4L1DA

Voltage-gated sodium channel beta3 subunit ig domain
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
124
structure length
113
Chain Sequence
VCVEVPSETEAVQGNPMKLRCISCMKRATTVVEWFYRPEGGKDFLIYEYRNGHQEVESPFQGRLQWNGSKDLQDVSITVLNVTLNDSGLYTCNVSREFFVKTTRLIPLRVHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sodium channel subunit beta-3
publication title Crystal Structure and Molecular Imaging of the Nav Channel beta 3 Subunit Indicates a Trimeric Assembly.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Membrane protein
total genus 25
structure length 113
sequence length 124
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2013-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4l1dA00
3RVTD 2AJZB 4KI5E 5DLMH 3EO0A 2R15A 2L0DA 4MQ7A 5C0GA 2H41A 1WAAE 3NFPA 3E6HA 1DBBH 2AABL 1O5DT 2BNQD 5FCUL 2J8UA 1U95A 1CLYH 5L6YH 5D5ME 5C8JB 5CD3B 3QDGA 2XZCH 3FT4A 3ARRA 1MEXH 2DLTA 3QDMB 2GTZB 4M43H 1E4XH 4LLVB 4HZLB 5ESVB 3AAZB 3MLYH 4KC3B 1Z9OA 3LPFA 2VDQH 1U92A 3BIKA 3UPRB 2H1PL 4BZ1H 1M05A 1WFTA 4NQTA 3BP4B 4R96A 4R4FL 3TWCH 3ULUE 1YNLL 4ELKA 2AV1A 4R9HA 5I1GH 4X7FC 1BIIA 2F19L 2D7MA 3W2DH 3ZDXE 5CAYB 4OQTH 3NCYS 1C5CL 3QNXB 4F8TA 1A6ZB 5DJDB 2CO7B 5JA9A 4W68A 5J6HB 1MFBH 1UZ6F 2EC8A 1S7UA 4NQDE 4TN9A 4HEPG 4KK8C 2FYYA 3LV3A 3TC9A 3DTXA 4LCUB 1NCDL 1H3UA 1BAFH 4HIIA 3FJTA 1HHKA 5F3HB 1IRAY 1DL7L 5F21B 4AZ8A 5DRXA 5BS0E 1RZ7H 1JWUB 2M26A 5T1LD 4WV1A 3QXTA 3D85D 4PLOB 3V2AR 3MJGX 3RPIB 2BY0A 4GKNB 2BSRB 4X7CC 3JTSA 5IW1A 4NNPL 1Q9OA 1LK2B 1REIA 3OKMB 1HI6B 4P2QB 2AEWA 1U8HA 2F54A 3LPGA 4X4ME 2MHAB 5H2BA 1ZE3C 1NFDF 2Z31A 3TYFA 1BECA 4XT1C 2V2WB 3Q5YA 4PJ9C 1PYWB 5C3LD 5HGGS 3WJLA 4YHPA 2VN7A 4HCRL 3D18A 3PGFL 2DQDH 5D2LB 3MREB 3TN0A 1DEEB 3MNZB 5F7UA 4WCYH 3MLUH 4RGOL 2YN5A 3OG4B 4H1LA 1FFRA 4UB0L 1A7RH 1CDUA 4R4BA 3MRCA 4WO4D 1D5BB 1AJ7H 1T4KA 3MJ9L 2P5EA 3MLXL 3PNWB 1A7QL 4MCYB 3MMEB 5E8PB 2ZNXA 4OF7A 3JVGA 4YWGL 3TZVB 4L3EA 5DS8A 5DVOA 5BV7B 4X4XB 5F70A 5LQBL 4OF6A 1IT9L 5DQDH 1WICA 3AM8C 5I18L 1ES0A 2C3XA 3MGOA 1KG0B 5KW9H 3P40A 4PD4J 5E8EB 5J9PB 3L3KA 3CFJA 1FFOB 2DLFL 5E5RB 5E03A 2ZSVA 3OSKA 1TDQA 4JKLA 1NLBH 5DJ6B 2P8MA 4QYOA 5LCVH 2C4XA 1N8ZA 3HI5H 1XR9A 5HHOD 1I7UB 4X9GA 4PJ8A 3KLHD 2KZ1B 3FO9B 1WEJL 4Q9QL 4R0LC 4XMKL 4NDMA 1X6NA 3D39E 1XIWA 2BRRL 1FFQA 4DFHA 5IB2B 3WIFB 1AFVH 3MR9A 4ODVL 4XVUC 2I27N 5C0FA 5JR1L 1NC2D 4QOKE 3IAGC 2YBRB 5CKAA 2VLME 4OV5B 1A6VH 1S7RB 4Q6IB 1ADQA 3HG1B 3VMOA 4GXVH 4LASL 1HHJB 1YPZB 3G08B 3DSNA 1YEHH 4PJHE 1O7SA 1P1ZB 3RVVC 1OOAA 3GMMA 1VDGA 1T0NB 5GHWL 1GOHA 1AXSA 1T5XA 4R3SB 5T1DL 1PQZA 4BK5A 3PV6B 3WEXA 4JJ5B 4OZGE 3LKPA 3T04D 1ZT4A 1JPST 3GMRA 1R5VA 4UOJA 3B9KD 4KI1A 1TQCB 3LEVL 4KTDH 4PJIB 2JB6A 2K1MA 1FDLL 4HQQL 1MFCL 1INEH 3LQAC 2NY1B 4UIKL 4DZ8B 5E6ID 5IHZB 4LVEA 3DIFB 5IMLA 3W5MA 4EI5A 4OLEA 4JR9L 4TSCL 1KIQB 4NOBA 1QPPA 3G6JA 3ABZA 4F7EB 4XCFH 4N90E 4BQ9A 4PG2C 2AW2A 1J05B 2B1AL 4ENEC 3VXSB 3LKSA 2AP2A 4XPTH 1A1OA 4QXUL 2D31A 3WLWC 5BV7H 5IJVB 4TSAL 1CCZA 5L7XH 3O3EB 3B5TA 1I1FA 1GAFL 4O51A 2E6PA 1A9EA 1DQTA 5HYSB 2PF6A 1QBLL 2YWZA 4OZHA 4LQFL 1J18A 2XZQH 5MHSD 4GLRH 1KNOB 3H9SA 5IR1A 4ZNEE 5JLZB 1D9KA 1X5KA 4M4RA 5DHVB 4N1HB 4OI9A 1VACB 3DX7A 4UQ3A 5BZDA 3QDGD 3FT2A 1FGNL 1UCBH 2HYMA 3T2PA 3OAYH 2VLRB 3L3HA 3CX5K 1N64H 5IFJA 3CD4A 4GMSH 3PGDA 5C6PB 5C86A 4PJ7F 3SE8H 2JK5A 4Y7MA 2P8PB 2NYYC 1GGYA 4MD0A 5D7IB 2R1WB 2IAMA 5AYQA 5SWZB 1MJ8L 3GI8H 4Y5VC 3KJ6H 4O2EB 1HILB 4NGHL 3L6FA 3A67H 4NPYB 3BW9B 4ZAKC 4FQ1H 1B4JL 1FNLA 4XC3H 1OAYL 2OS7A 3SDCB 1DUZB 2AK4B 2FL5A 3FL7A 4M03A 3MV7A 5ENWA 1PKQB 2VMFA 4GBXA 1GGIL 3L5XH 3I6GA 2FIRT 1WC7A 3QUYD 3C8DA 1S8DA 5ITFB 4Z95L 5L2KA 4ZOBA 3CVHA 4HIHB 2Y9RT 4ODWB 1A4JB 4G5ZL 4DQOL 5JXAH 3CC5A 1RMFH 1QFWI 3V6ZA 2R39A 2QQNL 4MLIA 1AQKH 2EYSB 3HZYB 1W72B 5I16B 4I2XE 4FFZL 4IOFD 5JW5A 2VLJA 3HTLX 3CXHK 4KK9C 1OGAA 2BNUB 3ZHDA 4Z78B 1ZA3A 3H2WA 2DJ4A 4LPVA 1MRCL 1JV5A 2OL3B 2IANB 4JQIL 1S9XB 5I8CA 4WI2A 2EYRA 2UWEE 1HK6A 3LIZL 4L29A 5HYIA 1T1XA 3OAZK 2F54D 5C0IA 2ARJQ 4Z6AT 3S35X 2BVTA 2HWZH 1J9CT 2XZAH 2Z31D 2J6EL 1NFDB 4NN5C 2P7TA 3O8XC 3O11B 1FCGA 1XGYH 2NMSA 4OGZA 3RUGA 3RP1A 5CHNB 5CWSB 4D9LH 3UYPA 4O02L 5IB5A 2C4FT 2HT3D 3TN0D 4KAQH 3RDTB 4OB5H 3EUUA 4XXCA 5EWIH 4Z77A 4KV5F 1FC2D 2QQKL 5ID1A 5IOPB 1S78C 1ZA6B 1U6AH 1FIGL 3PP4L 1UM6L 2IH3A 2P5ED 3MBXH 3RWDA 2H9GA 4YDIH 1U3YA 3QI9A 5C0BA 3BUTA 4ZYKA 1G1CA 1TJHH 1NUGA 3G5VA 5DD0L 5FO7B 4BSJA 3SJVA 1DFBL 1KSRA 3RWCA 3RZCB 1CU4L 2XFXA 5ADOH 4L3ED 4PS4H 4HKJB 4JN2B 5C0CA 5J4MA 5HDOA 2GY5A 1FVDB 4R90H 4X83A 2BXZA 4B7LA 4QLRA 3I3BA 4PTTB 4PP2A 5JW4N 1JWMA 5E2VH 4EVNA 3VFVA 4Q9RH 5KVEL 2VDNH 3KJ4B 3EYUH 4I48A 2X4TB 2VITA 1V7MH 4TPRH 3O6FB 4GS7B 4PJ8D 5HHPA 4OZFG 2R69H 1K2DB 2C3VB 1EFXB 4E41A 4G9FE 3MLWL 5C0JB 4WIQA 1XIWD 5I1KH 4G42B 3BAEH 4NKDA 2VDKH 5TDOA 3A6CH 4D9RD 4D0DB 4LP5A 5HI3C 4DGVL 4KUZH 3RBGA 5IGXH 1QFUH 3WIIH 1SMAA 3G04B 2DLGA 5DD6B 4N5ED 5JIKA 1IJ9A 2BJMH 3C09B 5C3TA 3OB0K 3FQRB 4ETQA 5L88L 3TNMA 4UU9A 1KN2H 3ARFA 5T3ZH 3VGEA 1AGCB 4B50A 5DRWA 4NRYA 1UJ3B 3IGAA 3LCYA 1QRNA 4LSUL 1CLZH 3S37X 1MCWM 5FO8B 1KEML 3I6LD 1YQVL 3S37H 2FHBA 1DQJA 4ZUVB 4ERSL 3MOBL 5DK2A 4KJYB 1LDPL 4QXGL 5EU3A 3TH4T 2OSLA 2FBJL 4F80A 6FABL 1AGDB 3QUXA 3FQNA 5TQ2L 4EI5D 3BXNA 5FO9A 4MS8C 1I1AA 4KXZI 3LB6C 3EOAA 1TJIH 4OKDA 5E4EB 5FEBA 1ZXQA 2GITB 3T3PF 1KXTB 4NNXB 3DETC 1UXSA 1CDBA 3GMPB 2BVOA 5EOTA 1FVEB 4JY6A 4FZEL 5HHMD 1MI5E 1TPXB 3CLFL 5I73C 1R3HB 1UKTA 4L4VA 4TUJA 1JHLH 3OKLB 5JPNB 2DQUL 4MJ6B 5D7SL 1LEKA 4PJ5A 4PREA 5I1IL 3H9SD 2IALB 4Y1AB 5EPMB 4TQEL 1D9KD 2UVEA 4MDJA 3SDXF 2NY6D 3HA0A 3QQ9C 5GGVY 1I7RA 2X4NA 1MQ8A 4UT9H 1I8IA 1MRDH 4FFWD 1UEYA 1CXFA 3I6KA 3VW3H 4NRXA 4NN6C 2EXWC 1RJZA 5CBAB 2GCYB 2XT1B 5F8QC 5HHOE 3FFCE 1E4XI 1MCNA 1CE1L 2I07B 4X9HA 3B6SB 4HW6A 4POZD 4JO3L 4HK0B 4PJ7B 1T22A 3AS0A 4LSSH 4DCQB 4X6EA 4G8FA 3U30B 3IKKA 1QBAA 1KTRL 2IAMD 3F58L 1RK0B 2YD9A 1RVFH 4D9QD 4LNRB 2ORBH 3MV8B 1GZPA 3CSBA 3K8KA 4KKAD 4LSQH 4CJ1A 3S96B 1E27A 4RWYH 4WFED 2HFFA 4YDVA 1YMME 4HBCL 4CW1B 2DM3A 5EZLA 4KJPD 3LRSA 5IB3A 2YD4A 2VZTA 1GXEA 2QADC 3GMNB 3MV7D 5BW7A 4GBXD 4MJ5B 5C0DA 1NPUA 1YEKH 3RBSA 4GQPH 2ICEA 4NQVA 2X9XA 1C1EH 3WUWA 1VESA 5H8DA 5L2KD 1HH9A 2DMCA 1NMBH 2DTMH 2BHUA 3D5OF 3WHE1 5GS2D 1JMXA 3QCVL 4GRLB 5DYOB 4QHLA 5K33A 3I02A 1AH1A 3CGTA 4OIAA 4PTUA 4PR5A 5AZ2L 1P4BL 2FEDD 5EBMA 3V9FA 1OGAD 4EUPA 3V0AC 2BOBA 4U4BA 4TTGA 4RGND 3HNVL 3OKDA 4YXLL 3GBML 2AQ3A 2N7AA 5DFWH 3PE9A 4RMWA 1T04A 3DHMA 3QUMH 1H3TA 1N6QL 3DBXA 4JY5H 1A2YB 4MXQD 3UPAA 4LF3A 2PYEA 5F1OB 3IB4A 5DA0B 2ZP0T 4BQCA 1VEMA 2QSCL 2I9TB 1DVFA 4JPWL 3IXTA 3MXWL 4UAOB 4HKBA 4M3KB 3O2VH 3IDYC 2HRPL 5DI8A 3U0WH 1NBVL 5TJWK 3ESUF 1QLEH 5FYJE 1UM5H 3W39A 3H7BA 4RFNB 2J8UE 3QDGE 3FCTB 3L9RA 1PG7X 4I1NB 3ZYOA 3RHWF 2JELL 1ZLSH 2Z9TA 3WHXA 5D7JC 3QI9D 5C0BD 2R2BB 4ZTPH 1I9JH 2FO1A 1LWRA 1OAXL 1PG7H 3SJVD 4IRZL 1KB5A 5CZXD 4YXHH 4OFPA 4QF1A 4OGYH 3WUZA 2ITCA 5C0CD 3MRGB 3DLQR 2VSDA 3GRWA 1HWGB 2R56H 3VFSB 3NACH 2BVQB 1GGUA 2NR6D 4U0RC 3VGAC 3CX5J 4BSVA 1IBGL 1TCMA 3OKEB 1TXKA 2QEJA 3H0TA 1BEYH 1FQ9C 4GUPB 3HUJF 1HIML 3C5SA 1QVOB 5CSZA 5C6TH 3MRJB 3HI1B 1T1ZA 2OX5A 2EIDA 3KPPA 5GRWA 5E5MA 4G43B 4E41D 1QYGH 1V7NH 4PRNB 5TE7L 4KQ4H 4I3RH 5DJZA 3THML 4ZS6C 4K7PY 5JMOC 1Q1JH 2HJKA 3O41A 1XGRA 2EXYD 4X8XA 4J4PC 1M1SA 3INUH 1PKOA 1RZGA 2BCKA 2QV2A 3U2SB 2EDHA 4HWBH 5DO2C 3ARFD 4G8GB 3QDAA 3U0PB 3K2MC 2XTJC 4J3TA 1QRND 4FZ8H 3U4EA 3WFZA 1SJHB 4JVWA 5I1AA 2CKBB 3L3DA 5MI0B 3DVGA 1F11A 2W07A 1QFWL 3CCHB 2FD6L 2WBJB 3BEVA 2F54E 3EHBD 3CXHJ 3TFKC 3HC4H 4L8SB 4OKVA 4LEOB 3QUXD 1B9ZA 3P4MA 2FX8L 3GJFK 1F3DJ 1CFQA 5IJKA 1F58H 1I1AD 4TVPE 5C09B 5JQ6L 3C60B 2HT2D 3HR5B 1EO8L 4BZYA 5EIIA 1GIGH 2AXJA 1AC6A 2B4CL 3FOLA 2P5EE 5GS1C 3FRPA 1NGQH 2YA2A 4LIQH 1OAQH 3HC3H 2BHYA 3TCLA 1ZGLB 4YHNA 4YJZL 1UT9A 2HG5A 1FAKT 3LDBC 4U6YB 2D0FA 1UWEL 3EYFA 5IFAH 2E7LC 4PJ5D 5DD3H 2CRYA 1Q9KA 1JJUA 3MA7B 3K8LA 2AXFA 4ODTH 2DI8A 4MWFA 4KDTC 3SDXB 5IMOB 4P5MA 1FN4B 4DKFH 5DJXA 2CDEB 2VN4A 4QCIA 4P2RB 5LG1A 1CIDA 1K8DB 3KR3L 4LARH 3OPZL 5KAQG 2GAZB 4EDXB 4NM8L 4K94H 4AM0B 4XGZB 2HRLA 5FHBL 4XWOC 1DQLH 5B38B 5GGUB 3JWDH 4ODHH 2Q86A 1K4DA 2BSSB 3P0GB 2GI7A 1TTFA 4Y16B 3D2UB 1A6WL 3MJ7A 1P4LB 1WK0A 5T5NG 1XF3A 4EI6B 4D9RE 3ES6B 1YECH 4M62H 3MRFA 5FYKE 4KH2A 4FMFA 1U3HA 1ACYH 3BGMA 1KCVH 4LDEB 5IMMB 4LSTL 2WINA 4HC1H 5AAWA 1MIML 1JGVL 1DBKL 3WXWL 2AV7B 3TO4A 5EU4A 5JTWA 4P5TA 2J12B 4ZO6A 3MCKB 2V2TA 4IRJB 4WNQA 5ADPH 4G6JH 1D5MA 4MD4A 4RRPG 3SDDB 3VA2C 4JLRA 5INCA 1MIEH 1F4XL 4M7LH 1T1YA 4Z8FH 3MV01 3U9PL 3I84A 1ZGLP 3PQYB 1T21A 4LU5L 4HS3B 3HHRB 2B39A 2FZ3B 3FB5A 4NQEA 1AHWA 3Q1SL 4RFOH 1WV7T 3F7VA 4AEEA 4HWNA 4H5SB 4XC1H 2YD7A 4Y5XA 4LPWA 5DD5L 3EO9H 2VXTL 3RY5A 3V0VB 1A6AB 2C26A 4XI5C 4FFYH 3RU8H 3BN3B 1UCTA 1LILA 3MRQB 1OB1A 4P23C 1PY9A 5IWLC 4WU7B 5HPMA 3EFDH 1R3LA 2VDLH 5ERWB 4UT7H 2PYED 4MQSB 2YMXL 3JV6A 4YHIB 1HDMA 4RAVB 2X2YA 1DVFD 3IAPA 4MAYC 5DD1H 1OSPH 1BD2A 2PW1B 4TNWK 4QRSA 3DURB 3H9SE 1NC4B 3IDMA 5EBWA 4A2LA 5HDBE 3E8UH 4TULL 2IFGA 1BIHA 5GRUH 1SYSB 1AIFA 3CVHL 3QQ4A 2O26U 4QGTA 2HKFH 1T20A 2R23B 4PFEA 4UMGA 1UACL 5ACLA 3UTQB 1G9NC 1KPUA 3BGAA 4P9ML 2W60A 5EIQA 2YSSB 1T66D 4JPIB 1U8LA 5D9SA 4FNLH 5DLML 1NKRA 2VR9A 2X1OA 3NGBB 1TCRB 5T1KA 1B4RA 1FJ1B 2CXKA 2ZPKH 4D9QE 3FTGB 1HKLH 1WBYB 3S36H 3G5XB 2JJVA 4PY8I 3U82B 1CLYL 5L6YL 3L7EA 4NC1C 4N8CL 2LQRA 2XZCL 4G6AD 4WFEE 3VI4F 5E9DA 2L7JA 2XWJB 2C4FU 3KDMA 2JIXB 4X5LA 5JPMB 5GSVB 1E4XL 1I3VA 1R3JB 3IDYB 1IGJB 2FJGA 3FQTA 3PHQA 3SE3C 4ZPVB 1HHIA 4HUUA 4DGYH 2NY5H 2VDQL 1BOGB 5EUKB 2QBWA 2VLLB 3HC0A 3VXOB 5FV1L 5I0DA 1QTYT 4ZSOA 3UBXG 5I8EA 3TWCL 1S7VB 4IMLB 3P77B 4ODBD 1RZIA 4NHCL 5I1GL 4C57C 4HKZB 1HOCA 3W2DL 2F53A 1ZLWH 5CGMA 1OGAE 3QEQB 3V7AE 4IDJH 1FNEB 5CJXC 1JNHB 4XWGH 1D5IH 1BX2B 3SDAA 4ZFFA 4OLYH 3MRHB 3VGAB 1C7TA 4PJDA 1AD0A 4Z7VE 3M1BB 3WNNA 1T7ZA 1BAFL 3BD4A 3BH9A 4K7PX 4NO5A 5IQ9B 4YC2C 5IEKA 1WCBB 4OM0H 2Y6SD 3BQUD 1RZ7L 5I66A 2P24B 3ZE0F 4JFPB 3VXRB 4XVSH 3IXAA 1D6EA 2J8OA 5AYUH 5I19H 3VWJB 4F7CB 5IEHA 1S9VA 43C9A 1S9YA 3SKNB 3WKML 5DHYB 5E1AA 4XP5H 3SKOA 3EAKA 3V5HA 1RUML 3L3GB 5D1ZC 3Q6GL 5C0NC 3TLRA 4P48A 4MNGA 5FGSA 1MCWW 4MZ2A 2XQYG 2EKSA 4QT5A 2YPLE 4XCCH 4A6YA 4GG8A 3FT3B 4FQHB 3MGAA 5DSCB 4YGVA 5D8JH 5C7XH 4DW2H 1T7XA 2MPAH 4KRLB 1Z0MA 3VFNA 1JGDA 2DQDL 1BWMA 4I5BA 1ZSDB 2GUOB 3CAFA 3MLUL 5F7LB 4M6OH 5L8KB 3ARYA 1TNNA 2I9LA 2OMBA 3UC0L 1A7RL 4YO0B 3QXDA 4JKKA 1NAKL 4Q7DA 1A1NB 2BXYA 2FB4H 2Z92B 1OARH 1H8OA 5D1XC 4GW4A 4O9HH 5T3ZD 3WS3A 1E4KC 5ESAB 4K3GA 1BVKB 3SCMB 3WS6C 3T1WA 1CDJA 3WMSA 5JDSB 4WJ5A 4ZTOL 4JFXB 3EDEA 3CSGA 3QZWA 4AIOA 5FM4A 5DQDL 1U3HD 2P8LB 4NQCA 5A1AA 1LP9A 3MROB 4BH7A 3SKMA 3MUY1 1IGCL 2GT9A 4HV8B 2NY3B 1JGUL 4JFYB 5E0QA 3HKFA 3MYJB 4NSKA 2VE6B 5KW9L 1QSEB 4I0PB 4MGXA 2YC1A 3TO4D 3G6AA 4P5TD 3V7MA 4PJFF 3TBYA 4JY4B 5LCVL 3HI5L 3SO3B 3DXAD 1ZLUK 8FABB 1U9KA 4PRAB 1NH6A 5IW3A 3CK0H 1MCQA 4GW5B 4PJXB 5C0RH 4OZIA 1NCAH 1YC8A 1X5FA 4J3SA 1AGBA 3U83A 4NQED 1NEZB 1CL7H 4OSUH 4YDLB 2WUBL 4JZJB 1A6VL 4QGYA 1KPRB 4N0CD 4D0BA 4GXVL 2WUCH 1YEHL 3TA3A 3UTSD 4WI9A 1A3LH 2VOTA 2CMRH 3GIZL 2G75A 2YK1H 2YN3A 5GXBB 2VRAA 3PHOA 3O6FD 2XV6B 5EFIB 2NXYC 4UBDC 4WW1B 3RNKB 1QR1B 5MENB 2VL4A 1BD2D 1A22B 2MJWA 4KTDL 1CICA 5I9QC 2A6DB 5F9WB 1FG2A 2KKQA 4QTHB 5F96H 3UZQA 4HWEH 3GM0A 3MRDA 2EIBA 1KB9K 1MREL 4XCFL 1H3PH 4JFOA 5ICZB 1MCOH 2D7OA 4CN6A 4XPTL 4OF0A 1X5HA 2B20A 4OLZH 5IVXF 4E9LA 3EFFA 1SVZA 2CLZA 2A77H 4NZUH 5LGHH 3TH3T 1GC1H 3CFKA 3GIVA 4X7SH 4M8QA 5L7XL 3VFMB 3EBAA 1EEYB 1NCWL 5CJQH 2EZ0C 5C70A 4F9PA 1OTUD 3BEWA 3ULVD 3V5DB 1U93A 4XCEA 5T1KD 4MNQB 2YEZA 2XZQL 2Q7NA 2VAJA 2FH6A 2XRAL 1NMAL 4OQ1A 3WO4C 1T1WA 1ZS8A 4ZFOA 4WHYH 2NY0B 3P73A 5E9DD 2DQCH 5D2LE 3KVQA 1QQDA 2X4PA 1WTLA 3T2QA 4F58H 1GHFH 2CJUH 3QFJB 4DKAA 1J0YA 4MJIB 4HPYH 4RIRB 4D0CB 1FNGA 4H26B 1J0IA 3ZTJG 4UINL 5L2JB 4GO6B 2DD8H 1NGYA 1QFOA 5I1LA 4NQXA 2NZIA 1G7IA 3FQXA 3KJ6L 2R2CA 4YHOL 3VE0B 1LE9B 1EHLH 5EO9A 3A67L 1XF5A 1RZKH 4Y4KC 3V0WH 4FQ1L 2F5BL 2E6QA 1ZLVK 3UXFA 4LVNB 3BUYA 4XC3L 3DO7B 4FQXA 1KB5L 5IB1B 4X6BB 1HXMB 1INQA 3BJLA 4MD5A 5ID0B 5JW4M 3O4LB 4CMMA 3SDAD 1VGKA 2VKWA 2VR4A 5C1MB 3C5JB 2BNRD 1T6WA 1RMFL 3QO1B 3SQBA 4XPBL 4G7VL 5JHDB 4TYUA 5FOBB 2CGRL 4UIMA 1FPTH 5D2NB 3SE9H 3OX8A 3JSSA 2OXGA 3AXLA 3QJFB 5IBLD 2HLFD 5FUOL 3FN3A 1A7BA 2YA1A 1PG7W 5FECB 4KKCC 1WZKA 5GJSL 3HG1E 4P3WA 1JZ3A 1YPZE 4KMTL 2HH0H 1IGMH 2ICWB 1DBJL 3SGJA 1ORQB 3NCMA 4JO2H 4KQ3H 5HHXH 3NBNA 1CYGA 2XA3A 4WEBH 4WY7L 3SGKA 4HUXA 2HWZL 1TVDA 2A74A 2XWTB 4K8RC 4XHQA 4ZUTB 2D0GA 2X7LA 1XGYL 4G80B 3S35L 3KXFA 4IJ3B 3AGVA 1EUTA 3QIUC 4D9LL 4JPKH 5FDWB 3V52L 4KAQL 4LCCC 1XF2B 4OB5L 5CLWA 4H8WH 5EWIL 5F44A 1EEQA 43CAA 1EA9C 1U6AL 5HY9B 4JM4L 3O0RH 2IPUK 4R2GB 4YDIL 4P4KB 5F7EH 3KWWB 2Y5TA 3GGWB 3BP5B 3QUZA 1TJHL 1NCTA 4M93C 1IFHL 4JRWA 5ADOL 3KPOA 1S7TA 3TYGH 5A2JH 4IS6B 3K74B 1HHGA 2QTEA 2QQLH 5CILL 2OTPA 2OTWB 3U36A 2OI9B 4R90L 2YD1A 2YKLH 3VWKB 4NQCD 1I1CA 3IDIB 1MCJA 4UILH 5DJAB 2AKRB 3DHJA 3RX5A 4Q2ZA 1ONQA 3RX8A 3FMGH 3MA9H 5MEOB 2VDPH 4X5XA 4WDIB 2IH1B 5KZCB 2R1YB 1B2WH 1IMHC 3BN9C 3W0WA 3CUPA 1A47A 2R69L 2MFNA 3NCBB 1R5IA 4HFWA 1EBAA 4LLMA 4X8JB 1IQWL 3BAEL 4QRUA 4ZXBB 4V1DA 5JA8B 1KIPB 1CE6B 2VB5A 2FEEI 4HWZA 3A6CL 4UI2A 1W0YT 4KUZL 3PWJB 3QIBB 5IGXL 1QFUL 1MHCA 1J87A 4JVPA 3VRJB 3WIIL 3M45A 3F6LA 4YE4L 4QXWA 5SWZE 4KTEH 1KN2L 3BPCA 2DYPA 1F3DH 25C8H 3I50H 4JZNA 5EZIH 3TA3D 5T3ZL 4Z7UA 5EU7E 4PUBL 5KSVA 5I30H 3CPLA 1KCUL 4LMQE 2WZPD 1KULA 1MWAH 4X6DF 1YMHB 4LVOC 5J11B 4GW1B 2AK4E 1P7KA 3MZGB 5DJ2B 1KN4H 4K23H 1UADC 3S37L 4JREB 1BOYA 4FOMA 5I6XC 2KBGA 3EZ8A 1UZ6E 4U1KB 1OP5K 3IT8D 2G2RA 2VISA 2GSIB 1B88A 4JM2F 4ORZC 3VD5A 1CICD 1FNAA 4HS6A 5TH2B 1AXIB 1BJ1J 5AWNH 1AD9B 2KUTA 2QSTA 4MXVE 3S4SB 3N9GH 5D1QC 4JZOA 5K9QG 4XMPL 3ILQC 3QYCA 1KFAH 2H6PB 1P4IL 2DS4A 3IJSA 4U1LB 4M7KH 1AP2B 3ULUC 1SBSL 2IANE 4K71B 4APQC 4ZDHA 5T3ZE 1JGEA 2V9TA 1H3XA 1JHLL 3MUGA 1P7HL 5CJ8A 3OV6A 3TGXA 1NFDE 1KGCD 4Y2DC 4DWHA 2EH7H 1D5ZB 3LHPH 4F33A 4UDUA 2NXYB 5HGBA 1MRDL 4LLUA 5D70H 3IRZA 1A7OH 4HAFA 3VW3L 4XHJC 5H35A 4Y4HA 3RWIA 3E1F1 1NGWA 3VXMD 2C1PA 3MRLB 4E5XA 2YD8A 1AE6H 2IC2A 3DXAE 3RX7A 2AS5M 1K85A 4HD9A 4DK3A 1EH9A 3T77B 3JV4A 4JO1H 4Y0GA 1TVBB 2GYSA 4OD2A 1BQHG 3CFBB 2ORBL 2AJXL 4JJHA 1RD6A 4LSQL 1WFOA 4JG0H 4OGXH 1LMKA 5DJCA 4NFDA 4RWYL 2YZ1A 3PGCB 4P46B 2GKIA 1FYTA 5T3XH 3S5LG 3UTSE 2V7HA 5GPRA 1CBVH 5F71A 3ULVL 1YEKL 3CFCH 3T0EB 3JTTB 1UXWB 3TBVA 4AT6B 5ANMB 4JG1H 2Q8BH 1EXUB 1HYSD 3ZKMD 1G7QB 3BDBA 1IM9A 4J1UA 4HIEA 3HE7C 2D7PA 4MMZC 3O4OB 1U3JA 1DEDA 1R3KB 3F12B 5E6ZA 5B39B 5T5NF 4Y5YB 3P4NB 3TH2T 2ZUYA 4NO0A 1K3IA 4NT6B 3GMLA 1EGJH 2EDLA 4Y4FC 5K93A 1UB6A 1R6VA 4XAKD 4NN7C 4C83A 3QUML 4I9WD 2A9MH 3JWOL 1RPQA 5E7FA 2VNCA 3IFPB 4IRJD 1VKXA 1IL1A 1G7PB 1Z0NA 1BM3H 4IRSC 3MLZH 1KB9J 1UWXH 4OM1H 1UENA 1UG9A 4M7JH 4XCNB 4R4NC 3IFLH 3F6IA 1Q9LA 3T1FB 3ARTA 3K2UH 3PL6A 3UO1H 3WE6B 3AU1B 4I0KA 1EK3A 2B1HH 4U6HA 3QDMA 2GTZA 4OFDA 5BRZA 2UZYB 3OKNB 5E9DE 5ALBH 1N5AA 3N1QC 1C08B 3EDKA 2V7NB 1GGBL 3LD8C 3QUZD 3NCJH 3GJEB 4ZTPL 1I9JL 1S7SA 4MSWA 1PG7L 4MA8H 2FIKB 3TVMC 3QWOA 1HEZA 4OGYL 4KK6D 4GRMA 3PABA 2IPKB 4HUVA 3WJJC 2R56L 4NRZA 2PYFB 5CZVH 4HGWB 4X0KB 5C0AA 3T65A 5HI4D 1BEYL 3FB6A 1HCVA 3RKDD 5IIEB 3RIFK 2IG2H 1M4KA 3GSQA 4UV4H 5DEGA 5J6HA 5C6TL 3OJDA 4XAWH 1OHQA 1N3NA 1YEDB 3W0WD 3BKYH 1RURH 4XXDA 2PO6B 4ETYA 1FFNB 4WEUD 4Z7WF 4KQ4L 4V1DD 5F1KC 2BNRE 4BELD 4ZNCD 3CFDA 1W0VB 4OLWH 2CLVA 4PJ7E 1CGUA 2E9IA 2DF3A 3UJJH 1CR9L 3INUL 4LHUB 2CDGA 3L3OB 3OMZA 1CL7I 3VXUB 1I7ZB 1FCCA 3MV8E 2JE8A 3ZHLA 2I60L 1DBAH 1HI6A 4DVRH 3IDGB 3OZ9H 3ROOB 4X6DB 4J2XA 3MO1A 1DE4A 5KVGL 4ZFZB 1RJLA 3VFGL 3IF1A 2NTSP 4MNGE 1FAIL 4PV8A 2RAMA 3QXAA 1A6UL 3BP7B 3HC4L 2HTKC 3VG9C 5D71H 4JM2B 1QFPA 3MREA 5I1CH 3O9WB 3BPOC 1AGEA 3GJFB 3A6OA 1F58L 4QWWD 5JNYB 1N59A 4WWKA 4L9LC 5BQ7B 1OTSD 4L8DA 5ICYA 3VFWB 3EYVB 4JDTH 1UKSA 1OWWA 1UGNA 3RZWA 4HJ0D 1H15B 1SM3H 3BYTA 3RA7L 1KCSH 4K9EH 4LIQL 3KLAB 1OAQL 4W4OC 2EO1A 2WK2A 3RGVD 3HC3L 5IW6A 1R0AH 2FX9H 4JKWA 5TE4H 4TSBL 2HFEA 2R2HB 3BIAX 3HE6A 1IC4H 3SEPA 4CBPA 4EDWH 5IFAL 3MLRL 4KU1A 4M1CC 3BISA 2IQ9L 4GKSB 3DMMB 3K4ZA 1NGZB 3AREB 4KHXH 4NQCE 5J3HD 4DKFL 3ALPA 5DMGD 5EBLB 1LP9E 4YHZL 1PZUB 4NQUA 1D6VH 1YY8A 1I7UA 4TTDC 1GVIA 3VXPB 3F5WA 1IM3B 4YK4C 3FO9A 4EJ1C 4LVHB 4Y4HD 3BRDA 5FDYA 3VWJD 3RTQA 4KV5E 1T0MB 4MB3A 5ICXB 4MYWB 4XB7A 1DQLL 3EOYG 4UNTA 4X98B 2IBZX 2G9HA 3JWDL 1KJMA 3QEUB 4ODHL 4X99A 2KZWA 3EDFA 1TTGA 5C9JA 5D1QB 3VD3A 1ZEAH 1MWAA 3HZVB 1YECL 1I8LA 1HHJA 2NX5A 4G8EA 4JAMA 3RJDA 4BH8A 3U4BH 1FSKB 1ACYL 1MFAH 4LIQE 1P1ZA 3CSPA 1CDHA 4OAWB 2GTWA 5A2LH 1I3GH 2ZCHL 4APQB 2DKMA 1FYTD 3WDHA 4Y2OA 1P7QB 5EA0H 1H8SA 2BK8A 3UTOA 3RVTC 3R1GL 4H25A 4G6JL 2FNBA 2FEEL 1I9IH 1IM9D 4OFKA 4JHAL 1MIEL 4QKXB 4DAGH 4ZFOL 4MA7H 5FB8B 4DZ8A 4PGCB 2ZOLB 3DIFA 4NQDB 1U8IA 2PTTB 5F88B 1MCBA 4RFOL 4FFVD 1VFUA 2Z4QA 5KTEH 1ODAA 1T0PB 5HGAA 4HDIB 4HK3N 3STZB 4NYLA 4FXKB 5ISZA 1ACZA 1OD7A 4O2FA 4NO0D 4PRDB 1Y18A 5FUZH 4YR6A 2H32B 5BS0B 7CGTA 1PLGH 4G8GE 3BD5A 1AQDB 1DN0B 5TQ0L 2J8HA 4FQLH 5DZNA 1BQSA 3EFDL 2A9NL 3HNSL 1WT5A 3OKOA 4I18A 2DLEA 5AUMA 4CU6A 3SBWC 1MCEA 1H9VA 5KSUA 1RZ8A 3MLSH 4XNMB 3OGOE 1BZ9B 3MJ8A 1G6RH 1OSPL 3GBLA 1IGYB 3ARBC 5KSAC 4WFGD 3RWEA 4ZD3L 1QHPA 3D25B 2Q76A 1U91A 1DDHA 3FB8B 1KT2B 2FGZA 3WN5C 1L0XA 5BJTA 1HKFA 3PL6D 1F4YL 2UYLB 2BSTB 2Y5EA 3E8UL 4OUUA 5GRUL 4CVXB 4N0FA 5IKCB 1RY7B 1I8KB 5JORA 1JHTA 5BRZD 1LGVA 5LKNA 1F90H 2IJ0C 3LN9A 1FGVL 4UUJA 3GSVA 3EYSH 5DK0A 1XH3B 5KVDL 1M7DA 1QRKA 3VXME 4LBEB 3DJ9A 5D7IA 3HMXH 2FLBT 1XGPA 4PRBB 4FNLL 2E8ZA 5HYQB 5L8LB 3O81A 4OZFA 4WW2C 3UMTA 5C0AD 2ZPKL 5HBBA 4F7PB 1DUZA 5KVFH 2F9BT 1K3ZA 5BMFH 1XGQA 1QOKA 4TNVK 4MQXD 1YEJL 4U6VH 2UY7A 4JGUA 3QNZB 1JHKL 2AXGB 3SDXE 1NGXB 1G7JB 4JKMA 4S10A 1V8HA 1AO7B 4X4YB 5H37H 3GMQB 3TBSB 5FCUH 3T4YA 4DGYL 1EGJA 1FORL 3MNWA 4M1DL 4JPVH 4Z7WB 2D03H 3BPLB 3NABL 1W72A 1H0DB 2Q6WB 2GJ6B 5MERA 3KYKH 1QZ1A 2W0KA 3D39B 1XF4A 4J8RB 1XAUA 2M2DA 4JFZH 3RVXC 3STLB 2VABB 3DRQB 4NFCA 4QTIL 5CEYB 4UDTA 3EDJA 5F8RC 2EDJA 3DGGB 4E42A 2PXYC 4IDJL 1CF8H 4XAKE 3ZT7A 3NCYP 3CU7A 3MRNA 4NKMA 4PJHB 4XPAL 1D5IL 2HTLD 3OKYA 4I9WE 1WFNA 3ECBB 4MJID 1KPVB 4DN4H 1KCKA 3ARDC 1PEWA 3MRRA 3E6FB 1KC5H 5JOFA 4Q9BA 3QDJA 2Y72A 3U48A 1JPTL 2DM4A 1OAZL 4HUNB 3PQYE 1JIBA 4YZFF 2W65B 3QQ3B 4OM0L 5IV2B 5MEQB 3B8SA 4WWKD 1I8MB 1I4FB 2EDBA 1NCDH 4PG9A 5HGHB 1QEWB 4XBPA 5AYUL 4P5KB 1P6AB 4FG6D 1P5VA 1RJCA 5FO7A 3T0DA 1ZVSA 4XP5L 4RFEB 4B0MM 3JUZA 3O3BA 3O4LD 4DJMA 3QIWC 2Z93A 1BFVH 4KROC 1RK1B 4LK4A 4JRXB 1XGTB 3MRKA 5DGQA 2XOTA 3UEZA 3HE6D 1BPVA 2V2XB 2JJTC 3BWAA 5C7XL 4DW2L 2BRQA 3H42H 2MPAL 4YFEA 4QHMB 1XZ0B 3Q5OA 3EJZC 4M6OL 5FYJU 1TMCB 4IIQB 2AJVH 4PJ9A 5J12B 5KS9A 2E27H 2DIBA 1EFXA 3B9KC 3RTQD 2FB4L 2AJSH 3W0WE 4O9HL 4BQBA 3P9LB 4QY8B 5B8CB 1V5JA 3ESVF 2R0ZH 5E6IC 1PW3A 1EO7A 1YUHA 5F7KC 3FQRA 4KKBC 1A6TA 3MLXH 4YUEL 2NX5D 1A7QH 3MPCA 3P11H 4KKLC 5F6IB 4ELMF 1AGCA 2HA1A 1B0GA 5DJ8A 5E2TH 5DDHA 4LGRB 4YWGH 4KRPB 5BXFA 1OP3H 5HHQA 5E8OA 5LGJB 2ADJB 3HUJE 4FXGA 2GSGA 2JF1A 3AM8A 2X1XR 2NY2C 1HWHB 1H3GA 1K5NB 2VLKA 4K07A 5CMAB 5C0RL 2DWDA 2B7DT 2A73A 5GS0C 5DMYA 5F1IA 2DLFH 1AGDA 2CIIB 4HF5H 2Q20A 4NNYA 2ICCA 1I85C 5DWUL 3TBWB 2ATPB 4R0LA 4XMKH 3KGRA 5KN5B 4WI5A 5ISZD 4PGEA 5LAXA 1HNGA 2MCG1 2WUCL 1NUFA 3OB8A 1U8PA 1LD9B 1A3LL 1CT8B 2X4RA 1F3JA 2CMRL 3K4AA 1FVEA 1IQDA 2YK1L 2DBJA 5JR1H 2FRGP 3HPJA 5F9JB 1HINL 1CLOH 3C6LB 4LSVH 3AFLA 5I75C 2NCMA 2N4IA 5EC2B 3BKCL 5JW4Q 3DUSB 1IARB 5TDPB 1FZMB 2DQFA 1MELA 3TCXA 1Q0YH 3AUVA 5EO1B 1XEDA 5EPMA 4OJFL 3EYQD 4L8BA 4HGKC 1K9TA 1KTDB 5KJRL 4JDZA 3VFPB 3OL2A 5I1HL 1WJ3A 3GKZA 1JYWA 4ZOCA 1TZIB 2AJYH 4I0CC 4DKEH 2GFBA 5HVGB 4O2CB 1JVKA 3QUYC 2FBOJ 3L5WA 4HQQH 5C2UB 2J8UF 2BNQB 3SY0B 5JMRA 1RULH 2A77L 2C1OB 4HIXL 3PUCA 4NZUL 3CSYB 4TSCH 1KJVB 2Z35A 4M6AA 3GBNL 1BHGA 4UTBL 2FJFA 3DYMA 5T3XD 4PG2A 2BVYA 1SEQH 5CJQL 1W0WB 2B1AH 3RIAK 1YYMH 3DI2B 3NFNA 5EU5B 4I3GA 1GL4B 4F15C 1QKZH 1WBZA 4LKCA 5HI5C 3GSXB 1QSFA 3ZYZA 4TSAH 3AB0B 2A1WH 3IKCA 5SV4A 5ETUA 4EOWH 3B43A 3BYYA 2R2EA 3OAUL 3QPQC 1EHXA 2B5IC 1GAFH 2SEBA 5F7NC 4MJ5A 1DUYA 5FK9B 4KK5D 1ZK9A 1GGCL 3ARQA 4LQFH 4G6FB 3QJHA 3ROLA 4F58L 4WHCA 4ZODA 5C0EA 5TF1L 2FWOB 2F74A 2HN7A 3FRPG 2W92A 5JUEH 3OXRA 1FGNH 1RHHB 5C6WH 1E4WL 2GK0B 4K3JL 3IJHA 3MOQA 5C92A 4PYHA 1YN7B 1VPOL 1EHLL 4RDQF 1PJ9A 3R0MA 1RZKL 5GGRB 4PLNC 1FLRH 3GSUB 3VXTB 3F7RA 3QULA 2D7TL 1G6RA 5FYKU 1T3FA 1IGTB 4LLWB 4N8VG 3G5YB 1A2YA 2WP3T 4Y5VA 3FQUB 3NCEB 5IF0A 5DVLA 4M6MH 1QSEE 5T1LB 1J8KA 4P49A 4OV6F 4NHUA 3D85B 4ZAKA 3MSPA 4H20H 2R0WH 3N06B 5SWSD 1OAYH 2ZG2A 5J7CC 5I1DA 2J4WH 4S1SL 2IF7A 3HRZB 2LE9A 2BMKB 3NCFB 1MLBB 3QDJD 1Z9MA 3IDJA 1SJEB 1W2KT 2ZUQC 3SE9L 3RL1B 4Z95H 2ID5A 5DQJB 2A6IB 4DQOH 1CQYA 1JTTA 5J1TC 3PWLA 2ADFH 4YDKL 4P2OC 2OK0L 5JO5B 4HH9A 5L0QC 2HH0L 4HIJB 5BRZE 2CSPA 1XIWC 2D9CA 3C8KA 3ARWA 4KGJA 5GQBA 1J86A 4QNPF 4JO2L 4KQ3L 4EXKA 4JHZA 4S1DC 1ZWIA 3MLTB 3T0ED 4DZBB 3N85H 3DNKA 2D9QB 2OQJA 4U1IA 4OCRH 2BVQA 5IK3B 3CDGB 4WO4B 3EIFA 1EAPB 1FG9C 4PRHD 4EIGB 5IG7B 4N9GB 3LIZH 3MV9D 1N7ML 3KLDA 2C9AA 3T8XA 4PJAF 2J6EH 4H8WL 4MCZB 4Q6YA 1YA5A 2XKUA 5F93C 2APFA 4PJ9D 5CEXA 3O8XA 4ONGH 2QLVB 2BZDA 1A8JH 5F7DA 4G43A 4U1HB 3R06B 3D3VA 3N1GC 3MRPB 1X44A 4O02H 5F7EL 3QDHA 4QRPA 1PZ5A 1C5BL 2QQKH 2D3VA 3TYGL 2IPTL 4U2ZA 3G5ZB 4WHDA 4XP4L 2QQLL 2PUQT 1FIGH 4EI5C 1FL5A 5EZOH 2OTUB 1ZLVH 4PRPA 5D96C 5DMIL 1Q0XH 4RRPA 2NW2A 3GSRA 2YKLL 4GXUN 4MA1C 1JYXA 2D4FA 2E9BA 1CZ8L 4UILL 3U0TA 1IVLA 4O58H 1OP9A 1SJHA 3FMGL 3Q3GA 4YIQB 1J0KA 1PX3A 1JPGA 4DGIH 1B2WL 1DLHA 3HZKA 4PIRF 1JNLL 3HCVA 3IFOA 1B6DA 5FF6A 1IKFL 2VLKD 2Z91B 1CFTA 3ZTJH 5KVEH 5EOQH 4EN3C 1SYVB 1G7MB 3SKUD 4HGMA 4MHHI 3QFJE 4MJIE 3LVEA 3SO5A 4AENA 2XKSA 3MFFA 5F89B 5C09A 3RL2A 3B9KB 4OLVL 1MJUL 4KTEL 4XNZC 1IGFH 5EZIL 4XVUD 4DGVH 3KYMA 5I30L 5E6IB 5J1AB 1MWAL 2WNGA 3UTZB 2EH8H 3WNMA 1XGUA 1N4XL 3G6JF 4K23L 1M6OB 3WFCH 2IQAB 3O4LE 2BOCB 3RVVD 5BVPH 3C2SA 1XR8B 1CDYA 4HHAB 4KKAC 3FO1A 3LH2H 3MCG1 3QNYB 3LEXB 1NLDL 5E95B 5ITBL 3MV11 4UOW1 4QO1A 5D2NE 4OZHF 3MOBH 1NBQA 5B4MD 5C0GB 1LDPH 1MUJA 2Z8VC 2X4QA 2AGJL 4QXGH 3UDWC 1G9MH 1F6AA 3O45B 3E6HB 3ZE0E 4U1NA 2DI9A 2WBWB 1KFAL 3MCLL 5A2FA 3AVEA 2J8UB 1U95B 5LWYL 2CUHA 5TQ2H 3QDGB 4XTRD 4NZDA 4M7KL 4XPGL 4YEFA 3FT4B 5K9KA 1TZGH 4EQ3A 1OSZB 4ENED 3ARGC 1BVLA 4HLZG 2XXCB 4Z0XA 3WLWD 3NCCB 1QSFD 2LTQC 2RR3A 1U92B 2DN7A 2NX5E 3BIKB 2A6KB 1M05B 4RBPK 4R96B 3UBXA 4MLSA 4ELKB 2AV1B 2VXSL 2OP4L 2VWEE 5D7SH 5I1IH 1BIIB 5KSBF 2DBLL 1TLKA 2X70B 4TQEH 1AE6L 1RJYA 4PBXA 1RSFA 5E1HB 3VFOA 1Q9WB 3FFDA 5GRXG 1YZZA 1JFQL 4POUB 4JO1L 4GJTB 3QUYB 1S7UB 5IM7A 2OM5A 1BBDL 1BZ7B 2FYYB 1U0QA 5CCKL 3LV3B 1CE1H 3DTXB 3C5ZC 1EPFA 4JG0L 4JO3H 1T2XA 1JNJA 1G7LA 1CQKA 1NJ9A 3ARED 5ISZE 1HHKB 2X09A 2YD6A 4JHBA 1FHGA 5T3XL 4R7DA 4KFZC 1H5BC 3F58H 3GK8L 5E00A 4WEMB 2WIMA 3GKWL 1LO5A 4WV1B 1CFNA 1VEOA 3CFCL 4QRRA 4JG1L 2Q8BL 4ZAKD 1UVQA 4PJFE 3PWNA 2FHCA 4KJWC 3JTSB 1CTOA 1Q9OB 2B5IB 1G9EA 2W9EL 1U8HB 2F54B 3UROR 4GT7A 2WV3A 3H3PH 2Z31B 3TYFB 4ZUWA 4GG6A 4YFLF 5TGBA 1TVHB 3QCVH 2DM2A 1EGJL 3RUGF 4MDIA 4YHYC 3D18B 1T89C 3VFTA 5EOCL 2KPNA 3TN0B 2A9ML 2YSSA 3CIQA 5AZ2H 5GRVK 3BO8A 3ELAT 3ORJA 4HSQA 3EGSA 4H1LB 1P4BH 4KK9D 1OT2A 1T2JA 4R4BB 3S3PA 3HNVH 1T7VA 5T3XE 1T4KB 3QHTC 2P5EB 3OQ3B 4OM1L 2AEQL 2HKHH 3IFNH 4M7JL 3IFLL 5JIHA 1N6QH 3X13A 2QHRH 3K2UL 4WGWB 4L3EB 5DS8B 1VFOA 5JPMA 2F15A 3O8XD 5HD8D 2HRPH 2VL5A 4MMXC 1NBVH 1ES0B 2FECL 3S7GA 4ESKA 5EH1A 4ORGA 2VLLA 3L3KB 5DZOA 3CFJB 4QRPD 4H0GA 5IVXE 2ZSVB 3LSOA 2P8MB 4QYOB 3NIGF 2IGFH 1S78D 4LLQA 4LLYA 1XR9B 4PJ8B 3R8QA 4LHQB 4PRPD 5D7JA 4FRWA 1J1XL 4NDMB 5L0QB 3BVNA 3RWHB 1XIWB 5IBUB 3FRUB 3QBTB 3QSKB 4HULB 3MR9B 5E8DH 4TNVF 4RMVA 5T33L 2JTDA 5C0FB 4FQJL 3NTCH 2IFFL 2IG2L 4YBQD 4OFYA 5B21A 1WIUA 1DCLA 2DQTH 3W9DA 1IBGH 1MHHA 3RRQA 3CJJA 1YNKH 5TE6H 3NIFE 1WGOA 3KYNB 3GMMB 1AXSB 5SWSE 3ZO0A 1T5XB 2EDYA 1PQZB 1BFOA 3WEXB 1I9RH 3LKPB 5KBNC 3BE1L 4JFPA 3GMRB 1R5VB 4MX7A 3UBXI 1CFBA 4GAJL 4PD4K 5C07A 3WL9A 2XI9A 4L3CA 3W82A 3THMH 3BDXA 2GW5A 2JB6B 3SKNA 4KTYA 1DBAL 2X4SA 5I1JH 4H1LH 4PY8J 1G7HA 4R8WH 5IMLB 3OZ9L 4J4PA 3UAJD 4EI5B 4L3AA 5SWQA 4QRQA 3GFUA 5D72L 5I71B 3G6JB 3WBDA 1L6ZA 2K7QA 3OHXA 3LKSB 3T0EE 5DSCA 3NIDF 2FDBP 1A1OB 2CUIA 2D31B 3ARUA 5HHMB 4WTXA 1UZ8A 3UTPD 5I1CL 1IEAA 3MLVH 4PRHE 4QRTA 5SX4H 1I1FB 2BC4B 3MV9E 3O2WL 4GAYA 2FD6H 3L7FA 4Q0XH 3H8NA 4O51B 4M7LT 4YO0A 4OZHB 2R1XA 1FO0H 4MAUH 4PP1C 2F5AL 3TT1L 2P1YA 3H9SB 3BT2L 4B7IA 5IR1B 4JDTL 1D9KB 2H8PA 3B5HA 1SM3L 3IYLW 2NY6B 3DX7B 4UQ3B 5BZDB 1KCSL 2FX8H 3IU3A 5J0BA 1CGWA 4F37F 4MS8D 3FT2B 3CH1B 1BVKA 3LB6D 3TZVC 5INDA 1YQ2A 5JDSA 5BV7C 1KF9B 4M61A 3L3HB 3S3JA 5HSFA 5J13C 2Q87A 5IFJB 3CMOH 2BP3A 5K9JL 5TE4L 1A4KA 3DETD 5GS3A 5DURD 3HAEG 4XZUA 5EN2A 3PGDB 1ZHBA 3MROA 5GS1A 3L1OH 1Z9SA 2ARJA 4MD0B 3QPXL 5EUOA 1ADQH 4FQQA 2ATKA 2IAMB 5J6GA 1D6VL 4LNVA 2E7LA 3L6FB 4PRAA 3ZKXB 1WVZA 1OAKH 3K0WA 4GW5A 4PJXA 1U8QA 1KXVC 3QQ9D 4F7MA 4Y19A 1MCKA 4KDTA 3UZVB 4F3FA 2FL5B 1NEUA 2VLKE 5A43C 5JW4R 3MV7B 2E9WA 3KR3H 5ENWB 4FA8A 4GBXB 1ZEAL 1Q94A 1WC7B 4NM8H 1L9NA 4Q6IC 5L2KB 3CVHB 1CD1A 3CC5B 2A6JB 1CGXA 3V6ZB 1R5WA 1VFBA 1PEZA 1S5IL 2C5DC 3Q48A 2EYTA 4KJQC 5CZKA 5EA0L 1T66C 5JW5B 2VLJB 1NMCB 1X4YA 4QRRD 3K46A 4PYGA 1OGAB 4PJGA 1JZ4A 1TQCC 1ZA3B 1I9IL 4RGNB 1O7VA 4MVBC 3W9EA 4MA7L 2QADD 1IGIH 2NY1C 2P43B 5I8CB 1L7TL 1EVUA 2EYRB 4L29B 1T1XB 4DOHE 1JPFA 5HJ3A 3O6KL 1WISA 1SHMA 4G6AC 3VH8B 5KTEL 1D3CA 1PSKL 1A0QL 4K7FA 1E6JH 3DX9A 2HJFB 3BMVA 1I7TA 1F4XH 2P7TB 5ICZA 4MXWH 5FUZL 4LU5H 2VH5H 3RUGB 3MBEA 4KRPD 4JRYA 1PLGL 1QLRA 3VXUE 5D6DC 5IB5B 3FAXA 3SN6N 3CFEA 1JNNH 4Z77B 2Y7QB 1A9BA 5ID1B 4X6DE 1KCRH 3V5DA 2FHFA 4MNQA 1G6RL 4NJ9H 1FL6A 2IH3B 3RWDB 2H9GB 3WFDH 4P23A 3QI9B 5C0BB 5IWLA 4S1RH 4ZYKB 3G5VB 1ZLWK 1FFPA 3SJVB 1BREA 3RWCB 3V79C 1JN6A 4QHNA 2YMXH 3IU4L 2F8VA 3K1KC 5CP7A 4PPTA 4MAYA 5C0CB 2V5MA 3ARSA 1U3ZA 5DJ0A 5F7HA 4LL9A 1F90L 1GOFA 3IDXH 3LOWA 1JWMB 1TENA 4XNQA 1JF1A 1P5UA 4LAJH 4EVNB 1TJGL 2GK2A 4I48B 3WXVH 2VITB 5GRJH 4C55A 3CVHH 1A7NH 3VE0A 2YHGA 2Y6SC 3BQUC 5HHPB 4RMUA 2EC9T 3BDYL 5CS7A 5EU7C 5D7JD 1X9QA 4E41B 3P3YA 3DX6A 3MZTA 1FZKA 2K7PA 4NKDB 5TDOB 3SDCC 3ARPA 4IOSD 5BMFL 4C54A 3QT2A 4Z7OF 2WQRA 3C6SA 2DOCA 4U6VL 4AY0A 5DR5L 1CS6A 4OFYD 3W11C 2HLAB 4ETQB 4UU9B 2XXMB 4G6KH 5CKGA 1K8IA 3ARFB 3P0VL 2A0LC 1A5FH 4L4TD 4NRYB 2APBA 1QRNB 1MCLA 4N8CH 4AIXA 4JPVL 4C56A 2D03L 1F4AA 2YZ8A 4K8RH 1TQBB 3BKML 2LVCA 3KYKL 4PJEF 3SE3A 1DQJB 5C07D 4JFZL 3V7AG 5DK2B 1QACA 3S34L 4CNIA 5EU3B 4ZS6D 1A7PH 1QO3A 2OSLB 2ICWA 3M07A 3TV3L 2MCPL 3QUXB 4J4PD 4ZO7A 5F97E 1CF8L 4PV9A 2RCSH 3VH8G 5E8NB 5FO9B 1I1AB 4NHCH 2XPGA 4G6FD 4OCNC 5DO2D 2OYPA 2XTJD 4U7SA 4H88L 4NUJA 4NCDA 5TDNB 3REWA 4BSWA 4KZDH 5IBTH 4DN4L 4G80A 1UXSB 2BVOB 5EOTB 4JY6B 1KC5L 1J8HA 3D1MC 1AR2A 3IJYA 3RDTC 2OBGA 4L4VB 3RWFA 2N56A 4TUJB 4FQIH 4YPGA 2H2SC 1IZKA 3IVKA 3TFKD 1LEKB 3RKPA 4PJ5B 3TP4A 2F8OA 3MACL 4J7RA 4MXVF 2X05A 3REVB 4MDJB 2A83A 3DWTA 4R6UA 1I7RB 2X4NB 3EO1A 3RZCC 1T03L 4PJBA 1I8IB 2AJ3A 5H94A 3BZ4A 3LMJL 1BFVL 3P30L 4JFEA 4DUXA 1FRGH 5A2KH 4BZ2H 3I6KB 4QRPE 4NRXB 1RJZB 3C8HA 3WKMH 2I5YH 3QO0A 4NWUH 2JJSC 5GSRA 1RUMH 4U1MA 3H42L 4PRPE 5D1ZA 4UQ2A 5IFHL 3Q6GH 4D8PA 3KJ4C 4I4WA 1ZAGA 4X6EB 4KRNA 4G8FB 4UT6L 4B41A 2IH1A 3HZMA 8CGTA 2AJVL 3O6FC 4GS7C 3DRTA 2XNAA 1RZFL 1IAOA 1BQHA 1GZPB 4YX2H 2E27L 3V8OA 4HUMB 4RAHA 1E27B 2AJSL 4YPJA 2UUDH 1MH5A 4YDVB 4Y19D 3OGCA 4L1HA 4I77H 3LRSB 3S5LA 2DIAA 5DC0A 4PGBA 2R0ZL 5D4QA 3UC0H 5C0DB 2ZWLT 2V5SA 1NAKH 3C09C 2ICEB 4NQVB 2P49B 4RCAA 3WUWB 2DIJA 4Z18A 4CUCA 2VKXA 1HH9B 5D1XA 3P11L 1NDMB 4XWOD 5A2IH 3Q6FA 1CD0A 1V3KA 5TFSH 2XIDA 5E2TL 1E4KA 1SMOA 4ZPTA 3HFML 1UJ3C 3A0OA 4UTAH 2VXQH 5EZJA 3WS6A 4QHLB 4PJAA 4LOUC 4ZTOH 2EEDA 5J13B 3X11A 3I02B 1U8NB 4PR5B 4PTUB 4W70A 4Q9CA 3GUTA 5IQ7H 5EBMB 1OTUC 4EUPB 1EX0A 5HHVL 1FO0A 1IGCH 3OG6B 2BOBB 4Q74A 4XRCB 1JGUH 2P44B 3OKDB 1AO7E 4BQ8A 1T04B 4JFHD 3WDIA 2ERJB 1Y0LA 3DBXB 1FZJA 4HF5L 4Z7WE 2PYEB 3S4SA 2YUVA 2Y1VA 3HB3C 4LCYA 3Q2CA 3GMOA 2GJ6E 4M6NL 4X6CA 3S9DB 5E4EC 1DVFB 3L3JA 5FAAA 3MODL 2ESVA 4HKBB 4X9BA 2BY1A 1YY9C 1ZT7A 4L8CA 2H6PA 3PWPA 3MBED 5C9KA 1U41A 4U1LA 1TPXC 3WFHA 1JZ5A 4OCSH 3E3QE 2WUBH 3W39B 3H6JA 3H7BB 1CLOL 4LSVL 1EERB 1YNTB 1F8TL 2EECA 5ALCH 1BLNA 3QB7C 1UEMA 3L9RB 3GIZH 1Q0YL 1YJDH 3NN8A 3WHXB 4P23D 4DFIA 1MLCA 1G1YA 5KG9A 3O6LH 1D5ZA 4X5WA 3GZKA 2KH2B 3OKKB 4N0UA 1KB5B 4QF1B 3QWRA 4MAYD 3ULVF 2ITCB 2AJYL 4Z5RB 3IS1X 5DRZB 4DKEL 1IAIH 1OF2B 1QBBA 1S9WB 4YLQT 1QFHA 1J5OH 4BSVB 4FTVA 5K9QI 3H0TB 1RULL 4UNUA 3C5SB 3Q5TA 1VADA 5CSZB 1MREH 5I74C 3U30C 3HLAA 1U42A 1KIRA 4N1CA 2EEAA 1SEQL 2EDTA 1YYML 1T1ZB 3TPUA 1JI1A 3KPPB 5IBLC 4FABL 5E5MB 1QKZL 5FGBC 5KANG 4JRXE 2MQ3A 5I8OH 4PJCA 1S7XA 4QEGA 3LKQA 2A1WL 4EOWL 2HJKB 3IDNB 3O41B 5EG6C 3SE4C 2ZUWA 1NCWH 1XGRB 4EUPH 1UXWA 1RZGB 2BCKB 4ODSL 5ANMA 2ADIA 4FQ2L 1G7QA 2ZZUT 4P59L 3VJ6A 1IAIM 2XRAH 1NMAH 4WRLA 3QHFL 4ZOAA 3DI3B 4QRRE 5CD5C 3IETB 5JUEL 4GRLC 4HJGA 3U4EB 4J3VA 3FN9A 4C56D 2DAVA 5I1AB 4G9DB 3L3DB 5EIVA 3DVGB 1RQ5A 3OJMB 5F9DC 3BEVB 4PJDF 4NCC2 5HDQH 5IVZA 1ZHNA 1X7QB 4NT6A 3O2DH 2FO4A 1FLRL 4UINH 3MUHL 5FGCE 4K2UL 4GG6E 3MRMB 4OKVB 1HQRA 2HT4C 3P4MB 4YHOH 1CFQB 3BQUB 4GXUM 4M6ML 3NFSH 3V4PH 2P48B 2MTPA 1RFDL 1I3RA 5KSBA 4Y4KA 3OR7A 4H20L 4K3DH 4UAOC 2F5BH 2R0WL 4U3HA 1N5YL 2RB8A 1C12A 3EYOA 1KB5H 4BFBD 5EIIB 2MNUA 4YXKH 2GEEA 2J4WL 2P42B 4I13B 1J8HD 1HSBA 1JWSA 3FOLB 3BRFA 3BJ91 3GRWH 3WE6A 3AU1A 1TTUA 1T5WA 4LKXA 4RFNC 3TCLB 5ACMA 3OXSA 3U1SL 4YHNB 2XN9A 2M1KA 2HG5B 4RZCA 3WSQH 5SX4I 3EYFB 3SDYL 2ADFL 3RAJH 4XPBH 5MP6H 4G7VH 3EOBA 1Q9KB 1FP5A 2V7NA 2CGRH 2AXFB 2WW8A 2ITDA 3ETBF 1ND0A 2CK0L 4P5MB 3BSZL 5DJXB 4QCIB 2APWA 3N85L 4JFED 5FUOH 3RVUC 3ZYJA 4U31A 2EE9A 4OCRL 5F1SA 5GJSH 5I76A 1MJ7L 4KMTH 1DBJH 4P2YA 2R29L 5IHUH 1AY1L 2ZCLH 3UTTA 5D1ZD 4F7TA 1F6FB 4AEFA 4XNYL 5LJYH 1K4DB 4WY7H 4MQTB 3MJ7B 3QA3B 1MVUB 1XF3B 1YEDA 1LE5A 1U8KA 2IADA 3MRFB 4ONGL 3MUZ1 3S35H 1U8OB 3RFZC 2O5ZL 4J23A 1U3HB 3BGMB 1LP9F 3QIUA 4PLJC 2DDQH 4F8QA 2AI0L 4LCCA 3V52H 2WINB 4K94C 2BNQE 1JZ7A 2NTFA 4WU5A 5GISL 4L4TE 3TO4B 4P5TB 5HYSG 5IB4B 4P3DB 1S7QA 3U7WL 1B90A 2V2TB 3JWDC 3DXAB 5EZOL 4WNQB 4JM4H 3T0BA 1Q0XL 5D1XD 2WWMD 4U6TA 5EO0A 4OZIF 4JLRB 5ABDE 5INCB 3V95A 1T1YB 4XBEH 4D3CH 2HJLA 1KJ2A 5C07E 2GJZA 1T21B 1IFHH 3QEHA 4NQEB 3FB5B 4O58L 1AHWB 4PRIA 4CVUA 5CILH 3F7VB 4KRMB 5MI0C 4XX1G 1CVRA 4ZFZA 1LNUA 4DGIL 4Y5XB 2WBJC 3QRFM 3UTSB 3NZ8A 4RQQA 5EOQL 5E6YA 5EORH 2X1WL 3U6RA 4L8SC 1OB1B 2CRIA 1TFHA 5HPMB 4XH2A 5A3IC 1R3LB 4CL7A 3GJFA 3P4LA 3JV6B 1HDMB 1UFUA 3E0GA 3UYRL 3QH3A 1CK0H 2E9JA 3U9UB 3C60C 3DGCR 1BMGA 4RAUA 2ESVD 3VFWA 1BD2B 1IQWH 1IGFL 3KPNA 1PY4A 1YEFH 2OJEA 2VQ1A 3PWPD 4LEXL 4QRSB 2WIIA 1S9KC 3IDMB 5EBWB 1FIEA 2EH8L 4YE4H 4XMLH 4R7NA 3ZE1F 3WFCL 1AIFB 3QQ4B 3FQWA 2R2HA 4PUBH 1FNHA 3JWNC 4QHUA 5BVPL 5I17A 2CO6B 1KCUH 1T20B 3CNKA 4R97B 1KPUB 3LH2L 2W60B 2VAAA 1WAAA 1CG9A 1U8LB 3QWRD 5GZND 5D9SB 4UBDD 1B0WA 4HZAA 3IDUA 1RHFA 1CXIA 4NJAL 3PV7A 5D5MA 3VFUA 5JOPD 5T1KB 4LAQL 4YZFE 3AC0A 4JEGB 3SKJH 1G9ML 1HYSC 3ZKMC 1JPSL 4FTVD 2W9DH 5CIPH 4U7MA 3KPMA 5D1QA 4Y16C 2DM7A 4JCMA 5E9DB 1TZGL 1ZHLA 3KDMB 2X9WA 2I25N 2EE6A 4XMPH 2FJGB 3RWJA 4U7KA 3FQTB 1P4IH 1E4JA 3GHEH 3PXJA 1T7WA 4RGMB 1HHIB 2ZOKA 1A02N 4HUUB 4X4ZA 1OGTA 2YS4A 4NIKB 5E99L 1SBSH 1MFEH 4IMKC 4APQA 2E7HA 2EZ0D 3QUMB 1IC7H 2Z8SA 5I8EB 1LO0L 1RZIB 4IRJC 5CGYC 4Y2DA 1KLUA 4NBZB 3SDDC 1HOCB 2BERA 1JK8A 3V5KB 3ZDYF 1UWXK 4W81A 1ZT1A 4NQDA 4PJGE 3DVNA 2PTTA 5CINH 2NY5C 4ONHA 3WIHA 3SDAB 4ZFFB 1KLGA 4YFLI 2BNRB 4PJDB 1AD0B 3DPBA 5DQ9A 5E2JA 2HP4A 4WTWA 2EC9U 1JUFA 2R4RL 3BH9B 4OLUL 4NO5B 5K59F 5I74B 4ELME 4NQSA 2NXZD 5I66B 1OAUH 3FAWA 2G60H 2AJXH 4XNMA 3DV6A 2OR9L 4Y4KD 3IXAB 1D6EB 1RUAL 2WBKA 3D25A 43C9B 1S9YB 2CIKA 3R8BB 4JFDA 5E1AB 3SKOB 3FB8A 2W0PA 1KT2A 5D7KD 1A3RH 1EEZA 3ULVH 4NZRL 1F3RB 4FS0A 4MNGB 3PDOA 5SX5H 3H3PL 1K4CB 5DMKA 2XN9D 2EE3A 2NZ9C 1F02I 4GG8B 2AEPL 3HE7A 3MUJA 4YGVB 3SOBL 3FOMA 5IP4A 4BA8A 3BZEA 3SQOL 1QBMH 2F58L 4LGSB 1Z2KA 5L9DL 5E2WH 3VFNB 4LBEA 4HXBH 3VCLA 1RU9H 5EB9A 4I5BB 3B5GA 2VLJD 4BFGA 4AMKL 3KNBA 2I9LB 5HYQA 4J3XA 3NGBC 4KKCD 3QXDB 4Y4FA 1QLFA 1YEGL 4HXAH 3NMEA 4ZUSA 4HMDA 2HKHL 3IFNL 4GW4B 2VZOA 4RBPH 3UTTD 3WS3B 2LU3A 2QHRL 3JWOH 4AIZA 1F00I 4IRSA 3O3AA 4WJ5B 4K8RD 5FYLD 4KDWA 4JFQB 3QZWB 4CAGA 5JW3L 3Q0HA 3QIUD 4NQCB 3FO2A 1LP9B 3O2DA 3SKMB 2GT9B 5DXWA 4BH7B 5DUPL 5MHSE 4NSKB 3V6OC 3LN5A 4RA3A 2Q6WA 2YC1B 3DYPA 4NC1E 3G6AB 1CGVA 2IGFL 3TBYB 4QWWC 4FQPA 3T09A 1OTSC 3V8CA 1GGBH 3QG6A 4OZIB 3TESA 4QOKA 4NCC1 4EBQH 7FABH 3TVMA 4F2MB 1AGBB 3EJYC 5E8DL 3BZFB 1JI2A 2CR3A 3CVIH 1KXQE 3NTCL 2ADGA 3WJJA 2BX5A 4JANA 1ZVHA 4YNYB 3RGVC 1RZJH 4LCWA 4D0BB 3WDJA 4X7EC 5D93B 2DQTL 4Z7UF 5IVNA 3TA3B 2FR4B 4NWTH 1YNKL 5TE6L 4JFFA 2EO9A 1PAMA 4OZGA 2G75B 5T1MA 2IBBA 1ULVA 3PHOB 2E5EA 1P2CA 4DVBA 4A6YH 3BN9D 5EU6A 3QQ3A 1I9RL 3LKOA 3WCYA 4NBXB 3P9MA 1F2XK 2DQHL 4YBLB 2QR0A 5CEZH 1SEBA 3VWJC 1CICB 1FG2B 5I1JL 4R8WL 3VI3F 3MRDB 1N0LA 1CR9H 1NDGA 4WUKH 3RI5K 3KPSA 3QUKB 1XGTA 1XMWA 1NBYA 4JFOB 4EQ2A 2QJDA 2YD5A 3JBG7 2I60H 4NZTH 3EFFB 3BOVA 4ODXA 1XCTA 4GKZA 4ZG1A 1ERNA 3K80A 3MC0A 3MLVL 5KVGH 4M8QB 1LEIA 1Z5LB 3X14A 3KLSA 3RVWC 4Q0XL 3VFGH 3FO0L 1S3KH 3MXVH 4PJEA 3BEWB 1FAIH 1FO0L 4MAUL 1U93B 4XCEB 1CTNA 1A6UH 2YEZB 4KGLA 5DEFB 3I9GL 1IAII 5HGDA 1BFSA 1Z6JT 1T1WB 4F57L 4ZFOB 3UP1A 3P73B 4L9LA 1OPGH 5F1NA 1QA9A 3SCMC 3M8OL 4YHLH 4QNPE 1QQDB 2X4PB 5GS0H 1GC1C 3CMOL 3ILQD 3VXMB 4KZEH 1KTKE 3ULSA 1FNGB 3RA7H 1EAJA 3ULUD 3L1OL 2NY3C 4W4OA 4ALAH 4L4VD 4I0PC 2EDWA 1NGYB 1ADQL 5I1LB 4NQXB 5LGJA 1G7IB 2ADJA 3FQXB 2JCCF 4TSBH 3SO3C 4L3EE 1JCKA 1TITA 5EO9B 4PJAE 1XF5B 2OJZH 1OAKL 1WWWX 4Y2DD 3MLRH 2VIRA 4JQXC 4CVZB 2IQ9H 3BUYB 4U0QB 5IESH 4LLAA 4N8VA 4YHZH 3BI9X 5M94B 2WP3O 1INQB 3DUHA 4MD5B 3H9HA 4NP4L 4YDLC 1SVCP 3NH7H 1IAKA 1B6UA 2VYRE 4CMMB 1VGKB 4JZJC 4WUUA 4DEPB 3BH8A 3TIEA 3DX8A 3SPVA 4I2XA 1ZV5A 3ZKND 4ONFL 2ESVE 1TZHA 1MY5A 4HUWA 5DT1L 2C7UB 4UIMB 4PB9L 1GCFA 1AXTH 5JDJA 3F7PC 3PWPE 3EDDA 3AXLB 1CFSA 1VGEH 1NAMA 2UWEA 5EO1A 4JQVC 2EE2A 1OW0C 2ZCHH 3LKNA 3LN4B 4OBSA 1KTDA 4JFDD 1IGIL 5F9WC 1ETZA 5CIPA 2NLJA 3KG5A 3R1GH 5GGVH 2Q3AA 4P9HC 1WBXA 3I6LE 2A74B 1E6JL 4P57A 4ZS7H 1BQUA 4JHAH 2X7LB 3HE7D 4MXWL 2NY7H 4JVUA 3EJJX 3KXFB 2VH5L 2BVPA 4HT1H 4WTZG 3GB7A 3VDBA 3JUYA 5TPWH 4FTVE 1JNNL 4LSPH 4LDOB 5FKPB 1KCRL 4ZMAT 3G6JE 3B3IA 3PWUA 4NJ9L 3AS3A 4JGJA 1EMTH 3GSXA 3WFDL 1ZANH 5TQ0H 3TNNA 3WHE0 4S1RL 3QUZB 2Y5TB 4I3SH 5BOZG 1DBML 2A9NH 3HNSH 5HYJA 3SBWA 5HHME 3KPOB 2NY0C 1F4WL 1KENH 4IRSD 2V17H 3ARBA 3D0LA 3U36B 5KSAA 3RY6C 12E8H 5FKAA 3X12B 3BMWA 4H8WC 4R4ND 4ZD3H 2FATL 3IDXL 4OZHE 3T4AA 3WN5A 2Y25A 2Z8RA 1F4YH 3WXVL 1FVCA 4X5XB 5GRJL 4G9FA 1A7NL 2ZSWB 2NW3A 3W0WB 3CUPB 4LQ1A 3F7YB 5EOCJ 1FGVH 2AK1H 1R5IB 4HFWB 4LLMB 5SV3A 5KVDH 4QRUB 4QOKD 4LVNC 4V1DB 5ESQA 3TVMD 3O6ML 4HWZB 2VLMD 2G5BA 1OTTC 5HYFA 1MHCB 4HG4J 1JZ6A 4WW2A 3PJSB 4G6KL 4LCWD 3BPCB 1YN6A 2RHEA 1BJMA 1Q38A 1OQOA 3KS0H 1A5FL 5B38G 4JFFD 5KSVB 3HRZA 5KSBE 3CPLB 3HUJB 2BMKA 4PY7A 4HJJH 1YEJH 4DKDC 3GSWB 1JHKH 4K8RL 5FYLL 5D2NC 1P7KB 1BF8A 2NY4B 5EU6D 3LEYH 1UB5A 3MV7E 5D7KE 1XT5A 5LVEA 1DQQA 3BKJL 2A6IA 3JZ7A 1QFWM 3C9NA 4KMQA 1FORH 4M1DH 4XB8A 5L2KE 1A7PL 2VISB 2XN9E 4FMKA 1J1PH 3NABH 5BZWA 5GZOC 3FB7A 4XP1H 2XYCA 3P0YL 2Y07H 1CDGA 3GSOA 2RCSL 2CDFB 1A1MA 1DR9A 2KDGA 3KPSD 5EC1A 2X4UA 4QTIH 2ZUVA 1C16A 1MI5A 2VLJE 4KZDL 5IBTL 4XP9H 3KPLA 2MOVA 1KJ2L 1MHEA 1MOEA 1IKNC 3KPQB 2PXYA 4IJ3C 5AG9A 4RGNE 3KPRA 1GSMA 3BZDA 4WENB 3WFBH 4XPAH 3RGVB 1Q72L 4ZDHB 4MCZA 2VWEC 4FQIL 1OP3K 1JGEB 3ARDA 3MUGB 3M17A 2J88H 1T83C 3BHBB 2HTKD 4NO3A 5BCAA 4R2GC 4P4KC 4ZO8A 1JPTH 1B0RB 4F33B 4UDUB 1FNSH 1OAZH 4OD1H 1WWBX 3MFGB 3RUGE 5HGBB 4K7PH 3KPTA 4RNRA 4U6XA 5HHOA 3FFCA 4S1QL 1FRGL 4BZ2L 5H35B 2OI9C 4Y4HB 3RWIB 2C1PB 3NZHL 4E5XB 2I5YL 2BY3A 4NWUL 3VWKC 4E0RB 4W6WB 4U1JA 3GSNH 3QIWA 5C0BE 3JV4B 1NC2A 2O5YH 3SJVE 3V6BR 4OZ4A 4OD2B 5B3NA 3LQMA 1YMMA 2JJTA 3WV0A 4YX2L 1JYVA 5C0CE 4M1CD 5DJCB 1SYVA 4ZXBC 2KQNA 1OD9A 1FYTB 4I77L 3B2UC 2V7HB 3QIBC 4XBGA 4PGJA 2YR3A 1LEGA 3B9KA 4TOYL 2XTLA 2J5LB 5DFVC 2LU7A 4WUUD 3NIGE 2W0FA 4PJIF 1I9EA 1IM9B 4J1UB 5TFSL 3DROA 4HIEB 4YDJA 4E41E 4UTAL 5E6IA 5J1AA 5C08A 2VXQL 3TIDB 1JBJA 5J11C 4EIZC 3PXHA 1XCQA 1N2RA 4HUKB 4YUEH 4Z7QF 2IQAA 4JREC 3V6FA 2XQYK 1VFAA 5IQ7L 3OJ2C 4NO0B 2PW2A 2ENYA 1EBPA 3GMLB 1HNFA 2EDNA 3ULUL 3LRGA 1OL0A 3DOSA 4C83B 2HMID 3QNYA 4HBQA 4M5ZH 4X7TA 1QRNE 4OGAD 4Y8AA 1MJJA 1JYNA 1JGLH 1VKXB 1IL1B 4S2SB 4KK5C 3BPNC 3O45A 2VDMH 4NC2B 2NNAB 3O3UN 3C2AH 5MEPA 1Q9LB 3DSFH 2FSEA 1LK3L 4NFBA 2LU4A 1I85A 5DWUH 4OCSL 5CP3A 1QR4A 3PL6B 3WIHL 5E7BA 4K71C 1F97A 4U6HB 1FC1A 1OSZA 2JLLA 4LLDA 3VDAA 3MLPA 5ALCL 4GMTH 1HSAA 3QXVA 5BRZB 4P0DA 4PLKC 1YJDL 1N5AB 2OZ4A 1OCWH 3PDDA 3O6LL 3BP6A 1S7SB 2I26N 4MSWB 5HYJD 3NIDE 1FL3A 4NUGL 5D7IF 1HINH 2A6KA 3QWOB 4LCIH 3GEWB 1HEZB 4X6FA 1AKJA 3VXNA 4YHMH 3BKCH 3MRBA 4OI7A 4GRMB 3PABB 3VG0L 4HUVB 5JXEC 3ARBD 4L4VE 5KSAD 4MNHA 1IAIL 4NRZB 1KELL 4OCMC 4MA3A 4OJFH 2X70A 3I3DA 5C0AB 3T65B 1J5OL 3PWVA 5D6CB 3QFDB 4J3OC 5KJRH 4BM7A 4PJ5E 1Q9WA 5F3BA 3FB6B 1X4ZA 5JIPA 1CVSC 5I1HH 3O3DA 2M8XA 3U4AA 3GSQB 5DEGB 3OJDB 1TIUA 4G9FD 1AGFA 1N3NB 3QUYA 1G84A 1BZ7A 5BOPA 2P5WA 4XXDB 4GOSA 4ZQKA 1RIUH 3VXQA 4GSDH 4CADB 4HIXH 5I8OL 1JRHH 4N9OB 3NPSB 4P46C 3GBNH 4UTBH 1GJIA 3CFDB 3DV4A 4O4YL 1CGTA 4XCYA 2CLVB 4CDGC 3ALXA 1S5HA 3T0EC 2CDGB 3L3IA 1RI8A 1GZQA 2BSED 3OAUH 3GI9L 3KYOA 4GFTB 2MKLC 3O4OC 2XG5A 4QXTB 5HVHB 3MO1B 3NIFF 1DE4B 1GGCH 3MNVA 4IOIA 4JFDE 2R9HC 1RIVH 1TVHA 1RJLB 4Y5YC 5HDQL 3IF1B 2DQEH 5TF1H 3O2DL 4PV8B 3QXAB 3HS0A 4KUCF 5JHLH 1E4WH 2EDKA 4K3JH 4G8IA 4OCLC 1VPOH 2VQUA 1AGEB 4WHYG 3WLBA 1HXYA 3RVXD 3NFSL 3V4PL 1NCBH 1TNMA 1N59B 4WWKB 1KJ3H 4L8DB 1WTGT 1HH6A 1MI5D 2F53D 2D7TH 4K3DL 5ICYB 4S11A 3D69A 4YXKL 3RNQA 3OTTA 2PXYD 5A16B 1C5DA 1LDSA 1NEZG 1WLHA 2EIZA 1PX4A 3KPRD 3GRWL 4ZUUA 5IW6B 3ARDD 2PYEE 3WSQL 2HFEB 4L9DA 2Q7YA 2D7NA 4ACPA 3HE6B 4KVNL 3HAEA 3RAJL 4S1SH 5MP6L 1F5WA 1IC5L 4O5LH 2FJHA 4MB5A 4FHBD 4JN1H 1YY8B 1C8PA 3FFCD 4K9EC 3F5WB 5KS9F 4P2OA 4CVWA 4YDKH 1J0HA 2OK0H 3DUUB 3RTQB 3RWHA 2K3TA 4W4NA 3C87A 5IHUL 2ZCLL 3FRUA 4OTXL 1R3IH 2G9HB 3QIWD 1KJMB 4X99B 4LPYA 4KROD 5FOJA 1ZHKA 3MGTA 5C9JB 1EZVY 1MWAB 3MRIA 1UQSA 32C2A 3VMNA 1YMMD 1MCPH 5CSBA 3U46A 2NX5B 4G8EB 4JAMB 1DQDL 1U8MA 2C3GA 4BH8B 2PO6C 1AI1H 1N7MH 3P4OA 4OCYL 2DDQL 5CEZD 3KYNA 4LCWE 1R24A 2GTWB 3EJZD 4OUOA 4NO2A 4JFFE 2KQMA 4ODUA 4GRWF 2JB5H 4NKIL 4H25B 3ZDZF 4NC0B 1CGSH 1E28A 5EU6E 4X80H 4F9LC 5B4MC 1JF5A 3ALWA 4XBEL 5E70A 4D3CL 2FLRT 1C5BH 4AH2A 3K81A 5C08D 1YEEH 5LGKA 2EDOA 1U8IB 2DQJL 2IPTH 4NKOA 4XP4H 3VRIA 4XTRC 5GRZA 4KKBD 2Z4QB 1SBBA 5DMIH 1CXEA 5HGAB 4KKLD 4Z7OE 4NYLB 5ISZB 5C2BH 3PIQA 4O2FB 5K9OB 1Y18B 4YR6B 1CZ8H 3KPSE 2QKIA 5EORL 1ITCA 4JM2C 4JDVA 3O9WC 4XVJH 3OKOB 2BC4A 4I18B 4PJFB 1KCLA 2RFXA 5AUMB 1JNLH 2NY2D 5HDLA 5KSUB 1CK0L 1IKFH 1RZ8B 1WWAX 3MJ8B 4EN3A 5FYJD 5GS0D 1NBZA 3J8F7 1YEFL 3RWEB 4PJEE 2Q76B 4YAQA 1U91B 1UH4A 4PGDA 1DDHB 2VZ3A 4KVCH 3CH1A 5BJTB 3GSNA 1YDPA 2BY2A 4XMLL 3LS5L 3RI5F 3NAAH 4OLVH 1MJUH 4OUUB 4N0FB 2H26A 5JORB 1JHTB 1F45A 4ISVA 2Q3ZA 5JZ7D 2H3NA 4UUJB 3GSVB 4J6RH 5DK0B 4KI5C 1BGXH 2Q1EA 1M7DB 3DMMC 1N4XH 3AREC 4NZJA 3VD9A 1XGPB 3X3FH 1AKJD 4HWUA 2H2PC 4FQCL 3LQZA 1NAML 1RUPL 4DK6A 4OZFB 4LVHC 5E94B 1DZBA 3SKJL 3HRPA 4ZO9A 1PD6A 2W9DL 3QAZB 4HX1A 4IHOA 1NLDH 1J0JA 1XGQB 2CRZA 2X4OA 5ITBH 1L4IA 2PCPB 3DVIA 4AK1A 3UDWA 3U7YL 3BPNB 5CJ5A 2AGJH 3HPLA 2P5WD 3QG7L 2HVKA 4U1SA 3MCLH 3CZFB 5LWYH 2A6JA 3D6GA 5IVXB 1FSKC 3GHEL 3T4YB 3BD3A 4M48L 2Y06H 4B53A 4XPGH 3MNWB 4WUUE 1HQ4A 1MFEL 1NFIA 4TUOA 5GIRA 3ARGA 3HI6L 5MERB 1IC7L 2DQIH 2IBGA 1XF4B 1CFVH 3B2VL 5HI5D 5KOMC 4UDTB 4V2BA 5CJOH 2XQBH 3QPQD 4E42B 5F72S 3LKRA 2PETA 1MY7A 2VXSH 5HVWA 5CINL 2ZUSA 3MRNB 4NKMB 3VH8A 2OP4H 2YPKA 4BKLA 4Z7VA 2WLYA 4XNXL 2DBLH 2VQTA 4BFIA 2HJFA 3HMWL 5DHVH 4Z76A 1BQLH 5SWSB 3I75A 1HYRC 2DWEA 5HD8C 5FA4A 2O5XH 3D0VA 3MRRB 5I2IA 1IEBB 5DUMH 4TVPD 3CXDH 5AD0A 2HVJB 1JFQH 3VFRA 5JOFB 5LXGL 5ACZA 3QDJB 4FN0A 4L5FH 2Y7QA 4NQEE 1BBDH 2JCCA 1OAUL 2WAHA 4P4RB 2G60L 4YBHA 5CCKH 2VXVL 3C5ZA 2XKNA 1CI5A 3MJ6A 4KKNA 5AAMA 4PG9B 4XBPB 4FQXD 4Z0BL 1GRWA 1L7IH 1H5BA 3GK8H 1ZVSB 4OQTA 1S7WA 2R0LL 2W1NA 1A3RL 3O3BB 2YPLA 3GKWH 4OZFH 4N1EA 4TRPL 2X1QA 2Z93B 5HYJE 4YBQC 5KAQF 3G9VA 4DUVA 3MRKB 3AS2A 5DEZA 1SY6H 3TO2B 3BWAB 2XICA 4PRHB 4OLXH 3MV9B 2W9EH 1BD2E 1QBML 1T80A 1D5XA 2RIKA 5E2WL 1EFQA 4HXBL 1RU9L 4HS8L 4HKXA 1ED3A 1CDCA 2YD2A 1NFKA 4WGVB 5DUBA 4PJ9B 5D7LA 3PP3H 4P2OD 5KS9B 1BP3B 1KTLA 2CLRA 1T89A 4HXAL 2P4AB 1PDKA 1M71A 1W72H 5EOCH 2PR4H 4S1DD 5HHNB 2AJZA 5FYKD 3S4SG 3ZL4L 1YUHB 3UAJC 2HLAA 1P9MC 1A6TB 5I15H 2OL3H 2AEQH 3KXFD 3ULVE 1B0GB 5DJ8B 1HZHH 2NQCA 5FHAH 5C8JA 5CD3A 5DMJB 3VGHA 5DDHB 5F6HI 4XPHL 3UCRA 1UWGH 3BPLC 1NSNH 4N5UA 3I2CL 4ZFGL 5BXFB 5HHQB 1FH5H