1FH5L

Crystal structure of the fab fragment of the monoclonal antibody mak33
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
213
structure length
213
Chain Sequence
DIVLTQSPATLSVTPGESVSLSCRASQSISNNLHWYQQKSHESPRLLIKYASQSISGIPSRFSGSGSGTDFTLSINSVETEDFGMYYCQQSNSWPLTFGAGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MONOCLONAL ANTIBODY MAK33
publication title The crystal structure of the fab fragment of the monoclonal antibody MAK33. Implications for folding and interaction with the chaperone bip.
pubmed doi rcsb
molecule tags Immune system
total genus 45
structure length 213
sequence length 213
ec nomenclature
pdb deposition date 2000-07-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1fh5L02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1fh5L01
5FDYA 1OD7A 4YHNB 5D7IE 4OCYL 3SKNB 4YC2B 4ACPA 3SOBL 5GS0H 2AI0L 4EIGB 5EIIA 2P5WA 3NN8B 1DDHB 2NY3D 5HVFB 5HGAA 2JIXD 2VLKD 1HKFA 1OAZL 3FAXA 1IC7H 5DR5H 5C0IB 3B5GA 2DM7A 3WFCL 4JE4B 3DBXA 4MA8H 4O5LH 1UEYA 3FTGB 4CJ1A 1U8MA 1QRNB 1BLNA 4P59H 5FGSA 1OD9A 4XWGH 5GZND 4JM2F 1DJSA 3EJYC 3FMGL 2Q6WA 1G6RB 1HYSD 4Q2ZB 2FX8L 1F42A 2YA1A 2GJZB 3FT2B 3OKNB 1D3CA 2RCSL 3QWOB 1RHHA 4QXTA 3R1GL 1V3LA 1LE5A 1JNHB 4LLMA 3NCEB 4G6FD 5I74C 5I76A 2ICWB 2P1YA 3O4LD 3IAQA 1KGCD 2VLJE 1UCTA 2NX5A 3OZ9H 3VFPA 3S3JA 2FZ3B 4E42A 1OAYH 1JYXA 1U8QB 3ARPA 1D5ZA 5EU5A 5E1AB 4JN1L 4EKXA 3MNVA 1OTTD 1L0XA 4GG8B 4IS6A 2CKNA 1GGTA 2DI8A 2V5MA 4WW2A 3ZKXC 4WGVB 3LKPA 1NUNB 4C56B 1CLYL 3MLWH 1Z9LA 3QPQC 5FA4A 4ODUA 2R4SL 5F96L 4H26A 1RFDH 4Z0XB 1ROWA 1H8NA 4G6AD 1U8IA 2I07A 1NH6A 2DAVA 2NLJB 1U8LA 4FG6D 4PJ8C 3RVWD 5IR1A 5K59F 1L9NA 1P4IH 2DQDL 2WM0A 4QRPB 4L8DA 1I85C 5JUEH 5A3IC 4P3CL 3MV9A 3NGBB 2AS5M 2EIZA 1JI2A 1E6JL 4Y1AA 3EGSB 2PYFA 4UQ3A 1B4JL 4OFIA 1IILE 4XCNA 3E2HC 3EYUH 3CX2A 2N4IA 4BK5A 4GFTB 1IC5L 4QRSB 3B9VA 4NP4H 4FQQA 4CMMB 4L1DA 4IRSA 1RZJL 3O3DB 4NFCA 1FO0A 5JHLH 3MUGA 2OM5A 4R4BB 3HNTH 4UDUB 5HYJD 4S1RL 1WVZA 3TH4T 4N90E 2EDWA 1SJXA 1B0RB 2RQ8A 2Z8SA 3ME0A 1MRFH 3QXAB 4QRUB 3BPCA 5CJ5A 4Y5XB 3ZO0A 2PW2A 5IMMB 5IG7B 3HE7C 3OL2A 5FDWA 2B1AH 2P5ED 1EXUB 35C8H 3EO9L 4F9LA 1S7XA 2MMXA 3RWEB 4HHAA 1JZ3A 4HUKB 2Y7QB 3VD7A 2D4DA 2CUHA 2HT3D 4BUGA 2DJ4A 5IOPB 2V2WA 1OP5K 1Y0LA 4JJ5A 2YWZA 4PRPB 3SDAB 1LILA 3H9YA 4PB0L 2LE9A 5A2JH 4BA8A 2HMID 1T04A 4JDZA 3U7WL 1IL1A 3V6FA 4L9DA 1FDLL 1MFEH 5EU3A 4Z78A 1OTSC 4LSQL 5EU6E 1G9MC 2VAAA 5IT2L 1UWXH 4KKNA 1Z2KA 2FHBA 2IFFL 4IRJB 2NY0C 5D1QC 4MCZA 4RCAA 2FHFA 5DK0B 4ZQKA 1OOAA 5GJTL 4XPAH 4QRRB 1A9EB 3FFCB 4LCWE 3MV8A 5SWSB 3W9EA 4OGXH 5E2TH 3EYSH 1GGUA 5GRYA 5GGRY 2E9WA 2ED7A 3RAJH 3G6AA 5HGBA 3FT4A 1GGIH 2H1PL 5EZIH 5F7HA 1D5MB 2XZCH 1UENA 5DEFB 4MDJA 3UPRB 4M4PA 3CZFB 3KYAA 5IJVB 3QDGE 4HCRL 3TPUB 5FYJD 2F5AH 4HK3N 1JTPA 5CGMA 1T20A 5I6XC 5F8RC 3RIAK 1HXMB 2ADJB 5JO5B 4JRXB 3FFDA 1H5BB 5ALBH 3VFTB 4OFDA 5A2LH 1FZJA 1NDMB 2X89D 1KJ2L 5K9QI 3KYMB 4PJGB 3VXUB 4YK4B 4E5XA 3S88L 4NQVA 3JTTA 3H7BA 2E9IA 3DVIA 4KC3B 3DVGB 5AG9A 2W60A 4XMKH 1L7IL 2ZPKL 4KKBD 4ZUUB 3AU1B 2V6HA 5FO8A 1AO7D 4NKDA 1MFBL 3VMNA 4JHZA 5I8KL 3V0WH 1NSNH 4DEPB 5C07B 3VXSD 1A0QL 4JDVB 3DOSA 5DK3A 1A7OH 5DFTA 2H6PA 2CH8A 5KJRL 4LSVL 1J9CT 3QDMB 1K85A 1F11A 3RTQC 1OGAD 3OXRB 1PDKA 5EBWA 4QF1A 4XCYA 3L3JA 1CQYA 1MWAB 2W9DL 4G9FB 1ORQA 3EZJB 3O9WA 3CIQA 3RY4A 4RFNB 3MRFB 3IAGC 2BJMH 3VXME 1J0JA 3TT3H 5F9JA 4HFUH 5IV2B 2EYRB 3BZFB 1A4KA 3QZWB 4HPOL 4BFIB 1R3JA 1KXQE 2F58L 3T0EE 3O3AB 4R8WL 2W65B 3PHQA 4OLWH 5IB4A 5INCA 1P6FA 2AXFA 1IC4L 4LRNL 3NA9L 3QULB 5MEND 4JREB 3M07A 3QO0B 1EJOL 2YK1L 4NM8L 1U3HC 3EYOA 3QB7C 4GRLD 5CLWA 4AH2A 3AY4A 4PJ5A 1U2CA 3BH9A 3VGFA 1EVUA 3VFGL 3ZE0E 5HDOA 4X7EC 1P7KA 3P9WB 4F57L 3ULVL 4MX7A 2H2SD 3RZCD 4OZ4B 4YHYB 2DTSA 1GZPA 3Q2CA 3VWJC 1I8KB 3IDJB 4OLUL 4PP2B 4TUKH 5IW1B 1YN6B 1N7ML 1MJJA 1JTOA 4KROB 4XAWH 4PJCB 2ERJB 5T1DH 3L95A 1URLA 5D2NA 4MMZC 4K9EC 5DUBB 5BZWA 2QBWA 3BDYL 5CD3A 3MRDB 2OTUA 5F71A 1IGJB 1DUYB 4NQCA 5E99L 3OKKA 5IBTL 2EYSB 3OGCB 3QO1B 4X6BB 5A1AA 1NGYA 4UU9B 4DOHE 3K7UA 3DVNA 3MV7D 1WBYB 4H1LA 1MHPL 4JG0L 1OAKL 2QJDA 3DPBA 5JOPE 3DURA 4DCQA 1KTKE 1MHCA 1DQLL 1W72B 5BJTA 2QSCL 5IFHL 3S36X 4GAFB 2EH8L 3QUXC 4PJFE 2ZOKB 1GHFH 2DRUA 4I5BB 1MF2H 3GSXB 1BHGA 1ZLUH 3UTTE 4GG6F 5T1MB 5E4EC 4JFHE 3W0WD 1A14L 1JGEB 1YYLH 2FDBP 5ALCH 2DQFB 4BH7A 4FQJL 2AEWA 2DIAA 1E27A 1PG7W 3PV6B 2VZUA 3GDBA 3MR9B 4BSJA 3BEWA 1J5OL 1RK0B 1HN1A 1CDIA 1AGCB 2DQUH 5K93A 3MACH 1LO3H 4N1EA 5F7DA 1OWRM 1A7BA 3S5LA 2XZAL 3DIFB 4LPWA 2A38A 3C8KB 3DNKA 3VDAA 1KULA 4Y4KC 4PJDA 3TPKA 4GW5B 2IQ9L 1HHKA 1GZQB 4LGPB 5T33H 3WS6C 1E6OH 4Y4HB 4HV8B 1AKJD 3QA3A 4K9EH 1KFAH 4OCWH 5ICXA 5B21A 3GMMB 4DZ8A 2NCMA 2E6PA 3QG7L 4WFFE 2YD5A 3CFJA 1R0AL 3VD3A 2IBZY 5DA0B 3DROA 1MFCH 1A6WL 4Z5RA 1FQ9C 5MERB 1QFWL 4LSUH 2OCFD 1J8HE 1CZ8L 1SM3H 1U8PB 4H20H 5SV3A 2VWEE 5T1LB 5TFSL 3VXPA 2WQRA 3GBNL 2YR3A 2PNDA 1GGYA 1CBVL 3L3IB 4U6TA 3VI4F 2KZ1B 4MAYC 5HHOB 3Q6FA 4C59B 4Z76B 4M62L 4YO0B 2OSLA 4MDIA 3PL6B 3IDIA 5AYUH 4Y5YC 5J56B 1YC8A 2GKIA 3IU3A 4QRTA 1KPRB 4NQEA 1GVIA 3P73A 1YJDH 2H32B 5EBLB 3QXTA 2GAZB 3UZVB 1D5XB 4XPFL 3OJDA 3NZ8A 1Z9SA 3X13B 2IADA 2CR6A 3F7VA 4UOW0 2BVTA 1CFNA 2AJYL 3G5YB 4QTIH 2ICES 5ACZA 3MRNA 4X7DC 5GS1B 4GMTL 4NQSB 1BQHA 4RZCB 1XCQA 3U0WL 2A74A 1P9MC 3TIDA 2FEDC 2A83B 3NIFF 5HI3C 4Z8FH 1T1YB 4FQXB 5KSUB 5I66A 5E08H 1N4XH 3VGDA 1N5YL 4K7PL 4L4TD 2V2XB 3VFWB 1EZVY 4PGCA 3LKSA 2A6JB 4J3TA 4M1CC 1WJ3A 1UVQB 4AZ8A 2LVEA 1QYGL 4KK8D 4EUPB 1A4JB 2P8LA 4HWBA 1RUKL 4YX2H 4P2RE 2GITB 5D4QA 2DJUA 4WDIA 4ETYA 1CQKA 3ES6A 4ZUTB 4X7SH 1G7JB 3UTQA 3BD5A 4X6EA 3TNMA 1VA9A 2HTLC 2MHAB 2VXSL 1WK0A 5JLZB 1I8IA 3I6LD 4ZO8A 2P45B 3GMNA 2HFGL 5DZLA 3FCTB 3OGOE 2HFFB 3MYJA 4ELME 4ZO6A 3ULUL 4RFEA 3C6SB 4GAYA 4N0FB 2NTSP 3MLZL 4YHPB 4XMLL 3K2UL 4KI5F 8FABB 5GSVA 5CIPA 4U0QB 1WUNT 1J1XL 3IB4A 5INDB 4WCYH 5K33A 2BVQB 1BVKA 3MRBA 3RVTD 5J6HA 5AZEH 3NPZB 1AFVH 3QUML 2G60H 1DLFH 2Y5TA 3QEGL 1EO8L 3VW3H 2XQBL 4GBXD 3TGXA 4X8XA 4JRYA 3Q5YA 4OLYL 2J8HA 4I3RL 3RDTD 1FNGB 1NFDA 4MA7H 3SHSA 5DMKA 1G7IA 3CH1B 3NABL 4QT5A 5DHVA 5FYJH 1IMHC 4HH8A 3W2DL 3N1QC 5CJQH 3L3OB 5IVXB 5DURB 4AQ1B 4YIQA 3UTOA 3IXTA 2VLJB 4HG4K 3HZVA 4KTEL 4DGVL 4JDTH 3BW9A 1R3IL 3EYQC 1K2DA 3VDCA 1MRDH 1N5AA 4P2QD 3QIWB 3IJHB 1JN6B 3O81A 2H8PA 3BO8A 1EAPB 3HC0A 2GCYA 2A9NL 1V8HA 3GHEH 4GRWH 1DE4A 4R2GC 2ICCA 3WJLC 2X41A 3SKMB 1YYMH 4HF5H 4UT6H 1WEJH 2Q7NA 3ZZ1A 1YMME 3MFFA 5GGSB 1RIUH 3CMOL 1HCVA 1NMAL 1JWUB 4U6VL 5I1KL 3IDXH 4FMFA 4PJ7B 4GKZB 5GGQL 2DL9A 4DTGH 4X5XA 5D7JD 3EDFA 1FL6A 2XFXB 4EDWH 3HCVB 4EOWL 4YDKH 5CMAA 2EDRA 4HW6A 1QLEH 4ODWB 3QUMB 1FGNH 2A1WH 1A1MA 1TCRB 1XGQB 4JCMA 4D94A 1ZEAH 3FONB 1ZVYA 4NKMB 3LPGA 3HI5L 1K9TA 4M7JH 3MRJA 2HN7B 3KPMB 1OSZA 2AEQH 4CDHA 5L9DL 1C5CL 4KHXH 2Z4QA 3KPOB 5DD0H 4JN2B 2OX5A 2X44D 2FO4A 3V52H 4KKLC 3W9DB 3TT1H 1MREL 2EIEA 1HH9A 4IOIA 4EN3C 1BQLL 4I48B 1YY8A 2NXYC 3EKCA 4I0PA 4OGAC 1EFXB 5GGTA 5FYJU 5EZLA 2P8MA 4BUHA 3R8BB 2FYYA 3VCLB 1HQRA 4ZXBD 3ZT7A 2OBGA 1TQBB 3AROA 1VADB 2EKJA 2X4SA 4NZJA 3QT2A 4YDLC 5I1JH 3MLTA 5IB2A 2XTJC 4HLZG 2D7TL 3QAZB 4CADB 2HFEB 4L8SC 2EDJA 3UTSE 4MJIB 1GC1H 3NCJH 1VACA 3ARUA 3JV6A 2Z31B 4YXKH 1ZA3B 1MH5A 1A21A 4R4FH 3KVQA 3KXFA 5D6CB 1U0QA 4PJHE 3QIBB 3FO2B 5IHBA 3HE7A 3FQWA 1EHNA 1NLBL 2KDGA 1XGRA 4HGKC 1QSZA 4XVSH 2UY7A 4R0LC 1N59A 5EU7C 4PLJD 1TZIB 4MA1C 5E5MB 1S8DB 5D2LA 1FNSL 2ARJQ 2ILLA 3OKMB 5C0CD 3DXAA 2QKIA 2ZCKH 1MJUH 4WI5A 1G0DA 3DMMC 4APQD 4GAJL 2PW1B 5F3BA 5BS0D 4Z0BL 1TZGL 3O0RL 4LIQE 4EIZC 3PWUA 3BRGC 3IFNH 4LNRB 4RQQA 4RGNE 3P4OB 5E94B 1HHHB 5L2JA 1NMBH 5L2KD 3D39A 2E27H 3EYVB 5D1QA 3ARZA 4WO4C 4WI2A 1FAIL 3BJLA 4ORGA 2VRAA 5FHBH 5CZVH 3ZHDA 4UINH 4NBYB 4H1LG 4WWKD 1VFAA 4B7IA 3RGHA 3BPNC 4HK3J 5HVHC 4G3YH 5FM5M 4TSAH 3HE6A 4DAGH 4Q9RL 4QHLB 2CGRH 2H41A 2NX5E 4BQ6A 1A5FH 4U1IB 4B5EA 1BECA 3IYLW 3MLPA 1VFMA 1UWGH 5F1OB 5CCKH 3B2VH 4FFVC 3MBEB 1C16B 2EEAA 3JV0A 1ORSB 3AAZA 3GSNB 3G5VA 3RFZC 3GMQB 4JHWL 4WNQA 3WFEH 1RULH 3LIZH 3T4AA 4TPRH 4XPBL 3DGGB 5IB1B 3DX8A 1I3VA 5GS2D 3S5LG 4G5ZL 4X8JA 2IH3B 3V5KA 2EE2A 3MV9E 3N0PB 4JFZH 2SEBB 3WLWD 1I7ZB 3JV4A 1UXSB 4Y1AE 5ISZB 4Z77B 3FQXB 2Y6SC 3TBTA 5JA8B 1JWMB 3E6HB 3OPZH 2DJSA 3O6LL 4KUZL 5DTFB 3R06A 5BV7B 5IMLA 1IAIL 2GI7A 3FQRA 4HIIB 4NFBA 1MCIA 4NJAH 4X5LA 1CFQB 2CK0H 2V5RA 3MA7B 2AEIT 2AW2A 3K4AA 1EGJA 3H42H 2F5BL 3BP5A 4JFQA 5KSAB 3RWCA 2D9QB 1K8IA 4UMGA 1RY7B 1A3QA 4C56D 4YWGH 5IMKB 2KKQA 4PRBA 2V7HB 4XI5C 2XG5A 4HXBH 3RL1A 3AUVA 1ZTXL 1FIGH 4FQPA 1BX2A 5FCSH 5JA9A 1BEYH 2VYRE 2AK4A 3MMEB 4NKOA 3RVVC 4JPIB 3M1BB 2P7TA 2DQIH 3IDYB 4QRPD 1XGYH 4D9LL 4DKAA 4GW4A 4IHOB 3MXWL 1YPZA 2Y5EA 5I17A 1LDSA 1OWWA 4JPKL 5HI4D 3P9LA 1RV6X 1DLHA 4NYLA 4TNVK 2FECI 5EUKA 1ZHKA 3U1SL 5IHLB 4ZYKB 2IPKA 4P4KD 1NCNA 1RUAL 4DZBB 2DWEA 3BQUC 1XEDA 5HHMB 2ENYA 5IIEB 2PXYB 4PLKD 3MJ6A 1Q72H 2VXVH 1BQHG 4U1LA 2APWA 1BGXH 4KQ3H 1G0YR 3VWJA 5I1AA 3T3PF 4Z7QE 4ODSL 2D03H 5IVZA 1A2YB 4ZAKB 3I6KB 4C54A 1WT5A 1WZLA 2FD6H 4L3CB 5EPMB 5T3ZL 4PJ9C 2WUBH 2R1WB 4FQ1L 5E9DA 1JBJA 3QNYA 4XHJC 2DWDB 3AREB 1NAMB 3H9HA 3MV8E 5DWUL 1G9NL 4QXUH 1O0VA 1CF8H 1CGVA 1DSFH 3L7EB 3C9NA 2ZZUT 1II4E 1FPTL 1SJVA 5E2WL 5CSGA 3MOAL 2AJSL 4J6RL 3VXRB 3VI3E 1ETZB 1JPSL 4M7ZC 1X5ZA 2ITCB 2WIMA 2FL5B 2XG4A 5D7KE 5K9KA 4OZFH 4PRPD 3SDAD 4ZG1A 1YN7A 5E6IB 3ARFB 4LLYA 1AH1A 3QUXA 2ITDA 5T1KB 2QR0B 4JPWH 5IQ7L 4Y8AA 3GGWA 5DF0A 1J7VR 3P4NA 4YDVA 5GRJH 3PDDA 2FSEB 3OSKA 5HYFA 4NBXB 3SQOH 3OAUL 4RA0C 5JDSB 1XGUA 2IFGA 3CZJA 4U1HB 5DJ6A 5EO9B 4ZDHA 4IRJD 5F6IB 1OW0C 1AIFA 3CDGA 3REWB 1UJ3A 1I9IL 3DX7B 5JHDA 4MXVE 2BC4B 1NBZA 1C5DB 2EDKA 4QRRD 1HHGA 4UNVA 1OGTB 3FFCD 4KMQA 5CZXC 5SWSD 4TQEH 2F74B 3I75A 2HJKA 4LF3A 3TO4D 1OT1A 2DI9A 3QH3A 1KENH 4NO3A 4Y4KA 2EH7H 1TVDA 3TA3B 3WNNA 3UJIL 3WS6A 3V4UH 1JPTL 3EYFB 5KANI 4I0CC 3PV7A 3S37H 2FX7H 4KJPC 4O4YL 4K3JH 4RMQA 2XZQL 4NZUH 3PE9A 3NVQA 3MNWA 1K8DB 1HH6B 3BEVA 1Q0XH 4R3SA 1ZT7B 4RGOH 4U7KA 1TTUA 3WXVL 4YLQT 2F15A 1ZK9A 1YY9C 3OKDB 3MUHL 1NFKA 3VXUD 1D9KC 3H8NA 3BT2L 5D71H 2CSPA 1F3RB 1MCEA 3HI6H 1JHKH 3BXNA 4MAYA 4TRPH 5EZOH 2WP3T 3PJSA 4FQLH 3R4DA 3F7RA 4WU5B 2XYCA 2MKLC 1RZKL 4AEFA 5I9QC 4EI5C 1HK6A 1K4CB 5JR1H 3PG2A 4Y5YA 1I1FB 4LPXA 4P3DB 5C07D 3TEUA 3LB6C 1FV1B 2P43B 3HPJA 1VFBA 4PJ5E 3QDMD 3C5ZC 4JM4L 2HKFH 4X9HA 4L29A 5DRNA 3BHBB 4JCLA 4LPUA 4RMUA 1B0GB 5L88L 3WFHA 3IFLH 4G9FD 4IIQB 1XGPA 4NN7B 3RNKA 3VG9B 1E4WH 3IKKA 1X5LA 3CFDB 4Y0GA 1VEPA 1A6PA 2ATPA 15C8L 4UV4L 2CDEB 4P2RB 1YEIH 4K8RD 1QPPA 5E4IA 5D8JL 5D2NE 3GIVA 1FHGA 1TETL 3QI9C 4NQCE 5CAYB 1FC1A 3SGDI 4XBGA 2ZSWB 2XT1B 4N0CD 3CLEH 4ELMB 1IGMH 3WFBL 2DICA 3BD3A 4MA3A 3QIUB 3UO1L 1PLGL 3CNKA 5TH2B 1JWSA 3BWAA 1R3LA 5LGJB 1P4BH 2Z92A 2EXYC 5JW4R 3K3QA 4UBDD 1H9VA 1S7TB 1U95A 2CMRL 3MLSH 2K7PA 3BSZL 3GIZL 2AJVH 1VGEL 2DD8H 1XF5A 3S96A 3A0OA 5KSVB 3IJSB 3EDEA 3C5SB 4U1MB 3SDYL 4BQ9A 4OD3L 1M6OA 4ISVA 4KROD 4LCYB 3ZDXF 4G8GA 1OLLA 1RK1B 2FJHB 1GRWA 4N9GB 4XNYH 5ETUA 3GI8L 1L6ZA 2LQRA 5EUOF 2C3HA 2X5PA 3O2WL 1U8JB 4PJDE 4NRXB 4TNWF 3UEZA 5IQ9B 3PGFH 1ZHLB 4WV1B 3CFCL 4K7FB 4HUUB 1GSMA 4OIIH 1OSPL 3ARBB 3G6DH 3TVMD 1FC2D 1ACYH 5HGDA 2J1KA 5LCVH 3CX5J 1TQCC 1S5IL 1MJ8H 1BM3L 4XC1L 2C1OB 3S8WA 2VXTH 1E4XI 1NMCB 2JJWA 1A3RL 1IFHL 2ZCHL 1I1CA 1QFHA 2B5IC 1YMMB 5B38B 1BF2A 1U58A 4PG9A 5FAAA 3GMPB 3GO1H 2IAMB 1CE1L 3V0AC 2P42B 1EDQA 5TDNB 4Y19A 5DFVC 3PWJA 1PX4A 2QEJA 3H3PH 5DQ9A 4ERSH 2VH5H 1Q9OB 2W07A 4U1GB 2JELL 1M7XA 2DIBA 3MV01 5F1NA 3WJLA 2L7JA 1AXIB 3MZGB 2P46B 4XP6H 4G42A 5F6HI 1IBGL 3V9FA 2F19H 5IBLC 3LKNB 3LPFA 4ODHL 8CGTA 1OPGL 4GS7B 2JB5H 3KPNA 1AR1C 4NQEE 2P49B 5EO0B 1XIWB 2D3VA 3D2UA 3BYYA 4D3CL 4TSBH 4Y4HD 2MJWA 5CILH 1LEGA 5SX4I 1MPAH 3SCMB 3K4ZA 4FXKA 2XTLA 1DN0B 4XH2B 2J88H 2BNQB 4X6CF 4KTDL 3QQ3B 4XGZA 4PR5A 5GISH 3G5XB 3I85A 4AK1A 1YEKL 1S7QA 5F7EL 4FTVA 3QQ4A 4C4KO 5I1HL 1IGFL 1KIUA 2X4RA 5HHOD 1T22A 1EBPA 2IF7A 3B9KB 2BOCB 5HI5D 1DVFC 2AJUL 4QHKJ 5KN5B 4HIXL 1BOGA 2PN5A 1LEKA 3U83A 1NBVL 2VQ1A 3PQYA 3PL6D 4EN3A 4QTHB 5C09B 3V6BR 1MIEL 1EHLL 5SWZA 3MGOA 1QNZH 4K07A 5CHNA 3U30B 4NO2A 5FKAA 1SMOA 4UIKL 2DQEL 4ZFZA 4PJHB 1BP3B 2Q76A 5I18L 4UZGA 4M43H 4I2XA 1FNEA 3KPPB 3WS3B 2WINB 4QHNB 3OR7B 4M93C 4KUCD 5BOPA 4NZTH 3T0WA 3KJ4B 1JGDB 1YC7A 1P5VA 3X3FL 1ZA6B 1EV2E 1F58L 4NO0A 4JO3L 1F13A 4FN0A 2VXQL 4AIXA 1A7RH 1VGKA 4XP9H 4LQ1A 4P48A 5EIIB 3TBSB 3WEXA 4D9RE 1Z0NA 2BCKA 2VTFA 1A6AB 2WWKT 3G5ZA 3CFKA 4FQXD 4H5SA 3VH8B 4R0LA 3WSQL 3DBXB 3OBAA 2J3SA 1MCJA 1OAUH 3CDYA 4PGEA 1I8MA 1JTTA 1BLNB 4PYGA 2NY4C 1QBML 2YC1A 4BZ1H 2Q6WB 3O4OC 4HJJL 4KMTH 2VDQH 3C6LC 2XY1A 2FNBA 4G9DA 3DMMA 3MREA 4JRYE 4UOW1 1RURH 3D3VA 3IGAB 3SDCB 2R0ZH 3S3SA 1RHHB 2I27N 4WUKH 1G7LA 2VR4A 4LLMB 4P4RB 3P40A 4P0DA 5I76B 2DMBA 5L6YL 5IBUG 2O5YH 1VKXB 4E42B 5MI0C 3TFKC 5JOEA 4WO4A 5J12C 3DSFH 5DT1H 3V5HA 5K9QG 5EU5B 5GIRA 4OCRH 4XVJH 3WNLA 5KVFL 2FB4L 4KXZH 4AEHL 3HNVL 3IETA 4IS6B 2D31A 5EOCH 4LVHC 5EH1A 4WW2B 3H9SA 5IGXL 1UM4H 4X4MA 3CLFL 3MCLL 2E5EA 3JWDC 3O6KL 5FA4B 4ODUB 3RGVB 3BMWA 1KPUA 4U3HA 2Y36L 4R6UA 1U8IB 4XCCH 5IR1B 4EVNA 2BSSA 3WFDL 1WBXB 4L8DB 2EE3A 3VXTB 1D6EA 4NWUL 3STZA 3H0TA 4Y1AB 1A1OA 2FWOA 2PYFB 3X14A 5JW4N 5DURD 1YEGL 4Z7OF 4LPTA 2VLJD 4ZO7A 4AYFA 4XCNB 1LO2L 4X99A 4X9GA 3ARGB 2FX9H 4EI6A 3QIWD 2BVOA 4QOKA 1A9BA 4FZ8L 1F4XH 5HY9A 2C1PA 1QHOA 1U8KB 5MHSE 3ULUD 5IF0B 1FO0B 1RIHH 3MUGB 2X4PB 1INEH 1MCNA 2OR9H 4U6YB 4XCFH 5TE4H 2J6EH 2VDOL 5F21B 3VFVA 2UWEA 3MLVH 3KLAA 2PW2B 4J3VA 4YQXH 1A7NL 1H3XA 3LEYL 5FDWB 5C9JA 2OL3A 1CGYA 3FN0L 5DI8A 4KMLB 3JWDH 3ZDYE 4KU1A 3PWLB 4HHAB 4HH9A 3X3GH 3MZTA 4E0RA 4Z18A 5IK3B 2V2WB 3KXFE 2XA3A 4JO2L 1MWAH 1Y0LB 2XWTA 4R26L 4X9BA 5KZCB 3JUYA 5DMIL 4YEFA 3TIEB 2X1XR 3MA9L 3G9AB 1T04B 5F7LB 3VRJA 1T21A 1UB5B 2EDYA 4Y88A 3QXDB 3DO7B 4K8RH 4XP4L 4OT1H 3BISA 3DXAE 5ICYB 4Y7MA 3IDMA 4WFHE 4P46D 1UCBH 4WEBH 4CVZB 1EFXD 1R5VA 3UBXI 4N90D 2Q3AA 5IESH 1KB5A 4JY4A 4UIMB 2YD1A 2X4NA 4ZQKB 2BERA 3L3DA 4GH7B 5I15L 3DYPA 3MV8B 3UYOD 1FVDB 3W9EB 4TOYH 2X1PA 4NPYA 3HNSH 2RBLA 3ZE1E 3CSGA 3FT4B 4HJGA 4JQXC 3KLHC 5E03A 4XNZC 3SPVA 3D39E 4UNTA 4MDJB 2Z31D 4IDJH 1QEWB 1BREA 1K5NA 4WFEE 1T20B 1WLHA 1FZOA 4RFOL 3QEQB 1MQ8A 5LWYH 3CVHL 1UYWH 4W6WB 3WIHA 3FFDB 1PEZA 3V0VB 4PTUB 4TVPE 4TULL 1AI1H 4HJ0D 4AMKL 2V5SA 4MD4A 1TFHA 3MJ7A 1UM5L 4X0KB 3EFDL 5F7YC 2MCG1 3JTTB 3RKDD 4XXDA 2DDQL 5DUML 3H7BB 3O6MH 5EU6D 2YXMA 1KB5L 2W60B 1ZSDA 3S35X 1S9YA 4AENB 3LS5H 1X7QB 3HFML 2R9HD 4H25A 3VMOA 4NKDB 3OAZK 1BZ7A 4MXQC 4LCWD 3C2SA 1XH3A 4PRAA 1OP5H 4RRPA 1NGPL 1JPGA 1K4DA 3HB3D 4LSRL 4U3XA 1IQWL 1V7NH 2M2DA 3GK8H 4Z7NF 1OW0A 4N0YH 4QF1B 4XCYB 1CL7L 1HSBA 3QFJA 3MLUL 3JUZA 3NAAH 4JG1H 5CBEA 4Z9KB 3O9WB 1OHQA 2CIKA 4GSDH 1QRKA 1CI5A 1GGBL 4XPTL 3UJJL 4RDQF 1BBDL 5KS9A 3TH2T 1GH7A 3QRGL 4XBPB 4OZIF 4NN5C 1A4KB 3QQ9D 1BVZA 1R3JB 2H3NA 3CVHB 1J0YA 2R1YA 4U6XA 1RZFL 3KS0H 4LLVB 3PHQB 3BP6A 4B0MM 5INCB 2BRRH 5IB4B 25C8L 5DJDB 4P9HH 1G7HA 4YEEA 4K71C 5EFIB 1CR9H 5I19H 3MBED 1FBIL 1U42A 2IG2L 1WC7A 1D9KA 2B1HL 6FABL 4G8FA 1FZMB 1CGXA 1FSKB 3EYOB 4FXLA 4X6DA 2BY2A 1CFTB 4AH2B 2FJFA 2AK4E 2OI9B 1P7KB 3T2NH 1BFVH 4JFXA 4MX7B 3HMXA 3HS0A 1GZPB 1GPOL 3RBGA 4YPJA 1YPZE 3K81A 1X6LA 3GMLA 5ISZD 3KNBB 5EZJA 3HAEA 5JXED 4NC1C 1CD1A 4Y8DC 3U9UA 1YUHA 3C5ZA 2VE6A 3L95B 5D2NB 5BZWB 3ZTJH 5CD3B 5D5MA 2EIDA 1KNOA 4NQCB 3OKKB 5DLML 4BM7A 3MOBL 4F3FB 4UUJA 1NGYB 4CU6A 5KSAD 3O2DL 4DN3L 4QGTA 3DVNB 3L3HB 3TO2A 4H1LB 2KZWA 4OZGA 4BQ8A 1H0DB 4DGIL 5E9DE 2O5XL 3DURB 4DCQB 2COQA 4QY8A 1UG9A 1FG2B 3A6BH 2ZG3A 3U46A 1A3LH 4J3UA 1XF2A 3DHMA 1CXKA 3GSRB 1EX0A 2LU4A 2ZCLL 5F9WB 4DN4H 2C26A 2FO1A 3CVIL 4OI7A 4YFLI 1QFUL 4PRHB 5JIKA 3RPIB 5DSCA 1DQDH 1REIA 3MRRB 2GT9A 4G43B 4BH7B 2AV7A 4NJ9H 4N8PA 2EDBA 3MRKB 4KDVA 4LHJB 2RHEA 3BEWB 1S7SA 2DKUA 3NZHL 5GRVL 2VSDA 4RMTA 4NO5A 3BD4A 5F7DB 5HHMD 4UAOB 2PXYD 3ZL4L 3TCLB 3O41A 4J4PD 4EUPH 5D6DC 1DEEB 4PJDB 2HA1A 1HHKB 5ILTH 5J4MA 3VXOA 3OG4B 1MHEB 1VB9A 2ZUTA 2KPNA 3ETBF 4DZ8B 1X5KA 2FIKB 5JOPD 2NZIA 2AV1B 1F6AA 5JHDE 3ARED 4LVOB 3AXLA 5GS0L 2BXYA 2VDRH 5HHPB 3H7LA 4V2BA 5I1DA 1IC7L 4LQFH 3LPWA 5DR5L 3KPQA 4KJQC 3UZQA 3UTTD 2MSPA 2X4TB 3VXRD 4MA8L 1IZKA 4O5LL 4PGBB 1V05A 4JFHD 3N85H 4P59L 2B4CC 4XWGL 4YE4H 1WWBX 1TNNA 5E6ID 3ARFD 4X6FA 4MDIB 3IDIB 1UWEH 2GTWA 3ILPA 1HCFX 1LWRA 4K3EH 3DRQB 3PWPA 3DRTB 3IU3B 5I71B 4D0CA 1KC5H 3S6CA 1NC2A 2CO6B 1EK3A 5GRXG 1WFUA 5D1XB 3TN0C 1IEAA 4WFFD 3OZ9L 5CGYD 3DHJA 1OAYL 3RA7H 2X40A 3OKEB 1CGTA 2IADB 4ZFFA 5DVMA 1CFNB 4LOUC 2JF1A 2RFXA 3DI3B 3MRNB 5T3ZD 1J8HD 1FFQA 5CUSH 5D9SA 3QP3A 1BQHB 1XCQB 4ALAH 4P5TC 4B41A 5FF6A 2AABH 4F33A 3FB7B 1S3KL 5J11B 3KAAA 3MLWL 4YBQD 3I3BA 3G6JA 1I3GH 5B3NA 4ELKA 1RFDL 4MB3A 3VRIB 4Y16A 4JGUA 2NXZC 3LKSB 4PGCB 2O93L 1P4IL 1Y6NR 4OF0A 5D93C 5JUEL 3NCMA 2ZSVA 3UAJD 2IALA 3C09B 2PTUA 3ES6B 3BN3B 2H9GA 1J1PH 4X6EB 2VQTA 4H0HB 4FQIH 1DVFA 1LO4H 4DKEH 5J3HC 3EYUL 3GMNB 3RHWK 4RFEB 3LCYA 4GAYB 4NP4L 1JRHI 3MGTA 4MMXC 4ZSOA 1YNLH 2W0KA 3MRLB 4LU5L 2GIYA 3CC5A 3WNOA 5JHLL 5GSVB 3HNTL 2PKDA 3V7MA 1JZ7A 1T1ZB 1GAFL 5DJ0A 5DC0A 5CD5C 1MRFL 3BJ91 4YXLH 2OQJA 3MRBB 2KBGA 1RMFH 3HMWH 4L3EB 2JLLA 2CRMA 3WUZA 35C8L 2C3GA 4JRYB 4HGWA 3ULSB 4P2RD 3JWOC 3TJEH 3OX8A 1C7TA 1HINH 1NKRA 4Y4FA 2MNUA 1PG7X 2EXWC 3CU7A 3NFPA 1LMKA 4YIQB 3D0VA 3IXTB 2W9EH 3HZVB 2ZUQB 1OLZA 3C6LA 4GT7A 1TJGH 4U0RC 4U1KA 3QIUD 1K2DB 4S1QH 1MFEL 3LQAC 1KUMA 3RL2B 1TTGA 2AQ3A 4MZ2A 4Z7VF 3VFRA 3BO8B 1G84A 1QSEB 5DK2A 1WTLA 2ED9A 2R0KH 3ZKMC 2GCYB 4PJBF 5C0NC 4OCSH 1BVLA 1DE4B 3DUHA 4Z7WF 3LZFL 3I9GH 5CP7B 3MFFB 2Y06H 4XPAL 4OGXL 4WUUE 5E2TL 3HR5A 1CE6B 4Y19E 4PP1D 4ZOEA 5D96C 3RAJL 3T1FB 1GGIL 4WI6A 5EZIL 3LDBC 3LEXA 5ACMA 3P4MB 1FL6B 2NR6D 4NNPH 5EB9A 2XZCL 1IGCH 4LLUB 2YD7A 4U2ZA 5LQBH 4R7NA 4TUJA 1J11A 2F5AL 1A1MB 3ZKXB 2A0LD 3TM6A 2C3VB 3C5JA 1IARB 2UVFA 3QUZB 4EJ1C 1CVSC 4NWTH 5ALBL 4HK0B 1P2CA 4POZD 3T0EC 1SJEA 4X7CC 4XTRC 4GG6B 3R8QA 1QR1B 3MNZA 5D7SH 2B20A 1OSZB 4HIJA 4PJ8B 2D0GA 2P47B 2VL4A 2QL1A 2Z4QB 3ARBD 4M03A 4RRPG 1VPOH 5AZ2H 5HJ3A 1JV5A 5D7IF 1MCSA 4BSWB 4XMKL 1I7RA 5DVLA 1HH9B 4ZO9A 4HXAH 2D7OA 3FQUA 1YMMD 5HGGS 2I9TA 4CGTA 1OVZA 3E2HB 3V0WL 4FTVE 1NSNL 2IAMD 5C0BA 1FLRH 1P84J 5FECB 2NYYC 4LP4A 1G9EA 2DF3A 1K3IA 3GSNH 3KPTA 2X4SB 4OFYD 1A7OL 4NDMA 5IB2B 5JXAH 5FOBB 3SBWA 3UJTH 3QWRA 3E6FB 3O3EA 1TCMA 1NCBH 1VACB 4NT6A 3PQYE 1CDUA 3RWFA 5SWZE 4PJXF 4CJ0A 3X12A 2VLLB 2EZ0C 4EXKA 5I8OH 4D0BA 3B2UD 3FO9B 5I75C 1XIWD 2BJML 3D69A 3HE7B 1XGRB 3TT3L 4HFUL 1VENA 3KJ6H 4LARH 2YS4A 4I2XE 1OARH 2XTJE 2L7UA 3O11A 3SCMD 1N59B 2WWMD 4QLRA 3TZVC 5ITFA 4B50A 4L8CB 4OLWL 2BSRA 3BZ4A 3IJYA 2A6KB 4B7LA 5BV7H 1T03H 3DXAB 4PBVC 1KTRL 5DRXB 3WE6A 5C0JA 3ZE2E 1JZ2A 4MD5A 4XXCC 5FUZH 5F6HJ 3FL7A 4PG2A 4OI8A 3PWUB 5DJZA 3B9KD 5TF0A 4Q6IC 3S7GA 3HAEG 3BN9D 1JRHH 3MRIB 3UTSD 2FEEI 5C09D 5D1QB 3VD4A 4U6HA 3D3VE 3LV3A 1IC1A 1JNNH 1I9JH 3WO4B 4G80A 2AJ3A 2C3XA 1WAAF 1VFAB 4XAWL 4JQXA 5T1DL 4JVWA 3WV0A 2WLYA 3QNZA 4U1JB 3ROOA 5ESQA 5ACLA 4OB5H 2IBBA 1XGTA 2FRGP 1MEXH 1OAQH 1VEOA 5I6XB 4G8EA 4BYHA 5BXFA 4NQXB 1LEIA 1Z5LA 3SJVB 2IEPA 2R1XA 3QEUB 3BAEH 3WKML 4LHQB 3SE3C 5J6GA 1DUZA 3H9SE 4FHBD 4M4RA 1JUFA 4X4ME 3U9PH 2NNAB 4NRZB 3SN6N 3ARDC 4R7DA 4BK4A 2IPUG 1MF2L 3ZHLA 1CDCA 3BZEB 3ZSSA 3V5KB 1BFOA 3TBVB 5GXBB 1GOHA 3IFPA 4KGLA 1YYLL 5KANG 5ALCL 4M3JA 3JV4B 4YFLF 1J18A 1OTUC 4JZJB 1XR9A 1RHFA 2DQUL 3IRZA 3MXVH 3MACL 1LO3L 3R06B 5DVKA 3RTQB 3UYRH 5H35B 3FQRB 4LBEA 1DQMH 2J5LC 4QOKE 3Q6GH 1DR9A 2ICEA 2QHLA 4X4XA 3L3KB 5T33L 5K9OB 1E6OL 4JFQB 5IKCA 4K9EL 3T2QA 1KFAL 4OCWL 4PTTB 1RQ5A 4EDXA 4JO1H 4QCIB 4IJ3C 4HUMB 1MFCL 1QO3A 4P2CG 3QR2A 1KPVB 3RGVD 4HZLB 1AHWC 2PO6C 2IGFH 2UWEE 2VDLH 2YA2A 3QUYC 4JO4H 4LSUL 3BUYA 4CBPA 1F3DH 1SM3L 4QHUB 5L0QC 1BX2B 5HSFA 4H20L 2E7MA 2F54B 3FRPA 1S9XB 4P2OC 3RWHB 1BJMA 5I16B 3MJ9H 4PV9A 3VE0A 4KK6D 3QG6A 1YPZB 2HAZA 3MV9D 4KQ4H 5C0RH 5I17B 4C83A 2JIXB 2VLKB 3P9LB 4Y1AD 2D7PA 1DLHB 4NYLB 1U3HB 3UBXA 5FHAH 4HUVA 5EUKB 3RWDA 1ZHKB 4MVBD 2IPKB 3D0LA 1RAMA 4LSPH 4FNLH 1T3FA 1QLFA 3ARGD 3QFDB 1RUQH 4P5KB 4HMEA 1YJDL 4IRSD 1CFSA 3VWJB 5C0FA 4NHUA 5I1AB 5ERWA 3ALWA 1T5WB 2AVGA 5E2JA 1NBYA 1HILA 5C86A 4P57A 5IBUB 4QTIL 4KZDH 1R6VA 3DUSA 4HS6A 1T0PB 3WYRA 2LV4A 4KTYA 3H9HB 4L8BA 1FVCA 3V8CA 3GJFA 5B8CA 3LN4A 1U9KA 5AWNL 4YHLH 3SO3C 1EO5A 3C9NB 4Z8FL 1OM3H 4LMQE 4GKSA 2QQKH 1ZT1A 4LL9A 5E08L 1N4XL 1PG7L 2HP4A 4YGVA 4Z95H 1T1XA 1N3NB 4JHBA 1DFBL 5EN2A 3SEPA 4UTAH 5K9KB 4OM1H 1YN7B 2BOBA 4LLYB 4HKZA 3QUXB 2ITDB 4YX2L 3GGWB 3P4NB 1KYOK 3KYNA 5D72H 4X7SL 1AGDA 4IMKC 3OHXB 3VA2C 4WFGE 5E4EB 2WV3A 4PJXA 1L0YA 2NY1C 5DJ6B 4ZDHB 1AIFB 2XWJB 4YC2C 2HT4D 4G6JL 2WBJC 3DX9B 2UUDH 5JHDB 2N7BA 3MV8D 4LDOB 4JGJA 5D6DA 3QH3B 3T09A 4NC2B 3VFMA 3CPLA 3L9RA 4KRPD 4WHTA 4Y4KB 2DLEA 4Y5VC 1CXFA 4WCYL 2Q8BH 2Y23A 3RY5A 1MCPH 2R4RH 4HIEB 2CDFB 3ZE0F 3QFJE 2AJZB 5AZEL 5A16B 4KJYB 1AFVL 5KW9H 2G60L 1DLFL 3WN5A 3BEVB 2NY6D 5D7KD 4EQ2A 3VW3L 4R3SB 1T0NA 1RU9H 5KS9E 1WWWX 3MRGB 3T77A 1ADQH 4PJEF 3VXSA 1MLCB 3EOAA 5F93C 3EHBD 1JFQH 2O61A 3QCTH 5FYJL 4MAYB 5CJQL 3GRWA 5I2IB 1UQSA 1KLGB 1X5HA 5CP3A 1M7DA 5IEHA 3BGMB 43CAA 1JGLH 3J8F7 5T3XH 4JDTL 4M3KB 3MLYH 1MRDL 4Y5YB 1WAAA 3HTLX 4N0UA 4MD0A 3TWCH 3PWNA 3FZUC 4JFFB 3GHEL 2LFGA 3K74B 3HPJB 4PIRF 5DRZA 3W5NA 4JHAH 3QUKA 4X6DE 4HF5L 4UT6L 4WHYG 5JORA 1WEJL 4FABH 3ZDZE 1RIUL 4KKAC 3DGCR 1I75A 3TN0A 5TE7H 4FQCH 4PJFF 3WFHB 1CGWA 1A6TB 1MIMH 3IDXL 3RVUD 4JQVA 3O9WD 2NY2C 4QNPE 4DTGL 2X4OA 1N64L 5DJAA 1JZ4A 1CK0L 4EDWL 2CQVA 4HPYH 1DBJH 4YDKL 2DL2A 4XWOC 4P5TA 2ATPB 1QLEL 1IVLA 3NGBC 1FGNL 2A1WL 5DJ8A 2BSED 5DMGD 5JW5A 4MQ7A 5HVWA 1ZEAL 1S78C 4H8WH 4GRLA 4OJFH 3LVEA 3CJJA 5D5ME 3B9AA 4M7JL 3HLAA 3B3IA 2QTEA 3QNXA 2AEQL 4WGWB 4PREB 4KHXL 1PKQA 4MA3B 5E5RB 4OZGE 5DD0L 1NUGA 3BWAB 5IEKA 2Z92B 3V52L 4K23L 3TT1L 4UNUA 1NJ9A 4W4OC 2DI7A 2FR4A 2GK0B 3SY0A 2PCPB 1U95B 4Y5XC 4C57C 5LKNA 4BFEA 4RGNC 3MGAA 4LLDA 5EIVA 1QBBA 1XF5B 3MUY1 4Q9CA 1I1YA 2WANA 3S96B 3OAYH 5I1JL 3TLRA 4ETQB 3W81A 3MV7A 1AO7B 1GC1L 3NCJL 5C1MB 3GHBH 4YXKL 1TDQA 4R4FL 3IKCA 4M6AA 3SDAC 4NQCD 4JFEA 3FMGH 2P4AB 4X5WA 4XVSL 1JNJA 4JKWA 3NFNA 2RCSH 2WIIB 5DVNA 3W0WA 2AXGA 2BDNH 1JJUA 2DTMH 1N8ZA 3IS1X 5BVPH 1BFSA 4K3DH 4M02A 4C55A 4P5MA 3CSYB 4AM0A 2DOCA 2X05A 3FQTB 1RZJC 5DFWH 2ZCKL 1MJUL 2BSTA 4MSWB 5I1EH 1NUFA 3FT3B 2CKBA 2A77H 1U58B 4PG9B 4RMWA 4WUUB 1KTDA 1QACA 5LJYH 2MTPA 4Y19B 3LEVH 2Q87A 1BD2B 1AKJA 1NMBL 2E27L 4RWYH 5F1NB 5MENB 1S9VB 5TDOA 2AK1H 4NQDA 4G42B 3PIQA 3O45A 1CLYH 1L7TH 4FFZH 3ZKND 3PWPE 3KPNB 2AQ1A 5FHBL 5KSBF 1U3ZA 3FB8A 5CZVL 4UINL 3OR6A 3SDDC 5DRWA 3D2UB 3EO1A 2R2EB 3BGAA 5C9KA 4TNWK 3WCYA 3IS0X 1ZT4A 4G3YL 4HDIA 4NUJA 1LEGB 4TSAL 2P24A 4DAGL 5FKPA 2CGRL 4OAWA 4H0IA 1A5FL 1I9EA 2F8OA 4FXKB 5T5FH 2CO7B 4ELMF 1KCRH 2WBKA 4TNVF 3CFEB 3KDMB 1UWGL 2X1OA 5CCKL 3B2VL 1DP0A 4XGZB 4PR5B 3FJTA 4MJ5A 3WNPA 1S7QB 3P0VH 4FTVB 3QQ4B 2CLRB 4YHOH 3WFEL 2YPVH 3G6JE 3DX6A 4YHIB 1RULL 3LIZL 4TPRL 1R3KA 5HYSB 1YEDA 4G8IB 4QXGH 1FL5B 4N8VB 3VFNA 2VQ1B 3PQYB 4EN3B 2VLME 1S7UB 2NXYB 3VFUB 3IT8D 5FKAB 2R8SH 4JFZL 3L7FA 4NQED 1KCUH 5GPRA 5GSRB 1LVEA 5DQDL 2Q76B 5GHWH 1JP5A 4I4WA 4Q9BA 2P8PA 4YDLB 1ZVHA 2XTJB 2VXUH 4MNHA 5D1XD 3OPZL 1G7MA 4L8SB 4M9PA 2EDQA 2YPKA 1AXSB 2AKRA 1AY1L 4YNYA 4NJAL 5ITBH 1NCDL 2CK0L 4ZSOE 5HDQH 3FRPG 3H42L 1VGKB 1RZGB 3WEXB 3D18B 4FFWC 1G7PB 5LXGL 3N1FC 3CK0H 2BCKB 4O2FA 1IT9H 1FO0H 2WNGA 5ANMA 4YWGL 1WCBB 3U6RA 4R0LB 3B5HA 3TZVA 4HXBL 4OF5A 2Y07H 1PGRB 1I8MB 3UBXG 5AG8A 4I18B 4MA1B 5EU4B 4F80A 1FIGL 1BEYL 3VMPA 1SY6A 4JLRA 3GMOA 2YC1B 1UM6H 4ZS6D 1XCTA 2DQIL 1HDMA 4JB9H 2CIIA 1XGYL 3MREB 5E8OA 1T5XB 4PYHA 1MAMH 3HRZA 4XXCA 5E7FA 2Q3ZA 2EYTA 1IAIM 4HWZA 5TGBB 2QADC 1G7LB 5E8EA 2EICA 2K1MA 1ONQA 1KIPA 1J10A 1FYTA 3N1MC 3ZT6A 5DJ2A 5J0BA 3NACH 2ZG1A 5BZDA 1CS6A 2CK2A 1Q72L 2VXVL 1IM9B 1KSRA 3B4NA 2HVJB 4WO4B 5F9OH 1BGXL 3V5HB 1FJ1A 1B6DA 4LGRB 2D03L 4UI2A 4D9RD 4OBRA 1RZ7H 5TPWH 2FD6L 2DLGA 2WUBL 3IETB 2D31B 1KCLA 3BPNB 2VUOA 3H9SB 1QFWI 4OF6A 5E8PA 1KJ3H 2KH2B 1T66C 1GL4B 5DYOA 4LCIH 4QXUL 1CF8L 2BNRA 3EFFA 1DSFL 4R90H 1ZKAA 2Y9RT 3U36A 1UA6H 3W82A 2Z8VC 5FYKE 4JRYD 3ARVA 3SE3A 1PQZB 1JNLH 3NBNA 4KRLB 5EOQL 3ULVC 3SKOB 3STZB 2OZ4A 5I1LA 4KJWC 4PJHF 3EJYD 4JPWL 3D25A 3MOQA 1YEFH 3IDGB 1QA9B 3QCUH 1WF5A 2MCPH 4X99B 5GRJL 2B39A 1EHXA 2VO5A 4EI6B 2VL5A 3SQOL 2BVOB 4QOKB 4HZAA 1U93A 1QSED 1UADC 5HY9B 2C1PB 1X6NA 2FATH 3T65A 1S7WB 4JQIH 5EUOB 5JIPA 3LS4H 2BFVH 1B2WH 2F58H 4BQCA 3J7HA 4UV7H 4TQEL 4OQTA 5LGHL 4QHMA 5C0BE 1A8JH 1IQDA 4M61A 1KENL 1FH5H 2EH7L 4N5EC 3KG5A 5C9JB 3IAPA 2OL3B 3V4UL 5CJOH 4NC0B 3BESR 5DI8B 2J2ZA 4LLWA 3S37L 4NGHL 3TJHC 1BJ1H 5C2UB 2FX7L 1YEHH 1X5XA 4K3JL 4CNIA 1AJ7H 2A6IB 1EJOH 1PJ9A 4NZUL 5BMFH 2IQAB 3VGEA 3QPQD 4HKJA 4RGOL 1AHWA 2PO6A 3B9DA 3QUYA 2XWTB 3S3PA 3TNNA 3I84A 5M7QA 1WWCA 3B9EA 2ARJA 4P2OA 5I0ZA 4PJ8D 1JZ5A 2J8UA 3FQNA 5D71L 4PJIA 5IJKC 4LEOA 4U4BA 1T21B 2MOVA 4HLZH 5A3ID 3HI6L 1JHKL 5C0GA 4TRPL 3MUJA 5EZOL 2LABA 4YBLC 4FQLL 5MHSD 3O3UN 4OGZA 4O9HH 1DBAH 3IDMB 2A73B 4ONGH 5KSBA 1R5VB 1U2HA 3D85A 4JY4B 5JR1L 3AB0B 2QQQA 12E8H 3BQUB 3BDYH 4KV5E 3FOLB 1VHPA 4WW2F 5HD8C 4NPYB 3AS2A 4HJGB 4PUBL 3UYPA 2EDXA 5H2BA 4P2QB 4PJ9B 5KBNC 5FK9A 3IFLL 1FCCA 1EFQA 2G9HA 5DXWA 5I73C 3KXFD 1FZOB 1KCKA 3NPSC 2W1NA 3HE7D 1E4WL 1A02N 2ZP0T 4GRMA 1U92A 4MD4B 1I8LC 1KJVA 2EDTA 4HWNA 4NOBA 1YEIL 5F3HA 3CXHJ 3T2PA 2H2PC 3MO1A 4MNQB 2Q8AH 4XXDB 3PP3K 4OKDA 1A14H 2R69L 4HUWB 4NHCH 1R24A 1MCOH 4YR6A 3SDXA 5IMOB 1ZSDB 3DXAD 1TMCB 1S9YB 5JPMB 4WFHD 4POUB 2YPLA 4M7LH 3CLEL 1IGML 2FECL 5LBSH 5KAQG 4ZPVA 5BOZG 4NFDA 1WIPA 1T7ZA 1BBJA 1XH3B 4PRAB 4H1LH 2HJFA 4OV5B 3FO0H 1MI5A 5AD0A 1K4DB 4IMKA 1OTSD 3K1DA 3FN3A 2DQCH 3MLSL 1KGCE 4NSKA 2NY0D 4YHNA 5D1QD 5I1GH 1MCLA 4E41A 2AJVL 1W0VB 1INQA 1Q9WB 1HSBB 2DD8L 2WBJA 3QFJB 4WFED 5C7XH 4O51A 3CCHA 4HWUA 3WHE1 2CIKB 4ZUWA 3QPXH 1F6LL 5KS9B 2ESVB 2DQGH 3GSUA 5E56A 3ZKQD 4Y5VA 3NMEA 3FTGA 4XNYL 1QRNA 5FYLE 3WMSA 2RAMA 1HQ4A 1G6RA 4Q2ZA 1G7HB 4H0GA 3PGFL 3SJVD 4Z7QF 1JIBA 2GJZA 3AS0A 4RAVB 4OIIL 1MHHA 1SBSH 3G6DL 2Z8WC 1ACYL 2OS7A 5CJ8A 5LCVL 1D9KB 4LEXH 1R5IA 3F12A 4AEIH 1MJ8L 4G8FB 3V2AR 1JNHA 5ADPH 4N0RA 4A6YA 1RJYA 2VXTL 5SV4A 3T0AA 3PGDA 1N6UA 5DHYA 1UKSA 5F89B 4S0SD 2GFBA 1F4WH 2FZ3A 3GSWB 1F3JA 1SVCP 4JFXB 4OD2B 2CRIA 5I9QB 4EI5B 3HS0B 3UC0L 4GMTH 3H3PL 2OR8A 3VI3F 2VH5L 1FFPB 3UX9B 5EZJB 3OAZH 4APQB 1CCZA 4XP6L 3DV6A 5E7BA 1CD1B 1YUHB 3C5ZB 2F19L 2YWYA 3RTQD 3L6FA 2NY7H 1YA5A 2JB5L 4Z0XA 2QSTA 3L1OL 1CDGA 5D5MB 2VQUA 4PJAA 3GSOB 1MCRA 2NLJA 3V5DA 4TSBL 5CILL 2DBJA 2CPCA 2I24N 1MPAL 1YQVH 4MAUL 1WZ1H 4I77H 3TO2B 4TUOA 5SX5H 3EJJX 4OZGB 3ZLQC 3C60C 2BNUA 4HS8H 2ZUXA 2J88L 4GKNB 1UH2A 3DETC 3EW3B 3QI9B 5EWIH 5GISL 1XF2B 2F54D 2AK4D 4ZMAT 2E8YA 5L8KB 5FO7B 1TQBC 3AFLA 2ZOLA 4CVUA 1AC0A 3S98A 4CL7A 1H3UA 2W0FB 2UZYB 2R0WH 4UDUA 1U3HD 4W4OA 1D5BA 4LLQA 1B0RA 2VIRB 1CTNA 1QNZL 4NO5B 4Y5XA 3QIBC 5DD6A 5IUSA 3O41B 2NMSA 4HWBH 1QSVA 3VWJD 1EO8H 4M43L 4PJXE 1HE7A 4NUGH 3VXOB 3BGFC 1HHIA 3V4VH 4Q58C 2Y7QA 5E9DD 5EBMB 5F7UA 1EEYB 1F6AB 5IOPA 3I6GA 1X4YA 3T0XA 1A7RL 4U1NB 4XP9L 3CDFA 4PRPA 3SDAA 4JKPH 2DBLH 1PEWA 5I1DB 3INUH 3M17B 3KYKH 2ICWJ 5CIPH 5I30L 1OAUL 4UTBH 1TQCB 5F1SA 1JMZA 2C4XA 3QISA 4BZ1L 1CDJA 4KMTL 2VDQL 1TENA 4X6FB 3QUXD 1QQDB 5CKAA 2B5IB 3ILPB 1RURL 1UB6A 4DUWA 4Y2DC 3VXSE 2R0ZL 3UDWA 4D0CB 3LQZB 3RU8H 1J05A 5GGQH 4WUKL 2UY6A 1D5MA 1NC2B 5DJXA 5DEFA 3VGAC 1IAII 1CFVH 5IJVA 1IEAB 5DHVH 2O5YL 4ESKA 5JHDD 3P0YH 3DSFL 2N7AA 5DT1L 3EBAA 5DHXB 4F2MB 1WAAE 2RFXB 5JO5A 4JRXA 4N0UE 1H5BA 4RBPK 4JAMA 3VGGA 2DQHH 4I0PC 4OCRL 4XVJL 5D9SB 4Y4KD 2DYPA 4P4KB 4Q0XH 3SDDA 5FF6B 5EOCL 1GCFA 1UM4L 2D7MA 5C6WH 3THMH 4ELKB 1OAXH 2JKXA 3MX0A 5KOMC 4ZUUA 4MYWB 3AU1A 4XCCL 3RZWA 2X2YA 3RP1A 4S2SB 1CFBA 4X83A 1MAKA 4MCYA 5C07A 2ZSVB 1C7SA 2IALB 1FL3A 4JDVA 3RWJB 5JQ6H 1B6UA 5C71A 1CICC 2IANE 2XN9A 4MAYD 3QDMA 1DVFB 5DD5L 3SE9H 3OXRA 5JIHA 3VG0H 1EEUA 2LU3A 4PJDF 3CD4A 1VDGA 2IPTH 1IAKA 1PKQE 1T4KB 4G9FA 2FX9L 2V2TA 4OZIB 4K7PX 1F4XL 4XHQA 4HCRA 3HI1B 4JFFD 1QFOA 4NOFA 2NW3B 2EYRA 1RIHL 3DTXB 5CGTA 1INEL 3QZWA 4KVCH 5J1TC 2OR9L 4LCCC 4XCFL 5TE4L 5DJ0B 1FNAA 2J6EL 2W65A 4M93B 5A2KH 1KB9J 5GGVH 3S36H 1KJ2A 1EVTC 2OQJB 3BP7B 3MLVL 1FFRA 5GGTH 4ZTPH 2P48B 1FNHA 4YQXL 1MRCH 3IDYC 4BZYA 2M26A 3MV7E 4ZODA 2NQCA 3JWDL 2FEDD 4M6MH 5C6TH 5HI3D 3X3GL 3OX8B 3TO4B 3G08A 1MWAL 2F53A 3JXAA 5BW7A 5MEPA 2HLFC 3HE6C 4JFEE 2GY7B 4S1DC 1T80A 1UXWB 2NY4B 3O4OB 3C6LB 2JTDA 4W68A 4M1GL 1I8KA 3SGEI 4XNQA 3IDJA 3HR6A 1E4KC 4PP2A 3W0WE 1HSAA 5IW1A 4K8RL 3VFRB 4ZAKC 2GUOB 4OT1L 5DK2B 1G6VK 3A6CH 3LN5A 1UCBL 2HTLD 4PJCA 4WEBL 4YDIH 5IESL 3AREC 1G7QB 1QSFA 1FZKA 5D1ZC 1IGJA 1DUYA 2IMNA 4TOYL 2H26A 3HR5B 5J12B 3HNSL 2EYSA 4X6BA 4UU9A 3JBG7 5JZ7C 3LEXB 4F7CB 1WBYA 1W0YT 4IDJL 1TIUA 4NQTA 4M5YH 4LVHB 4MWFB 1ED3B 4N8CH 1G9MH 2R15A 4NQDE 3WJJA 2V9RA 1W72A 2VN4A 5LWYL 3C5JB 1UYWL 1N0LA 4XPBH 2BK8A 5TDPA 4LAQH 1P2CB 2ZOKA 4FZEH 1AI1L 4I5BA 2R23A 2ZUSA 1MLBA 3GSXA 3H6JA 2Y72A 1MELA 4HIJB 4TVPH 1IEHA 3C08H 5E2VH 3O6ML 1JGEA 4OKVB 2AAVA 2VAJA 2DQFA 1I7RB 4XVUC 3HZYA 3LS5L 3PV6A 4MXWH 5LVEA 3B6SB 1RK0A 3FQUB 1AGCA 3RQ3A 3DUUB 4OLXL 2I9TB 1MFNA 2XQYG 3DIFA 1LO0L 2HWZH 1VESA 3C8KA 4WUUD 5C0BB 3EYQD 2KL6A 5C70A 5MEOA 4Y19D 1UGNA 3TA3C 3H9ZA 5DEGB 4Y4HA 3G04A 3QHZH 4HV8A 1BD2D 1V7NL 4QYOB 1G9NC 1W72L 3GK8L 3GMMA 4R2GD 4D0DB 4N0YL 1AGFB 3S4SA 2Q7YA 4NT6B 1TZHB 3BH8B 3RWFB 3GSQA 3GKWH 3NAAL 5EC2B 3Q3GB 4JG1L 4MNGB 5MERA 4GSDL 1LNUA 1MNUH 2ZWLT 3D69B 1NFDF 3D2UD 3EAKA 5T1LA 3NFSH 4U3CA 1HEZB 3O11B 2HRPH 4RAUB 4D9LH 3L3IA 5ITFB 3GJFK 5HHOA 3NTCH 2BRRL 3BZ4B 3SKJH 4XBEH 1BF8A 1WT5C 4P9HL 1BZQK 1Z3GL 1CR9L 2V17H 5I19L 4PJEE 2VOTA 3GFUA 2YRPA 5C0JB 1NC4A 3L3GB 1EGJH 2VISB 3JTSB 2Z93A 1X3DA 4FTVD 2GK2A 1AE6H 1KPRA 3NIDE 5ANME 2H32A 5IJKA 5EBLA 2GAZA 5ID1B 1S7VB 4KKLD 5FA3A 1JK8B 3FB6B 3X13A 3X17A 3PQYD 4EN3D 3MLXH 4JFDA 3CUPB 3T2NL 3TVMB 1BFVL 2NXYD 4OGAD 2MQ0A 3RUGA 2PTVA 1ES0B 5KG9B 43C9A 4AIZB 5CBAB 3VG9C 3BPOC 5IHUH 2CLVA 3LV3B 2XICA 4ODXA 4RZCA 2EO9A 2L0DA 5C3LD 4G80B 5E6YA 2AJ3B 2XTJD 5E2WH 2NPLX 3B5TA 1FYTE 5I1CH 1LGVA 5EOTB 4XNZB 4NNXA 2DS4A 4NNYA 5ESQB 3ROOB 1ND0B 2V2XA 2Q20A 5GQBA 4LHUB 2A6JA 1XGTB 2W59A 3GKZA 2W0LA 1HI6B 4G8EB 5JNYB 1UJ3C 3BP4B 1Z5LB 2ADGB 4OD1H 2CDGA 4V1DB 1CU4H 4BFBD 5DEZA 1I8LA 3HZKB 2X1QA 2XV6B 3KS0J 1DUZB 3M45A 4ZUTA 1RZKC 1G7JA 2FLBT 4QHKI 2FH8A 1JUFB 3MLRH 4YXHH 3A6BL 5JLZA 4PGZA 1A3LL 3K0WA 4PD4K 2I5YH 3UROR 2BNRE 3IU4H 3MROA 3X11B 2VMFA 3FCTA 4ONFH 4DN4L 5C8JA 1IGIH 3C6SA 3DMMD 3MBXL 4N0FA 1HKLH 1BFOB 3PP4H 4YHPA 4LNVA 3REVA 1T1WB 3D3VD 3ZDYF 3OWEA 4WTZA 1DQDL 3ZMRA 4NJ9L 5INDA 2CLZA 1DQJB 1XR9B 1GYAA 5F1IA 4IMLA 4O4YH 4LP5A 1IM9D 4WO4D 1G0XA 3GNMH 5DO2D 2VN7A 3HHRB 3UPCA 2ICEB 5ILTL 5C0EA 1U8NB 3RKPA 5FFLA 1MCCA 5D2LF 3NCFB 4EDXB 1D6VH 2ZUYA 1FNGA 2BP3A 1MCKA 3LMJH 4NN5B 3H9SD 1WZKA 2V9QA 3CH1A 4MJ6B 1NMCC 2VDRL 3LH2H 4I3GA 1X5IA 3L3OA 5IVXA 2XXMB 3VDBA 1TVHB 2HKHH 4LQFL 1S9WB 4K71B 3T3ME 1B9ZA 4Z7VB 3RHWF 3ZE1F 1NAKH 4FFVD 4PJBB 2HTKC 3PF2A 3ILQD 2C4FT 4G7VH 1EAPA 3N85L 1QG3A 3F8UB 1NQBA 4M8VA 4Z7WB 1OF2B 2GTZA 2UZIH 3BIAX 4U1GC 4YE4L 3TYFB 3OJVC 3SKMA 4J3SA 1CTOA 2XA8H 3BI9X 4HUVB 3GI9H 4Z7UA 4NRYB 3OV6A 5GGSA 4CAGA 1SJHA 1UWEL 4D9QE 4GS7C 4K3EL 1RUPH 1T3FB 4DGYH 1P69B 2J8UE 1RZIB 4PJ7A 4PJIE 1AP2B 4E9LA 1JHLH 1KC5L 4QOKD 2D7QA 1I9RL 2WBWB 3WIFB 5ERWB 5CEXB 1MCQA 3STBA 4ZFOL 1GXEA 4ODWA 3A6OA 3QUMA 2Y6SD 3RA7L 1TCRA 1XGQA 5C2BH 5KSBE 3LHPH 1F5WA 2R29H 1NBYB 1ZLVK 1W0WB 3FONA 4P57B 4NKMA 3DUSB 4YUEL 2HG5A 3KLDA 4M7LT 3ROLB 5HXMA 5CUSL 5DJYA 1A7QH 1I3RA 2HLAB 2HN7A 5CSZA 4ALAL 3KPMA 3F65A 1AC6A 2AABL 3DYOA 5D7IB 4GKSB 2G5BB 1ZANH 1ZT1B 2C9AA 2PF6A 3KPOA 1I3GL 1WZMA 3C60A 4YGVB 3W9DA 1T1XB 1F4YH 3BPLC 3JV5A 4I48A 1EFXA 3OMZA 3I3EA 4JFPB 4IOFC 3VCLA 1RIVH 5E00A 3RVVD 2Z8RA 2CUMA 1VADA 3KYNB 3A67H 3NH7H 4ZTOH 1AGDB 1J1PL 5CFHA 4GXVL 4FQIL 3QZWG 4FFYH 4PJXB 2HFEA 4AT6B 1ZGLA 1LO4L 4RMSA 4MJIA 3SDXE 4DKEL 4M5ZH 1RJZA 1ZA3A 3N1PC 2YPLE 4XT1C 3BQUD 4ZFOB 4CVXB 3GI8H 5D6CA 3PNWB 1YNLL 3QIBA 1U8OA 5T3XE 1MI5E 1T7XA 3VFMB 3CPLB 3L9RB 3RWIB 2R2HA 1KJMA 4TTDC 3P30H 4PJ9D 1TZIA 3BKYH 4E41E 4YXLL 1SEBB 4XHJD 1RMFL 4L1HA 1JF1B 4KK5C 2ZJSH 4F7MB 3HMWL 2ADIA 2ZNWA 1MJ7H 4YZFE 1A7PH 1YPZF 1T0NB 5BQ7B 3TJEL 3SDCC 1HINL 4MNQD 2C7UA 1CE1H 4JVPA 3PABB 4LNRA 2O61B 1QRNE 4WFGD 3P4OA 4DK3A 1KN4H 4KZEH 1QR4A 3ARXA 1E28A 1FN4B 1UQSB 5ICZB 4UDTA 4HX1A 3EYVA 1M7DB 3MRPB 1DBMH 1ZHNB 2W9EL 43CAB 5CEZE 4AG4H 4S1QL 1KF9B 5C0AA 1C1EH 1JL8A 4N0UB 4MD0B 3WDIA 2R0KL 1Z9MA 4Y2DA 3PWNB 4OCSL 5DRZB 2WSKA 3I9GL 3VD5A 1MFDH 4NBZB 3TN0B 4M48H 2Y06L 3RGVC 1YMHB 4U1IA 3QFJD 2D2OA 3I3DA 3UPAA 3RWGB 5CZXD 4C58B 5DJAB 2Q1EA 1XR8A 4P46B 1C16A 4NNPL 2XRAH 1IGCL 1NCAH 1ORSA 1NANI 1ZS8B 2ESVD 4P5TB 3BMVA 3GMQA 5CZKA 5LQBL 3K1KC 3FOMB 4PRDA 3QJFB 4FRWA 5JW5B 1HZHH 3IXAA 2QHRH 4JKLA 2IANB 4KJPD 4MQ7B 1WQVT 5D7LA 5IB1A 4NWTL 2X6MA 4PJAE 1CD8A 2NXZB 3HLAB 3B3IB 3K8LA 4R4NC 5DD1H 5D7SL 3V8OA 2YEZB 1YY9D 1WFOA 1VFOA 4P23C 1VPOL 2X70A 5D93B 1D9KD 5IEKB 1NCWH 1I7ZA 3BKMH 5ISZA 4PLOB 1AD9A 1CICA 3VXQA 5IFAH 1NJ9B 2QQLH 1GOFA 1JWMA 4HXAL 3S4SG 3E6HA 5JXEA 2FR4B 2ATKB 5BVJA 4MGXA 4KPHH 3MJ8B 3U0PB 5EU6B 1FLRL 4EI5D 1RJLA 3H2WA 4LLDB 3GSNL 1OQXA 1M4KA 2DLFH 5JXAL 2P5WE 1WFTA 5KSAA 3LB6D 5C08A 3UJTL 3AS3A 1U3YA 4OSUH 1NCBL 4LCWB 3C5ZD 4LCCA 5IMKA 2BVUA 5I8OL 3WBDA 1EA9C 4JFEB 3KJ6L 4LARL 1R5WA 4JPIA 1OARL 3M1BA 3QDGB 5DQJA 2A9MH 4HC1A 4IHOA 5GJSH 3NFNB 1WBZB 4ZUSB 3HC4H 1N8ZB 2JB6A 5BV7L 1J0KA 5F1KC 1T03L 4IRZH 4P5MB 4AM0B 2OXGA 4PRPE 3BWUC 3VJ6A 4ZYKA 1ACZA 4PRIA 3QI9D 1A1NA 2BSTB 3P11H 3IF1A 4DW2H 4DZBA 4LMQI 5IIEA 2CKBB 1P1ZB 5FUZL 4ENEC 2NW2A 2VZTA 4YH6A 3CMGA 4JY6A 3ESVF 1Q9LA 1E4KA 1J0HA 1OT2A 1JRHL 4W81A 2EXYD 1A2YA 5JMRA 4ZAKA 3I6KA 5GGVY 3U4BH 4FQ2H 1NGZB 3VGBA 1CL7I 3QSKB 2AJXH 3WL9A 5TDOB 4XP5H 2DWDA 3AREA 4NQDB 3PIQB 2OK0H 4N9OB 4TSCH 4KK9C 5M95B 3I02B 3VWKC 3WNKA 3FN9A 5D1ZA 1JNNL 2HT2C 4HC1L 1I9JL 2YKLH 4HG4J 4U7MA 5E95B 5GZOC 4HAGA 4V2CB 1SEQH 4GKOA 3EO1B 5D96B 2W38A 3LDBB 4HDIB 4NUJB 3ABZA 3VXRA 3KR3H 1FNFA 2BHYA 4Y89A 1KN2L 2B2XH 4PS4H 1ETZA 1CGUA 1NL0H 4OB5L 4M00A 2ITCA 1MEXL 3VXMB 2FL5A 1OAQL 4P49A 4JRXE 1HXYB 3ARFA 1QLRA 3OKLA 5T1KA 3BAEL 2OLDA 2D4FA 3T0EB 5ESVB 4PLNC 3BOVA 2EC9T 3K46A 1LHZA 4L4VA 2FSEA 4WTZG 3P3YA 1X4ZA 2ZG2A 3DX6B 3NOIA 4U1HA 5CWSA 5EO9A 1G1CA 3T8XB 1R3KB 3HC3H 3TV3H 1YEDB 1NAML 1RZ8B 3GM0A 4ZUVA 4KH2A 5SWQA 1NLDH 2D7NA 4ZD3H 1C5DA 4X7TA 1B88A 3W11C 4DUXA 1BQSA 4PY8J 5C07E 3BKJH 3L7FB 2VUYA 2GSIB 2BMKA 2HJLA 2XN9E 5DFVD 3O6FC 2APXA 4I4WB 4LKCB 3TA3A 1NC2D 2P8PB 2DIJA 3EYFA 3QDME 4JM2C 3BUTA 3FN0H 5CLTA 3MXVL 4X4YA 1G7MB 3UYRL 2YPKB 4OTXH 1KEMH 2UUDK 1HH6A 4G9FE 5IBLD 2AKRB 5I0DA 4YNYB 1DQML 4PGDB 1ZT7A 3Q6GL 3LKQA 3EOTH 4PJEB 1AR1D 5I75B 1ZWIB 4O2CA 2E7BA 4RISH 3QQNA 4O2FB 1X4XA 4JO1L 2V5TA 3FB5B 5ANMB 1XT5A 1FSKC 3TZVB 4KRNA 1IKFH 4JO4L 2IGFL 5ECJE 4XP4H 4N1CA 2BX5A 3O3BB 4DOHB 3QRFM 1UH3A 5B3JF 4WU5A 1M71B 1CG9A 4JLRB 2VLMD 3MJ9L 1CGSH 1HDMB 2OL3H 5LGKA 4OLZH 5GRUH 3HRZB 4KQ4L 5C0RL 1QZ1A 1FV1A 1LK2B 4PJFB 5FHAL 3M8OH 3P77B 4Q6IB 1DVFD 2F53E 5E8EB 1KIPB 1Z6JT 3BHBA 1FYTB 2HH0H 3UTTB 4GXUM 2E9JA 4LSPL 1B0GA 4FNLL 2X4QB 3KHQA 4I3SH 4IIQA 1RUQL 5JW3H 3CFDA 2XWBB 4JFOA 5HHVH 4AMKH 2XZZA 2CDEA 4PJCE 2BZDA 2XQYK 2WUCH 4TVSa 1QSFE 4KZDL 4U33A 3TCXA 4YDJA 1DN2A 5DYOB 1WTGT 1KB5H 5BO1H 3GM8A 2X7LB 2BNRB 2JJUA 3EFFB 4ZOBA 3TESA 4YHLL 1DANT 1NDGB 2GSGB 1G1YA 1OM3L 4HS3A 3FRUA 2RGSA 1FORH 2K9UA 1ODAA 5J89A 2Y25A 1J8HB 4KHTH 5FGBC 1AR2A 4UTAL 4OM1L 4GUPA 1PX3A 2NY4D 3O8XC 4MQXC 4UAOC 4W4NA 3ARDB 2DN7A 3D25B 3WIHH 3C6LD 4JY5H 4F7EB 5D72L 2VL5B 3I50L 5KSVA 3IJSA 4U1MA 3ULVE 3QRGH 4LCYA 1QD0A 3T65B 2E7LC 4P2YA 2VZVA 2FJHA 1W2KT 1RUMH 4XX1G 5HHQB 4LDLB 3ZE2F 2UYLA 5IM7B 1GGCH 2VZOA 3TFKD 1IQDB 1U8JA 4M61B 3OAYK 3TC9A 2J5LB 3BVNA 4WV1A 4DUVA 4K7FA 2AQ2A 1I1AC 2Q8BL 3DV4A 3ARBA 3EO0B 5FYKD 5ENWA 2O26U 2R4RL 3U7AA 2E7CA 3PXHA 4IJ3B 2OJZH 5KW9L 3DI2B 2C1OA 3U48A 3GMRA 4HKJB 3QUYB 1RU9L 5B38A 3TNNB 3U82B 5L0QB 1HNGA 3OF6A 1JPFA 2ARJB 1AXTH 5I71C 3GMPA 1ADQL 2J8UB 3FQNB 3KGRA 4PJIB 5TDNA 3ZT5A 4MS8C 5F72S 1JFQL 4LEOB 3QCTL 4S10A 1EPFA 2AEPH 5D1XC 4ZS7H 1VCAA 4M1DH 3K4DA 3DARA 1NEZA 1RJCA 3F7YB 1JGLL 3QBTB 3BIKB 2OTWA 3WIIH 2BRQA 2CJUH 5KSBB 1LDPH 2YSSB 3LKNA 5AUMA 3MLYL 2D0HA 3LRGA 3TWCL 5C0BD 3HUJA 1LO5A 5GS0C 2DM4A 4JHAL 2DM2A 2O5ZH 4FABL 3QWRD 3SCMA 4KGJA 5TE7L 4FQCL 3R0MA 4JFDE 1JCKA 2GJ6A 1MIML 3VFOA 3WUWA 5FK9B 1DN0A 3RUGE 2BNQA 3QDJA 4LRIC 1KLUB 2F9BT 4XNUH 3HMXH 2GQHA 4HPYL 1DBJL 4GRMB 4WEUD 1U92B 5J9PB 3F7PC 1OL0A 3SO3B 1YEEH 1KJVB 5F3HB 2VDPH 3MO1B 4LLAA 3HAEH 1DTUA 5FCUH 5IB3B 2G75A 4H8WL 4OJFL 2ID5A 1R24B 4YR6B 1N26A 4XRCB 4N1HB 1LK3H 4QTHA 5C09A 1P4LB 2YPLB 1PYWA 4JPVH 4D2NA 3LSOB 3QJHB 5B4MC 5FO9A 2HJFB 1MI5B 1BWMA 3WS3A 3KPPA 4OCXH 1A6VH 4QHNA 2UWEF 1KACB 4P9MH 5IROC 4NSKB 1TPXC 2NY5L 4E41B 1FE8H 5CKGA 1JGDA 1INQB 3LY6A 1T89A 1ZA6A 2WBJB 4S0TD 4MQSB 4O51B 3CCHB 2APFA 3KPLB 1DEDA 3SE8H 3TBSA 2W9LA 4XPGH 4ZUWB 3ZSTA 2IBZX 3L5WB 1A6AA 2XNAB 5GGUA 2IH1A 4M6NH 3GHBL 3GSUB 3KLHD 4Y5VB 3VH8A 4KKCC 1KCVH 2OJEB 2Q86A 4LHUD 4OI9A 1HQ4B 4DFHA 4GQ9H 2ZUQC 4R97C 3F5WB 4V1DD 5EA0H 5F97E 4OM0H 1MHHB 5TF1H 5MEQB 3IGAA 2BDNL 3SDCA 2J4WH 5DDHA 4QO1A 2DTML 1R5IB 5BVPL 3F12B 4K3DL 5DUPH 1EMTH 5IVNA 1CLZH 2V5YA 4P4RA 1V7MH 1RJYB 4A6YB 1S7RB 2WP3O 1U91B 3PGDB 5IVXE 5DHYB 5IHZB 4GW1B 4PV8A 5C6PB 1VKXA 2VJXA 5I1EL 2GFBB 2A77L 3D9AH 3ECBB 5TE6H 1UZ6E 3PP3H 1F3JB 1T2QH 4LFHD 1LP9A 1ULVA 4Y16C 4LASH 4MXQD 5JQHC 3LEVL 4LIQL 2BVEA 2LU7A 3AMLA 3ULUE 1ZLSH 4RWYL 1YNKH 4Z7UE 1S3KH 2AK1L 3DV6B 1WISA 1JGUL 1XF4A 1L7TL 1NCCH 4LCUA 3QUZC 4FFZL 4K55A 3L6FB 3RGVA 3GSVB 5FYLD 4F15C 4CMHB 4PJ7E 1JYNA 5KTEH 5GGRA 4PJAB 3UTSB 2NY2B 3V5DB 2KQNA 1WBXA 4Q9QH 1UZ8A 4TUOB 1EZVX 3VXTA 1IRAY 5T5FL 2RR3A 2BNUB 4XVTH 1KCRL 5CJXC 3IVKB 2PETA 3C2AH 4JZNA 3L5XH 5IVOA 3DWTA 3ARGA 3P0VL 3LD8B 1KIQA 2ZOLB 4YHOL 4KY1H 2N56A 2YPVL 4P23A 2WAHA 4ODVH 4LU5H 4QWWC 2P5WB 5D70H 1U8KA 5HGAB 4OF7A 4QXGL 5IF0A 2X4PA 1UACH 3WXWH 1GAFH 3SGDH 4U6YA 3FHAA 2Z35A 1D5BB 4LLQB 1WV7T 1BZ9A 1KIRA 4Y4FC 4UB0H 4F9PC 5E6ZA 2QV2A 1IJ9A 5KS9F 2P44B 1L0QA 1U8MB 2BVPA 2R8SL 4RGNB 5DD6B 2AGJH 1KCUL 1FLTX 5GHWL 1ERNA 2L4OA 1QBAA 3DVFA 2VXUL 4MJIE 1EEZA 4D8PA 4NN6C 3PWLA 5B39A 3VFSA 1HHIB 2EKSA 1QKZH 2WW8A 5IK3A 1NFDE 2GY5A 4NIKB 4KDTC 5ITBL 3S35H 3I6GB 4QXTB 5HDQL 4KDWA 1LE5B 1JHTA 1TXKA 3ESUF 4XPHH 3TIEA 3CK0L 2E6JA 5DZNA 5TJWK 2NX5B 3VFPB 2W0PA 1IT9L 3KYOA 4X6DF 1FO0L 1C12A 1UB5A 3QXDA 3TYGH 5J8OA 3ZDZF 2Y07L 1D5ZB 3VXNA 3DO7A 4XX1E 3MNVB 3WKNA 2HVKA 5ICYA 1J1OH 1AGEA 1Q94A 4QNPF 2BXZA 1UM6L 4CVZA 3LZFH 5TQ2H 3ZTNL 4UIMA 4JB9L 1MFAH 3LKPB 4WY7H 1MAML 1AQKH 1UB6B 1FVDA 1S5HA 3WO4C 4H26B 3TP4A 4PFEA 1INDH 1J05B 4XMPH 5FIEA 1SYSA 1FIEA 2I07B 4HIHA 1U8LB 3N9GH 1E4XH 5DJXB 1Y6MR 5D5MF 4BH8A 3NACL 1PD6A 1QEWA 3WD5H 2ADFH 3MV9B 3BZDA 5F9OL 2EIZB 5C0AE 1H8OA 3GB7A 3GZKA 3QEQA 3VWKA 4OZGF 2E3VA 4JAMB 3V0VA 4PTUA 3B83A 4UQ3B 1RZ7L 2FGWL 2R56H 5TPWL 4LK4A 2DYPB 4HKBA 3SDDB 1IM3A 4X0KA 4J8RA 1OQOA 6CGTA 1KJ3L 4FQQB 4IRSB 4LCIL 5AAMA 3NCBB 3N1GC 3SBWC 4HEME 3BE1H 4AENA 4R90L 4RSVA 4UT9H 2J7LA 2UVEA 1UA6L 4KI5C 1X7QA 4PBXA 4UT7H 3EJZC 4KJQD 4MCYB 5SX4H 3OKOA 3BPCB 1JNLL 1FL3B 5FYKH 4DVRH 4WHYH 2XN9B 4JZJC 5D7LE 2XIDA 1S7XB 5F7NC 2NZ9C 3PHOA 1YEFL 2CRZA 3QCUL 2MCPL 1IAKB 2OYPA 4JKKA 5HYQA 1RSFA 2V2TB 4PB9H 4JJ5B 5ISZE 2FATL 5EORH 5GRZA 4XBPA 1LE9A 2V9TA 3O6FA 4G6KH 3EOYG 4JQIL 3LS4L 4JM2A 2BFVL 1B2WL 3CVHA 4JDZB 3TN0D 1IL1B 1HWHB 4PG2C 3D1MC 3V6FB 4LLVA 4UV7L 5EU3B 4U49A 4Z78B 1KJ2B 1CDBA 5DJDA 1DBBH 3RNQA 5D2LE 4LOUD 1FH5L 2LTQC 2VAAB 5B38G 5EFIA 1MCHA 4MCZB 5CJOL 5C08E 2YZ1A 4HKXA 2WWKO 4P5TD 2MPAH 1YEHL 1AJ7L 2NY3C 3F6IA 1FZMA 4XP1H 4RBPH 5BMFL 2VLRA 2IAND 3KPSA 4LVNC 3G08B 1CFTA 1NEZG 2HRLA 4KRPB 5I1IH 3G6AB 5HGBB 3MCKA 2F53B 5MEPB 1JYVA 2NXZD 1Z9OA 4K3HA 4OZHF 3V6OC 5GZNC 4DQOH 2C3WA 4XNQB 1HYSC 2NY6B 1HSAB 3ALXA 3KNBA 4O9HL 1DBAL 5FYKU 3FO1A 2QADB 4LKXA 1FZJB 2GHWB 3LN5B 4ONGL 4PRIE 4E5XB 5CJBA 3WUWG 4NQVB 5CINH 5J3HD 3EDKA 1QSFB 2WK2A 5HHME 12E8L 1FZKB 1A6ZA 2H26B 3C8HA 5KVGH 4GLRI 4ZFGL 4F3FA 3W5MA 3G6JF 4A2MA 5FO8B 3L3HA 4HLJA 3HRPA 3WKMH 1H0DA 7FABH 4BZ2H 4L5FH 1OTTC 1T2JA 4FOMA 4I9WE 5CD5D 4OGYH 1FG2A 3U0TA 2H6PB 4W70A 5TDPB 1H3PH 4IEFB 4JFED 3GSRA 1F11B 4NZDA 2R23B 1YDPA 3QDGD 1BJ1J 5EBWB 1MLBB 3LKRA 3L3JB 5HBBA 1QP1A 3VXRE 5SX5K 3ZHKA 2Q8AL 4G6AC 3PHSA 1ORQB 1N6QH 3F62A 3PDOA 4FG6C 3RVWC 4PRHA 3RPIA 1NGQH 1PZ5A 3MRRA 4G43A 4NHCL 1MCOL 4O00A 5FGBA 3HZYB 4OLEA 2EXWD 1YJDC 3MRKA 5F9JB 4M7LL 4CUCA 5LBSL 1ITBB 2D9CA 4DKDC 3O8XA 4M8QA 1IGTA 3TCLA 4L4VE 1HOCA 1DEEA 5EC1A 5E2UH 3FO0L 1Y18A 5MEOB 2AXFB 2DLIA 4F7PA 3G04B 3ZKMD 2DQCL 2CXGA 3VH8G 4OFPA 5C0ND 1MHEA 5I1GL 2FIKA 3S4SB 3O2VH 2Q7YB 2E7LA 2AV1A 4NQDD 5C7XL 3GSQB 3O2DA 3BDBA 5HHPA 5T3ZE 1LNUB 1YQ2A 4DVBA 3QPXL 5J13B 4PJ5B 2VDMH 3BH9B 3RVXD 2DQGL 2APVA 2X4TA 1I1AA 2EO1A 3MJGX 4PGBA 1FG9C 1KG0A 1K3ZA 3P9MA 4CN4A 3VXMD 1Y6KR 2YN5A 4CU8A 1MJJB 2W92A 5FYLH 4WU7A 3NCYS 2HT3C 3T0ED 4KFZC 4XTRD 1SBSL 1NC4B 3DRQA 3RY6C 2Z93B 5HDBE 3ARTA 3DRTA 4LEXL 2VNCA 2OTUB 4AEIL 5B8CC 4B53A 1KBGH 5ADPL 3UXFA