2IAMB

Structural basis for recognition of mutant self by a tumor-specific, mhc class ii-restricted tcr
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
190
structure length
182
Chain Sequence
GDTRPRFLWQLKFECHFFNGTERVRLLERCIYNQEESVRFDSDVGEYRAVTELGRPDAEYWNSQKDLLEQRRAAVDTYCRHNYGVGESFTVQRRVEPKVTVYPSNLLVCSVSGFYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords HLA class II histocompatibility antigen, DR alpha chain
publication title Structural basis for the recognition of mutant self by a tumor-specific, MHC class II-restricted T cell receptor
pubmed doi rcsb
source organism Homo sapiens
total genus 39
structure length 182
sequence length 190
ec nomenclature
pdb deposition date 2006-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00969 MHC_II_beta Class II histocompatibility antigen, beta domain
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2iamB02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 2iamB01
3RI5K 1SVZA 3PWJB 1GC1L 1W0VA 5HHOB 5CINL 4I77L 2NY5C 2VABA 3HZMA 4HGKC 4N8CH 2I60H 3QXDA 3VWKD 3V6BR 4RX4D 1X6NA 3B8YA 3E3QC 2FR4B 2VLKB 4RCAA 3MRKA 2LU4A 4XRCB 4ZAKB 1LGVA 4LF3A 4D0DA 3MV7A 3TA3B 1DSFL 1FL5B 4X4YA 3MUHL 4HDIB 3LN5B 4DVRH 1X6LA 1YPZB 3RY4A 1IQWH 2VQ1A 4EI5C 5F7UA 2IPTH 4PRPB 5CJ5A 4WI5A 1HEZA 4MA3B 3B2UD 4JZOB 2ADFL 1WBYA 3CCHA 2CLRB 1FVDA 5KANI 4H5SA 2J6EH 2V2WA 3QIBB 3TPUA 2NW2B 5CD3A 3QHZH 4GAGL 3GI9H 2R1XA 1DQQB 5EOCL 4Z95H 4PJIA 4ONOA 5D1ZD 1FBIH 5AAWA 4J8RA 4RQQB 1ZS8B 3CUPB 1LNUB 2OYPA 3NCCB 3S98A 5MI0B 2V17L 2DTML 5K9OA 5D2LB 3VCLA 3PWUA 3Q1SH 3VFRA 2P8LA 3WFBL 3VA2C 3CSPA 1EJOH 1BBDH 5D7SL 1EPFA 2NY4B 4NKIL 1FGVL 3KYNA 1S9VA 1E0OB 1YN6B 4PY7A 3ARVA 1QG3A 2CJUL 2WLZA 4UQ2A 5A16A 1J12A 3FQTA 2NY3D 1NCDL 5FOBA 1MQKH 4PJEE 2VSDA 2F54D 3C5ZB 2DQTH 3WNOA 5DK0B 3F62A 4OCXL 4OBSA 5GS2D 4BSJA 3WBDA 5CD5D 1N5YH 1INDL 3GSRA 2OI9B 4Y0GA 3E1F1 2IANA 4UU9B 1NLBH 3D5OF 3B43A 1XF4B 5SWQA 1OTTD 2EIZA 4MNHA 2GW5A 2XZQL 3RZCB 2B2XH 4ZS6D 4WO4B 5I75C 1X4ZA 4EXKA 3BKJL 5I66B 2BCKB 4N0RA 4ZFGL 4ODXB 4LSTH 5T3ZE 5JW4M 1EIBA 4L4TD 4FFZH 1HYSD 3IJYB 2Q76A 4YHYB 4X9GA 3VE0A 4M48L 2CO7B 5E4IA 2GJJA 3FO1B 3QQ3A 3BH9A 3AMKA 3JBG7 3TIDA 1T2JA 2CRMA 1NBVH 2GT9A 1MI5B 2EIBA 5JUEL 4JDTH 1LEKB 1G9NH 1G9EA 1VPOH 1XF1A 4XNYL 2X70B 4NQXB 1MH5B 5C08B 1PFCA 1TQBB 3DROA 4JFDA 2H41A 3QFDA 4LDEB 4XMKH 4LLMB 5C0CD 5F3BB 3LN9A 4HIXH 3VXQB 3FQUB 4ZTOH 5K9KA 4WUUA 3MPCA 3UTSA 3SO5A 5IW1A 4GKSB 1AGFA 4RWYL 4QLRA 2DLGA 1RQ5A 2W1NA 4EDXB 3V79C 4Z78A 1MCNA 1U41A 3B6SA 5IHZB 1YNTA 3W9DA 5F7EH 5E8OB 1C08A 4OBRA 4E41E 4FA8A 4PJGE 3V6OA 1BGXL 3F6LA 4Z5RA 5EZJB 4O58H 5TJWK 4ZUTA 1I4FB 2H3NA 3U9UA 4MNQE 3ULUD 5BJTA 1P1ZA 4DKFH 4UNVA 1O7VA 3REWA 5F7DA 3OHXB 4KHTL 4XWOC 4H88L 4A6YB 1T66D 4FQXD 2DQCH 2NY1D 3VWJB 5IEHB 4KAQL 4QGYA 3KWWB 5TE6L 1JPSL 1DJSA 4JN2A 2DQEL 3TH3T 2OTWA 2QSVA 3L3DB 4K7PX 3FMGL 2ADIA 4QOKB 2VJXA 4I48B 5AEAA 1LE5B 2FWOB 4G8EB 3I75A 2A83B 3WUWB 2UWEF 5A40E 1HHGA 5IB2B 2BNQD 4R0LC 3AS3A 3WFDL 1EHXA 1WAAA 1OARH 1FE8L 3T3PF 2AJYH 3U0TA 5I1CL 5FB8B 2Y5EA 5IMOA 4RA0C 2FGWH 3LV3A 3OGCA 1G7QA 1H5BC 4E42B 3K4AA 1U8OA 1EHLL 4PR5A 4MS8C 1UWXK 4LAQL 5DHYB 1HH9A 4RMSA 5DGRA 1LK2A 4ZXBD 5CEZD 3MUGB 3FTGA 4BM7A 3WJJC 5E0QA 3QRGH 4MAYD 3E3QE 5B39G 3KGRA 4WWKD 3F58L 1CGUA 1EGJH 1XGUA 3L1OL 4C56A 5E5MA 1FYTB 2ZSVA 1I8KA 4N0CC 5TQ2H 3VWKC 4BZ1H 3LKPA 1FZOB 5GQBA 4F7PA 3OKLA 1KNOA 2UZIL 5IESH 4HUXB 1UM6L 3D69A 5GRVK 2NY6B 4YBLB 2OP4L 5TE7H 5E08L 2XZZA 1MHHA 2KBGA 4R2GB 5I2IA 4PJ7F 4PJXE 3JTTA 1I1RA 1BOGB 3EOTL 3GBNL 4HWBA 3BKCH 4LVOB 3FQNB 4C59B 1PQZB 5ACZA 3K4DA 1RIUH 4HV8B 5DMYA 4KQ3H 1A9EA 3AB0B 1HYRC 3B2UC 4UV4L 2PW2A 1G1CA 4MXQD 1SYVA 5MENB 4P23B 3QFJB 1RU9L 4KI5C 5I1HL 4HKXB 3LKSA 1BIIB 2YPLE 1KB9K 1GGBH 3VFTB 2XKNB 4POZC 5D1ZC 3MRIA 1Z3GH 2P24B 4LCWB 4RFNC 1KB9J 1PKQB 2ICCA 4A6YL 2H8PA 5AZ2H 3IDJB 4YPGA 5I9QC 3QIWB 4HS3A 5IF0B 2CGRH 5IJKA 5EZOH 3RZWA 2APVA 4G6AD 3NIGE 4JHAH 4KY1L 5GGTL 3CSYB 3EO9H 3VXUA 1D6EB 1ZA3B 2ARJA 4KUZH 4KKBD 3P9LA 1DFBH 2BVQA 4MQSB 2ICWA 1F4XH 4Y2OA 2VDOH 3U7AA 1P7QB 1RJYA 1UADC 3IDUA 3STZB 2VITA 1T5XB 3HZVA 4GFTB 3TO4B 2NY3C 1J5OL 2C5DC 5CJQH 4Y5XB 2IGFL 4HWBH 2Q8AH 3ZE1E 5DRWA 3QYCA 4OZIB 2DQIH 2WK2A 2OMBA 4U1LA 4OAWA 3U6RA 3O2DA 1S5HA 1P4BH 5CD5C 4G43B 1WZMA 4Z6AT 4JFYB 5DJZA 4W4OC 4OD2A 1OTTC 4ZOBA 4FQCL 3B5HA 1W0VB 2VABB 3HZMB 3QXDB 4P49A 3D87B 3LRSA 4APQA 1U3JA 5FM4A 4NQDE 2R0ZH 3QQ4A 3I3EA 1ZVYA 3MRKB 3L3GA 1E4XL 2OXHA 5KTEL 3ARRA 1ADQA 4L3ED 4RDQF 4LF3B 3FCTB 4D0DB 3MV7B 2OR7A 4X4YB 5I30L 4J4PA 1JNHA 2IQAA 3UAJD 5EBWA 2VQ1B 2AI0H 3L3KA 4PJ9C 5ID0A 4RGND 4ODWA 1I7ZA 5EBLA 4B5EA 2E6JA 1HEZB 5FF6A 1MCRA 3CFEA 5CZVH 2EDDA 1WBYB 3CCHB 1FVDB 4H5SB 5F7NC 4DN4H 3RUGF 1G7IA 2V2WB 2YRPA 3FN0L 3TPUB 1KFAL 5CD3B 2D9CA 1OGAD 1RZKL 2R1XB 3B3IA 1H8OA 4OF0A 4PJIB 5T1KD 3RKDD 3O2DH 1BVZA 5HVWA 3H9SA 4J8RB 1N8ZA 1N7MH 4F8QA 3GM0A 4DKDC 3GJFK 1I1CA 4OTXH 5K9OB 3I3DA 3U4BL 1QSFD 3KS0H 3PWUB 2YUZA 3VFRB 2P8LB 2HKFL 3OR7A 5FHAL 2X05A 3ZDXE 4JQIH 3WFZA 2JJTC 4HMDA 4OFYA 1QKZL 1CK0H 3EYFA 3KYNB 3SE9L 1S9VB 2EYTA 3HC4L 1UC6A 4OCYH 5HYJD 1T66C 4FQXC 4PY7B 1CT8A 1II4E 3HRZA 5A2IH 4X5WA 4UQ2B 5A16B 3FQTB 2UWEA 5BOPA 5IT2L 5FOBB 1WCBA 4GMTH 4UQ3A 1AR1D 5C6TL 1GOFA 4YX2H 3NGBB 4G5ZH 2OR9L 4GS7C 3SE3A 3GSRB 4E41A 4PV9A 1EO7A 3FB8A 2IPTL 2IANB 3VXTA 4XPBH 2JE8A 4DZBA 5SWQB 5EU5A 3CFIC 2EIZB 4MNHB 3JWOL 4MNQA 1CXEA 1RSFA 1S7TA 1Q0XL 5T3ZH 4JZNA 1J8HA 1CL7I 4P5TD 2NTFA 3GI9L 1J8KA 1EXUA 5KJRL 3VMOA 2Q76B 3VE0B 5I6XB 5EH1A 4N68A 2HT4C 5T3XL 3QQ3B 3BH9B 3PXJA 3WIHA 3TIDB 4PRNA 3CZJA 5CKAA 2GT9B 3IAPA 3Q1SL 1FHGA 4FP8L 5DURD 3X3FH 3QHFH 3QBTB 1CDIA 4BZYA 4P48A 4KGLA 4W6XB 4DGYH 3DROB 4JFDB 3QFDB 2LAAA 2DBJA 1EO8H 4M4RA 3WMSA 4XXCC 5C9KA 5BMFH 5F3HA 3BESR 3VG0H 1A5FH 2B8OT 3X14A 1NH6A 5K9KB 4WUUB 4G6JL 3UTSB 4KJQC 5IW1B 3ROOA 1MQKL 2A9MH 1AGFB 2XY2A 1REIA 3W81A 3U1SL 2R8SH 4Z78B 1F6LL 4O4YL 3B6SB 5IJVA 1YNTB 3W9DB 4Q9QH 3EO1A 2GKIA 4X0KA 1C08B 4KI5E 1DBKH 4Z5RB 2HLFD 4UV7H 5DDHA 4ZUTB 2CXGA 2C3WA 2H3NB 3U9UB 4HZAA 2OTUA 2W92A 3BAEH 1TVHA 1P1ZB 5BJTB 4ALAH 2RHEA 2C3VA 3NBNA 4XCFH 3REWB 5F7DB 2C4FU 1IAII 4TUJA 4OQTA 1IKNC 4H1LA 5DD5L 3OXSA 1BFOA 5JMOC 5CEYA 5DHXB 1MCDA 3WIHH 1D5BA 4KVCH 4EI5A 1JJUA 4RMTA 4JN2B 3O2WH 4BFIA 5J13C 4MJ2A 1J0ZA 2ADIB 1GGTA 3DSFH 4HXBL 1OL0A 3I75B 2WUBH 2VLJD 4WI7A 4WUKH 5FGBC 1HHGB 1SY6L 3ZSTA 2EDRA 1FL6A 4GXUN 3VXSE 4UILH 3BVNA 1FFNA 3FFDA 3U0TB 5E1HB 5IMOB 2B0SH 4KKBC 3LV3B 3SKJH 3U7WL 4DW2H 3OGCB 1G7QB 1MPAH 1NPUA 4IMLA 3B9DA 1KTLA 4R4FL 2NY5H 3HLAA 1U8OB 4O5LL 3OPZH 4P9ML 4S11A 2A0LC 1ITCA 2M2DA 4PR5B 3NPZB 3MLZH 3DV6A 2FECL 4ZUWA 3CNKA 1HH9B 4O58L 5SX4H 1LK2B 3S9DB 3KG5A 4AL8L 4YR6A 3FTGB 1V7NH 4K7FA 3S36L 2E9WA 4OQTH 3FB5A 3SDAA 3BIKA 4H1LH 4C56B 1XGUB 5FM5M 4NBZB 5E5MB 3K1KC 2ZSVB 1I8KB 4MJ6A 4YXKH 4Y2DD 4L9LC 3RX7A 1KCRH 3EO0A 4KKCC 2PTUA 2X1PA 4JHZA 3LKPB 2HH0L 3DO7A 4JQXC 4F7PB 3OKLB 1KNOB 4I4WA 1NGXB 3G6DH 2H2PC 1CFBA 1UWEL 3D69B 2XXMB 5C0AA 1MHHB 4I1NB 2NNAA 3Q0HA 4V1DA 3MNVA 4XP6H 3JTTB 5I8OH 5FYLL 1QSZA 3NACH 3UAJC 2AJYL 5JW5A 5ACZB 1NLDH 4RGNC 5J12B 3T2NL 3RUGA 1A9EB 5CSGA 1HQ4A 4YLQT 2HKHL 2VDKH 5EOQH 2PW2B 1Z6JT 4BFBD 3X17A 1MAML 3GJEA 1SYVB 3NIFF 1A4KA 2X09A 3TBYA 3LKSB 1AY1H 3KPNA 4PJHE 1W72H 5JIPA 1UM5H 1ZANH 4NQDA 5J6GA 1R3LA 5H37G 2EDXA 1RZIA 4R7NA 3MRIB 1V8HA 2Y6SD 3T65B 1IMHC 3HZYA 3VXMD 1FG9C 4ODHL 2H8PB 3ARED 4YPGB 1F58L 4HS3B 3PGFH 1E28A 3IFNL 3WXVL 3V52L 1MREL 3BDYL 1KN2H 1RUPL 1BQLH 3DXAE 4WIQA 3VXUB 1IEAA 1LQSR 2ARJB 5LVEA 3TT3L 3P9LB 2BVQB 1Q94A 2ICWB 1JGVL 4TSAH 3TV3L 2DIBA 4FABL 1RJYB 1WF5A 1WWAX 1TETL 3DX9A 1HILA 5DWUH 2VITB 2R0LH 3H42L 3HZVB 1UT9A 1QVOA 3C8DA 3HMWH 5DRWB 3ULUF 1RV6X 4U1LB 3P77B 4OAWB 3U6RB 3VGEA 1S5HB 4CU7A 1RIUL 2BY2A 4YHPA 5DJZB 4XPTH 1N6UA 1NGWA 4OD2B 3U0WL 5HGHB 1E6OH 2B7DT 4OSUH 3CX5K 5CEZE 3LPWA 1ZK9A 3ALWA 4I0PC 2J88L 4RBPK 4X7CC 1MNUL 3LRSB 5E6YA 4APQB 3LOWA 4R0LA 3S97C 4XC3L 1OAYL 2DQHL 1E4JA 3ZDYE 1I75A 3L3GB 1XF2A 1H3VA 4DZ8B 4TRPL 2V5MA 1JNHB 1RUQL 2IQAB 4KFZC 3T3MF 5EBWB 3L3KB 5ID0B 4H8WC 4ODWB 1I7ZB 2WLYA 3TBSA 4G8IA 4LRNH 5FF6B 1NC4D 4DCQA 3CFEB 1F4XL 2D7NA 3IDYB 1FNEA 1LP9F 3IDNA 1G7IB 1N3NA 3IXAA 3RI5F 3WJJA 5C2BL 2SEBA 5I71B 2DI8A 4QRPD 1UG9A 5F1KC 2DJUA 4WCYH 3N9GH 5F7FA 4HWBL 3B3IB 2QL1A 4HC1A 3H9SB 2YK1H 1N8ZB 3MOAH 3MXWH 5IGXH 3VWKA 4UB0L 4RX4A 1IJ9A 3OR7B 1WFOA 1A7NL 3U46A 5KS9F 3MLWH 3MNZA 3WHE1 3FHAA 1XIWD 3EYFB 4PBWD 1HZHL 2EYTB 5DVNA 3FHQA 4PJ5D 4OZHE 43CAA 3OB0K 4LSVH 1T22A 3E0GA 3HRZB 3IFPA 4G7YH 4X5WB 4PRHE 4CVZA 5LXGH 2UWEB 4QRRD 1WCBB 4EDWH 5D7IE 5BO1H 4UQ3B 3NPSC 2AABH 1Y0LA 3GDBA 3QUXC 5FUOL 2GK0A 3P11H 4X9BA 5I8KL 3WN5C 5GGVL 4EQ2A 3OAZK 4E41B 4PV9B 4TTGA 4PJFE 3FB8B 3VXTB 1U8HA 4PUBL 3KPLA 5EU5B 2ID5A 2APXA 4EN3D 5DMGD 3AU1A 5D1ZA 4JFQA 4Y8AA 1S7TB 4WNQB 4ONGH 4GKZA 1UQSA 4U3CA 4C4KT 2WWKT 4JZNB 1J8HB 4HC1H 2Z8RA 2NTFB 4LMQE 4GXUM 5KVEH 1EXUB 4HX1A 5F9DC 4M6OH 4RRPG 4RAHA 2FO4A 3V8OA 2MQ3A 1MY5A 4JHBA 3HN3A 5IQ9A 2VH5L 3KR3L 1MRFH 1FDLH 3JV5A 4KH2A 2HLAA 1MLBA 4WGWB 3U9PH 4QKXB 2EC9U 1RUAL 3SPVA 1U95A 2AXGA 1GZQA 4L3EE 5DD1H 5HYSA 3IJHA 3HE6C 4Y2DC 2F54A 4HEPG 4JFOA 3CD4A 5F3HB 1ADQL 3X14B 1HKLH 3GNML 4YXHL 3T0EC 3ROOB 1WGOA 3MRPA 4W4OA 5IFAL 5E00A 1NCCH 1D5MA 2FX7L 5IJVB 3FO9A 4G5ZL 1HXYA 3EO1B 4MD0A 4X0KB 2KZ1B 4LSSH 3NAAH 3QDMD 1FFOA 4M1DL 4M7KH 4XPBL 5DDHB 1LK3L 4X5XA 4L4TA 2OTUB 3UC0H 1KIUA 1TVHB 2C3VB 1KLGA 1EHNA 3CVIL 4P59H 5KAQG 3PNWA 4HXAL 5B39A 3W5NA 3VW3L 4TUJB 5IVXE 1PGRB 1QR4A 2ENSA 4XCYA 5F7LB 4H1LB 3N50A 2UV3A 4L4VE 3OXSB 1BFOB 3PWPE 4R90H 1QSFE 5FA3A 3VGFA 5C71A 1FAIL 1DL7L 5CEYB 1QOKA 5FDWA 1D5BB 4ETQA 2ATPA 5HHME 4EI5B 1AQKH 4OZFA 1MCIA 3S35H 3MLXL 4BFIB 5F6HI 1Q72L 1T89C 5B38A 3NCMA 2VZ3A 3X3FL 1F3DH 3CFCH 4E5XA 5C0CA 1PEWA 4YDIH 3QHTC 2C7UA 2Y23A 1ZHNA 1T83C 3HNTH 5E2VL 1FL6B 2YUXA 5B3JF 4ZO7A 1M7DA 3IFOA 4MQTB 2P5EE 3BVNB 1FFNB 3FFDB 4JPVL 4K3EH 3OQ3B 1F00I 5DEFA 2ADGA 3GI8H 4IMLB 3QDGE 5JORA 2BOCA 1KTLB 1R0AH 1KG0A 1A3LH 2H6PA 2HT3D 3HLAB 5E95B 3NCEB 3DV6B 4ZUWB 1TJIH 1NAKH 3IETA 3B9AA 4JG0L 1QD0A 2CO6B 2E27L 2O26U 4YR6B 2VZSA 4FQXA 2YD9A 3MBED 4K7FB 4LIQL 3UYPA 3LS4L 3PHQA 2O5YL 3QCVL 4PGZA 3FB5B 3SDAB 3BIKB 5HI5C 1WVZA 4MJ6B 4U6TA 2OTPA 2VN4A 4IMKC 5C07E 3EO0B 5D71L 3DO7B 2BNQA 3S37X 1YYMH 5M94B 4I4WB 1TJGH 5DO2D 1RZGA 2HN7A 2WUBL 2ZJSL 5B22A 5C0AB 4R8WL 5I75B 5DUML 2NNAB 4V1DB 3MNVB 3HNSH 3S88H 2NCMA 3GSXA 3K8KA 5JW5B 4GKNA 1V3JA 4MZ3A 2X42A 4DKEL 1J1XL 1LP9A 1NCAH 3RUGB 4UOW1 4DW2L 1HQ4B 4Y4KD 2J8OA 4OZGF 2W9EH 5C6PB 4ZXBA 3FB7A 3GJEB 5IOPA 1A4KB 1LO5A 2IG2L 3TBYB 4KKAC 4EOWL 4MAYA 4JKMA 4U49A 3KPNB 4LVNC 1HQRA 1K3ZA 4NQDB 3OSKA 2XTJB 4WWKA 5J6GB 5JTWA 1R3LB 4ODSH 4K9EC 1RZIB 4R7NB 2FATL 1DCLA 4BZ2H 3HZYB 4M6MH 5KS9A 1GXEA 4RFEA 5ILTL 4X9IA 4PPTA 2M1KA 2H2SC 3VI4E 1NMCB 1E28B 1L7TH 4YXKL 4O9HH 5E2TH 1AXTL 1U8QA 1IEAB 2FCBA 5I1GH 1IE5A 4EQ3A 1Q94B 2E3VA 3DX9B 4QRTA 1HILB 3HAEG 1QVOB 1IKNA 1OD7A 1FC1A 2N7BA 1NL0H 4Z8FH 1TJHH 5HY9A 3BO8A 3NIDF 4K8RL 4YHPB 1NGWB 1KTDA 3MV01 1C1EL 5KVDL 1OY3B 4WU5A 5EOQL 5CEZH 3TCLA 5DMGC 1PZ5A 3V95A 3RNQA 2X4OA 5CJXC 3PP3K 4KK9D 5FGBA 4D3CL 4R0LB 3L5XH 4K3GA 5E99H 1VFUA 5BV7B 2ZCHL 2WP3T 2MCG1 4FQPA 2F5BL 4G7VL 1XF2B 5AYUH 2AK1L 1ZVSA 5D7IA 3ARGD 3T0EE 5SWZE 4MHHI 3FRUA 1E4XI 4R26L 4N9OB 3SQOL 2N56A 1BQLL 5GRXG 5J3HD 4KRNA 3TBSB 1OP5H 4G8IB 4DCQB 3G5XA 2R1WA 4LRIC 1FNEB 3IDNB 1N3NB 3OG4B 3UDWC 4YHLL 4OCWL 2SEBB 3GM8A 3IFLH 4X9HA 1K9TA 3F5WA 5IQ7L 1K4CB 4EKXA 5A2FA 4NT6A 4L9LA 1Z5LA 3SGDH 3VWKB 2VDLH 4FZEL 4LPTA 2IPKA 5FCUH 3L5WA 2E8ZA 5DTFA 4FQJL 5L2KE 1CGSH 3U46B 4KRPD 4BFGA 3MNZB 4NO2A 4Y4FD 3IS0X 4NQED 3K46A 4L3EA 2ITDA 3VFVA 1YYLH 4HIJA 43CAB 3Q5TA 1MCJA 2QJDA 4I3RL 5EFIA 1T22B 4U3XA 3IFPB 1VFBA 3JWDL 4CVZB 1CFVL 2EECA 3OKEA 4XTRD 1Y0LB 2JCCF 2GK0B 3BPNC 3E8UH 5E8NA 2DOCA 3G6AA 5F6IC 4PLJD 2FIRT 2XG5A 1Z0NA 1U8HB 3KPLB 1IGIL 3AU1B 5D1ZB 4JFQB 3FO0L 2OL3H 3C6SB 4OKDA 4GKZB 5GRYA 4EBQH 3WDJA 4XZUA 1UQSB 2Z0BA 5KN5A 4KDTC 4RFNB 5IVXA 1QBLH 1CXHA 4YHZH 4UNTA 3HNVL 1S7WA 5D1XC 1NEZG 3GK8L 4HX1B 5GGUA 1QSFA 5IHUH 5CGTA 2FO4B 1DVFC 2HT3C 5I19L 5IQ9B 4Z7NF 2DDQH 2CQVA 4X6CE 5HYJA 4LPYA 2HLAB 1MLBB 3F7VA 4W68A 3MBEC 1CD9B 1U3ZA 2AGJH 2P49B 3SPVB 3BI9X 1U95B 1A7OH 2WNGA 2AXGB 1GZQB 3W39A 3DRTA 3KXFE 4FRWA 2OK0L 2NY3B 3C08H 5BV7L 1WZKA 3IJHB 5HYSB 3LH2H 4I2XA 5TF0A 2IALA 2F54B 4JFOB 5EIIA 1JPTH 2IADA 5MEPA 5JQ6L 3D1MC 5AZEL 2CRIA 2IC2A 2NXZC 2V7HA 4OF7A 3KHOA 1HSAA 5C0RH 3MRPB 1NSNH 5E00B 1I8MA 3P11L 5DO2C 1WJ3A 2NY7H 4FQHA 1D5MB 3MLSH 4UTAL 3A6CH 3FO9B 1S8DA 1HXYB 4MD0B 5T5FL 4WFFE 3RKPA 1RJCA 2C3GA 1FFOB 3QG6A 2DIAA 4YBQD 5C0IA 2MWCA 4AT6A 3GHEH 3WSQL 5D7LD 4X5XB 1KBGL 4L4TB 4OZGA 4DFHA 4ONGL 1MCPH 1FPTH 4TNVK 1SJXA 1KLGB 5I18H 3PNWB 1QPPA 1L9MA 5B39B 4HC1L 3DVGA 4O2EA 4XCYB 5KVEL 4KRLB 4M6OL 1T7YA 5FA3B 1JZ6A 5FDWB 3CFDA 2Z4QA 1MRFL 4ETQB 1KEML 2ATPB 4JREC 1NGPL 4OZFB 1J1OL 1JWSA 4IBLT 5JPNA 4YFEA 2A77H 5B38B 5CLWA 4E5XB 4LHUG 4LDLB 5C0CB 2AJXH 5DC0A 2C7UB 3V4UH 5IMKA 4OM0H 1ZHNB 5CGYC 3X12A 3FKUS 1N64H 1Y18A 1PZUB 3IFOB 4WHTA 2XPGA 5GJTH 2DL2A 2AEPL 1KGCE 1HKLL 3D3VE 3LIZL 3VFOA 3FN3A 1UJTA 1OGTA 4UT7L 4TTDC 5DEFB 2ADGB 1F11A 1NBQA 5JORB 2BOCB 1KG0B 3EZJB 4HBCH 2H6PB 3FQRA 4IRZH 1UWXH 5KSAD 1I3VA 3QZWG 3NAAL 5CILL 3IETB 1UH3A 4S1QL 4FQXB 2NY1B 2FECI 2HAZA 4NPYA 3CPLA 3QB7C 5JOFA 2DF3A 3MLTA 3PHQB 1YN7A 1I9RL 4YUEH 4HK3N 4Q58C 1IT9L 2ED7A 2YHGA 3SDXF 1X5KA 4P4KD 3DUUA 4WI9A 1KTRL 4TVPD 4L1DA 5GGVY 4OFKA 1CF8L 4YHKH 3WN5A 4H8WH 4MQXD 2VLJA 2F8OA 4GS7B 2F8XC 3H3PH 1IC4L 2BNQB 1BJ1J 3VFSA 1MFBH 5D5MF 2EDEA 1RZGB 2HN7B 4IRSD 3V4PH 1I85A 4FQ2H 1W8NA 2R39A 1N4XH 4YDIL 4K94C 3RNKA 5HDLA 3MODH 3O9WC 3HNTL 3ARGC 4R97B 2Y07H 3GSXB 4NM4H 4M5ZL 3T2OA 1OAKH 4GKNB 3ET9F 1OCWH 1LP9B 3BUYA 2RIKA 2A9NH 5BRZD 4ZXBB 3FB7B 4MCYA 4OQ1A 5IOPB 4IDLA 5GSVA 1LO5B 4MAYB 2X9WA 4JRXD 5SWSE 5HHVH 1HQRB 4XNUH 4WWKB 4LARH 5IWLC 1BQHG 5H37H 1I9IH 2DJSA 3BP6A 3KPRE 2AJSH 4ZYKA 4Y2DA 5I9QB 2EH8H 2NXYD 1NCNA 1FIGL 5KS9B 3WFEH 4RFEB 1P2CA 1MJUH 3SDDD 2X9XA 5EO9A 1ZWIA 5JHLH 2GCYA 3SGJA 4P9HC 1YYML 4OM1H 1X5ZA 3ZDZE 2APBA 4XVTL 2WAHA 5CLTA 4QRTB 4OT1L 4JFXA 4NDMA 3I2CL 1RURL 4XTRC 3SOBH 1SEBA 3ZKXC 3S88L 4X6DF 1EBPA 1UZ6F 4LP5A 4K23L 3S3JA 1LVEA 3WD5H 2AK4D 1BQSA 3BO8B 4PLJC 5HY9B 1D5IH 4JHWL 1JCKA 4WU5B 3GBMH 3TCLB 4ZMAT 1ZXQA 3TJEH 5E6ZA 1PZ5B 3ULUL 4LHQB 1T89A 3HMXA 3RNQB 1RIVL 2X4OB 2EC8A 4OF5A 3MZTA 3VXMA 5CCKH 3UTTE 1JI1A 1UVQA 1YJDC 1T83A 2VLRE 3OAYK 4KJPC 3DHMA 4IDJH 4BZ2L 1EFXA 1OSPH 1JE6A 1WUNT 1WSST 1ND0A 2BNRD 5CWSA 1ZVSB 5C09D 3FRUB 3DTXA 1P84J 1LE9A 4DGIH 3VRIA 4OF6A 2BHYA 4WEBH 4N0FA 3O4LE 4L9DA 3U48A 2BFVL 2P5WE 4RMVA 5IROA 1AI1L 3G5XB 2R1WB 5ICZA 1OM3H 3QEHA 4WFHE 4XBEH 1W0WA 1A22B 4MAUL 3F5WB 1QACA 4JFZL 1MFEL 1JGLH 4M03A 4Z8FL 1LO2L 4NT6B 3GJFH 1BX2A 4L9LB 4IMKA 4X4ZA 5IKCA 1Z5LB 3V5HA 1Q0YH 4MDJA 2ICEA 5E5UB 2IPKB 3IU4H 3L5WB 1TQCC 5DTFB 2WZPD 3RVVD 4NO2B 4G3YL 4FFYL 3CLFH 5ICXA 3H3KA 4HS6A 4L3EB 1JMXA 2ITDB 3VFVB 4HIJB 1U2CA 1JF6A 2B1AH 2RR3A 5EFIB 4Z7OE 4JPWH 1VFBB 3LQZA 2B1HH 3CVHA 4X9FA 1JNLL 5ETUA 4KK8D 4RGNB 4KVNH 4OD3L 3OKEB 5I16A 3WYRA 5JDSA 4JFEE 2BOBA 1T4KA 4TSCL 1KCSL 5E8NB 1NC4A 4YWGH 5I1IL 4G8FA 3S3PA 3G6AB 3QIUC 3N1FC 3ZT5A 4OFPA 5CHNA 5AYQA 4JDVA 4QRPA 4LQFH 1HINL 5H2BA 1PKOA 3ABZA 2ICWI 4ODBD 1H0DA 3HS0A 4XZUB 5KN5B 3DO3A 1UA6H 3VRLE 2YA0A 4TYUA 4X83A 5DZNA 5IVXB 3UBXA 4S0SD 1S7WB 2OZ4L 3PV6A 5GGUB 1YC7A 3MBXL 1QSFB 1YQ2A 1FNSH 1QRND 2DLFH 1OAXH 4LPUA 3ULVC 1XIWA 2IEPA 5HYJB 3KJ4C 2D7MA 2O5XH 4PJ5A 4WW2C 3SDXA 1X44A 3F7VB 1HCFX 2BXZA 4Z7VF 4RAUA 2J8UE 5DUBA 2UVEA 2BVOA 2VC2L 3W39B 3DRTB 4QRRA 1J10A 3LD8C 4I2XB 1N2RA 2IALB 4GQ9H 3CVHH 5EIIB 3ARDD 5D5MA 2IADB 3M45A 5MEPB 5EZIH 1D3CA 5AWNH 1CLZH 4LNRA 2V7HB 1QBMH 1HSAB 3LMJL 1JNJA 3C87A 2FB4L 1RVFH 5CIPA 3IKKA 1I8MB 1QLEL 4Y5YB 4FQHB 4EN3A 3S5LG 1S8DB 1A6TA 1EUUA 3QG6B 2FYYA 5CJXA 3WJLC 2AJVL 5C0IB 5TE4H 4AT6B 4P5TB 3BYYA 4K9EH 1K85A 5GGQL 1LO4H 4OZGB 5H35A 1XGQA 3PG2A 5ADPL 1WTLA 2IMMA 4TOYH 1CFQA 3DVGB 1F5WA 3T1WA 4KPHL 2VXVL 32C2A 4J6RH 3C60D 3CFDB 5DURB 2Z4QB 3O11A 5EU7C 1ZGLP 3QR2A 1JWSB 2PXYC 2RB8A 2FGZA 3RU8H 5JPNB 1UKQA 4KGJA 4LRIA 2NXYC 3UDWA 5IMKB 2HTLC 2COQA 3X12B 1Y18B 1EZVY 3FOMA 4WHTB 2XPGB 3SDDC 5I15H 1X5JA 3VFOB 5C0RL 3L3IA 3NABL 1OGTB 1SBBA 2DB8A 3ARUA 1F11B 2NY7L 4X6DA 2FLRT 3FQRB 4X7EC 1HH6A 1MJJA 3WLWC 5D6DC 3LKNA 1F4WL 3W2DH 1ZHLA 4F7MA 1JN6A 4U4BA 5IVNA 2XI9A 1JGUL 4HBQA 1MCPL 2DLIA 3MLTB 5JOFB 3RWHA 2ZOLA 2BDNH 4M1CC 5B4MD 3MO1A 4NKOA 4D2NA 2X1OA 3NPSB 4HG4K 3DUUB 1G7LA 3MLUL 3EYSH 3WN5B 3M1BA 2J3SA 2VLJB 4N0YH 5FGCE 3VFSB 2GTZA 3MLYH 1BLNA 1EMTL 1S7UA 2AJXL 2JLLA 1G9MH 3RNKB 4NCDA 3QQ9C 1G7PA 4N90E 4KDTA 1JHKL 4MX7A 1SVCP 5ALBH 5D1XA 5DD0H 4AH2A 5A2JH 4RMUA 3UJTH 4XAKD 1B2WL 2HYMA 2R56H 3BUYB 3EBAA 4KJYA 3MROA 4MCYB 5D7LE 4JCMA 4KTEL 1B6DA 4OV5A 3MBEA 3CXDH 2Q86A 3LKOA 3NA4A 3EFDL 4HJJH 3GRWL 3BP6B 4Y19D 4ZYKB 3QO1A 4Y2DB 3NCBB 2WWMD 4XNXL 1QFOA 1RFDH 5L88L 1DQLH 1T0NA 1KJ3H 1P2CB 1F3JA 2NYYD 5B21A 3UPRA 3RVVC 4BQ6A 4KMTL 5EO9B 1S3KH 3HI5L 2GJ6D 1MFCH 2NQCA 4MJID 1ZWIB 1AO7D 2GCYB 3HPLA 5EC1A 3DGCR 1ZT7A 5IBUB 5MEOA 3N0PB 4UTBH 4YHMH 2APTA 4N1EA 5F9JA 5DJ6A 1BF2A 1YECL 2EEBA 5D72L 5I74C 3M8OH 4JFXB 3HAEH 1RAMA 1FL3A 4W70A 1SEBB 5JW3L 4Y4KA 4NM4L 4G8GE 1OAKL 5I1LA 5EPMA 1YEGH 3FOLA 4NRZA 1CGTA 5FHBH 1JPFA 3HC0A 3ULVE 1WLHA 5TF1L 4RBPH 3T0XA 3VXMB 4JB9L 4B0MM 1UVQB 3MJ8A 3UCRA 1MHPH 5ACMA 2V7NA 4S1RH 2IAMC 3L5HA 4KKLC 3ZTNH 1SYSA 2EH8L 4YIQA 1J9CT 1ND0B 4NC0B 4OLZH 5I1JL 5CWSB 4GW1A 5F9WC 5DXWA 1BFVL 2FLBT 4JFEA 3DTXB 4CN6A 4UUJA 4LDOB 1CXIA 1K8DA 1MJUL 4OLYH 1LE9B 4XP9L 3VRIB 3LDBC 5LGHL 1PD6A 4N0FB 3CIQA 3GHBH 2QLVB 1MCWM 5ICZB 4LSRH 4U6VH 1BM3H 3QEHB 3CX2A 1W0WB 3SOBL 2Q20A 3LKQA 1J0JA 1NEZA 4DK3A 4Z7QE 1BX2B 1L7IH 5GS1C 5IKCB 1T7VA 3V5HB 4MDJB 5EU7E 2CIIA 2ICEB 3R1GH 3PIQA 5CUSL 4L29A 4Z18A 2L4OA 3FRPA 4EIZC 3MJ7A 3T08A 1G6VK 1A1NA 5ICXB 5CP3H 3WNLA 4HS6B 4L8BA 2IH1A 3OB0H 3QI9D 4X5LA 3ARGA 1OWRM 4DN3H 2MQCA 3LQZB 3CVHB 3DETD 5ETUB 3NA9H 4PY8J 3LEYH 4WENB 1KPRA 3BGAA 4XB7A 5I16B 5JDSB 2BOBB 1T4KB 5DJAA 4L5FH 1NC4B 2YUVA 1F8TH 3OAZH 2EDFA 4G8FB 2FNBA 4LLWA 4O00A 4HFUH 1ZLSL 4ZUUA 5CHNB 5C0ND 1H3PH 4M62H 1CFSA 4JDVB 4P46D 4QRPB 1Y6MR 4OUUA 5H2BB 2QSCL 1CYGA 5HHXH 1H0DB 1B9ZA 1NMAH 5IBLD 2ZKHH 2H32H 3UBXB 3SDCD 3PV6B 3O0RL 3MXVH 1YQVH 1VADA 5GGSA 3MRRA 1XIWB 3TN0C 3D9AH 4NQEA 4UMGA 1NMBL 3GEWB 1S9XA 3HMXL 4PJ5B 3SDXB 1YNKL 3ECBA 4QHUA 5ECJE 2V9TA 4QTIH 4RAUB 4K94H 5DUBB 4PRAA 4LHUA 2BVOB 4JQVC 1OAZH 5B4MC 1B4JL 5FO7A 4QRRB 2BNRE 1INEH 5C09E 4C54A 1N2RB 5D7JD 5D5MB 1SMOA 2JELL 1CDUA 5CAYB 2G5BA 5F71A 4LNRB 3IT8D 5F9OH 4LSPH 2DMBA 5ITBL 4IM8A 1P4IH 2EDOA 3NZHL 3BKYL 5CIPB 5D93C 1S7SA 3O41A 4EN3B 1A6TB 2CR3A 2FYYB 4NZUH 1KTKE 4TPRL 4F3FB 4LQFL 4BH8A 1U8IA 1VGEH 2XA8H 2EDBA 5H35B 1XGQB 2APWA 3OJ2C 1KJVA 3QNYB 1B0GA 5L9DH 1CFQB 3A6OA 4KXZI 1K8IA 2RBLA 1OTSD 5GISL 4I9WD 2DMKA 32C2B 5MEQA 5D70H 3CZFA 2DLFL 3IRPX 3O11B 4P9HH 3QUKA 1BD2E 3KYOA 4TNWK 4ENED 1CFTA 2Q8BH 3QCUH 1NKOA 1U9KA 3NN8A 1YEEL 3VD7A 1EH9A 2V5RA 2WWMC 3D6GA 3F7RA 4MB3A 4UIMA 1E27A 1HHIA 4FTVD 3QDHA 4M3JA 5C7XH 1TTGA 1FLRL 3FOMB 2J12B 1G7MA 2CIKA 3O6FD 5EZIL 5C0BD 3O4OB 1C5CH 3ZT7A 4ISVA 3L3IB 3QDMB 4NUGH 1S5IL 1XF5A 4PJCF 2EIEA 2WANA 2F5AH 2QQKL 3VRJA 4TNVF 4Y4HC 1R3IH 4LVHC 5D7LA 2LVCA 4X6DB 2WIMA 1HH6B 2KPNA 1MJJB 2A1WL 4PP2B 3T8XA 5JHDD 3LKNB 1YJDH 3PDGA 1ZHLB 4XP5H 4F7MB 3PUCA 1JN6B 2OCFD 1LO4L 1B6UA 1F90L 1BQHA 1CBVH 3RWHB 2ZOLB 1KOAA 5BVPL 1Q9OA 5FOJA 3MO1B 4NKOB 3EUUA 4FQIH 3OZ9H 3H0TA 4J6RL 4J3OC 1G7LB 2PR4L 3P3YA 3BPNB 2X4RA 3DPBA 4GXVH 3M1BB 1A7RH 1X4XA 5F6IB 1ODAA 4HPOL 2Z8WC 1YNLL 4ONFL 3B8SA 1RUMH 2GTZB 3MNWA 1BLNB 1S7UB 2R69H 4JM4L 4RGOH 1FZJA 3R4DA 2Z9TA 1G7PB 4XPFH 3DUSA 3RP1A 1A7BA 3N1PC 3EDEA 4NJAL 4MX7B 2DMCA 4M00A 2Y72A 5D1XB 2X1QA 4G8GA 5I15L 4AH2B 4HZLB 5F96L 3QUZD 3DSNA 4QXTA 5KSAA 1FO0A 4K7PL 1WWCA 4KJYB 3ILQD 3MROB 5SV4A 1MIEH 3QRFM 3V5KA 3T77A 2G9HA 3QCTL 2XQBH 4OIIL 3MBEB 4OV5B 2R15A 3LKOB 2Q86B 5DR5H 1N0XL 4C58B 3V5DA 5GZND 4IIQC 3UPAA 3BGFC 4P4KA 3QH3A 2RFXA 3QO1B 1M4KA 4NFCA 2BDNL 2R2HA 3JV4A 1T0NB 4QEGA 3FT4A 1F3JB 1R24A 1BBJA 4JPKH 4Q9RH 1VFAA 3UPRB 2ZNXA 2AERT 1JZ2A 1YY9D 3HPLB 3LN4A 3QG7L 5EC1B 4Q9CA 1D7FA 4NP4H 1ZT7B 1XGYL 3VFGL 4MA7L 5MEOB 4H26A 3MOQA 3EYOA 3WO4C 1CXKA 4HAGA 5F9JB 5DJ6B 5JXAL 3BP7B 2W91A 3OX8A 5T1DL 3RAJL 4PLKD 1T2QL 1FL3B 4NQCD 3KVQA 2NR6D 4Y4KB 4DVBA 3ARTA 2ZCLL 4JFHE 5C0DA 1S78D 5BRZA 5BS0E 5EPMB 5I1LB 1UFUA 3FOLB 5EU3A 4NRZB 5IBTH 4XVSL 1WIOA 1FO0H 1BVKA 4JRXA 4P46C 3BEWA 3ULVH 1JPFB 1LDPH 3CSGA 4JREB 2FH6A 3JUZA 3HC0B 4KV5E 1JGDA 4HKBA 4PJDE 3PP3H 2P8PA 5IBLC 4A2LA 1TZHA 5J0BA 4EJ1C 3MJ8B 2B20A 3B9EA 3NCJH 2V7NB 3HB3D 5I1DA 4XPHH 4QWWC 4HLZG 3SHSA 1SYSB 1GZPA 3SDDA 1GGCH 2OX5A 4YIQB 1RFDL 2Y36H 2XNAA 1MCCA 4RISH 4GW1B 1XR9A 2IPUK 1R3JA 4JFEB 3A67H 5FM5O 4UUJB 1K8DB 5FUZH 5DVOA 5E8DH 2XN9D 3KYKL 4GG8A 4XVJL 3SGEH 2CXKA 3WNPA 1I7TA 3W11C 3AS2A 2AJUH 5D7JC 1MCHA 5DHVA 2AK4A 4XMLL 4XAKE 1WT5C 1TVDA 4PJDF 2JIXD 3LKQB 4LBEA 3Q5YA 2VAAA 5DEGA 1NEZB 1QYGL 1BFSA 3AGVA 1VFOA 3BZ4A 2ARJQ 2DAVA 4LCYA 4KJWD 2CIIB 3PIQB 4L29B 2MQ0A 3D48R 3OKMA 2DD8L 3MJ7B 3FFCD 5HPMA 1A1NB 3KYMA 3KS0J 5ISZE 2X40A 4L8BB 4G6ML 2BNRA 2IH1B 5C09A 1SBSL 3UROR 3ARGB 3MRGA 1KXQE 4CW1A 1EEQA 4QGTA 3MRNA 3RIAK 4HS8L 5KVGH 1JIBA 1FNGA 1AO7E 1KPRB 4MB4A 4ENEC 5DJAB 5TFSL 1GGYA 3NFSH 3UTQA 3PV7A 4LLWB 3P4NA 2D7PA 4P2QE 4BQBA 3BD4A 1DBJL 3S5LA 3WKMH 4PJAF 5B8CC 4ZUUB 5T1LD 3J8F7 1CFSB 4P57A 4OUUB 1LO0H 4PJCA 1AC6A 4U1HB 4U6VL 5DHVH 5HSFA 3O6FC 4LU5L 4YGAB 3KPMA 1H9VA 5FK9A 4Z0BH 5LWYL 4DGVH 3K74B 4KRPB 1VADB 5GGSB 3LEVH 3MRQA 4DWHA 1JHLL 2MKWA 1CLYH 3MRRB 4NQEB 4Y5VB 4ZS7L 2VDPH 3ZHDA 1S9XB 3WEXB 4LCCC 3SGDI 3ECBB 4QHUB 3OJDA 1DQMH 4PRAB 4LHUB 4GAJL 1FNAA 5FO7B 3HG1E 1YA5A 3LCYA 4OB5L 1TITA 3ZKXB 1NEUA 4MXVF 3OBAA 3SDYH 2G5BB 4IJ3B 4HIIA 3NA9L 5FCSH 5C92A 5MHSD 2DQGH 4ZD3L 1S7SB 5JXEC 3O41B 1G0XA 4LPCA 3X3GH 1TTUA 1SJEA 3S35X 4HFUL 4FQLH 1H3PL 2ESVE 4M62L 2F53D 1UACL 4BH8B 1U8IB 5HHXL 1Z9SA 4JGMA 3MOBH 3F65A 2EE6A 2EDYA 2HRLA 3AS1A 4EEEA 3BT2H 1KJVB 1UEMA 1B0GB 1QRNA 2XKSA 1K8IB 3LS5H 2ZKHL 3MJ9L 3PQYD 2X5PA 3B2VH 1XGTA 5MEQB 1JI2A 3CZFB 3I84A 1T7WA 1P9MC 3RHWK 5D2NC 4RZCA 3QUKB 1UWGH 4NNPL 3KYOB 3ARBD 4OLVL 5GZNC 1CFTB 1A9BA 4PTUA 5J8OA 5FO8A 4DAGH 5DYOA 3NN8B 1FORH 1BHGA 2VERN 4K94L 5D7KE 3U79A 3C5SA 2YZ8A 3ARDA 4UIMB 4UI2A 3BW9A 1E27B 1HHIB 1INEL 3UZEA 4ERSL 4RA3A 1ZA6A 4N8PA 1G7MB 2CIKB 2XA3A 2HT2D 1C12A 1YY9C 5KW9H 4ISVB 5GS1A 2CDGA 3ARFC 1XCQA 1XF5B 1RPQA 2KKQA 1CQKA 1XZ0A 3VRJB 1DP0A 5L7XL 5D7LB 3LPGA 1TQCB 5I1KH 2VL5A 4M7LH 3RVUC 4PLKC 3C2AL 3T8XB 3DARA 4TVSa 4J3VA 1CDCA 4UIKL 4LCIL 3GIZH 1BQHB 1S78C 1YEIL 3C60A 2ED9A 5L9DL 3QJHA 3O2VH 1BJ1H 5FIEA 2PF6A 1Q9OB 4KZDL 3GMNA 3CFJA 1HHKA 3QEGL 1OT1A 3H0TB 2JJVA 3UJIH 4LGSB 1X9QA 1A6AA 4G9DA 3ULSA 2X4RB 5BW7A 2Z91A 4P9HL 1MEXL 1U8KA 3MRFA 4YZFE 4WTZG 3TNNA 1J0YA 4FG6C 4XC1H 1DBMH 2CLVB 4X4ME 1FZJB 3ZE0F 1T2XA 2W07A 5FYKU 3DUSB 1H8NA 3C09C 5C7XL 3INUL 1G7HA 4JM2D 4U1SA 4G8GB 4GRLC 2EKSB 4NO5A 1ZTXH 2XICA 4QXTB 1RJZA 1BOYA 5KSAB 4OIAA 4AEIH 2CUHA 1AE6H 1FO0B 4U31A 1A64A 1PSKH 1R3IL 4PJDA 5D96C 3V5KB 3T77B 2G9HB 4N5ED 1IC7H 2WV3A 4GO6B 1TXKA 3G6JF 1KXTB 4OFIA 4ZNEA 2J4WH 3V5DB 4JQVA 4PGDA 4UT9H 3JXAA 3UZVB 4APQD 4YDLB 3LD8B 4P4KB 3QH3B 1RMFL 2RFXB 3CXHK 1CBVL 4DEPC 3T1FA 4M7LT 1FRGH 4KJWC 2R2HB 4QXUL 3JV4B 5DS8A 3FT4B 1JRHH 1R24B 1AGDA 1VFAB 4S0TD 3LHPL 5E7FA 4GXVL 4M5YL 3CXHJ 2CSPA 4OJFL 4IRSB 4NCC1 4XNZC 3LN4B 1KLFA 3DMMC 3QJFB 5L8LB 2VXUL 4H26B 1W0YT 3EYOB 3QO0A 4AMKL 4M9PA 2R69L 1KELL 2OMNA 2ERJC 3MUY1 4BELD 2DJ4A 5LGJA 3OX8B 1IKFL 5HYEA 5TQ0L 4YHNA 4PJAA 5FYJU 4DVBB 2QHLA 5T3ZD 2NX5E 4NZDA 5C0DB 3VD9A 5BRZB 3BOVA 5EU3B 1XR8A 4K3JL 4ZG1A 4HWEH 1BVKB 1IC5H 4JRXB 5C0EA 3BEWB 1Q38A 1A7QH 4O2FA 4WGVB 5GHWH 5MP6H 4DFIA 4ZSOE 1JGDB 4HKBB 2HRPL 4Y19A 2CK0L 2P8PB 4MWFA 1A3QA 4W6WB 1TZHB 1E6JL 1J1PH 2NXYB 4JR9L 5DR5L 3OAYH 5IV2A 1MIMH 1OVZA 3WIIH 4PB0H 4Z7UE 2UVFA 4WDIA 5I1DB 3BUTA 1GZPB 3SDDB 4CN4A 2GJ6A 2IPUG 4MJIA 2XNAB 1AO7A 1R3JB 4F15C 3MGTA 1GVIA 4PS4L 3VMNA 4S1SH 5KVMC 3TT1H 1FH5L 1I7TB 2W60A 3DUHA 2D7TH 2WUCH 5E9DE 1NFKA 3MCLH 4MNQD 5DHVB 2AK4B 1OQXA 4XNMA 2VXQL 5IVZA 4LBEB 5DEGB 2VAAB 2DQDH 2FBJH 2PCPA 1F42A 4PFEA 3O3DA 2C1PA 3BZ4B 5IBTL 3IJSA 4LCYB 5C0JA 3L6FA 5D2NE 4FNLH 1E4WH 4Z7UF 4ESKA 4PJBF 4LLDA 5CJOH 4U2YA 1A02N 1MCOL 1NGQL 3DWTA 3OKMB 4NGHL 1CR9L 5HPMB 3UZQA 2ZSWA 3KYMB 5F7YC 4HUKB 3DBXA 2BNRB 1GGIH 3NCJL 5C09B 4I3SH 3MRGB 3P0VH 4CW1B 4TVPL 2RCSH 3MRNB 1P4LA 5E2WL 5GJSL 1KENH 2WBJD 2Y36L 3UTOA 1FNGB 3RDTD 5GXBB 3ARBC 1OHQA 3A67L 4JFFE 4NN7C 4K7PY 4Q0XL 3U7YH 3QEQD 5FUZL 4FS0A 2BY0A 3P4NB 1QHPA 3ARYA 2CD0A 3S5LB 4YNYA 2ESVA 4P57B 4DQOH 3UEZA 3VG9B 4PJCB 1A6UL 2X4SA 4WY7L 4IOSD 2HT2C 3V0WL 1F02I 5LCVL 3A6BL 3SBWC 4HT1H 1IGFH 1DDHA 4KZEL 3KPMB 1B88A 1CZ8L 3LZFH 3OJMB 5JDJA 3MRQB 2QBWA 3MFFA 4YPJA 25C8L 3TWCL 3QI9A 1IZJA 4X80L 3OJDB 2WQ8A 3CFKA 5I74B 2IBGA 2JJSC 4LEXL 5KSUA 3R0NA 2GY5A 3Q2CA 2AEIT 5C0FA 4HIIB 2XN9E 3K3QA 3SE8H 1QSVA 4H20H 3OKKA 3UTZA 4P46A 3HI6L 3CH8A 1SJEB 1J87A 5F88A 1JTOA 3RWDA 4YXLL 5TGBA 3ZL4H 2YPLD 4ZFOA 4NQVA 3FZUC 3RJDA 1YEKH 3BSZL 4NKQB 2GHWB 3SDCA 5JOPE 2Y9RT 3FONA 1GIGL 2L0DA 4D9QE 1HOCA 2F58L 1CN4A 1QRNB 2VXSL 3ZHLA 3ELAT 3QSKB 1MCLA 2LE9A 3G6JA 1XGTB 5F9WB 4D0CA 5JW4R 4N5EC 1PW3A 4RZCB 3HFML 4U6HA 3LDBB 2ZPKL 3ETBF 3W5MA 3E2HC 1A6ZA 1A9BB 1SQ2N 4PTUB 5D6CA 4NHCL 5FO8B 1N6QH 2UY7A 1V3LA 5DYOB 5D7JA 4NWUH 2EEDA 1DEEA 3C5SB 3ARDB 4ZTPL 3DIFA 3WS6C 4Z77A 3SCMD 2DQJL 3BW9B 3UO1L 2VKXA 2VR9A 4LASL 1WT5A 1F3DJ 2DWDB 1ZA6B 1JBJA 3I9GH 2YKLH 5E6IC 1C12B 5HI4C 5GS1B 2CDGB 1XCQB 5IMMA 3AM8C 4WHDA 1XZ0B 1OAUH 4OGZA 3LEXA 2VL5B 4NO0A 5AD0A 5IB1A 4QXWA 4LNVA 35C8H 3HC3H 3NVQA 5ALCL 1A3RL 4YJZL 1RZJC 4W81A 4FQ1L 5FECA 2D4FA 3PL6D 4NQDD 3PE9A 1JFQL 3C60B 3BT2L 3QJHB 5GRUH 4NZTH 2YMXH 4DUVA 3GMNB 3CFJB 1HHKB 2VZTA 3UBXI 2GSIA 1A6AB 4G9DB 3ULSB 5L0QC 4QNPE 1JNNL 2Z91B 3QPXL 5ELIA 1U8KB 2ZUTA 3MRFB 4AK1A 3TNNB 1I1YA 4FTVA 3UPCA 1WEJL 2IF7A 3MLVH 4P99A 1FORL 3N85H 1T1XA 1H3UA 2P1YA 3O6FA 3P30L 5C0BA 2ZNWA 5K59F 4B7LA 4GH7B 2OQJA 3OWEA 5HHNA 1G7HB 4BKLA 2NX5A 4U1SB 5MHSE 5F93C 2YRZA 3QWQB 4NO5B 4PG2C 1RJZB 3SKMA 2RAMA 1F45A 2DI9A 2HP4A 3RIFK 5JHDA 4CADA 3O6LH 5ENWA 3SJVD 4PJDB 1T7ZA 2IWGA 3CLEL 1MJ7L 2R29H 3RGHA 2PUQT 3RPIA 4PB9H 4JO2H 5ITFA 2FD6H 5I73B 4PGDB 3H6JA 4TQEH 3QXTA 1FFPA 4Z7UA 1EEUA 4PJBA 1UGNA 5DLMH 1KCVH 5DGQA 3V7MA 4K3HA 3T1FB 3EYQC 1C5BH 2ATKA 1YMMD 2AV1A 3MMEA 1AGDB 1ZLVK 3S4SA 1OLZA 5D93B 4YHOH 1XH3A 3HE7D 3QWOA 1U92A 3RTQD 1M7IB 1NUNB 4H25A 2Y7QA 1ZGLM 3QO0B 1KSRA 1FAKT 4MS8D 1H8SA 5LGJB 2WBJC 4DUWA 5EC2A 3RDTC 1SEQH 3QUZA 4YHNB 3ROLA 4PJAB 4L1HA 2FDBP 1OP3K 3UJJH 3THMH 1QPXA 2I5YH 4HEME 1UH4A 3VMPA 1XR8B 2DRUA 5E1AA 5DF0A 4N0CD 5D2NA 5E03A 4ZFZA 3S37L 5C0EB 4O2FB 2E5EA 5HJ3A 2J5LC 4GRWF 5CJBA 4OCRH 4Y19B 4MWFB 2DLHA 1A6WH 4K3DL 1MJ8L 3RA7L 3Q6GL 5IV2B 3KLDA 4P3CH 4KUCD 4XMPL 1RUKH 1TZGH 3BWUC 1KB5H 1VENA 2FEEL 4WDIB 5BXFB 4HAFA 1ITBB 3AY4A 2GJ6B 1FRGL 2ZG2A 4MJIB 5JR1L 1AO7B 2D4DA 2X1WL 4XP4L 1HHHA 4JFFA 4GW4A 2WBKA 5F21B 3MGTB 4X7SL 4LVHB 5T1MA 4YE4H 2YN3A 1V7ML 1S7XA 4LSQH 2XWBA 1FSKC 1YEJL 4KI5D 4NQCA 2W60B 3DVIA 4RMQA 1EAPA 5SX5K 1DBAL 4M1GL 4CU6A 4POZD 3ZKQD 4XNMB 5FO9A 1DBBL 3RWGA 1S7VA 3TNMA 4MSWA 2PCPB 1FVCA 3O3DB 2C1PB 1IL1A 4ZO8A 3VD3A 3IJSB 1RZFH 2YPVH 5C0JB 3L6FB 4F58L 1JK8A 1XGRA 4MDIA 4LLDB 15C8L 3U4AA 3TVMD 3IDXL 1IAMA 1U93A 2OJZH 3OAUH 1KCUH 4YFDB 1X3DA 3I02A 2FO1A 2W0PA 2ZSWB 3RWJA 3DBXB 4RSVA 4Z76A 1U8NA 3WIIL 1LDSA 2CH8A 3MGAA 4F9PC 2QHRH 3VXSD 1P4LB 4GRLA 3P4MA 2XN9A 4ODVH 2JB6A 1KC5L 3T0AA 1T80A 1S9YA 3DYPA 4JM2F 3DVFA 6CGTA 2R2BA 4YH6A 5EN2B 4YNYB 4LKCA 2ESVB 4WFEE 3SCMC 3TT1L 5DRNA 3DNKA 4CN1A 2YSSA 2P4AB 5DJXA 2AS5M 2JIXA 3O3BA 2WUCL 2X4SB 3MA7B 4XCCL 1GAFH 1WZ1L 3BGFB 4G6KH 3HUJE 3F7PC 3CDGA 3MA9H 4L8SC 3TJHD 1DDHB 1SJVA 1KN4H 1KF9B 2FBJL 2VNCA 3S34L 1F4YH 1GPOH 5IP4A 5KVFL 4MLIA 3FFCA 1CTOA 3MFFB 5CJOL 1DANU 4PJ9D 3QI9B 1Q1JH 4PJEF 3WO4B 3PL6C 3ILPA 4K2UH 2GTWA 3RRQA 2BX5A 3P0GB 3CFKB 1ZLWK 4MD4A 3D2UD 2P7TA 4I3SL 5KSUB 4J1UA 1QSEE 3MGOA 3I3BA 4KHXH 1YC8A 5DMIH 1QA9A 2VL4A 1I8LC 5C0FB 3V4VH 4FXKA 2VLLA 4LPXA 3OKKB 4UOJA 5E4EB 5FV2A 5T1LA 4P46B 2W9LA 3C6LC 3U7YL 3DJ9A 4NQSA 3K2MC 3MYJA 1MHEA 5F88B 3RWDB 1ES0A 4X99A 3QDJD 2R0KH 1MCEA 5TGBB 4EXPX 4NQVB 4M43L 5A1AA 4XPGL 4JRWA 3SDCB 4K07A 4POUB 4U1GC 1BZQK 3K4ZA 4C55A 3CK0H 1EGJA 2NZIA 1KJ2A 1QFWL 1IGFL 5F8QC 3G6JB 1H3XA 4IOFD 4D0CB 3D39D 1VCAA 3BE1H 1H3WM 2EH7L 2H1PH 4U6HB 1VDGA 2ZUQC 3DXAD 2DTSA 3MV8D 1A6ZB 4WI4A 2X7LA 5CMAA 5GRJL 4WTZA 5D6CB 5FYKE 3N06B 5D7JB 3MFGB 4U7KA 1DEEB 3MR9A 4Z77B 3DIFB 5J9PA 5MERA 5CBEA 4PJGF 1AFVL 3L3JA 4A2MA 3QEQE 2MPAL 4D9LL 2MKLC 5SV3A 1NCBH 1JZ3A 5IMMB 3HE7C 1A7PH 4Q6IC 3RTQC 2XRAL 2C26A 2F53A 2HT4D 5HVHC 1HIML 3LEXB 2QQNL 2OSLA 3P4LA 1OAQH 4NO0B 5AD0B 2HG5A 5IB1B 4KQ4H 1J0KA 5C3TA 3NH7L 5EA0H 5E70A 4CDGC 3PQYA 3RHWF 3DECA 5FECB 1PEZA 3K2UL 4GSDL 1HNFA 2VDML 1A6VH 1E4KC 1KJ2H 1NQBA 3JTSA 4ODTH 1Q8MA 2R4SH 2XT1B 1X7QA 3TBVA 2ADJA 1OPGL 3ARBA 4PG9A 4U05A 4PLOB 2GSIB 4KJQD 2H45A 4R3SA 1GSMA 2FL5A 4Z7WE 2M26A 3OF6D 5GGRA 4O02H 4OCSH 4ZAKC 1I1YB 2DKUA 4FTVB 4HQQL 3BRGC 3W0WE 4XWGL 3TA3C 6FABL 5IFHH 2BRRH 1T1XB 4Q74A 5FYJE 4WI8A 4AEHH 1SM3L 5L8JB 3OKYA 5EWIL 3O6FB 1NBZA 5C0BB 3SBWA 1M7XA 2DLEA 2OQJB 1D6VH 5HHNB 2NMSA 4BKLB 2NX5B 3TO2A 1MQ8A 1R3HA 4KROD 4P2OD 5IB5A 2FX8L 2ORBH 2MFNA 3SKMB 2B5IC 5JHDB 4CADB 1V3KA 4PV8A 5ENWB 1T6VN 3TYGH 1QZ1A 4AEFA 4LSUH 2P8MA 2Q87A 2FX9H 4OD1L 3RPIB 5LBSH 4JG1H 1T20A 3BGMA 5ITFB 5MI0C 2PYEE 1FFPB 4Z7UB 4KMQA 4PJBB 2O5ZH 4GRWH 3FQWA 2H9GA 5GRUL 3WUWG 3EFFA 2AV1B 2ATKB 2PW1A 2VDRL 5FUCE 3GO1H 3MMEB 4PRHD 3TVMC 1MRCH 3S4SB 3KJ6H 4PJXF 4M8VA 3ZKNC 2D03L 2G60L 1XH3B 1DQDL 1NBYA 3HR6A 1UM4H 5GS0L 3I50L 1U92B 4H25B 2Y7QB 2A0LD 4RFOH 3IDMA 4DOHE 4KTYA 1RZ7L 4JM2A 3C5ZC 1T7XA 4F9LC 5E2UL 5EC2B 3QUZB 1YEHL 2OI9C 3ROLB 4AIZA 1NCWH 5I1EH 4ZOAA 5E1AB 5D2NB 5HDBE 1U58A 4ZFZB 1QNZL 2YA2A 1PJ9A 4OGYL 5C3LD 3T4AA 2E7LC 5HJ3B 4KKCD 4FXGA 2J8HA 4YHYC 3NIGF 5K9JH 2F19L 4U0QB 1JYWA 2H2PD 4XT1C 2VN7A 2QQLL 3TJHC 3WS6A 1NFDE 4LPVA 4TQEL 2VE6A 3RVTC 3BZFA 4FZ8L 4CBPA 3JVGA 4OLWH 4PJEA 4FMKA 5KSBE 5E6IA 4J3XA 1K2DA 4OLUL 4JY5L 5D1QD 1U36A 1HHHB 3UTPE 4JFFB 2AEQH 1MFAH 1IAKA 3AM8A 4GOSA 4GW4B 1TQBC 5ACLA 2XYCA 3ZE1F 4JN1L 4HF5H 4XBPA 5T1MB 3KPSE 4Q97A 4YDVA 1S7XB 3VDBA 2XWBB 4NQCB 4UT6H 3GKWH 1EAPB 2MCPH 2X44D 3U30C 5FO9B 3RWGB 1T03L 1RIHH 4HHAA 3VGHA 1S7VB 1J88A 3TNMB 3THML 4MSWB 4XNQA 3SJVE 4LFHG 4GG6E 1FVCB 3SGKC 1IL1B 2R2EA 4L4VD 2P42B 3PWPD 3VCLB 5E5RB 1JK8B 1HDMA 1XGRB 4MDIB 4NJ9H 4IEFB 4N8CL 2I60L 5HHMD 5IIEA 1ZEAH 1MFDH 3VWJC 1S9KC 1U93B 4U1IA 3UYRH 1XCTA 3I02B 5HTSA 3RWJB 2X10A 4Z76B 1U8NB 1YMME 4IOFC 3VFPA 2HTKD 1BEYH 1AJ7H 3P4MB 2P5ED 2XN9B 1CL7H 4PG2A 4DVRL 4AG4H 1U91A 1S9YB 1XF3A 4JO4H 4O2CA 1IQWL 4PJGA 4PRID 2EZ0D 2YXFA 5IM7A 2R2BB 5D96B 3LQAC 3QDGD 5CBAA 4LKCB 1NDMA 1VACA 5DRNB 2YSSB 3EZ8A 5DJXB 1RZJH 2AW2A 2J6EL 4I0PD 2JIXB 4MMXC 1HE7A 3O3BB 5LJYH 3HTLX 2MTPA 3JV0A 3QHZL 3ZDXF 4Z95L 3HA0A 3EJJX 1FBIL 5HHOE 3CDGB 3GMQA 4FMFA 3GBLA 5D8JH 3KPTA 5DK2A 4KTDH 3GMRA 2GK2A 1WBZA 2OR8A 1MWAA 3FFCB 3C2SA 5C07D 1EJOL 3K8LA 1A1OA 1BBDL 2D3VA 3JV6A 2OJZL 1Z9OA 3ILPB 3OAUL 3STLA 2ERJB 2GTWB 4NBYB 4NRXA 4YEFA 5C70A 2N1KA 2WBJA 2JK5A 1CLOH 1YPZE 1FN4A 3LAFA 3RDTA 2P47B 2P7TB 3MACH 4J1UB 4PRPE 1I7RA 3MGOB 3IXTA 3QEQA 2YD6A 4QHNA 4XPAH 2FHBA 1QA9B 5HXMA 2DQTL 4FXKB 4ODVL 4W6YB 1IAIH 2VLLB 2E7HA 5T1LB 4R2GC 4TUKH 1N5YL 4NQSB 4QXGH 5DC4B 3BZEA 1NLBL 3MYJB 1NUGA 1MHEB 2NY2D 3BN9C 1ES0B 4X99B 2B2XL 1UXSA 1OTUD 1OD9A 4K71C 4F57H 1DR9A 3LRGA 3R06A 1FC2D 4KROC 4P2OC 5D2LE 4LSTL 5BCAA 2AP2A 4FFZL 2R4RH 3N1MC 4JVUA 1KJ2B 4KUCF 4UINH 4YDKH 3VDAA 4F15B 4LLQA 5I8EA 4JO3H 4P3WA 1NBVL 1MWAH 1GPOL 2OTWB 3QUXD 4JDTL 1G9NL 1MRDH 2X7LB 1VPOL 5CMAB 1CIUA 4YQXH 1Q1JL 2CMRH 1J11A 3QIWC 1L0XA 4W4NA 1BAFH 4PJXA 1MHCA 2J7LA 4XMKL 1MVUA 1UYWH 3MR9B 5J9PB 4E9LA 5MERB 4HIXL 3GSVA 4NC1C 2VDQH 5CBEB 4KI5F 5H8DA 4ZTOL 1I3RA 1I9JH 3L3JB 4FXLA 1NGZA 4PBXA 1A1MA 2ZCKH 3JWOC 5EORH 4NWTH 3TO4C 5F7EL 2F53B 2CKBA 2Q3ZA 5DT1H 1AD0A 2YPLA 2PETA 5E94A 2VISA 2OSLB 3Q5OA 4AM0A 2LFGA 5JNYA 1W72A 3BPLC 2HG5B 2R0KL 3Q48A 2WIIA 3V8CA 5L6YH 4DKFL 3PQYB 3GKZA 3O6KH 5CP7A 3GSOA 1IBGH 2UZYB 4IRJC 4HJ0D 4GRWB 3JTSB 4FN0A 1VSCA 4M9OA 2DQCL 1MI5E 3EDDA 4JKKA 1M05A 2A73A 1OF2A 4M93B 3HE6D 1X7QB 3TYFA 3TBVB 5F7WC 3MTRA 3ARBB 5HDQH 3H9YA 4NN7B 5C08E 3T0ED 2AAVA 5SWZD 4ZOEA 4R3SB 4YHIA 2ZG3A 2FL5B 3BEVA 1J18A 5GGRB 1CS6A 1V3MA 5FFLA 3SCMA 4C4KO 2WWKO 5J1TC 5FYJH 1WWWX 5TPWH 4Q6YA 3EHBC 3I85A 2GEEA 1K3IA 2W38A 3IU3A 4EUPG 5I2IB 5GZOD 1OARL 3PWVA 1ACYH 1NBZB 5D1QC 3VI3E 2IQ9H 4GMSH 4HW6A 4HGWA 5F1SA 3TO2B 1FP5A 1R3HB 2FGWL 3MV9D 5IVOA 1NCTA 5IB5B 4NSKA 1A14H 1IEHA 2CKBH 4I18C 3W9EA 3QDJE 2YR3A 4DTGH 4CDHA 4PV8B 2AVGA 5ABDE 3DYOA 5DRXA 2P8MB 4OGAC 5DJ8A 4CVUA 5IFJA 3PL6A 5L2KD 2W65A 1VESA 1T20B 1IGCH 3BGMB 3QRGL 3SO3C 4DK6A 5EA0L 2KQMA 3GSNA 2Z92A 3K81A 5EUKA 3FQWB 1CGXA 2H9GB 2VB5A 1EGJL 3AXLA 4HULB 4Y8DC 3D39E 2NZ9D 4ODTL 2R4SL 5IHBA 4QOKE 3GFUA 3EFFB 1EFXD 5TQ2L 2PW1B 1VEMA 1I8LA 3VGGA 1DTUA 4BZ1L 3U0PA 3MV8E 5C8JA 4OI8A 2BJMH 4D9RE 5IESL 1NBYB 1X5HA 1KEGH 2CUIA 4OCSL 4L3AA 4R7DA 2DLTA 2JB5H 3PDDA 2XFXA 5TE7L 2MMXA 3IDMB 4NNXA 5DJYA 2HTKC 4JM2B 1GC1H 5DFVC 1G0YR 3HCVA 3NGBC 5CINH 4I77H 3BKCL 4PJHF 4F7CA 2JKXA 4AIZB 2EZ0C 3SJVA 4JZJC 4KQ3L 1AR2A 5HI5D 4JLRA 3CGTA 2ORBL 1U58B 3CMOH 3T4AB 4P5KA 3E2HB 3M17A 2QADD 4FXGB 2YD2A 4RNRA 1GGBL 2VRAA 2DYPA 1FYTE 4MYWB 4NM8H 1JWMA 4JG1L 1FNFA 3CX5J 3QQ4B 1Z3GL 2V9RA 4YK4C 3GSNH 5GSRA 1YMMA 2VE6B 3BZFB 4QHKJ 3KXFD 1VGKA 5AZ2L 4PJEB 3QPQD 1FGNH 1R6VA 2CGRL 1QFUH 3BX7C 5E6IB 5EZOL 2FEEI 3U83A 5HGBA 4L4JA 3F8UB 3GO1L 4JHAL 3B83A 3HE7A 2LQRA 3EO9L 1H5BA 1IAKB 4Q6IA 4HWNA 3RTQA 2CUMA 2VZ1A 4KUZL 3SQBA 4KK6D 4GAGH 2X41A 4ODUA 5EBLB 5EOCH 1DFBL 4XBPB 1U3YA 4YDVB 2VDOL 1JL8A 4WFFD 5CZXC 3AAZA 4KKAD 2V17H 2DTMH 5CJQL 1KYOK 2Q8AL 2HWZH 2DQIL 3WFBH 5E7BA 1E4KA 5ERWA 4HHAB 3QFJE 1T1ZA 5D7SH 1P4BL 5EG6C 5F89A 4NKIH 2KDGA 1FGVH 4GQPH 4XNQB 1CLCA 5HDOA 1KYOJ 2H2SD 2R2EB 4WV1C 1JGEA 2NY2C 3ZDYF 1HDMB 4NQTA 4LCWE 1OTUC 3ZHKA 5IIEB 2CJUH 2K3TA 1JTTA 1CD8A 1NCDH 4OIBA 4U1IB 2XWJA 1DLHA 4WHYG 4TSBH 1XCTB 2R0ZL 3BIBX 1CT8B 4TN9A 5DJCA 4OCXH 2V9QA 1INDH 3VFPB 4NC1E 2VZOA 1O0VA 3OJVC 1SHMA 4QY8A 2XZQH 1KGCD 1U91B 1XF3B 4O2CB 3D3VD 3KLAA 4PTTA 2AEQL 3BKJH 2AI0L 3CFBA 4PJGB 4ZFGH 3RX5A 1BWMA 5IM7B 5CBAB 4DZBB 2I9LA 4OZIE 5CZVL 1NDMB 4MNQB 1ZS8A 1VACB 4M48H 2FSEA 1CG9A 1EX0A 4OF3A 4DN4L 1U8PA 2V5TA 4MA8H 2P48B 2B4CC 5T3XE 2GI7A 5E2JA 3O2DL 5JUEH 3GMQB 5DVKA 1RHHA 1N7ML 5EU4A 4ZUVA 5DK2B 4ZDHA 3TVMA 4N5UA 4OZHF 4OTXL 4PRNB 1JTPA 3GMRB 1WBZB 3FAXA 1G84A 1MWAB 4JQIL 3KLHC 4NJ9L 1A1OB 3TGXA 5D7IF 5J57B 1CK0L 2D31A 3JV6B 4OCYL 1MOEA 4HJ0C 3STLB 4NRXB 3VXSA 3PDOA 1S7RA 3R8BB 4F9LA 2WBJB 2JK5B 5M95B 1FN4B 3NTCH 5FA4A 3RDTB 4PJFF 5IHLB 1BGXH 1EEZA 1FZKA 4UU9A 2YA1A 1I7RB 1BEYL 3IXTB 3QEQB 3J7HA 4QHNB 4GMTL 2W9DH 4CJ1A 3RWFA 4YX2L 4JO4L 3S3SA 4M6NH 2E7LA 4KHTH 1WC7A 2J5LB 3BZEB 4H88H 3C8KA 4PJIE 4MJ4A 5GZOC 4KAQH 2A6JA 5JA8B 2WP3O 3CH1A 3D18A 4AENA 2VKWA 5J12C 1UXSB 5SWSD 3VD4A 5TE6H 5T3ZL 1JPSH 3R06B 2DQEH 3FMGH 5LG1A 3KPRD 3BMWA 3RVXC 5GRZA 5IW6A 5ESQA 1H3TA 4LLQB 1QFWI 4PJ9A 5I8EB 3WFDH 1GGUA 4AY0A 1FE8H 1QBBA 3QHFL 5EU6D 5I1CH 3D2UA 1FSKB 2BVYA 2ZUVA 2VUYA 3REVA 4DGYL 2DQUH 2NZ9C 4PJXB 1MHCB 1MVUB 1EO8L 3GSVB 4H0IA 5BMFL 1PX3A 1EHLH 1I3RB 3VG0L 1A5FL 2RQ8A 1F4AA 2IANE 4LAQH 1NGZB 2A9ML 4PRIE 1A1MB 3DURA 5D1XD 3SGKA 3OL2A 4QF1A 1VHPA 4U7MA 2R8SL 1JF1A 1MCQA 3QDJA 1CDGA 5LAXA 1DVFD 3T2PA 4Q9QL 2JJTA 2CKBB 5IVXF 4PJHA 1AD0B 2YPLB 5E94B 2VISB 1DBKL 3F58H 3L1OH 4AM0B 2LVEA 3F12A 5JNYB 1W72B 4UV7L 4ZUSA 2WIIB 3BAEL 1P7KA 4ALAL 3ZE2E 2HJFA 3UTTD 4XCFL 4M3KB 5CP7B 1G6RA 3GSOB 2VLRD 3D39A 2UZIH 2LU7A 3BHBA 4QOKA 1UM6H 1M05B 2A73B 2FWOA 2YZ1A 4G8EA 4GUPA 3TYFB 4OI7A 3DXAA 3WIHL 2OP4H 4HUVA 3MV8A 2QADC 1JPST 4KVCL 2NXZD 5JW4N 1MWAL 4JFDE 3O2WL 4YHIB 5JIHA 4XI5C 1L6XA 3EOTH 3GBNH 3BEVB 3DSFL 5FYLE 3P9WB 3ZKMC 1ZHBA 4OZ4A 3RGVC 4WUKL 3HHRB 3SCMB 3O4LD 1X5AA 2VSCA 4WUUE 3BFOA 2P5WD 3UTSE 3IU3B 3RVWD 3B5GA 3QPQC 3PGCA 4UV4H 2Y4SA 3PWVB 4X7FC 4UILL 2DICA 4WFHD 5DA0B 5I1HH 3BJ91 4HGWB 2BVPA 2B0SL 2BNUA 4KK6C 3MUZ1 3SKJL 5GPRA 1MPAL 3IDYC 2ZCKL 4NSKB 4QTHA 4E0RA 4NWTL 2YBRA 3W9EB 2NY5L 5I71C 3BPOC 4HLJA 1ZV5A 3OPZL 4A6YH 1HK6A 5CGMA 3MLZL 5DRXB 5DJ8B 5IFJB 3PL6B 2IMNA 2ZUYA 2W65B 2AXHA 4I0KA 5IEKA 1EO5A 1GH7A 4KY1H 1V7NL 3TF7C 4XXCA 1G6RH 3GSNB 4OQTL 3RBGA 2Z92B 5EUKB 1HXMA 1IBGL 3AXLB 5CGYD 2BVTA 1CVSC 4B41A 2Y5TA 1NC2D 1ZLVH 3OF6A 1KCRL 3U0PB 4FFWD 1J5OH 5C8JB 3LQAH 4JFED 2IGFH 1YZZA 4TTDD 1WAAE 3G6DL 3L3OA 2EXYC 4R7DB 4LLAA 1UB5A 5DJYB 3C5JA 4XP6L 2C3XA 1UXWA 2GITA 3HCVB 1CFNA 1N6VA 4P2OA 5I8OL 4U1GB 3SE3C 1OP3H 1NGYA 3NACL 3U2SA 4GMSL 5TDOA 1CDHA 4F7CB 5ADOH 1NLDL 4URTB 2Y1VA 1TPXC 3SJVB 3WE6A 5TDNA 4JLRB 1JHTA 4TULH 2VDKL 1A14L 2CKBL 5KTEH 1AY1L 4P5KB 3M17B 4RNRB 2F15A 3EOBA 1W72L 3OV6A 3VI4F 1UM5L 4U33A 4C56E 1ZANL 2DYPB 5I30H 1KCKA 4OZHA 1JWMB 1FLTX 2VMFA 3VFMA 5GSRB 1YMMB 4PRHA 3QNZA 3O9WD 4RDQG 1VGKB 2FH8A 3I6KA 2DM2A 3PGFL 5HHQA 3S8WA 5HGBB 4NKDA 1KN2L 3HE7B 1H5BB 4JO1H 4Q6IB 3RTQB 3FN0H 4DUXA 4PJFA 1KFAH 1I3GH 2DM3A 1RZKH 4ODUB 5HVHB 1FG2A 4TSAL 3A0OA 1LEIA 4YAQA 1G9MC 3AAZB 5SX5H 3IXAB 1DLFH 2OL3A 5DWUL 2R0LL 3KPPA 4HUMB 5J11C 2EDNA 1F6AA 3U4BH 1YMHA 2YD5A 4B7IA 3HMWL 3MV9E 2HKFH 5FHAH 1Z9LA 4IRJA 1TMCB 5ERWB 1T1ZB 3GSWA 2LAGB 5F89B 1J0IA 1QKZH 1AKJD 1BQUA 2GYSA 4XPTL 3SE9H 3HC4H 1JGEB 1E6OL 2HFGH 3NCYS 4JQXA 4M6AA 3CMOL 4OSUL 5I76A 4LKXA 3UX9B 3QUYD 4KC3B 4ORGA 5IT2H 3FCTA 2XWJB 1DLHB 1T1YA 4NM8L 5C6TH 4ZQKA 5DJCB 3GSNL 1Z2KA 5LKNA 4LHUD 5D1QA 2OR9H 3VXUE 5J6HA 2VXTH 3CMGA 5FEBA 1X4YA 1S7QA 4QY8B 2EDWA 1FGNL 3JWOH 1OP5K 1QFUL 2Q6WA 4OKVA 3EYUH 2F74A 1P5UA 2CRYA 3FO2A 1Q0XH 3KLAB 4PTTB 4I18A 2B5IB 1IC1A 4U1MA 3CFBB 1MAJA 1ZSDA 5F44A 1M1SA 2W59A 1U0QA 2GSGA 4XHJC 2I9LB 4BYHA 2QR0A 2ZOKA 4LRNL 3W82A 3VFWA 1X5LA 5KJRH 1UCBH 5F1IA 2FSEB 1CG9B 4JE4B 1U8PB 5T3XH 4K8RC 3WCYA 2YD3A 3L9RA 4WCYL 3N9GL 2D9QB 2HWZL 4Y16D 4BUGA 3CU1A 4FP8H 4L4VA 3PWPA 2YD1A 4QCIA 2YK1L 4KJPD 4Y88A 1RHHB 3MOAL 3MXWL 4Q2ZA 5HI3D 4ONHA 5IGXL 5EU4B 1V05A 4ZUVB 4ZDHB 3TVMB 1A0QH 2N7AA 1SY6A 3CSBA 3UYOD 4LP4A 3SDAC 3MLWL 4G6JH 1U8JA 2D31B 2UZXB 1DANT 4TSBL 1ZLWH 3PDOB 3VXSB 1S7RB 1DZBA 1O7SA 3U1SH 4LSVL 2P5EA 4O4YH 1CD0A 5FA4B 1QRKA 4PY8I 5LXGL 4G7YL 1L0YA 1FZKB 1EEZB 4N90D 4EDWL 4PRIA 4JZJA 5BO1L 3EJZC 2AABL 3QDGA 4HH9A 1NCUA 3RWFB 1QTYT 3IB4A 3ME0A 4I0PA 1WC7B 5KZCD 3RVWC 3C8KB 3WS3A 3S96A 4NZRH 1IEBA 4LAJH 5DD5H 3H9SE 2A6JB 3CH1B 3D18B 4AENB 3GMMA 3T0DA 4MA8L 4X6CF 4U0RC 3PJSA 1X5IA 4R9HA 1KPUA 4HXBH 5B3NA 1MELA 5IW6B 5ESQB 5C07A 1SY6H 2XTJC 5AG8A 1FDLL 4PJ9B 4M02A 3VA6A 5GGRY 1IAOA 5HYFA 3U9PL 3D2UB 3JWDC 3QIUD 4N1HB 3T09A 2UWEE 3U7WH 1NMCC 3REVB 2X6MA 4DJMA 5DD1L 5F7MC 4EUPA 1M7DB 4R4FH 3NTCL 3AUVA 3U30B 3B4NA 4O5LH 2E7MA 4P9MH 2R23A 4FFWC 3T3PE 5CSZA 1DN2A 3BH8A 3DURB 2W9DL 4AL8H 4G8GD 4QF1B 4WV1A 1JF1B 3QDJB 1NCCL 5LAXB 5KAQF 3S36H 4M6NL 4LSSL 4PJHB 1J8HE 4LIQE 4M7KL 4LQ1A 3F12B 3ULVD 4ZUSB 4HWUA 3UC0L 1P7KB 2HJFB 2D0GA 4P59L 3BXNA 2HH0H 1G6RB 3D39B 4MLSA 3D0VA 5ESVA 3BHBB 1UWEH 4R90L 5L8KB 3QUXA 4GUPB 1AQDA 3ZTJG 1N59A 3DXAB 2DL9A 4HUVB 4HIHA 3MV8B 1AQKL 5HYSG 5ICYA 4BQ8A 3S35L 3QA3A 4OI9A 5FYLH 1I7UA 5BV7C 3MRJA 3CFCL 1WQVT 1ZHBB 4OZ4B 3T2NH 4WTWA 4F2MA 5A43C 43C9A 3DYMA 2DQUL 2M8XA 2HKHH 4EUPH 2OM5A 3PGCB 1MAMH 4PJ7E 5CJ8A 5DD3H 3K1DA 4K3EL 2BVPB 2BNUB 3L5IA 3GI8L 4QTHB 4E0RB 2YBRB 1R0AL 1EK3A 1A3LL 4BH7A 3DX6A 4UNUA 1L4IA 4ODHH 3CU7A 1TJIL 1F58H 1NAKL 2PXYD 3IFNH 3WXVH 2E6QA 3V52H 5IEKB 1MREH 3BDYH 1RUPH 5ESAA 3HE6A 4OZFG 2K9UA 4CMHC 2EDTA 3TT3H 5M7QA 1HXMB 4L8CA 2HTLD 5B38G 3T0EA 5SWZA 1NGXA 1JGVH 3OB8A 4MA1C 3TV3H 2Y5TB 4FABH 5DI8A 3QUYC 3MRBA 1TETH 1U8QB 2BK8A 5EU6E 3H42H 4NNYA 5F1NA 1Z0MA 4CNIA 1F2QA 3QNXA 4OUOA 4ZPVA 3L3OB 1TJGL 3IDIA 1JUFA 4I13B 1MSPA 3P73A 2FHFA 4YC2C 4OLXH 3T4YA 2B4CH 4JPIA 1UB5B 3C5JB 3WLWD 4K71B 1JF5A 1WIPA 1UXWB 3U0WH 2GITB 3HNSL 1CFNB 3MV9A 4KROB 1F4HA 4P2OB 5I0DA 1NGYB 3U2SB 5DK3A 3P4OA 5TDOB 2J88H 2X9YA 3WE6B 1MNUH 3GJFA 1NCAL 5TDNB 5AAMA 1KTDB 4HH8A 3Q6FA 4XC3H 2W9EL 1JHTB 4M1CD 3ZMRA 2C3HA 4GW5A 1OAYH 2DQHH 5J13B 5L2KA 3T65A 3E6HA 4M7ZC 3LRHA 3EOBB 4X98A 4TRPH 4OZHB 4Y16C 5FGRA 4ODSL 3H7LA 1RUQH 5BQ7A 1Y6NR 4RMWA 5HI3C 3VFMB 1G6RL 4M6ML 2CDEA 4PRHB 1U6AH 3QQ9D 3DVNA 3QNZB 1AHWC 4NFBA 1X5XA 4FOMA 2GAZA 3I6KB 1CVRA 5D7IB 4NUJA 3ZDZF 1IGJA 5EZLA 5AG9A 5HHQB 1L7TL 3PXHA 4V2CB 2RGSA 4NKDB 3DRQA 4O9HL 5E2TL 4F8TA 5C2BH 5C0AE 3EGSA 4PJFB 4V1DE 5I1GL 3LQAL 3VU2A 1FG2B 5HYQA 2F9BT 3WFCH 5J7CC 4KRMB 3P77A 5F8RC 3BPLB 1CD1A 1LEIB 1RULH 3TZVD 4YAQB 1X5GA 2OL3B 1FQ9C 3RUGE 3KPPB 4OFVA 4UB0H 3EJYD 3DX7A 1F6AB 5HGHA 1YMHB 3T0WA 4IRJB 1A7NH 4ZS6C 1NL0L 5ADOL 4NZJA 4ZODA 3GSWB 4OCNC 1TJHL 4RRPA 3KPQA 1GOGA 1A8JH 5DJ2A 1VKXA 1HZHH 2IJ0C 4X6CA 1HI6A 2XTJE 4TULL 1HYSC 5CEZL 4S2SA 5I76B 4LKXB 1Z9MA 1C5DA 4ORGB 4BQ9A 1BD2D 3C8HA 3RGVA 1MUJA 2EYRA 5DZLA 4DZ8A 3KXFA 4WHYH 1T1YB 4KDWA 5FUOH 3L5XL