4L1DA

Voltage-gated sodium channel beta3 subunit ig domain
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
124
structure length
113
Chain Sequence
VCVEVPSETEAVQGNPMKLRCISCMKRATTVVEWFYRPEGGKDFLIYEYRNGHQEVESPFQGRLQWNGSKDLQDVSITVLNVTLNDSGLYTCNVSREFFVKTTRLIPLRVHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure and Molecular Imaging of the Nav Channel beta 3 Subunit Indicates a Trimeric Assembly.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Membrane protein
molecule keywords Sodium channel subunit beta-3
total genus 25
structure length 113
sequence length 124
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2013-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4l1dA00
3EOTH 4LCCA 3NZHH 1JFQH 3IFNL 5DLMH 3DYMA 4JZOA 4PB0H 5J06A 1IM3A 4I0PC 4AG4L 4MXWH 1J10A 1MY7A 4JJ5A 4PJ7B 1A64A 2VKWA 4MA7L 5IVZB 3U9PH 4ZS7L 3VWJC 4Z7QF 4FNLL 3ARBD 2H1PH 4BUHA 2HH0L 3VGBA 4P2QA 1IGCL 1FZMB 5JXEC 5FF6A 3PXJA 4GMSL 2FH6A 4OLYH 4CMMA 1JGEB 5BOPA 1IGJB 2VLJE 1P4BH 2IANE 2ZG1A 3DPBA 5DEZA 4NNXA 3MBEC 1CIUA 4MWFA 4RWYL 5IESL 3PQYE 1FGNH 2D7NA 3SKMA 5HSFA 5IB2A 2X10A 4PJHB 1PY4A 5F7YC 3UO1H 5C6TH 3RZCD 1B0GB 3ARBB 5IB1A 5IVXE 2OI9B 1N59B 1VGKA 5HVWA 2X4TA 3VW3L 2BNRA 4NM8H 4WUUD 4IRZL 4XNXH 4I2XA 4QHNB 5GJTH 1BQHA 3IDUA 4KJPD 5F7WC 4M93C 4UINL 5J6GB 2VXVL 3O3BB 4LSQH 2ADIA 1M4KA 2Z92A 4B7LA 4RAHA 4WEBL 1J0YA 1ZKAA 3ZTJH 4Y5XB 1ZHBA 5EU4A 1KPVA 3RVWD 1L9MA 1R0AH 1CGTA 4MA1B 1QFPA 4XXDA 1HEZB 4Y4KA 3WUWB 4CMMB 5IB3B 3SDCD 3F12B 5EZJB 3T8XA 3V4UH 2P44B 3HHRB 5D2NB 5ANMA 1EPFA 1NC2A 2XQBL 3DUUB 4MAYC 1U95A 5FM8A 3ISWA 4Q74A 5HGHB 5F7FA 1M7IA 4Y16D 1YQVH 4P4KA 2F5BL 2HYMA 3ARDD 5IVNA 3VWJB 2YPKB 3X3GH 2QJDA 1DQDH 2Q3AA 1OAKH 3BPOC 2OXGA 4UDTA 5B3JF 4U1KB 1MJUH 4QRRE 2QL1A 2FZ3A 35C8H 3O6FC 3KPSB 3FHQA 3HE7B 1P7QB 3MBXL 4HWEL 3OKKB 2DBLH 3CFCL 5SWZA 1FORH 5DT1L 5F3HB 1K8DB 3H3KA 4BSVB 4EOWH 3IDMB 4QGTA 3H7BB 1XT5A 3WS6A 1FC1A 1RIHH 5INDA 1OARL 4MJ4A 3PNWB 1ZLUH 1T4KB 4CU8A 3V5DB 1CFBA 5MI0C 4FQJL 4JCLA 5GRJH 3QNZA 3DV4A 1T7WA 1BQSA 3MLRH 4Z76A 5C92A 3P4NB 1MY5A 5K59F 3LZFH 2X4RA 4IOFC 1LEIA 3OBAA 2YZ1A 1EFXA 2ZCHL 4GKSA 1N3NA 2QQKH 2HN7A 5IEKB 5DMIH 3ZSTA 4KZEH 2F74B 4MNQB 3UO1L 4OM1L 3CDGA 4Y2DC 4O00A 1HHJA 3KWWA 4XZUB 1JYXA 3JVGC 1F5WA 4PJCE 5EUKB 4PLKC 1IGTB 2CUMA 3O6MH 2I26N 3DX6B 4QRPD 3WLBB 3LKNB 5KSVB 2DJUA 3DVGA 1EJOL 2G5RA 2VZVA 4CN1A 4JRYD 3MRGA 4PRBA 3BDYH 2GSIA 3SGDH 1I75A 1SVZA 3IDYB 2UYLA 3PWJA 1KTDA 2ICWB 3GSQA 4ZUTB 4G7VL 1M05B 5I17B 1CTOA 3LQZA 1DE4A 1MHEB 5ALBH 4XAKE 2XQYK 5DMKB 1QFWM 4FZEH 1T04B 4UB0L 4F58H 4URTB 4CVXB 5L9DL 8FABA 3PG2A 3BXNB 1VESA 4RA0C 3EIFA 1DR9A 3OQ3B 3SJVA 5GRZA 5FUCC 1F42A 3WNOA 1A6TB 3S36X 1MF2H 3TA3B 4D0DA 1AJ7L 5ACZA 4HCRL 1S7RA 3MYJA 1A6ZA 3BHBA 4K94H 3WIHA 4J3OC 4HMCA 1BX2A 1BM3H 4KFZC 5F96H 3KYMB 1IC7H 1BWMA 5JO5B 3PV6B 4JKMA 1B2WL 1U8OA 3CFIC 4OLZL 3QA3A 5GISH 1A7BA 3QEQB 3MBXH 5LAXB 3DUHA 2OYPA 3REWA 1JGDB 3HUJA 1E6OL 4OCWL 1T2XA 3H3PH 5KSBF 4UINH 4XPGH 1DEEA 2ZWLT 5JHDE 1BECA 3KXFA 2FIRT 1A6PA 4LARL 1CLYH 4MB5A 5CP3H 5BV7H 5AUMB 3CDFA 4NRYA 5IR1B 4OV5A 2CKBL 2I24N 1OGAA 4NQVA 2J1KA 4G8FB 1NCAL 5IMKB 4M5ZH 4PJCB 3LSOA 4ODVH 3FTGA 4M62L 5H35B 4X9GA 1EZVY 1ZEAL 4L4TA 4HLZG 5DJ8A 3L3JA 4FQXB 2OZ4H 1VEPA 1HDMA 3DVFA 1LEGB 5EC2B 1GJIA 3QDJD 2KL6A 3DRTB 2W91A 4X6CA 5A1AA 3UPRB 4JGUA 1P2CB 3KPNB 3FOLB 4OD3L 2YPKA 1I3GL 3REVB 5DT1H 3NTCH 2X7LB 3O8XC 3WE6A 1JHLH 4FP8H 1NUNB 3A6CL 4LPUA 4O9HH 4O2EA 4F7CB 5FYKE 3RIAK 4RX4D 2XZAH 1MRDL 2P48B 5I66B 1U8OB 3WXVL 3OXRA 5GS2D 1H3PH 2Z31C 3MLRL 3VXOA 2FR4B 5IGXH 4UOJA 3NFSL 2B20A 1ZHBB 1U3HB 2WUCL 3O3EA 4IIQB 3TBTB 4ALAH 4U1NA 1RUPH 2YBRA 2ICWJ 5KS9A 4LVOC 1UM5L 3DBXA 4A2LA 3GSVA 3QQ9C 4XNUH 5IP4A 3QRFM 4OM1H 1G7PB 1R3HA 1I1YB 3QXAB 3CUPB 5D2NE 1CGXA 5KVDL 2J4WH 5D1ZC 5D96B 4UQ3A 5HTSA 5KVMC 1O0VA 2HLAB 4OCWH 2QEJA 4OCSL 3WNKA 1Z3GL 2H41A 2V7NB 4M7JH 4FQXC 5E08L 5A43C 3JSSA 4OV6F 5E6IC 5I30H 5IB2B 2BERA 5DHYA 4JQXA 1S7VB 3RWHA 5C86A 4LLYA 3RL2B 3ZT6A 4UV4L 4LVHB 2P5EB 3DX6A 4HGKC 3FAWA 1DDHB 4WW2F 5DZLA 3HE6B 4X5XB 3UTSE 4ODWB 1MSPA 1QNZL 1BJ1J 2JELL 1OSPH 5AZ2H 1NGXA 2XA3A 3QAZB 4I0PA 4M3JA 4LL9A 4LLMA 4WDIA 3IDJA 1J5OH 5F71A 1AGBA 4OD1H 2ZCKH 3VGGA 3TJHC 3K8KA 3BPLB 4U2ZA 4YC2B 4H88H 3O3AB 2Z91A 1JVKA 2Q6WA 4F9LC 4LVEA 3FAXA 5C07E 1LEIB 1D5MA 3TV3H 2AK4E 1MCLA 1VACA 2P5ED 5HXMA 5M95B 4MA3B 1JTPA 4U1IA 5D7JB 3VD7A 1T4KA 1MCOH 3T0BA 2D4FA 2P42B 1RAMA 1G7IA 4DOHB 4WHYG 2E5EA 4NSKA 3QDGE 4S10A 4GAJL 2JB6A 3WS3B 3T1FA 5DK3A 2AEIT 4KDTA 2FHBA 2I60H 4OZGB 5D7LB 4OGXL 1AP2A 4IJ3C 5ADPL 1BOYA 4F2MA 3LQAL 2DAVA 4POZD 3V0AC 3MNVB 3E6HB 3MCG1 4KROC 3FN0L 1KT2A 2EYRB 4LOUD 3DX9B 4ODVL 5T3ZD 3QIBB 4U6TA 5ID1B 5JDSA 4KUZL 1GC1L 1CL7L 1ZEAH 4D9QD 2CDGA 3VG9B 4X98B 4GAFB 1CZ8H 4JZJB 2G60H 1UFUA 5I15H 4UT9H 2Z4QB 2D2OA 3B5GA 2CDEB 3P4OB 1X44A 2MSPA 1FGNL 4BH7B 4NRZB 5I0DA 1CQKA 1TETL 5I74B 1BPVA 4EVNB 4G43B 3RVWC 3Q0HA 2IC2A 4OF0A 1A9EA 4M1CC 5EO1A 3EOBB 4L8SC 3U0WH 5B22A 1YEGL 1I4FA 2A73A 3IDGA 3KYNB 4U3HA 4ZO8A 5DQ9A 3UYOD 2EXYC 3VDAA 3KS0H 5EFIB 5EO9B 5IB1B 3AMKA 4JFFA 3D3VB 2VDNH 2UY6A 4OD1L 2X89A 3B2UC 1G7LA 3GM0A 1G1CA 2EXWD 3TM6A 4NOBA 7FABL 3CU1A 4WU5B 1N5YL 4OKDA 3C6SA 1QBAA 3MRIB 4R2GC 3BH8B 4PP1C 1YEHH 5B39B 1OPGL 1KXQE 3OF6D 4P2YA 1ZA6A 4L4VA 1G7HB 4KROB 1J86A 1P6AB 5FF6B 3GJFH 5DSCA 2Z35B 4FFVC 4XP6L 4YWGL 3VXSD 5D7IE 2OL3A 4N9GA 5BVPL 3LRSB 2JKXA 2VITB 2Y07L 4EXPX 1EAJA 3T0AA 4PV9B 4ODTL 2O26U 1DBMH 5HI4D 3SKUD 5TE4L 3TT3H 3X3FL 3U7WL 3ZDYF 1QLEH 4O2FA 1IRAY 4MX7A 4OZHE 4F7PA 4R6UA 3MCKA 3EHBD 3RPIA 1VKXA 4EI5A 3MUJA 4ONHB 1W0WB 4ODHH 5HGGS 1RIUL 3PP3K 5E70A 3TYGL 1OAUL 1TCMA 1DZBA 4PGDA 1IAOA 2DM2A 5JPMB 4NJ9L 5GRUL 5JORA 4DOHE 4RGOL 1A7NL 1JI1A 1RZFL 5CEYA 5HYSB 3RRQA 3GMOB 3TVMB 4AEEA 4QCIB 2JF1A 3CH8A 3VMOA 1UCBH 2ICEB 2H26B 1ND0A 2ZG3A 4QOKD 1P4LA 4Q6YA 3T3ME 1P7HL 3SDDD 3CPLA 1S7SB 4OD2B 4OQ1A 3QNXA 1KJMA 5JOFB 4OAWB 5HGAB 2ZUQC 1PG7X 4XNMB 3D18A 4RMWA 4G3YH 2GT9A 4XPTL 1DUYB 4U1SB 1J1OL 5T1KD 3EBAA 4UIMB 1EEUA 1SJHB 4FQCH 3VFOB 5C0AD 1D6EB 1QKZH 3FN0H 4OLWL 1QSFB 4DZBA 3O2DH 1FL3A 3AAZA 2FB4L 1NL0H 3QIWD 4YR6B 1SQ2N 5FM5M 1AI1H 1L7IH 1MCNA 4X6EA 1X5YA 2HFGH 4XRCA 1L4IA 4OCRH 1VFBA 4L4VE 5M94B 4Z7UF 4FN0A 4PJ9C 2O5YH 5FV1L 2NQCA 5GS3A 2VLLB 3BISA 1A1NB 4NGHL 2V2WA 4NT6A 5I19H 4GG6F 3HCVB 1KN2H 2DQTL 3C60A 1J0HA 2CLRB 4OI8A 5I8OL 2BVQA 2RJMA 2NPLX 2Z93A 4PJIA 1BBDL 1JZ8A 4Y1AA 3QR2A 4WTZA 2DICA 3WDIA 3UTTE 2D7QA 3HNTH 1FDLL 4O2FB 4RDQF 4AENB 4LKXA 1QLEL 4LP4A 4JM2A 3T65B 2AGJH 2AXGA 4IOFD 1T1WA 4IMKA 4P5KB 2FX7H 2VITA 5ENWA 4ODUB 5C0CE 1MI5E 2XWJA 3QCUH 4HWUA 4N1EA 4I0KA 4FTVA 2VZOA 4Q9BA 1S9XA 1CXLA 5KVGH 4JQVC 3GMMB 2EICA 3QEUB 4D3CL 1MFAH 3ARFA 1C12B 1MLBA 1UJ3A 3MGTB 2AABL 1J9CT 3LPWA 3PQYD 4RGND 5CD5D 2X40A 3N1MC 5GZND 4QRSB 5CGYC 2K7PA 1G9NH 1G7LB 3O6FD 4S1DD 4Y5YA 1IQWH 3HC0B 3HKFA 3MRNB 1AQDB 2R0WH 1XR9A 3L5XH 4BH8B 4HWNA 1I85A 1MUJB 3GSOB 3QXTA 4U33A 2NXYC 1H5BB 3FO0L 1A6AA 2D7OA 2ZKHH 4JFPB 1P1ZA 1B0RB 2OI9C 1LE9A 5K9QG 3D85A 2N7BA 5E8NA 2IANB 1VFAA 5E94A 3CXDH 1PDKA 1G0XA 5EO1B 4ZUVB 2AJSL 3O4OB 3RDTC 3WNMA 3OAUH 1NMCC 4MJ6B 4OT1H 4QTIL 4ODHL 4HBCH 4DKEL 1ZGLB 3IXTA 3N1FC 3IF1B 2HP4A 1QEWA 3PGFH 3JWDC 1A5FH 2G2RA 3MRFA 2OTPA 2V2TA 2Z31A 4MA1C 4ZOAA 4OCRL 3P30L 2FHFA 4I3SL 2DLTA 4XBPA 3D2UD 3WL9B 1TZIB 1QLRA 3RTQC 5TE6L 4MNQD 1NCNA 2ERJC 1HXYA 5C0DB 4BZYA 2XWTA 1GGBH 1YEIL 2PNDA 3BGAA 3IS1X 3PABA 5DF0A 5BS0A 4MSWA 3OKNA 5TDPB 4JKWA 5HYJA 3WUWG 1ZGLM 1Q0YH 1I7UA 4EJ1C 1XCQA 2NZ9C 3DRQB 4I18A 3M17A 4OCYL 5D70L 1N64L 4EZMA 1GGCL 3TH2T 1OAXH 1KACB 1T89C 1XR9B 3WFCL 3HI5H 3LKOB 3LRGA 5C8JB 2Y7QB 1KJ2A 4HH9B 5DD5L 3FRUA 3J8F7 5DVLA 3HNVH 4S1DC 2YA0A 1VACB 5CGYD 4OZIB 2D9QB 2R4RH 1ES0B 2Q6WB 3OR6B 4KKBD 3E8UL 1JGVL 2BOCA 3PDDA 1RULL 1QFUL 2ADJA 4IOIB 5I8CB 2JK5B 4HUWA 1ZS8A 3SCMD 4LBEB 5DI8A 5JMOC 4G6FD 4LLMB 4WDIB 1CDUA 3OPZH 4EDWH 4MJIA 3NCYP 1N5YH 4IMLA 1XH3A 2UZIL 2AP2A 1EHNA 3C5JB 4I5BB 2WK2A 3ZKMD 4KVNL 1WFOA 5DK0B 1BBJA 1FDLH 3G6AB 3JZ7A 2NY5C 2P5EA 3L3IA 5JUEL 3SGJA 3CXDL 4CVZA 3PWUB 1E27B 3QXWA 3G6JF 4YHPA 4Q2ZB 4OT1L 2XZQL 5FKAB 1ULVA 1OF2A 1SJEA 1PGRB 2AK4D 5K9OA 2PO6B 1B4JH 1OWWA 1YMMD 5KSUB 2PXYA 2E8ZA 1A1MB 3NN8B 4OZIF 3KXFE 4YDJA 1TMCB 2NY4D 5HHOE 4WGVB 1OB1B 4LSSL 5KN5A 3QDJB 4TVSa 4DQOL 5MEOB 5ETUA 4FQ1H 1UG9A 3WO4B 4NN5C 4QTHB 5DGRA 3L3KA 2BHUA 1SM3L 1N26A 1GGBL 1YEIH 4FQPA 4HXAH 4JO4H 4X80H 3QIWC 3QO0A 1D6EA 1EEZB 4X7EC 3TBYA 5F6IC 3IJHA 4WNQB 4FZ8L 3FO0H 3MROA 3GSXA 2W0FA 5JW4R 2YSSA 4BUGA 3T0DA 4TQEH 1FPTH 1YEFL 2VQTA 4OZ4A 2ICCA 3I75B 5CP7B 5CZVH 2EDBA 2DQGL 1AGFA 3C6LA 2Y5EA 4OD2A 1RIVH 5CKGA 3UXFA 1HQ4B 4U1GC 5EBWB 4ZAKC 3KPNA 3TZVC 2P45B 1JRHL 2EC8A 1WZ1L 3BP5A 2XFXA 3MLUH 1TQCB 4F3FB 1DTUA 2Y9RT 1JPGA 4HG4K 2IBZY 4FFYL 3MLYH 3T0VA 2VDQH 3L3DB 4N5UA 2O5ZH 1ZHKB 3T77B 4WI8A 2VDNL 3CFJA 5FYKD 3SJVE 5I76B 3U7AA 1JPTH 4E5XA 5E9DA 1R0AL 1HSAB 1HSBA 3OMZA 3MCKB 4AEIL 3QO1A 3ZDYE 4YX2L 3UBXI 3IGAA 4HPYL 5IIEB 5IF0B 1B6DA 3QQ3B 3FO2A 4J3UA 5ICXB 1TJHH 4P4KD 5LBSH 3H0TB 3ZSSA 1JNLL 5ALCL 4MD5B 1C7SA 3F6IA 4QRPA 43CAA 4GAYA 4XNZB 5CJQH 4BQ6A 3AFLA 4X6CF 2EDNA 3O11A 5BV7L 3BAEH 5CZXC 2E3VA 1ZWIA 4NQED 3ARGD 2IFGA 3VFSA 1SVCP 3A6OA 4QRUB 5DD5H 3VD9A 2QSTA 4YGAB 2AJVL 1N2RB 4H25B 12E8L 1ACYL 2VDLH 2YA1A 2IBZX 1FNSL 4IBLT 1N8ZA 4OGZA 1G9EA 3M45A 2QR0B 2YOCA 1UCTA 5L2JB 5GGUA 2C1PB 5FB8B 4QXWA 1U3HC 1RZJC 1HHHB 3VU2A 3SJVB 5D1QA 2BMKB 2H3NA 3SE3A 4NO3A 1SEQH 3D0VB 5D7LD 2VLKE 4PRIE 1ZOXA 5T5FH 5FYLL 3QH3B 3O6FA 3MRCA 4M93B 3F7YB 4ZUSA 3GBNL 1YEFH 1M05A 4JB9L 2FJHA 3MLSH 3G5XB 3HMXA 4HUXB 1JE6A 3SGEI 4Y4KD 4I0CC 1A8JH 4UOW0 4GLRH 3O2WH 1Q9OB 4KTDH 4C56D 5CS7A 3LKNA 1HHIA 2EEAA 2YD4A 4YHLH 5SWZE 5KSVA 4E0RA 3I2CL 3O3UN 1S9WB 1IGTA 3NFPA 4NQSA 5H94A 3P4OA 1KELL 5TDNA 3O6KL 5E2JA 5I1AA 3KJ6L 3BIAX 4NWUH 2B8OT 1U8LB 4ODSL 3FRPG 3O2DL 3GMQB 1LD9A 4QHUB 1UQSB 5I71B 3QIBA 1H3WM 4NFCA 2Q76B 2EYRA 4HWBL 1B88A 5I1CL 4GQ9L 4G6ML 1ZT1B 3BZFB 1MIML 1A9BA 3BW9B 4F58L 1RZIB 1P9MA 1NGZB 2E6QA 5E00B 4J4PC 3S34L 1OTUC 5C9KA 3QFJB 3BI9X 1WFUA 3IDMA 2XRAL 1NUFA 1TVHA 2RB8A 4OCSH 3ZL4L 1NMAH 5F3HA 1T66D 5DEFA 2DMCA 1PBYA 2XWBB 3FQUA 2A6KA 2Z8WC 1HOCA 1CXKA 2YKLL 4U1IB 4UDTB 3HRZB 3LV3B 2HT3D 4LSPL 1A2YB 1GL4B 5HHOD 4LSTH 4I4WA 3MV8D 4U6HA 3VWJA 1N4XH 3QCUL 2HFEA 2IGFH 2YD1A 4IDJL 2Q8BH 2ED7A 3DUSA 3VDCA 4NZTL 2VXQH 1I1AB 3QCTH 3PQYA 4QRQA 3DUUA 1CXFA 3E0GA 4JHWL 4TPRL 5FCSH 3U79A 3LKSA 1XR8B 4PS4H 5HPOA 3RA7L 3GSWB 1X5LA 3SDAB 2FL5B 2X4NB 4B5EA 3NIDE 2YD3A 3IU3B 2VDOH 1IQWL 1T89A 3EO1B 4AH2B 3OPZL 2ADIB 3GIZH 1WISA 3ARZA 2OZ4L 4QRTA 4XAWH 3FQXA 2DYPA 5T1MA 3JBG7 1J1XH 3BT2H 4Y4HC 1KIQB 3NABH 4L8SB 1I3RA 3X11B 5E6YA 2ATKA 3DX8B 1B0GA 1T66C 1KIQA 4YDKH 15C8L 5J4MA 2CLZA 1X5IA 3QJFB 1JCKA 3MZGB 5DA4A 1VSCA 5INCA 4UI2A 3ARRA 1KGCD 4JDVB 1A14H 1PVHA 1KB5A 1T22B 4JFZL 1UC6A 2YBRB 2CLVB 1MREL 4KK9D 2HVJA 1U3HA 3Q5TA 2MHAB 1KV3A 4RFEA 2VB5A 1EMTL 5T1DH 1MCJA 1MHCA 5EUOE 5K9JL 3LKSB 4P2QB 3GK8H 5CILH 3VXTB 4F33B 1FCCA 1PG7H 2F8VA 4WUUB 2B39A 3RZCA 1X9QA 4FA8A 1H3VA 2QHRH 1FFRA 3BYYA 4L5FH 4UT7H 3TNNA 4EBQL 5FDWB 1IM3B 5T1LB 1S7WB 3MFFA 4JO4L 3VA2C 2DB8A 3V8OA 3HUJF 3IRPX 1A2YA 1GVIA 3ETBF 1ADQL 4YZFF 2ZUYA 5LQBH 5FO7A 2UZXB 1CG9A 4WFEE 1HILB 3TBWA 3WS6C 4BELD 4ZNCD 2JJSA 2FJGB 4LSTL 1Z3GH 1D9KA 2CKNA 5F7HA 2YUWA 2H32H 3HI1A 4FQ2H 5E5MB 3TN0B 4YAQB 3N85L 1R5IA 4Y4HB 5KW9H 4R4ND 1ZVSB 1NGZA 3DMMA 4XXCA 3DYOA 4PJCA 5GGTL 5IMKA 3IDXL 4GW5A 4J23A 1HYRC 1KBGL 2IEPA 5F89A 5DJYA 5KVEL 1FNHA 2APFA 3LD8B 5FO9A 2A9NH 1H3TA 1T7VA 2CRIA 3VWJD 3L3GA 4P46D 1D5ZB 1I7RB 4YWGH 3IB4A 5CJOH 3RPKA 5DRXA 4F8TA 5BVJB 4W4OA 4J1UA 1GSMA 2X4SA 4LLUB 3VXRA 4PREB 5A2KH 3FQNA 3TYFA 4LCUA 1DBJL 3BVNA 3TO4D 3P9MA 1IJ9A 3HZVB 3BKYH 4H1LB 4N1CA 5LGHL 2F58L 4MDIB 2XG5A 4TNVK 1A7PL 4QXGH 2NYYC 3LIZH 1S7RB 1GRWA 2G5BB 2IGFL 4JE4B 3EYUH 5KJRL 4K7PL 1XGQB 1WFNA 1KENH 4LSDA 1BD2D 5IBLD 3KYAA 4HW6A 1NGWA 4HIHA 3I6GA 4CVXA 2CIKA 2XY1A 4O02H 5ERWA 3GKZA 5D1ZB 5H8DA 4YO0A 1ACYH 1JK8A 4JKLA 2WQRA 2LABA 4CBPA 1MCIA 3QUXC 3S88H 2DL2A 3GSQB 5JMRA 1PJ9A 4NZUH 1QR1B 3TN0C 2AEPH 4LCWA 3V6OA 4HMDA 3F7PC 2ITDA 3HZMB 3BOVA 1YDPB 3NAAH 3ZHDA 3CD4A 5FFLA 3QAZC 4OGAD 3KWWB 4UT9L 5IBUG 4JRYB 2EO1A 5E2TL 1RHHA 3UJTL 4ZPTA 4KTEH 1DUZA 2CSPA 4G6FB 5T3XL 3I84A 1U58A 4WFHD 2NY0C 3HPJA 3P77A 3K2UH 4CGTA 4QLRA 4HS6B 3VFUA 3FO2B 3MOAL 1PSKH 3GZKA 3M1BB 3VXME 1JGUL 2MFNA 1WBXB 2X4QB 3AMLA 3IAGC 1C1EL 3IFOB 3C9NB 2A6JB 2Y1VA 5T3XE 4GKOA 2X2YA 1EHXA 1P7KB 2MOVA 4L5FL 1F6AB 2B4CL 5IHUL 4RMVA 2GJ6D 1I7ZB 3UYRL 4MGXA 1T5XA 4R3SA 4UIKL 4CW1B 3FB8A 4LLQB 4KH2A 5EN2A 1VADA 5GSVA 3HE7A 2CJUH 5F1KC 2BRQA 4PJ9A 1IGYB 4OQTH 2VSDA 5K33A 1GPOL 3NFNA 1QVOB 3WIHH 5JW4Q 4Y19B 2FX9L 3BKCL 4H26B 3IU4H 3BP6A 3BN3B 5GGRB 5ALCH 4PIRF 1NMAL 2A6IB 3EYUL 5KJRH 3QUML 3SQBA 2RAMA 1CL7I 4CAGA 5ABDE 4MVBD 1G7QA 4Z95H 3LOWA 4JZJC 4XVJL 3FT4B 4P57A 4PJBE 1RJLA 4V2BA 5HDBE 3GSXB 5CP3A 3ROOB 3WV0A 1FNGB 2XNAA 5HY9B 3ULVL 4XXDB 3C5SA 3TC9A 5CD3A 3W9DB 4I9WD 3OKLA 5DUPL 2YXMA 4R4BB 3S4SG 5CJ8A 4U6YA 2R0WL 1IZJA 5KSBB 1FL6A 2W9EL 5E8DH 1J87A 2GAZB 1YMMB 1SEQL 4KJQC 4M03A 4YNYA 5EU3B 4PJEE 1ITCA 5TQ2H 3JWOL 2BNRB 1FYTA 2MQCA 5I18L 4HGMA 1A1OB 5DJDA 2OZ4A 5FGBC 4PTUA 4LPYA 2A38A 1F6FB 5DFVD 4LEXH 4XCEA 3SGDI 2V5RA 4PJHA 3AS2A 5GGRY 2EH7H 4RFOL 1U8MA 2ZJSH 3IFLH 1WWBX 4TNWK 1HHKB 2DLIA 3I2CH 4PV8B 4MWFB 3MX0A 1A5FL 2V2XB 4KJPC 3CVHH 5GZOD 2QQLH 4PJXA 4YXHH 1XF3A 1WT5C 3SKOA 3SBWA 1XH3B 3D2UA 3SY0B 1A7QL 3FO9B 2VDRL 4JEGB 4XTRC 5K9QI 5BW7A 3NCMA 2F19H 4GBXB 5I1GL 4ZOEA 4IOIA 2F54B 4WI6A 3TGXA 5IBTH 1ES0A 3H9SD 3H3BC 1MRCH 1NC4A 2EDOA 3SE8L 2VO5A 1UB5A 4K7FA 3ULVF 3OAYK 1CU4H 3QIUD 2P8MA 4F57H 2GSGB 1QRKA 2MCPH 1BIIB 1NGPH 3RIFK 1FL5B 1T7YA 3FRPA 4AEHH 2JJTC 4G8EB 1ADQA 5HI5C 2DIJA 4Y88A 5HGDB 2EDEA 5BRZD 3LEYH 4YH6A 2JIXB 3G6JB 4IEFB 4KJQD 4HKXA 1BFTA 5L88H 1LWRA 3QUZA 3WYRA 2AGJL 4MCZB 2GAZA 4MDJA 1L7TL 1KCLA 2KKQA 3PABB 4HAGA 4GLRI 1KCUL 1NANH 4ZO9A 5LG1A 5KVGL 5BRZB 2W9EH 2B4CH 2XNAB 5HY9A 3FFCA 1FLRH 4KHTH 2ARJA 1YY9C 2VIRB 4NCC2 2DI7A 3PWPE 3S3PA 5GRYA 4PS4L 4ZFZB 1QP1A 3STBA 3EJYC 1P53A 3BP4A 4HS3A 2HTLC 2DD8L 4QXUL 1WSST 1JV5A 4HDIB 5ESQA 3NH7H 4LPVA 4X9BA 3IYLW 4PFEA 2BVYA 4Y19A 5FKPA 4G9FB 1XF5A 4U1GB 1UKQA 3V5KB 5MEPB 5E94B 3BQUA 3KLAB 2CO7B 3I85A 1DBJH 2QQNH 2NXZC 3BEWA 3BUYA 1RJZB 2WP3O 4CNIA 2K3TA 5LGHH 1I7ZA 1NC2D 2A74A 4NYLA 3O4LB 5IUSA 3LIZL 2DS4A 1F2XK 1TCRA 3F7QA 4GQPH 2J8UE 3LQMA 4X4ZA 1EGJL 1AHWA 3W9EA 4A2MA 5I1JL 5FM5O 1XF2B 1ZT7A 2CGRL 3DXAE 2MQ0A 4AIXA 4I3SH 4Z77B 2E9BA 3ZMRA 5J1AB 2GHWB 1PG7L 1B3JA 2ATPA 2VH5H 5DYOA 4PRHE 5EU6D 2NY1D 2P8PA 5C0AA 5JPNB 4L29A 2CK0H 2PTTA 5FYLE 2Q87A 4OJFH 4FG6D 5I1HH 4DN3H 3ECBA 3E3QE 2H2SD 3VXUB 1G1YA 4JN1L 2EH7L 4LSUL 2EZ0D 1KNOB 1SBSL 1GAFH 4AL8H 4FTVE 2A9ML 5I16B 1MCEA 5DQDL 3HE7C 3RWEB 4FQLL 1CR9L 5E7FA 5D70H 2IQAB 2BVQB 4PJIB 5MP6H 2VZ1A 4EN3D 1ZLWK 3V6OC 4LK4A 3AVEA 5ICZB 3TF7C 4FTVD 1KCRH 4NWTH 3PP4H 1JK8B 3MOAH 4YHOH 2PKDA 2G9HB 2HJLB 5GGTH 3UPAA 3C8KA 3UDWA 4XCNB 2PW2A 5C0CD 4HS8H 1CLZH 2EYSA 4Z8FL 4TRPH 5D7KD 3QWOA 2GJ6E 1N0XL 1QG3A 3Q2CA 1CDGA 3UYRH 4P2QE 3RAJL 3LKQA 1LO0L 1YY8B 4ZFGL 3W5NA 2CIIA 1IC7L 4XMKH 2OL3H 3IRZA 4JG0L 5EO0B 1J0JA 4JY5H 2NR6C 1Q8MA 5GISL 4KKCC 32C2B 2ERJB 4OCNC 2VLKB 3UBXG 2K9UA 4PJFF 3WFHA 3QFDB 4AMKH 3B6SA 3RDTA 5JIIA 1QPPA 4X9HA 4MLIA 3KHOA 5F89B 4RGMB 2EYSB 5CZXD 4RAUA 2E7LA 4Y8DC 2CGRH 3QEHB 2AJYL 4XCNA 2WBJC 2N4IA 1K5NA 2AXJA 4LFHG 1R5IB 4WTZG 2OLDA 4Y4HA 1QZ1A 3VFNA 3S4SA 1GYAA 5E56A 5JPMA 4G8IA 4G9DB 1TZGL 2EIZB 5DVOA 2X4PB 1LK2B 5C09A 1T1XB 3LS4H 3EO0A 4FRWA 1CG9B 4M7ZC 4ORZC 4WWKC 4WTWA 2PTVA 5I1EH 1I8IB 4HFUL 3RZWA 4TVPD 4NC2B 4HLZH 3BE1H 3RUGF 1QSFD 1DFBH 5DD3H 3ZYJA 4I3GA 1I3GH 3VXUA 1YN7B 5CBAB 3MRHB 1XGYL 2D0GA 4K8RD 3ULVD 4A6YB 2DLFH 1OT2A 2PTTB 3T2PA 1F3DJ 4O9HL 1B4RA 2P8LA 3OF6A 4R4FH 5F7EH 3QRGH 5EZLA 5I1KL 3X13A 4PGBB 5I6XB 2MHAA 5C0FB 3C6SB 4G42A 1FZOA 1S78D 2PO6C 3KLDA 3INUH 4WO4A 4DN3L 4RGMC 1PLGL 2X6MA 5IHLB 4Y4HD 3O4LA 4XNUL 2C3HA 2PR4L 2ZUUA 3ZKNC 3QG6B 3STZA 1P9MC 1AKJD 3MREA 2AI0L 2GTWA 1J7VR 4RISH 4YEFA 4U7KA 2AQ2A 4FABL 2VXSL 5JZ7D 3ZKXB 3SCMA 1X6NA 4KI1A 5FKPB 3QIWB 1N4XL 1JWMB 1HK6A 1RUML 1M71A 1MEXH 4RGNB 3GEWB 4UV4H 4K3DL 3IETB 3GSWA 1TIUA 2J88L 2UWEE 3MACH 4JZJA 5DRZA 2KDGA 1IEAA 2HJFB 2JELH 3G08A 5GGVY 4HKJB 5B4MD 3P4MA 2VE6A 2J5LC 4U6HB 1ZXQA 3NIDF 1AXSA 5LGJA 3QUMB 1JRHI 2BY0A 5T5FL 2VXUH 1XIWC 4DN4H 2OP4H 3BGMB 1R24A 1F3RB 4PLJC 1AE6L 3VI4E 4JFOB 2YD6A 1M1SA 2VQ1B 2ZP0T 5A2IH 5C6WH 5D1ZD 5D1XB 4OZHF 4OGXH 4JREB 1MREH 1I8KA 2DI8A 4LVHC 3HG1A 2X4UB 3OTTA 1KGCE 1MCWM 2Q7NA 5DD0H 3OB0H 4R4FL 1S7TB 4ZTOH 4HJ0D 4PJFE 1DSFL 3OHXA 3KPRE 1MQ8A 1QLFA 1T0NA 5T3ZE 5C3TA 4OFIA 3RI5F 1IGMH 2ARJQ 1X7QA 1QSEA 1BVZA 5IHBA 2GCYB 5BW7C 1R3JA 2AJZA 3INUL 4YC2C 1IL1B 3BH9A 3SBWC 4NP4H 1NGXB 5C9JB 3SY0A 4NO2A 1HNGA 3BZDA 3T4AA 4PJ8B 3L3OA 3RWCA 1MVUA 3B3IA 2I9LA 5JNYB 3RL1B 2X1XR 3PHOA 2WINA 5F9JA 3U82B 3SDXE 4R90L 4NO5B 5CHNA 3STLA 2Q20A 4X7SH 1ETZB 2W65B 2R0KL 3C09B 2EC9T 4X83A 3QWRD 4K71C 2DLFL 1JNJA 3AC0A 2X41A 1T03H 25C8H 2AJXL 3JV5A 5D71H 2J7LA 5EOCH 4G7YH 2UY7A 4HT1L 4YXKH 3P73A 1KFAL 3WKML 2EE6A 4GG6E 4KDTC 2IH1B 1DLHB 4XI5D 3OKEB 1HHHA 5JHLL 5GS0L 3PDOB 5HGBB 1CVRA 5CCKL 5C1MB 5CJOL 3CXHJ 1UWXK 3WEXA 3ZKQD 4JHWH 3QEGH 4ODXA 4M7LL 4TPRH 3V4PH 4MAYA 1B9ZA 2H8PB 1FIGL 2B5IB 4DN4L 1JF6A 4XPBL 1H8SA 5CJXC 3DETD 4PD4K 3O11B 5GJSH 1Q94B 1TVDA 4LRIC 4LASH 3OGCB 4N0YH 1AGCA 1SY6L 2VDOL 4XH2A 2F58H 2WP3T 3S36L 3BQUD 3WFDH 1XMWA 2VDKH 4GW4A 3QQ3A 4KK5D 43C9A 4MQ7B 4RZCA 2PYFB 3NABL 3UPRA 4H20H 1GZQA 3EFDL 3WDJA 2AJ3A 2RGSA 1HSAA 4HG4J 1IGML 4XX1E 4X8JA 1P84J 5EZIH 2K1MA 1BFVL 5IOPA 3X17A 4AIZB 3QZWB 4HZLA 3T77A 4JY4A 1WEJL 3WN5C 4X8JB 3GMPB 1PX3A 1D5XA 2BNRD 3QHZH 1GGIL 4WY7H 5TE7L 2H2SC 1KF9B 2EKSB 2R2BA 2MMXA 4QEGA 4L8CA 2DKSA 2AK1H 5JW5B 3CX5J 3GK8L 5CILL 4PP2B 4LHQB 3QZWG 4M48L 5HI3C 1NLDH 43C9B 4YHKH 4LRNL 1UCBL 5DD6B 3MLWL 4N8VA 5E2TH 4QY8A 5HHQA 3MV7D 2YRLA 4OJFL 4B41A 4GXUN 5E2UL 1CS6A 2DJSA 3L1OL 2X70B 1DUZB 4GXVH 4IS6B 1JGDA 3HUJB 5F1SA 3CDCA 3B8YA 3UX9B 4C83B 3ZKSD 1YYML 4RFNC 5EDXA 4Y2DD 1LNUA 3HA0A 1F11A 1JGUH 2OR8A 4ODXB 1D6VL 1BX2B 1CVSC 4FQLH 4EI6B 2VXTH 1W0VA 2CD0A 2YMXL 3ALXA 3LAFA 4LVNB 4XP5H 2XN9D 3IFPA 3OKEA 1T21B 3A0OA 3MRLB 2P7TA 3GB7A 1INEL 2DIAA 5F7EL 4KRPD 3SDXA 1N6QH 2D3VA 4OLYL 1F2QA 2AKRB 3TVMC 1OTSD 3CLFH 5DFWH 3UCRA 3VG0H 1ETZA 1OF2B 1SJEB 2W65A 4N0YL 4RWYH 3RJDA 5I8KL 3RGHA 4CVZB 3DVGB 1WBZB 3GMNB 3X3GL 2R0KH 2FECL 3FN3A 3RNQA 4OB5H 1BVLA 1YEKH 1BJ1H 4WV1A 3FQTB 5D7IF 4BQBA 4JDZA 1IQDB 1FE8H 1X6LA 2YRZA 3VW3H 4P23C 4ZODA 1KLFA 3CFCH 3PJSA 1BFVH 4ZQKB 5DI8B 3C87A 2V9TA 1WCQA 1BF8A 2HN7B 5AWNH 4WEBH 1R3KA 3PL6D 1SEBA 3TBSA 4DKAA 4Q0XH 1T0NB 5BOZG 2HWZH 5E4EB 2C3VB 2AJYH 1KB9K 4WV1C 2VAJA 2W60A 3D85D 2OJZL 1MWAH 1FJ1B 2HKHL 3EAKA 3CK0H 2FIKB 4FFVD 3EDFA 4ESKA 4O51A 1AO7A 3GRWH 5GS1A 3BIKB 1BFOB 1Q1JH 3PGCB 4AJ0A 3GNMH 3HMXH 1I7UB 3CU7A 1JYVA 5ANME 5A3ID 4HX1A 1V3KA 1EX0A 1F3JB 2EDJA 4MSWB 4X6DA 2W9LA 1D6VH 3FFCE 3UJTH 4C55A 2DLHA 3PE9A 1MI5B 5ECJE 3K81A 4QTIH 2G75A 2BJML 2VDRH 5T1LA 3NACL 1AQKH 4LHUD 3P3YA 2HJFA 4MA8L 3QI9B 1NDGB 3UTZA 3VFMB 2YN3A 5EU6B 4JM2C 4NOFA 4U49A 1YJDC 1CU4L 3V95A 3WUWA 5IB3A 4Y4KB 3EOTL 2QKIA 2P49B 5F6HJ 4RFEB 1ORQB 3OAYH 3MV8B 1NEUA 2B0SL 3JV0A 1YNKH 3ZT5A 2NW2A 4PRNA 1OCWH 3I3BA 4H5SB 3RWDA 2IANA 4WHTA 2WW8A 5JTWA 5L6YH 3F7VB 4Z7WB 1CQYA 3BPNB 2C3GA 4J12A 5EUOB 1YEKL 3WBDA 5CGTA 4I2XB 1NEZA 4NN7B 4KVCH 4XBEH 1K6QL 1QFWH 4JQIH 5C2UB 2YWYA 3RUGA 3RBSA 5IESH 5A40E 3U4EA 5C6PB 4BH8A 3MGOB 1BWWA 5BMFH 1I85C 1A0QL 1W72B 4J4PA 1AH1A 2R39A 2I27N 4ZS6D 1HHGA 2AJUH 25C8L 2AJXH 3TVMD 3SDAA 1JGEA 5CFHA 1HNFA 1V7NL 3ARFB 4PTTB 5J13C 1FZMA 4XMPH 2F5AL 2VXVH 1INQB 3PWVA 1QSVA 3VXPB 1RU9L 5IJKA 1OAZL 1EAPA 2XWJB 1BD2A 4IRJC 3VWKC 4P5KA 4LCCB 4ZTPL 4JM2B 3T65A 1ZLSL 5DR5L 5HHPB 2VLKD 4NQCA 4KHXH 1U3JA 3HRZA 5ESVB 4FXLA 3P0VH 5GRXG 2Q1EA 3LH2H 2X4PA 4ZSOB 3U36B 3GMRA 4OLUH 4G9DA 3ZE0F 3HLAB 1WITA 2FJFB 3QDAA 1A1NA 2IG2H 1F45A 5EC1B 2R9HD 1WICA 5DURB 3MPCA 3CFEA 4IHOA 4P2QD 5JR1L 2BSTA 1ZVHA 4KGLA 4G8GB 3BEVB 5HYQB 1UWEL 3QEHA 5D7KE 2AERT 2VC2L 1Q38A 4R7DA 5KG9B 1IE5A 4GS7B 4JDTH 2Q3ZA 6FABH 3BGFC 3JV6B 4UUJB 1RUPL 5D7IA 5C0GB 1DEDA 1U8LA 1Q0XL 2EEBA 1FBIH 3BN9C 1QO3A 4LLWB 1WIOA 5EO0A 4MS8D 5H37H 1I3VA 2BVUA 1Q72H 3EGSA 1XGRA 4RGNE 1KYOJ 2ZG2A 1RMFH 4U6XA 3EJJX 3TBVB 2M1KA 4H8WL 4KK5C 1KIPB 5FECA 1SMOA 2ZSVA 3TFKC 3L1OH 1DANU 4GSDH 1CGYA 3IAQA 3GMOA 3FO1A 1VGEH 2CUIA 4M7KH 1JWSA 2HTKC 3DETC 2H32A 3MRCB 3O6FB 4ZOBA 4GG8A 4OF6A 1OW0A 3QUKB 1X3DA 4YBLC 3VFTB 5B38G 3GSNL 1QNZH 2VDQL 3BDYL 4L8BB 4XP5L 1CD1B 2JJUA 2WUCH 4PJGA 1QQDA 5GRWA 4Z7VB 4FFZH 2OBGA 4XI5C 2YPLD 3CH1B 3QDMB 3MQIA 3U30B 5I16A 3T4YB 3DVNA 4PV9A 1MCHA 5C0JB 5CINL 2CR3A 4HHAA 3QT2A 4U0RB 1U8IA 1CFSA 4FQQB 4HZAA 3OZ9L 1UXWB 2NX5E 2Z35A 1Q9WB 4CMHC 5JPNA 5TGBA 3H0TA 3SDYL 5J1AA 3BPCB 3ARSA 4JN2B 2IH3A 4OFVA 1TQCC 3UEZA 5IF0A 1NAML 5IMMA 3IJYA 3U1SL 5JQHC 2R0LL 3CIQA 5GHWL 4EIZC 1XZ0B 3SKNA 2WLYA 4PJGB 4I3RH 4WJ5B 2GJZB 4L8BA 2DMKA 3DGGA 3QDGA 1QRNA 1T7ZA 1PQZA 2BY2A 5F7NC 3B9KB 4HJJH 4GG8B 4PJDA 1I4FB 3IDGB 3IDNB 1KXTB 3W2DH 4N8CH 4F3FA 3GSUA 1T2JA 2VH5L 3T0ED 3X14B 1CFTA 1K8IB 1U93A 3UC0H 1RMFL 5JLZB 5D5ME 4P3DB 5T5NF 1CF8L 4UU9A 3KPTA 4JFEA 3QPXL 3JWOC 2Y36L 3TA3C 2Y5TB 4FG6C 5C0BD 2HT4D 3CFBB 1YC8A 3HZYA 3PIQB 1VGEL 3F5WB 1NJ9B 3ROLA 5TPWL 2JCCA 5KS9F 3HR5B 1P69B 4XPAH 3S97C 5I1KH 3WIIL 4ODSH 2VXTL 1CYGA 3V6BR 3UTPE 5MP6L 3O9WD 4TVPH 1T6WA 4RBPH 4CMHB 1KIRB 3VGFA 4G6AD 2B4CC 4YHNA 5I1CH 2P1YA 2XQYG 1ZTXH 4MCZA 3HAEA 3QUZD 3RWIA 2R56H 3D39A 1N6QL 3RVVC 1AP2B 2FX8H 3VCLA 2JIXA 1NGYB 2PXYB 3VG0L 4DGYL 4OQTA 5I8EA 4DVRL 5FKAA 4LMQE 1R3LA 2ADGB 5L6YL 1FL5A 1ZA3A 5C0NC 3UJIH 4MA3A 4KKLC 2NY2C 4GUPB 4NQCB 4X0KA 3NIFF 5FO8B 4RAVA 2J4WL 1U8PA 5FYKH 1AR2A 4PJAA 3R4DA 1HIML 4M00A 2QADC 2PXYD 2IADA 4G80A 3VWKA 2VDMH 1EO7A 4NZTH 1INQA 1V3MA 5F7UA 3R0NA 2ADJB 4HKBB 4V1DB 4FFZL 1WWCA 4HXBH 3LN5A 2I07A 1OQOA 4XC1H 3V0VB 1KG0A 2OP4L 4GKZB 3IT8D 3PWLA 1OSZB 3Q3GA 3I6KB 5IQ7H 1HHKA 3UC0L 3NGBB 3CC5B 2VSCA 1Z9OA 5CEXA 3DOSA 2A0LD 5K59E 3MGOA 2R4SL 3L6FB 4XCEB 3QWRA 5C71A 1CDBA 2VLMD 2BNQD 3D5OF 2P5WE 4KU1A 3HMXL 5DD1H 3CUPA 4K71B 4P99A 3BKML 4KKAC 4PY7B 5EG6C 1UZ6E 3I6LD 1KTLB 3L7EA 5DRNB 4JRXE 4K23H 1MCOL 3U6RB 4H5SA 3WIIH 3U1SH 5KSBA 2PF6A 4KMTL 3CVHA 3QIUA 4LKCA 4IIQA 1KIRA 3TBTA 4JFED 1MCWW 2XWTB 4GRLC 3V0WH 1JZ5A 4PJBA 1JN6A 5MHSD 4HGWA 5IROC 4DEPB 5E1AA 3RZCC 1DQMH 2VDPL 3LQAH 2C4FU 3OX8B 1WAAE 3AM8A 3HR5A 2D31B 1EUTA 1ZHNB 5IEHB 5KSAC 3V52H 1IT9L 3W0WD 3ROLB 1RZKH 5IJVA 3CCHB 5D5MB 4HWBA 4FXKB 4NGHH 1JZ7A 2Y5TA 4WHDA 3MUY1 1BOGA 1KLUA 3JTSA 5IMLA 3LN4A 2XN9B 3WFEL 4NFDA 1P2CA 4P3DA 1FZJA 4P2RB 5CLTA 3X14A 5F93C 1ADQH 4Y89A 5LQBL 2FRGP 4PRAB 3UP1A 4XBEL 5LVEA 4PJDB 5D71L 1B0RA 4JFPA 4XPFL 2X1WL 1AHWC 2DRUA 4Z7NF 1V05A 1R5VA 2XXMB 1J1OH 1QRNB 1UEYA 1EJOH 1BQUA 4U1LB 1NUDA 3QQ4A 4GSDL 2A6JA 2GJZA 1AQDA 2NXYD 3SO3C 1FJ1A 4S1SL 3TCXA 2OR9L 1AFVH 4G9FD 3SQOH 4XP4L 2AABH 4F15B 3IDXH 2C3VA 4XC1L 5ALBL 1J05B 1V7NH 3TBSB 4EDXB 3VFUB 5AUMA 1C12A 1MLBB 5DQJB 1R3KB 2F5AH 3MRMA 5HHVH 3HMWH 1RJYA 4XVTH 1OP3H 4P23D 3M8OL 3PHQB 1YYLL 3L9RB 4WEUD 4X4YA 3MA7B 4UAOC 1K2DA 4ZPTB 1AJ7H 3D69B 3WMSA 1TVBA 4KPHH 3QA3B 2ZKHL 1FHGA 3CSBA 5AAWA 2H2PC 1V3LA 2EC9U 1AO7E 4P59L 4PR5B 4YXLL 4H20L 3MV01 1VDGA 4FQHB 4HUVA 4E41A 5L8LB 1JF1B 5IT2L 2IPTH 1JPFB 5IBUB 4XPGL 3T1WA 1EEYB 5FYJD 1KENL 2JLLA 1DQDL 4LARH 8FABB 5E2VH 5BQ7B 3VFTA 3QUKA 4ZYKA 2CH8A 4LHUA 1A6UH 2H32B 1QFWI 4U1JA 5ICYB 3DYPA 3HPLA 5ILTH 3PV7A 4ZUTA 5J89A 2YN5A 3F8UB 2BNQA 5TE6H 3FQRB 1KTDB 4APQA 3KLHD 3VXUD 2NX5A 4NZUL 2G5BA 5H37G 1IGIH 1U8NB 1QSFA 1UZ8B 3L5XL 1FO0B 2BVEA 4MA7H 4WI7A 4ZPVA 5HHXL 1GIGL 4KXZH 4UIMA 1TTGA 2D7PA 4C4KO 4YHZH 3ALWA 3BKMH 3AB0C 3VMPA 1UYWL 4X6BB 5CSZB 3UTQB 5DVMA 5EPMB 4OCYH 2H6PB 1NSNH 1S9KC 4UAOB 5HI3D 5BJTA 5JOPE 4GKSB 1D5ZA 1I7RA 3CPLB 5DTFB 1A02N 3QI9D 3MUZ1 3WNNA 4OFDA 3R06B 5IWLC 3DV4B 3SDDC 3AU1A 1FG2A 5C0CB 2XIDA 3MRBA 1QHPA 2P47B 5CEYB 2EKSA 1ZVSA 1NCBL 2NW3B 4LAJH 4JFHD 2VQUA 1QKZL 2CRMA 3E8UH 4PGEA 4X7FC 2HG5B 5KVFH 4XWGL 4PJ5D 1L0XA 5GGTA 5IOPB 5LGKA 5JA8B 4W70A 4G7VH 3U36A 4EI5B 3KR3H 4OZIE 1RVFL 4KAQH 1JYNA 5BO1L 1J0ZA 2CJUL 3OJDA 4YLQT 1TFHA 4YHYC 1MJ7L 1G9NC 1KPUA 4RZCB 1PKQB 3BQUC 1U2HA 4HEME 5GGSA 2FGWH 1Y0LB 3VRJB 1QBMH 4R97B 4X4XB 5I30L 3ALPA 1T1YB 1DANT 4X6DF 1MCDA 2C3WA 4WUUA 5F96L 5ACLA 4PY8I 2MWCA 2FYYB 4JM2D 4PTTA 5GGQH 1MOEA 2NTFA 4D8PA 5TFSL 4OBSA 1HEZA 1ZSDB 4Y8AA 3QYCA 4XGZA 3E3QC 4O5LL 4BSWB 1KPVB 1RUAL 5BRZE 2C1OA 1FORL 4QOKB 2O61B 1KB5B 1PAMA 4PRPA 2APWA 4KRNA 3UYPA 1MFAL 4JFDB 3ZE2F 5DURD 5KAQG 5EO9A 1N59A 4TULH 4M43H 3KYNA 5HYIA 1QA9A 3G6JE 3CDYA 5EUOA 2D0HA 5TH2B 3MLVH 4E42B 4PRPB 4NZRH 1A6WL 4FFWD 4WHTB 1S8DB 2ZCHH 4LEXL 5K93A 2CXKA 1V8HA 2F15A 4G43A 4PRNB 1HXMB 4EIGB 5LWYH 1JZ2A 2CPCA 1JI2A 5HHOA 5FAAA 3RNKB 4NRZA 4GMTH 1DVFB 2X4NA 4UNVA 3RWCB 5FA4B 5FUCE 3H9ZA 3SDCB 4Y5XC 3NCJH 2NCMA 5J12C 5IVXF 1ORSB 1KEMH 4OZHB 3PL6C 1I8MB 2A0LC 4JO2L 2YUVA 5IVZA 5JXEA 1IL1A 5KAQF 4N5ED 4OCLC 3GHBL 5B8CB 2VL4A 4OZFB 5IGXL 2V9QA 1YNLL 5IMOA 2QTEA 5IB4A 2NLJB 3TO4B 2L0DA 2UV3A 4X6DB 5A16B 4OIIL 1T20A 4HPYH 4PRDB 4FZ8H 2MCPL 2LTQB 1O7VA 3MYZA 1A3LL 3CLFL 2QADD 5JIHA 5GZNC 1TJHL 2QLVB 4U6VL 2UUDK 1D9KC 3RVUC 3VXRD 3VFWB 3WSQH 3BDXA 4XNYH 4O51B 3CFDA 3MFGB 4UT6L 1LILA 1G7IB 4ELME 1UVQA 2GK0A 1H5BC 1OAYH 3F58H 4CDGC 1JYWA 3SGJC 4PJEB 2AJVH 3KPLB 1T80A 2IAMD 4XBGA 5TDOB 5IB4B 4FFYH 3R06A 1SEBB 1NMCB 1H9VA 2NY2D 2E8YA 3OKOA 4QHLA 4J8RA 4HC1L 4OZFA 4JRXD 3OB0K 4ZQKA 1T1ZB 3MRPA 3QDJE 5CSZA 3UTQA 4QHKJ 3RWJA 1NGQH 1FFOB 2XI9A 4ETQA 3BZ4B 4HV8A 3TCLB 2DQCL 5MERB 2D03H 4TSBH 2OS7A 3KJ4B 2IAND 5TDNB 4M5ZL 5FA4A 3SDCA 3MRQA 1GOFA 3MLSL 3O8XA 3TEUA 2DI9A 5DHYB 5C0IB 1JNLH 3QG7L 2CMRL 3F6LA 4Y2OA 1D9KD 4E42A 4BSJA 1SY6A 2BSSB 4UQ3B 4RRPA 2WV3A 5JR1H 1DBML 12E8H 1CXHA 1WJ3A 4YFLF 1K4DB 1EEYA 2EYTA 1DN2A 4CUCA 5JDJA 2ZSWA 3C6LC 1DCLA 2FECI 4BSWA 4P48A 4ZFOL 4Y2DA 2NTFB 4D8PB 1NCTA 1NCCL 1Q0XH 1A7NH 4QRUA 4ELMA 4POUB 1JUFB 3GBNH 4O2EB 1T1YA 4GAYB 2X70A 2BSRB 1SM3H 1Y0LA 3MRMB 3RKDD 1QR4A 3W5MA 4R26L 1OGTA 5GGSB 2NY4B 4GMTL 3FOLA 4C56A 1YA5A 2BCKB 3ULSB 5B38B 5IIEA 4HD9A 1UWXH 2A9MH 4JFXA 1T1XA 5FXCH 2E7MA 1N5AB 2DDQL 1P4IL 2EIZA 3C5ZB 5KZCB 1TETH 3MC0A 3RHWK 4QRPE 4HZLB 1AXIB 2J6EA 4X7CC 1YNLH 2L7UA 3L3DA 3D25B 1JPGB 4O4YL 5SWQB 1MFNA 4BM7A 4UQ2A 2PW1B 2XFXB 1MHPL 1QFOA 1CK0H 1AXTL 3EDJA 1VFOA 1CLZL 1OSPL 2A6DA 4RIRB 3GI8H 3AREC 5MENA 4U6VH 3JTSB 1OAZH 3GJEB 3WJLC 1A3RH 1IAIM 2VOTA 4J3WA 3V7AG 3C6LB 4UNUA 2DKMA 1E4KA 2VLRD 4X7TA 5EPMA 3GSRB 1SMAA 3TV3L 3PWNB 3QBTB 4RMTA 4AEIH 5ELIA 5BZDB 1OAKL 3RVTC 4ELMB 4NZJA 4XHJD 1OY3B 4PGJA 3TT3L 3MBEB 2FLRT 4X7DC 4PRPE 2YPVH 1FO0A 1DJSA 2ZSWB 4XVUC 2UZYB 1JHKL 3MYJB 4PJXE 4LKCB 1HI6B 1VB9A 3KYOB 3T3MF 3C6LD 3B2VL 2BNQB 2HLFC 3KYKL 3P73B 1NBZB 3BXNA 1QUNA 3C8KB 1PEZA 2WM0A 4LEOA 4IRSB 3AY4C 1T04A 3WIFA 5ILTL 1QPXA 4TSBL 5DMKA 1DE4B 1MHEA 2BSED 3I3EA 3EO9H 3N1PC 2R0ZL 5J56B 3QISA 1JPFA 2CDFB 4BJLA 2GSIB 1YEDB 4FQHA 3ARGB 4Q97A 5E2WL 3WHXB 2Y36H 3PWUA 4R26H 2OQJA 4M1GH 5E6IB 1WK0A 4DVBB 3RBGA 4TUJB 5D6DC 1JP5A 2G60L 5IW1A 5KSAA 3D1MC 2OJEB 2EECA 1RFDH 1LP9A 1UJ3C 3MRRA 1FFOA 3RWJB 2W92A 1I1FB 4G80B 1T1ZA 4YBHA 4LBEA 3B43A 3W11C 2BOCB 4J8RB 4TVPL 4WUUE 3BWAA 5EULV 2X4RB 4NJAH 1A4JB 3DWTA 3CJJA 5FO8A 4OF7A 3MV9D 1ZLWH 1RHFA 1V3JA 1J8HA 4MNQE 3IDIA 5HYFA 3KG5A 2E9JA 3GHBH 5J11C 5I8EB 2UVEA 2IALB 4NUJA 2MCG1 5INDB 5HHNA 1EHLH 5ISZD 4WFFD 2JIXD 2VLJD 4RA3A 4DZ8A 4BKLB 1DQQA 2A77L 4K94L 3ARXA 4HUNB 4PJGF 3BEWB 3HAEB 2MTPA 4G6AC 2HT3C 2YXFA 3KPSA 1Q9KA 3HNTL 4OFKA 4CRPA 4C59B 5A16A 4PPTA 1LQSR 5ITFA 1FZJB 1XF5B 5D9SB 4ISVA 4KDWA 3K80A 3BP7A 4R0LC 1AXSB 2FGWL 3S34H 1A7PH 1HIMH 2M8XA 4F7EB 1QBML 4HDIA 3DXAA 5ISZB 1BBDH 1WWAX 2UWEB 3RY6C 4MZ2A 1F4XH 2VLRA 5F9AC 3HI5L 4LQ1A 1QSEE 2EDWA 4NQDA 5IJVB 1FN4B 4L3ED 4N68A 1GGYA 4FQXD 1I8MA 3FT2B 5MEND 2VIRA 4HC1A 3U7WH 5IEHA 2X9XA 3S35L 1RZ8B 5E24E 4P5MA 4H0GA 4ZXBD 4RQQA 1YJDL 1BLNA 4WO4D 4GFTB 3O45A 3QP3A 1RIUH 5DRWA 3G5VA 3MNWA 1JWMA 2VXQL 3L7FB 4Q9CA 2B2XH 3NCFB 1MWAA 3GI9L 4MXVF 3GSUB 3GHEH 2XTJE 4PBVC 3DV6B 1LE9B 3GRWA 4Y4FC 4TULL 4PY7A 5E7BA 4FFWC 1J11A 3QG6A 3L95B 4WFGD 3STZB 1UKTA 3GBML 5CWSB 2OTWA 1G9NL 5IM7A 4WO4B 2VABA 3L6FA 3K2MC 1JHKH 4PJFA 3ZLQC 4K3EL 1IM9A 1UACH 3U30C 4ZFFA 4M3KB 3PWLB 1J1XL 3BT2L 4OUUB 4QXTA 1PSKL 3LB6D 5DEGB 1ZSDA 4R2GB 1MFCH 1MRDH 4RBPK 2LAGB 2R23A 2DOCA 4UNTA 4JO2H 2F54A 2DM3A 5JXED 5F88B 2IADB 3J7HA 5SX5H 1U8IB 5BCAA 4WFGE 4UBDD 1U8QA 1NCUA 5E6ZA 4K94C 1NLBH 4HIJB 3HB3C 4OIIH 2NY7H 1I8IA 5CBEB 4ORGA 1D5BA 4PV8A 2O5YL 3MJGX 4Y1AB 5DZNA 1R3LB 3UTSA 1NFDF 1KC5L 5HJ3A 3FFDA 4YBQD 3CMGA 1GGCH 2HTKD 5D1XC 3WFCH 4P2RE 4Z95L 3P9LA 1BM3L 1CDIA 3WLWD 3P0YL 5DDHA 3H8NA 1WZ1H 3TIEA 4OLZH 4DGVH 5DWUH 2BC4A 1NAKH 2VZSA 4XRCB 3UTTA 3E6FA 4Y1AD 2IAMA 3FQWA 3O0RH 4NQTA 3KVQA 3AAZB 4MCYA 4OKVB 3TBVA 2DJ4A 3FONA 5C2BH 4D3CH 4JRXA 4DGIL 1F4WL 1DUYA 4OFPA 4YDLC 1NCAH 3TLRA 5D7SL 4WI5A 4YE4L 2CIIB 5T1KB 2P5WA 1WCBB 3MJ7A 5E8OB 2WLZA 2JCCF 3WFDL 3EFFB 3RY6A 1H3GA 4H26A 4ELMF 1ND0B 4P5TB 4HPOH 1QVOA 5DD1L 4LQFH 4MNGA 1MNUH 2H9GA 2X4OB 5FK9B 3BEVA 1ZE3C 3TO2A 3H42H 3IXAB 1TZHB 3HG1D 4TOYL 5EN2B 1S5HB 5EOQH 1TTFA 5D96C 1T5XB 4LSVL 3N0PB 4R3SB 4PJ5A 1IKFH 2FJFA 3DIFA 4X6CE 3NTCL 3FFDB 4K7PH 1KN4H 3SKNB 3UTSB 1RZ7L 5IFHL 1DQML 2VDPH 1NLBL 3G5YB 1V7ML 4HUUA 4ONFL 3QNYB 3EKCA 1L0YA 2DQUL 4YFLI 1EZVX 3V52L 4C58B 3MRJB 4JN2A 2GITA 3S88L 3MLTB 1U8QB 3HN3A 1H3XA 2HVKA 3OV6A 2OCFD 3ZYOA 2P4AB 1IBGL 1W8OA 2P8PB 4U3CA 2I9TB 5DHXB 2HRPL 1G7HA 3DVNB 5DEGA 4L4JA 4FXGA 3NGBC 3PUCA 4Z77A 2J8UB 3VGHA 4QGYA 1YDPA 3EYVA 1YEJH 1HHGB 5L2KB 1CE1H 2AXFA 4PJAE 3E2HB 3WD5L 2HFFB 4NKIH 3TNMA 2NYYD 4NN6C 4Z7NE 3U4EB 2LU4A 4IJ3B 3RUGB 2OTWB 2A74B 4NYLB 3ARDC 5EFIA 4D9QE 2GTZB 5DUBA 4YO0B 4V1DE 3WHE1 4WI4A 3JTTA 4CVUA 2C4FT 1OP5H 1H0DB 3WLWC 2E7LC 1TZHA 2MKLC 3MLYL 4Z7WA 1MAJA 2H9GB 3TO2B 2DD8H 1JGVH 2XZZA 4EVNA 3BRFA 1BZQK 2XRAH 4PUBH 4ZFOB 3MJ7B 4HPOL 3K1KC 4RQQB 3VG9C 1MCQA 5FDYA 3FB5A 3EGSB 3HZVA 2Y07H 1P7QD 3THML 2EE9A 4JR9H 5EU6A 4PJCF 3P9WB 4PGCB 1T6VN 1FE8L 2E9IA 5J12B 5DWUL 5L8KB 1F90L 4CVWA 2BY3A 4U3XA 3ZT7A 4DAGL 2G75B 4P3WA 3KPRA 2F53B 1FVEA 1YPZE 5IHZA 5ADPH 5D9SA 5A3IC 4X5WB 4LAQH 1F4WH 2V9RA 4MDJB 3MRKB 2BC4B 4DTGL 2P24B 4HX1B 4BZ2H 3BDBA 4YDIL 4GRWB 3S35H 5KTEL 4DQOH 5FYLH 4U1MB 1JF5A 3MJ6A 3HI1B 3QCVH 3T08A 4BKLA 5GS1B 1D9KB 1IGIL 1RUQL 4NSKB 2MKWA 3QDHA 5LWYL 1AGEB 3KLSA 3QUYA 4Z78B 1CZ8L 1J18A 3U0PA 2V17L 4LQFL 4N0UA 4QNPF 3LPGA 4XCYB 1ITBB 3GBMH 4K7FB 5SV3A 2I07B 3ZTNH 3O3AA 2ZNXA 5AD0A 1NAMB 4F9LA 3FCTA 2DQFA 1EAPB 4Y5VB 3VE0A 3LEVL 4QRRA 1UACL 1AGDA 3MRRB 2NY6D 3D2UB 1KCRL 4JZNB 3P11H 4NWTL 4RX4A 3VXTA 1JRHH 1G7MB 4I2XE 1KCKA 1AI1L 1L7IL 4X5XA 2XTJC 2XZCH 5E4EC 4WV1B 4PJXB 3CZJA 4LCYA 1M7DA 5B4MC 4LLYB 3DMMC 2HVJB 4ZFFB 1ZA3B 1LO2H 2BRRH 3SKJH 2O5ZL 4NPYA 4TRPL 3HAEH 4U4BA 5I19L 1UM6H 3D0LB 4Z0BH 3OR7A 4DCQB 1OCWL 1ED3A 3HI6H 2Y72A 4D9RE 1DBKH 2EDRA 1ONQB 1XEDA 2VLJA 3OJ2C 4JM4H 4X5LA 4Y4FA 5HDQH 3PP3H 3QHFH 4U05A 5EA0H 1IKNA 3HR6A 4F57L 1QFWL 3C5ZD 2IPKB 1MCFA 3RWIB 3I02B 2YKLH 3OAZH 3GSNB 5KS9B 3MXVH 1ODAA 1MWAB 1KC5H 4YHNB 4X99B 3ILQD 4IRJD 4NN5B 3LRHA 5CEZL 1G0YR 3O45B 2FR4A 1C5DB 2FL5A 3HC3L 1F11B 2WWMD 3OXRB 3AB0B 2YRPA 4P23A 4D0BA 1DL7L 1LDPH 4PJ9D 1F3DH 3Q5OA 3GM8A 3QI9A 3VXUE 1JNNL 4HWZB 1I7TA 3L5IA 3LHPL 3O0RL 3F5WA 3I9GH 1AD0B 3FN9A 4Z0XA 2VLRB 1YJDH 1OAQL 1UT9A 1TJGL 1FVCA 5TJWK 4JFEB 1IM9D 2B2XL 5DMGD 3V2AR 4RIRA 3QG7H 2XTJB 3KDMB 4QT5B 4PYHA 2ICES 4Q6IB 1CFTB 3DRTA 4ZAKB 5I1EL 3HTLX 1S5IL 1PW3A 1NH6A 3GKWH 4UQ2B 4PJ9B 1FNEA 2OL3L 5DS8A 3T0EC 5J7CC 3PGCA 4OZGE 4C57C 2JJVA 2AJSH 5C0RL 4QWWD 3QZWA 1G6RA 3QDGB 4GRWH 5HHNB 1JHTA 1F58H 3C5ZA 1MFEL 5D1QD 4IRSD 1HZHL 5DJZB 5F7LB 4KC3B 3UZEA 3LSOB 4MAUL 1EFXD 1J8HB 2QQNL 5F1NB 4G8FA 3GUTA 1WBYB 4LGSB 5JHDA 3QXDB 2PYFA 3CX5K 3M1BA 1VERA 3G04A 4MNGE 4DTGH 4NO0D 3OAZK 1A4JA 4PLOB 2Q76A 1IKFL 3MV7B 1LD9B 4QHUA 1NPUA 2Z8SA 1AY1H 1Q9WA 1KIUA 1WAAF 1DQLH 4U2YA 2B1AH 4XH2B 1L6ZA 1MQKH 1FRGL 4LGPB 1CFSB 1EMTH 3REWB 3CVIH 4LCCC 4HWBH 5I1IH 1LP9B 4L3EB 1BD2E 4XNZC 4JRYA 3FOMA 2MPAH 5JO5A 1RURL 1BVLB 3NFPB 4JQXC 4NQSB 5H94B 4DK6A 1ACZA 4Z7UE 1IGFH 3BE1L 4NUGL 3DSFL 2QSCH 1YEDA 5E95B 2DDQH 1QQDB 1A6TA 1NBVL 2EEDA 3ZL4H 3BJ91 3DURB 1HWHB 2A2QT 3HE6D 1MCKA 3TIDA 1PKOA 1MH5A 2NXZB 2R2HB 3P0GB 1FAIH 1MHPH 5AZEL 1E28A 4HIEA 1T5WA 2JCCE 3IFPB 5FB8A 1DVFC 3RKDC 3MRGB 2BP3A 1IAKA 2YA2A 1VFUA 3PHOB 2RR3A 5EU5A 3ARGC 2I9LB 5JNYA 4M8QB 4H1LA 5D2LF 3BKJL 3DX7A 2IFFH 1LNUB 4JAMA 1S5IH 3D39E 4JFEE 3RA7H 3D9AL 3FOMB 4JG1H 4KVNH 1QO3B 4LCUB 4LLWA 4HS8L 2A9NL 1CDJA 2KPNA 1KEGH 3RVXD 1WC7B 2YPVL 1EO5A 5D7IB 3AROA 5C0RH 3DTXB 2YK1L 4HJGA 1N3NB 4UUJA 4PYGA 3MV7A 5MENB 3L5HA 1RUMH 5DD6A 5ICXA 1CGSL 3V79C 3JWDH 2L7JA 2BNQE 3HC4H 3U4BL 2EZ0C 2YD5A 3QNZB 4FHBD 4ZNEA 4AT6B 5DHVH 4UTBL 2O93L 4QNPE 3QIBD 5HVHC 1BJMA 3ULVH 1JNNH 1F13A 3EDKA 3G5ZA 3I3DA 5EOCJ 4AMKL 2R0ZH 1DQLL 4HBCL 1OAQH 3Q5YA 4NQXB 5I9QB 3SE9H 1WZMA 2H45A 4DKEH 2JJSC 4KMQA 3WN5A 1Z9MA 5C0BA 2HKFL 4NHUA 4ZSOA 1BQLH 2FJGA 5IFHH 4KK6C 4WCYH 2IPUG 2GY5A 3TZVD 1W2KT 1IILE 1NFDB 4PLKD 4P9ML 5DMGC 4JFXB 3W2DL 2ITCA 2WWMC 4UDUB 2XG4A 1T3FB 3IS0X 4QT5A 2W38A 2NLJA 3TO4A 1XGTB 2COQA 3SDDA 3MNZB 2SEBB 1RFDL 3EZ8A 4P2CG 1S3KL 3LS5H 3QPXH 1M7IB 1LO4L 1AD0A 1JWUB 3O81A 3G08B 5E8PA 3OG4B 4OZ4B 2ZCLL 4WW1A 5FGCE 5ANMB 5FYJL 2W0FB 4NCC1 4EKXA 3CVHL 1Q0YL 3F12A 5EZJA 3T8XB 3NBNA 1KSRA 4MAYB 5E0QA 1MHCB 3ARYA 1DSFH 4ZNEE 3JUZA 1P4IH 2CR6A 5EU4B 4TSAL 3QIWA 3OGOE 4NKDA 3PDOA 1T22A 4HUMB 5ETUB 3BPOB 3P11L 3ZKND 5I0ZA 2WANA 5DK2B 3B9KC 3AUVA 3CFKB 3MUGA 4YDJB 3RX7A 1F4YH 1I3RB 4Y4FB 2WMPA 3CFKA 4CU7A 5I2IA 2RIKA 5K9OB 1H8NA 4LASL 4KDVA 1EERB 3OR7B 1MPAL 1FNAA 4JHBA 4AH2A 5IB5B 4JO3H 5DHVB 1S9VA 4M1DL 1U92B 3CZFB 3O8XB 3VXMB 4J3TA 3EYOA 1BBJB 3MRQB 4D9LH 4IOSD 1K85A 4ZMAT 2W9DL 2P8LB 4K8RC 4FABH 4MLSA 3BKYL 3BZ4A 4HV8B 1FAKT 1FNSH 4QRQB 3WKMH 1RK1A 2HLFD 3MRHA 1ZV5A 4JJ5B 4PJ7A 2ORBH 4JLRB 5FHBL 3FCTB 4J6RH 3VE0B 1M6OA 4EI5D 3HB3D 2SEBA 1LP9E 1U3ZA 4JGJA 5TE7H 3T0XA 4AQOA 3X12B 3HG1B 2XKNB 1NFDA 5ESAA 4JY6B 2A6KB 3LHPH 5I18H 1UVQB 2GK0B 3KS0J 4JB9H 1CD8A 4JANB 1NCWH 1DVFD 1S3KH 1BFOA 3QJHA 5FYJU 4NQCE 3S4SB 3QFJA 3RTQD 4JPIA 1YEEH 3VI3F 3QUXA 4YHLL 1OLLA 3T3PE 3OKMA 2LAAA 3NAAL 4G8GD 5E1HB 2BY1A 3AY4A 1U8JB 3BGMA 3MRBB 5HBBA 4HMEA 1E6JH 4FQIH 4X5WA 3V9FA 3X12A 3HE6C 2BDNL 3TH4T 5CZVL 4M6NL 1OHQA 1WGOA 3ZKXC 2QADB 5GZOC 4HJGB 1C7TA 3ZE2E 1T83C 1M6OB 5CEZD 2H6PA 1HZHH 1FFQA 4X6BA 3GFUA 1GGIH 3C08L 3S3SA 4HJ0C 3FB5B 2G2RB 2IJ0C 4DJMA 1SYSA 3VI4F 4ZXBC 1T83A 3CZFA 4OFYA 1T2QL 4NBYB 4K7PX 2J5LB 5MENE 3AREA 4M1DH 3O41B 3CMOL 3T2NL 3TPUA 1NMBH 5TH2A 1UH2A 4WTXA 1XIWB 3B9DA 3QH3A 3SDXB 5BQ7A 5DQDH 4D0CB 1T0MB 4LIQE 3RFZC 1HINL 4ZO7A 5ICZA 3L5WB 2WUBL 1NBVH 4J6RL 1T21A 2BZDA 3B9KD 4FMFA 4E41B 4Z5RB 2C1OB 4G42B 1F02I 4JREC 3BAEL 5C2BL 1N8ZB 1ZAGA 4XP4H 4KKLD 3EOAB 4OZFH 5C0ND 5HYJE 1YNTA 1L7TH 4LIQL 1JBJA 3FZUD 1JIBA 4HK3N 4WW1B 5DGQA 3HMWL 3DLQR 2GYSA 1NCWL 2YD9A 4LNRB 2BX5A 1AD9A 3GIVB 3VRJA 5C0AB 1N0XH 3B9AA 3P40A 5DYOB 4QY8B 3K4AA 5HHQB 4N8VB 1GOGA 2N1KA 4ZUUA 1J1PL 3ILPB 2IFFL 5DZOA 4AENA 5CIPB 3IAPA 1WV7T 3OJDB 2GQHA 2ITCB 1XF2A 1E6JL 4PRIA 3O9WB 1WVZA 3W9EB 4RDQG 1F8TL 1SY6H 1J88A 1JHTB 3FZUC 4KTDL 5I76A 2V2WB 4NT6B 4K3EH 3SO3B 3C09C 2LQRA 2HG5A 1MFEH 3VWKD 4S0SD 5DJ6B 5DS8B 3ARDB 2QQLL 4F7MB 2HWZL 5K9KA 4ONFH 3SHSA 2Y06H 4MNGB 2EO9A 5C0CA 4AT6A 4N0UE 4RAUB 4ZAKA 4Y19D 2V7HB 3TA3D 4YK4C 3D48R 1HE7A 4DZBB 1JZ6A 1KLUB 2QHRL 3GGWA 3BFOA 2ZUTA 5BJTB 3DTXA 1SJHA 3ULUE 1QSZA 4YZFE 1AGFB 4OGYL 2P5WB 2VLKA 4J3XA 4NQCD 5GSRA 3CCHA 3VXRE 4WCYL 3LS4L 2MQ3A 3TN0D 1U6AL 3D18B 5KZCD 1NGPL 1WWWX 5HGAA 1YY8A 4YHKL 2J3SA 5DD3L 5T3XD 4LLAA 5JXAL 5EU5B 1CGVA 2QSCL 1JN6B 3LS5L 2VNCA 1Q9LA 2ARWA 1T5WB 2RFXA 3LEXB 4QTHA 4JM2F 3GSNA 2VLRE 5DRNA 3ZYIA 2BHYA 1KTLA 1ZT4B 2IPKA 1IVLA 1LEKA 1OB1A 5D7JC 2YD8A 2J6EH 1MH5B 3QRGL 4M4RA 3NN8A 2APBA 1I8LA 4Q9RH 5EOTA 5KSUA 3WJJA 5FM4A 3STLB 4Q2ZA 5DO2C 1UGNA 1ZANL 4F7PB 5HI4C 1E27A 1IAIL 4ZD3H 4MD4A 1ZLUK 5F9JB 1RVFH 4KAQL 1SHMA 1O7SA 3RAJH 1M7DB 3T2NH 5JIPA 1NFKA 2YPLE 4JG0H 2J8HA 2CQVA 1EUUA 4V1DA 1G7MA 4Z8FH 4L3EA 1F90H 1EBPA 3BH9B 5F88A 3MA7A 5DMJB 2JTDA 2R1WA 2FSEA 1Y18B 2R23B 5DQJA 1FO0H 2ATPB 3OSKA 1U8PB 1QSEB 4APQD 3HC4L 2AEQH 5KSAD 3NPSC 5T5NG 4XCYA 1QLFB 3MRIA 1WBYA 3ZO0A 5JHDB 2Y06L 4N0UB 5ISZE 4LSVH 4M1CD 5CUSL 4GG6B 4JRWA 5F1NA 3BIBX 4MJ5B 5B3JE 3K46A 1I8KB 4U7MA 4XMPL 3SE4C 1CICC 2LE9A 2VABB 6FABL 3MV9E 3QQ4B 3D3VA 2EXYD 4JVPA 2HA1A 1XF4B 2AEPL 4GAGL 2ZUVA 4I13B 4PY8J 1JNHB 1RZ7H 4JFOA 2NMSA 1HH6B 4EI5C 3L95A 1BQLL 1FYTB 4U1MA 2DTMH 2OJZH 1UKSA 1G9MH 4NO0B 5FUZL 4TNVF 5LKNA 4BZ1L 5IHZB 4KTEL 1FVEB 1FNLA 5MEQA 1CFVH 2V6HA 3LKRA 1U3YA 1JV5B 3C5SB 4HKJA 1EH9A 4KK8D 2IG2L 2Z4QA 4Z0XB 2R8SL 1I7TB 4HWZA 2GJ6B 5IV2B 1YECH 1KTKE 3FT4A 3OL2A 4FQIL 4NQDB 1DN0B 1NBQA 1UWEH 2XA8H 4P23B 4D0BB 1G7QB 3PIQA 1G9MC 1R6VA 3CLEL 5EWIH 4HGWB 5MEQB 3K8LA 4M61A 3QIUB 5KW9L 3VI3E 3VFRB 1MCSA 4AQ1B 4UIKH 2XN9E 5HDQL 2NXZD 3FB8B 2D7MA 3QUZC 3Q1SH 1CICB 3DO7B 2JB6B 3WS3A 5AG8A 4BK4A 3MXVL 5EB9A 4NUJB 1ED3B 4WJ5A 3HC0A 4K55A 2M2DA 3V5HB 1NMBL 3F58L 4GG6A 3ULUH 1CXEA 1LDSA 3HC3H 5C0FA 3PXHA 1K9TA 4KVCL 4LCYB 4FXGB 2IH3B 5H2BB 2RBLA 5BZWA 3BWAB 4NM8L 3TT1H 1CN4A 1OTUD 3RKPA 5TF1H 2DN7A 2R1WB 3NCEB 5BMFL 1AGDB 4HC1H 4BA8A 5LCVL 4QRRB 4I0PB 3FO9A 5FYJE 1XGUA 1AR1D 4WW2B 1HYSC 2OJEA 4TN9A 3LDBC 2VR5A 2APTA 3U7YL 2WWKT 5IW1B 3UZVB 1W72L 4LLVA 4H0HB 3T2OA 3CH1A 1VENA 3JWOH 1J0IA 2OQJB 3U0PB 4ERSL 2ZZUT 3RVXC 5FUZH 1LHZA 3EO0B 1AE6H 4EN3B 3QUXD 4RCAA 3O3DB 4WWKD 3C60B 3GO1H 4C54A 3V8CA 5EOTB 3SOBL 1A1OA 1ZLSH 3TWCH 3KPOA 3PWPA 1S5HA 2CIKB 5GXBB 1JWSB 1NBZA 5DD0L 2P24A 5TQ0H 4YXHL 4Z7UB 3WFZA 1BGXH 2LVEA 1FV1A 1Q9LB 2DBLL 3O6LL 1VFMA 3ET9F 4YBQC 1XGYH 4U6XB 2F19L 3N06B 4L1DA 3B6SB 4JFYA 1B90A 1WF5A 2ILLA 1TENA 4OM0H 3UJJL 2XZCL 3P9MB 4ZTOL 32C2A 5F72S 4F7CA 5LJYH 3FQNB 3TYFB 3DECA 2VC2H 4S1RL 4UBDC 1RURH 4KKCD 4NNYB 1F4HA 2X7LA 4NKQB 5DLML 1A47A 1G9ML 3AS1A 3CGTA 4NUGH 1BF2A 1Y6KR 2R29L 3JV6A 3DARA 3L3GB 3DROB 3VFPB 3GBLA 1FQ9C 4X7SL 3NFNB 2QQQA 3E6FB 4PJAF 4K2UH 4ETYA 3TVMA 3BD5A 1LEGA 5EA0L 1YYMH 4F7MA 1HDMB 5DDHB 5FHAH 4AM0A 5FYKL 1GZPA 3B9KA 5JXAH 3MR9A 5HVHB 4R90H 1IAOB 1ZHLB 3FTGB 4MQTB 3TFKD 4MZ3A 2R1YA 4I48B 1QOKA 3C9NA 5GQBA 4EN3A 4W4NA 4AZ8A 1VKXB 3O9WA 4K3DH 4KXZI 4PRIB 4Z9KB 2AXFB 3RWEA 4HXBL 3EYVB 2J88H 4IRZH 3QEGL 4G7YL 4XNXL 4FZEL 4NZDA 3D9AH 4HIJA 2BVOB 2CKBA 3N9GH 4Y5VC 3BD4A 3I6LE 2I9TA 1N6UA 3ARQA 2C4XA 2BOBB 5DJCA 3KPRD 1U58B 2Q86A 4WU7B 4YDVA 3ECBB 2BSRA 5D93C 1P84K 2HVKB 1TPXB 4WVRA 2HRLA 1KPRA 2FGZA 4PRID 3MLTA 4KRPC 4EEEA 4L8DA 3EOAA 2DYPD 3TPKA 3FMGH 4I1NB 3VH8G 2YS4A 4UTBH 5EU7C 4Z5RA 4NHCH 1F8TH 1NFDE 4LHUG 3TA3A 4D0DB 5ACZB 3KPMA 3O6LH 5I75C 4QYOA 2EYTB 2F5BH 3IDYC 3L5WA 2A1WL 3SE9L 1X5AA 4FMKA 5ADOH 3EFDH 4OM0L 3U48A 2EH8L 3ELAT 2A73B 3NCYS 2IQ9H 4P9MH 4PJDF 3EO9L 5GRVK 2W0KA 1A7QH 3AREB 3MOBH 2E27H 3EO1A 2R29H 2B1AL 3CSYB 4P5TD 3MLWH 3MCLL 3G5VB 5I1HL 5E2WH 3WLBA 2OM5A 4KI5F 3BMWA 1WCBA 2MPAL 4N0RA 3BP4B 4HS3B 4NRXA 3CAFA 1U6AH 1IEHA 2OSLB 4M48H 4CADA 4PREA 3EJYD 4GT7A 1RUKH 2GI7A 1RPQA 3F65A 4JRXB 1CR9H 3SDAD 2FO1A 5IEKA 1CFVL 3DXAB 3LEYL 5ISZA 3RVUD 5JA9A 2WZPD 1E4KC 1P5VA 2IAMC 1OM3H 2FBJL 3DX9A 2DL9A 4FP8L 5KG9A 3A6CH 3FQWB 5C07D 4NM4L 3VGAB 2DWDA 3WXWH 1NFIA 3UTTB 1T03L 2NY6C 4MA8H 2BXZA 3JV4A 3T0EB 3MNVA 1NBYA 2X9WA 5FOBA 1IT9H 3DMMD 2R69H 4GW1B 2EE2A 1WZLA 1JNHA 5F7DB 2N7AA 4KK8C 5IFJB 3QJHB 1EHLL 1FLTX 1MPAH 5HGDA 5D1XD 5HJ3B 1XFPA 4G9FE 1XCTB 3RWGB 5I8KH 1E0OB 1HILA 4MJ5A 1DQJB 4MQXD 1FIGH 5FO7B 4P59H 5DVKA 3BZFA 4OI7A 3VRLF 1UB5B 2F53D 1QSFE 1BD2B 1S7WA 5IFAL 2FSEB 4G6KH 3BX7C 4TVPE 5A2LH 4X4ME 4M9OA 4HCRH 2YZ8A 1I1FA 2DQIL 5F6IB 1MJJB 2ZUSA 1SJXA 4W6WB 4A6YH 4F33A 4Z6AT 4XHJC 1IQDA 2GW5A 3SKOB 4Q0XL 5DUMH 1EJ6A 3FQTA 5FCUL 2IQ9L 5HVFB 2NZ9D 4DVBA 4JPKL 4PJ8C 1S9VB 3S8WA 4OUUA 4NNPL 5E99L 2E27L 4MXVE 1JPSH 1HXMA 3PWPD 1W72A 2CDFA 2BHZA 2V7NA 3MCLH 3MV11 4B50A 4BQ9A 1EVTC 1KUMA 4JDVA 4ODBD 2CLZB 2NY6B 2I5YH 5MHSE 1VGKB 2XTLA 5DFVC 1I1YA 3QXAA 3ARBA 4L8SA 3MJ9L 4HSQA 1ZT4A 1D7FA 1NLDL 5DK2A 3F7VA 3DV6A 2CK0L 3GB7B 1YMMA 4LU5L 3RWDB 3SO5A 1Z6JT 4M6NH 2RFXB 1K3ZA 4OBRA 1LO4H 1Q1JL 3O3EB 2JJTA 1YQ2A 4RMSA 5E03A 2BJMH 1ORQA 1TQBB 4NNXB 2KZWA 1GOHA 1QBBA 2P5WD 4NKOB 3MBEA 2WNGA 4AL8L 4PJBF 3PL6A 1RK0B 2QHLA 4M5YH 2KH2B 2C7UA 1JGLL 4PG9A 4P57B 1YC7A 4OD3H 2R1XB 1FN4A 5GSRB 4K07A 4XWGH 3MOBL 2E6PA 3MTRA 4AG4H 1CLOL 3NACH 3H9SE 4X9FA 2A6DB 2PYEA 2AXHA 3UJJH 3U2SB 1T3FA 3LN9A 4X6CB 5SX5K 1F3JA 4YPJA 4XT1C 1XF1A 3S96B 4IDLA 5K9KB 1HCFX 3FT3A 3KPSD 3HE7D 5E9DB 3KHQA 1C08A 5I9QC 1RY7B 5DJ8B 4GJTB 4NQXA 4JVUA 2DQHH 1NSNL 1ZHKA 4AIZA 1P7KA 4YFEA 3AGVA 2BXYA 1A7OH 4HFWB 2AJ3B 4A6YL 3P0YH 2AJUL 3U0WL 4ZAKD 1WBXA 1NAKL 1ZT1A 2BCKA 3ULSA 3OB8A <