4L1DA

Voltage-gated sodium channel beta3 subunit ig domain
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
124
structure length
113
Chain Sequence
VCVEVPSETEAVQGNPMKLRCISCMKRATTVVEWFYRPEGGKDFLIYEYRNGHQEVESPFQGRLQWNGSKDLQDVSITVLNVTLNDSGLYTCNVSREFFVKTTRLIPLRVHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sodium channel subunit beta-3
publication title Crystal Structure and Molecular Imaging of the Nav Channel beta 3 Subunit Indicates a Trimeric Assembly.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Membrane protein
total genus 25
structure length 113
sequence length 124
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2013-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4l1dA00
4M43L 1WTLA 3RPIA 3BD3A 2DQCL 3BKCH 4GSDH 3BGMB 1S7QA 5ICZA 3T0DA 4NGHH 1CE6A 4MA3A 4JFDA 3ZE0F 1HIMH 4NHCH 2MQCA 4FQCL 1S9VB 2YUXA 4F7TA 2EYSB 3ULVC 3C60D 3DVNA 1IC7H 4F33B 4NJ9L 1A6WL 4MD5A 3C5ZC 1BJ8A 1MCPH 1ZXQA 3DHJA 5KSBB 5GRXG 4M61A 1QACA 4OUOA 4EN3B 3DJ9A 5LQBL 3MRLA 5AZEL 1YJDC 3NH7L 2XPGB 2HG5B 3MRBB 2VDLH 1P5UA 2D7NA 5DUBA 4D9QE 4I3SL 2VAAA 1JGVL 2XXMB 3JV6A 4M8VA 1FG2A 1BF8A 5CZXD 2OSLB 2CKBL 4Z8FH 4XB7A 2P48B 2UUDH 2VH5L 4MAYA 3U0WL 1UJ3B 1V7NL 2FGWL 2Z91A 3OGCB 3VFMA 1XR9A 4IOIB 4KI5C 1DVFA 2MTPA 3AREB 1NFDB 3TBSB 5E5UB 1HDMA 4KPHH 4HSQA 1I8KB 1WGOA 3VXUD 1T04B 3MREB 3P9LB 1V3LA 3VRIB 1A7OH 2CIKB 1I8MB 4HIXH 3HNSH 1KCUH 4PJCE 4YHKH 2EO1A 2RGSA 3AUVA 2X1XR 1FBIH 3VFWB 2E6PA 4PJ5A 5I73C 5GGSY 1K4CB 1RI8A 1TDQA 1AO7D 4IDLA 2DD8H 1U8HA 4LRIA 5HYSG 1HH6B 4ZAKA 4M1GL 4KHTL 2R0LL 3HFML 1BHGA 3HZVB 2DQTH 2W65B 3D0LB 3EOAB 5HSFA 3IXAA 4PREB 5I75B 4U6HA 5CUSL 4CU6A 5KN5B 3TNNA 3B8SA 1QBBA 2YWZA 2EXYD 2JB5H 1IC4L 5CS7A 3CFKB 1C7SA 4PJ9B 5D7IF 1VFBB 4NJAL 1XF5A 4PGCB 2L0DA 5C1MB 3TFKD 4MJ6A 2Q86B 1KB5A 2NY3D 1P9MC 2CRYA 2HLFD 4NPYA 1G0XA 3WE6B 4QHUB 1CQYA 2EDRA 4FZEH 4FFWC 3VXTB 3MNVA 3GHEL 4MYWB 15C8L 1F2QA 1A9BA 1UM4H 2GJJA 3INUH 3AU1B 4LLMB 5HVHB 4FXGA 5EO9B 3C60A 5GGQL 5CJQH 5DYOB 4G8FB 3RGHA 4UV4H 5IP4A 4NWUH 4LCYB 5L8LB 4KVCL 4CAGA 5C2UB 5D5MF 4D0CB 3P0VL 4N9GB 1INEL 5H94B 2X1WL 1B4JH 4PY7B 4Y16C 1VACB 4OCXL 3VFUA 5I1AA 5DJCA 5ID1B 4JFXB 3CDFA 1CFNB 4R26H 4MXQC 3O6KL 4JFFD 1RUKL 2V2WB 2HKFH 4YHZL 5E1HB 2Z8WC 3TN0C 1RZ8B 3GHBH 3QXAA 1FZJA 1UENA 4ZUWB 2H45A 3DECA 2Q6WB 5AWNH 3L5XL 1T4KB 2ESVD 3RGVB 5D5MA 1MWAH 1SBBA 4GMTH 5CEZL 5IMMA 4IHOB 3VXUA 4V1DD 1GPOH 4NO2B 2R4RL 1KEML 2V6HA 1ZEAH 2F9BT 2FX8L 1R24B 4I2XB 4G6AC 5HYQA 2X4PB 2VISB 3QNYB 5CMAB 4OCSH 3ABZA 1VADB 2CDGB 2AJUH 4J6RH 4G43A 5I8OH 5F6HI 2BDNH 1OL0A 3PXHA 4G7VL 1BBJB 1IGCH 1A9EB 2R69H 1UZ6F 3UP1A 3U2SA 3BP7A 1AO7A 4W4OA 4RMSA 3QXDA 2JK5B 4QHKJ 5L8KB 4OCRL 3V7MA 3TBWB 2YUVA 1KBGL 1BFOB 4XC1L 4Q6IC 3IDYC 4JZJC 1EMTL 1RZJC 5AAMA 3QEGL 5BV7L 1CF8H 2DDQH 3NFNA 5KTEL 5CD3B 1SM3L 2F53E 3GI8L 4H88H 3QFDB 5IEHA 1OAZL 3ULVD 2R15A 1JRHH 3B9KA 4WHDA 4ZYKA 3WL9A 4OM1L 5JOFA 5HHXH 3C5ZD 3UO1L 2HH0H 2Z93A 3ARPA 2O5XL 4DVRL 3MA9H 2WQRA 2APBA 3ARBC 1RIVL 3D69B 3DVIA 2H9GB 3DX8B 4RX4D 3L3GA 5KVGL 1KG0A 3SPVA 4OZGB 2YD2A 5C0CD 1I1FA 4JGUA 3PWPD 1KXTB 5DO2C 5BO1L 4GLRI 4H1LG 4AEIH 4I13B 4F58L 4WEMB 4WU5B 4ZTPL 1LO3H 3CLFL 3FFCE 5E6ZA 2VJXA 4E41E 1MAJA 5SWSA 5E08H 1FN4A 2VLJD 2R1WB 2P8PA 1N0XH 5HGHA 1LO2H 3L5JA 5IIEB 3WCYA 1GYAA 3PV6A 3SO3B 1LEKA 3B83A 2OL3L 3VXOA 1LVEA 2LU4A 1BM3L 3G6AB 1XZ0B 3PHQB 2WMPA 2UZIL 1ZA6A 4MNQD 4JFFA 3SDDC 1HQ4B 1RY7B 2BK8A 3ZLQC 4FP8H 4WI2A 2ADGB 1OF2B 1QFWL 4K3DL 3G6JF 5GRZA 1ORSB 1CS6A 1FL5B 35C8L 4M00A 2A77H 3CUPA 3WHE0 2JB6B 4IOFC 4YUEL 4L8SC 1EHXA 1MVFA 4CVXB 2ZG3A 2XA8L 1FL6A 3D3VB 3U0PA 3QUXC 3B5TA 3IVKA 5D2NA 5GRVL 3FHAA 2VQTA 1MCHA 3MRCA 5JHDE 3OR6A 1MCSA 2AQ1A 2CLZA 3OG6B 5CZVH 3G6JA 2BNQD 3V6OC 3UPCA 1K85A 1UB5B 3MJ9H 4C4KO 1M71B 4JPIA 4FFWD 5EULV 5B22A 2F53B 3BZFA 5DMGC 3HN3A 2YS4A 5AD0A 4BZYA 4KUCD 4XNQA 3PGFH 5TQ2L 2D7PA 4CNIA 1CLOH 4HS3A 2DB8A 4Y5XC 4RAUA 4LVOB 3LN5B 4ODWA 3H9SD 3QCUH 4PJ8A 5E4IA 5TF1H 3H7BB 4POUB 1IAIL 4TNVF 43CAA 4JFYA 4NKMB 1FNGA 1AGEB 3WSQL 5GGRA 3FQTA 5C0DB 5MERB 2EDNA 2FB4L 2PXYB 4MD4A 3EYFB 1S7XA 1PLGL 3HI5L 1DBBL 4H5SA 4Y16D 4LSRL 4RGMB 3GSWB 3TYFB 1J87A 4JG0H 4MS8C 5CSGA 2AEQL 4MXQD 4GLRH 4RGOL 5B8CC 3PWVA 3FFCB 4ETQB 4GXVL 3WIHA 2VIRB 3TN0D 2HTKC 4LQFL 3MR9A 4G9DB 2ERJB 4FQJH 5KOVC 2VLJA 2FH8A 2DQHH 3JTSB 1RJYA 3OJDB 4WI5A 5C0AB 1I8IA 1G6RH 1DL7L 4U6YA 2OTWA 2FX9L 1AGFB 4RMUA 1E27A 3VGHA 4LLVA 3D9AH 3SE3C 2XY2A 2Z35A 4I18A 4G6AD 2H6PB 3SDXF 2GSIB 1WZKA 3ZL4L 4DUVA 4UT9L 3RX5A 3LRSA 2DKMA 5FYJE 5K9OB 2VWEC 3GIZL 4ZD3L 1QPXA 4H0GA 4L3CA 4PTUA 2FYYA 1C08A 1NL0H 1OAQL 3MRHA 1FZKB 4ONHB 5GS0C 5DRXB 3QP3A 2VLRE 4XPFL 4QXUH 5TE4L 5J12B 3ARTA 5JQ6L 1DP0A 3TZVB 1L0QA 3QXVA 1TMCB 2LVEA 5F6HJ 1IQWH 3GSOA 2GW5A 3SDXA 1A7RH 1UH2A 4OZ4A 5HGDA 2HRLA 1KGCD 2ZG1A 4XPAH 1D6VL 2QSCH 1NLDL 1FYTE 1YPZB 1E4WH 1IEBA 4K23H 1WT5C 4UV7L 1MIML 4KTEH 5DS8A 5GRUL 5DT1H 3LEVL 4YC2B 1P9MA 2WBWB 4OAWB 2A9MH 2BNQA 5GRYA 4OT1H 5IW6A 3BUYB 1AXTL 4PJHF 2IFFH 2JE8A 1OTUC 2CK2A 4I1NB 4NO3A 4GG6F 3I2CH 5DO2D 3C08L 3S98A 1QR4A 2VXTL 5MENE 1J05A 2G5BB 3DRQB 5ITFB 4PJXF 4P4RB 1FVCB 1F00I 1YYLH 3T2NL 2OZ4L 4UUJA 4KHXH 4R96A 1JGEA 4O02L 5CEZE 4TVPH 4PRBB 5HVFB 4MHHG 1MLCA 2HWZL 2VQ1A 1JUFA 4ZNCD 4XPTH 4W6XB 1F4YL 2DIAA 4PJHA 1CL7L 3T08A 4MA7H 3U4EA 5JPMB 5B39G 1BF2A 1OY3B 3Q1SL 4NHUB 4U1IB 4YHPB 1U0QA 3QDGE 2VZ3A 4P2RD 5L2JA 4J3UA 1UCBL 4BQ6A 4XP6L 3MYJB 1FFOA 1JI1A 1YA5A 4OD2B 5FUCE 3OV6A 5E2WH 1S9WA 3SDDD 1KPUA 4JFPA 5ESAA 3MRKA 3TN0A 3KS0H 3WKML 4KTDL 4HKZA 1LK2A 2N1KA 3O0RH 4Y19E 1W2KT 4XVSL 1HK6A 4PG9A 3D48R 5A2LH 3LSOA 1NAML 3KXFD 4MZ2A 2WBKA 1CFQA 1K8IB 3S5LB 4PJEE 4ERSH 1RAMA 3LKNA 4IOFD 2Z9TA 1EO8L 2Y6SC 5JDSB 1HE7A 3MV11 2X9YA 4CVUA 1WISA 2Q3AA 4Z95H 2BRQA 3QUXD 3FO1A 4PB0L 4XGZA 1WTGT 4XXDB 2VLRB 4XMLL 3HPJA 1W8OA 3RHWF 3IGAB 5HDQH 1H3PL 1GZQA 3QZWB 1F90L 1NDGA 4Y1AE 5IVXF 2V5TA 4C56E 1U8JA 5DMGD 4JM4H 3F7PC 5L88H 4NZRH 4OLVH 5KSAB 1IGYB 4Q6IA 4JZJA 4L4VD 3UTTA 5HPMB 1U91B 2HKHL 4P23B 3P11H 1QPPA 4ONGL 3HI6H 2Y72A 3FB6B 1CDYA 2X4UA 2IANE 1ROWA 5DJ8A 3QPQC 4P2QD 3ARFC 3ARBA 3KYOB 5IVXA 1DBKH 2IPUK 2Y36H 5E94B 5MENB 2BP3A 4QRTA 5HHPB 2NY5H 5IB2A 1KB9J 3QG7L 2DJUA 2EIBA 2IAMB 3KPLB 4PRHA 1ORQA 4X8XA 3WO4B 3U83A 3L95B 5ALCL 1S7TA 1KB5H 4ZTOL 5BOPA 3DBXA 3CJJA 5EU4A 2HTKD 3KYMA 2YPLE 5HY9A 3UTPE 4U7SA 4U1SA 3K4DA 1NBQA 2NZ9C 3VXQB 3JSSA 2DQUL 1NMBH 4TUKL 3FAWA 5GSRB 1QUNA 1WBXB 1JHTB 5T1KA 3T0VA 1U6AH 4JFEE 3MGOB 3NZ8B 1TZIB 3O3EB 1R3JA 3H9HB 4YJZL 5JOPD 3U36A 5C07D 4ZUVB 1EAPB 1YEFH 3KPMA 4CRPA 1J0KA 3BO8B 2C3WA 2H1PL 2PCPA 1UZ8B 4GSDL 3SDDA 2V2TB 4NGHL 3P9MA 3OSKA 3LN4A 3OKOA 5DURB 1RU9L 5GS0D 1BZ7A 1HIML 3C2AH 4PJEB 3D2UA 3NAAH 3ZMRA 1AE6H 3LMJL 3CXHK 2ITCA 1HNGA 4ZPTB 3IJYA 1B88A 4G6MH 5MI0B 2FCBA 5CILL 4WHYG 3E2HB 4ODXB 4PD4K 1MLBA 3I6GA 2ZKHH 5CP3A 2PYFA 4YEFA 1T21A 2F8XC 5C09A 1KN4H 5I1DA 4HUNB 3IT8D 5GSVB 1JGUH 4LCIH 4EIZC 1RIHH 2DKSA 2VDLL 1XGQA 2ZCLH 1XFPA 5J1AB 3UTQB 3F7YB 4Y1AB 2BY3A 1S7WA 5I66A 4Z8FL 1JWSB 3OHXA 4M6AA 3V4UL 1FO0A 3SJVE 3KDMB 4J3WA 3V6OA 5HPOA 4LASL 1OTUD 4HIEA 3F7VA 3VI4F 3R8BB 4B0MM 4IIQC 3GRWL 1F5WA 4B53A 5IHUH 2OR8A 1EHNA 3BMVA 5CGMA 3ULUF 4Y5XA 4XBEH 3DUUB 4G8EB 3TT3L 5GXBB 4HIXL 3HNSL 1IC1A 1KCUL 4X6BB 1B9ZA 3LKRB 5C08A 1CG9B 1JWUA 2E8ZA 3VXSE 1KJ3L 3MRJB 5DJXB 3DROA 1HNFA 2BNRB 2L7JA 4ZXBB 1FBIL 3ARVA 3QWQB 2CDFA 4R0LB 1SY6A 3KLAB 3S37X 4R7NA 4LLYA 4D9RE 3D87B 3GMLB 4D0BA 4MWFA 2C1PB 3CIQA 3RWHB 1XF2A 5EU6D 1U8IB 1T22B 5JR1H 5FCSH 5I8KL 3DTXA 4MCYA 3ZYJA 2YPLB 1P6AB 1S3KL 4PRNB 5HYEA 2FJHA 2DQTL 4PGJA 1I7ZA 4LEXH 1QBML 3FB7B 2FIRT 2JB5L 5I1IH 3SCMA 4TTDC 3S34L 5JO5B 4I0CC 1WC7A 5J56B 4JG1L 2Y6SD 1MFCL 3SE3A 5C07A 3KPRE 2XWJB 3ZKXB 3ILPB 5SX5K 5ETUA 4TULH 1YY8A 2ADIA 2AEWA 1U92B 3VWJB 4ODSH 1UM4L 3OKLA 3PUCA 1MCEA 1CXLA 5E1AB 1H15B 4O5LH 4X7FC 3QNZA 5CJQL 1DFBH 2IWGA 1A7PL 4G8GE 2GUOB 4Y8DC 4UV4L 4YZFE 5EBLA 4TYUA 3VXMD 2RR3A 5HHOE 1G7QA 4PJDA 2V7NB 1IARB 4LSPH 2BVQA 1B4JL 3IETA 1IJ9A 3C8HA 5IMOB 4P2CG 3QPQD 1CT8B 2ATPA 2M2DA 4ZDHB 3RDTC 2H8PA 5KVFH 2FJFA 3ARFD 3RVUC 4K07A 1QO3A 1EUTA 3I75B 3LKQA 2DWDA 5FYKE 3WFBH 3BPCB 1P4IL 3K80A 3U79A 1E4JA 3GHBL 1RJLA 3V5KA 5DQJA 4LLDA 4OF5A 2EIZB 3V0VA 3RL1B 4AG4L 2IQ9L 2CIIB 2YZ8A 3PNWB 1MWAL 4I48B 3V0WH 1FZOA 3CCHB 2I9TA 1WZ1H 2G9HA 5GJTL 5IROA 1DQTA 2K3TA 3VXSB 1OT2A 1ZEAL 3OKKA 2NZ9D 1CFSA 3CLEL 4PRPA 3GSNA 2F54E 3CC5B 5FO7A 1L9NA 3A6BH 1NBVL 1PZ5B 2AJUL 5I8OL 1QFPA 2HFGH 5HGBA 3FTGA 2LABA 1U95B 5CWSB 4AT6B 1JIBA 2R69L 5F1OB 1A4KB 5EPMB 3QA3B 3ULVH 1NUDA 3B5HA 5IVZA 5EU3B 1G7MA 4GXUN 2DM2A 4XCEB 5CINH 5TQ0L 4Y5YB 2GSGA 2VXVH 1V7ML 1YJDH 5LGJB 2DMKA 3BYYA 3MXVH 4QY8B 1AP2A 2G75B 2JCCF 4KK8C 4XVUC 4HJJH 4MB4A 2CLVB 4H88L 1WQVT 2EIEA 3EYQC 2P5ED 5HHXL 4G9FB 4FXKA 4JM2B 3VJ6A 1I7RB 3WIHH 5E00A 1EBAA 4G80A 5KSUA 1S9YB 3O8XC 2HVJB 3MA9L 1U3HB 4P59H 3IU3A 5GGTA 1AIFB 3IB4A 4X5XB 1U93A 3MV7A 3S37H 1VGKA 5GIRA 4Z7WF 1IAOA 4FNLH 3OAZK 3TJEL 4ZUTB 4AEIL 1X6LA 4LSVH 3PWNA 1FFNB 3QSKB 1IEHA 5LCVH 4JDZA 1A6UH 1UWGL 3KVQA 4PJGF 2EEAA 4YHMH 5E08L 5IV2B 2HTLD 4FTVE 3VXMA 3WHE1 3U7WH 3GUTA 4Z7WA 2UWEA 5K9QI 4WHTA 2WP3T 3F7RA 2G2RA 3DRTA 2DKUA 4L8BA 1QP1A 1TTFA 2Y23A 4WU7A 4CW1A 5I17B 2VLME 2YA2A 5CBAA 4LLWA 3BKYH 4NO0B 5D2LF 1ZVSA 2MCG1 3KJ4C 3L3OB 1NGYB 2DLFH 3PF2A 5T33H 4F9LC 1MF2H 2GY7B 5J11B 5LG1A 5L2KE 4WI3A 5IG7A 2BFVL 4PJAE 1JNJA 2A77L 2F54B 5GHWH 2BOBA 1H8OA 1OP9A 2Z31C 4HKXB 5I9QC 1JHLH 3K8MA 4RGNC 5JIPA 4PTTB 4NNYA 1PDKA 3BP6A 1JMZA 5HHNB 4NKQB 3KPQA 2OXHA 3PWJB 4HK3J 5D2LA 4TTDD 4NKIL 4RBPH 5I6XC 2FBJH 4M4RA 2YD7A 3BHBB 4KJWD 5AUMB 1RUQL 2ZCKH 2HFFA 3QHTC 3NN8B 4JPVL 3RVVD 4NC0B 4AQ1B 4NRYA 4GKOA 3MJ9L 3VXRE 3GB7A 2X4RB 4KZEH 1IL1B 4XC3H 12E8H 3KAAA 3TV3H 2EDOA 4M03A 3M1BA 1CLOL 3C6LC 5FUZH 1KIQA 3QCUL 1UXWB 2NXZB 3UYOD 4G7YH 5TF1L 5BVPH 3QDJD 2ZUWA 4JFQA 4NQCD 4JE4B 4OFYD 3RJQB 4BUHA 4EQ3A 3CH8A 1D6EB 4XPBH 2R2BA 1KC5H 3O3BB 3NCBB 3WNMA 4JRYD 3BAEH 1OPGH 1T7XA 1UADC 4JG0L 3V5DA 4HIHB 3RVUD 32C2B 3KPSD 4TSBH 1ZT7B 5DC0A 3G5VB 1OVZA 5CP7A 1CXKA 1YMHB 1A47A 1DBML 3QI9B 3FQRA 2AXGA 1MCWW 3TCLA 2ICEB 4H1LB 4IIQA 4P5KA 4PV8A 4RFOL 1LP9B 1UXSB 4QRQB 1G6RL 4EUPG 2H2PC 1QYGH 3D39E 1FC2D 3P3YA 4YDVB 1BGXH 3D9AL 4TVSa 5I74B 4HK0B 4NQSB 3O2VH 1RZJH 1LWRA 2Z92A 2APVA 5IB1A 4KGLA 1FZMB 2OTPA 4JDTL 1NL0L 1NCDH 2CLRB 3EFFB 4H26A 1GGCH 4PJAB 4CKVX 4EN3C 4S1DC 1JV5A 3EFDL 4N90D 4KK5C 1JN6B 3OXSA 1AD0B 4PUBH 1IQWL 2W59A 1A7RL 5D93B 1M7DA 2E7BA 2EC9T 4KK8D 4XVUD 4M3KB 1DN0A 1IAKB 4XPAL 1T03L 1S7VB 3EYQD 4BJLA 3W9DB 4K23L 4HC1A 3CDGA 4E5XB 4BH8A 3LKOA 4KTEL 3O8XD 3GSVB 2V7HA 2VKWA 4XVTL 1YEDB 4HUKB 1B0GB 4JRWA 4WNQB 4WI4A 2A9ML 4UINH 4ZQKB 4Z0XB 1R3KA 2NX5A 2DQDH 3GM8A 3ZT7A 4ZFGH 1Q9KB 2IFFL 4UTBH 2HN7A 3HE7D 4FQXC 2NLJB 3BRGC 1HI6B 4I0PC 5TDOA 3HZKB 4NKOA 3WYRA 1CIUA 3MUGB 3IKCB 3ELAT 4X7SL 1ETZB 4HH8A 3MC0A 1G9NC 1D5ZA 2P7TB 1AR1C 2VDMH 3ZKSD 4NWTL 4PJBA 4MCZB 1C5DB 3HE6C 3SDAC 4D9LH 4WIQA 3SGEI 3MLUL 2NY1C 2WUBH 1JTOA 2XTLA 4UDUB 4DVBA 2P5WD 4MA7L 2FZ3B 1IKNC 1MPAH 3MRQB 5I75C 4HUVB 1NLBH 2VE6A 5DJ0A 2EKSA 2ZUSA 3QEQE 4JREC 4NC1E 3VRJA 5JUEH 1JL8A 5DI8B 4MAUH 3RDTA 1Q0XL 2P8LB 2NR6C 1J1OH 1T1XB 4PJ9C 3ZDZE 5E2WL 5TDNA 5SWQB 3DYMA 3DNKA 4B7IA 5IJKC 4BQ8A 1G7PA 2PF6A 5CCKL 5HYJD 1NDMB 3T3PF 4LVNC 5F7KC 4JKPL 3UZVB 4DAGH 2HT4C 3JWNC 3DMMC 3MBEB 3DPBA 3HPLB 3ZE1F 3W0WB 2Z31D 3WEXA 1JGDB 1FO0H 4OI9A 1KJ2A 4YPGB 4RGND 5HVHC 1BAFH 2OP4L 4X4XA 2OX5A 4Z95L 3RRQA 1WSST 4BQCA 4OIIL 3MLWH 4S11A 4F37F 3RWJB 1WV7T 5HDQL 4N8PA 4LPUA 4BFIA 4AMKH 3STZB 4RWYH 4JM4L 1SY6H 1T1ZA 7FABH 5FO9B 3T3ME 4ODUB 2VAJA 3C6LD 4JKKA 2W9EH 4AK1A 4X99B 4JHAL 3HI6L 1EEZB 1QOKA 5A2JH 2C3XA 5F70A 3MV8A 3T0EE 3RGVC 1OGAD 2WWKT 1IGTB 3O3DA 2WK2A 1LDSA 4QWWC 4ELMF 3MLYL 1F3RB 1Z9MA 2NY5L 3EYOA 1VKXA 4LCUB 5EBWB 2ILLA 5T5NF 1A2YA 1Q9WB 2QR0B 4POYA 4LHJB 5A2IH 4U1MB 5EOQH 2AABH 2QKIA 4J4PA 4XBGA 4PJFF 4QRUA 2QSTA 1KB5L 4HKBB 2FL5B 3BI9X 4OCLC 5DJAB 1ND0B 1R3LB 1JNLL 4Y4FC 1PYWA 3HB3C 1VA9A 3QG6B 2JJUA 3B43A 5IOPA 1MQKL 3SGEH 1E6JH 1U6AL 2IFGA 1PBYA 1KACB 2H2PD 4Q2ZB 3RNKB 3QEQB 3MACL 3QHFL 2AAVA 2PNDA 1PJ9A 1BOGA 2R2EB 4PJFA 4Z76A 4FXLA 5DEFA 5E8NA 1Y6MR 5FB8A 1W72A 1EEQA 3HG1E 1JFQH 2ORBH 3UTSE 4GRMA 5B39B 4WW2C 3N9GH 4RMWA 1F4AA 3V0AC 5D7LA 3MROB 3C2AL 3MJGX 1HWHB 1TVHA 4DN4L 4S1DD 3NAAL 5M94B 2GJ6D 3FRUA 4GKSA 4KK5D 3U46A 4X9FA 4L8CA 3JUYA 1NH6A 5GQBA 2Z31A 3FFDB 4AH2B 3FT4B 3PWUB 3VD7A 3G04A 4JRXE 2ZKHL 3BXNB 2ID5A 1KN4L 2J88L 3S4SG 3T09A 5D1ZB 3N50A 4LCIL 3BUTA 5FECB 2DMCA 2P44B 5JNYB 3C09C 2K7QA 2Y06H 3MODL 1PSKL 1RHHB 4HIJB 4F7MB 4XRCA 5EDXA 2MSPA 2VUYA 3NACH 3U0TB 3GSNH 1QBLL 3SO3C 1WBYB 4L29B 5FAAA 1MFNA 1UH3A 2ADFL 2M26A 4FQXD 4M9OA 3KWWB 1RVFL 2BHYA 4I0PD 5IHUL 3T0EB 3C6LA 2O5ZH 4XBEL 3MNWA 2WLYA 1IGFH 2IALA 3ZKNC 4KJYA 1AR1D 2ZCHH 1KEGH 5EOCH 1HXMB 5ILTH 2X4OB 3ZT5A 3HE6D 3SDAD 2XZQH 2NY1D 3HC3L 2W0LA 4WWKC 3EJYC 1FNEB 1C1EH 4P9MH 1YEJH 2DWEB 1NGXB 1Q9OB 2V2XA 5IQ7L 2UY6A 4TN9A 4EXPX 5GZOC 1CWVA 3CVHH 1BVKB 2NR6D 2AGJH 2YA0A 2KBGA 4NYLA 3CK0H 1N26A 1NUFA 5GGTH 3VA2C 4PBVC 3DX9B 5L9DH 4LEXL 3D25B 4NRXA 2W0FA 4OLWH 2HT4D 3WS6C 5I1IL 5KSBF 3DMMD 3AFLA 4JPKH 2NY2B 1PEWA 1D9KB 3HG1B 2AI0H 2VB5A 4OFPA 3NCEB 3NABL 5B4MC 3I3EA 1S9VA 3LDBB 3TA3B 2EYSA 3U48A 3QWRD 2VKXA 3ARQA 5KAQG 1VENA 2IBZY 4F33A 2R4SH 1F13A 3FT2B 4UIKH 5KSBA 5D4QA 4OJFL 3GMOA 2OK0H 4EN3A 2PXYC 4D9QD 1BOYA 3DV4B 1OLLA 4O5LL 3CXDL 1DBJH 1T1YB 2XPGA 3O2WH 4OZHB 2GJ6A 2AK4E 2HG5A 5C0BB 1DFBL 3MRBA 2DYPB 3H9ZA 3TP4A 5MEOA 3QIBB 1A5FL 2OSLA 4LSPL 1I7UB 2A6DB 3ZDYE 3BX7C 3BEVB 2N4IA 4QXTB 2NXYD 4KJQC 4WENB 3OGCA 1MJ8H 4GG8B 2OJZH 3S3PA 1NFDA 3TBSA 5KVFL 5IMLA 5IM7B 1JF5A 3B9DA 4Z5RB 4QWWD 2FEEI 2W38A 2JJSC 2YD3A 4LU5H 1UFUA 2CIKA 5DDHB 3SY0A 1I8MA 4OLXH 4IDJL 5TE6L 3UPRB 4OGAC 5EOCJ 3H3PH 3V0WL 5J1SC 1TTGA 4I0PA 1PX4A 3VFWA 1WZ1L 4GW5B 4XX1E 5IVOA 2BVTA 4Y4FD 3DO7A 5TFSH 3ZE0E 5B3JF 1BLNB 2GHWB 3ET9F 4JY4A 1HH6A 2CK0H 1EEUA 2A73B 5J12C 3L7FB 3HZVA 1BQHA 1NBYB 2EDEA 2HFEA 3D0LA 1IKNA 2W65A 1CZ8H 3EOAA 4GQ9H 4PREA 3ULVL 1CFVH 5F9AC 1BWMA 3O11B 2BHZA 3T0XA 2MMXA 3FO2A 2WIIB 1Q94B 5CINL 4KZDH 1FV1A 4PJ9A 1VFBA 4RRPA 5BRZB 4ONFL 4JANB 4PGCA 4EXKA 1UVQB 1EJ6A 4HF5H 3VGAB 1NCAL 2Q86A 2BVOB 1W0VB 4HJJL 1PAMA 2C3HA 5K93A 1HHGB 4MB5A 3WE6A 4QHUA 1ZHBB 1NJ9B 3IXTA 3WIHL 1QVOA 5T1DH 5EIQA 3AU1A 4K71B 3EYVB 2NQCA 4MJ5A 3GMQB 1EIBA 5EC1A 3OKMB 5BJTB 1PQZB 5K9KA 3S37L 5F6IB 3CPLB 1TTUA 4IRZH 4XNUH 3S8WA 2J4WL 4NZTH 1I3UA 4G8FA 4I3RH 3T2OA 5FYLL 1KV3A 4LCYA 4WV1C 3DVFA 1ZKAA 4LSVL 4N9GA 4Q9CA 5H94A 4PY7A 1VACA 2A0LC 2BY1A 1A0QL 5ID1A 3QDME 4JFXA 4P5MB 2WINB 4LPYA 3U7WL 2V2WA 2YZ1A 1Q38A 3BP4B 3MUZ1 3ZKND 5E9DE 1ADQA 1FVEA 1WCBA 5DJYB 2Q6WA 3Q2CA 2O61B 1CBVL 4KQ3H 1B90A 1T4KA 4R9HA 3RGVA 1HHIB 4CN6A 5KS9F 3VFTA 3QQNA 5D7IE 5TH2B 1BREA 4WWKD 4M02A 5FV2A 1FHGA 4IHOA 1L6ZA 2ZNXA 4U05A 3BKYL 4PGEB 3HC4H 1MHEB 5KVEL 1LE5B 3CH1A 4NO2A 4DZ8B 5BW7A 1CGVA 1MF2L 1R24A 4I2XA 4HC1H 4Q6YA 5HHVH 2DM3A 2Q8AL 2VISA 3D85B 3QNYA 3Q6GH 3BN9D 5JDJA 2CDEB 1JGLH 3PP4H 1NEZA 5GHWL 1BBJA 1JYNA 1A9EA 3WFHB 3IDMA 3W9EA 3DETD 2VDQL 4BQ9A 3MPCA 4YDJB 2JK5A 3V8OA 3WN5C 4WUUB 5ISZB 4EQ2A 2FBJL 3TBWA 4Z7NF 4LGPB 2C1OA 3W2DH 4JY5H 2VUOA 4HCRA 4KRNA 2M8XA 4OZGF 5D5ME 2VXSH 5CD3A 5B4MD 5I1JH 4NCC2 3UJTL 1MEXH 4CMMB 5M7QA 3QFDA 4BFEA 1ZA3B 4QCIB 4UT7H 4XWGL 2QHRL 1WEJH 4XC3L 3TV3L 1AXIB 1OSZB 3QO1B 1JZ4A 4QOKD 1D5XB 4LEOB 3FQNB 4XP5H 3D69A 3RIFK 4TTGA 2H9GA 3BDXA 2XTJB 2YD9A 3DX8A 2BOCB 3GBNL 2QTEA 3TO2B 4ELKB 5J13B 3AY4C 4G7YL 1EXUB 1I3RB 2W9LA 4OZGA 4WEBL 5BVPL 3FT3B 5TPWH 1XGUB 4E41D 3SGDH 1ZT1B 4XPBL 4WU5A 4YIQB 1KC5L 3I6LE 4KJQD 5C86A 1OPGL 4NNXA 4HUWB 4Y8AA 5I1GH 2BSRB 1IM9B 2R1WA 3VFRB 4KVNH 3VFGL 1KJ2H 5IIEA 2R8SH 3BIBX 1UZ6E 4MLSA 4DQOL 5C0JB 2B0SH 4AEHH 1A3QA 1F3JA 4QXGH 3G6AA 4BSJA 5FUCC 3PHQA 1BBDL 1GZPB 4OGAD 5EC2A 3WNKA 3D1MC 4KKLD 5DUPH 1WVZA 3F6IA 4Z77B 2OJEB 4XMKH 4HDIB 4K8RL 1HQ4A 1YQVL 5D7IB 5IBUB 4CJ0A 4ZFFB 5BV7C 3UBXB 2ADGA 1OF2A 3O2VL 1CXEA 2XRAH 4WWKA 1ORSA 4N0UE 2EDWA 1KXVC 2H3NB 5C3TA 1HH9A 1RJZA 2JB6A 4NRZA 3PE9A 4CVXA 4DJMA 5DWUL 4X5WB 3D3VA 5JHDD 2DS4A 4U1JA 4HZAA 1JHKH 2DN7A 3BQUB 4LCCB 4PUBL 4JQVA 4UQ3A 1A1OB 1X5IA 2AQ3A 3RVWC 5EIVA 3RWFB 1X4YA 1Q8MA 3CSYA 4U6TA 3WS6A 3NIDF 5F7WC 3IKKA 4WO4B 3BW9B 1ITCA 5DHXB 3RIAF 1UB5A 5D7KE 3FQWB 3QDHA 1T0NB 1M71A 1RURL 4E0RB 2F53A 4MA8H 5C8JB 1X9QA 3S96B 3MRFB 1N7MH 4UDTB 3VG0H 3A67L 4UINL 4L4JA 5ERWB 4CMHC 5CFHA 3LN5A 1JPTL 2J6EA 1MI5E 4ZFGL 4JFHE 4UTBL 3H7BA 3CFDA 1H9VA 4NKMA 4MNGE 1AD9B 1AGEA 3NIFF 5C0DA 5MERA 3LS5L 5TGBB 2PXYA 1W72H 3EYFA 4LDLB 1Z0NA 2NY4B 3K4AA 4W70A 4HMDA 3SKOB 5D2NE 2VDML 3GSWA 3TYFA 3NOIA 3VCLB 4X6FB 3FN0L 2YPKB 1MCCA 1ZLWK 1JZ5A 3FFCA 4ETQA 1NC4B 1BEYH 4E41A 5E6IC 2VIRA 3BISA 2X44D 3FB5B 2VABA 2YEZB 4JFOB 2ZOKB 3UROR 4ESKA 3MUY1 8FABB 4G9DA 3DXAB 5IBTH 3OJDA 2H26B 2F74A 3BRFA 1FNHA 1G6VK 3JTTA 3HRZB 5IFJB 3MCG1 2AJ3B 3ZKXC 3NPSB 2GSIA 4RQQB 2MWCA 4L3AA 4ODHH 2GFBB 2VLRD 5SX5H 1FO0L 5B38G 1YPZF 1F97A 5FGCE 4HJGA 1BAFL 4R7DB 4N0UB 3TT1H 1FZKA 4ONHA 5DRXA 3CXHJ 3ROOB 4XCYB 4LIQL 4DFHA 3TZVA 1NPUA 4JZNB 1NMAH 5H37H 3RP1A 1Z3GH 3B9AA 1FYTD 2A74B 3RNQB 2KDGA 1Q9LB 3BWAA 1OCWH 4XP9L 4YFEA 3LQMA 5K9JH 5JHDA 1U2CA 5FYLE 7FABL 3VWKB 4RA0C 1A6AA 2WP3O 1OP3K 3OPZH 4OAWA 5MEND 4M48L 1PG7W 4UAOB 3BUYA 4NNPH 1MI5B 4JVUA 5CEZD 2W9DH 4P4RA 1CFTA 4XP4H 4MNGB 2F15A 3G5ZB 2EIDA 4N8CH 4IS6B 1RPQA 1M7IB 2HVKA 4PRBA 4XNMB 1XIWC 4L4TE 4C54A 3QQ4B 4YEEA 1FL3B 1V3JA 1SMAA 2YPVH 4WV1A 3QDGD 2GJZA 1DQLH 3ARGB 4OLEA 4J23A 4KRLB 4DKEL 5JPMA 2VLKB 1IGML 2CRIA 4NHUA 4U1IA 5KSVB 1ZHKB 3LEXB 2LV4A 4Y19D 3MYJA 1G9MH 4OD2A 1PW3A 3WBDA 1S7SB 3O4LE 1R5VB 1CGTA 1RZIA 3SO5A 1BZQK 3L3HB 2BX5A 5DURD 1OAUL 3K3QA 1QLFA 5FUOL 1JFQL 2ORBL 3ILQC 4JM2C 5F7MC 1K8IA 3S5LA 1ZT4B 2VN4A 3QEHB 5JDSA 3AGVA 2QADB 4I8DA 3X3FL 1XF4B 4PJHE 5FGCB 3DURB 4MDIA 4GG6E 4UU9B 5AYUH 2DLIA 4E42B 2UUDK 1P7QB 4C59B 4OCNC 2VLRA 3V6ZB 5E2TH 1QRNB 4PJXE 5DRNB 3ZZ1A 1GVIA 4C56D 4HAFA 2MQ0A 1Z2KA 3IGAA 3DSNA 1DCLA 3QUYB 3QZWA 5EU5B 5F97E 3F65A 3O6FC 2RCSL 5IWLC 1IGYA 4BK5A 1G9NH 2IAND 5DQDH 5HPMA 2ZUYA 5D1QC 1U91A 3NACL 4HFWA 3GSNL 3FB6A 4I4WB 3TWCH 4X6DB 2OI9C 3TLRA 3WV0A 4M3JA 5I76B 5D7JC 5I2IB 4XVJH 4JZOB 2O5ZL 3R1GH 1IGFL 4ZOCA 5E94A 5MENA 4U4BA 5HHPA 5T3ZH 1CGYA 3AY4A 1KEGL 1VPOL 2IAMA 3UTPD 4LVHB 2DJ4A 2E8YA 3L95A 5FDYA 2Q8BH 5J11C 3V5HB 4F7EB 2IQAB 5E6ID 1UKTA 1C1EL 1INQB 2B5IB 4P9ML 4X0KB 4FQPA 1UB6B 3VA6A 4JFED 5C0FA 2LU7A 1A6TB 2BCKB 1JYXA 3VXQA 1K5NB 1TZHB 1A6VH 1V3MA 2F8OA 3P77A 4JCMA 3TBTB 1JHTA 1OT1A 5EZJA 2VL5B 2AGJL 1IGIH 1TZIA 3O3EA 4BM7A 4YQXH 5C9KA 2W92A 3QJFB 2XNAA 3QDGA 4WEUD 5KZCB 4FFZL 4GAYA 1ACYL 1EAPA 2DM4A 1MFDL 5IVXE 1JPFB 2DM7A 3V6BR 2MQ3A 4JPKL 1O5DT 1UZ8A 3NFPB 1YMMB 2FATL 1YN7B 1T1WB 1RIUL 1RULL 4PJEA 1JVKA 3TVMC 3BT2H 1PY4A 5DJDA 3TH3T 3ULSA 1C16B 4ZPTA 1PGRB 3E0GA 1J0JA 4Q7DA 4ODXA 1ADQH 2RJMA 2OK0L 2J5LC 3PQYD 3FRPA 1GOHA 3V7AE 1DBJL 5BMFL 2XYCA 4LSTH 4JO2H 2YOCA 2PKDA 1CFBA 3SJVD 5C0GB 3DLQR 1FIGH 5J1AA 3DV6A 4QYOB 5GS3A 4JQIH 3UTQA 3F7YA 1N8ZB 4Y1AA 5F93C 1NGWB 4C56A 4TSAH 3C5JB 4NFDA 4PRID 1HILB 3O6MH 4XP1H 5C92A 5DQ9B 2I26N 2PO6B 3HCVB 3KDMA 2EDKA 1H3VA 4BA8A 3QI9C 1MJ8L 1P84K 5T1LD 2OJZL 4TNWK 2P49B 3KPPB 1RZFL 1TPXB 2IANA 4LLUB 1U8OB 2O26U 3IFOA 4G42A 3DUUA 4G8EA 3VXSD 2Y7QA 3BKJL 4HAGA 5CSBA 1QTYT 3G08A 1GXEA 2MPAH 2IJ0C 4OLXL 3SDCC 4ODVH 3MV9D 4X6BA 4D9RD 1XIWD 2J8UB 3RVTC 3LKRA 3NIGF 1CG9A 3HNTH 4FMFA 5C09E 3H3PL 1H3TA 3MRJA 4P2OB 5DJXA 4HCRH 2MFNA 2AJVH 4R0LA 3GMLA 1F11A 3H9YA 2BSTB 5TFSL 4OUUB 2J8OA 1U8IA 3QFJE 2YPLA 1EK3A 4OCYH 4NQVB 1BVLB 4KY1H 1CZ8L 4GQ9L 4M9PA 1MJUH 4JFEA 4X6EB 3Q5TA 2I25N 4LHUD 3FB7A 4WDIB 2YD4A 4LIQE 5D1XB 3REWB 3ILQD 3M17B 3KPRD 4R4FH 4KZDL 5EG6C 5JO5A 1RZGB 4WI8A 4HF5L 4M93C 3NGBB 3DUHA 5C08E 1I9IH 5JW4R 1HCVA 2XWJA 1EH9A 3BJLA 3ILPA 1SJVA 3BGFB 1DBAH 3VI4E 1U92A 2I9LB 3VWJA 1T2QH 2BSED 1H5BC 4LHQB 4WHYH 5E56A 5T1DL 2EXWD 1NGPH 1U36A 3ULUE 4YNYB 4XT1C 3H3KA 2I27N 5GS1B 3KLHC 3RX8A 5I18H 4G8GD 4OLUH 5E1AA 1H15A 3BJ91 3O6FD 4U1GB 4XNUL 5JA9A 4JO3H 2I60H 5HHOD 3QO0B 3HZMB 4NZTL 1CN4A 1N5AB 1C5CH 3C6SB 1BX2B 2GUOA 2OLDA 4M6OH 1AY1H 3T1FB 5D1QD 4GUPB 2BC4B 5JW4M 4X7TB 2V7NA 4PR5B 2XKNB 4IM8A 4GO6B 1H3UA 1I4FB 5IMOA 1CT8A 3WXWH 4ZDHA 3SJVA 5D7JD 4F2MB 1ZS8A 5IW1B 1FC1A 3OZ9L 4ZUUB 3KYKH 4NP4H 4CVZB 3BPCA 3QUZD 4NUGH 2FSEB 3GKZA 4JGJA 5HHME 2EIZA 3RL1A 1S7RA 4M7LH 2CIIA 4X80L 3PNWA 4I48A 4X7EC 3LD8B 1SYSB 3CCHA 2FEEL 2Z0BA 2W60A 1VCAA 2O5YL 1DQML 3UZEA 3VXSA 2IBGA 5GPRA 5IHBA 3AB0B 4HC1L 1XIWA 3CC5A 2YSSB 1WJ3A 4M6MH 1QSFE 4FQ2H 2ZP0T 3QFJB 5CWSA 4AT6A 1A4KA 5EPMA 3QA3A 5MEPA 1RUMH 2J6EH 5IT2H 5D9SA 5EU3A 4BELD 3THMH 1RQ5A 1EJOL 4DZBA 2HRPH 2ZUXA 4XCEA 1WWCA 3L5HA 2WBJB 4UNUA 3W2DL 2IEPA 4JY5L 4OFVA 4Y5YA 3GGWB 5T5FH 3TIDB 3B6SA 3QCVL 1KTLB 1PG7L 4O58L 1G7IB 4XCCL 3SDYH 4QY8A 2G75A 5I1JL 4LHUA 3TVMD 2CLVA 4J8RB 4I9WE 4UT7L 3KPRA 1LE9A 5ESQA 4G9FA 2IBZX 1M05A 4JM2A 3LKPB 4PRPE 4LFHG 5IESH 1KIPB 2HVJA 4HPYH 4YGAB 4XP5L 1U3HA 3JV4A 4JN1H 2XN9B 1AIFA 5C6WH 4X5XA 5DJ2B 1LO5B 3BPOC 3O9WB 4Y2DC 3T4YB 5CLWA 2E7MA 5FEBA 1MQ8A 1HSBB 5GISL 5J6HB 5DLMH 8CGTA 4NQDE 4ZUTA 4JY6B 3ARDB 4WI7A 1H3XA 4X9HA 4G8GA 4GBXB 1P2CA 1FFNA 4FTVD 3QI9D 5HHOA 5E95B 3PDOA 1A7QH 5I1GL 5IWLA 2NY7H 3QUMB 1TLKA 2C4XA 2DQCH 3HZYB 4Y4KB 4KVNL 4NKDB 1KJ2L 4NC1C 2R8SL 5E8DH 2WWMC 4OCMC 4RMTA 5ANME 1DLFH 4HS6A 2VDRL 1FSKB 2ZSWA 3BE1H 2VLMD 4R2GB 5D72L 3SDCD 2I07B 2DAVA 3QIWC 3RVTD 3D18A 5IUSA 3NCMA 3FMGL 5HHMB 5D7JA 5FA4A 5DUPL 1FGNL 1KIRB 1N59B 2R0KL 3MV01 4XMKL 3RWEB 5L2KD 4MA1B 2JCCE 4P5TC 3L3OA 1NGYA 4GXUM 4KDVA 3U9UA 1MCLA 4W81A 3EOTL 2XRAL 3CFJB 5TF0A 1GGUA 4I77L 3RI5F 2F54A 1U2HA 4HKXA 4RMRA 4KMTH 4AIZB 1RZ7H 2VH5H 4IJ3C 5DHYB 3PWJA 2FGWH 4JEGB 6FABL 5E5MB 3E6HB 5D1ZC 1JHKL 1KLUB 4YHLH 4CDGC 1G0YR 3BHBA 2SEBB 5AUMA 3PL6B 3ALWA 1XF3B 3VXRD 3GJFK 3NN8A 3QJHB 3RWDB 1MRFH 1XGYL 1F3DH 4PJGE 1Z6JT 4Z18A 3KLSA 2GEEA 5JW4Q 4MA8L 1CDHA 1EUUA 3P73B 1IL1A 1TJGL 4RCAA 5AZ2H 5KG9A 3RKPA 3KLHD 2DOCA 3RJDA 4DGIH 4DCQB 3VG0L 3TVMA 4DW2H 2PW1B 1UXWA 3UJIH 2E9IA 5IF0B 4UNTA 3E1F1 4Z78B 2R0LH 3HFMH 1XR8A 5D2LE 1EFXB 3X13B 1YECL 1W72L 1LP9F 1D6EA 1FCCA 3GNML 2MHAA 5GZNC 3QISA 3N06B 1E0OB 5KJRH 1QFUL 3P30L 3TCXA 4WTXA 4HIHA 32C2A 3MXWH 3PHSA 3ETBF 1BEYL 5FYJH 4H20L 3G5VA 4J3XA 1WITA 2ICWB 3WNOA 3MCLH 5BQ7A 4FTVA 3QI9A 3D39D 4L9LB 4DKFL 4DUXA 5J6GB 5IBTL 1AJ7L 1LP9A 3GHEH 1MFEH 1UXSA 4QRQA 1I1AB 1REIA 4YDVA 2DTML 3GSRA 1HINH 3SQOH 1OQXA 2EE9A 5GRWA 4YAQA 1EO7A 3S3SA 3QQ3B 4HJ0C 1DQDH 4HK0A 1LILA 4CJ1A 3OAUL 4NQSA 1OP5H 4ODHL 1IE5A 1QSEE 4KVCH 2Y07H 5CIPB 5JW3H 1FZMA 1KT2B 4MSWB 2CLRA 3EFFA 3E3QE 5HI3C 5E4EC 4PJAA 5FKAA 3HR6A 3RZCB 1J11A 1JPGB 3OKYA 1KTDB 1IZJA 1JN6A 1AD0A 2VR5A 1TCMA 1KELL 2GKIA 3U1SL 4ZOBA 3VXNB 3KYNB 1OCWL 1KIUA 5HBBA 1IAKA 4UOW1 2ED8A 1JPSL 1S7VA 5CEYB 2YR3A 1UACH 1F58L 3W9DA 4AENB 5CEZH 1F3DJ 1M6OB 1IZKA 3GBLA 4ONOA 5K9QG 3GSVA 1KEMH 1YEDA 3OPZL 1B0GA 2FX8H 2EZ0D 4WNQA 2ZUVA 4ZQKA 4Z0XA 3BD4A 4Y2DD 5DK2A 3MFGB 5SX4I 1JJUA 1YN6A 2HJFB 4G7VH 4CU8A 3P0YH 1XCQB 3GRWA 1HI6A 2W9DL 3HZKA 2VITB 3MUGA 3IKCA 1KJVB 4N8CL 3EAKA 3AM8C 3GM0A 4ETYA 4MCZA 5J9PB 4IRJB 1MCRA 4QRRB 4CN1A 1KBGH 1BFSA 2PETA 4OZFB 1EMTH 5ACZB 2WWMD 2GK0B 3BMWA 5BV7H 5JXEA 3MRQA 3GI8H 3CNKA 2YC1B 2X4TB 3QIWD 4HZLB 5DI8A 5DRWB 3F6LA 5DZOA 4OM1H 2P8LA 1G9ML 1T1XA 2NX5E 4OF0A 2DLHA 1AGBB 5SWQA 3ZE2F 4P5TD 1M7XA 3PWLA 1RIVH 3VGAC 3AXLB 1QQDB 3LHPH 3D39A 5KVGH 1NDMA 4Z0BL 1MSPA 3K7UA 4ZPVA 4HKJB 1HXYB 2R0ZH 3MBEA 2VLLB 3HPLA 4FMKA 3L3IA 5DZLA 3W39B 2GI7A 3GIVB 1JGDA 2GCYB 4K71C 4YPGA 3TH2T 3MGTB 4F58H 3I6KB 1QSEB 2Z8SA 4HUXA 5D1ZD 1HKFA 1J12A 1OSPH 3KJ6L 2DI9A 5DRZB 3DARA 5E2TL 2FECL 2IH1B 4PLNC 1J8HD 1K4DA 1J0YA 5F21B 3T2QA 3KPOA 4TPRH 5DMKB 5DXWA 3STZA 3BESR 4JB9L 3SE8H 5DR5H 5FO9A 3OF6D 3QUKA 5FDWB 1G9NL 4ODUA 5DQDL 4R97B 3EDKA 2EDJA 2VOTA 1QFWM 3VD4A 4X99A 1EEZA 1VGEL 2ZUQC 3RPKA 3VH8A 3VD5A 3P0GB 4LCWB 4K3DH 4U1NA 35C8H 1UC6A 1OGTB 4GRWE 3PDGA 4XVJL 3GO1L 3DWTA 5F72S 1IKFL 3B9EA 2JJTC 3FKUS 4WFGE 2PTTB 4N1CA 5T3ZL 3T3PE 2XA8H 5GZND 5EBWA 1Q9WA 2QR0A 3WLBB 5SX4H 3ES6B 5I1LB 4U1MA 2Q8BL 5F71A 4RMQA 1MUJB 2AV1B 1BD2E 3ZE1E 4OF7A 3GMRB 2FL5A 5DK0B 2FX7H 1ND0A 1QG3A 3VGDA 1FNSH 4RFEB 1BQLL 4WI6A 4PIRF 1A6VL 3I84A 3QG6A 3VG9B 3ESVF 1IGIL 4Q2ZA 1Z5LB 4Y88A 2WIMA 3RNKA 3QEQA 2Q7YA 1SHMA 1HHKB 2R2EA 3UTSD 2RHEA 1IAIM 4NQEB 5SWZD 1EX0A 3QIUB 2EDLA 2FWOB 4M7LT 1EEYB 3VGGA 4P5TA 5HI3D 4GAJH 2D31B 3MLTA 3L9RB 3FAXA 1DANU 4F15B 3BT2L 4PLOB 4ZAKC 3ARWA 4JRXD 2AEIT 5DVOA 5HI4D 1UGNA 3O45A 4NZDA 2Z4QB 3FFDA 1ADQL 3FT4A 2J7LA 3PWUA 5J1TC 3BXNA 4LQFH 4ELME 3TEUA 2V5YA 3FQXB 3JXAA 2B7DT 1KJMB 1EDQA 5D1ZA 2NY5C 5FECA 4PJFE 1FIGL 4JQIL 1ZSDB 5DJZA 2FX9H 1D5IL 1RHHA 4HIJA 4F7MA 5E6YA 4GS7B 3U0TA 5ICZB 2XG5A 2X05A 5IVNA 2OQJB 4JFDB 2D9QB 3OTTA 3OJVC 1UQSB 3ECBA 2NYYC 3MLSL 3KWWA 5D7LE 3GIZH 2DLTA 3B2VL 4WTZA 4PP2B 3T0EA 2IPKA 4MD5B 2C7UB 4PGBB 3OJ2C 4PJ7B 4GRWB 1U3JA 3BZ4B 1JZ6A 1HXMA 1MY5A 2FRGP 4XPFH 2X4OA 3RWCA 3TJHC 1NSNL 5JQ6H 2VTFA 4QHNB 1FNEA 1KLGB 7CGTA 2DWEA 2KPNA 4NZUL 4GH7B 4GT7A 5HXMA 1D5MB 1NGXA 3WNPA 1Q9OA 3UEZA 5EN2B 1D6VH 2EC8A 1NLDH 3QHZH 1BVKA 4OCYL 3VFMB 5DSCB 2CQVA 2EH8H 5TDPB 1MJUL 3DX9A 2EDXA 2Q76B 4TNVK 3D25A 4OGYH 4PY8I 5C6TL 1AXTH 4HH9A 2XA3A 1UYWL 4LMQE 2ED7A 4OZHF 1D9KA 3HG1A 1I9IL 1KLFA 3T2NH 5F9WB 4PJ5B 4Y5VC 4U1LA 4P3DA 4AIOA 1DBAL 1IAMA 3TA3A 1MAML 1NC2B 1JP5A 5IBLC 1T2QL 1AHWB 4XTRC 4XXCC 3TGXA 1NGPL 3FT2A 5I8CA 2AK4D 4K7PY 2D0HA 1JK8B 5FYKH 4Q9BA 1TQCB 3IXAB 3MCKA 4U6HB 1T1YA 3BPNB 4JRXA 3TNNB 5DMIH 4K3JL 2ZOLB 4ELMB 4P4KB 4HX1B 3C5SA 1C5CL 3FO9A 4YO0A 4M6OL 1AY1L 4NT6A 1CGXA 1CE1L 5EH1A 3WKMH 3CSPA 1HKLH 1I7UA 2A6DA 2NY0B 4FQHA 3BEVA 4TSCL 1ZLWH 4QXTA 1WFTA 4NPYB 4I3GA 3WXWL 4GG8A 4ORGA 5IGXH 2R2CA 5IM7A 3KYKL 3MNVB 1A9BB 4NUGL 3RBGA 4N8VB 2V5SA 3TNMB 5DDHA 5KSBE 1S9KC 4PB0H 3EO0B 3WUWA 3NPSC 4J3OC 3QWOA 3C60B 2H2SC 4XMLH 1F2XK 3OKDB 1OW0A 3RUGB 2X4NB 3AM8A 1H3PH 1BLNA 4LSSL 3UMTA 1A3RL 1B0RB 4FQ2L 5KANI 3I02B 2A73A 2HA1A 3KLDA 5I1AB 3AS3A 3H42H 4OB5L 4RA3A 3BVNA 1MHHB 3UC0L 1PKQE 1NBYA 3DUSB 2HKHH 4OQ1A 1RUML 3AMKA 2J6EL 4ONGH 4XB8A 3O11A 5HYFA 3THML 2BNUB 3QXAB 1FZJB 2WIIA 3QXWA 2HRPL 1QEWA 5BRZA 1UVQA 2MCPH 3VWKC 3L3JB 5HGAB 2BVOA 1G7JB 1W0VA 4PV9B 1NKOA 2ESVE 2ZSVB 5FGSA 4ZAKD 5C0IB 4UAOC 5L7XL 4HHAB 5ALCH 4D8PB 1NJ9A 4ZTOH 1OP3H 4V1DE 4DEPB 4S1QH 1QR1B 4L5FH 4UTAL 3EYVA 3GMQA 1N64H 4HEPG 5IKCB 4FHBD 1NAKL 3IJHB 4TUKH 1PQZA 5HDOA 3B9VA 4QF1B 4YHYC 3SKNB 5I71C 1E6OH 5DLML 2UYLA 3GJFA 5D2NC 3X3GL 3QDMD 1AQDA 4HGWB 1KF9B 3OB0K 2VMFA 2H1PH 2NYYD 1A7QL 2NY7L 3KHOA 3HRPA 5E9DD 4P5MA 1A21A 2AW2A 4ZYKB 2WINA 1O7VA 5JOFB 1D5BB 4U7MA 5E8DL 1L7TH 4YE4H 3BP4A 1DLFL 1RU9H 3BE1L 3MQIA 4DTGL 1MVUA 2NY3B 5DJYA 2ZJSH 1MREH 4PJ8C 2DL2A 4Z7UF 3LMJH 1HHIA 2P45B 5TH2A 3AROA 4G8IB 3RHWK 5L0QC 5CILH 3WFDH 1IC5L 1I1FB 2BERA 1HSAB 4PGEA 2JJTA 1MHEA 4DZ8A 2EDYA 3D0VB 3PWPE 4OM0H 4N0CD 2CDEA 3LIZH 4M7ZC 1QRKA 4Q58C 5BCAA 3ESUF 5J89A 3V4UH 1J88A 4GMSL 2IG2L 1PKQB 4KMTL 4YDJA 4DN3H 1RZ7L 4LASH 2EH7H 2WAHA 5E99H 5BZDB 4YHLL 3GRWH 3RU8L 4MVBC 2NW2B 4MJ4A 5F1IB 3TT3H 4JFFB 4YFLI 5I30L 3HI1B 1MRFL 3GFUA 4KROC 4CMMA 4YGVB 4I18C 4PY8J 2E3VA 4QCIA 1G7HA 1KJ3H 4MNQE 4XTRD 2ESVB 5FGRA 5AZ2L 1OSZA 4I2XE 1MOEA 4LEOA 4DGIL 3FQNA 4V1DB 3CUPB 2ENSA 3LZFL 5HJ3B 3TBVB 5ID0B 4DW2L 2BOCA 3LRGA 5I8KH 1DE4B 2JF1A 4ELKA 3UJIL 1EXUA 5KS9E 4Z7QF 1C7TA 1S3KH 1T83C 2CJUL 3FT3A 1XGUA 1FL6B 3H0TB 4M1DH 1XH3B 3WD5H 1FNAA 3NCCB 3I6LD 4HULB 2WW8A 5ACLA 1QBMH 3MRCB 1CR9H 3OR6B 4M62L 4YIQA 3B9KD 1F02I 3S34H 5KJRL 2BSRA 1URLA 2C26A 3P40A 2Y9RT 3VFRA 3MXWL 5IHZB 5A43C 5FYJL 1MHCB 4JG1H 2PW2B 1MFCH 3QDMA 3K0WA 4MQ7B 2A6KA 3MCLL 2XXCB 3CSBA 4CNIB 5C0JA 3GMMA 1T0PB 1AC0A 1QSZA 3L5WB 3TO4C 5DMYA 5E9DA 2QQQA 1MFEL 4Z7NE 2H2SD 2DQEL 4X4ME 1CDBA 3C5ZB 4Z77A 2AJXL 2OJEA 4IRSB 4JFYB 4OZGE 3RA7L 1PD6A 1HINL 5J0BA 5D7IA 3SQOL 1R5WB 43C9B 3H9SE 4MD4B 3UBXA 1DQDL 4NN7C 1NCCH 5SWSD 2G60L 4ZFZB 3WDJA 1A7PH 5I16B 2IPUG 4XHJC 5C0CB 3BP5B 1NUGA 3PWPB 2EEBA 2H3NA 1MJ7H 2Y07L 5JW3L 1P6FA 1A6ZB 5CGTA 4X5WA 2VRAA 5DVLA 2Y4SA 4JAMB 2HJKB 2VLJB 1RJYB 5D7KD 1I8IB 1P4IH 5C2BH 2DBLH 4GW4A 5J3HD 5INCB 5FM8A 3RWFA 4LPTA 2YN5A 4ZFOB 2DQJH 4LLVB 3BW9A 4AG4H 2IQ9H 1JF6A 1UACL 1P69B 3FQWA 5D6CB 1MHPL 1T0NA 3UXFA 4E0RA 1SJEB 1XMWA 3HR5A 4PLJC 5EZIH 2DQIL 4FG6D 5EZLB 5C8JA 4YHOL 5GJTH 4JFHD 1TPXC 3MRFA 1EHAA 4MNQB 4FFVC 2X1QA 4QTHA 4UDTA 4Y5VA 5I73B 2FYYB 3CLEH 3BPLC 5ERWA 4RIRA 4LK4A 1C08B 3S88H 3OKNB 2LAAA 1NBVH 4FFYH 4JKWA 1EGJA 4XXCA 4P48A 1YYMH 1XGPB 4KKCC 3P0YL 1AD9A 3D3VE 3GDBA 5DVMA 5KS9B 1TZGH 2VZUA 4RAHA 4LFHD 2UZYB 2FLBT 5DGQA 4K8RC 5HGDB 2C4FT 4UOJA 3MOBH 3MRGB 4ACPA 2YUZA 5TQ0H 4HWNA 4MGXA 3NZHL 5BZWB 3VCLA 4XZUB 4WTWA 5KVMC 1V7MH 1ZE3C 1KGCE 5ENWA 3FB5A 5DS8B 1DDHB 4PJ8D 8FABA 3R06B 5ICXB 5KW9H 4APQC 2BNQB 5KOMC 4LRNH 5EOTB 4UI2A 1AI1H 4RNRB 3NGBC 4S1RH 3LHPL 2AJ3A 3NIDE 4OF6A 4NUJB 4K9EL 3H9SB 4RQQA 2R0ZL 1FAKT 3DVGA 3TJEH 1E4XL 1MLCB 4L3EE 1JUFB 3ZHDA 3QULB 4CBPA 4C83A 1YEEH 3NPZB 3Q0HA 4N0UA 4R7DA 3T2PA 1UWGH 4YXKL 3TC9A 4KI5D 3TF7C 4Y16B 3ROOA 1S5HB 4U1GC 1OSPL 4MVBD 4XCYA 3V4VH 1QZ1A 1BVZA 3QDAA 4JZNA 4WVRA 5IJVB 1YEGH 3HUJB 3NIFE 3V79C 4KUZH 3I3DA 5FYLD 1GRWA 2A74A 4PJIE 5K33A 2H41A 3LS4L 5C0AE 4KROD 5ESAB 5FK9A 3TN0B 3PG2A 4P2RE 4TPRL 4NM8H 1MCBA 3TBYB 4BSWB 3SE8L 2XWTB 3OAYK 5DR5L 3VWKA 4LKXA 4Y4HC 1NFIA 3MRNB 4F3FB 1N6UA 4OLYL 5I1CH 3LKNB 4NSKB 3C8DA 1YEIL 1P84J 5ICYB 3GMPB 3V6FB 5JLZB 2BFVH 1IBGL 5CBEB 2IADA 2IMNA 1MI5A 3LD8C 4N1EA 4XGZB 4L4TD 2BVPB 4MNGA 1FORL 4M5ZH 4A6YB 4XI5C 4NKIH 1M7IA 4I5BB 2KZ1B 1YNTB 4XNMA 3QQ4A 4TUOA 1FL3A 5DEGB 1RUQH 1TETH 1U8PB 2EDTA 3ZYOA 2FX7L 5H37G 4ZMAT 4JPVH 1YPZE 3ARGA 3IDYB 3WIIL 4H8WC 5F7EL 5CHNA 3LKSA 1FNSL 2VLKA 3TO4D 1ZHKA 3O4LD 3ZTNH 1CDCA 3MOQA 3O6LH 4KV5F 3BSZL 5IR1B 2X4UB 1LEGB 5DJ8B 1S7SA 2NTSP 1R5VA 2CXKA 1FNFA 3L3HA 25C8L 1FLRL 2JTDA 1INDL 3WDIA 1AKJB 4F8TA 4XHJD 4DGVL 5LGHH 1YDPB 2A9NL 3F7QA 1ZT4A 1S7TB 3QEHA 4GAJL 5SV4A 1PFCA 3B8YA 4PPTA 1GGBH 2JKXA 3MNZB 3DBXB 3ARRA 4L3EB 5EU4B 3KYMB 5HY9B 1CU4L 4U1SB 3ULUC 4LNVA 3DURA 4KU1A 2B8OT 3HAEB 1BFTA 1K8DB 4UU9A 4E42A 4JCLA 4K2UL 1EO5A 3V6ZA 5DRNA 3DO3A 4X6DF 1DBMH 4GBXC 3GSUA 5EU5A 4PJIB 4D2NA 4RFOH 4PLJD 3SCMC 1JNHB 1U8QB 3NA4A 4P2RB 4YHIB 3IS1X 4FFVD 3N1MC 1X5LA 2IGFH 2FHCA 5FO8B 5F7FA 1BZ7B 5T3XH 4X98B 4KKCD 2ADJB 2P47B 4QNPE 5I76A 4HWUA 5I2IA 1BJMA 2ITCB 1IT9H 2YD1A 4JZOA 3SKUD 4JDTH 4BQBA 3KXFB 3DSFH 5EUOB 1KCRL 1S8DB 3VRLE 1YC8A 4K8RD 4MA1C 4L8SB 1T83A 3EFDH 5BXFB 1WICA 5C0NC 3PHOA 3DIFB 3QUXB 3V5HA 1DUZB 4F7EA 2R2HB 4DK6A 2IQAA 1INQA 4O2EA 4WFEE 5F89B 3UTTD 4L4TA 1UB6A 1H0DB 1Q1JH 1NKRA 4M5YH 1T03H 5I66B 1A6TA 2BCKA 1K5NA 3OHXB 4RMVA 1RUAL 1TZHA 3QHZL 4APQD 1R3HB 1VEMA 5F3BB 4HIEB 3BEWB 2EH8L 2R29H 4UILL 3U30C 3ARBD 3QJFA 4XVTH 5J8OA 3PGDA 4L4VB 3DX7A 1J0HA 3KYAA 4Y5XB 4OGYL 5JIKA 3TO4A 4PRHD 3O4LA 1JPFA 2AERT 2VR4A 4CUCA 1BQHG 2WZPD 3MLRH 3GJFH 3NFPA 2JJWA 1MFBL 4MXWL 5KBNC 2IH3A 4P2QB 2CUHA 1YN7A 2A1WH 4P46C 1T1WA 4X7SH 5IROC 4JHWL 2YXMA 2FBOJ 1EZVY 4NWTH 3LV3B 4DKAA 1XF2B 1NCBL 4RRPG 5T1KD 4X9BA 1C16A 3MLUH 3O4OC 5I19H 5B8CB 4GRLB 4G6FD 4GG6A 5EU6E 5DHVA 5FYKL 3RY6A 4ZOEA 1YUHB 3UBXI 4WJ5A 4PJXA 3ALPA 3C8KB 5DMIL 1Q0XH 3J8F7 4YBLC 1SBSH 2A2QT 2L7UA 4Y4HD 5C0GA 3NBNA 4U0RC 2WQ8A 4QYOA 1BIHA 1N8ZA 1NGWA 2VSCA 2OXGA 2J8UF 3C5JA 1EA9C 2UZXB 5JHLL 1HKLL 4ZO6A 4IEFB 5DQ9A 5CCKH 4LDEB 3HCVA 3UDWC 4JKPH 5C07B 4BUGA 3D2UD 5JQHC 4NN6C 3IDGB 3UAJC 1CYGA 5BVJB 3ZKQD 5IGXL 2ADIB 1I1AC 4LLUA 4U33A 1JYWA 3OGOE 2PTUA 2R23B 5C09D 3OKLB 4OD3L 5DUMH 3MJ8B 3ROLB 1RK1B 4XI5D 2OP4H 3BH9B 3FOMA 1U8NB 2J8UA 4HS8H 4O2CB 4OIIH 3LB6C 3QNZB 4P2OA 3ARXA 1FP5A 2BMKB 4M7JL 1KPRA 1IEAB 3P4NB 2ARJQ 3MLZL 4NM4H 2BVQB 3LH2H 2AXJA 1DEEA 5CJ5A 4BSVB 3H42L 1TJIH 3QPXH 2VSDA 1BVLA 5EIIB 3IDNA 4X6EA 3Q5OA 4JHAH 2ZPKL 4APQA 2A83A 4LNRA 3REWA 5C08D 5DQJB 4LLDB 3M17A 1NEZG 1QHOA 1I8LC 4WY7H 1ED3B 4K3EH 2MCPL 4LPVA 1II4E 1FZOB 1OWWA 2I9TB 3IS0X 3MLYH 1TVDA 2BNRE 1DUYB 4MS8D 1J10A 4BH7B 1ES0B 5FA3B 1CFSB 4S1SL 5KAQF 2E5EA 2EECA 3WJJA 5FO7B 1ZHNB 4S1QL 4YNYA 4L5FL 5GS1A 1JNLH 1N64L 5FFLA 1MQKH 5EU6B 2AV7B 3SCMD 5HVWA 3NIGE 4FQ1H 3HZMA 2Y25A 1E6OL 2PR4H 4HBCL 3MACH 1YEKL 3QHFH 5GGSA 1BX2A 1NMCC 4DFIA 4HG4K 2BC4A 5C7XH 4X7TA 1P7KA 4PR5A 2XKNA 2EEDA 2APXA 3N1GC 3F12B 3RAJH 3HMXL 2QLVB 3CD4A 4Y4HA 5HYIA 3KNBB 5HHMD 4F2MA 3CVHB 3IJSB 4ZUUA 1L7TL 4YE4L 1WFOA 4WI9A 4DN4H 2ZJSL 1N3NA 1MREL 4HXAL 2P5EE 3MTRA 5C0ND 1U93B 1OAKH 2QSQA 1MFAH 5GIRB 3WFDL 3KPNB 4EDWL 3SKMB 5D96C 1ULVA 4YR6B 1QSFD 2BSSB 2J88H 1U58A 1FIEA 3N85H 3Q3GA 1CQKA 2YSSA 2APWA 4OM0L 2FO4B 4OF8A 3E3QC 3MODH 1PSKH 3LIZL 1JF1A 2IMMA 3QFJA 4TUJA 1QBLH 4MDJB 4DN3L 4NOFA 5FHAH 2ADFH 2EH7L 1EGJH 4WHTB 5E99L 2YK1H 5D8JH 1RVFH 2R39A 5F1NA 2N7AA 2WBJA 5AG9A 4O2FB 4I9WD 4L8BB 3ARFB 4P46D 1KTLA 3DHMA 4MX7B 5CBAB 4EIGB 4PRPD 3UYRH 4EVNB 3FCTB 4J8RA 3ARYA 1KCSH 1N0LA 1ZVHA 5LAXB 4E9LA 3HC3H 3LKPA 3HLAB 3U9PH 1KIPA 5F9DC 5IQ7H 4K7PX 4RAVB 4EOWL 4URTB 1KFAH 1LO5A 1L7IL 4NQDD 4M1DL 4WWID 3KPQB 3WD5L 4V2CB 4UMGA 5J6HA 1LK3L 4OFKA 3ARDA 3DOSA 3TIEB 2B4CC 4GBXA 1CR9L 3P4MB 2I24N 3UAJD 1NQBA 4NRYB 1CIDA 3QUMA 4Y4KA 2J12B 4K94H 4NKDA 4YDKL 1ERNA 1I1AD 3MA7B 2VZSA 2XOTA 4G9FE 2V5MA 4NCC1 3NABH 4R4BB 3FL7A 2I07A 4RFNC 3MV7D 1T0MB 1B2WH 3LB6D 1KIQB 3IRZA 4MMZC 3QIUC 1KIRA 1N59A 3EW3B 3RTQC 2P5EB 4JFQB 4OGXL 4OJFH 5C70A 2YWYA 1IILE 1A1NB 5IEKB 4AY0A 2FLRT 2NZIA 3CXDH 4X8JA 3QDJE 4NQCE 1NCCL 1UWXK 2ZNWA 3L6FB 4XH2A 3WXVL 2DQFA 1MCWM 3CFJA 2LU3A 1P5VA 3T77B 3V5DB 1MJ7L 1G0DA 1A5FH 4X7CC 2Y1VA 4TRPL 1QSFA 1RV6X 2PTVA 3LQZB 1BQUA 4JRYE 4NO5B 4PB9H 3S9DB 1YQ2A 2VDNH 2VQUA 2C3VB 2GTWB 5E5MA 3E6HA 3TCLB 1AR2A 2NPLX 2SEBA 3PL6A 1XF3A 5C2BL 2DBLL 1CLZL 4ZS7L 3QJHA 3W11C 1ZGLB 4OBSA 4GJTB 4IDJH 2DQJL 2E6QA 4WGWB 5JIHA 5TE6H 5DTFB 5GS2H 1DLHB 3MX0A 5EZIL 1B6DA 1S5IL 3P73A 1A6PA 4P46A 1SEBB 5JW5A 4DCQA 5MP6H 2R56H 2VXUH 3S88L 2PW1A 2I5YL 4H26B 1T5XB 2X4SB 1XGTA 4FFYL 2D9CA 5IF0A 4Z78A 4GW1A 1YYML 3SBWA 1TZGL 5FOBA 1EFXA 3X13A 3HKFA 3BDYH 4HD9A 1X5HA 5HDLA 4NQDA 3MOBL 1U8KB 1Q72H 1NFKA 4ONFH 2VYRE 2B39A 5HYSB 2CUMA 1NCAH 4JLRB 4LPWA 4BH8B 3UDWA 3FONB 2ICWA 2V7HB 4KAQH 4L9LA 5KW9L 3AMLA 5ANMA 5J6GA 1LNUA 1CI5A 2LQRA 4ORZC 1I1AA 2NW3B 4LRNL 1AI1L 3X17A 4CU7A 4R4NC 3CU7A 5F88B 4S1RL 4IMKC 5TDOB 4QRSB 1V5JA 5F9WC 3QQ3A 4JO4H 2J4WH 1KPVB 2JCCA 5EA0H 2FH6A 4J4PC 5DJ6A 1WCQA 3A6OA 1FLTX 5FYLH 3QDJB 1I75A 2APFA 4NQCB 3MJ7B 4QEGA 5CIPA 1KT2A 4MSWA 2PN5A 4DOHE 1YEEL 1MCKA 2CO7B 1A0QH 1TQCC 1E4KC 1I9EA 1XGRB 2VE6B 1JPGA 3FOLB 1KTDA 3PJSB 5D71L 3V4VL 3S5LG 4JRYB 2NNAB 1OB1B 5IQ9A 5CKAA 1YEGL 4KUZL 3LN9A 4J1UA 1ITBB 3KPSB 1IVLA 3VXNA 3ZTJH 3KYNA 1LP9E 3L3KB 1HQRB 5CGYC 3S35X 1CBVH 5CEYA 4H25B 4J3SA 4NM8L 5J57B 1I8LA 4AENA 1T20B 3L5IA 1M6OA 2BRRL 4PJGA 1X3DA 2CR6A 5KVEH 3QZWG 3OX8B 3CMGA 5F3HB 5I1CL 3PP3K 3KPTA 1N5YH 2HJLB 4M4PA 5D7SL 2W1NA 2VZTA 4NN5B 2Q8AH 4M7KL 2P46B 1J86A 4X4XB 2HJFA 1FFPB 1ZLVK 3QT2A 1XCQA 5HDBF 2VDQH 2VITA 4YDLC 2XFXA 4XAWH 1KJVA 4M5ZL 4OFDA 5J9PA 3STLB 1F4XH 1HYRC 4QRRA 1TETL 1MCDA 2D7QA 5GJSH 4ZNEE 1LEIB 2E9BA 4UIMB 4OZFA 2YXFA 3OR7B 5ACZA 1EPFA 1T1ZB 3GKWH 3BIAX 3UJTH 5JORB 4XPHL 2YC1A 2X4TA 2NX5D 4HZLA 4N5EC 5FF6B 4XWGH 5DRWA 2QHRH 3ZTNL 2KKQA 3O6LL 4XNXH 3RVXC 3QIUD 5JIIA 3VXPA 3RTQD 4C57C 3MUHL 4NQXB 5DHVH 3O8XB 4FZ8H 3AXLA 2VXQH 1QQDA 4U7KA 4CADA 1T3FA 3GBNH 4WFFE 1WUNT 4WEBH 1MRCH 1HXYA 1OGAE 3FZUC 3K2UH 1EBPA 3VFPB 3WS3A 5LGHL 1NGQH 2QKIB 3IDXH 4XBGB 3HE7B 1LD9A 2LTQB 4L9DA 2GCYA 1GGBL 3MGTA 4HUUB 3I6KA 1QSEA 5IW3A 1EHLH 3RDTD 4DOHB 4PRDB 3GJEA 1CXIA 2E9JA 3VFGH 3UTZB 5DRZA 5FCUH 3EYUH 2IH1A 5GGVL 3W11D 1TQBB 2R0WL 4DQOH 1Q0YL 2P5WB 4G6KL 2ENYA 4MD0B 5DEFB 5DMKA 1BBDH 2R1YB 5E24E 1KSRA 1ODAA 2X1PA 2EXYC 2AJYL 4K8RH 3OB0H 1YQVH 1QHPA 2B2XL 3FRPG 2IGFL 3E6FB 3KJ4B 4OQTA 5EU7E 5A16B 1LO4H 3W0WE 4HWEH 5T3XL 5HYJB 4LCWA 4KDWA 3CFBB 4WFGD 3MRDB 4ZSOE 1K3IA 3U46B 1IT9L 3ZE2E 3R0MA 1NCNA 3FQUB 1G9MC 3DSFL 5IB3A 4FQLL 4IOSD 1BD2D 2PTTA 5I9QB 3F5WA 5DWUH 4RGNB 2A6IB 2PUQT 3WLBA 3ES6A 3QXTA 4MQTB 5I1LA 2CRZA 4V2BA 3TESA 1H3GA 5A2FA 5I6XB 1MUJA 2WUCH 2AV1A 3GMRA 1ZGLP 5DA0B 2XQYK 3CFIC 1QFOA 1Q1JL 4M5YL 3EYSL 4B7LA 4RFEA 3B2UC 4PG2A 3MV8D 1RURH 1UJ3C 3WKNA 1BJ1H 1Z5LA 3AREC 3S35H 2R29L 2C3GA 3LEYL 4HGKC 4R4ND 4HIIB 1FPTL 1HHKA 1K9TA 4KMLB 2F5BL 1FE8H 3A67H 1KNOB 1RZKL 3C6LB 1A14H 1JPTH 1TNNA 4NBXB 4NQEA 3HMWH 1CGSH 2CSPA 4J4PD 1RMFL 5E7FA 3QIUA 4ZUSB 3MLRL 3MGAA 4JJ5A 5F44A 3RTQA 1JZ8A 1IM3A 1CTNA 2FWOA 1TNMA 1U42A 2D0GA 1OGAB 3LS5H 3DI3B 2A1WL 1W0WB 4YWGH 1N2RB 4JPWL 2D31A 3K2MC 2YKLH 3L9RA 3TH4T 1FH5H 3FN0H 5DZNA 5I19L 4YX2L 3FN9A 1L0YA 2Z4QA 2PYEE 3MO1B 4NYLB 5CGYD 1ZV5A 5I8EB 4YPJA 1J1PL 5F1SA 1DSFL 2W0FB 4NDMA 1SBSL 5LBSH 1R5IA 2D4FA 3VE0B 4PJ7F 4GRWF 5CP3H 4D0DB 1ZSDA 1UWEL 1Y6KR 5CZKA 3LOWA 4X6CB 3HNVL 5D7LD 4QHLA 2OQJA 1OQOA 1UQSA 5CSZB 3SEPA 3BDBA 4YXLH 4XNYH 4H8WH 4PP2A 3TYGH 2EYTB 2V5RA 2C7UA 4PGBA 4IRSC 3SN6N 5DUML 2P8MB 4PJ7A 4ZSOB 5EUKB 3BZ4A 3GMOB 5DGRA 5E8OB 4HS8L 4LIQH 5B21A 2GJ6B 4CN4A 1I7TA 1I3GL 4QHNA 4RZCB 4LKCA 1KLGA 1HWGB 3RIAK 3UX9B 2AXFB 4XP9H 3MLXH 1D5MA 5E03A 5MEOB 1BD2A 4LAQH 3CZJA 4N5ED 5EN2A 5HHQB 4NM4L 3LH2L 3RVXD 3GEWB 3NTCH 4AM0B 3RL2B 4BYHA 1U8LB 2B1AL 1TJIL 3QPXL 5DSCA 4H0HB 5TDPA 5IMLB 1BJ1J 3RWGB 3ULUH 2Q76A 4LSUL 1J7VR 4P49A 4M48H 1MIEH 4RDQF 4ODBD 2P1YA 4GQPH 5GGUB 3FZUD 2GTZB 3SY0B 1BZ9B 4WY7L 4K3EL 4FQXB 3EGSA 1R3IH 5FGBC 5F7UA 1HZHL 4I0PB 4P57B 4IMKA 5BW7C 1QFHA 2ICWI 3OJMB 3QUMH 3DO7B 4OZIE 1NC2A 5K59F 4MZ3A 4JY4B 3EOBA 3HE6B 3SDAB 2QJDA 1AHWA 4S10A 2NY1B 5ESVB 3ZHKA 4LHUG 2X41A 1BQHB 1JK8A 2HFEB 4DKEH 4KC3B 1IGMH 1E4KA 5EO0B 4JREB 2PYEB 4X9GA 3RBSA 4FQ1L 1T6WA 1FGVH 2ZOLA 4P4KA 4HX1A 2PR4L 3FO2B 4ELMA 4LOUC 1X44A 1FV1B 1JRHI 3IFNL 2MKWA 5C7XL 1W0YT 3JWOL 1DQJA 1OAUH 3RAJL 4LVNB 5FUOH 3RUGF 3DMMB 3IXTB 5JMOC 1X6NA 5DFWH 1QVOB 3Q6FB 3RQ3A 4N5UA 3T0BA 4EN3D 3MOAH 4N8VA 3TNMA 1EVTC 4MJ5B 4U0QB 3X3FH 5EC1B 5C9JB 3EO0A 4FQIH 3MRIB 5M95B 1OAKL 5K9KB 1MFAL 2BXYA 2CD0A 5E2UH 1BIIB 5C6PB 2RQ8A 3OKDA 4OZHE 5IK3B 5C0BE 3RUGA 2X4NA 1ONQA 3B2UD 5DVKA 2P24B 1I85C 3N85L 2EKJA 2RCSH 4U1HB 1B0RA 3ARED 1U3YA 3I02A 4PLKC 1OHQA 1MHHA 4U3XA 3DUSA 3BYTA 4O4YH 5FHAL 2OR7A 3F58L 3E8UH 1EGJL 5H2BA 2BNUA 1OWRM 1FVEB 2YK1L 5D8JL 1WCBB 2NXYB 2V17H 3M45A 2QQKL 3VFTB 3L3JA 5HGAA 3IDIB 2E7HA 4PJCB 1G7JA 3UYRL 4PV9A 2CXGA 2HLAB 1T5WA 2ZSVA 2OTUB 3CH1B 3OAYH 1VPOH 5SV3A 1KCSL 1EZVX 5C0IA 1VFOA 2EC9U 4JGMA 4HHAA 4D8PA 1MAKA 3UJJL 1EVUA 1QR1A 4OZIB 5FKPB 3U9PL 4JQXC 5EWIH 1NEZB 5T3XE 5IKCA 3IDMB 3IJHA 4Y4FB 3W9EB 4XMPL 1KFAL 2LVCA 4QF1A 5T3ZD 3SKNA 4TOYH 1HHHB 2D7TH 4PJ9D 2VN7A 4UT6H 3H6JA 2AKRA 4JQVC 3F8UB 3BKMH 4FFZH 5ADOL 2C1OB 1RHFA 2AQ2A 4OI7A 3MLVL 1GOGA 1OD9A 4EDXB 1ACYH 5BRZE 1MFDH 4HGWA 3OG4B 3X14B 4EEEA 4QT5B 4KK6C 1UT9A 3MBXH 4K94L 3BGMA 4GKZB 5CIPH 2FATH 2D2OA 1TIUA 1D5BA 1OP5K 4WW2B 4IRSD 4OKDA 1RIUH 1RULH 4UQ2B 3ZDXF 4LVOC 4YXHH 5FHBH 3VMNA 1A7NL 4LGRB 3VW3H 4KH2A 1B2WL 1FJ1B 2B1HH 4QXWA 4DGYH 4G8IA 2X1OA 4HV8B 4QOKE 3V4PH 4ZO8A 5ITBL 1HSAA 3X12B 3MFFB 1AQKL 1JNNL 2R1XB 5BMFH 1NGZB 3QH3B 3D0VA 1OAXH 3UCRA 4RGMC 5ALBH 1J0IA 3G5YB 4N0FB 3D6GA 1OAYL 3C09B 4NNXB 5I1HL 2FNBA 3QEUB 2A6JB 4PB9L 1PKQA 4WFHE 1UJ3A 1PG7X 2VDNL 3RGVD 2ERJC 4IOIA 5BZDA 2D4DA 3AREA 1F3JB 2JJVA 5JPNB 1RZFH 1I8KA 2NW2A 3QRFM 5EC2B 1P1ZB 1T04A 3MREA 3P9LA 4HGMA 5F1IA 3BKJH 5IFAH 3VRIA 5I15H 3HI1A 2EDFA 4YGVA 4FS0A 2X9XA 5LXGL 4G6JH 4OZFH 2ESVA 3QYCA 4M1CC 4WWKB 1K4CA 2FO1A 4XCFL 5MP6L 4V1DA 2R56L 3HB3D 5HJ3A 3TBVA 1GOFA 5ID0A 2ICWJ 2VXUL 1HH9B 1RJZB 4JKLA 4CL7A 4NRZB 1DE4A 4Z7UE 3H0TA 1J5OH 2E6JA 1XH3A 4LOUD 3TZVC 4U1JB 4R8WH 4WUUE 4UQ3B 5ISZE 3ARZA 4OKVB 3BDYL 5KN5A 3ULVF 4YK4B 4C55A 2QSVA 5J06A 1DQQB 5KANG 3HC0B 3CFKA 3CSYB 5ADPH 4F80A 1Q72L 1LO0H 5IHZA 1MHCA 2PW2A 3R0NA 4GFTB 4YC2C 3MZTA 4MQ7A 3REVB 1K2DB 3CDCA 4KAQL 5A3IC 3L5WA 1F45A 3MSPA 4M6NH 3VXTA 4N68A 1Z9OA 3U6RB 2XTJE 5CEXB 3CFDB 2Y5EA 3C5ZA 4LSQL 1GAFH 4LLMA 4IRSA 1R5WA 1J9CT 43C9A 4KI5F 5EO9A 4QOKB 3QQ9C 1KCKA 4JO4L 2IC2A 4RX4A 5EA0L 4PLKD 4ZFZA 5DYOA 5I16A 4K7PL 1BFVH 5F7LB 4K3HA 5C0CA 5HI5C 3BP5A 1GGIL 3NCYP 3PWPA 1SYVB 4D0CA 4OQTH 1A6ZA 4GRLC 4E41B 4LF3B 2D0FA 2H32B 1RFDH 1FFRA 4F8QA 2VABB 4X4YB 4Z7QE 2BY0A 1CFNA 4JAMA 2HJKA 3OZ9H 1AFVH 1U9KA 2BZDA 3H2WA 1RZ8A 5INCA 2F74B 4ZUWA 4ZFOA 3JTTB 4X80H 5D6CA 2AJZB 1SJEA 3EJYD 5FGBA 1MH5B 2B4CH 5EZLA 1Y0LB 5J7CC 4LL9A 4XPGL 2O5YH 1DQMH 2RAMA 4HUMB 4MNQA 5GZOD 1N5YL 1JI2A 3IYLW 3D3VD 4HJGB 1KENH 2X4PA 4AL8L 3OKNA 5CMAA 2VDOL 1VADA 2CDGA 1JZ2A 2J1KA 3IAPA 1XGPA 1E28B 3ARSA 1X5XA 3DGGB 3ZHLA 2JIXB 4Z7UB 2C5DC 5E0QA 3CMOH 3U4AA 5KS9A 4O9HH 4LDOB 1VFMA 3KG5A 2HFTA 3VH8G 4XAWL 4RSVA 3MYZA 3BWAB 1EJOH 3MRGA 4KK6D 1F4XL 3GSQB 2F53D 4KUCF 5BZWA 4O51B 4XZUA 5JHDB 5GJSL 5KSAC 1BFOA 3QCVH 1PG7H 4O58H 4IBLT 3CFCH 4XCCH 4KQ4L 4P23C 3GKWL 5F1KC 1D3CA 1DDHA 1A6AB 3R06A 3HS0B 5ICXA 2CKBB 5E8EB 1LQSR 4XNXL 1AKJD 2C9AA 1WK0A 1FFQA 5EOTA 1X5ZA 4P99A 5DVNA 2PXYD 4FZ8L 4RNRA 2VXQL 4X4MA 1CD1B 1UEYA 4L3ED