2IAMB

Structural basis for recognition of mutant self by a tumor-specific, mhc class ii-restricted tcr
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
190
structure length
182
Chain Sequence
GDTRPRFLWQLKFECHFFNGTERVRLLERCIYNQEESVRFDSDVGEYRAVTELGRPDAEYWNSQKDLLEQRRAAVDTYCRHNYGVGESFTVQRRVEPKVTVYPSNLLVCSVSGFYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class II histocompatibility antigen, DR alpha chain
publication title Structural basis for the recognition of mutant self by a tumor-specific, MHC class II-restricted T cell receptor
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 39
structure length 182
sequence length 190
ec nomenclature
pdb deposition date 2006-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00969 MHC_II_beta Class II histocompatibility antigen, beta domain
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2iamB02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 2iamB01
1U3HD 2JK5B 4JFZL 4F7TA 3CFJA 1MH5A 4YFLF 3RDTA 4KJYB 2VDRL 3PQYD 4RAHA 4A6YH 4I77H 1F4XH 3DO7A 5IQ9B 3NIGF 1FNSL 4WW1A 5FA3A 3DX6B 1FGVL 1JBJA 2OTWA 3G6AA 1BIHA 4IM8A 2WP3T 3HNTH 4D8PA 1S3KL 4OFYA 2YD1A 5AAMA 4BQBA 4WRLA 4YFEA 3B9AA 2ESVD 3FRPA 4N0UA 3L5XH 1KLGB 5EBWA 2FWOA 3GSNL 5CD3B 3HG1A 3WDHA 1IEAA 3ARGB 3C8HA 4NM8H 1LO4L 2BRRH 3LH2H 3GMQA 4G6FB 3WUWA 5FA4B 2G9HA 3WIHL 2X70B 4IMKA 4LEXH 3MRCB 1GPOL 2XNAB 3QDGD 3HZVB 4ORZC 4JFEE 3DTXB 1OP3H 3WS3B 1IC7H 3OB0H 3WKML 1BECA 3RVTC 1NEUA 2BVYA 4I3RL 3OKLB 1VFBA 4K3EH 4NP4H 2A9MH 5INCB 2JF1A 3O3BB 3ZYJA 1KXVC 4OZGB 3R0MA 1BQSA 3GI9L 4X7TB 1DQQA 3UJIH 2D3VA 1MIMH 4HWEL 3ZE2F 5BQ7A 2HJLB 1RMFH 4LCCB 5L9DH 3HI6L 1C5BH 3ARWA 3AY4A 4X5XB 3SCMC 4JZNA 1FIEA 2V7NB 2ICCA 4I2XA 2MSPA 5JXAL 5IKCA 3O45A 1HWHB 3CD4A 2OSLB 2Q20A 5DO2C 3TBYB 3X3GL 4HUNB 4YLQT 1MVFA 1F8TL 3G08A 4OZGF 1FORL 1NGWA 5AAWA 2P44B 1LO0H 3R06A 2VL5A 3MNZA 5EU6D 5I17A 1WT5C 1DBAH 1AGEB 3WXVL 3BIBX 1EEUA 1ERNA 2DL2A 3FFCE 1WBXA 1U8OA 3S7GA 4MJ4A 3CXDL 3TFKC 3ZE1F 1IZKA 4NHUB 2W0PA 3WNNA 5GZNC 1WTGT 3NABL 1INQA 1KPRB 5GRVK 4NBXB 4JR9H 3Q5OA 4KWUA 3VFTB 3QJHA 2QQKH 4U1MA 4AL8H 3NFSH 5LG1A 5C0FA 5IGXH 4U2ZA 5E8NA 2H32A 4XVTH 3VWKB 1CTNA 5I8CA 2GI7A 2JJSA 3WN5A 4AT6B 3BP7A 3V7AG 5IM7B 2W07A 3PQYE 1U8MA 3RWEA 4OD2B 4GLRI 1WICA 2HN7B 2VXSL 1W72B 4APQB 3MBEC 3MGTA 4JO4L 5JOEA 1INEH 3O2DA 2ESVE 4JHWH 3QIUA 4D0DA 4OLYL 1WF5A 3G6JE 4K8RH 3TPUB 1T2XA 3H9ZA 5GRXG 3ROOA 2J6EA 4R7NB 4XNZC 4PY8I 1PZUB 5F1NB 5HY9A 4Y16A 1NL0H 1BOGB 3QHFH 4LCUB 5SV3A 5HJ3B 1G9MC 3QDGE 4EVNA 2WUCH 2NTSP 1NDMB 1KN4H 2OM5A 4D9LL 2F5AH 4G6KL 2NMSA 3HE7C 3V6ZB 3QUYB 4E41A 4ZOEA 1YNTA 4HWUA 5EU5B 1CDBA 3MV9D 2A0LD 5IF0A 4P2RD 4NCC1 3IGAA 2DICA 4JB9H 4BH7A 2HJFB 2LU4A 3MXVH 3VD3A 3IDGB 1O7VA 3FQTA 2H2PC 3I2CH 1HILB 4G9FB 1Z5LA 4Q74A 1JGDB 4Q7DA 1XIWB 3U6RB 2IH3A 5CD5D 4JRYD 1EA9C 1GZPB 3BZ4B 1MCNA 1CFQA 2X9XA 2P48B 3HFML 2E6PA 1A5FL 5SX5K 1MJUL 4NO5B 2ICWA 3U0PB 3HI1B 3ARXA 2AI0H 2A73A 3JV4B 3WFCH 2V9QA 4NKIL 4YDVA 1JV5B 5C6TL 1Q1JL 4BSWB 1S7QA 4X7SL 3HLAB 3VRJB 4HKXA 3A6CH 5I1GL 5BV7C 1G9ML 2H3NA 3EJZD 3QH3B 5IHBA 4WGVB 4PUBH 3DRTB 3GIZH 3I6GA 4X9IA 3I6KA 1NAKH 1VPOH 5K9QI 1DBBH 4RMSA 5IQ7L 1W0YT 3G6DL 4QWWD 3TN0D 3SKOB 1T20B 1K8DA 2ZCLL 3QUZD 2GT9A 3MNWB 4XX1G 5F7NC 2J88L 4ZNEE 4RA0C 4KAQL 3HI6H 5MHSD 3STBA 1W8OA 3ZKMC 1X5YA 2ADIB 1GIGH 3FB5B 1FZJA 1Z6JT 3GFUA 4GQ9H 4JRXD 4C83A 1NC4A 2P8MA 2P47B 1W8NA 4C56A 4Y2DB 1JN6B 4CJ1A 4PGZA 5ENWB 3S36H 1XF5A 5CUSL 1XF2A 3FN3A 4QO1A 4W4OC 1OM3H 5C07D 5HDQH 4ZTPL 3OB8A 2YRLA 3VGGA 4PGJA 4Z7UE 4ALAL 5MENB 3MJGX 3W39B 3PP3K 1G7PB 1P7KA 5BV7L 5FIEA 2FO4B 3B8SA 3UTTA 1UQSB 2AK4B 5CBEA 3AU1B 2IQ9L 3QUXA 4JFHD 1K6QL 3WFHA 3NCYP 1UADC 3NCCB 3ZL4L 1CG9A 5LGHH 3ZMRA 3VXTA 2BVOB 5AYUH 1RIHL 1ZA6A 3MV9E 4K8RD 5JHDB 4P2RE 3L3KA 1A7OH 2VSCA 4O2EA 5DSCA 5E00A 4NYLA 1M05B 4F57H 4TOYH 1YA5A 4YBQC 1E4JA 4MWFB 4YHIB 2A38A 1E27B 2VZOA 3V5DB 1WBYA 4OB5H 1T7XA 1HNFA 4XWGH 2RR3A 4I18C 1WSST 2O5XL 4JRYE 4PJBA 4Y5VC 3IFLH 3L5WB 4H5SA 3TBVB 4RGOL 5C0DA 3O41A 5C0CA 5ANMA 5FKPA 4G8FB 3LN4B 5DHVH 5I1KH 1EO7A 2YS4A 4P46A 2E9JA 4FQXD 5CJBA 3MRFB 4DKDC 1U8IA 3RI5K 4KDWA 4UINH 4G6AD 4PV9A 1NLDH 3I9GL 4F3FA 1ES0A 3GIVB 4NHCH 3SJVD 4WHTB 1EHAA 2MKWA 1A6UH 2CLZA 2X1PA 1N2RB 3ILQD 4RAVB 3HPJA 2XY1A 3QIBA 5M95B 3GSWB 2XA8H 4HWZB 4LLYB 5DJ2B 1KCRH 4FZ8H 4XVJL 4P5KA 3QXDA 5FO9B 5B3NA 4MCZB 2IBZY 5I16A 1OQXA 3RKDD 4JY6A 4DVRH 3FHAA 1A1OB 2OXGA 5CSZB 4CW1A 5MHSE 1QSEB 4NKMB 4YBLC 3OSKA 2J8UE 2LAAA 4HLZG 1LDSA 5I1LB 4PJHB 4XP6L 5D7IA 3BZFA 3IAQA 5BS0B 5BCAA 2V9TA 5FGRA 5J89A 1T7VA 4JJ5A 4JRXE 3SE9H 4HC1L 3F62A 3U4EB 5I30H 1T89A 3WHE0 1KV3A 4ZSOB 3L3OA 3VFNA 5D2LA 2YOCA 5FAAA 4PJHF 4WGWB 2EYTB 4TRPL 5C07E 5BVPH 4CVUA 1RVFL 4WTZG 5SX4I 3PL6C 5E9DA 1OLLA 2O5ZL 4QXUH 2APBA 5ETUB 3MYJB 4L3CB 1NCAL 3U7YH 5GS1A 1YMMA 3BSZH 3OHXB 4ORGA 5ICXB 5MERA 2ILLA 4JFHE 4X6DB 3V8OA 5C8JB 2P7TA 4K7FB 1T83C 2IH1A 4UV4H 2BDNL 2FATL 2XRAL 4Y19B 3EYSL 2DKSA 4R97B 5I8OL 1AKJB 5IB1B 1TJHL 2BVTA 4MA3A 5EA0L 2YD7A 3REWA 1OF2A 4XRCA 2P5WD 3T77A 1KENH 4Z7VA 3DYMA 4X6DF 3GMMB 1BP3B 1OTUC 3ARQA 5CS7A 5E2WH 5FHBH 1FCGA 2HRPH 2VQ1A 3TJEH 4RFOH 2HVKA 2V6HA 2V5MA 2R2HA 4HDIB 4X0KB 3KPPB 1QPPA 1ZVSB 3HMXL 4MQTB 4OSUL 4Y1AD 4NO2A 5JR1H 3SDAD 5I19L 3T8XB 4HHAB 4LCWB 5D9SB 1B6UA 3AS3A 4LSPL 1ZLUK 5SWQB 4LARH 1MJJA 1IGTB 3SJVE 3ZE0F 3VGAC 1KPVB 3ARDB 2QADD 4JGMA 3MLYH 1ZHLA 3OG4B 3FB6A 4HKJA 2A74B 3EYOB 3CVIH 1MCKA 5HI5D 4Y4FB 2AJXL 4JFPA 4R8WL 3O9WC 4PJGF 5F9JB 4KROB 4XPHH 1UKQA 2XZQL 4QHKI 4DZBB 1FNHA 5FO7A 3UTPD 4H26A 5D1QA 2C3VB 1U0QA 2B2XH 5IOPA 3MV8D 3JTTB 3KPLB 4YGVB 2HLAA 1TITA 3E0GA 4EN3B 4KDVA 1KT2A 5HPMA 3P2TA 1I1YB 3T4AB 4YDJB 1TZIA 4HUUA 4YPGA 2AVGA 4PJ8C 3RVWD 4H0HB 3U1SH 1LK2A 3FO0H 5LQBL 3T1WA 3LS5H 1EHLL 3ME0A 4HW6A 3SDDD 1NAML 2X4SB 4MXQC 4HEPG 5FUZH 3QIWC 4JCLA 3C5JA 4POUB 1WZ1L 5E7FA 4QXTB 4M7LH 4NQUA 2ZP0T 3JWNC 4XC3H 1WIPA 4KXZH 4OZHE 3IDIA 4L8SC 3UPCA 3N06B 3FQNA 1CL7L 4HT1L 5L2KA 12E8L 4RX4A 2J12B 3QXTA 1HKLL 4X83A 4XVSL 4HUWB 4CU8A 2I60L 2IPTL 4YHYC 1EERB 4JFDB 1OB1A 3BPCB 4UT7L 3K1KC 5GRZA 1HXYB 1Q94B 2GSGB 2P5WE 2LU3A 1HH9B 1J1XL 2VXUH 2GTWB 2JELL 1AD0B 4X98A 1MI5D 1N26A 4UTAL 1JPSH 5D7LD 1WBZA 4UMGA 4LU5L 1MQKH 4M43H 1NJ9A 4Y1AE 1GVIA 2MQ3A 1XR8A 3R0NA 4YR6B 3PWNB 1F13A 1ZA3B 5DI8A 5IR1B 5EUKB 5F7DA 3GI8L 5TE7L 4P5TB 1UJ3A 4MZ2A 1ORQA 5EIQA 3CSYB 4ODVH 3FRUA 2YEZB 2XZCH 4GRWB 5FYJL 3SGDH 2X1QA 1T6VN 5IB2A 3LPWA 3DMMA 4NQDD 4S2SA 3QDHA 4PTTB 1CLZL 1G0XA 5DURD 5K9JH 2I07B 2J7LA 2XKNA 4M3KB 5F89B 4I4WA 1INDL 3UTPE 4G6JL 5DLMH 3OKKB 4Q9RH 4EXKA 1I7RA 2FSEA 3BMWA 3MV8E 2XQBH 1U6AL 2JIXB 2XIDA 3BO8A 3UPAA 1JYWA 3MRLB 3GHEH 1CE6B 4JKKA 1HEZA 1W0VA 4JG1H 3LRHA 5I6XB 3DV4A 2X4TB 2Q8BH 3EHBD 5DUML 2YWYA 2NY6D 3PXJA 2R0ZL 4GG6A 2NYYC 1A8JH 3OKNA 5TH2A 3VG9B 5KSVB 5DEFA 5DFVD 3V4UL 1LE5A 1AGCA 3BW9A 3FB8B 4NM4H 3L5IA 2IADA 4JQXC 1SY6H 4RMTA 5E6IB 1BJ8A 3C5ZA 3X3FL 1DE4B 3E6FB 4QRRB 3ARED 4HPOL 5HXMA 3DBXA 4OBSA 1T7WA 2Y36L 4KTEL 1QKZH 1WCQA 2R1XA 2A6DB 3V6OC 1SJHB 3C60D 4NFCA 1H5BA 5HYQB 4M48L 4X7DC 1MFEH 5AZ2L 3KPSE 4YPJA 1RHHB 3GMLA 2VABA 1DL7L 1RUKL 3I3BA 4X6FB 1A47A 5I1HH 4LHUG 3RX5A 3DIFA 3F7RA 4F33B 3I85A 1Y6MR 3D9AL 4EQ3A 1K3IA 1S7VB 4WUKL 2G60L 3Q2CA 4FQ1H 5GGRA 1H9VA 3U0TB 1MI5E 4PRIB 2PUQT 5D7LE 1XMWA 3RZCD 3QP3A 2CLVB 1FFRA 3RZWA 4O2CB 4PJFE 1HCFX 5EOQH 3BGAA 4HGWB 5FHAL 3T4YB 3REVA 2VISA 2ATPA 3SGEH 4YHKL 4Y4HB 3VXRD 1GHFL 2FLRT 1E4XI 4AIXA 1YEHL 4D0BA 4DCQA 5GSVB 1J05A 2YUWA 4PGCA 1BWWA 1S9YA 3MROA 4J3UA 1G9EA 1YECL 4X5LA 2VLRD 4NQDE 1X5AA 3O8XA 3BP4B 3KXFA 4ZS7L 4HWBL 4ZUUB 2IANB 3P4NB 5L88L 5IJKA 2WIIA 3FT3B 2PF6A 2X40A 3OKYA 2AGJL 2NNAB 4BZYA 4IRZL 3VA6A 43C9A 1GGTA 4U1KB 4MVBD 5EORL 1X4XA 3STZA 1TNNA 3MLSH 1BJ1J 3PWUB 3FQWB 4H1LH 1J0YA 2Z31A 4HK0A 4YDLC 2ZNXA 3KLDA 3MMEA 3VFOA 1U58B 5C08B 4BSVB 3MLZL 3MACH 4F15C 3GMPA 2NR6C 3MCLH 1A6WH 4NT6A 3HRZA 2ZUXA 5B21A 5C0JB 1ZVYA 1E4KA 1NSNL 2OL3A 3RWHA 2R2BA 2H2SC 4HIXH 1GOGA 4Q9CA 2XZAL 4Z0BL 4LFHD 1JRHL 5C9KA 2AJ3A 4ONHA 5DMIL 1KFAH 2IQAA 4X8JB 1ORSB 5ID0A 1AXTL 5DK0A 3IDYC 2AJVH 3D3VD 5KG9A 1A1NA 1T4KB 4I5BA 4S0TD 1ACYH 8CGTA 2FCBA 4XCEA 1T1XA 4UOW0 2HFEA 3SKUD 1SEBA 3C09B 1GC1L 4LVOC 3LS4L 3QJFA 4N8VB 4J3OC 4OFVA 1G7MA 1ZHBA 4G6JH 5FECA 1OCWH 4PRDB 3TT1H 1LILA 1UXSB 4IIQC 1QFWI 3IKCB 1FJ1A 4AH2B 3FOLB 4JREB 2F8OA 4H25B 2UZIL 3RFZC 1F45A 2PCPA 4C55A 5HHQA 3PWPD 1ACZA 3QQ4A 1AQKL 1QSZA 3VXRE 3G5XA 5HTSA 4NQED 4AEEA 3QA3B 2JB5L 4J6RH 5IMOA 5JW4M 4X9FA 1RZIA 4D9RD 5DJ8A 1UA6L 4OZFG 4WWKA 2NXZC 1OSPL 4PD4J 5JW3H 1D5XB 3SDYH 3RVXC 2VLRE 2CDFB 3ISWA 3D5OF 1P1ZB 1Y0LB 3KR3H 2X9YA 3LIZH 3Q1SH 1LP9E 5DJCB 5HDBF 3PHQB 4WI8A 3GSQB 1CDUA 3HNVL 2HYMA 3FT2A 1IZJA 5KN5A 1W2KT 2F19H 1HIML 2GJ6D 3RWIB 1YEGH 1GGYA 1P9MA 4M62L 5IESL 2CKBB 3LN5B 4PJ9B 1RJZB 4M7ZC 4G7VL 3CFEA 4ERSH 5BRZB 1OAYL 3NBNA 4XWOD 1V5JA 3CGTA 4XH2A 2VDLH 4OGXL 1R3JA 4KRPD 5A2JH 5IHZB 5IWLA 1LD9A 1CZ8L 4OCYH 1VFAB 5E1HB 2FJFB 1A6ZA 2WAHA 3D2UA 1BVZA 4J7RA 3LRSB 4IMKC 2G75A 2ATKB 5KSAD 2X4OA 4JPWL 3ZTJG 2GJZB 2UY7A 4O51A 4P57B 1ZLSL 5I9QB 4XPAL 4CRPA 4X4MA 5EZJA 4D3CH 1VGEH 2Z4QA 2KDGA 2HKFL 4G42B 2QQQA 2PXYD 3D3VE 4NWUH 3ARPA 3OKOB 1I8KB 4R96B 2NY3C 2AGJH 4HV8A 4Y5XA 3MCKA 5B3JE 3VDCA 4HUMB 2A77L 1OGTA 4JY4B 2E27H 4OCLC 1U93B 4OBRA 2GCYB 3GRWA 1SVZA 3C87A 3OJDA 5TPWL 3QNZB 4LLMB 3QDJD 3X12A 3HB3C 1D9KD 3WV0A 1B88A 1F3JA 2WBJB 1KLUB 4S1SL 1FL3B 3PWPE 4Z5RB 4JPIA 3K8MA 2V7HB 4P23B 4XZUB 1KIRB 3FO2A 5IB5B 3P0YL 1EEZB 1G7LA 2B7DT 2D7OA 1BAFH 3BXNA 4NQEE 2C1OA 2DWDA 1MFAL 4UIMB 1CIDA 5GQBA 3GKWH 4D9RE 4OZ4B 3IU3A 2VERN 2I9LB 3CLEH 4GRMA 3M8OH 3VXUA 1KC5H 3D39D 5ESAA 1J8HB 1GAFH 1X6NA 2EE6A 2JJSC 3WN5C 4G3YL 4J23A 4NN6B 2XXMB 5B38B 1RZJH 3O11B 1NLBL 4XMLL 1EH9A 4ZO7A 1EUUA 4PRAA 3ZKXB 3TBWA 1B90A 4DOHB 2AXJA 2GJ6E 5E70A 3EOTH 4YHNB 3FQXA 2VUOA 5L7XL 1A7QH 1ZGLB 5EOCL 5CIPA 4ODTL 3CFCH 4U1NA 3WCYA 3AMKA 1RZ8A 1QUNA 1T3FB 1M6OB 1FIGL 5DUPL 2MCPL 4B41A 5C0NC 5TF1L 5A16A 3W9DA 3FT4B 2Z93B 1F2XK 5ACZA 15C8L 1C5DB 1FFNA 4FN0A 5C6WH 4UB0L 2GY5A 2AK1H 1BREA 5I2IB 4UT9H 5J12B 5IB4B 3STLB 5IIEB 2VLMD 5F9OL 1OGAA 3K2UL 3ARBD 2B4CL 4Y4KB 2YPLD 3H0TA 5KS9B 5JDSB 2YC1B 1T0NB 3LQMA 1CXEA 3THML 4XNYL 2FB4H 3UTSB 4ZYKA 3CDCA 3SDCC 4JFOA 4PYGA 4M5YH 1JI2A 3TO4D 1CICB 4HXBH 2QTEA 2DWEB 4PJEE 2FGWH 5K9KA 2RIKA 3WD5H 1FL5A 1ADQH 3IVKB 3WFBH 1KJVA 1CCZA 3OWEA 5IW1B 1KNOA 2CMRH 4K9EC 4IDLA 4GSDH 2N1KA 3H7BB 3QDJE 3TIDB 3QCTL 3BX7C 1KEGL 1EFXA 3W0WD 5FB8B 3WEXA 3M17B 4NQVA 3TIEA 3WS3A 1U9KA 5GRUL 2YD2A 3ILQC 2BNRA 2VQUA 4WCYH 2D7QA 1KJ2A 2WW8A 3MQIA 4HX1B 4P2OD 1KG0A 2R2CA 4M6MH 5F3BB 4ZFOL 4Q6IB 3LDBB 3D85A 2DQJL 1QLRA 3O4LD 5T33H 3LKQA 4OKVB 4XTRD 1ZLSH 3D39E 4L9LA 4YE4H 1G6RB 4M8VA 4JFFA 2DLHA 4HIJB 2E6QA 2EKSA 3H2WA 4G43B 1FAKT 1KJMA 2KQNA 4LDEB 4N9OB 5ICYB 2GW5A 3P4OA 3KAAA 1EZVY 5T1DL 1CD1A 5C92A 1PYWA 3MLXL 3WYRA 1SEQH 2IPKA 4GJTB 5FYLD 3QRGH 3O6LH 3ECBB 4TPRL 4Q0XL 5TGBB 5IBTL 4E5XB 4XAWH 3CFBB 1Z9LA 2W1NA 3ABZA 3D6GA 1KB5A 4KI5D 4XNXL 5CEZD 3EO0B 2GUOB 4NO0B 4OLVH 2AV7B 2HFGL 3QFJD 3VFPB 4I0CC 2OR9L 4K9EL 3FAWA 4NHUA 1FSKB 2ZUWA 3JVGA 5LGKA 4RWHA 1U8KB 2VLLB 5HHXL 4XNQB 5B4MC 3IXTA 5JLZB 4JM4H 3CX5K 4EBQH 3DRQA 1NMAH 3HUJE 2W65A 1S9XA 3P77A 1I7TB 3B9KA 4GAYB 5IVXA 4XI5D 5GPRA 3MRQB 4IMLA 2R56L 4NZRL 1U8JA 2QSCL 2VLME 3EDJA 3OXRB 4PB0L 5A43C 3QWRA 3CSPA 1MFNA 2PKDA 5BZDB 2N4IA 2YPLE 4KQ3H 1F02I 1A7RH 3QUXC 1JNNH 2N56A 5T1MB 3BQUA 2C4XA 2F15A 5DYOB 1XZ0B 2BOCB 1MPAL 4DGYH 1OAUH 4P5MB 5K9OB 5C09B 4XNUL 1FBIL 3F58L 3RWFA 2HA1A 4MJIB 5BVJA 4PJ7E 4WUUD 2HMID 1E28A 3MUGA 2IAMA 1QBAA 3RQ3A 1J1OH 4WI6A 3TPUA 2X4PB 5D7JA 1BEYL 5E2VL 5AZEL 2FR4B 2B20A 4YHZH 1JWUA 3UDWC 3S37L 1YEEL 1IQDB 2A9NH 1JFQH 5IW6B 4AIOA 4RMUA 1KTRL 5F1NA 4PJIB 1T0PB 3ARGD 3C8KA 3TZVA 4UV7L 1Q9LA 1P2CA 4JDVB 4PREA 4RQQA 3W0WE 1FFOB 4C58B 1CFBA 1JWMB 2NY5C 3IJHA 1IKFL 2F53B 5CWSA 5GS0D 4P2QA 4EI5A 2XTJC 2AAVA 4DAGL 4NWTL 3K1DA 4BKLA 2VDKL 4G8IA 5MP6L 4FFYH 4FS0A 4PJIF 1F4YL 3FAXA 4DW2H 5IT2L 3O4LE 2YA2A 5T3ZH 1IGJB 2DQCL 3QIBC 3DURB 4PJ5B 3LKOB 2H32H 4MMXC 3QBTB 2XWJB 1VSCA 2EYRB 2P4AB 4Y88A 3MODH 5E2TH 2UWEB 3BI9X 4P3DA 1I7UA 5TQ0L 1UYWH 1MF2H 1BOYA 4TULL 1VHPA 5FYLE 3KPMB 4YZFE 3BRDA 1CFVH 1Q0XL 1AD9A 1NUNB 3O6FC 3RY4A 3MLVH 2WNGA 4KI5E 2C3WA 2CIKA 2H1PL 4HK3J 5CEZE 3MOAL 5AG8A 5EOTB 3O2DH 3PWVA 4PLKD 2ITDB 5CJ8A 3QFJE 1AR1C 2IPUG 4CVXA 1NFDA 2UWEF 1T89C 1AXSA 4FMFA 4FXKB 5DC4B 1P7QB 4MS8C 1A7PH 1M7DA 3LQAL 4GW5A 2J6EH 1XCQB 3QUMA 4LSSH 1NKRA 2EXWC 5MEOA 4QHUB 3T1FB 1TZGH 3RDTD 5IB3A 2C5DC 4JLRA 2VDMH 1FG2A 1GH7A 4NPYB 4B7LA 1XGYH 3JXAA 1SVCP 1YMHB 25C8H 1GZQA 2OI9B 4G9DA 2UV3A 3GJEA 3CPLA 3SN6N 2MPAL 3MA7A 3GMNA 1NC2A 2HAZA 4XNMA 1N3NA 3B2UD 3GM0A 1AY1L 3RUGF 1QRNA 4LLWB 3WL9A 4L4VA 2HLFD 4NBZB 3O2VH 3S3PA 1HK6A 4YUEL 3HG1D 3MV11 1JZ3A 4ZFGL 4WUUE 3WJJA 3DETD 1WIUA 3IJSA 3IDJA 3SQOH 4WU5B 3U7WH 4FFZH 1UZ8B 2BHUA 4TTDD 3G5VB 5IEHA 3GO1L 4RFEB 1DEEB 5BMFL 1SBSH 5JOFB 4X6CA 4KH2A 4HIHB 4LHUB 2DQFB 1G0DA 1QACA 3DROB 4ZUTB 4OLXH 4J1UB 4ETYA 1IEBB 1Z3GL 2VOTA 3ZE2E 4L4TA 1EK3A 3GBML 1S78C 1JZ4A 5KVEL 1MUJA 1V7ML 3OJMB 5SWSA 2ZOLB 1JHTA 1I1AA 4R2GB 4F8QA 3H9SB 5E1AB 1IGYA 3QUYD 3BZEB 2Y5TA 2ZUSA 1NCWL 4U1JA 2WLZA 3FZUD 4L3EB 4ZXBC 5D96B 3V5DA 5HHOB 3IDNA 1FGNH 1O7SA 4LLVB 4OM0H 1MFBH 2VL4A 3SE8H 5EO0A 2RFXA 4AIZB 4Z7WE 4X6BA 4FZEL 3QNXB 1XCTB 2WQ8A 3LHPL 1XIWD 4RMVA 1AFVH 2BVUA 1CU4L 1X44A 2CDGB 4PY7B 1MCWW 1KIPB 3MO1B 1T21B 5DWUL 1EAJA 1A6VL 3BESR 2FECL 5TFSL 2FH8A 4U3HA 1N2RA 2CSPA 2EE3A 2EH7L 5AG9A 3BFOA 4WO4A 3WO4C 4PP2A 5BOZG 4OUUA 4L8BB 1B4JH 1UXWA 3IAPA 1MY5A 4Z7NF 1FNFA 2GFBA 1PZ5A 3KYKH 4PB9H 1FLRL 1HI6A 4ZUVB 3G9VA 5IT2H 4MB4A 4YHML 4OM1H 4HEME 4PGEA 4OIAA 3QIUD 4N0UE 5I1LA 1WITA 2F74B 3BDXA 3N1MC 1RUAH 3T3PF 4WI5A 3LKSB 5HHVL 3HG1E 2AABL 4YK4C 4IRSB 3BOVA 4KY1L 4YEEA 1MJ8L 4GLRH 4YC2C 4BQ9A 4LGSB 1IJ9A 1VEOA 3C6SA 4OCRL 4EIGB 4YXKL 1FG9C 3ULVF 1G7HB 4DKEH 4Y16D 4MXVF 1IAOA 3VWJB 2ITCB 2IF7A 3HS0A 4RNRB 4Y2DD 4YX2L 4FTVB 1J86A 1MVUA 3HE6B 2B5IC 3TV3H 1NUGA 1J5OH 1NANI 4ZAKC 1S5IH 3K8KA 2NY5H 4TSCL 5L0QC 4NN7C 1AGDB 1MHPH 4E41D 1FO0L 1TPXC 5E6ZA 4QTIL 3BPOB 5T1KA 1X6LA 1EIBA 4NRZA 4UILL 1C5CL 4N0FA 4I2XE 1LK3L 1JMZA 2AK4D 4ZPVA 2OYPA 3VXPA 3WS6A 4P59L 1MRDL 1TCMA 4JAMB 4W6YB 1IARB 5ALCL 3UMTA 1IGIH 2EC9U 5LAXA 4DKAA 2HTLC 2V2TA 1IMHC 3CVHA 2E7LA 2OK0H 2NXYB 1U91B 5JPMB 1D7FA 3V52L 4UI2A 4CDHA 4KZEL 3RTQC 3C6LC 1AGBB 4WHCA 2PO6B 4F8TA 3N85L 4LAQH 3SY0B 5T1LB 2FIRT 4R26H 4U6VL 5IK3A 1F6AA 3MBXL 3Q0HA 3BN9D 1HXMB 4G8GB 5E2UL 5FM5O 1QEWB 1TETL 2QQLH 3BE1L 3BP6B 4GBXA 3WDIA 4QRUB 1BX2A 3ARFA 1L7IH 2MHAB 4QY8B 3WLWD 3WNOA 2BOBA 3QI9A 2FGZA 1BD2A 4GAJL 2Z8RA 5L6YH 2OJEB 1NGPL 2ZJSH 6FABH 3NIDF 4Z7QF 2HKHL 4U2YA 1RK1B 2EXYC 1QYGL 4LQFL 2Y07L 3ETBF 4J3SA 1OPGH 3C5ZC 5JPNA 5F1OB 2PTTA 1F58L 1UZ6F 2CXKA 3VXMB 5I66B 3Q5TA 3CU7A 1CLOH 4LSUH 4LQ1A 4R4FL 4P48A 1NC4D 1H5BC 2Q87A 4Q9QL 1OW0C 1JGVH 1NBZB 4K71B 5KAQG 2FHFA 2X42A 4C56D 2RQ8A 1IM9B 2W0FB 4YDJA 3EJYC 1QSED 3UBXG 5J3HC 5J6HB 2FLBT 2GAZA 3RNKB 5BS0D 1MJ7H 4YEFA 1J7VR 3EDFA 4JG0H 4ONFL 3HR6A 4UQ3B 1AIFA 1FC2D 3OJVC 1GOFA 4OIBA 4HPYL 2ARWA 5EBLA 4GW4A 1EHXA 4LCYB 1I3GH 4OCXH 4WV1A 3C5SB 1FAIH 3FMGH 1JYNA 3H7LA 3OZ9H 1OARL 5GRVL 3EO9L 1WVZA 4OV5B 5EWIL 3IXAB 5EO1B 3RX8A 2EC8A 3N1PC 4E41E 4K7PY 4ELMA 4GRLA 5JOPD 2B8OT 1TTFA 3BGMA 2AK4E 1ZS8A 3VGDA 3E2HC 5HYSG 4OLUH 1MWAA 2EEBA 5LGJA 1AXIB 1RQ5A 3BPCA 3A6BL 3EGSA 3HC3L 1UEYA 3RA7H 3VJ6A 1R5WA 2ZUVA 1R6VA 5FF6B 4AM0B 5DMKB 1N59B 3QO0A 2VLJA 3O3EA 4M1CD 4Y19D 2R4RH 5KOVC 4YXLL 5DTFA 3QG7L 5C0CD 4OUOA 5ADPL 3QXAA 1H8OA 4YAQA 1TTGA 3QQ3A 3T65A 2EIZB 4OCNC 2YKLL 1H3WM 3DV6A 4P46D 5D2NB 4GS7C 2E7MA 3U2SA 4KHXL 1P53A 4R4ND 3ALPA 4ESKA 2VZVA 4S1RL 4R4BA 1A9EB 3DVGB 1QBML 3Q6FB 4YR6A 3BKYL 1FNAA 1V7NH 2Z31C 3ULUC 5EUKA 4HFWB 4I1NB 1UJTA 3S8WA 1YYLH 3R8BB 2QHRH 4UBDD 5DFWH 4TUOB 3VG0L 3HAEB 1S7TB 2DTSA 3V5KB 4JFEB 4LCWD 1YEKH 1E4KC 2XV6B 5C1MB 5GJTH 1BBDL 3TNNB 2I07A 2DDQH 2JLLA 5AYQA 3LKNB 5T5FL 1GGBH 4XC1L 2ZG2A 4Z95L 5DRXA 4ZO6A 3TBTB 2BJML 3WFEH 5JW4R 3HZMB 1CVRA 1J88A 4HZLA 3SO5A 4C56E 2GKIA 4KROD 1JHKH 3RL1B 1QSEE 1S7SB 4HWNA 3QEGL 4PJHE 4PRPB 5BS0E 3OXSB 1RUQH 2AERT 4PG9B 4EN3D 1U8QB 1IL1A 1A1MB 2V2WB 5JZ7D 1YEDB 2Z8VC 4XBGB 3FFCB 4KKCC 3IFPA 5E9DD 4XCYA 4KU1A 2VDNH 2V2XA 4ETQA 5CZVH 3UTTE 2Q76B 3EOAB 3LSOB 3OKEA 4MJ6A 1CFSA 2E8ZA 1DLHB 1KTDA 5F96H 3KPRA 1OP5K 4DGIH 5J9PA 2BY0A 4F37K 4Z76B 2NZ9D 4Y2OA 1AH1A 2XI9A 4RAUB 1U3HB 1SJHA 5DR5H 5JOPE 2VO5A 3X17A 2MWCA 5DMGC 4WWKC 3QCUL 3PQYB 3ARSA 1RHHA 3L5HA 5JMRA 1Q0YH 1CGSL 4WW2B 5I0ZA 3CZJA 4X4XB 1CBVH 1UB6B 2GQHA 4DUVA 5J4MA 4PJBE 1RPQA 2V5SA 2W9DL 3F8UB 2PW2A 1DEDA 2R29L 4Y19E 1A7BA 4OJFH 5D1XB 5C0CE 1IT9L 3U0TA 2ESVB 3MOBL 3AXLB 4PJAF 2Y23A 2NY4C 4NNPH 4MA1B 3MRDA 4FQIH 4JPVH 4J8RA 3NZHH 3B3IB 3ESVF 3A67L 3G6JB 2OZ4A 1CGUA 1P9MC 5D4QA 2AKRA 5GSRA 4KKAD 1SMAA 4MCYB 3PGDB 1VCAA 5HPOA 4M7JL 3Q48A 2DD8L 3EFDH 3EUUA 3W2DL 5J1AB 1JGLH 3KLHC 1DBMH 1AGFB 1TJGL 4N90D 2DLFH 1A6AB 1YEJH 4LSTL 1S9WB 2V5RA 2GITA 3QDGB 3G6JF 4LCWE 3GSOB 2HTKD 3MJ9A 3IYLW 4RISH 2R2EB 2VNCA 2EO9A 3P0VH 4FQJL 5TDPA 4PJGE 1JP5A 3BIKA 5EU4B 4ZDHB 3BD5A 5F9DC 1OAQH 3IFNL 4UNTA 1JHLL 5D1QD 4OIIH 2DJUA 1S7UA 5I74B 2APWA 5FOBB 1HINH 5GGQH 2KKQA 1K4CB 1TTUA 1F5WA 3D0LA 4DTGL 3GHBL 4JO3H 4XP9L 2VDOL 4MSWB 5IMKB 5J1SC 4RWYL 3MC0A 3VFGH 1H0DA 2V17L 4YXLH 1NDGA 1S9VB 5ICZB 1HHHB 4O02H 3FQWA 4YJZL 5IV2B 2A6JA 4U3CA 5D2LE 3C2SA 2JIXD 1N7MH 4K07A 5ABDE 3ARYA 4LSRH 4X6EB 2NTFB 1DBKL 1SYVB 2IBZX 3CXHK 4KVNL 4LPTA 5DJAB 1S7XA 2ADJA 5E9DE 5F7MC 4ONGL 1QO3A 5DEZA 4OGZA 3L6FA 4RZCA 4F7MB 2VDPL 5I73C 4XXDB 5DHYB 1YNLL 2P5EA 1BIIB 4XT1C 5LWYH 4RX4D 3T2NH 5ELIA 4MAYA 2C1PA 4K2UH 3WHXA 1H15B 2ZSWA 4JM2A 4LVHC 2F58L 3KYOA 1Z9MA 2ZZUT 3X11A 3KPQA 2IG2H 4QRPA 2AEQH 4LRNH 4QRRD 1RZFH 2EDHA 1T4KA 3GBNH 3RWGB 1YNKL 4Z7VE 4ZQKA 4HH8A 3MXWH 4CMHB 1S8DB 2C7UB 2NY1C 1FRGL 2OTUA 4IOSD 2NY2C 2SEBB 4KI5C 1BZ7B 1T04A 4IRJA 32C2B 3IJYA 4Z8FL 4XP4L 4CMMB 4LF3A 5CEYA 4NKDB 1JGEB 1N64L 1DVFC 3WFDL 4H25A 4WFFD 3QZWG 2J3SA 2VE6B 1TLKA 1CI5A 3S88L 3OX8B 3O4OC 4KI1A 1FYTA 1NMBH 2UVEA 1QA9A 4O9HL 5B22A 4PRID 4RFNB 5J56B 5CJOL 4M9PA 4A6YB 4Q58C 1LQSR 3CDGA 4FP8H 4N90E 3WSQL 3E3QC 3ULUH 1DR9A 1L7TH 1QFWM 3MV7A 3AC0A 1OAZH 4G7YL 4FG6C 4RGMB 5I15L 4KZDL 1UCBL 2HP4A 3ROLB 1BLNB 2ZUTA 1FHGA 3ALWA 5E08H 3CFIC 1ZGLP 3MLTA 3KVQA 4MA8H 2OL3H 4L4JA 2LVCA 3RGVA 4LVEA 4OGAC 3UBXI 2BVQB 3CK0L 4OD1L 2A2QT 3MV9B 5CSGA 4P2RB 1CXLA 1JJUA 1HZHL 2IAND 5FYLL 3VCLA 4R0LB 4DN3L 2WMPA 3AM8A 3O2WL 5CEZL 5FYJU 2ORBH 2EICA 4JANB 3P9MB 3TCLB 1DTUA 1PQZA 3FKUS 3ARGC 4F7CB 1K2DB 3EDKA 1ED3B 4FQHA 5F21B 1YQVH 1U36A 4KK9D 3DVNA 1ZWIA 4GT7A 4QLRA 3I84A 3QPXL 5F7WC 4D0CB 5DT1H 3C2AH 1FH5H 5KZCB 1FE8H 2ATKA 4URTB 5E99L 5D71H 4FRWA 5ISZA 2RJMA 2GJZA 5C08D 4BELD 4KJQD 3G9AB 4LLQB 4LRIA 3U0WL 2R0LH 1DQDL 5L2JB 5KVFH 1NCNA 4N68A 1TZHA 1KCVH 4OTXL 5KTEL 3TN0B 5LCVH 4JCMA 3SGJC 4QRRE 3VD5A 2WWMC 4LCCC 3QUZB 2F54B 2O61B 2YXMA 3IAGC 2A6KB 5IEKB 3EYUL 1I85C 2H8PB 4ODUA 2B1AL 4HF5L 3WLBA 1UWEL 2BCKB 1WEJL 3FN0H 4XP9H 1NGXA 1URLA 5HHNA 5GZOC 5D5MA 4JRXB 1A14L 4E0RB 4WFFE 3GSNA 3VDBA 2MMXA 3O6ML 4XMKL 3HHRB 1BBJB 1U8PB 1MRCH 4HBCL 1A0QL 5E5MA 2V7HA 1T1ZA 4BZ2L 4PRIE 5GS0L 3JVGC 1FC1A 3BIAX 1PG7L 1XH3B 5C07B 3WIHA 1WC7B 3L3HB 4TVSa 3O8XD 5DQJB 4HQQL 3B9KC 5F7KC 1G9NC 4NJ9H 3RX7A 3VWKC 3B9VA 5EN2B 5IVZA 2H9GA 3L7FB 1J12A 2Q7YB 4Y8AA 3TA3A 4QHMA 4Z77A 2Q8AH 1I9IH 4QRSB 4TSBL 5SWZA 1A9BB 3IS0X 3PGFL 5EZLA 1E4XH 1YDPB 3CSGA 2R23A 5HGBA 5GGVY 4APQC 3CLFL 4LSQH 2D4FA 2ERJC 1N5AB 2FJHB 2IANE 4RSVA 4AENA 4HXAH 4HK3N 4FNLL 5DGQA 1FN4A 3MRBA 4HJGA 2W0KA 3L3IA 1R3IH 1JK8B 4W70A 4OF8A 2DS4A 5J1TC 3MLWL 4TNWK 2YN3A 5D1ZB 5IHUH 5HGDA 1EAPB 2WBWB 5CSBA 5AWNH 5DD0L 1GOHA 1T3FA 5D7JC 5GGVH 5DJ0B 1ZTXL 1LEIA 3LKPB 4Y5YA 4IHOA 3G5ZB 2VAAB 4AK1A 4PJ9D 5CBAB 5F3HA 3V7AE 2X89D 5ADOH 5F71A 4FQXB 5F7UA 3D69B 3MRJB 3GRWH 3TZVC 2VN7A 2VZUA 4YNYA 5ACMA 4HG4J 4MQSB 3QR2A 4DVBB 4KQ4H 5C08E 3SJVB 3TBSA 4IDJH 3BH8B 5KS9A 3BGFB 1QVOB 1FNGA 4OT1L 4DGVH 4JKMA 2CR3A 5JIPA 1I7ZB 3SO3B 5I1CL 3MFFB 2NZIA 2AJSL 2G2RB 3PWJB 3QRFM 3UBXA 3H9HB 3MRPA 1W72L 3GGWA 2XY2A 4OFKA 1U3ZA 3SCMA 1D5IL 5HHPA 4JO2L 5IFHH 3RBSA 1A2YA 1FVEA 1S7WA 1KCLA 5D6DC 5HVGB 3KDMA 3H3PH 3J8F7 2KZWA 3UCRA 1MCCA 1MLBA 5HDLA 3M07A 4FQCH 3MR9A 1WT5A 1XGPA 4V1DA 2IWGA 3M17A 5BO1L 5GHWL 1RU9L 3NTCL 5CIPH 3PHOB 1CD0A 2WM0A 3HI5H 1F11B 1XFPA 4I0PA 4PJCA 3NFNA 4JGJA 2WBJD 3FN9A 5HYSA 5DD3L 5T3XH 3D0VB 1UM6H 1TFHA 4N0YH 1ZLUH 2ZG1A 4P23D 4OKVA 2KUTA 5E8OA 3C08L 1IGFH 1LDPH 4PD4K 3MUZ1 3F6IA 1AQDB 2JJWA 4Z7OE 4EUPG 1N8ZA 2JCCA 1WZKA 2GK0B 5I1EL 1ND0B 5DD6A 1HH6B 4U1SA 4BQ8A 1A7NH 4PS4H 3BT2L 4N1EA 3TVMA 1DDHB 2W0LA 4M61A 3ECBA 1JZ7A 4HS8H 5DVKA 1WZLA 2MKLC 3QXWA 4XPBL 3S96B 1EJ6A 2RCSL 2XXCB 5IJVB 4CN4A 3IETB 3WJJC 3T04D 3ZDZE 2Y6SC 4JY5L 2BMKB 1OAKL 1T1WB 2FX7L 1JUFB 4CUCA 4Z78B 1PLGL 4J3VA 3D2UD 5FK9B 3O0RL 3QEHA 5I1DB 3MUY1 3CC5A 2XQYK 5CHNB 5JW5B 3O3UN 2A6IB 3SDAB 3P9LB 1JWSB 4KMTL 4XX1E 4HH9B 5DJ6A 2DMCA 4OCSH 1M71A 4NNYB 1MSPA 2WINB 3V79C 1NBVH 4DN4L 2QADB 3HR5A 4JHAL 4YIQA 4QRQA 2PYFB 3VGBA 5DYOA 1KJ2H 3HE7A 2BC4A 2Q6WA 4Y4KD 5KAQF 1I1AC 3DXAA 3JWOC 3KLAA 4WTXA 1ZE3C 1B0WA 4MD5A 4PR5A 4WU7B 4ZFZA 5DHVB 4QOKD 3CLFH 1RULH 1FYHB 1SJEB 1G7IA 1HYSC 3Q3GB 4NQCB 2KL6A 5GGSB 1CICD 5F7LB 3MV8B 4XBEH 5H8DA 3G5YB 4MGXA 3BH9B 4LIQL 1VGKB 3BKJL 2VWEE 2NW3B 2CKNA 4O58L 1UWGL 4KKLD 4JDVA 1EO8H 1RURH 3NFPB 1CT8A 3NCBB 1KB5H 2BSTB 1K5NA 3OG6B 3SDDB 4NQSA 3GB7B 4KGJA 3WNMA 3NZ8A 2DTML 3VXUD 3GSXB 4PP1D 3HZYA 5C0GB 1MIEL 2WANA 5FGBC 1D6VL 3MBEB 3ZHLA 4KHTL 3BJLA 1G9NH 4L8DA 4TUKH 3B43A 4NSKB 1TQCB 5D70H 5AD0A 5JO5B 1ZEAH 3JWOL 4CADA 3L3DB 3UTQA 3KPSB 5MEQB 1IFHH 5B8CB 4FQ2H 1X5HA 1EJOH 5GGTL 2C9AA 2HFFB 2M1KA 5CZXD 5C0BB 2E8YA 1CE1L 3DX8A 1AP2A 1BGXH 1XGRA 4GKNB 4XCCH 1L4IA 2FD6H 3QYCA 5D7LB 4YDIH 1FDLL 2IGFL 2FEDD 4PJFB 5FEBA 1DUZA 3QAZC 1Q72H 2YD3A 4LKXB 1N4XH 1Z0MA 2ADFL 2PYEA 1Q9OB 3VFWA 3NN8B 4M93B 4X4ME 1IGCL 4BUHA 3QSKB 4O4YL 1A4JA 1CL7I 3BPNC 4QRTB 5FO8B 3D18B 1QNZL 1DQLL 1WFUA 3L5JA 1F00I 5B39G 5CGMA 1NGQH 2AQ1A 1Z9OA 4PRBB 4PJFF 2X7LA 1IKNA 4NC0B 35C8L 4NN5C 5DURB 2VIRB 4U6YA 1E4WH 4R97C 3QDMB 3PNWB 1PEZA 2UYLB 4QOKE 1AI1H 2VAJA 2BVPA 4JFQA 4XP5L 4POZD 3WO3B 5C09D 4Y89A 3QG6A 1VFMA 3MREA 4RFEA 3J7HA 5D72L 1G7QA 1MLCB 4U6XA 1BFOA 4HC1A 2GK2A 5F8QC 1EFXD 1F6LL 3U36B 1RZ7L 1HNGA 4Y5VA 3R1GH 2FYYA 2YBRB 4WEBH 1C1EL 5DD1L 3G04B 1SJVA 2NY6B 1GCFA 4LK4A 4NRYB 1YPZB 5F72S 3JV6A 5I18H 3D85D 1IC5L 2LV4A 3GJFA 2QQNL 3VXUE 3ARFC 4JGUA 3ARDC 2F53D 4HUXB 4XGZA 3QI9C 1CK0L 4JPKL 4ZFFA 1D5BA 3NOIA 2FBJH 3QUMH 1B2WL 4JQVC 1JPTH 4NFBA 1SYSB 3PP4H 5CGYC 1QFHA 3T0EA 1CD9B 4MQ7A 5ESVA 4M1DL 4F58H 4YFDB 3DSNA 4Y4FC 1CF8H 2H6PB 5HHOA 1YPZF 5CCKL 1S5HB 4P49A 5E6YA 3NH7L 1U8HB 4OKDA 4KROC 4PJ5D 5C3LD 3P30H 4HJ0C 3QZWA 4IOFD 4NGHH 5DS8B 1FL6A 3VXSA 3RWDA 3MRMB 3CX2A 5JA9A 1DSFH 4JN2A 5C2BL 2YD9A 4XBPA 2DQEL 3OB0K 5EIIB 3BKJH 4WI2A 2AV1A 1QLEL 4NO3A 2X41A 3CMOL 1OY3B 3PXHA 5JHLH 5IG7A 3BDYL 4TUJA 3VXNA 1JNHA 4L9DA 3IF1B 5CMAB 1KELH 1T5XB 3HMXA 3QWOA 1PKQB 4IOIB 3AAZB 1C08B 5DEGA 5CJQL 3QWRD 1T66D 4GAGL 1LNUB 1RK0B 4TSAL 4WV1C 3JZ7A 3DECA 3UYRH 5TDNB 3HC0B 2Q3ZA 3QEQA 4NZUH 1ZHKB 2HT3D 1VKXA 4LCIL 1I1FA 3MA9H 2WZPD 4OAWB 2AJYH 1NGYA 1LO5B 3BEWA 4ZTOH 5J57B 4I18B 1DUYA 2IAMD 3D48R 2CJUL 1T83A 3PGCA 3L7EB 3LKSA 3GBLA 3MRIB 1X4ZA 4NC1E 1UGNA 2J8OA 4GG8A 5F88A 4HIEA 3VH8G 4HKZB 4MD4A 1LP9B 4K94C 2R1YB 3FO9A 4GQPH 1BF8A 1KTLA 1PG7X 5C09E 1RUML 1Y18B 3HNSH 4GW1B 1TJIL 4QYOB 4NQXA 3U9PL 2D9QB 3KPOA 3SKJH 1XGTB 1M1SA 3EOBA 1R5VA 3WKNA 4PIRF 3L3JA 4JKWA 2DQDL 3DLQR 4EI5D 4FABH 2VXVH 3RWJB 1LP9F 4DUXA 5HYJA 3WJLA 4HZAA 1WTLA 4V2CB 3V4VH 3W11D 5HGGS 1NAMA 1FV1A 2PW1B 3PE9A 1JZ2A 2L4OA 4P5TC 3MGOA 4KJPC 4YXHH 4LHUD 5F6HI 2F53E 4X4ZA 4JFFE 3RWCA 3DX7A 1IGCH 4JFYA 3DHJA 5A3ID 3CUPB 3U46A 1KBGL 2QEJA 4AEIL 3FB7B 1YY8B 1KB9J 1UM4H 4R2GD 4AEHH 2OP4H 3EJJX 4QTHB 3QHZH 3D3VB 1MRFH 2PETA 3OAUL 1ZSDB 3O9WA 3PJSB 4J3TA 4L3ED 2AJUH 2ZCKH 3N1QC 4K94L 3VXOA 3NACL 1H3PL 1K8IB 4M1GL 1I8MA 3FQUA 1B9ZA 3SDXA 4RA3A 2P24A 1EUTA 1CR9H 1V3LA 1KN2L 4B7IA 2OJZH 1FNEA 5I6XC 3PWLB 4PJ8A 3PL6B 1CGTA 1T0MA 4PY8J 3RNQB 1SHMA 4XPTH 1MCRA 1RIVH 2YD8A 4NUGH 5C0RH 4QY8A 3VG9C 1EZVX 4P9ML 2OX5A 4BQ6A 5B3JF 3PWPB 4MD0B 3QIWA 4K7PL 5GS3A 1HDMA 1J8KA 4WY7H 1D5ZA 1JRHI 2Z92B 3ZTJH 1WCBA 5E6IC 1RJCA 5I1JL 5KSBB 3RUGE 1OAXH 2WUBH 2NY7L 3F5WB 1QRND 1I1CA 4KPHL 1N5YH 1IBGL 1J1PH 3BKMH 2J4WL 4YHPA 3N9GL 1DFBH 4JZJA 4UDTA 2PTUA 5H94A 4LASL 1FVDB 1U8LB 1TENA 5DD5L 5EU3B 1I9JH 5DVLA 2IMMA 1JGUH 2VITB 3ULVD 1HOCB 1CDJA 3D25B 1R3LB 3VDAA 5KSBF 2K3TA 1JPFA 1XF1A 1BZ9B 3LKRB 4YQXH 4KGLA 2NLJB 2VXQH 3KJ4B 5LXGL 3CVHH 3HMWH 2X4QA 2XWTB 2AEPH 3AFLA 1RAMA 3B9EA 3V2AR 2XFXA 4P4KB 4U1HA 1AE6H 1WAAF 3VGAB 4P2QE 4H8WL 4Q9BA 5GRWA 4GMSL 4MXWL 5AEAA 3S3JA 1ZVHA 1RUPL 4L4TD 1I3RB 4LKCA 4OV5A 1C16B 2A1WH 4Y4HC 1C12A 2GJJA 4KVCH 3UJTH 3IFOA 5SWSD 1X7QA 1P4IH 3HE6D 4MX7A 5DJXB 2EDJA 4QHNB 3OL2A 5FCSH 5TJWK 2IFFL 2DRUA 4GKSB 4W81A 1Q9WB 3QQ9D 4S1DC 4WENB 1FCCA 5EC2B 5KSUB 1EV2E 4YDKH 1D5MB 4MDJA 3CU1A 1I3VA 3QEUB 4ELKB 1OWRM 4XCNB 5GRJL 5DJZA 4DKFH 2K7QA 3C9NA 2I9TB 1N59A 5BZWA 4H1LB 1VADB 1FZMA 5CEXA 4NDMA 1IAIH 5C0AB 1QHPA 4L3EE 1JPGA 5L8LB 5I1AB 4ODXA 1NFDE 2DIJA 2HJKB 2NXYD 3B9DA 1EVTC 1TVHB 3OV6A 4OZIB 2X44D 1NMCB 3EAKA 1F3DH 2YA0A 4HFWA 1VB9A 4RIRB 3QDJB 5HYIA 3BUYA 4XAKD 1OSZA 1D6EB 4WO4D 3CCHB 4L8SB 4Z7NE 2QR0A 4G8GD 3LB6C 1KCSH 3EFFA 4EUPA 4HS3B 3OGCB 1EMTL 2NY0D 4OZIF 3IU4H 4XCFH 3MRHB 4MDIA 3T0VA 4FFVD 4YHYB 1HSBB 4JQXA 3T3PE 5C70A 1QRNE 5I8EA 3VRIA 3TC9A 4HWBA 4FQLL 3LMJH 1AC6A 1QPXA 4ODSH 3ULVE 3TJHD 3RL1A 3C09C 1MWAH 2BZDA 2ARJB 2HWZH 2R39A 3LEYL 3FCTB 3ULSB 1IM9D 3JWDC 1I9RL 3O6KH 4H20H 5FYKD 3UO1L 4X4YB 1T2QL 5H35A 4JREC 5C0IB 4OQTL 3VFSB 3BEVB 3ZKQD 1NCCH 4MNGA 1EVUA 2FZ3B 4CVZA 3MRGA 4JN1L 1MELA 4L4TE 4N1CA 1R3HA 1QG3A 1CDYA 2VH5L 4UU9A 3HUJB 2C3HA 1BQLL 2YPVL 4X99A 5SWSE 4U6HB 5T5NG 5F7HA 5E8EA 2ZSVB 4G5ZH 1U3HA 2ED9A 2IJ0C 1FZKB 1BM3H 5FGSA 5CILL 4MAUH 2L7JA 4JKPL 3WNPA 4P3CH 4DQOL 3ARBB 2ENSA 1T22B 3QULB 3UPRA 5FUOL 3HUJF 5KANG 1MHEB 3KYMA 3M1BA 4PBVC 3RIAK 1I8LA 5DXWA 1K3ZA 4NOFA 4E42A 5DDHB 3O3AA 3ARVA 4HKBB 3AM8C 4BQCA 3GK8L 3OKDB 1BFSA 3EO1A 3S97C 3MJ8B 1MREH 2CUIA 1GGCH 2DBLL 3MCG1 4GBXD 3PIQA 5FCUH 3V4PH 2IALB 1LEGA 4FXLA 1BD2D 2R8SH 5KVDL 4Z7QE 3NAAH 4XAKE 1Z9SA 5IROA 3BWAB 4R3SA 4G8GE 4D94A 1MCOL 4PRHA 5CP3A 1HSAA 5ITBH 1LO2H 4K3JH 5FDWA 1UZ6E 5IBUG 2P46B 2BSSB 2M8XA 1TVBA 5C0EA 3SBWC 5D93B 4F7EA 4JFED 2LVEA 2DM2A 3BN3B 4I48B 7FABH 2AEIT 1M7IB 3RVUC 4KRLB 1ZHNB 3JBG7 1MAJA 4BZ1H 1BQHA 2FX8H 4N8CL 2ED8A 3ZKNC 3VFUA 1MEXH 3TYFB 5E94A 4LBEA 2WK2A 1MCWM 3V6FA 2AXGA 5TE6L 4F2MA 1DCLA 1A6TA 1R3KB 4FQQA 4QNPF 5HGAB 4CNIA 5EU6A 3MJ7A 2CKBL 4M03A 3LZFL 1DQJB 3PF2A 4IIQA 1MFCH 1U92B 4MNHB 5FYKE 3P4LA 3QFJB 4X7FC 2O26U 1QR1A 2XN9A 2L0DA 4PRPD 5TE4L 3ARUA 2HT4C 2OZ4H 1RZGA 2VLKA 3NA4A 1BIIA 1NGZB 2R69H 1P4LB 5B39A 4P23C 3L95A 4YZFF 4XXCA 3ET9F 4GRLD 3WXWH 3HZKB 3KNBA 5JUEH 3GNMH 1II4E 2D2OA 4PGDA 5J6GA 1PW3A 3KJ6H 4NJAL 1T03H 3LQZA 3E8UH 4J4PD 2EDLA 3MJ9H 1KEMH 1KCUL 5GGUB 4GKZA 4JDTL 3TA3C 5EUOB 4ZNEA 4JRWA 4NN6C 4UQ2A 4OD3L 3PDGA 1U8NB 5EU7E 3P4MB 4M4PA 4QHKJ 5H2BA 4TQEH 2FIKA 32C2A 1MCPH 3ZKXC 4KKBC 2X4RB 4JQIL 5IFJA 1ZT4A 1F90L 5HD8C 3DSFL 2LE9A 1H3VA 4LLDB 4WUUB 4Y0GA 4Q2ZB 1LHZA 4BFIB 4BM7A 5C3TA 1YY9D 5C7XL 5D1XD 5EUOF 3RHWK 4D9QD 4LGPB 3MNVA 5D2NE 2ZCHH 3TYGL 5JQ6L 4G8EA 4XVUD 1BD2E 4Y5YC 4EDWH 2ICWI 4Z7UA 1W0WB 3RY5A 3OPZH 3DUSB 1ONQA 1QBLH 5AUMA 5IFAH 2ADGB 4FXGB 4O2FA 5J12C 1BQLH 1I4FA 3IDYB 5EB9A 4QT5A 1I1RA 1KYOJ 1UWXK 3ILPB 1F4AA 5E5UB 2FRGP 3BAEL 3U9UA 1YUHA 3TCXA 5E24E 4AMKH 2X6MA 1OTSD 1T5WB 4GXVL 1OT1A 1MCIA 1UH4A 2HT2C 3BP5B 4N5EC 4JRYA 2VDQH 5JW4N 1DBJL 2VXTL 1K2DA 2CGRH 3MPCA 4NUJB 2OCFD 2PN5A 2YK1H 3UAJD 4Z7WB 1FVCA 3QCVH 1UM5L 1CGWA 5ERWB 3U4BH 3DGGA 2Y7QA 5EO9A 4QF1B 3JWDH 2BXZA 3MRNB 3NA9H 3QNYB 4PRPE 1NCTA 1JNLL 1TCRA 4ZOAA 4CN6A 3KPRD 5DUBB 4KK6D 3INUH 5HI4D 4Z0XB 3EYQD 1FFPA 1I8IB 3NMEA 1AJ7L 3E6HB 4KK8C 4P9HL 4Z7WF 4MNQA 4F7TB 4I0PC 3CFJB 1MH5B 3RDTB 1IC1A 5L2JA 1ETZA 4NC2B 1CLYL 4ZOCA 1A22B 4Q6IC 3DO7B 3LDBC 4JZOB 3BKCL 4WW1B 3VH8A 5FA3B 3QUZA 2OTWB 3G6AB 4L3AA 1IILE 3B2VL 2D7PA 3VMOA 4D8PB 1FPTL 2CDEA 3QO1A 1UACL 4HJJH 1DLFH 3LY6A 3RAJH 4PJAE 1JNJA 2QKIA 3ZYOA 4N0UB 2J8UA 5EBWB 2FWOB 3IDXL 3TVMC 4XP1L 3HG1B 1IEAB 1PX4A 3BHBA 2OXHA 1XAUA 2DQIL 4PLNC 3S35L 4K7PX 4JKLA 2PR4L 1LE9A 4PPTA 5E8PA 3OKMA 4OLEA 4D9QE 3WUWB 2YR3A 1PSKL 1MCJA 2G9HB 4XMPH 3RU8L 5KW9H 1NCBH 5ECJE 4YWGL 2CK0L 2E5EA 1U41A 4O5LH 3DWTA 1IQWH 1VFBB 4ISVA 4UIKH 4HFUL 5DRZA 4M3JA 5I8KH 1RFDL 4I3SL 1HHKA 4LSVH 2DQGH 2HVJA 1NH6A 4NCC2 1DQQB 1DQML 4ZFOA 1E0OB 5BQ7B 5ID1A 4JZNB 2ZPKH 4I2XB 2HG5B 1G6RL 3PABA 5IKCB 3O45B 2O5YL 3F7VA 5HI3C 5I1IH 1O5DT 3NCJL 4JFZH 3G08B 3SDCA 1QFWL 1NGWB 2VDRH 3R06B 2VL5B 3MNZB 4M7KL 1DJSA 5I17B 1FNSH 3L1OL 4UAOB 1VACA 1QSVA 4PJXA 5H37H 1FGVH 1WBXB 1S3KH 1U8OB 1P4BL 1ZT7A 3UX9B 2EDNA 2ZKHL 5HBBA 1INQB 2P5ED 2P8LA 2N7AA 2DJ4A 3KPRE 1QLFA 3GSNH 3QJHB 4MAYD 4U1MB 1NFIA 5C0FB 4JM2D 1LO4H 3OF6A 5E8NB 4GUPA 2H32B 1HKFA 5KANI 3RJDA 5I8CB 5KZCD 4QRPD 3WN5B 1MCBA 3BP7B 2R0KL 2JB6A 1U8MB 3WIHH 2YXFA 3RWEB 2D7TL 4NIKB 3KWWA 5MEPA 1NQBA 2OQJB 2ZOKA 1GPOH 4H88L 4TVPL 3RVVC 3WKMH 2F5BL 4KTDL 3FONA 4U1GB 2NW2A 3MGTB 1U2CA 4I3RH 4IRJD 2R4SL 2R0WL 4EI6A 3QIUB 4NZJA 4PG2A 2F54D 5MI0B 3GI9H 1R0AL 1HE7A 3BVNA 4HWEH 1UVQA 1NEZA 3ROOB 4QXGL 1ZT1A 1UKSA 2Q86A 4WDIA 4XPGL 3C8DA 5JXAH 2C4FT 5HY9B 3X3GH 4Y16B 3CZFA 4UDUA 1F8TH 3MV7D 1FORH 4KK5C 4ACPA 5JXED 4N0CD 4EVNB 5HVHC 4U1IA 2FECI 3MRRA 2QSTA 2D03L 3WUZA 5GISL 3WXVH 4ZUWA 4WEUD 4Q6YA 2B1HL 4LSDA 4OZHA 3CXDH 4S11A 3V0WL 3W82A 4IEFB 4E41B 5J8OA 1YNTB 3QPQC 3NABH 2CUMA 4K23L 5IF0B 3UXFA 3IGAB 4BH7B 2AXFA 1MQ8A 3WE6A 3FQTB 4LPVA 2DF3A 5I76A 1YEFL 1Z5LB 1IKNC 4ZOBA 2IH3B 2P5WA 2ICEA 1CFQB 5F70A 5FM4A 2VXSH 3VXQA 2FX9L 1CFNA 4WTWA 1KIQA 3S34L 4AG4L 2XZZA 2A73B 2BNUA 1HQRA 1H3TA 4JO4H 1V8HA 4ZD3L 3SE3A 5FK9A 1IAKA 5GGSY 5D1ZD 1ZAGA 4YDVB 2YMXL 3UDWA 1ZV5A 4Y1AA 1S7QB 5F7FA 2P5EE 4OLYH 4RDQG 4NKOA 2H3NB 4YHOL 4J3XA 3UC0L 4PV8A 5CFHA 3I6GB 3PV6A 3I6KB 4XPFL 4BFEA 1RZKL 3L3GA 4QRPE 4MMZC 2Z35A 1F3RB 4OGYL 4XHJD 4HBQA 5FUCE 1K8DB 3KS0H 2GT9B 3T2QA 4X5WA 2Z91A 1B0GA 3SOBL 4G80A 5DHVA 5ITFA 3DARA 3T0EC 2XKUA 4D9LH 5D96C 5C86A 5KJRL 3PDOA 4G6KH 1BFVL 3Q3GA 3UROR 4C83B 4JFXA 2CIIA 1NC4B 1KACB 2F54E 5ACLA 1R24A 2P8MB 2CXGA 2X4NA 4C56B 5J7CC 4WJ5A 3F7QA 1XF5B 4RGNB 1XF2B 3O6FA 4EIZC 1RD6A 2AQ2A 2FJGB 1XR9A 2A83A 4ZS6D 4YHLL 3MV7E 3VD4A 3OAYH 1P7KB 3BZDA 3LV3A 3HFMH 3UTTB 2YPKA 1A5FH 3P73A 2Y06L 4RBPK 1MJUH 5CBEB 3QUXB 2UY6A 3WFHB 3SGKC 4NKIH 3BD3A 1CG9B 4LNRA 3VXTB 4LOUC 5C6TH 1Q1JH 1ZA6B 3V5HA 4X7SH 3L3KB 4O2EB 5EPMA 5DSCB 5E00B 4NYLB 5I1GH 5CAYB 1EPFA 1G9MH 2E6JA 4LVNB 2F5BH 1WBYB 3SKNA 1REIA 5TDOA 5IMMA 4PTUA 2FL5A 4KJWD 5IQ7H 3G6DH 4PJBB 2E7HA 3CH1A 4ZUSA 4H5SB 2ZCLH 1Y6KR 4IRSC 3UTZA 5C0DB 3O41B 5C0CB 5ANMB 1SM3L 4PLJC 5CLTA 2J88H 1MI5A 4KAQH 2W60A 4P46B 1KJ3L 5D7LA 1U8IB 4BH8A 3W9EA 3VWJC 4LPWA 4RRPA 1MAML 2J8HA 3Q6GL 4F3FB 4PJBF 1ES0B 2YZ1A 4LKXA 5EC1A 1HQ4A 1Q9OA 2CLZB 2BY2A 3FJTA 4FMKA 4WNQA 3RVTD 3WJLC 5F1IA 1IGML 4HG4K 3HPJB 3QIBB 1P84J 3QQ9C 1YEIL 4JJHA 3LPGA 2XWBA 1Q9KA 5CUSH 3BPOC 2ZG3A 4P5KB 3QXDB 4ZTPH 4NQDA 4ALAH 4PJGB 4LEOB 5I16B 3EYVA 4JY6B 4JEGB 2R1WA 1CGYA 3SCMD 5BV7H 1QRKA 1AR2A 3FTGA 3ULVL 5HSFA 1ZLWH 1JF1B 5D7IB 3BZFB 1A4KB 5DO2D 2IQ9H 1K6QH 4JJ5B 4HIIA 4ZXBA 5ILTL 4YO0A 3JTSA 3ZL4H 3QFDA 3FFDA 4U3XA 1RIHH 5CINL 3LPFA 2PO6C 1CFTA 3ZYIA 3L3OB 4NQCD 3VFNB 1UB5A 5D2LB 2W59A 3TFKD 1HHIA 5D7IF 4IS6A 5GZND 2O5XH 5DQDL 3VFMB 5E9DB 3LEVL 2CO7B 4RGOH 5GS1B 1YMMB 4ORGB 5MERB 3DYOA 4NZTL 3SE4A 3ZSTA 4OLWL 5D2LF 2VQTA 2HH0L 2P7TB 4K3DL 3AREA 3GMRA 1FO0A 5DRNA 3OQ3B 4I0KA 2GSIB 2IH1B 5TQ2L 2FHBA 4CDGC 3OR6A 3I9GH 3GSVA 3ZT6A 4KDTC 1P5VA 3C60A 2WWKO 4MA3B 3MBED 4JO1L 5D7SL 1VENA 4MA7L 1OF2B 4XRCB 3T77B 4JZJC 4Z7VB 4K71C 3UJJL 4XVJH 1YN7A 2APVA 2VQ1B 3IT8D 3KPSD 4OI8A 2HVKB 1IAMA 2R2HB 1MFDL 3IF1A 5C0BD 4NO2B 3RZCA 1QFUL 4XP6H 3RPKA 4Z7VF 1EGJL 3AAZA 2IFGA 4HC1H 3DVIA 2EH8L 1MJJB 4EQ2A 3VFRA 3VXRA 3LRGA 4R90L 5JIIA 1ZHLB 4EOWL 3FB6B 4HKJB 3HE7D 4ZAKA 1MNUL 2OR7A 1RJYA 3DXAD 4TRPH 2VLRA 1RVFH 4JFPB 3S35X 3GJFH 4U49A 4JVPA 3BJ91 2O5ZH 3L7EA 1YJDC 4HUKB 2NPLX 5FO7B 4H26B 5D1QB 3RJQB 1NCAH 2H2PD 2MQCA 5IOPB 4POYA 2HLAB 2AP2A 1KT2B 1N0XL 1ZXQA 3VW3L 4C59B 1TZIB 3QDMD 4HUUB 4YPGB 3RL2A 4CKVX 5BW7C 2BDNH 1LK2B 2FATH 2XRAH 3EYSH 5FYKL 3FHQA 5I8OH 3RTQA 3C6LA 1TJHH 4ZPTB 5EA0H 4NQCE 3OR7A 4OLZL 4OQ1A 3RWJA 1AO7D 5LBSL 2VC2L 2VR5A 4HCRL 5FKAA 3MYZA 4LLUA 2Y72A 3C5JB 4KTYA 1F4WL 4LPYA 4PJDA 4M7LT 1RJLA 3F7YA 1MHCA 4L8CB 2VSDA 1IM3B 4UTBL 1PD6A 3IDIB 4NKQB 3FQNB 3HMXH 4OSUH 4FFWC 2Z0BA 5L2KB 2JCCE 3KYNB 5I19H 4W4NA 5JIKA 5ESQA 2ARJQ 4U0RC 4LSPH 5HHMB 4K3HA 4X80L 1OB1B 5DQ9A 5CZKA 5EZOL 4DZ8A 4YK4B 1YJDL 1ZSDA 1H8SA 1LEKA 5JQHC 5BJTA 1LGVA 1FP5A 3ZKMD 5BOPA 3LCYA 4ENEC 2YD5A 1OW0A 3KPTA 4X98B 2AJXH 1JPST 4R8WH 5HGHB 1QSFA 1WBZB 3TWCL 2XZQH 4HUVA 4NRXA 4OCWL 1XR8B 1YYML 5C0BE 3I50L 3CDYA 4KUZL 5GS2H 5D7KD 3RPIA 5DI8B 5F7DB 1TPXB 3PWPA 1UJ3B 3NIFE 1A3LL 1ORQB 3BWUC 4NOBA 3B6SA 3F12A 3FRUB 3LEXA 1WIOA 1A3RL 4NQEA 5LQBH 3Q5YA 4R6UA 5IB2B 4GOSA 4J4PC 3DMMB 4O00A 2B0SL 3RGHA 3O3DA 4S2SB 1EHLH 2XT1B 1T1YA 1WV7T 1NAMH 1XF3B 3DXAE 1U3HC 2L7UA 3OGOE 3L9RA 2OTPA 2XKNB 1R5IA 1WZ1H 4I4WB 1EEYA 2DAVA 4U33A 3HC4L 2DLIA 3CFKA 2DYPA 4OCMC 4YBQD 4WW2C 2VR4A 1T7ZA 3VFVA 1I7RB 3X14A 1CL7H 5JNYA 4HT1H 3LKRA 12E8H 2GJ6A 3BO8B 1HKLH 2UZYB 2ZWLT 4XVSH 3QDME 1HEZB 1KPUA 3K4ZA 4AQ1B 1I8LC 1W0VB 2WQRA 4UT6L 2I60H 2IPTH 3DV4B 4GMTL 4MA1C 3VE0A 2DQTL 1GC1C 4XVUC 1LO3L 3MLRL 4GG6B 4UT7H 3DGCR 3OKNB 5TH2B 3ZDXF 1AO7E 5DEFB 3S6CA 1J1XH 4ZG1A 1LE5B 1AGCB 2JELH 3BW9B 1B0RA 4ODHL 3I02A 4UTAH 4EDXA 3C5ZB 5KSAA 5CP7A 5IROC 3DBXB 4LU5H 4GG6F 1YPZE 1ZANL 2R1XB 3B5GA 5KVMC 2YSSA 1H5BB 3GI8H 3FQRA 5TE7H 2EYSA 3GMLB 2VABB 2PXYA 3VGEA 4HMCA 3VXSD 3GUTA 1CD8A 3DIFB 1NUDA 1IC4L 4F9PC 5FYJH 5DJYA 1NKOA 5KVGL 4JHZA 4PJEA 4YBHA 1NCDL 1CLZH 3DUUA 5GGRB 3S9DB 7CGTA 1MHHA 2W38A 4W68A 1INDH 2GIYA 2PNDA 4RIRA 1TXKA 3QDJA 3ZT5A 2I24N 1D9KA 3REVB 2VISB 1S7RA 2ATPB 3GSUA 4YFLI 1OD9A 5D7KE 1U6AH 1QR4A 2DLGA 5J11B 3I75A 2YD4A 3PL6D 4D0BB 4DCQB 3TNMA 4PGCB 3RKPA 1S9YB 3MROB 2BNQA 5DUMH 1PKQE 5EZIL 5INDA 4XXCC 2R0ZH 4S1QL 3JUZA 3O8XB 3VMPA 3KXFB 4P4RA 1E6JL 5ALBL 3V4UH 4G6ML 3D39A 1G1CA 2WIIB 3ORJA 4P0DA 3EBAA 3S5LA 2VRAA 1TQBB 4MJ5A 3X3FH 5JORA 43C9B 4M6OL 3S4SA 1F3DJ 5GS2D 3QUKA 4HPOH 1XGUA 2XOTA 3STZB 2EDEA 2Y36H 1OTUD 3EIFA 4KTEH 5DVMA 1RIUL 4K3GA 3ZT7A 3ZO0A 4M48H 4AQOA 2Z31B 3EYFB 4HK0B 5AZ2H 3WIFB 4Z7OF 3MMEB 1DL7H 1RUKH 1NBYA 3WDJA 4UUJB 5EH1A 4F7PA 3GMPB 3D9AH 4NT6B 3HRZB 4P4KD 1U95A 4Y8DC 2ZNWA 4L29B 4WUKH 2G60H 5DRWA 2OL3B 2JTDA 4CBPA 3RWHB 2R15A 3QB7C 2R2BB 2XPGA 3U7AA 3U30B 3FOMA 3ULUF 1K85A 4RGMC 1VA9A 2AJ3B 3GSRA 3WMSA 4ONHB 3ZDZF 3KGRA 3WIIL 2IQAB 5C9JA 2DQUL 5FHAH 1N6QL 2YPLA 3AS0A 5ID0B 5DK0B 4HS6A 4YHKH 4EUPH 1GHFH 2M26A 3H42L 4PRNA 3SPVA 5KG9B 1YEHH 2K7PA 3P11L 1DP0A 3O9WD 4I5BB 5E8DL 1JIBA 1FZOA 1KB9K 1T1XB 4XCEB 2A0LC 5DJDA 2HFEB 3DX9A 5GJSL 1SEBB 3VXSE 5BXFA 1E6OL 3TO4A 3SKMA 3TT3L 2VYRE 3X13A 1G7MB 1YECH 5FECB 2AXHA 4PJ7A 4M6NL 3BYYA 3OMZA 4ZS7H 1BVLA 4HWBH 3TO2A 2X4UA 1DN0A 2I5YL 1IE5A 5L88H 5C0AD 5CD5C 2KH2B 2NX5A 2J1KA 2W9EL 2PCPB 4IRZH 5HHQB 4MXQD 3QIWD 3W0WA 2QBWA 3QQ4B 5EORH 3G5XB 4HULB 3MRKA 5DGRA 4A6YL 4I77L 1F4XL 5FUCC 3GMOB 5IMOB 2BSSA 1RZIB 3RBGA 4P2OA 5DJ8B 1QQDA 5FYJD 4NNXA 4WWKB 3EJZC 3HNTL 1NFKA 3O4LA 5F1KC 3MLZH 2CLRA 4EJ1C 3HCVA 1L0QA 5A1AA 3L5XL 1NSNH 5KSBE 4QWWC 3TN0C 1AHWA 2B4CC 3QUZC 1P6FA 2XZAH 1YN6A 2N7BA 5DHXB 4Z0BH 3IDMB 3FT2B 5KN5B 1JRHH 4NM8L 2BRRL 3LH2L 4PGBA 1X4YA 5DMIH 1QP1A 4HAGA 4N9GA 5HGAA 2BSRA 2D31A 1J10A 2P8PA 1WAAE 1AXTH 3CFEB 1JTTA 1WJ3A 5C6PB 2BX5A 3QFJA 4LEXL 4XH2B 1DVFA 1R3JB 1IC7L 3UZVB 1LD9B 1GC1H 4P99A 3LS4H 1KULA 1SQ2N 4F9LA 2GTZA 4K3EL 1A6ZB 3FO1A 3D2UB 4NP4L 2A9ML 2H26A 1GSMA 2G75B 2X10A 2X4OB 5DK2A 3UJIL 1MIML 4O51B 2GHWB 2UZIH 1RMFL 5L9DL 1C5BL 1OHQA 1XGQA 3HPLB 5EZJB 5KBNC 2QL1A 5CP3H 1AQKH 2JK5A 4KJYA 1LO0L 4K8RC 2JB5H 1DBAL 5IQ9A 4HV8B 1UA6H 3MCKB 4Y5XB 3DX6A 1OSPH 1OGTB 1ZOXA 4QOKB 3KYAA 2E9WA 1CGVA 5DA4A 3OJDB 3SEPA 5C0AE 5SV4A 1KLGA 3X12B 4JR9L 2C3GA 1F3JB 5CD3A 2QQKL 1HHGB 2NYYD 3HNVH 3NFSL 3ARGA 4AL8L 5IGXL 1HIMH 1W0WA 4JPIB 4XVTL 3FO2B 4OZIE 4M62H 5TF0A 4FQXC 5IESH 1G7LB 4G7VH 3BXNB 5FA4A 2C1OB 1HWGB 2DWDB 2X70A 4QGYA 5EFIB 4G6AC 1OAYH 3RY6C 3IU3B 5FYJE 3MRCA 4GRMB 2XNAA 3HZVA 3DTXA 3VXUB 4OGXH 4MLIA 3BGFC 5ESAB 1CZ8H 3OKLA 1INEL 1N6QH 3K81A 5INCA 2NY2B 4JHWL 3O3BA 4OZGA 2LABA 4IBLT 2LU7A 1EO5A 3ALXA 3TBWB 4X7TA 3UZEA 4JPWH 3SGJA 4K8RL 3RKDC 2HJLA 4LCCA 4X5XA 3FQXB 2V7NA 4XPAH 5CIPB 4PG2C 1I85A 4U1NB 2WWKT 2OSLA 3TBYA 2HKFH 1NL0L 3QHFL 2MFNA 3ARRA 2YUVA 2WUCL 1OLZA 5A16B 3W9DB 1KN4L 1H3GA 1AGEA 2CRMA 2F5AL 2A77H 5ACZB 3TESA 1FFNB 1MCHA 4GH7B 5TPWH 4N0RA 1OGAB 3W81A 5EIVA 4JB9L 1KPRA 4JZOA 3S3SA 3H0TB 4GXUM 3MXVL 3VFTA 3T3MF 3I2CL 4S1SH 3DPBA 1MY7A 2Z9TA 3VWKA 4ZYKB 3P0YH 4UNVA 4JFOB 4AT6A 1KTKE 4KJWC 5IM7A 1WWCA 3MUHL 1MFAH 2WIMA 5K9KB 4OD2A 1P7HL 2HN7A 1FL5B 1W72A 4APQA 2AI0L 4QEGA 1KJVB 3WFCL 2E7BA 1KNOB 4G3YH 5L8KB 1NLBH 4XMLH 3A6CL 1YC7A 3PUCA 5EDXA 1EFXB 3WEXB 4NQVB 3TIEB 3BRGC 3UP1A 4PUBL 4PRHD 3GIZL 4R7NA 3SE3C 2BNRB 1NAKL 1VPOL 2NR6D 5L7XH 5EOCH 1KJ2B 1DBBL 4ODTH 3SDAC 1KG0B 2DKUA 2H2SD 3B83A 1BOGA 2YHGA 2BFVL 3D85B 1L6ZA 4LCUA 1FIGH 1QLRB 5HJ3A 3LQAC 3LKQB 2MCPH 5DUPH 1J0ZA 1NDMA 2Z8SA 4L9LB 5TF1H 3TPKA 2QADC 2VTFA 4JFFB 2EKSB 2HG5A 3LD8C 1KJMB 15C8H 3V6OE 2VJXA 3V6ZA 3QUYA 1GIGL 1VDGA 4UB0H 4GQ9L 3P4OB 4QNPE 5HI5C 1CD1B 1PYWB 2VUYA 5F9OH 5EU5A 4R7DB 2IPKB 3K2UH 2OBGA 2B4CH 2CUHA 2HJFA 3MTRA 3S36L 1KB5B 3IDGA 1PY4A 3THMH 1HILA 4G9FA 1OM3L 1K9TA 2XN9D 4XNYH 5HDQL 1JGDA 2KPNA 4MNGE 1XIWA 3U6RA 1TNMA 5D6DA 4BA8A 1GZPA 1MCDA 3BZ4A 3RVWC 2VLKD 1VFOA 3IXTB 3DRQB 2W91A 3O81A 2W65B 1S9XB 3P77B 1KOAA 3B9KB 4NO5A 3U0PA 3HI1A 5IVXB 2APTA 2YD6A 3JV4A 3SDDC 3AB0C 4IMLB 5LGHL 1U8JB 1JV5A 5AYUL 4BSWA 1J0KA 3HLAA 3VRJA 1A7OL 5J06A 2NXZD 3QCTH 1KEGH 4F57L 4TOYL 2OQJA 1H8NA 4WIQA 3RVXD 1QD0A 3QH3A 1XF4B 2EDOA 1J87A 2ERJB 5GRUH 3BQUB 2X1OA 3DRTA 3RUGB 4OB5L 2APXA 5IVXF 1F4HA 3QQNA 1TQCC 4XWGL 4BK4A 1JTPA 3RWFB 3IFLL 3SKOA 2FBOJ 1T20A 5BVJB 1E28B 3MUGB 2IAMB 3MNWA 2DQJH 3EKCA 4OFYD 5EUOE 5I1KL 5D7JB 5B8CC 2CD0A 2RAMA 2C3XA 4BFBD 1JWUB 4DEPB 4AJ0A 2ADIA 4UINL 3ZHKA 2Z8WC 1PEWA 3FB5A 3VGFA 1JF5A 3AUVA 1NLDL 3TZVB 3C8KB 4NHCL 5T1DH 4EZMA 1Q9LB 1P2CB 4PREB 3MLXH 4RQQB 1A6UL 4OI7A 4Y2DA 1JN6A 3IJHB 4TPRH 4PRHE 4Q0XH 4B5EA 5CWSB 4N8VG 5IBTH 4P2QB 4XNXH 4EI5B 5ENWA 2XA8L 1KCRL 4FZ8L 4M5ZL 2HFGH 1BQUA 2OR9H 4K9EH 4BKLB 4G8IB 5MENA 3W39A 4M93C 1G7PA 4DVRL 5HHXH 2FO4A 1UQSA 2AK4A 3AU1A 1RI8A 1KYOK 2OR8A 3SE9L 4P3DB 4NZRH 2R56H 2FNBA 1I7UB 2QSCH 4PB0H 1IAII 2BVOA 2OS7A 5JHDA 5I30L 2NY3D 4L5FL 5EU6E 1HN1A 1AD9B 1M05A 1CDHA 1J0JA 2CIKB 4MWFA 4YHIA 1E27A 3PWVB 5F93C 2XN9E 1MPAH 5GGTA 2ZUQC 2I27N 4CVXB 5BVPL 1NFDB 1WFOA 4XNUH 1FBIH 1AXSB 3F58H 4C57C 3L5WA 4QXUL 3HB3D 2VLKE 4DK3A 3TBVA 4UNUA 43CAB 1M7DB 4GW5B 3U7YL 3EHBC 3LN4A 4G8FA 3QUMB 5EBGA 3BSZL 5MEOB 2NY6C 4MNQD 5I71B 1BEYH 5E2VH 5AZEH 5IB3B 1L0YA 4JLRB 1FG2B 3MRFA 3S37H 4DUWA 1YEEH 5DFVC 3T0XA 4UV4L 1NFDF 4PLOB 1C7SA 5T3ZD 1GZQB 2ZUYA 4G9DB 2BFVH 3GIVA 3GJEB 4UV7H 4WHTA 3CPLB 5FOJA 4WFHD 3MA7B 3SE4C 3GMNB 1NC2B 3V0AC 1IKFH 4RAVA 4XNMB 1N3NB 3AREC 5FGBA 1KENL 3GSWA 1QRNB 3WL9B 4L4VB 4HWZA 5DJ2A 4LLYA 1WWAX 1QZ1A 5E2WL 5FHBL 4U31A 4DAGH 4NWTH 2BHZA 2VDKH 3C60C 5FO9A 2HRPL 3TJEL 5MP6H 4QKXB 3UYOD 4MCZA 3IJSB 4RFOL 3IDJB 4ODWB 1F4YH 4Z9KB 4GO6B 1A1OA 2DQCH 5CSZA 1QSEA 4NKMA 4C4KO 5IEHB 5JR1L 4PJHA 3BRFA 5BS0A 2DLEA 2MCG1 2FJGA 2WV3A 4LARL 3ZZ1A 4X6CB 5TQ0H 3U4EA 4TULH 5C0ND 3DNKA 5H37G 3MLYL 1Q0XH 3KS0J 3RZCC 4ZSOA 3AGVA 4HGMA 2H1PH 3MOAH 4CVWA 4JDZB 3CVIL 4L4TB 2EYTA 1RHFA 2XTLA 2RBLA 1MUJB 1NBQA 5SWSB 1JHTB 1I1AB 4X6CF 4XPHL 1IGYB 5ETUA 2Y5TB 3LQAH 3MYJA 4L3CA 2B2XL 4U1JB 3OHXA 5ICXA 4CJ0A 4X6DA 3SDCD 5C8JA 3IDNB 5F44A 1HYRC 4K7FA 3U1SL 2G5BB 5EO0B 4Y19A 2RFXB 3FO0L 1AKJA 5IB1A 2MPAH 4X6BB 3LS5L 4X9GA 5FUZL 3ZYZA 1AY1H 2JJTC 4MVBC 4C54A 5B38G 3GMMA 5IMLB 4YUEH 4M7LL 4XC3L 4ZFGH 3OF6D 4OZFB 4MNQE 4BUGA 2YRZA 4HDIA 4X0KA 3KPPA 1ZVSA 4WO4B 3GO1H 3S98A 4PP2B 3T8XA 4OUUB 4HHAA 4LCWA 2E9IA 4TYUA 5D9SA 4M5ZH 1UXWB 5BMFH 5T3ZE 2GFBB 1PZ5B 4OF5A 1HI6B 5SWQA 4PJGA 1IGTA 4LEOA 2NY0B 1CXIA 1J9CT 4WFHE 4KRMB 1KPVA 3ARDA 3RRQA 4PGEB 4JQVA 1JF1A 4CGTA 1A4KA 2VXUL 2A74A 3EYOA 4KV5E 1Z3GH 1OOAA 4Y4FA 5HDOA 2Y25A 3GBMH 1L6XA 5KVEH 1V7MH 1JPSL 1YC8A 4L5FH 5F9JA 4DZBA 3C6SB 1MQKL 4M43L 4R9HA 2C3VA 1NCWH 4LGRB 1CDIA 1IAOB 3JTTA 3KPLA 4YGVA 4EN3A 3HS0B 3T4AA 1I1YA 3RP1A 3QAZB 3VFMA 1MVUB 3H6JA 5B4MD 2G5RA 4ODVL 3H9YA 4RGND 2Y1VA 2XZCL 2I25N 3BPNB 4FZEH 1LMKA 3LHPH 2DJSA 1TVDA 2X4SA 1DQTA 5K9JL 1JMXA 1V3JA 5T1KB 1CU4H 2GSIA 4P3WA 2LTQB 4NRZB 4NN5B 3UTTD 4QXTA 4N0FB 5HVFB 4ZPVB 1CQKA 4RCAA 3QUXD 5DWUH 3DO3A 1A6VH 3VXPB 5DLML 5TFSH 5EBMB 4Q9RL 1GJIA 2XQBL 2EH7H 5LAXB 2V2TB 3CVHB 2NQCA 3GHEL 4LP5A