1FH5L

Crystal structure of the fab fragment of the monoclonal antibody mak33
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
213
structure length
213
Chain Sequence
DIVLTQSPATLSVTPGESVSLSCRASQSISNNLHWYQQKSHESPRLLIKYASQSISGIPSRFSGSGSGTDFTLSINSVETEDFGMYYCQQSNSWPLTFGAGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of the fab fragment of the monoclonal antibody MAK33. Implications for folding and interaction with the chaperone bip.
pubmed doi rcsb
molecule tags Immune system
molecule keywords MONOCLONAL ANTIBODY MAK33
total genus 45
structure length 213
sequence length 213
ec nomenclature
pdb deposition date 2000-07-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1fh5L02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1fh5L01
1XGYH 1IKFL 4NO3A 2MOVA 2YOCA 3OGOE 4X5XB 3T09A 3WIHH 4JO3L 4NOBA 3QJFA 3FQWB 3KXFE 1KBGH 4JGJA 4JZNA 2ICEA 1HXMB 2VLRB 5GJTL 1J0IA 3LCYA 4PJ9D 4B7LA 5C8JA 4JRXE 3HE7D 3QQ3B 2GJ6D 4UTBL 1D6VH 3QYCA 1HHGA 2AABH 4Q7DA 2YPLD 4EI5B 5FYLD 1HHHB 1LK3L 1F00I 1MUJA 4HT1H 4L4VA 5F96H 1K4CA 4WU5A 4X9IA 3IDGB 3SJVE 2KH2B 4Q0XH 5F7YC 3ESUF 4HV8B 4LVNC 4KRNA 4I5BA 4KKBC 5FM5O 1BEYH 3DURA 1AR2A 3JWNC 1X5KA 4UI2A 1T3FB 1YMHA 4PJHF 3M17B 2J8UF 4Q9RL 2A6IA 5IJVA 4KUCD 3P3YA 7FABL 4F7EB 3QQ9C 1DVFA 5C0CD 1RIVL 3ARXA 1CDJA 3GSWA 5L6YH 3G04A 5D7LE 4WCYH 4MJIE 4YBLB 3WFEL 1YNLL 3CC5B 3VXNB 3IXAA 1KN4H 2ADGA 4FA8A 1NL0L 1CFVH 3BRGC 5F7UA 3UJTL 3I3BA 3PP4H 1F6FB 2VXUL 4HUVB 3BHBA 1G9MC 4XPGL 5D7IA 3ESVF 3HC0A 1CLCA 4X6FA 1WC7B 4NKMA 4OQ1A 3OHXB 3VFWA 1GOGA 4M7JH 2PETA 1CF8H 3QA3A 1N0LA 1D5ZA 3QJHB 1BQLH 4JANB 1EGJA 2IBBA 3S37X 5ID1A 3U7WH 4B50A 4Y4FA 4AG4H 5E2TH 4IMKC 3U7WL 1WCBA 4WI7A 5DHVA 4PY8J 1IKNA 1PQZA 1PSKL 3QCVH 3HNVL 3O11A 1QRKA 1LO3H 3IAPA 4NZUL 5HDOA 1KJ2L 1YMMD 3GSWB 3D9AH 3IAQA 1B2WL 3NABH 4S1DC 5IVXF 2D2OA 3ZTJG 2OR7A 3ULUH 1UYWL 5I1EL 5EU6D 4ZAKA 1CDGA 4XGZB 3NCYP 1OAXH 2IQ9H 4QYOB 2MJWA 1CK0H 4Z7NE 4WTZA 4JRYE 5D7IE 3KPNA 1RZJC 5IIEA 3IDMB 3L6FB 2IMMA 3OJDA 2FGZA 1OTSC 5ITFA 4P5TC 5T3ZH 2DRUA 1CIUA 1LE9A 2V2TA 2JIXB 5JDSA 4K7FA 2JELL 4RAUA 4YZFF 3RU8H 3UTOA 1O7VA 3EBAA 4APQD 4M1DL 5D1QA 4YK4C 4Y1AD 1A9EA 1X9QA 3MRLB 3ZKXB 1HXYB 5SWQA 1P6FA 3LEVH 1ND0A 2ZOLA 4IRSD 2FL5A 5HTSA 4J1UA 3TBTB 4F37F 2R0WL 2X42A 4P3DB 4Y4KA 2OL3L 5MHSD 4JZNB 2D7PA 3NH7H 1N7MH 4DK6A 1B6UA 2GI7A 4Z77B 1EMTL 3UTQA 1J5OL 5EOTA 3AMKA 2BCKA 4K8RL 2AXFB 5B8CC 1JZ8A 3ARUA 5B38A 3AROA 1CGUA 2LFGA 1TCRB 1HHJA 3LRSB 2ZKHL 4QLRA 3U4EB 1HQ4B 3LH2L 1NCDL 1DBML 3BMVA 3DXAE 1FGNL 1X6LA 5E94A 4ETYA 1H3UA 3FB6A 3R1GH 1U3JA 1S7VB 5DJYB 3FFDA 3BGFB 3SE8L 2CK2A 5C0RH 4ZUUB 4PJXB 2EXYD 4LFHD 3SE8H 3P4NB 2IEPA 1MCFA 3FT3A 5DQ9B 1L0QA 2XRAH 3D2UB 2YMXL 3VRIA 1L6XA 2C3HA 2HKHL 4ZTOL 4QTIH 3F7QA 4HUUB 4HKBA 3QO1B 1T1XA 1A6AA 4KRPC 4PJAF 4YXHL 1TITA 4KK6D 3FO1A 4M7ZC 1ACZA 4OLVH 5E8PA 5EZOH 1BD2B 4M4RA 3VE0A 4JRXD 1J7VR 1H5BC 3RVTC 4XBGB 2GJZB 2HFTA 4OZIE 1J11A 4QCIA 1JGDA 1S7WA 2HAZA 3QUXA 1J1OL 1KJMB 4TYUA 1YMMB 2R39A 4WFEE 3ZT6A 4KMLB 2AJVL 2VL5A 3U9UA 1DANU 1UGNA 5EH1A 3MUHL 4QRPB 2ITDA 2X6MA 5JNYB 5GGRA 2D7QA 1B2WH 1B6DA 4KDTA 2CIIA 1W0VB 5HGHA 5I75B 3O4LE 5FK9A 5I1HL 5F1SA 4XC3H 4N5ED 3TO2B 1GAFH 5SWZA 4I2XB 1G7HA 3BKJH 4R96B 2DLTA 5DS8B 4TOYH 4F58L 5FM4A 3ZKND 3BP7B 4P4KA 1ZLUH 1OF2B 5EWIL 5ITBH 1X5ZA 1X5HA 2NY0D 3MBED 3SQOL 3A6BH 1CF8L 3FT3B 3MRBB 4Z5RA 3U30C 3S8WA 3TJEH 3GM0A 1OWWA 1T66D 4GUPB 2E8ZA 1UJ3C 2Y5TB 1CFNA 1IC7L 3NCMA 4ZD3L 4C83A 2BERA 3EYVB 5A2JH 1YEEH 3O45A 4XPTH 1W0YT 1CDIA 1NGQL 3S5LG 1T04B 1TQCC 1Y18A 5ALCL 1EIBA 2APBA 4JGUA 5ICZB 1CWVA 1JYVA 4Z7VE 3OX8A 1MCWM 2OTPA 2NXZC 4FQLL 3UYRL 1YNKH 2FO1A 3OXSA 2NY2D 3R8QA 5D7LA 2J3SA 1BIHA 3K8MA 4KQ3L 2NY1D 5JIHA 4P5KA 4PJ8D 1IJ9A 2VDNH 4MA3B 2P5EB 3FMGH 1Q1JL 1S9VA 2F5AH 3MJ7A 1OT1A 2XRAL 4TULH 3UEZA 2IG2L 2HMID 2EXWC 4R4ND 3P9LA 5C86A 4RFOH 2XTJC 3I6GA 4NRZB 4WW2A 4Z9KB 5IWLA 3DYPA 5CBAB 1KACB 5D8JL 1BVKB 5FA4A 1OTUD 2EIZB 4I13B 2WUCL 1E4KC 2X89A 2IAMD 1R3JB 2OSLB 4OCMC 4OT1L 2VLJE 2AABL 5J1SC 2B39A 5AZEH 3QFDB 3U4BH 4OZ4A 5CP7A 3MLTB 1WZLA 3QHZH 5B3JE 4JCMA 1CXKA 1A4KB 1J05A 1JGVH 2J4WL 4WY7H 2FZ3B 5IQ9B 4WI5A 3CVHA 4OQTL 1GGCH 5D71H 3AREC 3C09C 1FGNH 5J9PB 1SBBA 1JHLH 1TVBA 1ZLVK 4XNMA 1N7ML 4H1LA 1NC4D 5HGAA 4NN5C 4PJ7F 4BZ2L 3CDGA 3IU4H 4AL8L 4R4BB 4Q9QH 2ORBH 2NQCA 3MLZH 4K8RH 2A9MH 3IJYA 1NUNB 4YHLH 5JTWA 1NSNH 3LN5A 2EDLA 2NX5E 4WUUE 5DJXB 4P3CL 4OLYH 4YXLH 3RGVC 5HVWA 4JZJC 4NKDB 1NGYA 3PE9A 4WTXA 2R0ZL 2MQ0A 3K7UA 1IKNC 4UV7H 3P9MB 2X4TA 3RIAF 4FXKA 4UQ2A 1A7OL 4V1DB 1U91B 4U05A 4FABL 1GH7A 3OPZL 3Q5YA 4C56B 1QNZL 3TBVB 3BW9B 3QIWC 5FYJD 2QQLL 4GRLC 1IAII 4NZUH 4PYGA 3MLRL 3EJJX 2X2YA 5D93C 3HC3H 4Y4KD 4U0RB 5GIRB 1MVUA 4KJYB 4L3EA 4Z6AT 4XPTL 4RAUB 1OAXL 4JRYB 3PABA 3GB7B 4M48H 3ORJA 4MB5A 4U6HB 4S2SA 1EAJA 4O58H 1QLEL 2FLRT 4G6MH 3WFZA 1G7QB 3W0WE 5F72S 3GI9L 1RFDL 3SGKA 3SDAB 4DCQB 4NO0B 3OWEA 3JWDL 3OGCB 3Q3GB 1OAQH 4XT1C 4PJ5B 4ZFZA 3E6HA 3U79A 4Z7QE 1BM3L 2CRMA 3C5ZB 2HA1A 4K7PL 2Q87A 2ADJB 1XR8A 1KTDB 2XA8L 3FOLA 2VXUH 1KIPA 3O3UN 5DO2C 5DDHB 4KRMB 1BF2A 2PYFA 4TVPL 2QR0B 5TGBA 1AKJD 1BWWA 3QG7H 4ODSL 2JB6A 1BZ9A 3LN9A 4BFGA 1HKLL 3AB0B 4L8BA 1VACB 5CINL 5L2JB 1ZVSA 4BUGA 3L3HB 2E7LA 4GG8B 2DQEH 4NC0B 5HPOA 1SBSH 5F21B 5IW3A 3UZQA 3QSKB 4N9GB 4BQ6A 4OD3H 2D31A 5KSAD 2H26B 2HYMA 1WVZA 5DHXB 3KXFB 1AFVH 3I6LE 3TA3B 1OHQA 4D9LL 4M5ZL 4M62L 3BSZL 5SWSB 1P7HL 1KCVL 5EBMA 5E8EA 3QDJA 1KTDA 4XXDA 3BZEA 3MLWL 2OTUB 4GRMB 3JV4A 4HSQA 2EYRA 4ZOEA 5D4QA 5DTFB 5I19H 2VDQL 2C3WA 5I19L 4FFZL 4PREB 1XR8B 1OL0A 3ARDC 4KJWC 1Q9OA 3G6AB 5KVGL 1A6PA 1Z6JT 4KTDH 1EFXD 4JFHD 5DJZA 5T33H 7CGTA 3JV6B 5ADPL 4NNPH 4P2RB 2C4FT 4MDIB 5GJTH 1VDGA 2A0LD 2DJ4A 3BXNA 3BN3B 2B2XL 4I77H 1CVRA 1QEWB 5TE4L 5I6XB 2DN7A 3CZFB 1IT9L 2VXQH 2FATL 4GRWH 3HR6A 1BAFH 2O5YL 4RISL 5TE7L 3L3OA 4NQCB 3QWQB 1YECH 5F9OH 4PS4H 4XP5L 3N1FC 5I2IA 3UO1L 1WWCA 4K94H 3ZE2E 2WBJA 5BV7L 4NBXB 5F7DB 4U6YA 1JK8B 1JNJA 1NCBH 1AGFA 1RV6X 4FQCL 4N0CC 43C9B 4PJCF 3VGAB 3F62A 3INUH 5HYEA 1BIIA 5GGTA 5M94B 1GGTA 4JG1L 1MJJB 1XGPB 2JJTC 1OSZB 5MEQB 3ARBC 3QB7C 4PRPB 4AIZB 4OZFG 3EZ8A 5EO1A 3SCMD 2VZVA 5TF1L 2ERJC 4GG6A 1IFHL 4OM0H 4QXWA 5D2NE 3M45A 1FIGH 2P5EA 4KDVA 1T0PB 5BVJB 5F7KC 2YS4A 4LLVB 3BP6A 1IC7H 1ZANL 5IB3A 2MFNA 5C1MB 2AQ1A 3PQYD 4QRQB 3VXMD 4JFDD 3A6BL 3ROLA 4EOWH 2P49B 4HQQH 5F7NC 3R0NA 4OZFA 4EDXA 3HI1A 3MLXH 3QPQC 2VABA 4WWKB 3BO8A 2EIEA 1H3XA 1ZV5A 3HI5H 3KLHD 1OTSD 1X5IA 3GHEH 3MLTA 5M7QA 1CD0A 4G3YH 4MAUH 3G5XA 4OLWH 3FQNB 1IAOA 1MJ8H 3CXDH 4LGSB 1U8NA 2XZQH 3U48A 3F58L 2APVA 5E6ID 2IADA 2FIKB 5F9AC 3W0WD 3BUYA 3ZMRA 4U33A 1PYWB 4P4KB 1E4WH 1J0YA 4Z7NF 3O3EB 4HXAH 1CICD 4Y16D 4Z5RB 1ZGLA 4Y0GA 3QFJA 4JFFD 4Z7VB 4YUEH 3VWKD 3H42L 5D2NB 4DN4H 3TT1H 2L7UA 1WV7T 2ARJQ 1QLRA 1MWAH 5F88B 1P4LB 3BD5A 3S6CA 4FXKB 3GJFB 4WDIA 2B5IC 3CSGA 2V5SA 3X3GH 1ZHLA 5HI3C 4P4KC 5C08D 1NGYB 5DD0L 3KDMB 1B0GA 4LK4A 2PR4L 4HLZG 4Y89A 4P23A 1I1FA 3FL7A 3WHXA 3UZVB 5DZLA 1WWAX 2GUOB 3KJ6L 4JFEA 1FNGB 1QSEA 3R1GL 3ZKMD 2VABB 3QEQD 1D9KC 2J1KA 4DWHA 1AXTL 1EHLH 3BZFA 4NQDA 2JKXA 5ILTL 2K3TA 5ACZA 1D5IH 2DQDH 1FQ9C 3GMRA 3QQNA 1KEMH 5E8PB 1VFBA 4WU7B 4MQXC 4XB7A 2Z35A 4I3RL 4L8CA 1XF3A 4L9LA 1T1ZB 2QHRL 5E2VL 5DVMA 3MRKB 5ADOL 4OZ4B 5CP7B 2X10A 3MRJB 4KVNH 2AV1B 1FH5H 4JE4B 4V2BA 1L7IH 1HH6A 1V5JA 4QTHB 4A2MA 2FHCA 4ALAH 2C7UB 4LMQI 1QACA 4FQLH 4OUOA 4JN1L 1MRDH 1OM3H 4U3XA 5E8NB 4U2ZA 2AJXH 5CHNA 5C2BH 2VDOL 4Y2DD 4YDKL 5F9WC 1ITBB 3C6SA 4GS7B 1CL7L 5FHAH 4MMXC 5IVZA 3CSPA 3GGWB 4UU9A 2C1PA 2QADB 1JRHH 1H3TA 2P43B 3KDMA 1LNUB 4EZMA 2XKSA 2AS5M 1SM3L 1CLYH 2MTPA 1S3KH 1MCCA 3ULUL 3M8OH 4HBCL 3HTLX 1VB9A 4LHQB 5CIPA 5JHDA 3QDGD 4ESKA 3TO4B 3BIKA 1UWEH 3OR6B 5B38G 4OF8A 4U1KA 3VDBA 4PRIE 2Y07H 4LHJB 4U1GC 1V8HA 1NCWL 3SQOH 5DMIL 1SEBA 2NXYD 2J8UB 4J8RB 2YKLL 3EYQD 4RQQA 4FN0A 3V52L 4AT6B 3OF6A 1BJ8A 1N64L 4CRPA 2H1PH 4ZG1A 5JPNA 4M8QB 4NKMB 1AC0A 4GAGH 1MCIA 5HHVH 5HHME 1U8QA 3BHBB 1F4XL 3NFPB 3T77A 5L2KB 5ICXB 1QNZH 4D3CL 4PRIB 4H5SA 2GQHA 1OD7A 3KPMB 4GMTH 4PLJC 3QEHB 1UVQB 3LEXB 1R3HA 2XFXA 1OWRM 3MRFB 3DMMD 1BP3B 3FMGL 4MA7H 4GBXB 1ITCA 1D7FA 1W72L 1P4BL 1EK3A 3CZFA 4PJEF 3ES6A 4X83A 1DQJA 4JGMA 4OLYL 3TYFA 4YXLL 4ELMB 1KCRH 1OB1B 1T20A 4BH7B 4BJLA 1E4KA 2BY0A 2G2RB 3QDGE 4LLVA 4ZXBD 3LPWA 5GRJH 5IIEB 1PFCA 4LSVL 1JWUB 4KKAC 2OJZL 3SKJH 3WKML 4NC1C 4HUWA 2ZCKH 3VCLA 4CGTA 1VFAB 1PBYA 2FIKA 1JP5A 5BO1H 1RPQA 1RIUL 4LSPL 5E2UH 1HIMH 3CVHH 1OSPL 1OSZA 4CBPA 4M5YL 5F7DA 3FOMB 3UTZB 5K9KA 1EUTA 2P7TA 5DMIH 5F8QC 2ZUTA 4NCC1 4YHNA 3ARBA 1INDH 1FYTE 2BNUA 3V6OA 1KIRB 4I9WE 3NZ8B 5KSUB 1CLZL 1TPXC 3EO1A 1K3IA 1LO0H 5CD3A 3EO0B 4R97C 4IRJC 4OGXH 1FL6A 1CT8A 2NLJB 3PG2A 4GKZB 3MV8E 3BH8B 3RVWC 4MS8D 2DQFB 3VI3F 4YQXH 3R8BB 5I74B 4LCWA 4QOKD 5J6GA 4P2QB 3TN0D 5DD1L 4HLJA 3P4MA 5IV2A 1EMTH 2BC4B 4Y4HA 4BYHA 3ARYA 2IF7A 3F6LA 3PABB 5BJTB 4JPIB 1EV2E 5ICYB 3Q1SH 4I0PA 4EJ1C 1MAKA 3FONA 1C08B 3W11C 3PWUA 1SJXA 3PL6A 1WC7A 3IRPX 3MRNA 4YDLC 1MCJA 4AEFA 1AI1L 2B1AL 4RMWA 4DKEH 2AXGA 3KVQA 4PGCB 3NMEA 2W0LA 4NQEE 2DL2A 2ADJA 2CLZB 2VKXA 3P4OA 4P5MA 3CU7A 3ARGD 2DYPD 3B43A 3RDTA 3TLRA 3UAJD 3JV5A 1ZKAA 5E4IA 3CSYA 2EEBA 1DN0A 3K4ZA 1MFDL 4GKNB 2EDWA 1EPFA 3D9AL 2ATPA 3I3EA 1E6JH 4KJQD 5KBNC 3BVNA 4GRWF 1XF2A 4PRHD 5C07D 1OPGH 3QCVL 4BZ1L 1AGCA 2NXZD 5DGRA 2YHGA 2I9LB 1I8KA 1RQ5A 5CP3H 3TPUA 3QZWB 3FRUB 3S35H 3QXDB 5DEFB 1U8PA 5H35B 4YEFA 3JTSA 5D70L 2IPKB 3C8KB 1D6EA 1M7IB 2DLFH 2Q8BL 4M9PA 1T6VN 4X7SL 3D18A 1KENH 3T2NH 2GKIA 4L8SA 1HYRC 2DM2A 2ESVA 5IBUB 1ZT1B 1F8TL 3MRNB 4UT6H 4GRMA 2W1NA 1JHTB 1L4IA 2FH8A 2OL3H 2Y6SC 4PJHE 5HHPB 4PTUB 2Z9TA 1MFAH 5LBSL 5T1DH 1A7QL 4H0HB 2Y4SA 3FT4A 1P7QA 1FRGH 3ULVD 3RU8L 5LCVL 3G6JF 4MA3A 4J4PA 1EEZB 4YHPB 2ZCLH 1FRGL 5ALBH 2CH8A 5GGVH 1PVHA 4HUXA 4F8QA 5ID0B 4YDVB 4JFFA 5E7FA 1GGUA 2NY4D 4OV5B 2IC2A 4JO2L 1G6RA 2EYSB 2YWZA 1HH9B 4Y8DC 2A6KA 4QRPE 3MRFA 3VFOA 3VWJA 1OQOA 3MOQA 2XQYK 3QIUB 3MRGB 5F89A 1MCBA 3TYGH 4MDJB 3W0WA 4L3CB 1CFSA 5C0IA 3KJ4C 4WIQA 3C87A 4FFYH 1CT8B 2NLJA 5DRXB 4X6EB 2NR6C 1QSFD 4KHXL 3KWWB 5D7SL 3MRIA 3VH8A 3ARPA 2OJEA 3MFFB 1B88A 1I9JL 3HUJE 3NA4A 5FKAA 2EO1A 4PR5A 2F53B 4XHJD 4XNQA 2OL3B 5DRZA 2EIZA 4NN6C 2H2PD 3SDYH 5GGQH 1QFUH 3VCLB 4YDIL 3PGFH 1M6OA 3SJVD 3U0PB 3NGBB 2IH3A 2E9WA 1AQKH 1NCCL 1RUMH 1MHCB 5HYSB 3UTPE 2H9GA 3VXRA 4G80B 3HAEA 4MD4B 3P2TA 5D6CB 1BX2A 3V0WL 3HMXL 1IRAY 1NMBH 3MCKB 5IW1B 3UJTH 1CDUA 3EO1B 2R2HA 3DUUB 3V7AG 3RKPA 1IBGH 3KPMA 1FCCA 1P84K 4ZUTA 2J88H 4WFGE 2VLKE 2F54B 4UOJA 5GRZA 5HHOE 5IB5B 3MYJA 4R3SA 2EE2A 3ECBB 3LRHA 3MV7D 4Y5VB 5A2KH 4QOKE 1QSFE 1T03L 5F6IB 5ABDE 5IMMB 3JWOC 5IB2A 3EYFA 1U3HC 3GRWA 5T5FH 2AEIT 4JLRB 5KVEH 4XRCA 3LS4H 4R4BA 2Y5TA 5EOQH 3WO4B 3PIQB 4HUUA 1OB1A 5CIPH 32C2B 4MJIB 2R8SL 4XAWL 1WIUA 1X5GA 3K1KC 5E2TL 3W11D 1OW0C 4MGXA 3C5SB 5JIIA 3D39B 2G5RA 2CRYA 1FNEA 3JXAA 3D3VB 4Z95H 2ITDB 2GFBB 5ENWB 1JPGA 1I8MB 5KSBB 1FZKA 4PJGA 4MJ2A 4QRSB 2CIKA 3SKMA 3JTTB 1EAPB 5ALBL 2W65B 3RUGE 1HHIB 4MJ5A 2IADB 4OD3L 4YEEA 1FZOA 1MCWW 4XVUD 3VDCA 1I3VA 4WW2F 3ZTNH 3B6SA 2ILLA 4HF5H 2P45B 1S5HB 4CU7A 3QFJE 5DRNA 3TBSB 2NYYC 3BDYL 2VLJD 5FDWA 1QRND 1F3DJ 4ZUWA 3T2PA 3WN5A 1C8PA 1CGVA 5DMGC 1MCRA 3MGOB 3ZKSD 3DGCR 4KJPC 4PJ9C 4PJ7B 1KNOB 3MNZB 1A0QH 4WTWA 5K9JL 1MAMH 1YEDA 1KJ3H 4IS6B 3MNWA 3UTTA 5JDJA 5B8CA 3O6KH 2CXKA 3WFCL 5GGRB 2VLJB 1Z9LA 1DP0A 1DQML 4HC1H 3W9EB 32C2A 5TF0A 4D3CH 2GSIA 3MODL 3MC0A 4HLZH 3D0VB 3BFOA 3NFNB 1G7PB 3RWFA 3KNBA 1P7QB 5TQ2H 1YEIL 2E9BA 2BDNL 5A2IH 3PP3H 4L4VD 2R0LH 5EU6E 1AE6H 3CX5J 5DFVD 2CJUL 3HI1B 3IXAB 3L5HA 1FIGL 1MIEL 5JMOC 3BKCL 1R5VB 4NM4H 4ORZC 3GMNB 1DN2A 2VITA 4UIKL 1G7JA 3OQ3B 1IEBB 5DUPH 1BQHG 1Y0LA 1FCGA 1JNLL 3VRIB 1W0WB 4NFCA 3C60B 5DMGD 5CSZB 4QRRA 3T0VA 1S7SA 4GS7C 3DUUA 5FGRA 3TH4T 1A6AB 3WFHB 4OF7A 3QZWA 4LARH 2VYRE 4HJ0D 3ARTA 3HI6L 4YFLI 1SYSB 3O6FD 4X9FA 5FUOL 4HX1B 5KW9H 3GMMA 2VOTA 3ARFA 5ID0A 5LXGH 2AAVA 1B0WA 4OLUH 2FO4A 4L3ED 3QP3A 4TUOB 3C2AL 5F9DC 3RWHB 4P2RA 1KJMA 1OM3L 5T3ZE 4C56E 5JXEA 4HAFA 2YPLE 2R56L 5H94B 1VGKA 4N90E 3RRQA 2HFGH 4UB0H 4WVRA 3QUYC 4MX7A 3EJYD 3VWJC 5ADOH 1QHOA 1RUML 2VDKH 4X6DB 5H2BA 5TE7H 1KPVB 2BHUA 1FNFA 2ENYA 4LSTH 3M17A 1ZA3B 3FQUB 3T0AA 2VQ1B 4PB0H 4L8DA 4JVPA 2GFBA 5ENWA 5I1IL 1DEEA 1NDGB 5F7EH 4WI9A 1AE6L 5JW4R 4YHIA 2WIIB 4JFEE 1KEGH 2UZIL 3BDXA 3QEUA 4K2UL 4G8IB 3D69B 2O5XH 2G2RA 3CUPA 1JTOA 1I9IH 3ME0A 2F5BH 3OAYK 1INDL 3CFEA 3MROA 2AJYH 3GMRB 5JDSB 2FYYB 1U8OB 4KVCH 4KWUA 4PJXA 4QRUA 5FYJH 4NZDA 4EI5C 4U31A 4CMHC 5BW7A 3IU3B 4PGDB 3VFMB 3ULUF 2Z93B 5IBTH 3RY4A 3CSYB 3Q6FB 5DWUH 1A7BA 3GI8H 1RZFL 1EGJL 4J3XA 4F15C 4NO3B 4QNPF 1DSFH 3QWRD 3I50H 2F9BT 3SDCC 2D7OA 2VLME 5FCUH 1ZS8A 2XN9B 5I17A 5EOCH 3BI9X 5C09D 3MV9B 5GS1A 4LF3B 5AG9A 1J8HE 1HILB 3O4LD 1SBSL 2B4CL 1EGJH 3CLEH 1Q72H 3HI5L 2XQYG 5ALCH 3WKNA 1E4WL 3PIQA 2YD5A 3VD9A 2CR6A 4Z78B 3RPIA 2ED7A 3K4AA 1EJ6A 5IFJB 1H5BB 4RCAA 1LO4L 3UYPA 5E00B 4XP6L 1X5FA 4ZPTA 1KENL 3T2NL 4DAGH 4G3YL 4WO4C 5J12C 2GJJA 4ZSOA 5IBUG 2MKWA 2FJHB 2Y07L 5SX4H 5CD3B 2DIAA 5DDHA 4UQ3A 25C8L 5JW3L 3DIFA 1MFDH 1MIMH 4X6DF 4R0LC 1OAKL 4KUZL 35C8H 3W39A 3PJSB 4QRTA 1C16A 3U0TB 2ICEB 4PV8B 3FTGA 3RY6A 4LSSL 2DM4A 4MD0A 5GJSH 1J88A 4IRZH 3UXFA 2YBRA 3WD5H 4XP1H 1A6UL 5FECA 5C2BL 1UCBL 1MRCL 4I4WA 4MQ7B 1QSVA 4QWWD 2BSTA 1NBYB 1SM3H 4PRHB 4XMPL 2R69H 4G6FB 1K4CB 3HC0B 4J6RH 3ZT7A 1GRWA 3HC3L 3QQ4B 1T22B 2FR4A 1UXWB 3HB3D 2V7NA 2BJML 1GPOH 3GIVA 1YUHA 4OFKA 1I7TA 4G6AD 2M8XA 4GRLB 4NBYB 3WNNA 5BVJA 3B83A 5LXGL 1R5VA 4LQ1A 5EULV 3LQAC 3V4UH 1KPVA 1YJDC 4G6KL 5CZXC 3WHE1 1FSKC 3V4PL 4E42A 2DQUH 1C5DA 1J18A 2FBJH 3CD4A 1G0YR 4R26L 4OCSL 1EJOH 2X4OB 3BH9B 1TZHA 2FJFB 1NCAL 5IOPA 2EH8L 4M7LT 3PXHA 1INQB 1OGAE 5AG8A 3QRGL 3AS1A 1FO0B 2I5YH 2MNUA 3MBXL 3V5DB 1ZLWH 2B5IB 3REVA 4S2SB 1ZHKB 1YY9C 3FN9A 5ETUB 5EZIL 3L3DB 1K6QH 3HNTH 1NBYA 2GSIB 1RZKC 3BQUA 3WKMH 3SDDD 1GGCL 3HPJA 5D71L 3GSUB 4CDHA 4LGPB 4K7PY 2P8MA 2R4RL 3PNWA 3WNOA 2VLJA 4N8VG 5HYQB 4NKOA 1AHWB 5DJZB 4NRXA 4XCYA 3SE4A 2B0SL 3K2UH 4HH9A 3H9HB 3LY6A 4YUEL 2IG2H 3GBLA 1IEHA 2E7HA 3S4SB 3E2HC 2W60A 2Q20A 4G9FB 1X5AA 2CDGA 2R1XA 4D9LH 1JZ6A 3T1WA 4PRNA 2B1HH 4G43A 5E1AB 4HS6A 3F58H 1I8IA 3L9RB 4CDGC 3QUZB 5MEPA 2W07A 4G6FD 4JFED 1RJZA 3WIFA 3RX5A 4F7MB 4QHKJ 3PGCA 1MEXH 1ZMYA 3CSBA 2ZNWA 3IFNL 3OR7A 4HX1A 3D3VA 5HHVL 3DO3A 3GSNA 5IBTL 1FVEA 3AVEA 3WFHA 4JHAH 4G42A 3SKMB 2IANB 1MI5D 4HK3N 1IGYB 2HJFA 2NY4C 5L88H 2GCYB 4PJBE 4OI9A 3ZL4L 1MPAL 2D0FA 2ZUXA 4V1DE 1LE5B 2H3NB 3G9AB 2AJUH 4QHNB 1XGQA 4RAHA 2HRLA 3T0DA 1FNSH 1QLEH 3OAYH 1G9NC 1WTLA 4TVPE 3SDDC 1UA6L 1I1AC 4YE4L 3AXLA 4K23H 3NA9L 4O2CB 1SYVB 1EO8L 2WBJC 1J0ZA 1Z9MA 4G8GD 5JPMB 1HEZB 4HGMA 4YH6A 3HKFA 5ACLA 4TUJA 1BBDL 4D8PA 5EBGA 5AYUH 5KVFL 5HJ3A 3SKOA 1HKFA 3TV3L 4RGND 4K3EL 4E5XA 4X8JB 4YZFE 2I24N 4BFEA 5B39B 2CO6B 4PRNB 1BVKA 4LAJH 5A16A 1OW0A 1GZQB 1JPSL 5C09B 4PV9B 3BRDA 2VR4A 4WFHD 4XCFL 3QCTH 4H88H 3V7AE 4LEXH 1IFHH 1JRHL 4JFDE 2A73A 1YYMH 4KVNL 1LO5A 1A6ZA 5KS9E 2Y7QA 3QEGH 1FL6B 5I1CL 1GPOL 4MAYC 2FZ3A 5IQ9A 2WP3T 5JNYA 4TNWK 5DD3H 4GKSB 4WNQA 1I1AA 2NY2C 4KK8C 1NGPL 4LRIC 3RUGF 4GRLD 3QNXB 4R90L 4QXGH 1WQVT 2WZPD 1IL1A 2N7AA 3JVGC 2YD2A 3TH2T 1S7WB 3REVB 2OI9B 2H8PB 2HT4C 3ULUD 3QUMB 3SO3C 5C0FB 2B0SH 3K2UL 4AQOA 2XG5A 5FYJL 4BK4A 5J13C 4TUJB 4ELMF 2FLBT 1ES0B 3VXNA 3HG1A 3HRPA 2ICCA 3BGAA 3KR3H 1FYTA 3V6OE 2E7CA 1DLFL 3HS0B 3ULVF 1T80A 1TTUA 5J0BA 3RVUC 4J23A 2WWMD 3HCVB 1LEGB 2AXHA 4FTVE 3SGJC 1LO2H 5CD5C 3WEXA 4IOIA 3STLB 3GUTB 2I27N 3M1BB 1SEQH 4LFHG 1YEGL 5AEAA 5EO9A 4LKCB 4K3HA 3WSQH 4PLNC 5E5MA 5EORH 1IM9B 4LLMA 2CRZA 2R9HD 2PW1A 3DNKA 3UJJH 2XA3A 4XVUC 4PGEB 1FNLA 2K9UA 4B0MM 4TTGA 5E2WL 1KB5L 4OB5H 4LCIH 4ODHL 1U42A 2B4CH 5FDYA 3ZKXC 5GRJL 4P2RE 1JHTA 3IFPB 1S9KC 5IHUL 2R23A 2H2PC 4NNXB 1G6VK 2GTZB 1S78C 2NYYD 1NEZB 4MD0B 5DTFA 3FO1B 3DRTA 4U0QB 2RFXA 4AMKL 2D03H 1W72B 4RFEA 5D7IF 1IAIH 3MYJB 3S3JA 3W9DB 3QAZB 4G7YL 5KJRL 3U6RA 2IQ9L 4JFFB 1OAUH 1AGEA 1L9MA 4P99A 2HFFB 1U8PB 4NQEB 3QQ4A 3LIZH 4TSAL 3MSPA 3FO2B 3WD5L 4DZBB 4GKOA 3PWJB 3RWIB 3LKNB 5DHYB 2JJTA 3TP4A 2RAMA 1MJUL 3OKDB 2JCCF 2P1YA 4FOMA 4OF0A 3VFSB 2Z0BA 4KJWD 3MBEC 4PTUA 2FJFA 4U6VL 4FZ8L 2QL1A 1TMCB 4KUZH 5CLTA 3WHE0 3BX7C 2Z31A 3B2VH 4LEOA 4ZPVB 4W6XB 4EOWL 1H8OA 1FO0A 3QEQE 3OV6A 4JKKA 1S9WA 1X3DA 4X99B 4Z7VF 2FX9H 1RUQH 1TZHB 4DTGL 2MWCA 4K3DH 1P5UA 4LL9A 1A22B 5TPWH 3RTQB 2WBJB 4RNRB 1S9XA 3PNWB 4BFBD 1UM6H 1CFVL 1XGQB 5T1MB 4O51A 3P77A 4G6JL 3VWJB 4XCYB 1BJ1J 4IIQA 3IYLW 1VCAA 5F7FA 1JUFA 4X6FB 2F19L 4NQXA 5JOPD 2EYTA 3RL1B 2CD0A 5KW9L 5EZOL 4UV7L 3ZE1E 3VH8G 4NP4L 2R0ZH 1QFOA 1EO7A 3R06B 2HKHH 1TJGH 1OOAA 3PF2A 3WLBB 3D3VD 4WHDA 5JQ6L 5C70A 4OZIF 5JOFB 3PGFL 2AJSL 2APFA 1E6OL 1S9WB 5DF0A 3ZE1F 4MCZA 4JO1L 1UEYA 3QXDA 3MYZA 5DEFA 5H35A 1VKXB 2BVOB 2A77L 2VQTA 1MJ7H 3AGVA 5LGJA 3VG0L 3HAEG 1LEKB 1I7TB 3PUCA 3UTZA 5K9KB 5EZIH 4MSWB 1MCOH 1U3HB 1KN2H 3QI9A 3PL6B 1MUJB 2YEZB 3U36B 3MJ9L 3DO7A 5DXWA 2HG5B 2Z91B 4PRAB 1QBML 1QFWL 2DJSA 2MCPH 2WANA 3PXJA 1QYGL 5E0QA 2EC9T 5T5FL 1KV3A 2X4OA 5BV7B 1ZVSB 5BRZE 2DQEL 1F4YH 3P40A 1TVBB 2OR9L 5SX5H 1NDMB 4HGKC 1J5OH 3FRPA 1KELH 3KPLA 5EBMB 4GBXA 5DURB 1FZMB 3MV8D 4HAGA 3OKKA 5IF0B 2D7NA 1F97A 4JM4H 3IJHB 4H25B 3G5VB 4MA7L 4QRRE 4DK3A 5KS9A 5KSAB 2FX8L 4N0UB 3TNNB 2HFEA 5JIPA 5BZWA 4OI8A 5LQBH 4HDIB 3ZE0F 2KPNA 1T3FA 4GG8A 2YD6A 3TV3H 4KK9C 1C5BH 5IB4A 4ZQKA 5GGQL 4WHTB 1T22A 5GS0H 2X4RA 2FEDD 3BAEH 1QSFB 3MXWL 4WU5B 4OZHF 2QSCL 4NQED 5KZCD 1OAKH 3HZYA 1NCWH 2QSQA 3JUZA 4OFIA 4Y2DA 4OUUA 1JIBA 4WEBH 3D39D 1FVCA 1JPTL 2BZDA 2NCMA 5I2IB 5I8KH 1OAZL 5E8NA 1Q0YH 2IAMC 3FKUS 2IMNA 4JFFE 3MNVB 3RP1A 4M48L 3E3QC 2AJVH 4H26B 1OP5K 1DFBH 3NFNA 3OKLA 3VRLE 1SJVA 3EOBA 3BJ91 4PGDA 1ED3B 4OD2A 4ETQA 3EUUA 3QDMD 3WFBH 4JG1H 1TJIL 5F70A 3N85H 2Z31C 2ARJB 5ISZB 5I8CA 5B21A 4EI5A 3MBEA 3D25A 2NY7L 5IB4B 4YDJB 3VW3L 4YHLL 1IM9D 3NCJH 5TE6L 5EU3B 3WV0A 3RUGA 1BZ9B 1QG3A 4U1LA 1QKZL 1WLHA 4NJ9H 3LN4A 4JJ5A 4BH8A 5FF6A 2YUXA 1HHKA 4GMSH 4BK5A 4NKDA 2Z31B 1HSBA 1MH5B 3SBWC 3HLAB 1ZHBB 2NXZB 4ZTOH 2DQCL 5HVFB 3O4OC 4PY7B 3SJVB 4S1RH 3O45B 3MJGX 5MEPB 1N8ZB 2QSTA 1CGSH 5H94A 3AY4C 4MQTB 1GGBL 1J9CT 3BZ4A 3SDCD 5IB5A 2UZXB 5DQJB 1MSPA 4JRXA 2I60H 1VFOA 3ARGB 4MJ4A 1IKFH 1M71B 5CEYB 1NEUA 1N4XL 2C9AA 3H0TA 2WIMA 1RZGB 4EUPB 1YEJL 1V7ML 5JXAL 1J0HA 1FNHA 3LMJH 3QIUD 2FSEB 3O2DA 2DLEA 1F6LL 4ISVB 1DBKL 1G1YA 5I16A 3DVGB 5CJOH 4MXWL 2IAMB 2NY4B 2H2SD 5I18L 3LKQB 2XZCL 2CRIA 2R0WH 5CMAB 4M3JA 4U1SB 5DC9B 5I75C 1CYGA 3IDUA 5CEZE 2PXYB 4DVRH 1CQKA 3K74B 3BEVB 4IM8A 4YLQT 4LAQH 3FQNA 6FABL 5B38B 1U8MA 2X1XR 4XX1G 4HBQA 2C4XA 5HGDA 4HKBB 3VGGA 3KYOA 4E42B 3PWPB 4WJ5A 4TVPH 3WLWD 1FFOA 2ITCB 4JG0L 3L3GA 5JXED 2HKFH 2UWEE 4K9EL 1ERNA 4LPWA 2A73B 3O6LH 4M03A 1VEPA 1G7JB 4RWYH 4FZ8H 4XVJL 1Q94A 3LS5L 5CGYC 1KCUL 1MY5A 1S7QB 3WJJC 4HKXA 5HI5C 4JN2A 3MMEB 2ZSVB 1NEZA 4FQ1L 4EUPH 5DA4A 5HJ3B 3SKOB 4FQ1H 4LMQE 4JFOA 2JK5A 2ADGB 3O9WD 1UB6B 1CICC 5GGRY 2OR8A 3NACH 4XVJH 5DSCA 1FL5A 3WIIL 4ZXBB 4F7CA 3X3FL 4JFEB 1YC8A 1YNTA 3GK8H 3SOBH 1U8KB 1C7TA 1WCQA 4M6NH 5IG7B 4F33B 3LOWA 1HINL 4WWKA 3ULVE 3OPZH 1AJ7H 4MD4A 4P46D 4XPGH 4JB9L 3DSFL 4MD5A 4B53A 2Q7YA 4LCCB 1YPZF 1LEGA 2R2HB 3NPSC 5I66B 1WCBB 5DHVB 1TVHA 1FFPA 4POUB 5KTEL 4OCRL 1CI5A 4XP5H 5HGDB 1YMME 5FDWB 1A6WL 5CGYD 1LNUA 2G60L 5L2KD 1NMCB 3IFLH 2HT2C 1R5IA 4QRPD 1REIA 4X7TA 1RD6A 2EE6A 4BQBA 4KTEL 4GLRH 5L7XH 3HMWH 5CBEB 1DTUA 2UY6A 2HVJA 4QWWC 1QUNA 15C8L 4BSJA 3KLDA 3W81A 3HHRB 2X4SA 4QHNA 5I73B 4IRSC 5IQ7H 1AGFB 43C9A 3U2SA 4HKZB 3WSQL 3VFOB 3QDGB 2P5WA 5IHZA 1P2CB 1MREL 1QLFA 2CKBL 3DXAA 3QO0A 5AD0B 3U7YH 3T0XA 2VLKB 4XNUH 1NFDF 4HPOL 3DROA 1JZ7A 5IVXE 5BV7C 5I1LA 3X3GL 5CS7A 2FH6A 4KU1A 3BP6B 4BQ9A 1H0DA 1S5IL 1AXSA 1KLUB 4YHKH 1ZLSH 1SQ2N 4NQDB 5I71C 2X4QB 3KPSE 2OL3A 2NZ9D 1NAML 5FM8A 1MFBL 4YHZH 5IKCB 4Z7UB 4DEPC 5D1XA 4LIQL 2YPLA 4NQUA 4G8GA 1S9YB 3K81A 3VXUA 4XXCC 4LQFL 2PTUA 4TSCH 1A2YA 3VRJA 3PHSA 5D7JB 1JYWA 5E56A 3A6CH 1QRNE 3MRGA 4P5TB 4NRYA 3JV4B 1C1EH 3VFGH 2AGJL 4D9RD 3P0VH 2LAGB 3U9PL 1C7SA 2W60B 5HYQA 3RZCD 3P73B 4ISVA 1IAIM 4APQB 4JM2B 3SOBL 3Q6GL 3H9HA 1T2QL 1UADC 3C8DA 1TQBB 1JPSH 1UWXK 5MHSE 3WUWB 2JIXD 5IBLD 1NPUA 3GB7A 1MRCH 4GOSA 2H9GB 3N1GC 3OTTA 4I4WB 5IB1B 1Q9OB 3VXRD 3QIBA 2DQFA 4LDEB 5DQDL 4WGVB 1F2QA 3QUZA 3QUXB 5CZKA 1RUPL 3RGVD 3ZL4H 3VGHA 4FFYL 4MAYD 3LIZL 3QHFH 1KCUH 3DYMA 3NIFF 1JL8A 4WW2C 5IWLC 1HNGA 1TJHL 4OF3A 2DTSA 1FO0L 5E4EB 1QZ1A 3VWKB 1UQSA 5CSGA 4X8XA 4K9EH 1UACH 1PY4A 2YZ8A 3CLEL 3TO4D 4M7JL 4NRYB 2A6KB 4WV1C 1C5CL 2ATKA 2YC1B 3WJJA 4DGYL 3V8OA 3MR9A 2AXGB 4ZO6A 3LHPL 4LRNH 2LU7A 1U8QB 2DBLH 3LQZB 4WW1B 5T1KA 2D7MA 4JQXA 1I8LC 2GY5A 4OM1L 3E6HB 4NZRH 3FQRB 3G6JA 1I75A 3L3HA 3WUWA 1TFHA 4AMKH 2VAAA 4ODUA 3RVUD 5IMOA 5BMFH 2VXVH 2KDGA 3V5DA 4JR9L 4RMUA 4Y19B 1A7PH 5ANMA 2QHRH 2BOCB 1ZVHA 3K80A 5FCUL 1CTOA 4LCYB 3NPSB 1AO7B 4ZOBA 4OLVL 4JEGB 4MQ7A 5DVOA 5CKGA 1O0VA 3ZYZA 4L3AA 3ULSA 4KI1A 4LHUA 1KLFA 2GK2A 2ADFL 3PQYB 4L4VE 1U58A 2FNBA 1TZGL 5FAAA 2E7LC 1KXVC 3KG5A 3VI4E 2DAVA 1YYLL 4KPHL 3QXWA 1D6EB 1M7IA 1SY6L 1XIWD 4X7TB 3BXNB 4EN3D 5C0CE 1DBMH 1NCDH 3SCMB 1I1AB 5D7LD 3KXFA 4JKMA 2AJZB 2YRZA 1XZ0A 5CBEA 1GGYA 3BVNB 1F4HA 1XF2B 3JV6A 5JO5A 1U8HB 4LOUD 3P9LB 1VEOA 4EI5D 1T21B 5ESVB 5IMOB 1G9MH 4Z7WE 3QUXC 3L3KB 1PD6A 2V5MA 3WN5B 3HE7B 3NH7L 2UY7A 4ZFOL 1MCHA 2P5WB 2Y23A 4U7KA 1F2XK 5HVHB 3WEXB 4S1QH 1S7SB 1IGCH 3A67H 5BZDB 2VSDA 1LP9A 1G9EA 1ZS8B 2XN9A 2MQ3A 4FQHB 2RB8A 4CVXA 1WFTA 3O81A 2HVJB 3MRMA 1KB5A 4F8TA 1CGTA 4MAUL 4OLWL 3PWUB 3CDFA 4I18B 2XT1B 5HHQB 4M7KL 5HHNA 4JFPA 2GUOA 3T2OA 4ODXB 4P4KD 5KSBF 4X4YA 5FUCC 2AK4B 1A9BA 1D5BB 4ZOCA 5E8DL 2GTWA 4PJHB 4CW1A 4PRBB 3RBSA 2YUZA 5SWZB 5I8KL 1DQTA 4WWKC 1CN4A 1MLBA 2YD7A 5FYLH 4O00A 2ERJB 2EDJA 4ZYKB 1MFCH 1ZOXA 4PB9H 5F9WB 1EERB 5F3HA 2KKQA 1Q9KB 3TGXA 4YC2C 1LO5B 3L7EB 1LO4H 2DMBA 2RIKA 4JFDB 4G7YH 1X44A 3CH8A 1G1CA 1QRNB 2AEQH 1Z0NA 2ZOKA 3FO0L 5HVGB 2HN7B 5C0JA 2PCPA 4PJFA 2NNAA 3S97C 1ZSDA 3EYUH 2X4SB 3RWHA 1A2YB 4KKLC 3C6SB 4M1CD 3ARBD 3RI5K 4N68A 3SE4C 2RCSH 5HSFA 5L0QC 3I75B 5HI4D 4NN5B 2ADIA 5A1AA 4Z7UE 3IDIA 2BRRL 2DM7A 1U92A 3B2UD 4RDQF 3C08H 4L29A 2FECL 2YSSB 4NZRL 1BF8A 3MJ7B 3O41A 2WMPA 2R0KH 3WFEH 3TO4A 3NVQA 3GDBA 2DBLL 4X5LA 5EA0L 2ZPKH 4U1NA 4F7PB 2OR9H 4X9BA 2GT9B 1C5CH 3GBML 5L8KB 1QD0A 3LD8B 4O51B 2AJYL 1ORQB 4G42B 1W0VA 5HGHB 1UH2A 2EXWD 4JFQA 2MQCA 1QFWH 5D2LE 3HNTL 4QHLB 4GBXC 3UJJL 4F33A 5IG7A 4K8RC 4Y4FC 1FBIL 1KT2B 4I18C 5F93C 2BOBB 3LKQA 3IDYB 4B7IA 3QDAA 4P2RD 4YFDB 2EKSA 4XPBL 1CR9H 3VXPA 2E6QA 4Q6IB 4N0FB 5B22A 5F89B 5HYJD 1J0KA 1ACYL 4Y1AA 5DJ0B 2Q6WA 5F8RC 3M8OL 3RZCA 4HW6A 4C56D 2FB4H 2NTFB 3BSZH 2A83A 1KBGL 3KAAA 1CD1B 5MEND 4V1DD 2HFGL 3QRGH 4UB0L 5D8JH 1VFBB 3I9GH 4KROD 2AJSH 4HK0B 3V6FB 2BY3A 4L8CB 4O2EA 2Q86A 3RHWF 4KRPD 4YC2B 1KNOA 3MNZA 3S96A 4LVHB 2VUOA 1ZT4B 3WCYA 4PPTA 4XBEL 3VXUD 2EDHA 4HJJL 1XAUA 1DBBH 2NW2A 2HJLB 1XR9B 5I8CB 1BECA 1TPXB 1MWAB 1P9MA 3JV0A 4E0RB 5DHVH 2CLRA 2JELH 1GC1H 3HE7C 3U46A 3DVNA 3AS3A 2VZSA 3KYNB 2OYPA 3QEGL 4PJCB 4JFQB 1CLOH 5IEHA 4XNZB 4ENED 1NCNA 1WICA 4J3OC 1PQZB 3U4AA 1FLRH 1G9ML 1H8SA 4X7FC 4KKBD 5DLML 5IVXA 1HHKB 1J1PL 3MLZL 2KQNA 4PJIF 2CJUH 1TIUA 2FECI 1GGIL 1TJHH 3CFJA 4FQXD 1UA6H 4LLUB 1UCBH 2PW1B 3MGOA 5BS0D 1LE5A 1O7SA 3FHAA 5EIVA 5DQDH 2HT2D 5DK0A 2W0FA 1NBZA 3DI3B 3GIVB 2NY5L 2SEBA 3C5ZD 4WU7A 3QDJE 2QSCH 3NA9H 4RA0C 1FVDA 4JFPB 4LF3A 2DDQL 3L5XL 3MLSH 1LILA 1GJIA 1H3VA 4NO0D 3L3DA 4Q74A 1EX0A 4NC2B 1A9BB 3MUY1 1RZ8B 2XWTB 1AY1H 4TNVK 3EOBB 1KTLB 3U9PH 1YEFH 4F80A 3THML 4UTAL 1P53A 1K4DA 2OZ4L 3SE9L 3BH9A 1RZJL 1OF2A 3G5ZA 4JPVH 2EXYC 5C6WH 2X1PA 3VXME 1CU4L 3BPNC 4OZGA 2R1WB 1KC5H 1CU4H 1N0XH 3CNKA 5KTEH 1BFVH 4N9GA 5GXBB 3QA3B 3ZYJA 4IJ3B 5IEKB 3OG4B 5L0QB 1MI5E 1AGDA 4PJHA 4EQ2A 4KK6C 5BS0E 3L3JB 2XKUA 3TBYA 3HPJB 3V9FA 1XH3B 4ZTPH 1NGZA 1H8NA 4HF5L 1C12A 1IGMH 2ZUQC 2YPKB 1J8KA 3Q5TA 1IAKB 4LASH 2HWZL 4UT6L 4NWTL 2MKLC 3OKMA 1CXLA 2AKRA 4HCRA 4KK8D 2N7BA 2UVEA 5KG9B 4FZEL 4ODXA 3V52H 4RDQG 3KYMB 3LQMA 1NC4B 3UTSE 2KUTA 4NUJB 4U7SA 3IETA 4Z95L 2YD4A 1PKQE 3DOSA 4EI6A 3C5JB 3FRUA 5IROA 3FFCD 4P5TA 4KRLB 4RGNE 2V7HA 5EWIH 5I1DB 4PRIA 4IEFB 4N5EC 2I5YL 3MBXH 3RVXD 1P84J 3DWTA 1FLRL 4LPCA 3OB0K 1QOKA 2BY1A 1F02I 1JZ5A 5CEXA 1HK6A 3P0YH 3HR5A 1JF5A 2FBJL 5HD8C 3O9WC 3QUYD 2VDOH 4YDKH 4MHHI 2HFEB 4HZLB 1ZE3C 1MLCB 3B5HA 3RI5F 1XGUB 5GS1B 2DMCA 4OGYH 1KPUB 2XQBH 3TZVD 3DLQR 5FFLA 1CDYA 1UM4H 2BMKB 3R0MA 4KI5E 5L2JA 3MV01 4LQFH 4RBPK 4FP8L 2W0PA 2P5ED 3AXLB 4U1IB 2XZCH 4HJ0C 5DVKA 5FHBL 3CVHB 4DKFL 1T5XA 5ICXA 4KDTC 2BFVH 3KYAA 4J1UB 4XCFH 4YHYB 3UP1A 4U3HA 4YXHH 1NQBA 4JY5H 1NJ9A 1RU9H 3O6ML 3EKCA 3VMOA 3WJLA 2OK0L 4KTDL 4MS8C 3SDYL 2BSTB 4PBXA 5K9QI 3DX6B 1AD0B 1MREH 2CKBH 3NIFE 5J6GB 3LB6D 3O4OB 3DBXA 4HC1L 1HIML 4PREA 5J4MA 2G9HB 4W68A 3EOAB 1MIML 1SVZA 5AZEL 2OMNA 1TTGA 1YN6B 3N9GL 15C8H 3RY5A 1NDGA 3FQWA 5D2LA 3EHBD 3RIAK 4ELKB 1U6AL 3S3PA 4HD9A 3O3AB 4HIJA 1F90H 4ZMAT 2H6PB 4U1JA 2Q6WB 1FORH 4ACPA 1NFIB 3LRGA 4BQ8A 4FFWC 4IRJA 3PV6A 5HHXL 4JO2H 2Q76B 4IOFD 3S37L 3V5HA 3QCUH 4Z7OF 1VGEH 4OF6A 4RA3A 4ZS6D 3ZTNL 4XPAH 1F42A 3SPVA 1AIFB 3DUSA 5ERWB 3JWOH 4LCYA 1FORL 1DLHA 5DD6B 3AY4A 1AJ7L 3CH1A 4WUKL 1YEFL 2FR4B 5BRZD 3GMPA 1AY1L 1KB5H 4ODHH 4OB5L 2X4PA 5BJTA 4LDOB 5EC1B 1EFQA 4YAQA 1K85A 1IC4L 1I9IL 4Y88A 5DK0B 3RDTD 1ZLVH 4CVZB 2J6EH 2VQUA 1QBMH 1T7VA 4OTXL 4NZTH 4TPRL 3M1BA 2JB6B 5IW6A 3OG6B 5EUOA 3QEHA 3O0RL 2R29H 1PZ5A 5D70H 1EXUB 1GGBH 5GSRB 5IHZB 5C0BB 1JNNL 2BVQB 4XI5D 2IFGA 3ZDYE 2FJGB 2R2BA 3RL2B 4IOFC 1KB9J 4OZHE 4ODVL 4X6CA 3UPAA 1L6ZA 3KPPB 1XH3A 4CJ1A 3LSOA 5CEZD 4HFUH 5CMAA 3U36A 5I73C 3MRPA 3WIHL 5HGBB 1NBZB 3X12A 4XC3L 4P5KB 3T0BA 4HWUA 5DO2D 3SGJA 1UWEL 1JWUA 3RA7H 3EO9L 3GBNL 1WIOA 2HFFA 2O61A 1UZ6F 4QOKA 2OQJA 4LCWD 5JHDB 1WTGT 3TJHD 6FABH 3F12B 4PGZA 4C56A 4K71B 4Y5VC 4NN6B 2HLFC 2DIJA 1I3RB 3HI6H 3C5JA 4UAOC 4OGYL 4HG4J 1BJ1H 4CVUA 4OAWA 2F19H 4HKZA 1K4DB 4I9WD 5IGXL 1OCWL 4WHCA 4KV5F 1KPRA 4OLUL 1QA9B 4AIXA 5DJDB 3D0LB 3S36L 4KKLD 3GRWH 1IT9H 4OIIL 3RDTC 2P8LB 1T6WA 2R69L 1I8LA 3CFCH 3MA7B 4X99A 1F4YL 4AIZA 4Q9QL 4MWFB 3LEYH 2CMRH 4LLQB 4Q2ZA 4KK9D 4LPVA 4OCXH 4XHJC 4JQVC 4LEOB 5K9QG 5J6HA 1DUZA 4BUHA 2VZ1A 1D5IL 1JWMB 3MO1A 1N4XH 43CAA 5HYIA 3BKYL 3TBYB 5AYUL 5EUKB 4DN3L 4X6CE 3TZVB 2X41A 3BKCH 4NM4L 1S7UA 4ONGL 4FFZH 5E6ZA 1BWMA 5F96L 3BIKB 2VLRD 2J4WH 4WY7L 4E41E 1DVFC 5E2UL 4OCNC 1N26A 5D5ME 4W4OA 4F7PA 2VUYA 4PD4J 3TBWA 5ACZB 5F97E 4GW5A 2GAZB 1FC2D 3IB4A 3SGKC 2IH1B 4QF1B 4K7FB 4WUKH 1VERA 4J7RA 4FXLA 3CVHL 1PX3A 5TDOA 1BLNB 3I2CH 5LCVH 5HHOD 2V2XA 3QNXA 3KYMA 5AUMA 3RWJB 2D0GA 5JUEL 4W6WB 2VIRA 5I71B 1T2JA 2QBWA 3V6OC 3TVMB 3MRKA 1UM5H 5F7WC 2BRRH 4JN2B 5A43C 1QR4A 4JZOB 4JKPH 3RAJH 4PJBF 2O26U 1U8LA 4DGYH 5EU3A 4PJGB 4Q9RH 1S7QA 2HJKA 1X7QB 3VXSD 5FOBA 3NFSL 5LG1A 4HS3B 1MVFA 3X13A 4X4MA 1P6AB 4M1GH 3AS2A 5I0ZA 1N64H 1U95A 2D0HA 4NO5B 1UCTA 2EDOA 3L3GB 4YIQA 1S5HA 2I25N 2C3GA 1G7IA 4TSBH 1FC1A 3RWDB 4F57L 2XTJE 4QT5A 3U9UB 1RFDH 2NY1C 3HNVH 1E4XL 4UIMB 1LDPL 4OCWH 4X4XB 4GAYA 4M00A 4BZ1H 3VA2C 2YR3A 1QQDB 3MRHB 1JI2A 3UPRA 3TH3T 1K5NB 3V95A 4EBQH 3HG1E 4UNVA 2VDML 5KOVC 4GG6E 2J88L 3V5KB 5F88A 4UDTB 1YN6A 2CIIB 2F15A 3A6CL 5E8DH 3I85A 3S35X 1UM4L 4CU8A 1WBZB 1YPZB 1A1MB 3GMQA 4KK5D 3GMPB 4GG6B 1T7XA 5JLZB 1Y6MR 4HS8L 4HGWA 4M43H 4MWFA 4R6UA 2PXYA 3OAUH 3SQBA 1PEWA 1QFUL 1EFXB 3RWGB 3MZGB 2UWEF 3HE6A 3PWNB 4PR5B 1R0AL 5HDBF 1FFRA 2H6PA 3T0WA 4JQIH 4NQTA 1K8DB 1O5DT 1R3IH 2Q76A 3V5HB 4JVUA 4OZFB 4L4TE 2XTJB 2FJHA 3JSSA 3QPXL 4IRZL 5J56B 1AXTH 1EHLL 2VO5A 3ZKQD 1Y6KR 2Y9RT 5HDBE 1JTTA 5SWSD 4IHOA 1U9KA 3VXUB 1F6AB 3HG1D 3H8NA 4KRPB 3T2QA 4NCC2 5CD5D 3HUJF 1CICA 1YEIH 2P5WE 1M7DB 2ZKHH 5GGSB 1VPOH 2YN5A 5FECB 3U83A 1JVKA 4HEME 5ISZE 1ETZA 3DRQA 3JBG7 4P9ML 3SCMC 1JK8A 4RMSA 1G6RH 4X4YB 5INDB 4D0BA 5J9PA 3BGMB 3ARDB 4QXGL 5DK3A 1JPFB 4FQXA 4N90D 3BQUC 5TGBB 3IJSB 1OT2A 4U1LB 3GKZA 5DJ2B 1GC1C 2BCKB 2ZOLB 1F8TH 4ZAKC 5FF6B 2CO7B 3HB3C 3S34L 3TESA 1F4WH 4XAKE 3UROR 1X6NA 3WFBL 5IK3B 4KY1H 1MCEA 5D5MB 5IP4A 4XB8A 1LE9B 2V2TB 1EBAA 4JPVL 1BGXL 3SDAD 2DQIL 5TQ0L 4R0LB 4NO2A 3BQUB 3H6JA 1H5BA 5C0AE 1MJ8L 3AAZA 4PRPA 1X5LA 3DO7B 4LLUA 1RUQL 5ETUA 1GIGL 4KH2A 3ROOA 1UACL 4HWBA 2AW2A 2DJUA 4JFZL 4TTDD 3I75A 3MUZ1 3U2SB 4KJPD 5D96B 3ARBB 3O3DA 3G5XB 1N5AB 3EJZD 4DVBA 4Z0BL 1JPFA 4WHYH 4EUPG 2OJEB 2PW2B 4LSRH 3VFMA 1T5XB 4DEPB 3MRDA 4POZC 2A6JA 4HXBL 5EOQL 2X4TB 1KYOK 1S8DB 2VXSH 3Q3GA 3TT3L 1R3IL 4OBRA 5DMKA 4NOFA 4CKVX 1BMGA 5CJXA 3BIBX 4OGZA 4DQOH 5DJCA 5KVDL 5DJ8A 3KPSD 4LLYA 2VLLB 2E6PA 3UC0H 1IAMA 1R6VA 1JMXA 2HG5A 2Z91A 3HNSH 3MR9B 4K3JL 4ZNEA 4OIBA 5HHMB 4XBEH 2Z92A 4OZGB 4K3JH 5IGXH 4P0DA 3G5YA 4HDIA 5DS8A 2HLFD 1A21A 4MCYA 3UPRB 2AK4D 5AZ2L 1KULA 1NMBL 4OLZH 4OZIA 3Q48A 4NQSB 4RMVA 5CJQL 2X4NB 3O8XD 1SY6A 1KOAA 1MFNA 1H3GA 3C5ZA 2VITB 5E2WH 5IVXB 1SJEB 2FD6H 5F1KC 1R24B 4U1JB 1RUAH 3BWUC 4PJBB 3BPCA 2CUMA 1W8NA 1HH9A 4MZ3A 3CU1A 4GO6B 3QFDA 2HTKD 2KZWA 5KVGH 3UX9B 2FIRT 3MJ9H 4U6TA 3TA3C 2H26A 3GHBH 4BSVB 2V7NB 4HT1L 1LK3H 1UWGH 5GGSA 4YX2H 1ZTXL 5C0CA 1QFPA 4H0IA 1BVLB 3NCEB 5HPMA 2W0FB 1RIUH 4FQJH 4LSPH 3W82A 1FZJA 2H41A 4LGRB 2EKJA 2XPGA 5D7KD 5IFHH 1ETZB 1T66C 3DUSB 3N1MC 3VFNB 4MNQD 2VN7A 4OT1H 5J1AB 1DLFH 3NCCB 3DPBA 1AXIB 1IGML 4FG6D 5HI3D 2L0DA 5F6HJ 4CVWA 5EN2B 1Q9LA 3QO0B 2OS7A 1K9TA 2EH7H 5D7LB 5TQ0H 2X1QA 3G6AA 1VA9A 1AQDB 1YY8B 1XIWB 3LKPB 2QKIB 3IFLL 4B41A 3P4NA 3ZLQC 2GW5A 2W9EH 2EEAA 2XOTA 5EU5A 5E08L 3SE3A 1CTNA 2O93L 4UIMA 4MXVF 1RJLA 4LRNL 3C60C 2FGWH 4M6MH 1EHAA 1NC2A 2R0KL 2H2SC 4NO2B 1RZ8A 2H32H 4M6NL 3VG9B 2I9TB 3L3JA 5E6IC 5DWUL 4LBEB 4OM1H 2BOCA 1T1YA 3HUJB 2IH1A 4QF1A 1JZ3A 2DICA 2QLVB 4PTTB 4HKJA 4X9GA 4AT6A 3WIHA 2OZ4H 1UZ6E 5T3ZD 1QLRB 5CZVH 1G9NH 3UTTB 1P1ZB 4MLIA 2XICA 2VAJA 2DB8A 3ILQC 2Y1VA 4KZEL 5D1QB 3QPQD 3DV6A 4MVBD 5CIPB 1BZ7A 1EVUA 5DD5L 4UINH 1KEGL 4RGOH 3VG9C 3H9YA 3B3IB 4ZD3H 4KV5E 4GH7B 4XI5C 1BIIB 4H8WH 5L8JB 2P24B 3HLAA 1MAJA 2CKBB 1C08A 5T1LD 1A47A 5I1HH 2VN4A 1E27B 3OSKA 3LS4L 4NFBA 5F7HA 4QRSA 4KMQA 3OKMB 1RHHA 5C0AD 3O4LA 4MAYB 5GS0D 5CUSL 4UILL 3T0EA 3MCLL 4UT9H 1FVCB 4EN3C 1UJ3A 3TWCH 3MV7E 4QO1A 1NUGA 5FIEA 5GHWH 2PNDA 4JM4L 1AP2B 3T65A 4JRWA 4RFEB 2E9IA 3GSXB 4LBEA 3D2UD 1KELL 3ARVA 4RZCA 4OFYD 2X9YA 3DJ9A 5FUOH 5DRZB 5HHOA 5JOEA 4LAQL 1WIPA 4K94L 4MJ6B 3RZCB 3DX7B 3IU4L 4H0GA 1B4RA 4X80H 3G08A 4BM7A 5B39A 3MGAA 2XIDA 1ACYH 4NHCL 4D2NA 1JNLH 2A9NL 1AHWC 1U8NB 3LV3A 2QV2A 1G0XA 3EHBC 3O2VH 3BZEB 5D7JD 2WNGA 3T0ED 3VRLF 3WDHA 1PLGL 1NSNL 4FQQA 1QPPA 4EDXB 1XF5B 2GITB 1FE8H 4QHLA 3I84A 1G7PA 5E99H 5T1LA 4XVSH 1I9JH 4PRDB 3U4BL 5BCAA 2CUHA 4NQSA 3PQYE 3IFOA 4MD5B 4YX2L 4IRSB 2DWEA 2D4FA 5K93A 3H9SA 4XP6H 4Y1AB 3GMOB 4GRWB 3QDMA 4XRCB 3FB8A 4GW4A 4HIIB 3GIZH 3GNMH 3NCBB 3VFTA 2FHFA 4PJ7E 3SKUD 5INCB 2DS4A 4G6KH 1NAKL 3VFVA 1T4KB 1ADQH 3G08B 1P7KA 3RWDA 4YFEA 5EA0H 1A6TA 4JM2C 3T08A 3ULUE 5BRZB 1N59B 1VSCA 5FGBC 4F9PA 3C08L 4MCZB 4N1EA 2ZJSH 2OTUA 4PJIB 4XTRD 3DVGA 2XKNB 2AV1A 3MLVL 1P1ZA 3PHQB 4J6RL 1LP9B 2P8MB 2Z92B 2J12B 3VFPB 4OBSA 5EC1A 1XIWA 3LKPA 4ZFGL 4Q6YA 3BPOB 3N85L 4HH9B 4Q6IC 2QHLA 2ED8A 1A1NA 1WFOA 2QADC 2VXTH 1OAQL 3OXSB 4YJZL 1NGQH 2NY3C 2O5XL 5FYKH 5C71A 3X3FH 5I8OH 4HWZB 4PJGE 4ZUUA 2UUDK 1IC5H 1I8IB 4TQEL 2VTFA 2EDFA 4UINL 4PP1D 1DUYA 1DQDH 4Z8FH 4TUKL 5F7MC 5LGKA 4QTHA 4NJAL 2Y06L 4BH8B 3VGEA 2QQLH 4C83B 5CCKL 4LLWA 4JPKH 2GAZA 1ZHBA 1QVOA 1U3YA 1JPST 1MOEA 1AR1D 3NIDE 1KJVA 5D1XB 1N6QH 2HTLC 1DBAL 2V2WB 3DV6B 1V7NH 1IAIL 2W91A 2OXHA 2GY7B 3T3MF 3QNYA 2Z8VC 4UOW1 2XXMB 3SGEH 5ICYA 2F54E 1CXIA 3ZHDA 3X14B 5LQBL 1JUFB 1LQSR 4J2XA 1S7RA 2PTVA 1I7RA 2J6EA 2AK4A 4IRJD 1LHZA 2FDBP 3TNNA 5IHUH 1QHPA 2R4SL 2N56A 1TXKA 1F3DH 1UH4A 2DBJA 3RBGA 2A6JB 3J7HA 4KAQH 3EO9H 5EU5B 1ZHLB 1INQA 4YNYB 3VXTB 4Z77A 5TE4H 2ICWA 2ZNXA 2PCPB 3V79C 4PLKD 1PW3A 1VPOL 4ZSOB 2CGRL 1IGFH 3FJTA 1WJ3A 4MDJA 4OUUB 1MCPL 4HMDA 3DIFB 4XVSL 4FTVA 3TNMA 4HZLA 1HOCA 1VGKB 1EVTC 2IJ0C 5DJ6A 1U92B 1KFAH 3GSRA 3W5MA 4BA8A 1NEZG 4HUWB 3FFCB 5EIIB 4Y5YA 1T20B 5IQ7L 5GIRA 3OXRA 3GJEB 5IB1A 3UBXI 5J89A 4R0LA 2VAAB 4ODUB 4XH2A 1FFQA 1N3NB 2YBRB 5E70A 3CFBA 1S7XA 2VQ1A 3SDCB 2N4IA 3F5WA 2BVOA 2HP4A 4U2YA 1JGUH 3FN3A 4CADA 4JO3H 3ULUC 4X6DA 2DI8A 4QKXB 3KPSB 2R56H 1GCFA 2EIBA 4P23C 5E2JA 5IVOA 4FG6C 3P11H 4TULL 4U6XB 3O11B 3SDXF 4Z76A 1CXEA 5DSCB 1T2XA 2Z31D 1KSRA 2BMKA 5DMJB 5JUEH 5C9JB 5I9QB 4LEXL 4U1IA 4TRPL 3OKOA 3PP3K 1D5MA 2KZ1B 4UTAH 1WZ1H 2HVKB 3VXMA 2IPTL 3BE1L 3EOAA 5I1JL 2DLFL 3HA0A 2Q8BH 1IQWL 1U8OA 2YPKA 1FN4B 4MYWB 4U1KB 1DEDA 1U3HA 1V7NL 3LDBB 2YD1A 4OCYH 2BRQA 1FO0H 3QIWB 4OQTA 4LSRL 4XZUA 3PGDA 4ZDHA 1SMOA 3SCMA 3G5VA 4RGOL 4XAWH 4U1MA 1NFIA 4P2QA 1BQLL 1ULVA 1WAAA 1RSFA 5J11C 4Y2OA 4KGJA 1FYHB 4ZUSB 5I17B 4PGBA 4Z8FL 2CPCA 3QZWG 3LV3B 3DVNB 3GSVA 5I0DA 5L2KA 3B4NA 4H5SB 4R8WL 4JHWH 1KF9B 1G7IB 4O9HL 4OIIH 5INDA 1U8JA 3L5WA 5BS0B 2QQKH 4KI5F 4M7KH 3LKNA 1A1MA 5DHYA 3RGHA 4NDMB 1X4YA 1XZ0B 5B8CB 1XGUA 5LAXA 1D5ZB 3QJHA 3GMLA 1MFBH 4ELMA 4YHZL 1A6ZB 1DE4A 1S9VB 4DGIH 4DZ8A 1CL7I 2ZUYA 2Q8AH 1YC7A 2H32B 3A67L 4JDVA 1DBBL 2PUQT 4JKWA 5IJKC 4WUUA 4LKXB 3HZVA 4HPYH 1S5IH 4MA8L 5DJ0A 4ZODA 3T4YB 2YMXH 5EZLA 1MHHB 2HLAB 4EEEA 3FB5B 4XNXH 1K8DA 4NIKB 2KQMA 4HWEL 3SEPA 3ZT5A 4X6BA 3UAJC 2AEPH 3WFDH 1LEIA 1A7RH 1S9YA 3MFGB 2PN5A 2R4RH 1U6AH 1VADA 1A4KA 2UUDH 3KPLB 2F5BL 1U2HA 1R3JA 1DVFB 1F45A 4XNYL 2NXYC 1EZVY 4V2CB 2HRPH 1N5YH 5FV1L 1G7MB 1EO5A 1UH3A 3QH3A 3VU2A 4FQJL 2H45A 2EYTB 3KNBB 4JO4H 5FO9A 3O0RH 2LQRA 1E6OH 5C0DB 3QNZA 3N06B 3D39A 1HSAA 1MCPH 1YY8A 4IOIB 4R2GD 1KCSL 4A2LA 1JI1A 4JVWA 2HWZH 4XNYH 3E1F1 4WGWB 3FO9B 5MP6H 5H8DA 1A3RH 4XMLH 4OCRH 1U0QA 4W70A 1YEHH 4IHOB 4WO4A 3P30L 1KG0B 2NY7H 4FQQB 4KTEH 4LVOB 4POZD 2GK0B 4P2OC 4J3VA 1KCRL 3U0PA 3DHMA 1TJIH 1WZMA 5H37H 5T3ZL 2VDNL 1ZVYA 3F65A 4DKEL 4I0PD 4UNTA 4PJAE 4XNQB 5E94B 3C2SA 4LVHC 3RWCA 4IMLA 2FO4B 4EXPX 3KPRE 4YPJA 3RJDA 5MI0C 3NN8B 3CMGA 3KPTA 3TN0A 3AC0A 5E9DE 3CLFL 2IGFH 4P57A 4EQ3A 4JRYA 5IESH 4ZDHB 3KYKL 1BX2B 2AQ3A 4NYLA 2VH5H 1ZEAH 4LRIA 4YHML 2A83B 1LK2B 3ULVC 4R4FL 4TQEH 5BW7C 3OHXA 4CL7A 5F7LB 4AG4L 3FO9A 5DVLA 3NPZB 4R4FH 3HRZB 5DC0A 1ZGLB 3VD3A 4PP2A 2VISA 2VH5L 4ZUVA 2DF3A 5D7SH 2EDEA 3MRCA 5A2LH 3IDJB 4TUKH 1MCLA 3DVFA 3ZSTA 1PSKH 4C4KO 3GSQA 2EC8A 3NGBC 2BNRB 1KTRL 2VL5B 1B9ZA 4NZTL 1OAUL 4TPRH 3TO4C 1JFQL 1FL3B 3LKSA 1XCQA 2YXMA 1U95B 3IT8D 2ZUUA 4RQQB 1GVIA 3L7EA 3H9ZA 3QIBC 1HCFX 3OKEA 3T65B 1MEXL 3CK0L 4L5FH 1PG7W 4JDVB 4NC1E 3GSOA 3D5OF 2BSED 3ARSA 5HHOB 3OBAA 5I30H 2BVYA 3SDDA 1MHHA 3CFJB 4H20H 1ADQL 1UB5A 4XPAL 4WJ5B 4HK0A 5LBSH 4DOHE 2OTWB 1YECL 4FHBD 2BNQB 3PWLB 1BOGA 2CDEA 2XACC 5CP3A 3BYTA 5K59F 4WCYL 2VDPL 1EEYB 3WNPA 4PV9A 2IBZY 1NAMB 1S8DA 4PG2A 1XGTA 4QGYA 3FTGB 2EYRB 1PKOA 3GZKA 1HHIA 1HH6B 3QJFB 1HQ4A 4R7NB 3VE0B 3LH2H 3MLSL 5KSBA 3STZA 4MNGA 4URTB 5D2LB 3SO5A 3FT2A 4RWHA 2E9JA 3TF7C 1OD9A 1WBXB 4XWOD 4G6AC 1KFAL 2X7LB 5KAQF 2WWMC 3CPLB 3B9KA 2HLAA 3FB8B 4GW4B 3O2VL 4NJ9L 4WO4D 3ZDYF 4CNIA 1QSEE 1MQ8A 4YPGA 1TJGL 2NY3D 3FQRA 2WUCH 5HYSA 4I5BB 3QUKA 4XZUB 1A7RL 4GQ9H 5GQBA 4OGAD 4ONOA 4PJEA 2ED9A 1CLOL 3MRQB 3ZYOA 3X12B 5I1CH 1OP9A 4G8EB 3PWPE 3OJDB 1LP9E 5AWNH 4KMTH 4WWID 3A0OA 1R3KA 4O5LL 4OD1L 3V4PH 1NC2B 3CC5A 1EXUA 4ONHB 2BSSB 4WDIB 4H88L 1CD9B 4Y19D 4UILH 3IJHA 4H25A 3F7RA 4K07A 3DECA 3KWWA 4XWOC 4NUJA 1ND0B 3TBTA 1MF2H 4KQ4L 4Z7WB 4GRWE 4G6JH 4Z7UF 2B20A 3MJ6A 5D7JC 2XG4A 1ZXQA 3GMLB 4M93B 2VC2H 1QSED 1UKTA 4ZS7H 1E4XH 4PG9A 4NKQB 5I8OL 3QAZC 3LQAH 4HQQL 4JPKL 5IB3B 4OFPA 1PKQB 1KCKA 4Y5XC 4KZEH 2FEDC 2YPVL 1GZQA 4X6CF 5C09A 3RDTB 5C08A 3VD7A 1NGXA 4GAJH 4GXUN 3QXAA 5DJYA 3FQTB 2DLGA 4PJXF 5IK3A 2P47B 1S7TA 1RK0B 5L88L 4RGNB 5IMKB 5E9DD 3SDXE 1E27A 3TJHC 1T83A 4L4TD 5D2LF 3QUXD 3T3PF 3PDOA 5DD5H 3P73A 5JOPE 2ATKB 4MNQA 5MEOA 2D9CA 4U1HB 4U49A 3P9WB 2D9QB 4G8GB 3QFJD 1W8OA 4XCEA 1F13A 3HFMH 4CVZA 4ERSL 5I1JH 4AK1A 5CWSB 4Y16A 3WL9A 2BSSA 5EO0B 3V8CA 2FX8H 4JM2D 5T1KD 2VE6B 2JB5H 4KKNA 3U1SL 4QHUB 1NKRA 1Q72L 1XF1A 5CEXB 4HJJH 4GRLA 4LCIL 3RTQC 3BIAX 5E8OA 3GIZL 3GNML 2JJSC 1DBJL 2IAND 4Y5YB 1BJMA 3FCTA 5D7KE 5EOCJ 3BD4A 5DR5L 3QISA 5C0EB 4F9LA 2B2XH 3CDCA 1LWRA 1CDHA 4OKDA 5GS0C 3AUVA 5EOTB 2PF6A 5DC4B 5IMLA 3VMNA 4UDUA 2AEQL 1HQRA 3PDOB 3QUZD 3KPSA 2BVPB 2QR0A 4LVNB 2DLIA 4C55A 5LWYH 3UBXA 3FQTA 4XVTH 2K7PA 4G9FD 1V05A 4ELKA 4JCLA 3H7BA 3IDXH 3GJEA 2AVGA 4S0SD 3ARFD 3BKYH 4K2UH 4X98A 2VLKD 2NY5C 4L1DA 3CDGB 4UAOB 1OLLA 4NQCE 1B4JL 4M5ZH 1J1XL 4GKNA 3IJYB 4HS3A 3X13B 3AS0A 3VGAC 3SDDB 3CGTA 1DQJB 5IUSA 4XXCA 2ICWI 3G6JB 3IVKA 3W9DA 2BXZA 2AK1L 4JR9H 4L9LB 4PJCE 5J7CC 3C2AH 4CAGA 4KTYA 2X05A 3IFOB 1AGEB 1C16B 4ELME 4ZAKD 4NP4H 4UDUB 4ZNEE 1RJCA 1P2CA 3ZDZF 5KVDH 5DD3L 1CDCA 3F6IA 1NLBL 5FXCH 2VDMH 4R7NA 1A6UH 5ID1B 1AQKL 3FOMA 3B3IA 5CCKH 4LCCC 2O5ZH 4X0KA 4S1DD 1J86A 1IARB 1YYML 3EDDA 2Y06H 1AD9A 5D9SB 1D9KB 1CK0L 1MCKA 2MMXA 5A40E 3RWFB 1FYTD 1Z2KA 3UTTD 5JHLH 1G7QA 4OGXL 3MMEA 1IC1A 4IDJL 4EBQL 2W0KA 1HZHL 2Q7YB 4G8IA 4BSWB 1A1OA 2NY0C 3CXHJ 1Q94B 3MNWB 3EO0A 1FFPB 5J8OA 4WENB 2NY6B 1HOCB 5ITBL 1OGAB 5KSVB 5EPMA 3OKKB 5IF0A 4RIRB 4Z0BH 4F58H 1HHGB 5J13B 3O9WB 4LLWB 3TVMC 4KROC 4NWTH 3ZTJH 1CE1L 2ZG1A 2VL4A 4OM0L 1KJ3L 3EYVA 5KG9A 4LP4A 3RX7A 4AQ1B 4JG0H 5GGTH 4QRPA 3R4DA 5GGVL 3D0LA 2R9HC 4BFIB 2HJLA 3VFGL 4LIQE 2CKNA 3AREA 2D7TL 1SMAA 2JJUA 4KGLA 2RHEA 5KJRH 5DRWB 3C9NB 2NX5B 3HRZA 2J7LA 2IFFL 2AV7B 2C3VB 1P4BH 2VISB 3GI8L 4PJ5E 2JCCE 2JE8A 3ES6B 2DD8L 2OQJB 3HE6D 3KHQA 4GKSA 5EOCL 5K9OB 1JZ2A 1E4JA 5FEBA 2IH3B 4OZFH 2WUBH 1A1OB 2PXYD 1UWXH 1OTTD 3GHEL 3HC4H 3TFKC 1IEAA 2Z8WC 2A74A 1XCQB 2QEJA 1SVCP 5BVPH 5HDQL 3WJLC 4PJ9A 1KJVB 4MXQD 3L5XH 1ZWIA 4Y4HC 3QUML 3O8XC 1MHPH 1RHHB 2APXA 1IVLA 4MLSA 2IALB 3P4LA 4FQXB 1TETH 3QWOB 4S11A 1N8ZA 4Y1AE 1HYSC 3F7VB 3VFTB 4XVTL 1MHEA 5I8EB 1BZ7B 3W5NA 5E1AA 1TDQA 2HRPL 1I7ZA 1UENA 1B0RB 1BFTA 4R7DB 4QRUB 4U6YB 1CQYA 5SWZE 5JR1L 1AXSB 1UEMA 2JK5B 4O58L 4G9FA 1K3ZA 3TN0C 4XBPA 4NSKB 2JTDA 3SGEI 3IDYC 3D18B 2M26A 4JY5L 1NGPH 4LLDB 1R3LB 2E3VA 4RX4D 3HMWL 1RZIB 5JZ7C 5MI0B 4GW1B 1JGLH 3CJJA 1MQKH 1EEZA 1PGRB 4LPYA 4YHPA 4NHCH 4HG4K 3E0GA 2AI0L 1IGIL 3ILPA 2BJMH 5GGVY 1IBGL 3KPNB 2AK4E 4KDWA 4IMLB 5DUML 4EKXA 1NH6A 3MREB 4DGIL 3VJ6A 3WDJA 4XMPH 2XQBL 4F3FA 4X98B 2WWKO 5FUZH 2UZYB 5DUBA 4R3SB 4LIQH 4DUVA 3U4EA 1ADQA 4Y4KC 5ESQB 1ZSDB 1HEZA 2GSGB 4UOW0 3WMSA 4I3RH 4OAWB 3HZYB 3WXVL 4OKVB 3KLAA 1MFEL 3KPQB 5ISZD 1LDPH 3PWVA 3H0TB 1LMKA 1CFSB 3LAFA 5C0IB 2RBLA 3QIWA 3QDMB 4OFYA 4F2MB 4MNQE 4JY4B 5FB8A 2I9LA 1R5WB 3EJZC 4PYHA 5I76A 1Z9OA 4P9HH 4GW1A 4JHZA 4Z78A 4XP9L 4UDTA 3C6LB 4G6ML 2XY2A 1JWMA 4C4KT 1D5MB 4ETQB 1R3LA 1TZGH 2FRGP 1XT5A 3F7YA 3KYOB 5DGQA 2CKBA 2C26A 3SE3C 2XWBA 3QG6B 2W59A 4DKDC 3CX5K 4O4YH 1JNNH 2OJZH 2CXGA 1ES0A 1EZVX 1HWGB 5KZCB 1EEUA 1PZ5B 3RPKA 3GJFA 4XHQA 4XGZA 3UTTE 5GRVK 3ULSB 4MB4A 4GXVH 5DR5H 3BPCB 5DEZA 4OZIB 1IM9A 3U0TA 2X9WA 3ECBA 1ZT1A 1B0GB 4XP4L 3MRRA 3STBA 4XCCL 1JHKL 1K8IA 4JJ5B 4ZUTB 3EDJA 1YDPA 3BP5A 4RIRA 3DX8B 3CFKA 4Y19A 4U1MB 3VXQA 5IJVB 5I30L 3S98A 3HZVB 4GXVL 2DIBA 3UYRH 4JREB 5C07A 1NCUA 2AJZA 4PJ7A 3WNMA 3EOTL 3JZ7A 3HG1B 1UM5L 1CFTA 4G5ZH 4FTVB 4N8CH 3PHOB 5GGTL 1T21A 4JKLA 3MV8B 3IS1X 5EB9A 1RZFH 4PJEE 4Y2DC 1I9EA 4BFIA 4IBLT 4F7TA 2CUIA 1HWHB 1T1WB 5HD8D 2NNAB 3RVVD 3C9NA 3ZE0E 2PKDA 2YA0A 4HFWA 3NTCL 4OFDA 2E27H 1II4E 4H26A 1WFNA 4L3CA 4D94A 5KANI 1PG7L 4KXZI 4DN3H 3UDWC 1KUMA 4MJ5B 5GSVB 4FQHA 1ONQA 4NRXB 4UTBH 1RULL 5D5MF 2C5DC 4KK5C 5E99L 2DQUL 3PL6D 4JZJB 5I1AA 1BREA 5HY9B 3ARDA 2AEPL 3WFDL 4J12A 3WXVH 4I0KA 4HWEH 3LPGA 4LHUD 4I8DA 1I85C 4DKFH 5JQ6H 2O5ZL 4OCSH 3KYKH 5FHAL 1QEWA 3RKDD 2ZG2A 4D0CA 1RUKL 2PO6A 2V2WA 5BOPA 3TBVA 5ERWA 2NTSP 3OR7B 3CXHK 5D7IB 1F3JA 1ZA6B 4JB9H 2EDRA 1IGIH 1RK1B 4OD1H 1NKOA 5TDNB 1I1CA 3EYFB 1YJDL 1BVZA 2AJ3A 4EIGB 5E5UB 3EFDH 3ILQD 2W92A 4Y5XB 3T0EE 1GSMA 1KTLA 5IBLC 3UMTA 4NHUA 4EN3B 4LU5H 2QQNH 4NPYA 1S7XB 3LMJL 2HMIC 4YXKL 2F54D 3MRLA 5EC2A 1AQDA 1YQVL 1XCTA 1MLCA 3EJYC 4K9EC 3QI9D 2VXSL 5FA4B 1FDLL 1JWSA 2D4DA 4MQXD 4HPOH 4WEMB 3VJ6B 4R2GC 3U7YL 3MOBL 1XR9A 5AAMA 4IIQB 4OCWL 3T4AA 3VD5A 1V3LA 3OR6A 4M02A 4RAVB 5EDXA 3OKNB 4OF5A 1X4ZA 3RVTD 4NQXB 1AO7D 2JJSA 2J6EL 4OTXH 3KLHC 5C0ND 4OV6F 5FV2A 3UBXG 5IFAH 5C92A 4XCEB 1F6AA 3H3PH 4MSWA 4QRRB 3GFUA 4N8VB 1UQSB 4UBDC 3TVMD 3MX0A 5C9JA 1M7XA 4QXTA 2GHWB 5TDNA 2AERT 5IMLB 4OJFL 1F5WA 5C3LD 2XFXB 1LD9A 3SGDI 3I02A 3PGDB 3J8F7 3S88H 3SKJL 1J1OH 5D6DA 4NN7C 1W72H 4ZTPL 3LN5B 2WBKA 2YRPA 3Q5OA 4M9OA 8FABB 4XCCH 2P8PA 1BPVA 2I07B 3DV4B 3KJ4B 2BNRA 1T4KA 1DL7L 4G9DA 2XWBB 3CXDL 3QG6A 2MCG1 3FQXA 3NCYS 4P9MH 3QIBB 1FAKT 3VDAA 1CG9A 1BVLA 2DTML 3BDYH 1A7QH 2YD8A 1ORQA 3CDYA 1A8JH 4ONFH 3HCVA 3RGVB 1CIDA 3GMOA 5CEZH 5AD0A 4PJIE 4IS6A 3P4MB 2XKNA 1YEEL 2UZIH 2DDQH 3MRRB 4LSQH 3VA6A 2XNAB 3CFDB 4UQ2B 2YKLH 1OAZH 1SEQL 5D1ZD 4WEBL 3NZ8A 4LSTL 1AGBB 3AM8A 1KT2A 5T3XH 1NGXB 4KJQC 1D3CA 3H7LA 1IMHC 2F74B 4YWGH 5INCA 4HWZA 3PHOA 4JQIL 1YPZE 1CXHA 1P7KB 1J1PH 2OP4H 4K71C 3FFCA 4P5TD 5EIIA 2QQNL 1BLNA 2X1OA 1FFNB 5LGHL 4A6YA 1QRNA 2GJZA 3QPXH 4HJGB 5D2NA 1C12B 3MLPA 1VEMA 3CFKB 4YHYC </