K2DB 4P2QD 4XX1G 3BH4A 3FN0L 3OKYA 4D9LL 2UZYB 4OZGE 5ENWB 5D6DA 3P4OB 3SDDC 1S7VB 2NYYD 3MLZH 1WA0X 4JFXA 4TV3A 3ML9A 4XP4H 1DJYA 5CGYD 4F58H 1MIMH 2FAUA 5CFAA 2V7NA 2D4FA 3WIHH 1BFVH 2D7QA 3QJFA 4F57H 3DYPA 1ND0A 2M2DA 5D4JA 1P7KA 3O2VL 4LRNL 3OF6A 3FBKA 4KNQA 1RZ7H 1KIQA 5I8CB 1NM4A 3MODL 1HIML 3EH1A 4ZFGL 4I9XA 1AKJB 4X7DC 4N5EC 1SN0A 3KR3L 4MX7B 2XV3A 1TJHH 1M71A 3OM3B 4WFFD 4Z23A 4BFBD 4HUXA 3B7TA 4HZAA 3DVIA 1IBYA 4J1UA 1YQVH 2OKMA 2EIBA 4G9FE 4P4KD 1HZHH 4ZSOB 3B2XA 5BMFH 4G83A 2A74B 3I2CH 3QWOA 4X8JA 1IJ9A 4HGWB 3T4AB 3VDAA 1JZFA 4GBXD 5EC2B 3P3YA 1GW6A 3QIUB 3P54A 2Q7YB 1IGFH 1KGIA 3CDGB 5AUMB 3C8DA 3CAFA 1S2EA 2YK1L 1W91A 4JDEB 1AD9A 1B4TA 1VFMA 4K9JA 3HG1E 4DPRA 3QISA 2PO6A 2B8OT 2Z4QB 4HJUA 3RU8L 1RK1A 3FULA 3ZE2E 3FRUA 1EJ6A 3ARBC 1EFXD 3TBTB 1D9KB 2VT0A 1RZIB 2ZOWA 4UQAA 4XRCB 3MRHA 4FRWA 2X53A 3UC0H 5K59F 2V9TA 3PL6C 5GSRB 4PMFA 4NLHA 5JLZB 5EO9B 5IHUL 4ES9A 4YQXL 4Y1TA 3FTSA 4PY7A 4V1DB 3VFOA 1IKFH 1J0KA 2VXQH 4HXAL 2CRYA 4PJIA 1TJIH 4X7FC 1JD7A 5D2LE 4DTGH 1XGYH 3CQQA 4K3DL 4G42A 3UYRL 4TVSa 1KIPA 1X3DA 4O58L 1MNUH 2DWXA 3L5JA 4WI7A 3RWJB 4XNQB 2F19H 2UX7A 1ORSB 1VFOA 4Y2DA 2FO8A 2AEOA 5CLYA 1NGQL 5D4IA 3TNMB 3H0TB 2FQGA 4P46C 4G6FD 3WV0A 4WCYH 3VDCA 3AXIA 2GTQA 2Y7MA 4QHLA 2UYLA 3MRKB 3FPYA 4WI5A 5EH1A 4AH2B 2COVD 5ID0A 2VXQL 1QTPA 3HZKB 2AZUA 4JPQA 1LO4L 1RIHH 4OCSH 3U7WL 1ADQH 1CDIA 4BFRA 3HBPA 5KN5A 2YKLL 4EUPH 3WJMB 2Z35A 4J27A 3BAEL 4XCCL 3C2AL 5TDOB 2VUKA 2VITA 1VFAA 5F9WC 1MFEL 1YYCA 2HVKA 3BW9A 2X9YA 2J5LB 5E4IA 1HEJC 4G1MB 4YWGL 1J86A 3TN0C 1GS8A 3ZQXA 1SUHA 5KSAD 2HFFA 4H5SB 4H8HA 1J8HD 3WNLA 2MKLC 3IJEA 4XI5D 5IUCA 5DHDA 5CS7A 5IVOA 2F58H 4G8GE 4JN2A 2X70A 4UTAA 4GW5A 1T1XA 4LSQL 5GSVB 1VGEH 3RWCB 1TZHA 35C8H 2GEQA 1PZBA 2W88A 3MO1A 3BGMA 5J6HA 1A4BA 1PS3A 2VO5A 1EAQA 1RUML 4Z7WA 2AJXL 5IW3A 4HUMB 4M1DH 1M7DA 1A9VA 3BKMH 1FA4A 1UXLA 1ZLWK 3OC8A 3IDJA 4JM0A 3O9WD 5EC1B 5IVXA 3J7HA 3LRHA 1Q8MA 2XJKA 1KACB 2LABA 1T03H 4PJBE 4YSTA 3UPCA 1J5OL 3M45A 1M1XA 4LLAA 1HHGA 1NMCC 3UYPB 4LIQE 1RI8A 1UD4A 3VWKA 1DSFL 3PE9A 4P5MB 5C9JA 3K2KA 5GGQL 3AU0A 5EBWA 1LO4H 1RIHL 5HGBA 1U58B 1U2CA 4WTZG 3AG3B 3VQMA 5JNYA 5FUCC 1KULA 5I1HH 3A3YB 5JORA 1EAOA 3QWRD 3CMOL 3DUSA 1OT2A 3QZNA 5T5FA 3PHOA 3LHPL 4W4OA 3ALPA 4XPGL 3VTMA 2C1OB 1TTUA 3MUJA 2FZ3A 2IAND 4ZMVA 2G0KA 3MVSA 1CFVH 5CLTA 5AYTA 1ZLUK 1QSFB 2X4PB 1FIEA 1CBVH 2XIBA 4JPIA 3H3KA 1CD9B 3VI3E 1BYPA 2JB6B 3QJXA 1JTTA 2TSBA 3BOVA 4JREC 4JRXA 4AKQA 1EJOH 3QUYC 3D09A 4LVOC 1JNHB 2P5EB 1Q1JH 5CLXA 4YHIB 3B83A 2YD8A 3P0VL 4U2YA 5CGTA 2WXIA 3CC5B 1Z2KA 3QCUH 3SDXE 1H6UA 1Q90A 1SXSA 2XXFA 1A6ZB 2UVEA 3I6KA 4ACPA 1T1XB 2VLKA 2P5WD 4JFYA 1CJYA 1A14H 1ONQA 2FATL 5HYSB 3P3SA 4ZD3H 3ARBA 4XE0A 4XTRD 2EUXA 1QSEB 2FB4L 4J3OF 1ZRUA 3SPJA 3U0TA 5F9JB 4DQAA 2GSGA 4RFNB 5EF2A 2XZCH 4IGBD 1VCBC 3QUXB 1QSFE 3ZVVA 4MJ5A 3S3SA 1ZPUA 2J71A 4YUEH 1RUQH 5EC2A 1B9KA 2H3XC 1E90A 5HGAA 4EVNA 4X5LA 5E70A 4F2FA 1NPNA 3IDIB 5EN2A 5L4MA 1NJ9A 2BNUA 3Q8CA 4W6WB 4OD1L 1JGVH 5I23A 2NY3B 1MCLA 2Y1AA 3DRQB 3QNXA 3D4CA 2NXZC 1A6AB 3MCKA 5L2KB 1BMWA 4X99B 4M93C 5KOVC 1PKOA 5I1IL 3DJSA 2BPBA 4DWHA 5FGCB 3DDGA 5D1QC 3RWEB 1TQBB 1NFAA 1L6XA 1G7HA 5FYJH 1FNEA 1QW9A 2E6PA 4B95C 4HK0B 1OCZB 1F3RB 1LLAA 3COOA 5CZRA 1RHFA 1T04B 2V2WA 1IQWL 3KXFD 3L8QA 4X98B 4XVOA 4R26L 3ML8A 3TBTA 3QORD 2H0JA 2X4QA 4ODWA 4U1HB 3TZVC 5T3ZD 1BEXA 5I24A 4DGYL 5SWSD 3IMWA 4F33A 2FX7L 5FYKU 5MEOA 4PRHA 3U9PH 5DJAB 1GC1C 5A7BA 3LN5B 2BIMA 2NXZD 2ZPKH 4DUVA 2Z8RA 3B56A 3FHEA 1RU9H 4GO6B 3F7LA 4WTXA 3WYRA 1ZT1A 2JCWA 1FG2B 3GWJA 2V2TA 2JKNA 4DVRL 2R0KH 1MREH 3KWWA 2YEQA 1KFGA 2BRRL 1FVEA 5H37A 1K4DB 2CUMA 3D39B 3PGFL 1ONQB 4XNAA 4PEEA 1U0QA 2Q5BA 4HHWA 1GS7A 2KPNA 1WZ1H 1UD5A 3ZKMD 1E5UI 3KH4A 1XF1A 4JKNA 1NZRA 1CDHA 4N1CA 5CWSB 4JG0L 4JJ5A 5ETUB 4X5QA 5SV3A 1WFOA 2N56A 1YEEH 4N2HA 2GSGB 2QLYA 2WSKA 4Q74A 3NCXA 1ZVSA 2AGJH 2LAGB 1TITA 4X5RA 5F6HI 3PABA 5IB2B 1FAKT 5CILH 5FX3A 1PMYA 2CKBA 3DV4A 3MTRA 1AGBB 4HCIA 5LCVH 2FWLB 3AREB 3TIEA 3QNYB 3A6OA 5I5JA 4RFNC 5JW3L 3KLSA 4G6FB 4NQCE 4R84A 5IB5A 4O58H 4DP7X 3NCYS 4J23A 3WIFB 4Y1AA 2FHFA 1KCBA 4PJXE 3W39A 1P69B 4A7VA 2ITDB 4E0RA 3NJIA 1SEQL 2JWYA 3ULVF 1MWAB 2I25N 3JV4A 1T6WA 3CDYA 2NY3D 3AZUA 2HX7A 2QQQA 3ZUNC 5JR1H 4JQVC 3CU1A 3T3MB 2UZYA 5ENWA 1S6NA 2ODIA 4K9EH 4XO8A 2AXJA 3HNSL 2Y2YA 3R18A 4ORGA 4XPBH 4DO6A 1MCDA 4XPHL 2D9CA 4HCGA 4ZAKA 5ILTL 4LCCC 1U2HA 5IBLC 4TM9A 1XGUA 5KVDL 3SQRA 3I9AA 1NLDL 3U46A 1PSKH 5K9OA 3A23A 4ELMB 4M7LT 1G7LB 3WTVA 1RSFA 4AQZA 2IAMB 3AREC 3NGBC 3OSVA 1IFGA 1MFBH 4NM4L 4YNYA 3EOAB 4JM2D 1KPVB 2WBJD 1V7NL 2A9MH 1IL1A 1KCLA 4YIQA 1J9CT 1JPFA 2P9RA 1LMKA 2XN1A 1XGQA 2YSSB 3MRMB 4R5VA 1XF4B 5E8EB 3TBSB 3WEAA 2CGZA 3EDJA 4AYDC 4Z3GA 1E9QB 2QGBA 4HWBA 3V4VA 2YAFA 1GH7A 2HT3C 4N9OB 5C0CA 4JFDE 5CN3A 1ZLSH 2OW6A 5ETUA 3ZOAA 3L9RA 1FIGH 5ITFA 2ZT9C 1MWOA 4OZHE 1O9WA 2J57A 1QFWH 4KTDL 1KELL 3AQYA 3BCFA 3G5ZB 4YR6A 5D1ZD 4HGMA 3FYIB 4PVLA 4JY6B 1E42A 2FT7A 1XT5A 2NYKA 3BP7B 3CFQA 1NCBL 1YQ2A 3GSRB 5AYUL 3W81A 1SHXA 4HU2A 4K7PL 2H9GB 4Z77B 1UZ6F 3L7EB 4RGNC 1EEQA 1QUPA 4JFEA 1J5IA 3V6ZB 2O30A 1ZK9A 4LLQB 1KGJA 4Q9BA 1X4XA 2WLLB 2DZEA 3RTLA 5IGXL 5IK3A 2GY5A 2TSAA 4GQQA 1MRDL 5E51A 2QL1A 2EEDA 4NP9A 3N44F 4XPGH 1L3WA 4M5YH 4MNQA 4FQ2L 3FRPB 3GBLA 4AIZB 1FBIH 3AB0B 3BE1H 4Z5RA 1L6ZA 5KS9F 1WEJL 3HR5B 5I74C 4H13C 1HXKA 4G80A 4IOSA 3DX9B 5GIRA 1XSOA 1MFDL 2NQDA 3X13B 2XT1B 2NY1C 1DQDH 3FB7A 4OLYL 2OI9C 1NEZA 4OCRL 1P6WA 4G7VL 5TE4L 2FR4B 4MS8D 4H88H 1IM3B 3MACH 3PWLA 3B37A 2VDOH 2UZIH 4XT1C 4LMQE 1WD8A 2A83A 1F3JB 4UDUB 2BIQA 3LEVL 3D39D 1WBZB 1JJUA 2VDLH 4CSSA 3TH4T 2OSLA 2W59A 3PL6D 4PJHF 5T1LA 2YD7A 5DJDA 1F4WH 2EABA 2ID5A 1J88A 2ZX9A 3DPDA 1CTNA 1TEGA 3APFA 3UABA 1T04A 2X4UB 3L3HB 4MA8H 3C5ZB 4L3AA 4GLRH 4ZMNA 1OAKL 3DX7B 3HFMH 2P24B 4FQHA 4P23A 4LPCA 4XMKL 2NXYB 1BX2B 3CFTA 2ZOKA 3SPVB 1I1FB 2BVTA 4JFEB 1KFAL 3QQ3B 3TBVB 3O3UN 3Q9QA 1YEDB 4YFLI 2P8LB 3QYNA 1J05A 5C0IB 2HUHA 1JUFA 1X6NA 2DWTA 4XR8C 2E7HA 4MMXB 3WUWB 1SQ2N 2X6VA 1UWFA 5D7LE 4OLYH 5I6NA 4XB8A 5F1KC 5GGQH 2XACC 5GZND 2PP7A 3GDCA 3GJFA 5EC1A 2ZXGA 4I2XE 4NO5B 4HVBA 3MV7B 3CMOH 1EDQA 4LLVB 2HKHH 5FK9B 1JN6B 1LHZA 1G7PB 2E3VA 4RMRA 1FZJB 4FYRA 4F58L 2YPLE 3H9ZA 4IEFA 5C2UB 4G3YH 4HFUH 1UWXH 1KB3A 1ZGLM 2WNXA 3AREA 4F8QA 1DO5A 4NKOA 5D1XE 1O75A 3OKKA 2R4SL 1Z5LA 3IPBA 3TA4D 4KHTH 1BBJA 1E8YA 3B9EA 2D03L 3EGDA 1OW0A 4GAGL 1HAUA 3T09A 5TH2B 1KXQA 2YUXA 1RAMA 2AV1B 2ZAHA 2Y1YA 2F5AH 5FM8A 5C6TL 5FO9B 4LT7A 3ISRA 4Y19D 3DX8B 4L4TB 1I1YA 2BVYA 3C60D 4MD4A 5IFHH 5JXED 3VFVA 1U8HB 1X7TA 2E8ZA 2BVQB 2HVBA 4N9GA 3QCUL 3MV8D 4R97B 3DK2A 5BMFL 3IFNL 4IBVA 2Q9OA 4OLWH 4JLRB 5EO1B 1OWWA 1E65A 2ED9A 5ICXB 1J1PL 3ELAT 4NQXA 2NW2A 4ZMLA 3US9A 3I50L 2H4EA 4JDTL 3K6DA 1ZSDA 4JM4H 1V27A 4X4MA 4XCNB 5C0AA 1DZ0A 3ILEA 5DQJA 4CVUA 5FHBH 4A63A 5DYOA 3KEHA 2VTFA 3H7BA 5CCJA 1WTLA 2AHIA 3WXWL 3SO5A 1K6QL 3W0WA 3FT4B 1X9UA 1ZEAL 4RGND 1ZVYA 3C5ZC 5EOCJ 3CG8A 2HG0A 2FX8H 5C09D 5SWZD 5D9SA 1AHWB 4UV4H 3PV6B 1HQRA 5FEBA 1OE3A 1EA9C 5EIQA 5CJ5A 5IWLC 1G9EA 4NHUB 1D6EB 5FYJE 2EACA 4TMPA 1A8ZA 3MBEB 3QAZB 1UCBH 4E5XA 1MLBB 3E2HC 1CC3A 3C60B 4GAGH 4BUGA 2RD0A 2X9XA 5E00B 3UTSE 2W9LA 1KLUB 4YQXH 1IEHA 1NDMB 3RA7H 5DD3L 1Z3GL 2Z65C 1KLGB 3EYVA 4X4KA 2VLJE 1OALA 4LQFH 3AT8A 1DCEA 1YNTF 5C0FB 5ANMA 3WJJA 5IQ9B 1JYWA 1TZOA 1QPPA 2BMKB 4P05A 4PJXB 3GQFA 5TGBB 3C8KA 4A55A 2DQTH 2HJLB 1SF5A 2KPWA 3QEQD 2ED6A 1JZ7A 4JHZA 3DI2B 2UXTA 3JTSA 3IGAA 5CINL 2F1EA 1IBFA 2CO7A 3LRSA 3OG4B 3AXHA 1UA6L 2O5NA 5ID1A 2KERA 2OR8A 5I1DB 4QI3A 2AZAA 3EFFB 1XZ0A 3AMLA 1GW0A 4XZUA 5IBLD 2CLVB 2E7CA 2Q8AH 3JT2A 3UTTD 4ESKA 2VERA 3CVIH 1K6QH 4EZLA 1MFEH 1KBGL 2E4FA 1ZSDB 2H0PA 2CU9A 3HI1A 3CSGA 3S5YA 3SKJL 3UZQA 2VLRD 3S8FB 1E7UA 1QLFA 3FU5A 1BOGA 3TF7C 3F2LA 4QRSA 1NEZB 2WZ5A 1NKRA 2IG2L 4IRZL 3MCG1 2EH7H 3WHXA 3MLXH 4PJFE 3VFNA 4CMMA 2ZF8A 4JKLA 4G8GD 1WIPA 4UQIM 2IQ9L 1Q1PA 4OIAA 3MLPA 4TN9A 1RL1A 2YHGA 3D69B 3RDJA 1XF2A 5FECB 1PCXA 2R2CA 2XVKA 3MN8A 4XNMB 2NZIA 1BVNP 3LRGA 1U8CA 4PWEA 4GINA 4PJCB 2J8UE 1UACL 1AANA 2ADYA 3ZT6A 4KROB 3WAJA 2OULB 3IFPA 4NRYA 3FFOA 2BXZA 5FA3B 1MQKH 4FP8H 4JANB 4BDVA 4RBPH 5K9JH 1H8SA 2XI9A 2NY5L 1YEGH 4W9HC 1AXSB 1AHKA 2E7MA 4HD9A 3OR7A 5E2JA 5FO8A 5LG6A 1P7QD 4GW1B 3FK3A 4WI0B 4XAWL 1EANA 1OAXH 1FIGL 1JPEA 4H88L 3KNBB 1MJ7H 2DI8A 3AROA 1UXMA 1NA8A 3HC0A 3QHZL 2A9DA 4OH2A 4PMEA 5GJSH 3MV9A 4BELD 1PNCA 3SE9L 2IDSA 5IROC 3S48A 5HGGS 3D0VB 5BZWA 2WXLA 3NT0A 4WHTB 4KVCL 1H6FA 3OKMB 5D7IB 3LB6D 4JG5A 4YLCA 3MRLB 1ZPLA 4HJJH 2H3KA 4AZUA 3T2NL 1E43A 2DJSA 5TDNA 3B9DA 4DUWA 4WEBH 1HL9A 5E7FA 1BIIB 1IBHA 5CIPA 2HKFH 5FM4A 1XF5A 4NDMB 1G94A 5IHUH 4MWFB 5B1JC 3WKNA 3ZKXB 2WGXA 3NZ8A 4DGUA 3ARZA 4JW3A 4YIQB 2AJZB 1V05A 2D8KA 5FKPB 3S2AA 1SJXA 1XGYL 4K3DH 5C70A 3OKKB 1SEBB 4PSRA 4PRIE 1DBML 2FE0A 3F3HA 5GRVK 2AJSH 5D93B 2A9AA 3SKMB 4RDQF 1EZUA 1NCJA 5KN5B 4PJFB 1FO0B 3QUZB 5DK0B 4O2FB 4X4XB 3DX8A 4I4WB 4QTFA 1GY2A 1TKWB 1ZV5A 2YC1A 3DJ9A 3O8XC 4XNZC 3ZZQA 4R5TA 1ZD6A 1Q4NX 2Q7AA 4GMSL 4ODBD 3C9NB 2JQZA 3MV8B 3QK0A 2DOCA 4GT0A 5AB1A 4MZ3A 2GI7A 3ECBB 5T1JA 2TRYA 3NSJA 3B1TA 3NCJL 5C3TA 3SCMC 4N0CD 3ZKNC 1ZT1B 4GLRI 2P46B 1HEZA 2AXHA 4PJIB 3BDYH 3SDXB 1U8PB 3O2DH 3ARGB 1PW3A 3CSPA 5CBEB 1HC1A 2XCMC 1FZOB 2XLLA 4GKNA 3QPQC 5I5MA 3MFFA 5ELIA 5FYLL 4LF3B 3GSVB 1GR7A 4MDRA 5DD0H 4AYMC 5CP3A 4GQZA 3V5DB 4GSXA 3DRQA 5EORH 4G7VH 4TUOA 3KXFE 1EHLH 1M2VB 1UZGA 4JFZH 3S34L 4NKMB 1TZIA 3V6OE 4F5CA 4YDKL 3BN3B 4FJZA 4GG6B 3EW3B 4XP9H 1NGXA 5AALA 4HEMA 3X13A 1T5XB 3BKML 5D72H 5D96C 5HHOD 5DUPH 3ZRSA 1CBVL 2NT0A 3BPNC 2OMWB 3EH2A 4NN7B 4QY8A 5AFAA 4NO0A 3SY0B 2AKRB 3OLEA 1A7PH 2D3JA 2PF6A 4IRJC 4XMLH 3GMRB 3RURA 3GSUB 2X6UA 3AS0A 4UNTA 5EFIA 3HS8A 4APXB 4PJ9A 1XX9C 2GSMB 2JKXA 2WO4A 3L9BA 5EORL 1WFJA 4CVZB 1FH5L 1L0QA 3AUVA 3G7TA 4PB0L 2W0FB 5HDBB 5H94A 5C97A 5I2IA 4KH2A 4HIIA 5GS0L 5DK0A 1SY6L 2C9RA 3O11A 5DJDB 3FT1A 4M03A 2YC1B 2VE6A 3DYMA 2VR7A 4LRIA 5FM5M 2DBJA 5HJBA 3U30B 3HLKA 3MKKA 3MRJA 1T21A 4V1DE 4WSGA 4Y5XC 2EYTB 1M71B 2OYLA 1KFAH 5PCYA 4IIQB 5MEND 3CFUA 4OZFB 3MA9L 4F92B 1C12A 4F91B 3K46A 5CAYB 2YN3A 1K8IB 2P48B 2ZOLB 2XVBA 3OTTA 4UU9A 4UMSA 2PCFA 4NNYA 1I7ZA 5MEQB 1VZIA 1P7BA 4XNXH 3SPIA 2MNJB 2CBTA 1UZ8B 2FSEB 3ESOA 5AAWA 4G8EA 2F8IA 3GTTA 4NPJA 2OZ4A 3B8YA 4NQCD 5EU6A 2HYMA 3M1CA 1KBBA 4JFYB 3GZPA 2JELH 1IJNA 2IPTL 4OFQA 1N8ZB 4WU7B 5F9AC 5FYLD 3TO2A 4TVPH 5D2NA 3BIAX 4U6VH 4KRPC 3BFQG 1UH4A 3CFNA 1K8DA 1L5GB 5C7XH 1NIBA 4QF1A 3T4YA 1G0XA 4YHZL 2Y24A 3U30C 5DFTA 5KEZA 2C34A 1VB9A 4MNHA 2P28B 5L9DL 5SWSB 1CXLA 3IDGA 2ZWNA 4K9EC 3FT3A 1WS7A 5C8JA 4KKLD 5TPWH 1AFVH 4KJWD 1L7IH 3L95B 2NY2C 3IDMA 4XPAL 3CZGA 1FZJA 4RAVA 4Z3EA 2WVVA 2CIKA 2ZUQB 1PZCA 3IMUA 1NFDA 4S0SD 3WG7B 3ETTA 2APBA 3ZT5A 4WLCA 1AXSA 1RUQL 3EXJA 2EO1A 2MH4A 3GB7B 4N85A 3BWAB 3DGGB 3QG7H 4HLZG 2CR6A 4LOUC 1NAMA 4OFPA 2GTWA 4QLRA 2ZWZA 3KNBA 3CFDB 5GS2D 1W72H 5D6CA 5DFAA 4DERA 1VADB 3F12A 3B7SA 4CSTA 5IROD 1FVCB 3WTWA 4K3EL 3MBXL 5CR8A 2R4RH 5IB1A 4BKLA 4PJ5B 3U82B 4XB7A 2O5YL 4KKRA 3LQAH 2ARJQ 1E9QA 1BIHA 5FOBB 3SYPA 4JFWA 3VXQB 4UB0H 5E2VL 1FE8H 2LVCA 4MJIB 4NQXB 4BM7A 4F7MA 3SGJC 1MW2A 3WNIA 3T0EA 3EO9L 4WEEA 4IOIA 1CDUA 1OCRB 3D4GA 4CBPA 4UV4L 2R0ZH 5A1AA 3V4VL 3OB0H 5C0RH 1A6TB 1A7QL 5MEQA 3NFPB 3CFCH 5C0JA 5AL8A 1PD0A 4B9GA 1KTDB 4BZ1A 4ZYKB 2RFXA 4H5SA 4NGHH 3UBFA 3HRPA 5E5MA 1T83C 4UB0L 1CU4H 5EDSA 5J3HD 3O6LL 4CGUB 3M1BB 5A43C 4ZS7L 1TJXA 3QUZD 4FQQA 3BEWB 5D96B 4LSRL 2LU7A 2YBGA 1CFSA 4URTB 4Y1AD 3FXIC 3T77A 1MXGA 5BVPL 3X1GA 1FL3A 3T6WA 1P2CB 1YN7B 4K5PA 4PJGB 3O6ML 1FV1B 3BSZH 2EE2A 4AE0A 1W72L 4IHBA 3VFPB 5KBKA 1SLWA 1JZJA 1IEAA 3BHBB 4DIXA 1E9PA 3KYOA 1BX2A 3NJJA 4I3RH 4W70A 1N19A 4LE8A 1G1OA 1HCFX 3HR5A 4OLXL 2KLSA 1PDKA 4JZJB 4EF3A 2CHXA 5EU3B 1FFTB 2C3WA 3NIFB 4TULH 1MCPH 3ZHDA 4TQ8A 5C1MB 2AQ1A 3TEYA 1DVFD 1JV2A 3LEVH 5LXGH 3S3DB 1MCJA 1EH9A 5E95B 4NQEA 1JHLL 5DD1L 5IMOA 1OVZA 1RK0A 1RUKL 1GOFA 2VLLA 2CM6A 4G7SB 5AW2B 1NLBL 2D9QB 2H26B 4RIRB 2D3LA 1N70A 5AW8B 2G9KA 1XCWA 3GRGA 3F83A 1XIWA 5AZEL 1QACA 4XOAA 3KG5A 1THCA 4Y16D 3CFKA 2CBPA 3T4AA 1CK0H 1X7QB 4B9FA 5I9QC 4G7YH 5C0CD 5JDSA 1DEEB 4LSSL 4RSYA 1I3GL 3OKDA 1ZCRA 2YR3A 3LKRA 1IFHL 4MAYB 1CFNA 4N0UA 4G6KH 3KGRA 1D6VH 4UBDD 4ZYKA 4DFHA 4JDEA 4NUJB 3ARSA 2LAAA 2W0FA 4NEHB 2YD9A 3DVNA 5ITFB 1IC4L 1N0LB 2NYZA 2A6IB 1LDSA 2VMEA 1UOKA 3GHBH 4NN7C 5CBAA 3GSQB 5FLUA 4UIKL 3TU6A 2AK4D 1L0XA 2P5PA 3OZKA 3E3QE 4HPHA 1YPZF 3FRUB 3ZE1F 1E2VA 3OWRA 2J7LA 3VYOA 4IMLA 4Q2ZB 2XWRA 1FGVH 2PTTB 2R1XB 3HFML 2Z31C 1GAFL 4Q0XH 4TRPH 4TQEL 3AGVA 5FO8B 5HVHC 1UM4L 5EO1A 4O2CA 3C75A 3O4OB 5DVLA 3DVGB 2DQFA 1OAUH 2XPZA 3VI4B 3C5SB 2OMTB 2NY6D 1G7LA 3WS6A 4CDGC 4ODTH 2YD0A 5D1XD 4MAYC 1JCKA 1ZHKB 2XWTA 4GAJH 3F65A 4WU5A 3QC5X 4TS6A 2R51A 3DUUB 3KPRB 3VH8G 1T20B 4UOZA 3GRWH 5L8JB 3LN4B 3VFTB 2AMGA 4WHTA 3KWXA 4YFLF 3ZO9A 3NH7L 4AMWA 3CZNA 4EN3D 4K23H 4ENZA 2YAOA 3V4VB 4M43L 1TYEB 4QF1B 5E6UB 3WO4B 1BEYH 3HE6B 2E75C 1MW1A 2WXKA 3QUKA 1RULL 1RVFH 3BX7C 5I1CH 2WXMA 4M5SA 3DX1A 4LIQH 5I5IA 3PFUA 1H8NA 5MP6L 4GQRA 5T33H 2VDRB 1M4KA 4KJQC 5DZNA 3H9YA 2WO3B 2ADGA 4IDJL 5E1HB 3DX6B 3IU3A 2WLHA 2A9NH 4YSUA 1C16A 3PJNA 2P4AB 3GLEA 3PL6A 2HKAA 3QR0A 4G43B 3GGWA 2ETWA 3OGCA 5AKRA 2OL3H 5HHQB 4AC4A 3CTTA 4GMSH 2ARJB 4LK4A 5B4MC 2RR3A 4TPRL 5I6MA 4DOHB 2CBQA 3GFUA 1FHNA 1GAFH 4TQEH 4LCWA 4MLIA 2J3SA 1VADA 3F12B 4GW5B 3ULUF 3NFSL 3T0DA 1I7RB 4OZGB 1B6UA 4PV8B 4DZBA 3VSQA 1A6PA 3B5GA 3QO0A 2ROYA 4RVBA 5FYJD 4WWKA 3X2QB 4A6YH 3TJPA 5A6MA 1ODAA 4PN6A 1RZ7L 5C2BL 2VC2L 3WTYA 4LSPH 2W92A 1MPAL 4PGDA 2JKJA 2HFGL 4FYQA 4P9MH 2OMTA 1Z9LA 4WW2C 1T3FA 3BO8B 3UZQB 1CI5A 1BOYA 4B7IA 1OAKH 3H55A 4YEFA 2HG5B 1M1XB 1RD6A 5EEWA 2VLJD 1I9EA 4QRUA 2X1QA 1AACA 4KNTA 1S7XA 2KQNA 5T1MA 4AQ1B 4HHAB 2P8PB 4PRPE 2OM5A 2ITCA 4MQ7A 2EYRA 4ZMAT 3IU4L 4YMPA 2OCFD 3GSVA 3WUWA 1IEBB 2A6DB 4HT1H 2ZP9A 3DX3A 3HBZA 4QHUA 1ZHNB 1MI5D 1XO8A 2C9UA 2M26A 2WINA 1I9IH 4UNIA 4ZT1A 2DLFL 1OP3H 4YHMH 1UATA 2VLMD 5AVYB 3RL1A 3TVMA 3NJNA 4UQ2B 4HKXB 5C6TH 4CADB 3MRRA 1R33A 4QRRD 1P6AB 2ZX5A 3UTTE 5IFHL 4BDVB 2F7RA 1QFUH 1FV1A 3N1FC 2CO4A 5I1EL 4ES8A 4LQFL 3SKJH 2VR3A 2VDNH 1B2WH 1ED3A 2XWEA 2BOCB 1R4XA 1QWUA 4P5SA 2ZCKL 1CE6B 2QR0A 3S88L 5F1NB 4G9FA 3CVHA 2DLFH 3ZE0B 3ZDZF 5CSZA 1BAGA 1KJ2H 1DVFC 4LCWB 2IIJA 4DH2A 2V8MA 1Y07A 3GSNH 4OY9A 2BSBA 2DQGH 3TYFA 2IV9A 5J11B 1RSYA 4D9QD 2I60H 1AGEB 5DO8A 5B1JA 3VSUA 1BD2D 4ZMTA 1S7WA 4ZJ9A 4EKXA 5IV2B 4OLUL 1AZNA 2B59A 4GXVH 5KYNA 4BJLA 2ZOTA 1D5IL 1SOKA 4O51B 5CJOL 5DC0A 1G7QB 1YDPB 5E6ZA 1UOWA 5I8KH 3RVUD 2OL3B 3ETSA 4L29B 1P4IL 1J0HA 3KLHD 5SWZA 3TASA 3HCVB 5EPMA 4YHZH 3G5ZA 4XN1A 2IG2H 2P43B 3KYKL 4Z7UE 1H3TA 1QUNB 1OTTD 2CKBH 3BVXA 2MOQA 4W9GC 1SEBA 4LEXH 4TXVB 4XPAH 3JWOH 5EA0H 2NNFA 2WHVA 2CLZB 3I6LD 4YE4L 2ZUVA 2B9BA 4EIBA 4X99A 2B39A 2BDNL 43CAB 3SKOA 3L6FA 3UX9B 4DPBX 2DQTL 3E1F1 4XNDA 5HHXH 2WBJC 5AW6B 1N3NA 3HZ3A 4H8WC 4QT5B 3S88H 4NXKA 3BT0A 1A8JH 2NQ3A 3VFVB 5BS0E 5ISZB 2WAQA 3QEQA 3MRLA 5KW9H 1UKSA 4M7JH 3GMOA 4N2FA 4JRYE 3KM1A 2VSCA 4D8PA 5D7SH 1UA3A 1E8WA 2B0SH 1GRWA 4LKCA 2IMNA 5F88B 1HXYB 2APFA 3VXUA 3N5AA 5BZZA 3FOLB 1ZHKA 2WQAA 2NX5D 5TF0A 3MGOB 2IH3B 5DQDH 2K8QA 4NC1C 1C5DA 1CT8A 1NGPL 2ZG2A 3FOMB 3QJTB 4JFQA 4NWTL 2MCPL 4NS0A 4ZUUA 3INUH 3MQIA 3NOIA 3C5JB 5E8DL 2FO1A 4OZFH 3TO4D 3UO1H 1BJ1H 3SQOL 2JJTA 2DQ6A 2HJKA 2W8CA 4NI6A 2Z3FA 3UBGA 4P59H 4FMFA 3CHQA 3WE6A 4AJYV 2XN2A 5J1AB 2X89A 3KHQA 3WLBB 5CMAB 3FFCD 1MAKA 1SDDA 3MUY1 4L0ZA 4FTVD 5HHXL 3O6FC 1BPLB 4Z0XA 2BWQA 2EIJB 3HA0A 3N9GH 5D1ZB 4OAWA 4W9FC 1OTSD 5LDUA 1AOZA 1IZKA 1GGCL 1P5VB 4KO5A 1XCTA 4R2GC 5DD0L 3NJFA 1JYVA 4E41D 5C0EA 3C2AH 4OJFH 4WSJA 3OJMB 4YHPA 3WFDH 3DRTA 2CG9X 3BLPX 5GGSY 5KBDA 1RFDH 1KXTB 2WNGA 1R3JB 2BNRE 3FU9A 5I1DA 3FB5A 1RK7A 4KDVA 3ULVC 4GUQA 2JLPA 4MA3A 1D6VL 4JO3L 2NRDA 3BISA 3IFLH 2UY7B 3MRDA 2KKQA 2VRQA 2K6YA 4S1SL 1OE1A 5DEFB 4FERA 4XMLL 3RUGA 3VXSD 3DX2A 4KO9A 1A66A 5CEZD 5K5YA 4HJ0D 3H2QA 3VI3A 3L4WA 1S5IL 5LKNA 1F02I 2BZDA 2QSCH 4GKLA 3QFDA 4W4NA 4S0TD 3O2WH 1VAHA 1HHKA 4AX3A 4Z0BH 1DFXA 3M1OA 5E8NB 4P9HL 4LSTH 3GF8A 5E99H 2FJHB 3CBKB 1HQ4A 4NQDA 3TF4A 2X4RA 1NGYB 4PRDA 2EEFA 1TU2A 4UWQB 1I9JH 3SKUD 4DZ8A 2NX5B 1DVTA 4YBQC 1VFAB 4Y5VC 3U0WL 4EUPG 1OZUA 3FSVA 4KAQL 5CZVH 4YO0B 3FPXA 3H3BC 5I1AB 4MZ2A 1OANA 5ANME 2G75B 1CE6A 4L8CA 1GTNA 3SKMA 1IV8A 3A0OA 5BV7B 4AV5A 5DHMC 4GSDH 2CCWA 4G6JH 4PTUB 2QVTA 4PG9A 1RPQA 3BZDA 1U93B 2QVMA 2VJXA 2Y22A 3X11A 4I1NB 1LILA 5T5FL 4ZMPA 2DN7A 2BVPB 2JCCB 3GEFA 4IKLA 1DVXA 4CW1B 1CDJA 1OO2A 4X9GA 2RA1A 8CGTA 3IPEA 1D5ZB 3NFNB 3MA9H 3ES6A 4I3GA 1YMHA 3H3PH 4MA3B 1ZT4A 2ENPA 5EO0B 2QEJA 4MQXD 2H7WA 3I9GH 1QATA 5JIPA 2B5IB 2X4TB 4J3XA 4TUJB 3WTXA 1MCSA 1TPXB 1CL7L 1R5IB 3JBG7 4PBDA 1GVIA 4ZXBB 2I9TB 3IDYB 4TVPD 4OCYH 4KNUA 1HU8A 1KCSL 1WO2A 3CWGA 3MJ9H 4LSTL 5E99L 1S7VA 2QSTA 3LQZB 1HKLL 1N6UA 4UINH 3IJ8A 4E9YA 3DXAD 4HKJB 5L2JA 2XWBB 2A1WH 2VC2H 4NWUL 5DK3A 3WIFA 2WYHA 2A74C 2EXWC 3KCPB 5DR5H 2PWEA 3IKCA 4OM1H 5HDRA 3BQUA 2DF3A 1NUNB 3AUWB 2X7LB 2EDJA 2J8UA 3MUGB 3BUPA 4PJ6A 2F68X 5DD6A 3CQPA 4H20L 4Q6IA 3GINA 4G72B 4L2LA 4EDWH 2NNCA 3H9SD 3A24A 3DBXA 4I18B 4B9KC 4PRAB 1CXIA 5EZLA 3F8UB 1YRKA 1FRGH 1R3KB 2QPFA 2VXTL 3L3IA 4KKLC 3QS2A 5B38B 4GRLB 2VXVL 4KXBA 1EGJL 2OLDA 5ESAA 2YJLA 5FB8A 4XN8A 2R8SL 2FYYA 2NY0C 2V33A 4OD2A 3RWGA 3WFCH 3QUGA 1SN2A 4FNUA 5F7WC 4FYSA 1PZUB 4AEEA 2ZX8A 5MENA 2J6WA 3Q6GL 4C56E 2A4CA 3EGXA 1CR9H 4PU2A 1GGBL 1ZLEA 4L3EA 5EEXA 3TPUA 4ECNA 1YC7A 3QDJE 1VZGA 4BZ2H 4NO2B 4QJ3B 4R2GD 4AM0B 2OX5B 2IPTH 4QCIB 1XGQB 1YEJL 1D5ZA 1QBAA 4FXGB 1ZEAH 5I0VA 1ZLDA 2OMBA 3BH9A 4KTEH 4V2CB 3N2JA 4E41B 3VFWB 5ANHA 1ZSHA 2H1XA 1UQSA 4TUJA 2R2BB 1X4YA 1TVHA 1JK8B 5C0NC 1HH6B 4NSKB 3S7GA 1XAUA 5DC2A 3RA7L 3UJIH 1GL4B 1IM9B 4JQXA 3LQZA 3FCSB 3PHQA 5JOFA 3D2TA 4G7RB 4OFDA 5EF0A 5INCB 6CGTA 5L0QB 4NERA 4NUJA 2WP3O 5B7EA 5L2KA 2BRQA 5I18H 3Q3GB 5TJWK 5EG6C 3QFJB 3QUYD 5LXGL 1INEL 2D3VA 1WF5A 4JZJA 4C54A 3V6ZA 3KZ8A 2BIOA 4FG6C 2LQRA 5AYUH 1SXNA 4X8XA 5IK3B 1BFVL 3GMNB 3S6CA 1B4RA 1GGIH 4LLYA 4H26B 4OLVL 1M1SA 1BQHG 1RQ5A 2D4DA 1MAJA 3F01A 1NCOA 2OTUB 4N25A 3BAIA 1QBMH 1K8IA 4LVNB 2BO0A 4FN0A 5D5MF 5I66B 4FQLL 3UBHA 3EFOA 5EU5B 1M6UA 1AIFB 1TEYA 4B96A 1X5XA 3EZ8A 4RAUA 2GK0B 2RQ8A 5BUPA 5E2UL 5F7EL 4ZQKB 4KZ0A 4N0FB 1XBRA 2YWZA 4RCAA 2F74B 4U0QB 4OJEH 3V6FB 4AQAA 3L16A 2BSRA 5I5RA 2N0MA 4HIXL 3Q06A 3D87B 1Q9LA 1T6BX 4N0CC 3REVA 2A3TA 3MLRH 2VDNB 1BMZA 2FJHA 3HUJE 5B1CA 3PNWB 4HBCH 4KX7A 1RURH 5LWYL 2Y7SA 4UZSA 4H1LH 2LT9A 3SGDI 4Z3FA 3NJVA 3AU1B 5HI3D 4F3FA 2X12A 3UPRA 3FBQA 3ALXA 5JOFB 3PY9A 4Y5YB 3NEEA 1U30A 4FQJL 1D5XB 4OQ1A 1JGDA 3ZL2A 4A7UA 1OLLA 3X3GH 2LVEA 4AUUA 4M02A 4F80A 3ZHLA 4PR5B 1UUNA 2ESVB 2FJGB 3RDTC 1MCQA 2VOTA 4OCSL 3MAWA 1CFQA 1SM3H 1URZA 2VLKB 5AOJA 5MERB 4IJ3C 5DJCA 1CFSB 3EJCA 1QYGH 1JV5B 4WO4B 5ISZA 2C9PA 4AL8H 4KQ0A 2IOOA 3QI9A 2DLEA 5AVRB 3MLTB 4UM9D 3HKFA 3IGUA 3RG1C 4UQ3B 3WNMA 3T6QC 1CVSC 4HJ1A 3I02B 5KVMC 3KBPA 4ZW3A 1Z5HA 5H35A 3K2UH 5F9JA 1S5HA 3B1UA 1NGPH 1XH2A 2Z6FA 1N5YH 3IETB 4Y2DC 1QR4A 2F08A 1HJCA 3H2WA 2I9TA 5AZ2L 3UBXB 4GBXA 3BC9A 1SOSA 5AW7B 5K59E 4UT7H 1AO7A 1GYAA 2ITEA 1I3GH 1XIWD 3DECA 1R19A 1X5HA 1NOAA 1BWMA 2BXYA 1NCCL 1AXIB 1XZWA 2KZ1B 1SLUA 2AABL 3BLBA 4L4TE 5L2JB 4LESA 2IVFC 2R7EB 2LE9A 3IF1B 2CZNA 2NUPB 2AV1A 2IFFL 3EBIA 1ID5I 4KVCH 4G9DA 2ZKWA 3ZDYB 1H5BB 2IGTA 3C6LA 4HMEA 4AXWA 2DTSA 1JZ8A 3V52H 1MI5B 5FCUL 2WQUA 4MBOA 4ZTOH 1EUTA 2EYTA 2VDMH 3FO0L 3RX9A 3ULSB 5TE4H 2EDTA 2YZ1A 3BW9B 5AAMA 1Q38A 5F7LB 4OZFA 4F33B 1IAIH 2I07B 5E8OA 5I1JL 3SGEI 5DJAA 4MJ6B 4FJ6A 2SEBA 3F7YA 4PR5A 4P46B 5HPMA 3MPCA 1I7ZB 1MAMH 1MG2C 2G4GA 3BEVA 4NC2B 4WI6A 1NDGB 3D85D 3ROLA 4AG4H 4R3SA 3CPLA 4CVXA 2XZZA 2JJUA 5BNXD 4GAJL 1B3JA 1JV5A 2UX6A 4NZ8A 5ALCL 1WFTA 2WTPA 4JB9H 3KGSA 3MRBB 4I3SH 5DS8A 4F37K 2DQUH 4FFYL 4HS3B 3U6RA 1KYOJ 4GXFA 4O2CB 1CDCA 5IMKB 1QHPA 1WCBB 4QMEA 1DSWA 4NNXA 4L29A 3VSTA 4QHMB 4BQ9A 4YXHL 3LKNA 2ZCHH 3IJHA 3TYGH 3O4LD 1AR1B 1U92A 3DTXA 2VDNL 5F1IA 2QJDA 3CHSA 4R7LA 2EP6A 3L5XH 5GHWH 1ETA1 2GJ6A 4F1ZA 2GQHA 4R4BB 4DCQB 4NBZB 1JNLL 5GRJL 3A67H 4ODVL 2DICA 1RUAH 4S1RH 1KGWA 1F3JA 1D5MB 4BFNA 5C0FA 3FO0H 3U4EB 5LGJB 1FH5H 4NYLB 4AEHL 1QBBA 2JF1A 3P77B 4ISVA 2EDHA 2WY3B 5JZ7D 2ATKB 4WAFA 4JFOB 1M7IB 4XVJH 4A7TA 3MROB 1ZKAA 3BZ5A 4H2CA 5DHVA 4G3YL 4HFUL 5D1XC 5BXFB 1S7WB 2WTOA 1AG0A 3KS0J 3W9EA 1MG3C 2WSPA 5G55A 1XZ0B 3KDMB 5DC4B 2XY1A 3GXFA 4ILDA 5LVEA 3K0WA 3N40P 4QO1B 4LBEA 5TE6L 3CCHA 5LDSA 3SBRA 5EV7A 1T1WB 2O6CA 5DA4A 4ALAC 1G7IA 5TTRA 4W6YB 2OSXA 5EEZA 3OKLB 4H20H 4E9SA 4A7GA 2XTJD 3ARDC 5HVHB 4GKNB 2ZXBA 3P9LB 3EBAA 1CL7H 1CLYH 2XRAL 3IRPX 4YXHH 4IRJA 4MDJB 4NENB 1K5NB 3U6RB 1JI2A 3EHBB 2J5WA 5C7XL 1OEZW 3ZE1E 1HCZA 2OMVB 2UWEB 4S11A 1L9QA 4PHXA 2J1YA 4M6NL 4JHUA 1P4IH 2GTZA 1M7XA 1KNOA 1W6LA 3PAYA 4ODUB 2GEEA 1MREL 3IJHB 1IBZA 2QKSA 4LVHB 1YN6A 4PJDA 1WFMA 4RZCA 4EXPX 4JL1A 5B8CC 1YNTB 1H3UA 1Z5YD 4DP4X 5JXEC 3OHMB 3BYYA 5GS3A 4MQ7B 4ORGB 3LNDA 4PUBH 4GG6E 3MC0A 4HSQA 1Z5LB 1MY5A 1HWHB 1MELA 2NX5E 3EGDB 1JGEA 3Q1SH 4NP4H 5D2LF 6TAAA 2WKGA 2PYEA 4ELMA 2AMUA 4N1EA 4O2EB 3RHWF 1DVQA 3GNML 4MYPA 4IRSA 3F7QA 3DX4A 5KVEE 4PJ8A 1K4CB 5AW9B 2DD8H 3CN4A 3CLWA 2G2RB 4ABWA 5F0JB 3RI5K 3KJ6L 3SDYH 3P02A 4OZGA 1AP2B 3FQ1A 3MRQB 3MRMA 4XMWA 4CL7A 5IQ7H 5D2LA 1ZTXE 2AJ3A 4ZDHB 3EBHA 1L9OA 1DFBL 3CX2A 1GOHA 4WI2A 1VKXB 2XJLA 5GZNC 3FYEB 3QPXH 1ZIBA 4EIZC 4ZX5A 1QG3A 5CIPB 4EN3C 2Y69B 4P5TD 3EIFA 3W3BA 2GK2A 5TK4A 3STZB 5EU6B 4YDIL 3BUYA 3OMZA 2IXQA 1AC0A 4GBXB 4NNPH 1ECYA 4ODHH 3X3GL 4MX7A 1H0DB 5J6GA 3N1GC 4OF8A 2HKFL 5GRUL 3RWFB 2HA1A 4I48B 2FECI 2NY6C 1G6VK 2YPVL 2Q10A 4OM0H 5ACMA 1FFRA 4HUCA 1D2OA 3DVNB 3PXHA 3D48R 4ZO7A 4AQEA 5DF0A 3M7FB 3LV3A 4HWEH 2X70B 2DQCL 4WFGD 3PABB 4LEEA 1HI6A 4YZWA 4NNPL 3N41B 3P9MB 2PPDA 4F5CE 5LGYA 3GD1C 1NOFA 1JRHI 4IMLB 4Q2ZA 4UYPA 1ZA6B 1PIFA 1SRDA 4N0RA 4RRPG 3VM5A 2Q87A 3OXSB 4XO9A 3WNOA 2QR0B 3OKNB 4U2ZA 1E6OH 3TS8A 3AWFA 3C8KB 3RLSA 4Q4IA 1CI3M 4MS8C 1PSKL 3DPBA 4XAKE 3K8LA 4PCTA 1VEOA 2FDBP 1WAAA 1C1EH 1G6RB 2ZQKA 3SODB 8PAZA 5H37G 3SDCA 3VMOA 1JGLH 3V52L 43C9B 3V0VB 4XWGH 4OGZA 4KY2A 1F00I 3LKPA 1RZGB 2YOCA 5EOTA 2R23A 2KZBA 2E59A 1DUZB 1JPGA 1XQ4A 2R69A 4GQ9L 1UWEL 1DJGA 4HH9A 3G5VA 4X8JB 2AJVL 2WWMC 3VU1A 2CK0H 3CZFB 4E9XA 2ZICA 1MRDH 1QNZH 2IBZX 1GXEA 4L8SC 2R2EA 4WWKC 1RLWA 4JPSA 5GZOC 3GMRA 2KZWA 4U1JB 5EU6E 4ZMOA 2FHCA 4DN3L 4W9CC 4OD3L 1ZXQA 3L08A 3R8BB 2Z92A 2B2XH 4AITA 1AR1C 1LK2B 3MOBH 3QEGH 3FFCA 2ATKA 4EKJA 4I3SL 4DGIH 5A16A 3SSGA 2CHWA 1V55B 4TLTA 4PV8A 2BVQA 4L1TA 4RGMB 1P2CA 1YN7A 2VZVA 4PS4H 3MRHB 1KCVL 5D7KE 5DDHA 3WFDL 1S7QB 1FGVL 2UZIL 5JLZA 4TVPE 3FQWA 3RIKA 3EOBB 2ZYRA 1JNJA 3EDEA 3U0TB 2IH1B 2JKLA 4PJ7E 2B1AH 1NFDE 4L18A 3IRZA 2Z0BA 3H8NA 4KVNL 4Y8DC 3OJDA 3TCLB 4LASH 5T1KD 2OMZB 3AM8C 4JPKL 1FORH 2WBJA 4FA8A 2VW6A 4PJIF 4HWNA 5HGAB 3V4PA 1M3JA 3PUUA 2DQIL 1UZ6E 5IIEB 2DYSB 3L1FA 1IEBA 4WJG3 4W9DC 4Z7UF 3TFBA 2APTA 5IOPB 1F45A 3H9SE 1NTDA 1JDAA 3O8XB 4OCRH 5TDNB 3IDJB 1FAIL 4MNHB 3ZHKA 1RULH 1BLIA 1RVFL 2A6JA 4LDOB 4BK5C 4HIJB 4P57A 4EPSA 2PW1A 3VG0H 2CDEA 2QDVA 3OKEA 4GOSA 3HZVB 1JWUB 2AJUL 2W38A 3H1ZA 2HRPL 3LX9A 1MIEL 4M6OH 1PG7W 4FADA 3G9AB 2H32B 4UINL 3WLBA 4BK5A 3P4NA 4LOUD 4LCUA 5TPWL 5IB3A 2VDKL 4XMPL 2R69L 3ZY7A 4FQ1H 3UTSD 3WEBA 4ZW7A 1QO3B 4TSAL 4FNLH 1NAMB 3AJ7A 2QSCL 2B1OA 1NL0L 4LL1A 4WNQB 2GJZB 5I1JH 3FCBA 1AE6L 1KIQB 4K73A 2RB8A 3SBQA 3EO0B 3N43F 4IBWA 3BGMB 2ODHA 1MIEH 2CPCA 5J6HB 3T2LA 1INQA 2YMXH 3O9WC 4MNQD 3DWTA 4DP6X 4ZFFA 5J0BA 3FQTA 1YMMD 2QKIB 1NGWA 4B9ZA 1SVBA 3L3OA 1S3KH 2ZOKB 3AW5A 5FYKD 2H45A 2OL3A 2PP8A 2D7NA 4LLMA 4POUB 4K0OA 4AM0Q 5JA8B 5KG9A 2PYFA 5G5DB 3L7FA 1NCWL 1BWWA 2EDFA 4I9WE 3GXNA 4QXGL 4YSCA 5IIEA 1GGYA 1JCVA 4U49A 1MCFA 1PF3A 3ELQA 2WN2A 3GJFB 1RU9L 4XP5L 3TCXA 2X2JA 1ACCA 4NKMA 4ERSL 4EZKA 5GZOD 1O7VA 4PCKA 4Z95L 5EZJB 2DL9A 4ETQB 1N12A 2PMZA 2PW2A 3IAPA 4NQEE 4KKAC 4MCYB 2YD3A 3DXAA 3NJLA 4ZXBA 4FCAA 3IFPB 4J3WA 3FL7A 4NRYB 3TZVD 4R7DA 1ITBB 3CSYA 5CSGA 4KXAA 3VD0A 4HOWA 3AABA 1LD9B 4CN4A 3CLFH 3ZDXE 1B0IA 2O6FA 5DJXA 1PLAA 3LKQB 3KHOA 3RVXD 2VXVH 5I1AA 1LQBC 1PY9A 3UG3A 1IIKA 5F9WB 3MV11 1A6AA 3MCKB 3ZSSA 4P46D 1YZZA 5T5NG 2P80A 1JXFA 1TQWA 4WKZA 3OGOE 2LOEA 5I17B 1OD9A 4AMKH 4HK0A 4BFOA 3LJ3A 3AFLA 5EDXA 1GGUA 1JTPA 3BSGA 4OM1L 4ZS6D 3P0GB 1T89C 1FNGA 4JMNA 4ZX6A 3U2SB 5JW3H 4OLXH 2D0HA 4JN1L 4HH8A 3K1KC 3KDMA 5KVFH 4NJ9H 2XZQH 4CILA 3WMQA 3ZL1A 4Y5YC 1JNNL 4MQXC 1RJZB 3DSNB 3Q1SL 1B4JL 4KK6C 1RZGA 3FU3A 4FTDA 4DN4H 5AVZB 3WEMA 2J1XA 3GI8H 3LZPA 3U7YL 4MD5B 1IC7H 1OW0C 3H7BB 4LVOB 1S7XB 3EH5B 2H6UA 3P4LA 3MLWH 3AY2A 5HDQH 3SZKC 4UDTB 2OCCB 4BINA 2GFBB 3D07A 2WXNA 1ZVHA 1BM3H 3HAEH 5D9SB 2FLRT 2R7EA 1OSZB 3D3VB 1A1OB 3MBWB 1XH0A 3BD4A 3FU7B 4UT6H 2FX9L 4XVSH 4Z7NB 3T2OA 3QZLA 4HX1B 4QOKA 4CADA 1G9NC 2R0WL 3NJHA 5D1XB 4DPAX 5LWYH 1XCTB 1MFBL 4NM4H 5IMLB 3H7LA 3C60A 3GZKA 2P7TA 2P1YA 4XVUC 1LP9A 4YBQD 2R0ZL 5CUSL 5I28A 4TSBL 4WO4D 1F3DJ 2Y2WA 4Z3TA 2ADFL 3Q2CA 3KPMA 3MV8A 1WH0A 1W0YT 4JFXB 4JFEE 4RMVA 2DMGA 5IEHB 5AD0A 4P4KC 2ZKMX 1S9KC 3J8F7 1NMAH 5KS9E 2FO4B 3FSWA 3PWJB 1KTCA 1LM8V 3F7YB 4ZXBC 3B3BA 1QW8A 3BWUF 2ESVD 5L4FA 5IF0B 4BRVA 4ZSOE 4EJ1C 1U8PA 1BZEA 1MWAA 3JV4B 5DRXB 2WXOA 5IZ7A 1O0VA 4Y9FA 4J2XA 2ZSWA 3WKPA 3K71B 3ZQWA 1PQZA 1JF5A 5IOKA 1TQBC 3LPFA 5B7FA 4QCIA 4DNLA 3CN1A 1EDYA 1YY8B 1ET8A 3FUFA 3LSOB 4LCWE 4HCFA 4K7PH 5C09A 2DW5A 2G9HB 4HYTB 3ZU8A 3PPEA 3U46B 2CR0A 4NXSA 3IF1A 1IT9L 5DS1A 5KJ7E 1TJGH 4JJ5B 4G8FA 5ITBL 1R5WB 1OAXL 5I8OL 3RILA 1CL7I 2OP4L 3C09B 4QHPA 1SJVA 1E9OA 2I32A 2YFOA 3C6LB 3OAUH 1NBVL 1ZGLP 2WUBH 1IL1B 2NMSA 5LGKA 3BJLA 2WKLA 5E4EB 1SJHB 4KY1L 3O0RH 3KBFA 5JHLL 2Y7LA 1BZOA 2IBGA 4Q8BA 4G43A 1HFUA 1A22B 2MQ3A 1SBSH 4G8IA 3ZTJH 4EUPB 5DZVA 4DW2H 4APXA 2C9VA 2L4OA 1I7TA 1NBZA 4YX2L 2X05A 2OMXB 1XMEB 4F7CB 5KYYA 5HJ3A 4JFFE 1RIUL 5FFOA 1CLCA 1F6FB 1JWMB 3TN0D 2VZOA 5FUZH 3SE3A 2MWCA 5F3BB 1GGCH 2NCMA 3QDGD 4N6QA 2VE6B 1TYJA 2FWUA 4JO2L 1MWAL 1G7MA 1P1ZA 2G5BB 1JRHL 3Q1EA 3WY2A 4B9YA 3NK4A 1LE9A 3ES6B 3CPUA 3NIGB 3TX4A 3GMOB 1SXBA 1UVQA 2DLHA 1WT5C 4M3HA 1EXUA 1Y18A 1PLGL 4UTBA 1Z0MA 5I6XC 3EDFA 1J1OH 5EU4B 2BSTB 2VLRA 1VACA 5IHZA 2DQJL 2ZXAA 4CU8A 1G0DA 2E8YA 3RDTA 5MERA 5J7CC 1A7OH 4N0FA 1W8EA 1NC2A 6FABL 3N85L 3GMPB 4DKEL 3DJRA 4DCQA 5B3NA 3O41A 1K5NA 3OXRB 1Y1UA 2OPCA 1AJ7H 4PI0A 1OSPL 2OXHB 4XC3H 4F27A 1ZHNA 2ZUUA 1G9NH 5TFSH 3RIFF 4NO3B 4U4IA 4LCCB 1I85A 1TJMA 3F84A 4N0YH 5CP7A 2VAAB 1JHKH 3L9EA 5JQIB 1UASA 3O11B 1EFQA 4PTTB 3V0WL 2XIIA 2V2WB 2X41A 3AS1A 1KXQE 3N1QC 5MI0B 1JHTA 4HUVB 1DEEA 1UG9A 5ACZB 2VYRE 4KI5D 1WFUA 3TT1L 2F7OA 3A47A 5CJXC 5CZXC 2IOIA 4U05A 2W0KA 3C6LD 2V9UA 2UUDK 1SJEB 5FR3A 4P4KA 3IRCA 3FQUA 1S9WA 4I0PC 2W94A 5IHHA 3U9UB 4QLWA 1NC4D 1RP8A 5E9DA 3ECVA 5LBVA 3EO1B 3RWHA 2DQEL 4WFEE 2WKOA 4BEIA 4H1LB 3KPRE 5ESVA 3GTVA 4PRPA 5GISH 4CC4C 5ICZB 3QO1B 3EJYC 2CXKA 3ZTDC 4JDVA 4ICWA 3JWNE 4ODSH 4Z76A 5BO0D 2VDRH 3PXLA 3LRLA 4YXLH 4HOZA 1HQRB 3RGVB 3ZKXC 1KY6A 4PY8I 2FB4H 4BFIA 1D6EA 1TFHA 1I8KA 2YIHA 3CPLB 3W82A 4Z7WF 5IB4B 5LGHL 3GSOB 2QZ5A 4RMWA 3L2LA 4GSDL 2EJ1A 1KLUA 1MAML 2OR9H 2XBTA 3UTPD 1Q9KB 4R6UA 2VDQB 5FYKH 3VXMD 2BS71 5E6IA 3E9TA 4NUGL 2HVJB 2VXUH 1MPAH 3QQ4B 2C7UB 2VM9A 2PW1B 3R06A 4AGPA 3P2TA 2J55A 2NY1D 4XMUA 2Q1EA 1F0LA 2GKIA 3GIZH 1CDYA 4O9HL 3DROA 1BXVA 2BX5A 3FW6A 3NABH 4Y2DD 5F6IB 3BVDB 4HOXA 2JFCA 3OAZK 1HXMA 2J8OA 1YJDC 2YQ2A 3LZLA 3MNVA 3OQRA 1EGJH 2EIZA 3GI8L 3ARFB 4A2GA 2ZKXA 4LMQI 4JPWH 3QIBC 5TH2A 3H9HA 3SJVB 1CLZH 3EG9B 4JY4A 4J3OG 1YNLL 2IDFA 3VXUB 1I3VA 4J6RL 3T0EB 3L4CA 5F96H 4YDJA 5BV7H 3HNTH 4LCVA 1JPTH 3J07A 4M7LL 4ATTA 1PLBA 1R3HA 1M05B 4HK3J 4N2GA 1U8HA 3WTTA 2APVA 2CWRA 4HCRA 4AEHH 3PF2A 3S37X 3Q8FA 3FOMA 1GIGH 4AUJA 3BP6A 3S3JA 4WFGE 3M46A 4QO1A 4B5EA 4JGJA 1CG9B 2L3BA 1O5PA 3RPIA 4DT2A 4F2EA 1S9VB 1X6LA 2OR9L 5F1OB 3OQ3B 3BRDA 1AOHA 4NO5A 4LLDA 4LPWA 4KXZI 4IU2B 2DMCA 4Y5VB 4M5ZH 3WFCL 4GKZA 5AVWB 2MFNA 2E74C 3E9UA 4NUGH 4R96A 5A3ID 3ETBF 4IEFB 3WNKA 3PAVA 4P0DA 2N01B 3L1GA 3AU1A 4PS3A 3K4DA 5AVUB 2EDOA 1Q0XH 4GIAA 1SPDA 3X1EA 3G6JF 4A38A 5DU7A 4HKJA 4M7ZC 4JRYA 4MBRA 4XOCA 1D5MA 2FYVA 2IWEA 2UWEF 3U4BH 4DO4A 3CVIL 2VW7A 5I15L 2ZYIA 3RIAF 2A6KA 3ZE0E 1G6RH 2YRBA 1NDTA 1QR1A 2G3XA 4D0DA 3GSQA 4ONGH 5DLML 1MLBA 4BKTC 4X9BA 1EZVX 3VWKD 1HCYA 2YPKA 3GBDA 1R0AH 1JVKA 5I0WA 4MGXA 4XWGL 2XQ0A 3QULB 2VJ0A 3RPKA 1A7QH 2HTKD 5HDQL 1HXMB 4OSUH 1TMCB 1JPTL 1J18A 2CRMA 2OP4H 2PCXA 3CFCL 3OHXA 4PRHB 4TQIA 1TQSA 5G2NA 4HKBA 1HNYA 5GHWL 5A40E 5AAPA 3CCHB 3CVHB 4MSWA 1I1AD 3BYTA 2Z34A 2JQAA 1VACB 3VG9C 3CBJB 2H2SC 2OK0H 3QJVB 5E2VH 2C5DC 1T0MA 3IDYC 3WIIH 4D7PA 5HYSG 2DWYA 3FHAA 1EAPB 3WAKA 2NY5C 3PFQA 4OZ4B 2CALA 2LU5A 4PRNA 1ICTA 1AY1H 1T7WA 3WEXA 1IGJB 4XNYH 3NZHL 5J8OA 2HT2C 4U6HA 4XCFL 5CP7B 2N7BA 4AT6B 3GK8L 4EOWH 4ZUVB 4YSSA 4WFHE 4UM9B 4PTTA 3WN5B 5LXVA 1KMGA 1ZJBA 4P4RA 4X80L 4OUOA 3SE9H 1OP5H 3DYOA 1FSKC 3WKML 2Q7YA 3AS2A 1PKQB 2CBOA 4L9LA 3V9CA 4RWYL 4F2ME 5JMRA 2BY1A 3NMEA 2VWEC 1TQCC 1A7NH 1DLHB 4MRBA 3HE7C 1P4LB 2RFXB 1AD9B 3T2QA 2H6PA 2JLLA 5HXMA 1DR9A 1KYUA 4KTGA 3QFJA 1LL1A 3U79A 5HHNB 1T0NB 5BUAA 3Q6FB 3BT2L 3LV3B 1SVZA 5HDOA 1NCUA 4LSQH 3ZMNA 1HOCB 1MRFH 2NW3A 2YPKB 4M7ZB 1VSCA 4P2OC 1GZHA 2FGWL 4G11A 4U1GC 3F85A 5KTEL 3B7UX 1RURL 1PGRB 4HUWB 3L5WB 2A99A 3QJHB 4KGJA 4F93B 3D0AA 2DWDB 2EXTA 2XNAB 2X1OA 3TTSA 1UXWA 4BH7B 1A3LL 3L3JA 1JBJA 2HG5A 2PO6C 5FUZL 3ISWA 4XWOD 2A77H 2DWSA 5FK9A 1MFDH 4XXDA 5FF6A 4HV8B 3DX6A 3DKHA 3IU3B 5D1QD 4EIUA 5ABZA 1MCHA 3MI6A 3P30H 4WUUD 1BQSA 1NBVH 4HDIB 4X80H 4E42B 3ECUA 2I5YL 4G7YL 2A38A 1LJMA 3RHWK 3ABGA 5CEYA 1CIDA 3BQUB 1I7UA 4O4YL 3VD1A 3ARQA 4XNMA 1I1CA 3GXUB 3OMAB 2ZSVA 4GO8A 3S5ZA 4RX4D 3L3KA 4FKKA 3HZMB 3UC2A 3BPOB 1N9PA 3IXTB 4GRWE 4J3VA 4Q56A 4QRQB 2VNCA 4U6YA 5FYKE 5A2BA 2ZCLL 4WHYH 2GAZA 4F8LA 1HJBC 4ZO8A 1ZXKA 2YD5A 2YFNA 4LFHD 2FIKA 4PRIA 2ZOLA 3RIFK 2X2UA 2XVGA 3R19A 4LPXA 5F3FA 3NBNA 5DMYA 1KG0B 4YXKL 1ND0B 3EJJX 2HH0H 3SYAA 5F3BA 4MMYB 2ZNXA 4O02H 1MZZA 2CRIA 4LASL 1EEYB 3P3TA 2JKWA 3IWVA 1NIFA 4IDJH 4ANXA 3KYMB 2FWOA 2IALA 1Q9OA 2PTTA 2R1XA 1KC5L 3OKMA 1ACXA 2YEZA 4HW6A 1IAOA 4JE0A 4JCMA 3X3FH 5KVGL 3LMJH 3QWQB 4LSVH 2MSPA 4PJFF 2RTTA 4BV1A 4DQOL 1IU1A 3LEXA 1BD2E 2DJUA 1J1XH 2BNQA 3FQRB 5D5MA 4N2OA 4PVMA 4LP8A 3HCVA 3CDZA 1TZ8A 3MGAA 3S37L 3U9PL 2E6JA 3HRZC 1Z6JT 4Z7OB 1X5LA 5A2LH 1N2RB 3QYCA 3REWA 2O93L 1RZJC 4KMLB 1OOAA 5GISL 3K2IA 2XWXA 3TXAA 1R3IL 4JG1H 2BSSB 1JDCA 1XTMA 4YDNA 1FORL 1HSBB 1T2QH 1CGSL 3T0XA 3PP4L 5C6WH 4XHJD 2Q20A 2EKJA 3HG5A 2NR6C 5EEYA 2A9NL 3ASNB 5J89A 2K1MA 3L1OL 5FOJA 5JPNA 2EUVA 4P2RB 4WKZB 4FNLL 1TVBA 2GBAA 4TLUA 5DVMA 2W95A 3GMNA 3CFBA 1KBPA 5FV1L 3RYMA 3ROOB 1EEUA 3H42L 4KKAD 3W2DL 1XGTA 4P07A 5EFIB 3DX7A 3TTYA 2K3TA