4L1DA

Voltage-gated sodium channel beta3 subunit ig domain
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
124
structure length
113
Chain Sequence
VCVEVPSETEAVQGNPMKLRCISCMKRATTVVEWFYRPEGGKDFLIYEYRNGHQEVESPFQGRLQWNGSKDLQDVSITVLNVTLNDSGLYTCNVSREFFVKTTRLIPLRVHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords Sodium channel subunit beta-3
publication title Crystal Structure and Molecular Imaging of the Nav Channel beta 3 Subunit Indicates a Trimeric Assembly.
pubmed doi rcsb
source organism Homo sapiens
total genus 25
structure length 113
sequence length 124
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2013-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4l1dA00
1OTUC 4Z7WE 1R3KB 5KTEH 2JK5B 4D9LH 3TVMC 4I3SL 1DVFC 4N0UA 2KZWA 4WWKD 3K80A 4FFYL 2H8PB 1MEXH 1P4BL 3JV4A 3N85L 4UDUB 2VH5L 2WSKA 1U92B 4R8WH 5TDPB 5D2NE 2M8XA 3GGWA 2QKIB 1KT2A 1EEZA 2BSTB 2PO6C 3GSQA 1T7ZA 2FD6L 4M62H 5CEZD 4UT6L 3IDNB 5GJSH 3WN5C 3MLWL 4GMSL 1KJ2B 4U3XA 5I18L 1BLNB 3MLRL 2XTJC 3RTQD 3H9HB 3LD8C 2CLVA 4QHLB 4WI4A 2ATPB 3STZA 3QHFL 1ND0B 3NCYS 3C60A 2HFTA 4PS4L 3T1FA 4NM4H 2UYLA 2ZUSA 3H9SD 1OAUH 1ZLSL 3ULUF 1DR9A 4RA0C 1IGCL 2NXZC 3C5JA 4JRYA 5D72H 3VA2C 3TBTB 4BFIB 2AJUH 1M6OB 3FO1B 1HKFA 3QDGD 1JZ6A 2YPLB 3NTCH 3BQUA 3WFHB 4BM7A 4IS6A 3GBNH 1N7ML 2J4WH 3BISA 3PL6C 4I1NB 5BO1H 3MGOA 3PGFL 3DO3A 4XP1H 3TBWB 1SJHA 2NY4B 5TPWH 2BFVL 2Z92B 4HS6A 1FDLH 1S9XA 4JFXA 3WYRA 4BZYA 4W81A 4PV8B 4DW2H 5FDYA 3PWUA 4YX2H 1P7KB 4OF0A 4WU5B 5IJVB 3KPQA 4XPTH 4KZEH 3BDYH 5JQ6H 2D31A 1UCBL 3GK8H 2BJML 4HC1A 5JW4Q 4L8SA 1UB6B 2WZPD 3RI5F 2CDFB 2YEZA 3HC0B 5C09E 5EC1B 1KJ2H 2QADC 5T1KB 4AEIL 4K23H 1CU4L 2VLKE 4F7CB 3R8BB 1IILE 1SBSH 4UILL 5DGQA 5FUOH 1DUZB 3ETBF 4X5LA 2ZG2A 2A6JA 3UEZA 1VA9A 4OD2A 4PGEB 2E7LC 1FYTA 4O2CA 1LEKA 3QPQC 4S1RL 4E41A 4HKBA 3JWDL 3RIFF 1NC4D 4GXUM 3I50H 1RU9H 1I1AB 1NKOA 2AABL 1IM9A 1XGUA 4HS3A 4GAGL 2F8XC 5AWNH 1IAII 5TE4L 4P4KC 4JVUA 4NQEA 3CSBA 3ARBA 5IIEB 1RJCA 1IGML 2JJTA 1A14L 1TVHB 2FEEL 1QSEE 2NY6B 4NN5C 5KVDH 3WLBB 3SDXA 3MBXH 4K9EC 4OUUB 4PJXB 4HG4K 3OZ9L 2A6DA 3EDKA 5EU5B 2ZUTA 1MFBL 1PGRB 3KYKL 5EZIH 1EBPA 1B0GB 3ZE2F 1DEDA 2WMPA 5TE6L 1EIBA 2GTZB 5D9SA 5HHOE 4WW2F 3QNYA 4A2MA 3S36L 3C2AH 3MJ8A 3K2UH 4HS8H 1SEQH 3WNPA 1TCRA 1EEUA 4AYFA 5C92A 1AD9A 1WJ3A 3CX2A 1FP5A 4N0UB 3B6SA 4TPRL 5BS0A 4C83A 3QEHA 4JKPH 3EZ8A 3GNML 3QXDB 1T03L 6CGTA 1U0QA 1IGYA 4LDLB 3QEQA 2K7QA 4AIZA 2KBGA 1J9CT 5FGBA 3SO3C 5DJAA 1KEMH 4FG6D 1RPQA 2DTML 1KT2B 1TIUA 2E27L 3O2DA 4JREC 5JA8B 2DIBA 4FQJH 3GSQB 1I7ZA 2P5WA 2ADFH 2AJVL 3U0WL 3VXSE 1LE5B 4UI2A 5IFAH 1EFQA 4A6YA 4YDKH 1UJ3C 3OX8B 2CLVB 2J8UA 4NJAH 5E99H 3MJGX 4L9LC 4I0PD 4XI5C 3STZB 1WWCA 4WJ5A 4EI5A 3C60B 3D39B 5JHLH 4U1MA 2YD5A 1BIIA 3O3DA 2DQCH 3B4NA 5C9KA 1QHOA 2JELL 2MSPA 2MMXA 3C5JB 4JRYB 4OCRH 1F90L 3TV3L 3FZUC 3UROR 4PRIE 3SDAD 4Q9CA 2ZWLT 5GRJH 5MENE 3RKDC 3WDIA 1WSST 5D1XC 4X0KA 3BQUB 4IS6B 3ZMRA 5JW4M 1DVFA 3MGTA 4KK6C 3VWJC 3CMOL 5GSVA 4FN0A 1BZQK 1L4IA 3MGOB 3CXDH 2YSSA 4NZTL 1SJHB 3EOYG 3SCMA 2PYFA 4IOFD 4HS6B 1S9XB 4JFXB 3VGBA 4F57H 4MCZB 3HKFA 4PJ7A 3V0VA 2D31B 5C7XL 4RMQA 1OGTA 3OXRA 1N0XL 3DYOA 4GG6A 2NY5H 1HOCA 5CZXC 3WN5A 3IFPA 5KSAD 2BVUA 5J1AA 5FYKE 4M02A 1UG9A 3ZTJG 5HD8C 1NKRA 3F7YA 3CIQA 4M6NH 1GZPA 4F80A 1XF4A 1YMME 5JXAL 2VDMH 2E7BA 3I2CL 1JPGA 4OZFB 4GRLD 4JQVC 4E0RA 3H2WA 5E6IB 2A6JB 5D7LD 4OD2B 1HIMH 1FYTB 2PR4L 4NUGL 3P4LA 3JTTB 1LEKB 3DVGA 4JM4H 4N8VA 4E41B 5CWSA 4QXUL 3WJJA 4HKBB 4XNMA 1A9EB 4RFOH 3HNTH 4XBPA 4CJ1A 4EKXA 3P0VH 1XGUB 4HS3B 1MCBA 1S9WB 3T1WA 4JDVA 1HXYA 1X5YA 4JO2H 3ARBB 1Z9LA 1L7IH 2X4OA 1WTGT 4I48A 4R90L 5IEKA 5CEZE 3BPLC 3O8XA 3PL6A 4GRWF 3C5ZC 3QXAA 3SDXB 1F00I 4OKVB 1YA5A 3HE7A 2XQYG 2DB8A 1HHIA 3QISA 4B41A 1G9ML 4P23C 1MCJA 2F9BT 3WS3A 3O9WB 3QXTA 4KU1A 3QNYB 5DRZA 5HI5C 5L7XH 1MFAL 3NA9H 3SDCC 1JK8A 5CAYB 3MJ8B 2D7NA 4WVRA 5DC9B 1TCRB 2Q8AH 3WD5L 3H9SE 1MQKH 2F15A 4XPBH 4F37K 2F19L 4JY5H 3B6SB 4C83B 3QEHB 3WHE0 1EUTA 4KVNH 3QFJE 1CZ8H 4HH8A 4Z77A 2VZ3A 1IGYB 2WP3O 4G6ML 4OZFH 4BK4A 5DWUH 4JQIH 4AIZB 5EOTA 5D7IA 2BVYA 3G5YA 5CLWA 3JUYA 2E7LA 4MXQC 3V6ZA 4CJ0A 25C8L 1I7ZB 3RWJA 4UDTA 4F2MA 1CYGA 4N0FA 5KOMC 3BGFC 2E7HA 3TT1L 4HV8B 1FRGL 5T1DL 4P4KA 4A6YB 4CW1A 2CK2A 3VXRA 2J8UB 3D48R 3OKLA 4WJ5B 1L6ZA 3JWOC 5C8JA 4JG0H 4EI5B 2NY0C 1CXFA 1GJIA 5J7CC 2Q3AA 3L3KB 1EVUA 1RV6X 3IU3A 4U1MB 5DFWH 4XPFL 1BIIB 1G7LA 3T0ED 5CSGA 2NTSP 2B2XH 1A1OA 2BDNH 5HGAB 3GJFA 2DQGL 5ITBH 1I1YA 3H7BB 4ELKA 3IJYA 1UCTA 1H5BC 4PJ5D 2DIAA 4XCNA 5LXGL 4XWGL 1MLCA 1TJHL 4X0KB 2CRZA 3NA4A 3TVMB 1DVFB 3MGTB 1KLGA 4X4ME 5GSVB 1EXUA 4FQ1L 4QRPE 2O5XL 5FA3A 4XHQA 1G1CA 2YSSB 4ZFOL 5E9DA 3HR5A 3EHBD 2PYFB 5LBSL 2AP2A 4TQEH 2JKXA 3ZE0E 4WDIB 4JO3L 1KCVH 4PJ7B 3V0VB 2YWYA 4BZ1L 1WAAA 2A83A 2PO6B 3MOQA 3HZMA 3INUL 4H0HB 4HMEA 4NBXB 5D7SH 1EHLL 3OXRB 1NGYA 2A6KA 2HKHL 4ZDHA 2CIIA 1HOCB 3BSZH 3WN5B 5J1AB 2XTJB 2PCPA 3SQOH 3BZDA 4A6YH 1KCUH 5IBTL 1GZPB 3LD8B 5JW5A 1XF4B 5I1LA 1JPGB 4K7FA 3QJHA 1ZVYA 4ONGH 3Q2CA 3SE9H 3ARUA 5I1HH 4XNQA 4E0RB 4RGND 1CR9H 4NDMA 4UT9L 5KTEL 4JRXD 3MRLB 3DVGB 4N8VB 4ZOEA 2PTVA 4ONFL 3ES6B 5HI3C 3SKOA 4UT7L 4XBPB 1MEXL 1TZGL 2NXZB 1NCBH 1BWMA 2DLEA 1DP0A 3MA7A 4TNWK 1CIUA 5HHVH 4Z7VB 3KPSB 4R8WL 1R3LB 1KB9J 4JDVB 4JKLA 4DVBB 4XZUA 1YPZF 3MLTA 3MNZA 3IDMA 3VWJA 1FGNH 4I48B 3SE3C 2OJEA 3O8XB 3PL6B 1PKQE 5EG6C 2J7LA 4M62L 3DBXB 3KGRA 5DC4B 2YBRA 5EU4A 4Z7WF 3ZYOA 5GJSL 4KY1L 1HHIB 4MD0B 3P30L 3T0XA 3CC5A 2ZNXA 3VD4A 4O9HL 3G5VA 1W72L 2Z31C 5DRZB 4DTGL 5ANME 3V6BR 2ARWA 5EO0A 5FM5O 2F53A 2AAVA 1UXWA 1B4RA 2WK2A 3FT3A 3HAEB 2QADB 1AY1H 4FZ8H 3ARPA 5JOEA 2WBKA 5I16B 4Z77B 1F3JA 5B8CC 4JQVA 3AROA 5EOTB 2HT4C 3WXWH 5BW7C 5JA9A 1FV1A 3G5YB 4W4OC 1CDCA 3NTCL 3V6ZB 3GBNL 3MRDB 2J4WL 4KV5F 3RWJB 1O7SA 5BO1L 2C26A 2C7UA 2VDOL 4N0FB 4QGTA 4XP1L 3G08A 4QRRD 3BVNA 3MV7B 4PRAA 4PRHE 5TPWL 1FDLL 2F58L 1DSFH 4P4KB 2IALA 4YX2L 2BRRH 3LEVH 3VXRB 4XPTL 4KZEL 5JQ6L 1T0MA 3GK8L 4L3EA 3RY6C 5E0QA 2DLFH 4BFBD 5C8JB 3L5IA 2EYTB 3IU3B 1KCKA 1KJ2L 4PRPD 1G7LB 1XAUA 4G9FB 5A40E 2X1QA 3MV11 1A1OB 3U1SH 3GJFB 3HC3H 4DJMA 3O3AA 5FUOL 1GOFA 2VZOA 3ET9F 3FQUA 4L4VD 4ELKB 3IJYB 1INEH 1U41A 5ESVB 1UWEH 3HAEH 4XCNB 3TA3C 5FXCH 4LKCA 3SGDH 1UVQA 5C08D 3LB6D 1QFWM 4Q97A 2BP3A 1EXUB 5FA3B 1SEBA 5E9DB 3HR5B 1HHJA 1XF5A 4LIQE 3PNWA 3TFKC 5AWNL 5E00A 4HWZB 3SO3B 2V9RA 1DQMH 3KXFD 4CVXA 4KJWD 4JFEA 4JREB 3E8UL 4RWHA 2A83B 5C0BD 1ORQA 3HZMB 3MACH 1NGYB 4TUOB 2A6KB 2X10A 5KVDL 4ZDHB 2CIIB 3MBXL 1IL1A 3WFBH 1XF2B 5EZIL 4QRSB 1UJ3B 3T0AA 3W11C 4X4ZA 4P57A 5JW5B 4ORGA 3TLRA 3SGEI 3CLEH 2ZUQC 1DQJA 5I1LB 4L9LB 3UX9B 4K7FB 3QJHB 4U1LB 3C2AL 1WIPA 3K2UL 4K9EH 35C8H 4ZO8A 1V3MA 1VKXA 4XNQB 4HS8L 2RQ8A 5MEOB 4S1DD 1SEQL 1YEDB 4NDMB 4HULB 4B5EA 2L4OA 5DJDA 1JF1A 4QHMA 5JPMA 4JKPL 3GJFH 4WO4C 1CICC 1ZTXH 4AY0A 5SWSA 4KRMB 1H5BA 3BI9X 1KEML 2X89A 2J3SA 4XZUB 5DZOA 3MNZB 2APBA 3KNBB 3VWJB 5J9PA 1WWWX 1UZ6E 1IQWH 2OJEB 4FQJL 2JB6A 4NP4L 3G6AA 2ADFL 1TETL 2VDNH 2YBRB 5LGKA 5EU4B 3P73B 2HT2D 5IFAL 4RZCA 4YDKL 3QRGH 4LASH 1GH7A 3RWFA 3CC5B 3ULVL 1YY8B 1MHCB 4NJAL 2H6PA 4Y89A 3CXHK 1RJZA 5F3BA 2D7TL 5EO0B 4G6AD 3LRSA 2F53B 1UXWB 2ICES 2QHRH 3FT3B 2J8HA 3FO0H 3PXHA 5DJCA 5JHLL 4KKAD 1XR8A 3CUPA 4NQCD 2QQKH 5EZOH 4BQ6A 2DQCL 2CLZA 5IVXF 4JHAH 3TO4C 3HZVA 1WF5A 5DD1H 5B4MD 1JHLH 2VXSL 1F3JB 2XA3A 3LOWA 5EU6A 1RZKC 5IW1A 4PJ5E 3CFKA 5GRJL 4BELD 1I3GH 1CGXA 4XCYB 1WCQA 2IBZX 4K2UH 1ZANH 5HYSG 1TITA 1G84A 1U91A 3CK0H 5D1QD 1RZ7H 1ZHBA 1ZSDA 3G08B 4YGVA 1D5IH 3VE0A 3U82B 4YFLF 2IALB 4F57L 1BFOA 1PY9A 4WI6A 1NBYA 1T0MB 2FX9H 5EBLA 2R0KH 3BW9A 5HVWA 4OGZA 3BPLB 3C5ZB 1ZXQA 4L8BA 5FFLA 2NY5L 5TF0A 3VI4E 4CVUA 3PGCA 4P23B 1F97A 1BF8A 3MUZ1 4M6NL 4LHUD 5CZVH 4DCQA 5ISZD 2VDML 2Z31A 5JW3H 4NQSA 3SDCB 1ADQH 3FQUB 2EC9U 1VADA 4NNYA 5D6CA 4JRXE 1HIML 4LKCB 3VRJA 1CXEA 2JCCF 3K0WA 4JM4L 3U7WH 4N0CC 1V3KA 4RFOL 1N5YH 3HNTL 3P9LA 2FR4A 1HHJB 1XF5B 2ATKA 3PNWB 3QJFB 4ZTPH 5B8CA 3VFPA 1KCRL 4NYLB 4ONHA 5IHBA 5BW7A 2FEDD 4W4OA 5IQ9A 3H9YA 4H26A 1L7IL 2V9TA 1J0HA 4RISH 4OZHF 3ECBA 5T5NF 4M7JH 3IF1A 1IL1B 1EFXA 1AXTH 2AJ3A 1XGRA 3LN4A 2I5YL 1N2RA 2ID5A 3BGFB 4OF3A 4XX1G 4P49A 1C12B 4WUUD 2X40A 5I1JH 5DMJB 1XZ0A 2B7DT 4P57B 4PLJC 1GXEA 5GGRY 5F7MC 1DQJB 4MNGA 4HGMA 5ENWA 3LY6A 5IHUH 3RIAK 4PJ8A 5L7XL 3NA9L 1WZKA 3TESA 1OY3B 3RHWK 1VKXB 2NY0B 5EOCL 2Q8AL 2EDQA 1HHKA 1AH1A 1MQKL 4I0KA 4XPBL 1T2XA 2AVGA 4PJDA 3VFGH 1ZS8B 4OFVA 5CSZA 4JY5L 5DJDB 3IB4A 1JF1B 3J7HA 3L1OH 4QHMB 5SX5H 5JPMB 5L2KD 3WIIH 4KVNL 1CZ8L 3OAUH 1QPPA 5SWSB 4JQIL 2YN3A 1H5BB 2AI0H 5EB9A 2B4CC 4GKZA 3TA3A 1CFQA 1ZA6A 5J9PB 2JB6B 3G6AB 3T2QA 1IARB 4NO5A 1QRND 4QRRE 3BDBA 1V3JA 4RZCB 3TZVD 3RWFB 2CXKA 4HFWA 2H6PB 2ZSWA 1RJZB 4JPKL 5F3BB 1VGKA 2JIXA 4KTEH 1PFCA 2DQTH 4JG0L 5DJCB 4PRPE 1XR8B 3Q6GH 2C3HA 1G0DA 3HZVB 4NZUH 2X9XA 2B2XL 2BDNL 1SY6A 5ITBL 1RHFA 1N3NA 4RAVA 5EU6B 4P3WA 1REIA 3JWOH 1G7PA 1SYVA 5IW1B 3EYFA 5CMAB 1CXIA 1MH5A 3CFKB 3EDFA 4Y5VA 4L29A 3ARDD 1BFVH 3T2PA 1CLZL 3E6FA 4YEEA 5C08E 3I3DA 4H25B 4QCIA 5I19H 2XKSA 1AGCA 5DRNA 1U91B 3FJTA 2FO1A 2FJGA 1IVLA 1LMKA 1J8HB 2Y5TA 1ZHBB 1ZSDB 4YGVB 1CICA 4NHUA 4TQEL 3NN8A 3KXFE 4Z95L 4OGAD 2OBGA 3FHAA 1KCVL 1GAFH 1ETZB 5EBLB 3UPRA 3BW9B 1U2CA 4L8BB 2NXYC 5AG8A 5DK2A 5DJ6B 1IKFH 4IM8A 1PQZA 3PGCB 4EQ3A 3SQOL 4F8QA 4A6YL 1OW0C 1KCUL 4DCQB 4LMQI 1QBBA 1ZV5A 3QDMA 3MCG1 2EDFA 2Z31B 2HA1A 4NQSB 1QEWA 1T5XA 4ONGL 2B1AH 4GLRI 3SE9L 2NZ9D 4NNYB 1RFDH 4CL7A 5I1HL 3T65A 3V0AC 3ZE0F 3AREC 1CR9L 1HWGB 1Q1JH 4FP8H 1IKNA 2YPLD 5IMMA 3LEXA 4NQTA 1NCBL 2FR4B 5HHVL 2ATKB 5B8CB 3VFPB 3MXVH 4ONHB 3QB7C 1C08A 4KKNA 4OT1H 1F2XK 5IQ9B 1I9IL 4H26B 4YZFF 3QNXA 5GRUH 5KJRL 1FGNL 1DQTA 3IF1B 4AIOA 3K8KA 2VDQH 1EFXB 1FL6A 2AJ3B 1YUHA 4Z18A 3L5JA 1XGRB 1N2RB 4JDTH 4MJIA 5CIPA 1XZ0B 3T2NH 3I3EA 1CF8H 4LSSL 4MNGB 5ENWB 1JGVH 3GM0A 4PJ8B 5T1KD 5HVHC 4LK4A 4NQCE 5F6IB 4LNRA 4PJDB 2I07A 1AY1L 5CSZB 4LPYA 1KNOB 4PB0L 1JTPA 1T1XB 4Z7OF 1UT9A 3ELAT 4RMUA 1DANT 3WXWL 1I1AD 4Y5XC 4GKZB 3TA3B 3V79C 1JNNH 1ZA6B 5DFTA 1MJ7H 3G6DH 5KG9A 3AS3A 3PGDA 3DX8B 4LVOC 4X6DF 4LCIL 3RVVC 1BEYL 4Z9KB 2B1HH 4F37F 1WTLA 4N9OB 2HH0H 1PYWB 2YPKA 1J0JA 3WIHA 1I1FA 4HFWB 2P5EE 4OF7A 4Y5YC 1BP3B 2ZSWB 3QI9C 2Z4QA 1VGKB 2JIXB 3IVKA 4GG6F 2AQ1A 4FQQB 2CDEB 3UDWC 5EO9A 1EGJA 3QPXH 4NRZA 4OFIA 4C56A 3EYUH 1RUMH 2OM5A 3NIFE 4MNQE 5ISZE 2ZUQB 3HC3L 4LKXA 1N3NB 1YYMH 1ORSA 4RAVB 1KG0A 4K07A 1G7PB 1Q9OA 1SYVB 3EYFB 4ODTH 1MH5B 4HKZA 1INEL 4JHBA 2VN7A 1A7RH 2O5YL 3E6FB 1I3RA 2G5RA 4DKFH 4QCIB 1AGCB 2GY7B 3BGMA 5D2LE 2WWMD 4QLRA 4KJPD 5A1AA 2FJGB 1NFKA 2Y5TB 3D9AH 4WO4B 1CICB 4MB3A 4NHUB 5MP6H 1S7TB 2KUTA 2YXFA 3C8HA 3NN8B 4UTBH 2KQMA 4P99A 3X17A 2WBJC 4QRQA 4C4KT 4WI9A 4GH7B 1JWMA 1QSFA 4JHWH 3UPRB 5IV2A 3JWNC 1HQRB 1FO0B 1P6FA 3CGTA 3DRTA 1U2HA 3WFBL 4HWEH 1IFHH 4EDWH 3C60D 1T2QH 1JYNA 5EN2B 3QDMB 3OF6D 3CLEL 4PJHE 4QOKA 1QEWB 1T5XB 2AEQH 1D7FA 3PHSA 4HUMB 1H15B 4K9EL 1MCIA 35C8L 3T65B 5FF6A 4JRYD 3LKNA 4QHKI 3QUMA 1P2CA 1I9JH 3TO4B 1ZT1A 1IZJA 3OKKA 3V8OA 5L2KE 2UWEE 5I8KH 3TGXA 4K3GA 5IMMB 4RMWA 2Y6SD 3BQUD 1BZ7B 1SY6H 1IT9H 1T1ZA 3GDBA 1ZTXL 5EU3A 3UTTE 4G8GA 4J3OC 1C08B 3JV0A 4P9MH 3F7QA 1CE1H 5HHXH 3DHMA 1QVOA 3L7EB 3KYAA 5CILH 1IQWL 1U8LA 5IHLB 2GHWB 2ITCA 4YPGA 3MRGA 3DSNA 2LVEA 2D03L 4X7DC 3BWUC 4MJIB 1JZ7A 1HI6A 2CDGA 3WDJA 4KKCC 3UZVB 5KANI 3DNKA 4LASL 1FNSH 4TNWF 1XGPB 2J2ZA 3MJ9A 1CFBA 1FO0H 2QHRL 4FNLH 2CO6B 4WI3A 3U0PA 3RWGA 5ADOH 5E5UB 4LNRB 3CPLB 4OSUL 2BY0A 4FQLL 2QQKL 1UZ6F 2V2TA 3HUJF 3V8CA 3RRQA 2YS4A 1FYTD 5DD1L 4E41D 2W38A 1H3PH 4OCLC 4U1KA 2P8MA 3GRWA 1X5HA 5F7EH 2FRGP 1I3GL 4HJGB 1IM9D 1NAKL 2WQRA 1QG3A 3FB5A 4JFHD 4N90D 4K2UL 3V4VL 1ZANL 3FFCA 4JANA 5JNYB 5KG9B 3DI2B 3O2VH 4V1DE 4NQED 3PGDB 4ZNCD 3ZDYF 3ARBD 1LDSA 2ZPKH 1CLYH 3NGBC 1RZ7L 1RZKH 1UM5H 4WTXA 2EXWC 4JPVL 1NC2A 2YPKB 2GTWA 5CGYD 4HAGA 1QFPA 3TM6A 3LPWA 2IPUG 4M43H 1CE6B 4N9GA 3BO8B 3BXNB 2FX9L 4NGHH 2R0KL 3IVKB 4YDVA 2J5LC 1GGCH 1EEYB 3L3GA 1IAIH 3BE1H 4Z76A 4F58H 2R0LL 4NRZB 4PJCA 5CIPH 4C56B 1EDQA 4PRBB 5EBWB 3QSKB 5CZVL 3WS6C 4YHML 4LKXB 1ERNA 4GAJL 1ORSB 1KG0B 1DFBH 4KUCD 1ADQL 1AGDA 1S5IH 1Q9OB 5FIEA 4HKZB 3RNKA 1R3JA 3MLXH 1S78D 1T66D 1XGQA 1I3RB 3QEQD 1OT1A 1LEIA 4P9HH 5FOBA 3SKNA 5BCAA 2YPLE 1DQLL 3GMMA 2HTKD 3MUGA 4L1HA 4N5EC 2F54A 1N5YL 3U46A 4ODVL 4ZTPL 2HLFC 4PR5A 3VI4F 5D7JA 4Y5XA 2Z8RA 3DWTA 5FA4A 4XX1E 4QRQB 1VDGA 4NPYA 4UU9A 5HGDB 1CDIA 4RISL 5IV2B 2Q1EA 3DRTB 4MJ5A 1AXTL 4EXKA 4OZGF 5KVFH 4IEFB 3MRJA 4NWTL 3V7AE 4X9FA 4EI5D 5CUSL 5GGRB 5I1JL 3WIHH 2ERJC 1NUDA 3ILQC 4UQ2A 1JN6A 3QI9A 4QOKB 5IHUL 3EO0A 9CGTA 3MOBL 1Z0NA 3ZKMD 4MS8D 1SJVA 5FF6B 3L3OA 3UDWA 3RX8A 1FPTH 1OPGH 4HIJB 4XNXH 1MRCH 3CSYA 3EFFA 3LKNB 1EGJH 1GYAA 4MSWB 5DFVD 1OARH 4ISVA 3VFGL 3QUMB 1OTUD 4WTZG 3JV6A 3QAZC 1ZT1B 3OKKB 1YEIL 1O5DT 3WIIL 1BD2A 4LVNC 1DVFD 4D0CA 3DI3B 3VXMA 5EU3B 3VGAC 4G8GB 4ZUVB 1RJLA 2AI0L 4PUBH 1X5XA 4ENEC 4F33A 3HPJA 4MYWB 1QVOB 1U8NA 3ULVE 3VD5A 1U8LB 1VACA 5ACZA 2ITCB 4XCCH 4YPGB 2PO6D 4PJXE 1HI6B 2B4CH 1H8SA 3K7UA 3CH1A 3LKPA 4L4TB 4PJ9C 5D5MA 4M1CD 2XTJD 5ECJE 4F7PA 3GM8A 1CLOH 1A1MA 2FNBA 1FZKA 4KTEL 2X4PA 3TBSA 3G6JB 3PQYA 2ARJQ 2V5YA 3EJYC 3RWGB 3U0PB 2E7MA 3H9ZA 3QEUA 1MVUA 3OKYA 4WGVB 3DJ9A 3Q6GL 2BMKA 2OZ4A 2V2TB 1T4KA 5GGQH 1GPOH 4NZUL 2H2SC 4I0CC 4N0UE 1Y18A 5J6HA 4G80A 4U1KB 3JWOL 5IP4A 3MGAA 4HHAA 2HN7B 2NXZD 5CHNA 1H3VA 1WICA 3TN0C 3FB5B 3KPSD 1YNKH 1EV2E 4N8CH 5E1HB 1MCOL 3QWOA 5I19L 3FFCB 4JANB 3QUMH 4BJLA 3K46A 3S3JA 5HHNA 3UJIH 3O8XD 3PL6D 1A8JH 1NC2B 3JUZA 4DZ8A 1OWWA 2GTWB 4G7VH 3S35H 3TYFA 3HE7D 4P0DA 4PLKC 1GAFL 4N9GB 3GSVA 1INQA 1EK3A 1WBXB 4OUOA 3UBXI 4JVPA 2Z8VC 3HE6C 3MRQA 4JY4A 2X09A 3RDTC 1IKFL 3WMSA 1B2WH 3IETA 1Q0XH 2AKRA 3D39E 1IBGH 5GGSY 5ICZB 3M8OH 1UEYA 2QADD 3HMWL 5TH2A 1YNLH 3MJ9H 1AGDB 4F9PC 1J1XH 4JRYE 2B1AL 43C9B 5HVHB 1W2KT 4NN6C 1RFDL 3RNKB 2DDQL 2FB4L 4P2QA 5HGGS 1XGQB 3I6LD 3EBAA 1LEIB 5TGBA 3SKNB 1Q1JL 3D0LA 1QLRA 4ELMB 3GMMB 2F54B 3QPQD 4AEHH 3U46B 3GRWH 4PR5B 1GSMA 5D7JB 4Y5XB 5EUOF 1J0ZA 3EYVB 4OT1L 5FA4B 2ZOLA 4O4YH 3NFNB 1BMGA 4UU9B 4P2YA 4P4KD 5GRUL 3BN3B 3MRCA 1NGXB 3VXRD 4QO1A 4U33A 4MXVF 4HWBH 4LVOB 4K71C 2VDQL 4MJ5B 5F7KC 3MRJB 3Q3GA 4U3HA 3GSWA 4JDTL 3T2NL 4ZG1A 1X6NA 2CUMA 1K8IA 1HINH 2ICWA 4O00A 4M8QA 4UAOC 3F62A 4UQ2B 4PGJA 1JN6B 3QI9B 4G9FD 3EO0B 5GGVH 5GJTH 1FNGA 3L3OB 4WWKC 5C0AE 3CSYB 3EFFB 4J3TA 1ZA3A 1CVRA 1OAZH 4ISVB 1FCCA 1TXKA 1F2QA 5CJ8A 4E41E 1BD2B 4D0CB 1OVZA 3ZYJA 1Y0LA 1RJLB 5E9DD 4JFHE 4C59B 1JNNL 4F33B 4N90E 3H3BC 3B9AA 1YDPA 1ZLUK 3HPJB 4K8RH 3RIAF 1C7TA 4YBHA 2WUCH 3IJSA 4RAHA 3RHWF 5T5FH 2WWKO 1A1NA 1CS6A 2X4RA 4IBLT 2B1HL 4CKVX 4M7ZC 3GMNA 2HH0L 2EH8H 4MD4A 3LKPB 3Q1SH 1V8HA 2DIJA 1M7DA 1NDGA 1LDPL 1U8KB 4F7PB 1A1MB 1FZKB 1MJJA 3P0GB 3TBSB 5ILTH 2A77H 3PQYB 2PTTB 1BVZA 3QEUB 1MVUB 4XH2A 3QPXL 1KENH 2BMKB 3RUGA 3EYUL 5F1IA 1T4KB 1U8JB 3KJ6L 1FCGA 3N1QC 4F15C 3O3UN 1GC1C 2OX5A 1I7UA 1Y18B 4G80B 1TJIH 1YYML 3MNVB 3QCVH 1KPVA 1VESA 3GSUA 1ULVA 4IMLB 4ODTL 4HHAB 2M26A 1V7MH 1A7RL 1TZIA 2UY7A 4XAKE 4DKFL 4DZBA 3QWOB 1G6RA 1JTTA 2OXHA 4YHLH 3F7RA 3KPMA 3VDAA 1WV7T 1MIMH 4LFHG 2JTDA 3N1FC 3PP3H 1AGFA 3D9AL 4KK6D 5HHNB 3VWJD 5CJQH 5MP6L 2FIRT 4DZ8B 2FHFA 4AG4L 2XXCB 2YUZA 4S2SA 4UTBL 3TYFB 2IG2H 1KGCD 4OCWL 3GSVB 2HRPH 1CFTA 2J8UE 4JHWL 1U6AH 1INQB 2CH8A 2YXMA 3CH8A 4KH2A 4LSRH 3T4YA 5C0GA 5EOCJ 1HEZA 4JY4B 2D4FA 3NH7H 4HWEL 3VCLA 3SGKA 2F53D 4LVHC 3IETB 4KKLC 4Y88A 3VXUB 1IFHL 1AXSB 2AKRB 5D2LF 5JOPD 5CZXD 3V6OC 4PJ9A 4XP6L 2IFFH 4U7KA 4YHKL 3JTSA 2X4TA 4FRWA 2AEQL 4AT6A 3V7MA 5EZLA 3GJFK 1AHWC 4K94C 4P59L 4YNYA 4K3HA 3QQ4A 3S4SA 2EO9A 3D0LB 1I9JL 1QLRB 2OSLB 2A0LD 2ED9A 5DJ0A 5I8KL 4XVSH 2FH8A 3BZ4A 4ZNEA 3EO1A 1SY6L 3P2TA 1IT9L 1TZHA 1A21A 3VI3F 2X1XR 5J1SC 5DYOA 3WXVH 2OLDA 2ZOLB 4LLYA 2ZNWA 3P40A 2DQHH 1DDHA 5HHXL 3MRCB 3V5HA 2V2XA 4M48H 3EYQC 4PJ7E 2HT3C 3MA9H 3NGBB 2UVEA 4L3ED 2Z91B 3Q3GB 3GSWB 1ZVHA 2VUYA 3C5ZD 3PDOA 4MJ6A 1LE9A 2G9HA 1WZ1H 2DJUA 3CCHB 4MD5A 4XPHH 3CFBA 2UWEF 3Q5OA 2XTJE 5K9OA 4M8QB 2DLGA 32C2A 3O4LA 3MLSH 2AV1A 1J18A 2J5LB 4HCRA 5DT1L 1FO0L 4HMDA 2Y7QA 4FNLL 3HE6A 5HI5D 4RIRB 2VISB 3MSPA 5ADOL 4LSTH 1ZA3B 1BJMA 3DECA 3ZHKA 3AM8C 5JUEL 5SWZB 4LSPH 1DBML 3MRKA 4PJIA 4R4NC 1H3PL 4F9PA 4LOUD 2OMBA 4FG6C 1Y0LB 1X5KA 4YAQA 5F7EL 1GIGH 5JDJA 5DI8A 5GS1C 4Z7VE 3KPSE 1MWAB 1OT2A 1YDPB 3JXAA 2IMNA 4PRDA 3VDBA 4KI5D 3CLFH 3IDIA 5E56A 3O2VL 1IE5A 4MXQD 4JFED 1N8ZA 3F7VA 2ZPKL 1RZKL 1UM5L 1A7PH 4OCXL 2QLVB 2QR0A 4P46C 2CXGA 4X4YA 5ITFA 4HUNB 4KK5D 1T20A 2DTSA 2EO1A 2EZ0D 3QEGH 4MD4B 5DR5H 1M7DB 4M43L 1NDGB 3ZDZF 5DQDH 4BUGA 4NGHL 5DDHA 5F44A 4PJGA 5BZWA 1MJJB 1GGCL 4H1LG 1UYWL 1IAIL 3BE1L 4OAWA 5C0FA 3AVEA 1Q72L 4XH2B 3RUGB 2NY0D 4B50A 5F1IB 2YMXH 4D9QE 2ERJB 3QFDA 4W70A 1DFBL 1S5IL 1JGDA 3DGGA 3GSUB 5TE7H 3MLXL 2EEAA 2Y25A 1TZIB 4YHNA 4CADA 2JJSA 3I6LE 4MJ2A 4XHJC 3MCLL 5SWSD 5ADPL 1G6RB 1PLGH 5JR1H 3QAZB 3U9UA 3KPMB 4Y19A 2X89D 3KPPA 4IOFC 4I5BA 4NBZB 1CVSC 3KYOA 4LVNB 1AGFB 2X9WA 3MTRA 3VRLF 1MJUH 3VGAB 4GRMA 1ZHLB 3DHJA 2ZCHL 4OQTH 4S2SB 5ICYA 4Z8FH 2XV6B 2HVKA 3MV7E 1BZ9A 4Y4FC 1MWAH 3FN3A 3CZJA 1GVIA 3FMGH 2R1XA 4RRPA 3VXRE 1CFTB 1T80A 3T4YB 5C0GB 2FGWL 4ZXBC 4UNTA 5F89A 1HEZB 4MQXC 3RZCC 5LJYH 1AE6H 3VCLB 1DCLA 5KVFL 4OI7A 2ESVB 5BRZB 3QXUA 5DVOA 1HN1A 4UTAL 4OZIF 4GRLC 1MFCH 3WIHL 4PV9A 1T1YA 4PJ9B 2Z0BA 4G9FE 1A6UH 3JTSB 2X4TB 4LEXH 5SX5K 4AT6B 5EZLB 1F6AA 2OL3A 3VFWB 4YNYB 1FPTL 3FB6A 1OPGL 4XNXL 5EU6D 1KCSH 4DQOH 2VIRB 3O4OC 1OARL 1KXVC 5F1KC 3BAEH 5DJ0B 3BZ4B 2BC4A 1RUKL 3EO1B 5HHPA 5CINH 1OTSD 5HI3D 2EIZA 2IAMA 3L9RA 4WTWA 3DSFH 5DYOB 2X4NA 1J8HD 2APTA 1DJSA 5D96C 3TN0B 3BYTA 5DEZA 1RZGA 3DURA 3KG5A 1G6RH 3IDUA 1DDHB 4AQOA 3V5HB 2IH3A 2V2XB 1NJ9A 1WAAE 1JV5B 4XCCL 3QZWB 3PDOB 3EOBA 4MJ6B 3UTSA 2G9HB 2B4CL 4JRWA 4MD5B 3CFBB 5K9OB 3X3GH 4W6YB 4HT1H 3O4LB 1WVZA 2AV1B 1CLOL 4LP4A 4GAYA 2QTEA 2BHYA 4WENB 1MLBA 4MZ2A 1WGOA 2Y7QB 3HNSH 1LO0L 1QUNA 2Z31D 2EEDA 3CFEA 3HE6B 2CK0H 3QXVA 2ZG3A 4YDLC 2D9QB 3C5SA 3ULVF 5GGQL 2AQ2A 4KMLB 4YDIL 4YHOH 1GPOL 5DMIH 3WNOA 5IB4A 4GFTB 4PJXF 2NW3A 3TYGH 4NN6B 4YAQB 1EBAA 2RGSA 5DI8B 3V2AR 1EAPB 2GT9B 4UV7L 1RHHA 2NX5A 2FH6A 2HT4D 3T8XB 4PRDB 1YNKL 4N8CL 1RURH 4K7PH 5F7UA 2VMFA 3IDIB 1CGSH 3DX6B 4DKAA 1N8ZB 3F7VB 4Y4KC 3HTLX 4QGYA 2QR0B 5AUMA 5ERWB 4X4YB 4QXTA 1EFXD 3S35L 1T20B 3MR9A 2FECI 2IQ9H 1KGCE 2UVFA 3W9DA 5I9QC 1E4XI 4YQXH 1F4AA 2HFFA 3LQAC 5F7WC 5BZWB 4PJAA 4K71B 5C0FB 4UIMB 3T0EC 2F53E 4PJ8D 1SM3L 1Z9SA 1B2WL 4KJQC 2D9CA 1IBGL 4KC3B 1CTOA 1OAYH 3QFDB 4UAOB 3WL9B 1YNLL 3DGGB 1JGDB 4J3UA 4BFGA 1J1XL 2JE8A 4M6MH 3OAYH 4PJFA 1KJVA 4ODSH 4WWKB 1LWRA 2CIKA 3WUZA 4HUXA 1B6UA 2CRMA 1QA9A 4YHNB 5DD3H 3LPGA 1WBZA 5K9JL 4O5LH 1NGWA 4NO2B 3U9UB 4YFLI 4Y19B 4LPUA 1JFQH 4XPGH 3TA3D 3KPPB 4I5BB 4LP5A 4QTHA 1NGQL 3WNNA 3KYOB 4X98B 4AEHL 1KLUB 3HFMH 2D7MA 4G6JH 4XWOC 3GRWL 4U0QB 3IU4H 1R24A 3Q48A 5ICYB 4D3CH 5GS1A 2DQUH 2HVKB 1BZ9B 3V6FA 3TFKD 4HK0A 1FGVH 1ZGLA 2WUBL 3DUSA 2OXGA 4WW2C 2F5AH 4P5MA 1JF5A 3VFUA 4YDJB 4HWBL 2XXMB 2JIXD 4M7ZB 4U1NA 4TSBH 2HJKA 5DO2C 4P46A 5BOPA 4U6YA 3DRQA 4DOHB 3ALPA 1TLKA 1T1YB 3D0VB 4PV9B 4ZFGH 1HINL 4JZJA 2IPKA 4CRPA 4C58B 4RGNC 3W11D 3IKCA 5GGVL 2OL3B 5IMOA 3BMWA 4ZTOL 3FB6B 1NPUA 1T04B 5EC2A 1AI1H 1A47A 1OAZL 3SJVA 1LO3L 3EOTL 4N0YH 1P69B 5CFHA 2C4XA 3QDGB 3TT3H 2XWJB 4XC3H 2CPCA 3GHEH 3GSXA 2EIZB 2MPAH 4NRYA 3AGVA 3QQ3A 1CICD 3LKOA 1RZGB 3DURB 4YEFA 1X5LA 4AH2B 2IH3B 3HN3A 1NJ9B 2RR3A 4R9HA 2FJHA 2VUOA 3HI1A 1UKQA 3EOBB 1EVTC 3S98A 3PHQB 2XRAH 3DYMA 2EH8L 4Y4FA 3NIGE 3MREA 1T5WA 4NJ9H 2NY7L 3Q1SL 3PUCA 2F5BH 4LCUA 4GAYB 4P2OC 4ZXBA 4PJBA 3QDMD 1MLBB 3WUWB 5ILTL 5F3HA 2A77L 3RZCA 1TFHA 1G7QB 4LVHB 1EO8L 1KENL 1T3FB 4MLIA 4TNVK 5IB5A 4JFDE 1TJIL 2NW3B 3TO4D 3QCVL 2XZAH 4AL8H 1AHWB 2OL3H 1V7ML 2X1OA 2A9NL 4X7EC 4O02H 1RHHB 2BERA 1XF1A 3SKMA 4GW4A 5CD5C 3MXWH 2E9WA 4YHLL 3E0GA 4AM0A 1GC1H 5SV3A 3KPNA 3OPZH 2QSVA 4GLRH 4H5SA 5E2JA 2NY3D 3R0MA 1KN4H 1CK0H 5AUMB 4HUVA 4QXTB 3F6IA 4PYGA 4LSQH 1KIUA 1R3HA 3HG1A 3MR9B 4KUZL 2Q6WA 3W9DB 2IG2L 5BXFA 2W0FA 4GOSA 3N06B 4MJID 4GBXA 2VJXA 2HRPL 2HFFB 1U6AL 3OHXA 4EUPG 4PJAB 4CDHA 2IBZY 3O3BA 4NCDA 4OBRA 5SV4A 3NH7L 2O5ZH 3OKMA 4GS7B 5I6XC 1RK1A 3OKEA 4LARL 5IMKA 2ADGA 3WFDL 2IFFL 5F21B 4YHPA 1QFWH 2MWCA 4BUHA 3UAJD 1ZE3C 1L9NA 1INDH 1KJVB 1JGEA 1PEZA 4HUXB 4JLRA 1N6UA 1QA9B 3U2SA 4AIXA 2VDPH 1WBZB 5DGRA 1NGWB 3DVFA 2GITA 2GJ6B 1FFRA 1HHHA 1U8OA 2M1KA 2MCPH 3I3BA 4QHUB 4QTHB 4XVSL 2D7QA 4N0CD 1RQ5A 3QXWA 4XB8A 5E5MA 1R24B 1J8HE 4K94H 3S37X 4V2CB 5GS1B 5FAAA 3WXVL 3BEVA 5EULV 4UOW1 1VPOH 5DF0A 3P4MA 1ZGLB 3DUSB 1QYGH 1P6AB 1QACA 4RX4A 5DJ2B 4P5MB 3VFUB 4KVCH 3MA9L 3ROLA 4U1NB 2VAJA 4P46B 1OQOA 4U6YB 3DRQB 3U48A 3K4ZA 4FABH 2BVQA 4XPHL 2LVCA 3VXTA 1CT8A 4JZJB 4C56D 1H3WM 2IPKB 3G5ZB 4S1DC 4HH9B 1JUFA 4CVZA 3IKCB 4PLJD 4KZDH 5FO7A 3BEWA 2XA8H 4LSTL 5EC2B 3BWAA 5BMFH 3L5WA 3RAJH 1SYSA 3X3FH 4LSPL 4S0SD 5H94A 4LCCA 3U6RB 1QFHA 3GSXB 3FKUS 4DGIH 4NRYB 4J12A 3LQMA 2P8LA 5AD0A 4G6FB 3LKOB 2VXTH 3GMQA 3CLFL 4XVJL 3ROOA 1C5BH 4YO0A 2CRYA 3BIAX 1A7BA 1X5IA 4LLMA 1KIRA 1NCWH 4G9DA 2BVOA 5DJXA 1A7PL 1WZLA 2HLAB 5F7NC 4Y4FB 4G6AC 1LO2H 1T5WB 3QEGL 5H37H 5J11C 4CU8A 5GS0C 1T22A 5DR5L 5FHBH 4K3EH 4WW2A 4KKAC 4WEBH 4MNGE 4ZXBB 4PJBB 2HVJB 5F3HB 4Z7VF 3QCUH 3RZCB 3GB7A 3ZZ1A 4QOKD 4HPYH 1G7JA 5B4MC 1TPXC 2EKJA 5F9AC 2YMXL 1IGFH 4GRLB 5B3JF 5BVJB 4PJDE 3U0TA 3DPBA 1MNUH 3QG7H 5IB5B 4J23A 5D7LB 1WWAX 4HUKB 1B0RB 1PW3A 4K3JL 1TNMA 4B53A 3O4OB 4G8GD 4R2GD 1TTGA 4GW4B 1U8HA 5JR1L 3BZFA 2RCSH 5MI0C 4NC1C 2D0HA 1Z3GH 2A73A 4H5SB 4MQ7A 3S5LA 1MJUL 5JMOC 3MYJA 2CKNA 4OQTL 4Z8FL 15C8H 1R3HB 1F4YH 3HG1B 2GSGA 5D96B 2Q6WB 4YE4H 3KWWA 1FFQA 1MWAL 1TENA 4UUJA 3FMGL 43CAA 2W0FB 2Q8BL 1D5BA 4O2EA 1DBKH 4WNQA 2J12B 4LLWA 4YUEH 1MVFA 4JAMA 3OHXB 3FCTA 1F4WL 3MBEA 3O3BB 1AE6L 1U3JA 5D7KD 4KHTH 4RWYH 1FYHB 1B90A 2VWEC 1RK1B 3OKEB 1MFCL 2ADGB 5B21A 1CXHA 4GG8A 1A6UL 5JHDB 3UTZA 4P2OA 5EA0L 1NEZB 2HFEA 4LEXL 5T1LA 2FIKB 1JGEB 4OLUH 2Q76A 4WFHE 4JLRB 4S10A 4YDLB 5DHVA 4DQOL 3B2UD 1WCBA 3RWHB 2GITB 4DN3H 1MPAH 3SQBA 1HHHB 1U8OB 3ARRA 2VDLH 3B5HA 3BAEL 4HZLA 3FFCD 4PB9L 5E5MB 4LHQB 1UA6H 2LAAA 1HYRC 3AY4C 3DV6A 3DSFL 5T33H 2KQNA 3BEVB 1DQDH 3QDJA 3P4MB 1N4XL 1NC2D 3ZTNH 4ZUWA 2UY6A 5CEXB 2EDXA 5HJ3A 2KPNA 4Y4KB 1F3DJ 3ROLB 1CDHA 4F3FA 5FKAA 2WLYA 2BVQB 4XPAH 2Z8WC 3VXTB 5I9QB 3X3GL 1CT8B 2DQDH 2OP4L 1JUFB 4CVZB 1FN4A 3QDME 5E7BA 4NKIH 1ZWIB 4NNPH 4XB7A 5FO7B 3BEWB 3HNSL 4WCYH 3BKMH 2H32A 3T0EB 2ZUWA 2CK0L 4Y8AA 4NO0A 2Q86A 1JPSH 1FIGH 1ZT7A 3BWAB 4WI2A 1HSBB 1FZJA 1SYSB 1GHFH 3E2HC 5E5RB 3ULUH 5DMIL 1I8IA 1LILA 1RK0A 4K8RD 4OLEA 3GEWB 5GRZA 5H94B 5BVPH 3TYGL 1KUMA 3VFSB 1NUFA 1P84K 1FJ1A 2F54D 5E94A 3QUXA 3EFDH 3V9FA 2P8LB 5AD0B 4FFZL 2YK1H 4Q6YA 5D7JD 1RURL 4K7PL 3GMQB 3ROOB 4YO0B 1CGSL 4LLMB 5DXWA 5FCSH 3TZVC 4G9DB 4X6EA 5FO9B 1F42A 2BVOB 2VZTA 3AS2A 1BOGA 3STLB 4E9LA 5LKNA 5GGUA 3P11H 4ODWA 2IQ9L 4MJIE 3O41A 1NGPH 1T22B 2XG5A 4P2CG 4H8WH 4YQXL 4POUB 2ZCKL 2ZCLH 4WW2B 3EOAA 1Q9WA 3GB7B 3QI9D 1AO7A 1G7JB 2GY5A 3MLVH 4HIEA 2IPTH 2E6PA 4OCSH 1OAYL 5JOFA 3ARDC 2YRLA 3LQAH 5FCUL 4CDGC 5CJXC 4M6ML 2OTUA 4ODSL 1BD2D 4L8DA 3VXMD 5DD3L 1MF2H 3P0YH 4MAYA 2G75B 1U8HB 3BZFB 1JFQL 4XPGL 2A73B 4MQ7B 4OGAC 3T4AA 1ZT4B 3HFML 3RWDB 5DZLA 3S5LB 4G6JL 1JWSA 4D3CL 2GSGB 1W0VA 3KWWB 4UUJB 5EUKA 1I9RH 4R0LA 1C5DA 2ITDB 4O2EB 3RZWA 2F5AL 2ED7A 1AFVH 1MHEB 4JQXA 4P48A 5E70A 1RI8A 5JZ7C 4TSBL 2G60L 2G5BB 2P7TA 3PQYD 4Y2OA 4C56E 4NOBA 2NZ9C 1JHTB 2Q7NA 2YN5A 4ZFGL 4GG8B 4PGBA 4UB0L 3UBXB 4PY8J 3W9EA 4P2OB 3S3SA 2HFEB 1J11A 3EJZC 5T1LB 1NL0L 2ILLA 2Y9RT 4KRPD 3ILPA 2Q76B 1NCDH 3UO1H 4D0DA 3N1MC 1MCEA 5DHVB 1NFIA 3MOAH 4U3CA 4OIIL 2A74B 2BNQA 1WCBB 4NWUH 1ZHNB 3TT3L 1PY4A 4XC3L 2KH2B 4NZDA 2MPAL 3V95A 4UMGA 1XCTA 3DV6B 4YBLC 3F7PC 3QDJB 1BVKA 5KSVA 1NLBH 1OB1A 3KPRA 4JFZH 5HGHA 4KQ3H 2UZYB 1PJ9A 5D6DA 2ZP0T 2J88H 4NKMA 3BKJH 1A6TB 1L0XA 4MA8H 1V05A 1J1PH 4F3FB 5FKAB 1T7XA 2XRAL 4NJ9L 3UTOA 4CBPA 4KKCD 2F5BL 4X99A 4D0BA 2H32B 1JZ4A 2E9JA 1OLLA 1ZT7B 2YWZA 5FV1L 4P2QD 3V5KA 5I6XB 3V52H 1FZJB 1I8IB 1RK0B 1I1AC 3NCFB 3TIEB 2XZAL 1FJ1B 5E94B 1MCFA 4AL8L 2OL3L 3PP3K 1M71A 3T3ME 1QBLH 3KPLB 4G8GE 5DHVH 1PDKA 5LVEA 1OSPL 1XGYH 1YPZA 3MXWL 3EJJX 1QO3B 4KGLA 1GC1L 3D69A 4KDTC 4GRWB 4YHIA 3RQ3A 1BOGB 4IHOA 5FK9A 3GKZA 1CK0L 3AY4A 4Z7WA 3D2UA 5GGUB 4ODWB 2NTFA 1KF9B 2DL2A 3LHPH 5TQ2H 4L4TE 3FTGB 2JB5H 1OGAB 5IR1B 3EOAB 4YGAB 1Q9WB 2X1WL 2YPVH 5FYKU 5D7KE 5D2NA 4FA8A 1AO7B 3C6SA 1YYLH 3G6JE 2O5ZL 2W60B 3QZWG 1R5VA 3HPLB 5FGSA 3VH8G 2CJUH 2JLLA 4HIEB 4TVPE 1MHPL 4TUJB 5T3XD 4HLJA 5JOFB 3E3QC 1YEFH 2CR6A 1N6VA 1INDL 2OTUB 4R26H 4ACPA 4L8DB 2H32H 5K59E 5IW6A 2N4IA 4WU7A 2XYCA 4KJPC 4ODXA 2QJDA 4XBGA 1PG7W 5DD0H 2V7NA 4U6TA 2MCPL 3FFCE 4FTVA 2VQTA 3T4AB 5L9DH 3U36A 1JWSB 3AUVA 4K94L 2HLFD 1IC1A 4HQQH 5EUKB 4Z7NF 1VPOL 4R0LB 3NOIA 1MHHA 1PSKH 1C5DB 3OXSA 1QYGL 5F9OL 4HUUA 4PTTB 3DVNA 4JGJA 2BNUB 3LQZA 3OBAA 2EE3A 3BYYA 4GRWH 3RX5A 4YFDB 4TSAL 4POZC 1FAIH 3RVWC 1YEEH 2P7TB 1IEBB 4NQUA 5CLTA 1BFTA 2KZ1B 5J11B 5DK0A 5CCKH 1F4HA 3H6JA 4M1DH 3CX5J 3ZT7A 3W9EB 4XAWH 1CGYA 4KK8D 3ILQD 4KZDL 1UEMA 3ILPB 1AQKH 4D0DB 3EYOA 3FQTB 1NFIB 3J8F7 1B6DA 2Y6SC 3BQUC 1TPXB 5BMFL 4WV1A 4HKJA 3RAJL 3X3FL 3U9PL 2E6QA 3CMGA 1DL7H 4ELME 2CKBA 3W0WB 1OAQL 4DGIL 3FRUA 5C09A 5J1TC 3OV6A 1BVKB 5KSVB 2FSEA 1OB1B 2ZJSH 4PP1C 1RZFH 2IF7A 2ZKHH 2VXTL 3WEXB 5HGHB 3OKDA 5MI0B 4HEPG 1C5BL 4RSVA 4L8SC 3FAWA 2NR6C 5DD5H 3LIZH 1OWRM 4JFPB 4XGZA 5IESL 4OLWH 2DS4A 2W07A 4X4XA 3JSSA 2Y07H 4P5KA 1O0VA 3QHZH 1LO2L 1L9MA 2ESVD 2APVA 5BRZD 4Q9RH 5ACLA 4ZUSA 2FZ3A 4K3EL 5D93C 5CJBA 4WEBL 4PJ9D 5C3TA 4D0BB 4TUKH 3QCUL 1FNHA 3IXAB 4HXAH 3PIQA 2BXZA 2FLBT 4NN7C 3DXAA 3U4AA 3V5KB 2AERT 1IGFL 2AXFB 5GS0H 1QSEA 2VZ1A 1MNUL 3QG7L 4Y0GA 3K3QA 5JIIA 2D3VA 1D9KC 4DAGH 1AJ7H 2DYPA 2H2SD 4IDJL 3D3VA 1M71B 1FNEA 3OTTA 4OLXH 3PV7A 2JJTC 3RVTC 1YPZB 5IFJA 2EYRB 3BJLA 4P4RA 2RCSL 3B9KA 1Z3GL 3L95A 5FGCB 4KDWA 5CGYC 4YHIB 2AW2A 4POYA 3I6GA 4IHOB 4Z7WB 4Y2DC 3D2UB 2CLRA 15C8L 2H41A 1F4YL 2EE2A 2V2WA 4YE4L 1DBAH 3PE9A 3E6HB 4H20H 3THMH 3UYOD 4FZEH 4PLKD 1CGUA 4YUEL 4WUUB 3O4LD 5D2NB 1HYSC 3C6SB 4KHTL 3PQYE 4RWYL 4LDOB 5JO5A 3HE6D 3RL2A 2ICCA 3CVHL 2ED8A 5IVXA 5GPRA 3VXSA 3TCLB 1WC7A 3TCXA 5H2BB 2Y72A 5FGBC 3KLAA 2ARJA 3O0RH 4OLUL 5D71H 2DN7A 4ODXB 2VNCA 1CBVH 3FOMA 3O11A 4QRTB 4DN3L 5KVGL 2V7NB 1MPAL 1ONQB 3E2HB 1MAKA 5J12C 2VDLL 4FTVB 1HILA 1I3VA 4QHNB 1X4YA 1LP9B 3G9AB 5DURB 3MFGB 4ZAKC 5FM8A 1G9EA 3U36B 1WWBX 4EBQH 5AYQA 1PAMA 4JO4H 1JNJA 4J3WA 4FXGB 4I2XB 1DQDL 3CDGA 1MHHB 1QRNB 5FYJH 3N1GC 3ZTNL 3OXSB 4HUUB 3ABZA 3HHRB 1OAKL 3DVNB 4KDTA 2R2EA 2DKSA 5IB2B 3TZVB 4M03A 4U7MA 5MENA 3VMPA 1I1RA 4EI6A 1EO7A 4XPAL 4MS8C 3VXUE 2DQDL 2NYYC 2VDRL 3QO1A 4NKIL 4NNPL 5INDA 5GQBA 5M7QA 3GMPA 3EYOB 3L3HA 3P4NA 3SKJH 2P46B 1HCVA 1QD0A 1JPSL 1FIGL 5I2IA 2B20A 1QNZH 5J57B 4HIXH 2JCCA 2B0SH 1GHFL 2YZ1A 5BVPL 3ARDB 4RGMC 2CKBB 4Y19D 3SCMC 3L5HA 1S7VB 3FRUB 4I18C 3WO4C 3NCJH 5BJTA 5DTFA 3UTQB 2YK1L 2FSEB 4U7SA 1CDUA 3OKDB 4WHYG 3AXLB 1QKZH 4OM1H 5B39G 4XGZB 4OZHA 3MPCA 3WIFA 3CVIH 4PLNC 3K81A 4M1CC 4X4XB 4P5KB 1RIUL 3P11L 3ZO0A 4YR6B 1BQHB 1NGPL 1JHKH 4DVRH 3FQXB 4HBQA 4ZUSB 5HTSA 2FZ3B 5KW9H 2ZCLL 4BFEA 2P42B 2R0WH 4X6CF 1F4XL 1RVFH 5IG7B 4HWNA 2R9HC 3PIQB 5BZDA 3OAYK 3MLUH 3HB3C 3DXAB 3MLVL 1FFNA 3WJJC 5F7FA 2IPTL 1RZIA 3O81A 3T04D 3OGCB 4OCSL 5DS8A 2GQHA 1DZBA 2HP4A 4WEUD 5SWZE 1Z9OA 3LQAL 3K1KC 2DYPB 3D3VB 3RTQA 1FNEB 1MJ8H 5GSRA 5A3IC 5I1AA 2CD0A 1MF2L 5AZEH 3P0YL 2X5PA 5IFJB 4P4RB 3B9KB 3O8XC 1JPTH 3L95B 3OJMB 3HE7C 2CKBH 2FDBP 4YBQC 3I6GB 3VFOA 1EEQA 1AKJA 2H45A 3MRBA 3S34H 3NFPA 4YBLB 1QP1A 2CLRB 3FRPG 2V2WB 1I9RL 3REVA 1R5IA 3UTSD 1P4LA 3QFJA 4APQC 4GXVH 1AFVL 4M1GH 2WV3A 2ZSVB 1FVEA 7CGTA 2VITA 3MNWA 3S9DB 5JO5B 4G8EB 1ACYH 3RL2B 3VDCA 4HX1A 1AGBA 1B9ZA 3RUGE 4KKLD 5IVXB 1IC5L 1P5VA 4KRNA 4S0TD 5E08L 3K8LA 1WC7B 1NBVH 3VFMA 2ARJB 1NCDL 3O2WL 3H8NA 4BA8A 2LU7A 2XWBB 3MOAL 3RBGA 4F7EA 3P77A 3O11B 4RMVA 3ZDXE 1S7SB 2NX5D 3C8DA 4P5TC 1HILB 5HPMA 1FHGA 1D9KA 5F6HJ 2GK0A 5J3HC 3CDGB 4NFBA 1UKSA 3W39B 1NLBL 3NCEB 2MJWA 4M5ZH 4KQ3L 3F12A 2J88L 2R2EB 4YC2C 1Z6JT 3NPZB 1S9KC 1MREH 3EYQD 2HT3D 4JM2F 3S8WA 5L2JA 4NBYB 1J1PL 4Y2DA 5MERB 1TNNA 2XTLA 1MCPH 2R23A 2YHGA 4NUJA 4U1GC 4EI6B 2ESVE 5BRZE 4QF1A 4OFYA 4X4MA 2W92A 4QRPA 4X80H 4NFCA 3QO1B 4OFPA 5J56B 4YHZH 1R0AL 1X44A 1NFDE 3GMPB 4ZQKA 1OHQA 3L3HB 2BVPA 2UZIL 1VFBA 1E4XH 1IC7H 3V52L 2JCCB 2WIMA 3JV4B 4NQXA 5FHAH 4Z7QE 2GJ6D 4ZNEE 5FEBA 4WFEE 1P7QA 4R4ND 3GGWB 5DTFB 4AJ0A 2XWTA 3L7FA 1XGYL 3GIVA 1EEZB 3GKWL 4HJJH 1CIDA 4WI5A 4OZHB 3WIFB 1OF2A 2A9MH 1MCDA 4ZAKA 1TJGH 1F5WA 3QQ9D 1LQSR 3V0WH 2RBLA 1NBQA 4P46D 4ZS7H 1DQQA 4J2XA 3LS5H 5E2UH 5TQ2L 4X9HA 2BOCA 2JB5L 3MODH 3O4LE 3LV3A 5LG1A 2YPVL 4Z5RA 3T3MF 3T1FB 3ZE1E 2UYLB 2FWOA 5BZDB 1YYLL 2P8PA 2YRPA 1FFNB 4Z7UF 3C87A 2C4FU 2XKNA 1H0DA 4GKSA 5DS8B 2A6IA 4XMKH 3AMKA 3GFUA 2C3GA 4ERSH 1MRDH 5GGTH 3CU7A 4HLZH 4R26L 5A2JH 1P9MA 5I1AB 1C1EH 2ZUXA 5GISH 3VGHA 4G6FD 1K6QH 2IQAA 5EBGA 5IVZA 5DD0L 1KN2H 5ANMA 4XHJD 4BZ2H 1N26A 1A3RL 1UC6A 4R4BA 4TYUA 5DUPH 5L9DL 5BV7H 4X6DA 4I18A 3VFOB 2BY1A 1AKJB 2XN9A 3AAZA 3MRBB 4W6WB 3NFPB 3PWUB 5EIIA 4QTIH 3KPQB 5FUZH 4HQQL 4GKNA 2DMKA 3SDYH 3TJEL 3V4PH 1MQ8A 3REVB 6FABH 5ID1A 1R5IB 5AG9A 1P4LB 4Y4FD 5KBNC 3CSPA 3QFJB 4L8SB 1JGUH 1EZVY 2YEZB 1LGVA 2C5DC 2YRZA 3QA3A 4IOSD 1FVEB 2W9DH 5CP7A 2VITB 3MNWB 4ZXBD 1FAIL 1YEEL 4MQXD 3RZCD 1NCCH 3T09A 2Y36H 4LLAA 2MQCA 1KELH 4M1DL 3WV0A 5D93B 1CDYA 2GIYA 4PRHA 1SVCP 1AQKL 2A0LC 4NN7B 4O2CB 4F7EB 2FATL 5E8NA 3DMMC 4ZUTA 1A7QH 3F6LA 4PD4K 2PXYC 4XNYH 1KYOK 1DL7L 4Y19E 5HPMB 1CD9B 2XT1B 3UCRA 1IM9B 4GT7A 1D9KB 2YC1A 2VC2H 4TTGA 1J12A 2GK0B 3DX9A 4I13B 4NQEB 2ZJSL 5E6ZA 4PPTA 2ZKHL 3HG1D 3F12B 4G7YL 1J87A 4PGZA 5DD5L 1BECA 2GJZA 2A6DB 3LIZL 1A6AA 4GBXD 5EPMA 5L6YH 5F88A 3BDXA 5L2JB 2R29H 1KOAA 4Y2DB 2P1YA 1MY7A 2Y07L 1E28A 1BM3H 2R23B 3QP3A 3QHZL 4ONOA 3IT8D 5D9SB 3WCYA 4Q9RL 4JN2A 4DOHE 4OLYH 4HC1H 5HI4C 2IFGA 4APQA 3ULUD 4F8TA 3RGHA 4WI7A 3VXOA 5KSBF 3KJ4C 5JHDD 4TUKL 4HXAL 5HHMB 4NFDA 3BP4A 4ZQKB 3O6LH 3X13A 1AD9B 1VFBB 5BS0B 3BOVA 4JGUA 2HRLA 4LOUC 1IGTA 4LMQE 4M5YH 5GS0L 4J8RA 1BREA 4NQXB 2EIEA 1ZLVH 2GKIA 1AIFA 3DTXA 3QEQB 4DAGL 3QDGE 1AJ7L 4KI5C 5DJAB 1WBYA 1MAMH 1P7QB 4OLXL 2XWTB 1ITCA 4OF8A 4MHHI 3GIVB 1JRHI 4QXGH 2P5WB 4P5TA 5J12B 1OCWH 4KK5C 2EZ0C 1OF2B 1RIVH 1GZQA 4RX4D 4ZAKB 1KTRL 4JE4B 4KROC 4PBVC 1DEEA 2X2YA 4Y4KD 3QT2A 1YN7A 3FO9A 1Z0MA 5CEYA 3HZYA 1DBAL 1DQQB 2C1OA 3BD5A 4WHTA 4H20L 2J8OA 1W8NA 3LV3B 1B4JH 1S8DA 4Z5RB 3O6FA 5IWLC 2FWOB 5AYUH 3O3DB 2IEPA 2P8PB 5I74C 2XKNB 1H0DB 3HUJA 4GKSB 2A6IB 4KJQD 1VFOA 3BN9C 3V6OE 5MEQA 5FB8A 3O0RL 5D71L 1U9KA 5L8LB 2IQAB 2H1PH 5IVZB 2EXYC 1X7QA 3H42H 1CGWA 4RGMB 1AR1C 1X5FA 4R4BB 5A2LH 3SCMB 4X6DB 3WFEH 3RJQB 3WO4B 4I18B 2XN9B 3BPNC 1JNLH 2EDLA 1DE4A 4EBQL 5EIIB 1TCMA 4GKNB 3B3IA 3O6KH 4XWOD 5ID1B 4HG4J 3GJEA 5E2VH 3O2DH 2Y23A 1OGTB 2BVEA 4MAUH 2V7HA 5FYJL 5DQJA 1I3UA 4PJ5A 4GG6B 2EECA 3IFPB 4PJAE 4QNPE 5BOZG 5CP7B 5IROA 1A5FH 5IKCA 4KPHL 1SMOA 4DEPC 3F7YB 1DBJL 5DO2D 5E6YA 1RZ8A 4HXBH 1X4ZA 1RJYA 3RBSA 3MV01 4PRHB 3MZGB 1VGEH 1EMTH 3B9DA 3SKJL 1EPFA 2X4QA 4D9LL 5CWSB 1QNZL 4HIXL 1OTSC 1MFEH 2OR8A 4XNMB 4ZUTB 1RUPH 4KXZH 5CBEA 1HZHH 3GI9H 4BKLA 2GJ6E 3NACH 4ALAH 2YC1B 2IGFH 2WP3T 1SJEA 1T89A 3DETC 3SE4A 5IBUG 1NCUA 1HXYB 1YZZA 3NCJL 3DX9B 3ZLQC 3M07A 1LD9A 4OV5A 3AU1A 2X4OB 5IEKB 3PWVA 2NZIA 4XMLH 3QXAB 4OM1L 4LLQA 1A6AB 3HE7B 2E6JA 2BCKA 4KI1A 5EPMB 5IHZA 3QG6A 4HIHA 3CVIL 4Z6AT 3S88H 4ZPVA 4OZGA 1NANI 2CQVA 4X5WA 3T0WA 3MBED 3QUZA 5GRXG 3WS3B 3ZHDA 4ZFZA 4D8PA 1I8MA 2RAMA 3RI5K 3OR6A 1MFDH 2NMSA 4PP2A 1JHKL 2CGRH 4WUKH 4LBEA 5KW9L 1JK8B 4OTXH 4APQB 2R0WL 1OLZA 1RVFL 3L3JA 3BP4B 4NM4L 3OWEA 3GBLA 4YXLH 4P2OD 3MLUL 4R7NA 5T1LD 1OAUL 3X13B 4H88H 1BIHA 3C8KA 4J8RB 2CUHA 5D72L 1S9VA 3DTXB 4YIQA 4LGRB 2AJUL 4I3RH 5D7IB 3GMOA 3RIFK 1M7IA 1WBYB 1MJ8L 2Y06H 5AZEL 5M94B 3DMMA 3SE8H 3G04A 3QIBC 4UDTB 3QDJD 4P5TB 4F2MB 2PXYA 2DD8H 5CD5D 1GZQB 2CKBL 4RFNC 1M05A 5IM7A 1Q0YH 4Q9QH 4DW2L 4CW1B 1DEEB 4M9PA 1YN7B 3FO9B 3HZYB 3BDYL 2C1OB 4WHTB 3OKLB 2XQBH 4PJ8C 4JDZA 3MFFA 5F1NA 4YC2B 5KN5A 5DRWA 4M1GL 3O6FB 3TWCH 2YKLH 4PJBE 5F6IC 4KFZC 1CD1A 3QRFM 4U1GB 2H9GA 4FMKA 4K23L 4PJEE 4Z0BH 4NO0D 3HUJB 2PNDA 1I1YB 1SBSL 3U83A 3WSQH 5MEQB 5D7LE 1NBVL 5FB8B 1IMHC 4LHUG 1MLCB 1E4WH 3QUXD 1KLGB 3RWCA 5IEHA 1LNUA 1QFUH 1X7QB 3I50L 1RU9L 4RDQG 4DUVA 5B38G 1EHNA 4B0MM 3K4DA 1KEGH 5ESAA 1L0YA 2UZXB 5J89A 1FC1A 3QQNA 1VB9A 2V7HB 4M5ZL 2ICWI 5JW4R 5DQJB 4FFYH 1VEPA 4LHJB 1P4BH 4PBXA 3GI8H 2VH5H 3FQWA 4BK5A 4HMCA 4NCC1 1VFAA 1MREL 4M8VA 7FABH 1OGAD 5C86A 2PCPB 2LTQC 5IKCB 12E8H 2UUDK 1MCPL 1IEHA 1AO7D 1WEJH 4EN3A 2R8SH 1U3YA 2DKMA 4X80L 2GK2A 1RJYB 5GZNC 1O7VA 4YHZL 4B7IA 5JHDE 1E0OB 4Y5VC 1LHZA 5IWLA 4GMSH 2FECL 4Q6IC 2X4QB 5ICXA 1QLFA 1OOAA 1KIQA 4RBPH 4ZUUA 3WJLC 1E4XL 5GZOC 3SKOB 3C09C 5CBEB 4MAYD 3MA7B 4LSUH 2IADA 4BKLB 5FHAL 1HQ4A 3UPAA 4HKXA 5TDNA 1JNHA 3O6MH 5EUOA 5T1MA 1LD9B 3MLTB 1FNLA 5C0CA 4OV5B 2LABA 1ZLSH 3IDMB 2BNRA 4HJJL 3PWVB 4CNIA 3F65A 1NFDF 3I02A 4R4FH 4LLQB 2A9ML 3QG6B 4HIHB 1TJGL 4ZPVB 1OP3H 4OZGB 4X5WB 3VG0H 1A4KA 3SBWA 5IOPA 3A6OA 4IRZH 4D8PB 1I8MB 3V0WL 3OR6B 2O61A 2XNAA 3QUYC 5AAMA 3G5VB 2DI9A 4PP2B 2WQ8A 5E99L 4ZS7L 4ZO6A 3ZT6A 1N7MH 3LS5L 1IJ9A 4LBEB 4K55A 5GS0D 1J7VR 1QTYT 3PGFH 1SVZA 3R06A 3L3IA 1RSFA 3OKNA 2BFVH 3T0EE 4HIIA 2X41A 1HNGA 2E3VA 3MC0A 1IKNC 3HC4H 3C8KB 4OCRL 2EEBA 4G5ZH 1S9VB 1K3IA 4XMKL 1BVLA 2MOVA 2VRAA 1EO5A 1FV1B 3GMOB 1MRDL 1M7IB 4QXWA 5GGTL 1J10A 2LAGB 3W0WD 3ZTJH 1C1EL 3ARQA 3DMMB 2NY3C 1K6QL 3G04B 3MJ6A 1KN2L 4MDJA 2PXYB 3KPRD 2C7UB 3CXDL 4L3CA 4U6VH 4D9RD 2HWZH 2V5MA 5DUPL 3BVNB 4PRAB 1M05B 5IM7B 4LPCA 3IDGA 1T7YA 5MHSD 3HMXA 1A4JA 1GGYA 4QTIL 3DOSA 5FUZL 2X44D 1BJ1J 3V4PL 6FABL 3FFDA 4L3EB 3ZE2E 1K3ZA 4JDZB 5FGRA 5F1NB 2P44B 1I1CA 5KN5B 5DRWB 4PTUA 4J7RA 4GAGH 3W81A 2R56H 2W9DL 1I7TA 3TNMA 2QEJA 4P9HC 2H9GB 1NCCL 3UAJC 3TJHD 1NAMA 5A2FA 2Y36L 3O3AB 1KELL 2YUXA 3RVUD 4LLUA 3OZ9H 4RGNE 3KJ4B 3ARZA 2BY3A 2OJZH 1UVQB 2I27N 2P5EA 3RWCB 5L8KB 1A7QL 4PLOB 5IEHB 1XH3A 1SEBB 4XNYL 5FYJD 4ZYKA 3P0VL 4P3CH 4U6HA 1LEGA 5E00B 1GGIH 2VC2L 3VGGA 1BAFH 5F70A 4JO2L 4LHUA 1J05A 4CVXB 4JFEB 2EDBA 4MNQA 4MQTB 5ISZA 4DN4H 5JLZA 5LAXA 3D2UD 1X9QA 1ORQB 1E6OH 1GOHA 4TPRH 2H2PD 3QIBA 3DO7A 1T03H 4ZFOA 1VFAB 2E8ZA 4XP5H 5L6YL 4KROB 2ZUYA 4IOIA 1BM3L 1KULA 1VFMA 4ORGB 3W5MA 5D2LA 4EN3B 2E27H 1ZK9A 4OLYL 3BIBX 4HC1L 2VB5A 2EYSA 5EU7C 3V7AG 3MRIA 2NCMA 2QQQA 1K8DA 1T7VA 1XEDA 1EERB 1KBGH 1QLFB 1KIQB 4ZUUB 2KL6A 5I74B 2AXGA 3WHXA 4M5YL 3DGCR 1MCHA 2IADB 2YA0A 5FO8A 1HQ4B 2F8VA 2Z93A 4U1HA 5DWUL 5HYQA 2ENSA 2Y5EA 4FTVD 5TDNB 5DURD 5EUOB 5T1MB 5C0CB 2CR3A 5IW3A 3QDJE 2BNRB 4QXGL 4JR9H 4CNIB 3C2SA 1IAIM 3I02B 4F9LC 5L88H 4GQ9H 1RIVL 1MRFH 3A6CH 2R2HA 3BPNB 1CD0A 3PWNA 3VRIA 1ZHKA 3RA7H 2O61B 2XNAB 1KTKE 3KS0J 2UWEA 3CMOH 1JTOA 3LRSB 5C0DA 1UQSA 1B4JL 3UTTA 3B2VH 3FOLA 2VQUA 1BF2A 3EDJA 3CUPB 5K9QI 1WITA 4DEPB 4HIIB 2R1YA 5C9JA 2CLZB 4UNVA 5EH1A 5FUCC 3V4UH 5C7XH 1W72A 4L4VE 4JZOA 1BVLB 4LCYA 2YZ8A 2PYEA 2VLRA 4IDLA 4R2GC 4Y8DC 4KK9C 5I8CA 2WNGA 2GYSA 3HA0A 4Q6IA 3MV9A 4J3XA 5C09D 3P4OA 4WFFD 3WJLA 2H1PL 4MDJB 3UPCA 1KTLA 5JXAH 2DL9A 3H42L 1I4FA 2AK1H 4YFEA 3VE0B 1U3HA 4NC0B 3WFEL 2W0PA 3IDGB 1ED3A 1JNLL 4FFWC 1BBDH 4GRWE 1A4JB 1BFOB 1CQYA 3O6KL 1R3KA 4NUGH 5H35A 5C0BE 3FFDB 4LSDA 5HYSA 1NBYB 5E2VL 3O2DL 2DAVA 4MAUL 2YR3A 5D7SL 4XRCA 1NCNA 2H8PA 5GGVY 4DKEH 4UDUA 3BKCH 2BSRA 4PTUB 2K3TA 1OGAE 4ZSOA 3BSZL 1U92A 1EAJA 1I7TB 3TNMB 1A5FL 3WLWC 2CSPA 2KKQA 1AO7E 5E4IA 5JZ7D 3QUYA 4V1DA 1NAMB 3DXAD 4I77H 2BSTA 4XP4H 3TC9A 1VADB 4ETQA 3B2UC 5D6CB 1ZOXA 1EMTL 3VRJB 3EJZD 2FO4A 2DYPD 3D3VD 4GW5A 1X5ZA 3U4BH 1MFEL 1RUPL 1XH3B 2VDKH 1HZHL 2ATPA 3P9LB 4L1DA 2VSCA 3NACL 4MGXA 1LEGB 4ALAL 2IGFL 1ND0A 3B9KD 2YD8A 3PP4H 4E42A 1J05B 1JL8A 5DHYA 1NH6A 4MNQB 5ACMA 3HR6A 5LAXB 2F19H 5KZCB 1OM3H 3QIBB 3ECBB 5KS9E 2N1KA 3DO7B 4EOWH 4ZFOB 1QFWI 1VENA 3LN4B 4RFNB 5EORH 5E24E 2AV7A 4XT1C 3S88L 1M6OA 4L8CA 3CXHJ 3HMXH 4IOIB 1TQCC 5ABDE 3R4DA 5F7LB 4X6BA 2YPLA 1MFDL 4OZIA 1A7OH 4WUKL 2W9EH 1YJDC 1P1ZA 2EYSB 5I76A 4KGJA 1UENA 3MRIB 2MQ3A 2VZSA 2AEIT 1HHKB 4K8RC 2Z92A 5T1DH 2DICA 4FZ8L 4H88L 5IJVA 2IMMA 2XZZA 4WRLA 2AXGB 1DBBH 5LWYH 3VD9A 1NAMH 4OGYH 4UQ3A 4YXKH 5FO8B 3IDYC 2Z93B 4OZFG 5D7JC 4I3RL 1DLHA 4LAJH 1XMWA 4M4RA 3W0WE 1CFQB 4U6XA 1JZ3A 2Y06L 2HYMA 1CWVA 1RUAH 3SE8L 5H8DA 4NO5B 4YHYC 4M4PA 4D9RE 5DVKA 4NC1E 4D94A 3ME0A 2YD9A 1Q0YL 4Q9QL 4K3DH 3PWNB 4OB5H 1DSFL 5EWIH 3VRIB 1S3KH 2BRRL 3LEVL 3OG6B 2ENYA 2XQBL 1U3ZA 5C0DB 1UQSB 2DLFL 3R1GH 3FOLB 2YKLL 2LTQB 3CNKA 3JZ7A 3RPIA 2BRQA 2C3VA 2R1YB 3TBVA 2IH1A 1IC4H 4Z0BL 2VWEE 3U1SL 5DA4A 4JZOB 4LCYB 3WSQL 2PYEB 2VLRB 4PJXA 4Y5VB 4OUUA 4L29B 5I8CB 1RMFH 1UWEL 5C0RH 1T83A 4Q6IB 3MV9B 4U49A 1E4WL 3ARXA 3QIUC 1B0GA 3P4OB 3LRHA 5DRNB 3C09B 1KTLB 1CL7I 1QFUL 5FYJE 4NSKA 1I4FB 4UV4H 1U3HB 5FGCE 1ED3B 2JJUA 1DQML 4PJEF 1A7NH 4UT9H 5H35B 5HYSB 3MACL 1Y6MR 2EDEA 1FLTX 4ONFH 4XRCB 3RFZC 1YEGH 4UT7H 3MRFA 1TZGH 5F9WC 2RFXA 4Q0XH 4F9LA 1MCWM 3GI8L 3QXDA 5DK2B 2BSRB 4ZSOB 2VR9A 7FABL 4WUUE 1MCLA 1PQZB 3NABH 4OJFH 2E9BA 12E8L 5F8QC 3MRMA 1N59A 3QUYB 4POZD 1WEJL 4V1DB 3RVWD 4KRPC 2R8SL 4S11A 3BRDA 4ETQB 4LSVH 3MUHL 1LE5A 1VFUA 4KY1H 1NMCB 2X70A 2FO4B 3P30H 5IB3A 2VXUH 4GW5B 3OX8A 4O9HH 4OGXH 3LEXB 1W72H 4LSUL 4DTGH 4FTVE 3WE6A 1LP9E 4KV5E 5F7YC 4X9BA 4E42B 1G1YA 1UFUA 2APFA 3D39A 3K1DA 3O6ML 5DHYB 3OF6A 3F8UB 1AKJD 3QNXB 1FH5H 2EC9T 4I2XE 5C70A 2NY3B 3NMEA 1QRNE 3CSGA 4HSQA 4PP1D 5F7HA 1FL6B 4R4FL 1YUHB 2VDNL 1JP5A 4Q58C 5FM4A 2AV7B 3QFJD 1JZ8A 2NR6D 4FOMA 5CIPB 3VG0L 2MCG1 1UZ8A 4L8CB 3QRGL 4IRZL 4EXPX 4X6BB 2BZDA 4OZIB 3SDDC 3TF7C 1WUNT 5D4QA 1P1ZB 3LKSA 5I76B 2VDOH 4FQCH 3FO0L 4WFGD 2I07B 2F58H 5EZOL 4JHAL 2BY2A 4MCZA 3HC4L 4JG1H 3S37H 5LGJA 4UQ3B 4G5ZL 1JHLL 4WIQA 1WIUA 4M6OH 1DLHB 2FHBA 1VEOA 4PY8I 4KDVA 1D9KD 2XZQH 4U6XB 3RX7A 4Y16A 1A6WH 4WFFE 4N8VG 1X5GA 4NO3A 4AEFA 2VO5A 3CK0L 1KSRA 2PUQT 4U6VL 3RVTD 1D5IL 2HWZL 4OZFA 2OR9H 3OJ2C 5C0AA 4IMKC 5E6IA 4OI9A 1I1FB 4XP9H 3JTTA 4Y2DD 2ZZUT 2Z4QB 4XNUH 1A9EA 3EDDA 4FXLA 4OFYD 2AEPH 2QV2A 4QRPD 5EO9B 3MRHA 2R56L 3EYSH 3RPIB 1S9WA 2C3VB 3TBVB 1RY7B 5HHMD 1HYSD 2IH1B 3DXAE 3KYMA 3TPUA 3E8UH 5JW3L 2LV4A 4WHDA 2Y1VA 5BS0D 1V3LA 3MYZA 2AJXH 4OKVA 4ZS6C 3HI6H 3HAEG 5F8RC 2OJZL 3D3VE 3BGMB 4HBCH 1V5JA 3U7WL 1P7QD 3F58H 4GJTB 5SX4I 2AXJA 3O9WA 2D4DA 4DUWA 4NSKB 4P3CL 2P5WD 1GGIL 1CG9A 1BAFL 4TTDC 4MB5A 1C16A 2MNUA 4ZAKD 1IGJA 4R3SA 4DN4L 1JWMB 1QSFB 1WFOA 1E6OL 1G9NC 1G0XA 3MRFB 1R3IH 2RFXB 4M7JL 3UYPA 4FS0A 2HMIC 5DQ9A 2FLRT 1N64H 3OAZH 4XP5L 2DOCA 2DF3A 4JY6A 3MRMB 3VWKA 1N59B 4KK8C 2Z9TA 2XY1A 4XVTH 2BSSA 1KB9K 3V5DA 1BPVA 4NP4H 3AMLA 2DMBA 1RULH 1I8LC 5IVXE 3MLPA 2NYYD 1TETH 5DVMA 2J1KA 1ZLVK 3FQRA 2X70B 1KBGL 2PKDA 5I1GH 5IB3B 4HV8A 1P2CB 4K7PY 2R4SH 3L1OL 3ULVH 3FL7A 1U95A 1J0YA 1B88A 1T1ZB 3OAUL 2D7TH 3WE6B 1R6VA 4JKKA 4R2GB 3RP1A 3SCMD 3L3KA 5I15H 2XN9D 4LF3A 3QIUA 1J5OH 4JR9L 3U4EA 1HCFX 3BGAA 5HGAA 5L88L 3MRGB 2VXSH 4GQ9L 1MRFL 1S7RA 3SGKC 3A6CL 3H7BA 2CDGB 1UZ8B 1I85C 5D70H 3LS4H 4IRSC 3RA7L 3DARA 3TVMA 3IDJA 2DQTL 3B9VA 3LKSB 3B2VL 1MELA 4PRHD 3D18A 4RFEA 4JHZA 4WDIA 5EOQH 2R9HD 3HB3D 3V4UL 5LGJB 2JCCE 1A6VH 2PO6A 2P8MB 8CGTA 4X9IA 3UJTH 3E3QE 1BFVL 4ZOAA 2X6MA 4Y16B 4OFKA 4M00A 2LU3A 1BQLH 4NO3B 1XGTA 1U93A 5A3ID 5IBLD 2AK1L 4NC2B 1JJUA 1LK2A 5C0AB 4OZHE 1A6PA 1BBDL 3GMRA 2FBOJ 4YBQD 4MQSB 3MRLA 3RVXC 2FCBA 3ES6A 4YDVB 3L3GB 4DKEL 3MUJA 4Z76B 3BKCL 4HDIA 4R97C 5HY9A 1KCRH 3MRHB 4Z7VA 3KPSA 4APQD 4PJCB 1LO5A 1TQCB 1R3LA 1D5ZA 2R2BA 3RGVC 4DVBA 3KYMB 3TPUB 3SDDA 4I77L 3T0BA 4XP4L 3B9EA 1R3JB 5I0ZA 3DBXA 2W65A 3T3PE 2I5YH 4R7DA 1FZOA 2OI9C 5IK3A 4MD0A 5FOBB 4FP8L 3U4BL 3MUGB 2VDKL 3IDYB 3MXVL 4P5TD 4WW1A 2B5IB 5EOCH 4S1SH 3PP4L 5AEAA 1CG9B 4EQ2A 2YD6A 1PG7X 3I9GH 3HAEA 1C16B 1IGJB 4NPYB 4R3SB 2X1PA 2EKSA 2V17H 1OM3L 5J3HD 4YHYB 1T0PB 3AB0C 4NQVA 5DQ9B 4Q9BA 4EOWL 5I16A 1IRAY 5B3NA 5EORL 3QWQB 4UIKH 2HTLC 3CDFA 4IMKA 1P4IH 3HMXL 4JY6B 3O6FD 3VWKB 4GSDH 1JRHH 1CF8L 1JGVL 2BSSB 1A7OL 2W9EL 3MRDA 1AQDA 3V5DB 3EUUA 3ARGC 2V9QA 5HBBA 2FJFA 1NCTA 4ZD3H 3FQRB 2JJSC 4WFGE 3X11A 3MV7A 3I6KA 3JV6B 1FYTE 3NCYP 5KS9F 5LWYL 1DBBL 4QYOA 3IXTA 1NAML 1U95B 4OGYL 1UGNA 5C0JA 4YXKL 4JPKH 3VXMB 1YJDH 4KTDH 1H3UA 2EYTA 1FFOA 3RU8H 1S5HA 5FDWA 1MJ7L 4LF3B 3G6DL 3QIUB 4NQEE 4WTZA 1RUAL 3HLAA 1U8NB 4G9FA 4MA1C 1F6FB 1VACB 5ACZB 3U4EB 4FQIH 2EE6A 1UH4A 1S7RB 1T7WA 3ALWA 3SDXE 4K3DL 4OB5L 2MQ0A 5EWIL 3ORJA 5ESVA 1CLZH 1S3KL 3BD4A 3CH1B 2BVTA 5D5MB 1PX4A 4F7TA 3IDJB 2X4PB 5F9WB 3R1GL 3ARWA 4AQ1B 3KPTA 4HWZA 3D18B 5HHME 2C3XA 4RFEB 4Z95H 1RUML 1M7XA 1IC4L 4KRPB 5BS0E 1CLCA 5J6HB 4KJYA 1I8LA 4TUOA 2IAMC 5I66A 2VXVH 1YEHH 5CHNB 1RMFL 3QEQE 5C0RL 1XF2A 4GW1A 1JYVA 5C2BH 4QRSA 2XZCH 4BH8A 1UJ3A 1XGTB 1U93B 4EZMA 1YN6A 4MX7A 2MKWA 2EDOA 4L9LA 1Z2KA 3TBYA 4FQ2H 1YEKH 4YZFE 2P5WE 4J4PC 4U1LA 4UV4L 5F71A