2IAMB

Structural basis for recognition of mutant self by a tumor-specific, mhc class ii-restricted tcr
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
190
structure length
182
Chain Sequence
GDTRPRFLWQLKFECHFFNGTERVRLLERCIYNQEESVRFDSDVGEYRAVTELGRPDAEYWNSQKDLLEQRRAAVDTYCRHNYGVGESFTVQRRVEPKVTVYPSNLLVCSVSGFYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class II histocompatibility antigen, DR alpha chain
publication title Structural basis for the recognition of mutant self by a tumor-specific, MHC class II-restricted T cell receptor
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 39
structure length 182
sequence length 190
ec nomenclature
pdb deposition date 2006-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00969 MHC_II_beta Class II histocompatibility antigen, beta domain
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2iamB02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 2iamB01
1G9ML 1NFDF 3U4AA 4J6RL 1DVFB 1MIEL 4Z5RA 2ZUWA 4ZNCD 1CXKA 3B5GA 5F88B 5FA4A 4Y5YA 4PGZA 5F1SA 4RGNB 4M7LH 5GGUB 3Q6GH 5DMIH 1MJ8L 1MJUL 4LVEA 4Q7DA 1MHCB 5DUBA 2JTDA 1S8DB 2DM3A 3EJYD 5KANI 1XCTB 4JANA 1T7VA 3LY6A 5ITBL 3H6JA 4UAOC 4I77H 2BCKA 4R26L 1BBDH 2AJYH 5C09E 4LQ1A 4X9BA 4NQVB 1G7LB 4U1IB 3VJ6A 4PV9A 4PJGB 4GAYB 4DKFL 3QG7H 2Z4QB 1CF8L 5EU7C 4ZYKB 4NRXB 4F8TA 2EYTB 3WFCL 5L7XL 5ICXA 4WWKA 3TYGH 2ZSVB 3H9ZA 5D70L 2R4SL 4DEPB 3V7AG 4ODHH 3OAUL 4N0UE 5EU7E 1RUKL 1J1PL 1VDGA 4PJBA 1TZHB 1UXSA 4XVSL 4X80H 2JLLA 5ENWB 2HP4A 1R5IA 3IF1A 3L7EB 3ULVH 1PZ5B 3DVFA 3MOAH 5E99H 4AQ1B 4MA8H 5HYQA 1QFUL 3SN6N 4X5LA 1ZLVH 1WAAF 2W60A 3EJZC 4RAUB 4OZHB 4YHNB 4YAQA 3C6LC 4ZSOA 2GITA 3IDIB 1V05A 4MA3B 4DVRH 3GSQA 2P45B 3N06B 5J6HB 2CUMA 4NQTA 4ZUWB 5A2KH 3QH3A 2YK1H 1NGZB 4HJGA 1I1FA 3LRGA 5T5NF 4Q6YA 4R2GB 3S4SG 2CK0L 1B6DA 3S36L 4JZNA 1R24A 3MV8D 1GHFH 5DQ9B 1OCWL 1Z9SA 1ZA3A 5C0ND 5E5MB 5T3XD 4NNYB 3O9WC 5E9DB 4QHLB 2P44B 5J9PB 2LU3A 4EI6A 2YSSB 1R5VB 4L4TB 1ZHLA 1XIWC 2O26U 2VDMH 1DQDL 1KPUA 1EXUB 1SQ2N 3HI6H 3EIFA 1OTTC 2Q3AA 1U91A 2DI8A 5GS2D 1BPVA 1NFIA 3ZZ1A 3MA9H 3V6FA 4LSSL 1BVLA 1I7UA 1X4XA 5I1DA 1YYML 1KFAH 2BNRA 2F58L 4D3CL 1V7MH 3OPZL 4WEBH 5IV2B 2BFVH 5TGBB 4YBLC 4UQ3B 4D0CA 2EDLA 1U41A 1CR9L 3TJHD 5LXGH 4LPWA 3DRQB 4NKIH 3BH9A 1QVOA 5FYJE 1T2QL 3VG9C 1N0XH 3OKYA 1CWVA 2CR3A 5HI3D 2XTLA 1A9BB 3BN3B 2X4NA 1KN4L 4YQXL 3W9EA 3C6SB 1P84J 1F5WA 1KBGL 4OGAC 1X3DA 1RUPL 3GJFH 5C0RL 4S2SA 3RWCA 4P0DA 4ELKB 4WWKC 1KEGH 1J05A 4U4BA 1IBGL 1GSMA 4XWGH 3N9GH 1UEMA 4Y4HA 3GBNH 1IRAY 5CD3A 1PBYA 4WNQB 1IKNA 3TA3A 2UYLB 4K3EH 1E0OB 2YZ8A 2NY4D 3MCLL 2ZG2A 3OJVC 4U1HA 5TDNA 3SE3A 5A43C 1I9RL 5J1AA 4PRBB 5DJ8A 3PE9A 5DQJA 3NIGE 4HUNB 3UPAA 4D0BB 4FFVD 4Z76A 4PJBE 1NDGB 3ZDXE 3V6OC 3LSOB 1E4XL 2BNUA 2DAVA 2D0GA 2AJZA 4PGEB 4PREA 5IGXH 1BD2A 1RURH 1M71B 2WLZA 3B9DA 2W9EH 4PY7A 1HK6A 3V6OE 3V4VL 5F7NC 3CSYB 4HS3B 1AQDB 3HNVL 4WGWB 4K7FB 2Z92B 2R69H 1T0MA 1A6AB 2XWJA 4ZSOE 3W39B 4GKNA 4RFOL 1D5BA 1EFXA 4IOFC 1YJDC 5D8JH 2QLVB 4EI5B 3C60D 2VC2L 2MHAB 1QKZH 2H9GB 3MNWB 2R56L 3K8LA 5FDWA 4L3CB 2YD8A 4P5TA 3BGFC 3GSNB 4HMCA 5TJWK 4Z6AT 1RAMA 1P7HL 4DN4L 3ZYOA 4M9PA 4MNQA 3VXQB 1D5XA 4G9FD 3ZE0E 4CMMB 3HPJA 4S1QH 1N8ZB 3LN4A 2AABL 4O51A 5D93B 4JPIA 1FVEA 4AL8L 2F5BH 2HRPH 2I07B 1DLHB 2JJUA 2WIIB 4P49A 4ZFOA 4ZXBA 4OLWL 3BIKA 4ONOA 1M1SA 3U46B 5J1SC 4CW1A 5HBBA 4XRCB 2BOBA 2Z93A 3O4LB 3CIQA 3TBYA 5L88H 4TSAH 1WWWX 3G6JA 5T1MB 1IGML 4DN3H 2VLLB 5DDHB 4PUBH 3L3IA 4JN1L 5C7XL 4WIQA 3EAKA 3BE1H 3MGAA 1GOHA 3TO4D 5IFJB 2VZ1A 1I1YA 4PRDA 4JEGB 2EDEA 2UVFA 5KN5A 1LEIB 1ULVA 3QQNA 2BXYA 1KB9J 3S97C 2UZXB 4Y4HC 2JJWA 4NBXB 4KI1A 4G8EB 3P9WB 4R2GC 1IKNC 3DX7A 3TA3C 3T2QA 4KKLD 2C4FT 1T3FA 3FQXB 1I9IH 3MV9B 2GSGA 5E8DL 3DIFB 5HHXH 4XHJD 1K2DA 1BIIA 1HDMB 5IHBA 1U8OA 3SJVD 3BN9D 4U1KB 1OQOA 5DMKA 1UM6L 4QHNB 3MFFB 4YGAB 2V7HB 3LB6D 3G5XA 3BSZH 3CXHJ 4LLUA 3PQYA 4LSDA 1B6UA 5IB5B 1WBXA 3FTGA 4KK6D 4L4TE 1A6VL 1BD2E 1J8KA 3BXNA 4XNYL 5IHLB 3F65A 4O2CA 2A9NL 3CLFL 5HVWA 4TSBL 5J13B 2E27L 1AJ7L 3TBSA 2CLZB 4OD1L 4P23B 1Q72L 4Y88A 4PJ8D 1TQBC 4Z7UE 2X1XR 5D7JB 2APVA 2WANA 3TVMB 3MJ9L 5F7EH 3GSUB 5BS0D 4KJQD 3MLUL 5IG7B 4R4ND 2AP2A 3L7FA 2XTJD 4L4VD 4P5TC 1INQA 1JYVA 2P8MB 2F54A 4Y19A 4IRZL 2ARJB 2F19L 1EO7A 3GSXA 3T0BA 1V3MA 1VKXA 3SDCB 1MFNA 5F1KC 4Z7VA 2IGFH 3P30L 4MNQE 5T1LA 3P9LB 5L8KB 1QD0A 3QI9A 4PB0H 5CINH 4N0CC 3ZSSA 1MFCL 1KIPB 8FABB 4RQQB 5ITFB 3UZQA 1KN2L 3EYUH 1XGTB 3H9HA 3DSNA 4KV5E 2N1KA 2ZCLL 4J3VA 1JIBA 4QLRA 2NY5L 4N0FA 4ONFL 4TNVK 4DGIL 3SBWA 3SDDB 2FL5B 5CEZE 4PJIB 2YBRA 3GIVB 4IDLA 5MEND 1T04A 3WFHB 1JCKA 3UJIH 4KUCF 2AXGB 3G6JE 2JELH 4AENB 3Q5OA 5H2BA 1E27A 4PJCF 2ARJQ 1ADQH 4PJEB 4R96A 3GMLA 4RIRB 3FCTA 1T1YB 5BVJA 1UENA 4HZAA 5D7KD 4C56A 2OMNA 1A1MB 5JA9A 5D5MA 1J0KA 3GHBH 1HNFA 1U92A 1NCCL 3SCMD 1Z3GH 1B0GB 3C9NB 2ENSA 1SJEA 1MOEA 2ZNWA 3GRWA 4JY5H 4Z7QF 3DXAD 1UWXH 3ZTJG 5I30L 2H2SC 5KVGL 3U9PH 3KPSB 5DRZB 5E6ZA 2LAGB 3L1OH 1CLZL 4BFBD 2F8XC 3T3MF 1OQXA 3CSBA 3VH8A 2C1PB 4PRPB 5IESH 3KYOA 4QRPA 2Y23A 3CFCH 4NWTL 1S5HA 5FFLA 5E03A 2EDQA 4M3KB 3WIFA 5JLZB 3MYJA 2CKBA 5TE6L 2M2DA 5JXEA 5TE7H 2W0LA 1QBAA 1QR1B 1RJLA 1SMOA 5EO0A 3PQYE 2BDNH 2QR0B 4JKLA 1ZK9A 2VR9A 3MV7A 5E08H 3LPWA 3MLSL 1LILA 1YQVH 2HWZL 4Y2DD 4PJ5B 4HC1L 1Z0MA 5E2VH 2NZ9D 4MJID 4LHUA 1RJZA 4I3SL 4ZTPL 4Q0XH 3RPIA 4JFFD 1CDUA 3BKJH 3M17B 1CG9A 4NJ9L 1NL0L 3BZ4A 1KIUA 2FEEL 2I60H 2QHLA 3OGOE 4FTVB 3D0LB 1YMMD 4FQPA 1K5NA 1ZLSL 1AC6A 1GOFA 3O4LE 4BQ6A 5B38B 5LQBL 3CZFA 5F6IC 1WCBB 1NANH 2DN7A 4ETQB 3O2VL 1Q1JL 2F54E 5HHNA 5FGBA 1D7FA 3MRDA 3DX9B 1VFAA 3QI9C 3HPLA 4TSCH 5E6IA 4M1CD 4Z7VE 2FX8H 1JZ8A 4OT1H 5AYUL 4K3HA 1UZ6E 4KKCC 4YDJB 5EU6D 5IT2H 1MIMH 3S4SA 3UTSA 2BSSA 5HY9B 4JAMA 5IEKA 3BUYB 3LH2L 5I16A 2APWA 1IVLA 1BBJB 3LMJL 3K8KA 1V3KA 4M4RA 3SBWC 4JFXB 4PGCB 3WXVL 1LD9A 3KYMB 4KKAC 3JZ7A 3VXNA 5I1JH 1QFPA 1QA9B 3T77A 2DIAA 1NDMB 3HMXL 3PHSA 3D69A 4YWGH 3MV9E 2DL9A 4ODXB 3G5ZB 1UKQA 5GS0C 1EMTH 2WMPA 4PTUB 5F1IA 5M7QA 4P2RA 4OD2B 4LHJB 1MJJB 3RVTC 4PBXA 2EH8L 3WIHH 4S11A 4FQQB 3A6CH 1QSEB 4WHYG 4AEFA 4Q9CA 1T0NA 2HAZA 2VE6B 1A3LH 1XGYH 4O2FB 4C56E 2ZUYA 3S5LA 5J13C 4KJWD 1S9WB 4HWEH 4R7DB 3QRGL 5FYKH 1NCWL 4AYFA 3TVMC 4PRNB 4D0DB 5I75B 3NCBB 4GKZB 1W72L 3HB3C 3MV8B 3KYNB 1VSCA 4G6FB 4GSDL 4X6DB 3S98A 4F58H 5JPNA 1YECH 1TFHA 1OSPL 3RFZC 1EH9A 1CIDA 4P2YA 4PBVC 5IMOA 4QRPE 3I84A 2H32H 1GGCL 3O8XD 5LWYL 2NTFB 2FR4B 3F5WB 3SDCC 4Y1AB 5H8DA 4DAGH 2HFGH 5FYLH 4GG8B 3O11B 2P24A 5ADOH 3WFEL 5SWQA 3AS0A 3CVHA 3T0DA 2W59A 3U82B 4M6OH 2BY1A 3N85H 2ATKB 2AJXH 4DOHE 3BDBA 1A8JH 3EUUA 3MV7E 4LRIC 1PKQA 1BGXL 2YXMA 4O58L 4IS6B 2ARWA 1OAZH 4PP1C 3O2DA 4NBZB 3HZYB 5IMKA 1T1WA 1CL7H 5C9JA 1TCMA 3WLBB 3SKNB 4AEHH 2MPAH 4PJIE 5BOZG 2VR5A 4YXHH 5D6CB 4MB3A 2R0KH 2DQDH 3KLAA 1U8MA 1U8IA 5E6IC 1NMBH 2IH1A 3MJ7B 3WKNA 5JXAH 4LLDA 3UBXI 2Q7NA 3RWIB 1C5BL 3IJYA 4HK3N 2NR6D 4MQ7A 5E8EB 3C5JB 1FSKC 2Q7YA 2G60L 3Q3GB 3VFSB 4OM1H 2BVEA 2I9LA 2Y5EA 4N1CA 1SM3H 3P77A 4KH2A 3F6LA 3MRFA 1F8TL 3L5HA 3UTSE 2MCPH 4X6EB 2PN5A 1J8HB 3FQNA 2J6EA 2NNAA 1KLUB 4G43A 4FFWC 1F6FB 3KPMB 3MRHA 4H88L 3KPSE 3MLRH 3KLSA 3TV3L 4UDTA 5MEOA 4JHWH 4G9DA 3B9AA 4LK4A 4Y8AA 2ESVD 3C09B 3VI3F 4Q2ZA 4MVBC 3U7YL 4XNXL 3ZKND 2OR8A 4UMGA 3MA7A 3FRUA 2CIIB 5DUMH 1X7QB 1AC0A 3IVKB 3BISA 4MXVF 3TO2A 2YD5A 1FNSL 1U3HA 1CFBA 1T66D 3G04B 4YNYA 4OCMC 3P4MB 2X70B 4UU9B 3EJYC 3PGDA 2AKRA 3QEGL 2OX5A 3CJJA 1FORH 4BZ1H 1VGKB 15C8H 4WU5B 4NFCA 4JB9H 1Q0XL 1ERNA 1JI1A 1VERA 2EKJA 3ARGD 3SDYH 4OBRA 2RCSH 3O3AA 1GZQA 3GMPA 3UTQB 3C2SA 1P84K 2R2BA 1T2JA 4RGOL 4E9LA 2YA2A 4I1NB 4LPYA 4NZUL 2YUWA 1YN7A 2A77L 5FKAA 3I02B 4ZUSA 1FFPA 4OZGF 3NH7L 3V4UL 1AGEA 1N64H 3AFLA 4BZ2H 3HFMH 2XWTA 3JWOC 2HT4D 5DJDB 4LBEA 4M7KH 1DLFH 3MLXH 4K9EL 2IG2L 4KXZH 3OG4B 4RMRA 4NO2A 1G9NL 4JFHD 3RDTB 3DBXB 1P5VA 3HE6D 1R0AL 1NAML 4ZOEA 1D6VH 3V5KB 1IGCL 3G9VA 4HZLA 2A74B 1S9YB 4X9HA 1SY6A 2RB8A 3L3OB 4AEEA 4HUWB 1JNLL 1QRKA 2KBGA 3G5VA 4RZCA 1UVQB 5E8OB 3STLA 4K7PL 7FABL 2DOCA 5DJ0B 4NGHL 1SEBB 1MQKH 2GAZA 3D2UB 1MNUL 1ORQA 2NY1D 4F15B 2IBZY 3U83A 1IM3A 1WT5A 3VRIB 5CP3A 3V9FA 1IEBB 3QULA 1ZHKB 3C60A 3F8UB 2HFTA 5C0NC 3TN0B 4NO5B 3DV6B 3MV8E 3QDGD 4JDZA 3U9UB 1WIPA 1QOKA 5ERWA 5CEZH 3M8OL 5HYSB 1FH5L 1JPTL 2AJ3B 5F6HJ 2NW2B 2GTZB 5T3XE 2ZCKH 3H9YA 5D5MF 3TGXA 2X10A 3RI5F 4PRHB 5T3ZD 3FKUS 4G9FA 4OGZA 3O3DA 5HGDB 1ZA6B 1NUGA 2FH8A 1CI5A 2DF3A 1YNTB 4Z18A 1PSKH 3ULUF 4Q97A 5K9KA 5IJVA 2DKSA 4M61A 2DM2A 3OBAA 5MERB 5BQ7B 4PJ8B 5MI0C 4G5ZH 1EAJA 1ZHNA 3RVUD 1T22B 1REIA 5BS0B 2ED9A 2RAMA 3CVIL 1RPQA 3EO0A 3VG0H 5D1XD 5KSAB 5DS8A 2Q76B 1MFBL 3OF6D 4RA3A 3QXAB 1RIHH 1TJHL 2DS4A 2Q6WB 3RAJH 4JO4L 5HI3C 5F9JA 5MHSD 1HOCB 3TO4A 2V6HA 3GK8H 3T2OA 5I1KH 3VWKA 2EDWA 5ADPL 5CJOH 3MRPB 2PW2A 4LSTH 3E1F1 1P4IL 3HS0A 5HGAA 1BFVL 5AYQA 1WQVT 3T3PE 3NABH 1FVDA 1VFBB 1V3JA 3K74B 4GW4B 4MDIB 1NCNA 4UB0L 4NRZB 2CPCA 4NM4H 4HH8A 3SKOA 1BFOA 2D7TL 4YHKL 2NY4C 3MOBL 3UZEA 2HG5B 1QLEL 2XI9A 4XVTL 1NEUA 3L3GB 5IMLB 2QKIA 2AJUL 3QXWA 1N3NA 3VD9A 3X11B 4FFVC 2HH0L 5CBAB 3SJVA 1CGXA 5DLML 1QNZL 5EG6C 3UEZA 3WO3B 4NQUA 3SCMB 4WI4A 1HHJA 2WINB 3CFEA 1XGUA 4G8FA 3DXAB 4HKZB 4GKSB 4M43H 3KR3H 2R23B 4H5SB 2D03L 5C2UB 3C60C 1ND0A 3TBWA 4OKVB 4JO2L 5HPMB 1DN2A 4U6VH 32C2A 5J56B 4X4XA 1EPFA 2EDRA 3K80A 2UWEB 2ZKHH 2FB4L 4NUGH 4L4VA 4XCYA 4XP6L 2P1YA 4TRPL 3QUYA 3KYKL 2ATPB 1JPST 3QUMA 1NAKH 1K3IA 3VFPB 4TN9A 5JW4N 5JW4M 2IQ9H 4J1UA 2E6QA 3HRZB 4E42B 4XGZA 1EGJL 1FNEB 3X12A 3WS3A 4JLRB 1J87A 5K9JH 4G9FE 4X7DC 2Y07H 5AWNH 3G5YB 3T4AA 4G7VL 1MFEL 4GMTH 5DEGA 4Y2DB 1NFKA 4AMKL 1CFTB 4WW1B 1NCBL 2Z8RA 5CUSL 4X4YB 4XPGH 3MV01 4N9GB 4JFYB 5A16A 4C4KO 3MLYL 4C4KT 1WTGT 3GI9L 3REWA 3GRWH 5TQ2L 2DBJA 1Q9WA 3HA0A 4MQTB 3CCHB 4OIBA 5GS1A 3VFOB 3I6KA 3O2WH 2DQTH 4WRLA 2CMRL 3R1GL 1H3UA 5MENA 3FMGL 1IILE 2V2TB 5EA0L 2AV7A 1EV2E 1AGDB 2JB6A 4O02L 4PB9H 4PJHA 3TO4C 1WFOA 5JZ7D 5FM5M 2PXYB 1B0RB 2YPLA 2C3VA 6FABH 1JGEB 4JM2D 3VXOB 3QBTB 3EFDH 4LCYA 4JDVB 5ALCH 2APFA 1HI6B 3D3VA 1BVKA 1SEQL 2CKBH 4HQQH 1OVZA 4WHTA 1MJ7H 4JDTH 1NGYB 4YHIA 5HYIA 1RZFL 3PABA 4F15C 1R3KB 3S35H 2OYPA 3FO1B 3VXSD 4YHYB 1JV5B 4ODTH 5KVDH 1B90A 3QFDB 4MJ6A 3MR9A 2X05A 1MY7A 3RY6A 4XHJC 4LVHB 3DMMA 2HVJA 1ZT7A 1G7PA 3BN9C 1YPZA 1QLRB 2YN5A 2JJSC 1TQCC 1U93A 2MQ3A 2DIJA 2FJHA 4X7TA 1L0YA 3LB6C 5IVZB 3NFSL 2DLFH 4HPYL 3SJVE 1Q9LB 4WUKL 2OTPA 1CDYA 1FNGB 2OK0L 2V5RA 4KK6C 5IB3A 3ZL4L 5ESAA 5CP7A 2AGJH 4JN2A 1S7QA 1RSFA 1QBLH 2R4RL 4YHOH 2DQEL 4MA1B 1AFVH 3MJ8B 4FFYL 4M8QA 3PHOB 2ZWLT 1QBBA 4FQXD 4KVCL 4PJ8C 1L6ZA 2BNQD 1I75A 3HN3A 2PKDA 4MJIA 4HUUB 1EFQA 5F7WC 3VFWA 5IB1A 4KJQC 1UT9A 4JFFA 4R4NC 5EUOF 1PG7W 3QJFA 4LCWB 1HWGB 2EC9T 2OQJB 1YMMA 4Y4KA 5BS0E 4OKDA 5SX4H 2J88H 4UT9H 2C4FU 1UM5L 1RK1B 3AMLA 2XTJE 4L4VE 5JW5A 3RA7L 2DQFB 3W0WA 5F96L 2VISB 4PJFF 4LLMB 2CSPA 3L9RB 1ES0A 3LIZL 4OCWL 2R39A 2Q8AL 1UKTA 3AU1A 2YMXL 3KGRA 1NGWB 1HYSD 4GW5A 2VOTA 5J89A 1BLNA 1S7SA 5EU6A 2VB5A 2IFGA 4OCYH 5HI5D 1PG7L 1AD0B 4CJ1A 5DWUL 1BF2A 1ZOXA 1FNAA 4UTBH 4HGMA 3QUZB 5GS1C 3OJDA 2HFEB 3B4NA 2CJUL 1UJ3A 4XMLL 1NGXA 1L7TL 4QXGL 3RNQA 2D4FA 3AS3A 1I3GH 2RFXA 4LDLB 4MD5B 3BUTA 4NQXB 5MENE 3F6IA 1RZIB 3RY4A 1R3IL 5EIIA 2GFBB 2ZCHH 3VDAA 2YS4A 2FSEB 4RFNB 4PJHE 5JQHC 3SCMC 2DB8A 4PJ9D 1Y6MR 2FO4B 5D7KE 3ULSB 2HTLD 4LSVH 1AR2A 4XNUH 2ZUUA 5FOJA 5GJTL 3WNPA 3CVHH 4ORGA 1A9EA 3DXAE 3RY6C 4BSJA 3FB6A 3JV6B 4U2ZA 4OUUB 4WWID 3RWEB 4ERSL 4BH8B 2C5DC 1CZ8H 3QO0B 2AXFB 5E2UL 2UWEE 3F7YA 3CFKA 3ILPA 3O8XA 1TCRB 5DHYB 2CIKB 5LAXA 1A6ZA 1FO0H 1BM3L 2GYSA 3PDGA 2R29H 4IRJB 1DBJL 3GMRB 1OARL 4ZUUA 5L2JB 1ZLUK 3MNZB 1MWAA 4N8VB 2C3XA 4Y2DC 1DQJB 4H1LB 5FXCH 4YHPA 2NZ9C 3MODH 4TQEL 4WFHD 3SE8L 5EZOL 4EKXA 4LCIL 4HIIB 1K8IA 1KEMH 4POYA 1PG7X 4HS6A 4NZRL 4PY8J 1YY8B 4GW1B 4FNLL 2YN3A 4MJIE 4HIEA 3TCLA 1LE5A 1IM9B 1CTOA 4YR6B 3PV7A 4JFFE 3VFRB 5GRXG 3ZYJA 3LAFA 4PGDA 1OP3K 3T2NL 3DUUA 5KTEL 3K8MA 3KPPA 4JKPL 1YMME 2J6EH 5C0AB 1MRCH 4TNVF 3LEXB 5DFTA 4IOSD 1FYTB 1LGVA 3WHXA 4M1CC 4OQ1A 4PJAB 5CD5D 2BVOA 2QADD 3BH8A 3HC0B 4NIKB 3QNXB 1I8KA 1C08B 1IGTB 3M45A 1F97A 5GGVL 1BQLL 2IH3B 1OAYH 5GS2H 5EU6E 4YHYC 5F44A 1RHFA 1VB9A 5F8RC 3QEUA 4YDLB 3EYSH 1CN4A 1D6EA 2H41A 1A3QA 3UTPD 3VCLB 4OLUH 4UQ2A 4CVWA 1GGYA 1HSAA 1I8LA 3Q5YA 2HKFL 3ZT6A 4OLZL 3B5HA 4HMEA 2DKUA 2ESVA 2WZPD 2AAVA 2B20A 2XFXA 4JHAH 3VRLF 1DBKL 4XPTH 4LFHD 3FQTA 4RMTA 1KIRB 2GCYB 3LEVL 4KJWC 3B3IB 1HKLH 3VXTA 4GG6F 4YPJA 4BELD 2DI9A 1YEDB 5E2TH 1JWSB 2KH2B 4R8WL 5E8NB 5CEYA 3ZDZF 2NY1B 3RL2A 2ORBL 4RA0C 4ZPVA 2W9DH 4OZIF 4I4WA 1KJ2L 4EUPB 1KGCD 4ZPTA 5SWZA 3HE7B 4Y16B 2X4TB 5LBSH 4OLYH 2P5WD 5K33A 3O8XC 4OV5A 4BSWA 1LEGA 4QGTA 4OFYD 5I66A 1FGVH 3ARGA 3FL7A 1UACH 5F9WB 1FE8H 3P4LA 3FT4A 3HRPA 3BO8B 3PWUB 1S7RA 4U0QB 1UB5A 4BFIB 4O5LL 2N4IA 4M8VA 1OD9A 4ODBD 3LKRA 3ZE2E 2CD0A 1YNKL 3HKFA 5ESQA 3RIFK 3B2VH 1CFQB 2NZIA 1HHGB 5D1ZD 4BFEA 4M7ZB 4UT7L 3JUYA 2FZ3B 5CGYD 1ZHBB 3QRFM 2FX7H 1KTLA 3FFDB 4L3AA 3ARED 4XXCA 1IC5H 5C6WH 2X40A 3BPOB 4OUOA 4XBPB 5IVOA 2E6PA 5CP3H 3MREA 5C8JA 3HE6A 4U3HA 2KUTA 2MQCA 4ETYA 1MHPL 1QYGL 1WSST 4OTXH 4WU7B 4X99B 1IQDA 1CICB 3JUZA 4XAWH 1MHEB 4RFNC 1F4AA 3MLPA 2VNCA 3RU8L 5HYFA 1KB5B 2NR6C 3RIAK 2VLKD 4M5YL 5ID0A 5C0FA 2OZ4A 2EDKA 2VDRL 3NZHH 3D85D 3OGCB 1E6JL 3EFFA 3GM0A 1AP2A 3B9EA 4OBSA 3O6FB 1FVCB 4MHHI 4GRLA 3TBVB 3VFMA 1N59B 1D9KD 4DQOH 1G7HB 2P5EA 5FEBA 1A1OB 4CJ0A 4U0RC 4RBPK 2CLRB 3QDGA 4M7JL 5EO9A 1CVSC 5IV2A 4GH7B 3OKKB 1DBAH 3DX6A 5BV7L 4JRXB 1DFBL 3ZKNC 4L9LB 4XNQB 4GRWB 4IRJC 2JIXD 2ESVE 4JREB 1U36A 5DHXB 3HZMB 3S8WA 5EZIH 2M8XA 4QHUB 1C1EH 1U8NA 5E0QA 1J9CT 1T66C 1MI5D 1BZ9B 4CKVX 3CLEH 5GGTA 7CGTA 3ZTJH 2HYMA 2QHRL 3N1MC 3UJJH 4OIIH 1HHIB 5TE4L 5KJRH 3C8DA 4CGTA 5CJ5A 4ELMB 1YPZF 4OCRL 1DN0B 4HPOH 4U1SB 5D1XA 3BP7B 4M7LT 1UA6L 4X5WB 1IJ9A 5DUPH 4ZS7H 4YXLL 2ED8A 3FOLB 5JIHA 3JTTA 4NKMB 1E4XI 4KJYA 4G80A 1F6LL 4QWWD 5BMFL 3D39B 3I2CH 5K9QG 2XZCH 4LSRH 4PJAE 4P5MB 3Q6FB 3NACL 1M71A 1FRGL 1YZZA 2MQ0A 4K94H 5EBMA 2HT4C 3CFJA 1S5IL 4K3GA 3JTSB 5KBNC 2GTWA 4PJ7F 3VXRD 5HVGB 1TIUA 4D9LH 5IVXB 4DVBA 1A6AA 3HE6C 5EZJB 5HJ3B 2A1WL 4J3XA 5EWIH 3K4AA 4WENB 3QZWB 3F58L 3LS4L 5CJBA 4CMHB 4JFHE 4RDQG 1P1ZB 3RWDA 4I2XA 1PQZB 1DL7H 2R2HA 2V2WB 4KPHL 1JGDB 4LKXB 4TVPH 5JUEH 4YEEA 1I9JH 3QEQD 4ESKA 3NGBC 2AS5M 2FIRT 2X7LA 2NY1C 5D7LD 4V2CB 3TNMB 1P2CB 2B1AL 4I9WD 4FQLL 4RFEB 1KYOK 3TIDA 3HE7C 1L6XA 4ONGH 5FO9A 4R7NA 5T1DL 1SBSL 3RTQD 3QJHB 3IDGB 5GZOD 3BT2L 1VGEH 1RUQL 3QDGE 4F9PA 1KELH 1G0YR 3LDBC 3VFUB 5F9WC 3U79A 4NCDA 2XRAH 4KJPC 3GHEH 4OCSH 4QHMB 4GAFB 1BP3B 2Z35B 5MEPB 4OZFG 3FOMA 5T3ZE 2VLLA 5GGQL 3RGVB 4N0RA 5DJZA 5DI8A 4WHYH 3TJEL 5T5FH 3UP1A 2EIZA 3QHFH 3RVUC 2HRLA 5F6HI 1MVUB 5CBEA 1R3JA 3V8OA 4M7ZC 4QOKD 2PUQT 3PL6B 4LAQL 4MX7B 5D1XC 4HJJH 3EO9L 1QRNB 4PJXE 5DJ2B 4G8GB 2P8LA 1JFQH 3IDUA 3STZB 3P4OA 3LD8C 4G6MH 4G3YH 2SEBB 5TDOB 3BPOC 1B4JL 1RJCA 3QCUH 1AXTL 2R0ZL 5I1HL 3B2UC 1RI8A 4MAUH 5JQ6H 2IALA 1EZVY 3G6AA 4XP4L 4YIQB 1GYAA 1NLDH 2P49B 2F53D 4QT5A 4N1HB 5DHVB 4JM2A 3B8YA 3AUVA 5MHSE 3S96B 4CVXA 1RVFL 2UY7A 5DMGD 4ZUVA 1BEYL 3O6FC 4LGRB 2VQ1A 1INDL 1PYWA 1WWBX 4FQ1L 3HMWL 3VXSA 3HNSH 1MRFL 5E1AB 1RUAL 4N5ED 1FAKT 5IKCB 1BOGA 5IW6B 4X8JA 5CCKH 3MRCB 4OAWB 3BKCH 3WNMA 4ODUA 1RZGB 4OZ4B 1VFOA 1K6QH 4M6ML 5K9QI 4JREC 3VE0B 5F3BB 2CO6B 4HLZG 4I2XE 4C83A 5JHDD 4GRWE 4I0CC 4LIQE 1KPVA 4XP5H 1SBBA 2VERN 3ARWA 4Z7OF 3MUGB 1LO5A 1CE1L 4POUB 4FQXA 5C08B 3RUGB 5KW9H 2PTUA 2BNQA 5DD3L 4NDMB 5HYSG 2IFFH 3LQAC 4JJHA 1YEJH 1LEKA 4KDTC 5IF0A 2VQUA 1KG0A 4P3WA 2M1KA 4YK4C 5BV7B 1ZXQA 5I1IH 1RZKL 5IFAL 1WZ1H 3MC0A 5HDQL 4XCCL 4V1DD 1ED3B 1PLGH 3DGGB 3P40A 2D9CA 3KPNA 4ODSH 35C8L 4NUJB 2DYPA 2H6PB 5I74B 1V3LA 5GRJL 4HDIA 4WTXA 1B3JA 3VI4F 3MLWL 5I8OH 1NCDH 1QG3A 1XF5A 2ZUQC 1N4XL 1ZANH 1OT2A 1QO3A 2YRPA 2ZG3A 3O3BB 4JJ5A 4PJEA 3FQRA 3QQ3B 4LQFL 1U9KA 2BSTB 2FWOB 4GQ9L 2RQ8A 1OP5H 1L7IH 3P73A 1MCRA 3QUXD 3HR5B 3IAQA 1B0GA 1M7IB 5ICZA 5KSUA 4YO0B 1NSNH 3KJ6H 3QIBA 5E2WL 3ECBA 3IXTB 1ZLWK 1EHAA 5EZLA 4CMHC 1WBYB 1OWWA 5JZ7C 2P7TB 25C8H 2PYEA 3MRNB 1TJGH 4J12A 2GK0B 4JM2C 5TQ0H 2IAND 4Q6IA 2Y36H 2QADB 1FIGL 1FN4A 4NWUL 1NQBA 3IFOA 4PJ9A 4JO1H 3GKWH 4AIZA 2DKMA 2DDQL 1FP5A 5JLZA 3OKEA 4OZHF 5C0IA 1JPGB 1Y18B 2IADA 1MWAH 3JBG7 4XCNA 4OF5A 2P8PA 4C57C 1T1ZA 4X83A 3RPKA 3VXSE 1FV1B 2JB5L 2NCMA 3NMEA 4M02A 1UYWH 1HH6A 1I7TA 4U1LB 2OS7A 5AD0B 5I1AA 1P6AB 1TNNA 5FKPA 3QQ4B 5JOFB 3B6SA 1C12B 1GRWA 5DYOA 1QEWB 4Z0BL 3D0LA 5IB2B 1A1NA 1FAIH 3H0TA 4I18A 3SKMB 3GSRB 5ACZB 2F8VA 2CDEB 2AK4A 4FQXC 1U3JA 4HGWA 5F9OH 1IFHH 5I8EA 1AH1A 2BHZA 4JPVL 6CGTA 3MLVL 2BNQE 4P3CL 1Z9OA 1PGRB 3OX8B 1OGAB 5C0DB 2AEQL 3DECA 4POZD 2FBOJ 2IPKB 4MXQD 5DA4A 4YZFE 5KAQF 2G75B 4I5BA 2FLBT 3VFNB 2Q3ZA 5EBWB 4YDVA 3QCTL 1PEWA 3GMQA 3QDMD 5H37G 1NCAH 1HYSC 2B39A 4F7TA 4OLXL 3MRRB 3NZ8A 1LMKA 5DEFB 1OWRM 3UTTB 5HI5C 5BO1H 3V4PH 2W91A 5IBUG 1HHKA 2GSIB 1G7MA 4A6YB 4IMLB 1JRHH 1A7BA 5FUOH 4N0YL 4IOIA 1P7QD 4HWUA 2E7BA 1EJOL 2X89A 3BDYL 1AQKL 4CDGC 5DTFB 3KPOB 2JCCA 4JKMA 1ETZA 2E6JA 1D5MB 1T6WA 4BH7B 3W2DH 5F9DC 4ZD3L 2A6IA 3KYNA 1OPGH 2W9LA 1OY3B 2LE9A 4PJ9C 1M6OA 4HHAA 1IEAB 2A6DA 4K23H 4HF5H 3TT3H 1CBVL 4WI2A 1ZGLA 4TUOA 2HTLC 2FR4A 5GRUL 3QXDA 2MKLC 2FD6L 3PWVB 4L29B 4X7SL 1KF9B 3QXTA 3V0VA 4LVOB 2Q8BL 1U58B 4PRAA 1YYLH 2GT9A 4IBLT 2J8UB 5ID1A 3NTCL 4ISVA 1A7OH 4OQTL 1RMFH 4TVSa 4J4PD 5C0BD 4FQIH 2WBWB 3MQIA 1J0IA 2VMFA 1RZJH 2NW3A 4I18C 2D2OA 4EIZC 4DZBB 1BJ1J 3L5XH 3O45A 1CLYL 4OF8A 3ULUL 1NLBH 1U8QA 5CJQH 1KNOA 3BKMH 2Z9TA 3ULVD 1KUMA 1KCVL 2QQLL 1Q0YL 5EU3A 4R4BA 3HI5L 4WFHE 4J3SA 5D1ZA 3V6ZA 3THML 4YFLI 4OD3L 3ES6A 1S9VA 4P4RA 1E28B 5DD5L 1CT8B 5CGMA 2GQHA 5TDPB 4KHXH 3AREA 4FXLA 3HUJB 1IGFH 1JPFA 1CFNA 1HQRB 1QFWH 5CD5C 2VXTL 2O93L 2QADC 4ZDHB 4BKLB 4PY8I 4NO3B 4GUPB 2VLKA 3IFNH 5IIEB 2OCFD 3D85A 1CK0H 1CLOL 2EE6A 1CGWA 5KSBA 2RJMA 4K3DL 2W0FA 2FEDD 3KG5A 5F7DA 4HH9A 1I7ZA 5BZWA 3DROB 4TPRH 4RRPA 1X5KA 1YEHL 4XVJL 4O4YL 5GGRA 4Z7NF 1MF2L 5FGCE 1D9KA 5I76A 2XPGB 5EOCL 1UQSB 4LPVA 5SWSD 3MFGB 3NCCB 1SVZA 2Z31D 4UTAH 1WIOA 2C4XA 4GAGH 4XMPL 5HTSA 4X6BA 1MAML 1U8JA 4PR5B 5CSZA 3AXLB 3UTPE 5I18H 5DFVC 2JCCE 4OZFA 2VDQL 2VDNL 2CR6A 1A2YA 4IJ3B 4LCCB 2JIXA 2FGWL 4M62L 4P2CG 3S37H 1G6RL 1WEJL 3IKCB 4XBEL 1JZ2A 5E00A 1NJ9A 5BJTA 1MI5A 4JR9L 2D3VA 3MMEA 4LKCA 3V0WL 5EO1A 2XG5A 2BMKB 4JG0L 1Q8MA 2NXZB 3EYFB 1X6LA 3PWLA 1QTYT 3RTQB 5DD0H 3LKOA 3WE6A 1KGCE 4N8VG 5FK9B 4G8IA 4QKXB 4ZFGH 1AR1D 5HYJD 2Y72A 1F6AB 2O5ZL 5C1MB 2AJSL 2P5WE 4H1LG 3T8XB 4DGYH 3TWCH 1NMCB 4Y89A 1NBZB 3S35X 43CAB 4UIMB 3KLDA 5HHVH 1ACYH 4Y5VB 1ZT1B 1G7JA 2V5TA 3MRBA 4FZEH 4DUXA 5JORA 1A6TA 5L9DH 4LIQH 3IDXH 1UM4H 3A0OA 1AD9A 5D1ZC 2A74A 3VFTB 3MLZL 1S9YA 2FGZA 3O0RH 3GSNH 3VMPA 4X7CC 5TF1L 1G9MH 5CGYC 1KT2B 3FT2A 3GUTA 3DVGA 3QHTC 3AREC 4J6RH 3VXRA 1MIEH 3CUPB 3IJSB 5FM4A 3HMXA 3BPCB 3OKLB 4XMKL 3J8F7 3X14B 2LV4A 3MJGX 1MJUH 1Z5LB 4KZEL 5IMMB 3ARBD 1U8KB 3HG1D 3FN9A 3TN0A 3BAEL 4PJEF 1W0WA 1X5YA 1HH9A 5IW1A 3DO7A 3QEQA 1M7DA 2NLJB 5ITBH 2VLKE 2Q86B 3L5JA 5D7LA 4R26H 4I0PB 3MRJA 5DMIL 5KSBE 5KVFL 1D9KC 1M05A 5DA0B 5D7IB 4XBGA 1W72A 4DKFH 4Z7WB 5ALBL 2CRYA 1CF8H 1WICA 4P2QB 2D7MA 5SV3A 5L7XH 1GPOL 3WFCH 4LP5A 5BQ7A 3PDOA 1F42A 4L8BB 5AUMA 3LS5L 4FMFA 2R4SH 4I77L 4MNGB 4P46B 3BZEB 1N2RB 3OAUH 3H7BA 4NKQB 1BBDL 1RUKH 1C5DB 3MRKB 1J1PH 1AGBA 3KJ4B 3B9KD 1S7TB 2WK2A 4HD9A 3M1BB 3QG7L 1WZKA 4QY8A 3TYGL 3N1PC 5FHAL 4NPYB 4AG4L 5INDB 1QFUH 2HKHH 2J7LA 5GGSB 4D94A 2RHEA 3V5DA 1MI5E 1XR9B 2C3HA 2IEPA 5D9SA 4NSKB 3SGKC 1XCQB 1UZ8B 4QOKA 3U30C 3U36B 3IDMA 5FGRA 1PVHA 1HIML 3OKDA 4OLVL 1L9MA 3UTZA 4DZ8B 2ICEB 5T1KB 4MA8L 3P4NB 4XPAL 1AKJB 4P9HL 5DJCA 3RIFF 2B1HL 1VADA 1P4LB 2J2ZA 4KROD 1LO0L 1T20B 1IGYB 2CK0H 3S36H 2DQHL 1ZLUH 1OCWH 3T0EB 1U8LA 3CFIC 3HUJE 2VDPL 2HVKB 2F53A 4QWWC 5C0GA 1ZT4B 3HI1A 2BX5A 4WTZA 4WFED 3OR6B 5I8KL 2HLFD 3RHWK 3WUWB 3DJ9A 4LCUA 1DQDH 1ORSB 2AK1L 4LDEB 4NZTL 2YD2A 4ZFFA 3QIUD 3NIDF 2MCG1 3TLRA 5F9AC 1OP3H 4LSSH 4PS4L 3VFGH 1YYMH 2ADGA 4QRTA 2F58H 4X98A 4D3CH 1J1OL 1S78D 5I2IB 3OPZH 4H5SA 5CIPA 3VXRE 4HWZB 4LLWB 3DYOA 3U0TB 2OTUB 2VABB 2JKXA 5ETUA 2ADIB 4G6JL 1H5BB 3REVA 4D8PB 1F4YH 4IJ3C 1CR9H 1FZKA 5C0EB 1V7NL 3KPQA 1JHKL 1T2QH 3R4DA 2HJKA 1KFAL 4TYUA 4NJAL 5JHDA 2G2RA 5C2BL 1V7ML 3GI8L 4X7FC 2V7NB 2Y5TA 4WDIA 4K71B 1MH5B 3QEQE 3W82A 1KN4H 4YQXH 5I1EL 1CDBA 4XP9L 4BZYA 5D7LE 5ANMB 1KBGH 4U49A 5C0RH 5BRZD 1YNLL 5ISZB 5CSGA 4I9WE 3RTQC 1IBGH 5FCUH 4V1DA 5GZOC 1GGBL 5HVHC 1G6RB 3V52H 1AGCB 3VU2A 2X4RB 1XGQB 1NUNB 4EDXB 5I1CL 2D7OA 3MCLH 4L5FL 2FECI 3U4EA 1NMCC 3UZVB 1I9RH 3TBTB 1N0LA 3T0WA 4Y5VC 1FFNB 4M48L 1JTTA 3UYRL 3LV3B 2HJFA 2IQAB 3AM8C 5EOTB 3GBNL 3CDFA 4LLYA 3MSPA 3SDXB 5BVPL 5FB8A 1H8OA 1JGEA 5B8CB 3E6HA 4Y5XA 1CGYA 3QUXA 3HNVH 4EN3B 1I7RA 1XF4B 4IMKA 4QOKE 1EUTA 3SQBA 4RFOH 3ME0A 3CMOH 4RX4D 5HHPA 4CDHA 2VDLL 4WVRA 2YD1A 3C5ZB 1RURL 1YA5A 1EK3A 1NAMA 2VC2H 5DZLA 1MCWM 3QDMB 2R56H 4NO0B 2IANA 3V79C 3QIWD 5ACLA 1S7XA 4PPTA 5DMGC 2PCPB 4HUXB 4DN4H 2EEAA 2F53E 3L3KB 4JFPB 2CH8A 5D8JL 4BYHA 1NUFA 1LO2L 3DURB 4NZJA 4L8SB 1I8MB 2QEJA 3O6MH 3EYVA 4RDQF 2VIRA 4N5EC 4F2MB 1OL0A 5GZND 3PHOA 4PLKD 4OLWH 2ITDA 3RWGB 5FO7A 5HDBF 5D7IE 5DVKA 1MCEA 4MSWB 4S1QL 3EDFA 1FFOA 4MZ2A 4HBCL 2KZ1B 1XF2A 1IGMH 4HV8B 2V9TA 2XWBA 2R2EA 4JN1H 1NC4B 5C7XH 3ARTA 3ZYZA 4YBHA 3D18A 1NC2B 2NY6D 5JHDE 3SDAD 2VDOH 2VISA 1PW3A 2FJFB 3NN8B 4Z0XA 4PTTA 1B4RA 4IHOB 3UPRB 4HIHB 4RBPH 5DURD 3BQUD 2LTQC 1U95A 3OR7A 2CDFB 3U0WL 3AS2A 5DD6A 1RIUL 4X6CB 2A38A 3BE1L 4OM0L 5I19L 1J7VR 2H2PD 4V1DE 5HGHA 5JMOC 3MRGB 1QACA 3HCVB 2JK5A 3W9DA 2R1XB 3KDMB 1H0DB 4ODWB 1T7ZA 5IK3B 3BPNB 3MRIA 4RNRA 5BXFA 2QJDA 3BGMB 1RIVL 1FG2A 1UM6H 1OGTA 3PV6B 2HLAA 5GIRB 2P47B 1PX3A 3O6KH 2RIKA 2DIBA 1JF6A 4NFDA 1H3GA 2G9HA 1VACB 1K3ZA 1C7SA 1WFNA 4U6YB 1XAUA 3QUXC 1FZJB 3NPZB 1A6VH 3BWAB 2EO9A 1ITCA 3FB5B 5HHXL 4XNYH 1JF5A 4HG4J 2UY6A 2A9NH 2F5AL 3CLFH 1P7QA 2ID5A 4NFBA 4TSBH 2E27H 4FP8L 3OKMB 4OD1H 5D96B 4MD0B 3RWJB 4WUUB 1JWMA 3FQWB 4LLVA 2R1WA 4KUCD 4U1GC 3WN5B 1PX4A 4JFED 3BSZL 4JY6A 4KDVA 1XH3B 3DUSA 1A4JA 3OJ2C 5FYKD 3MLUH 3U7WL 3IFPB 3QDJB 4CN1A 3IKKA 4R0LB 1LNUA 3MUZ1 4IRZH 2IANE 1S7VA 4B41A 1E4WL 5BCAA 5D2LB 3MRMA 3WL9B 4K71C 3BJ91 4M00A 4JZJA 1UXWA 5E70A 3DVNA 5JNYA 1MFCH 4I13B 2P42B 5FYLD 4QF1B 1ZWIB 4JFQB 4ZFZA 1KN2H 5K59F 5I9QB 1TITA 5LG1A 4J4PA 3MX0A 4ONFH 2VXSL 5C0BA 4DGIH 5DJAB 4U6HB 5C9KA 4PB0L 3FQUA 1KJVB 1EGJA 1FL6A 4ZNEA 4YDKL 5IB4A 5EN2B 4YUEL 3EYUL 3PWNA 2NY3B 3OJMB 1I4FB 2QSQA 4BQ9A 5B8CC 1JPSH 3TIEA 1NCCH 4DW2L 4EN3C 4POZC 1N5AB 4PGBA 5F3HB 1AXSA 2VITA 1FZMA 4FZ8L 1S9KC 4MXQC 3GJFB 3QFJB 1C8PA 4QNPE 3QA3B 1CGSL 1IL1B 4DCQB 5I30H 5IHZB 3KPRB 1CLZH 5B3JF 4MCYB 3SY0B 3WKML 3FO9B 3GHBL 3RZCA 1JGVL 1R6VA 4MD4B 4NWTH 3MCKB 3IJHA 1OF2A 4JY5L 1FNHA 3U6RB 4AT6B 2BNRD 3QDME 4OZFH 2ICWB 4EVNA 2DWEA 3H3PL 4L8SC 3UROR 3U9PL 1EBAA 1RZ8B 5TE6H 5JW3L 1IGJA 5IEHA 1A14L 2B4CC 3K4DA 3ZT5A 4I48B 4U1MA 2EYRA 5IESL 3MCG1 3NA9L 2EH7L 2L7UA 2G5BB 2OTWB 4YHZL 3MLSH 5SWSA 3UDWA 4YFDB 3CU7A 1J5OL 1JHLL 4BSVA 4LF3B 3VW3L 4I3SH 4DUVA 3CFBA 1C16B 4HFUL 4GBXB 2E3VA 3DVIA 1CGUA 4XC1L 5GGRY 4Z77B 1F3JB 1ZLSH 2BDNL 5INCB 3ZDYE 5LQBH 3O2VH 1Q1JH 2XKNA 4MQXD 3DUHA 1NFDA 4Q0XL 4JZJC 1RHHA 5JIIA 1RFDL 3QWOA 1R3LA 1SYVB 5E4IA 3CFDA 1Q94A 3KXFB 3B8SA 3H2WA 4QXTA 1UB6B 3LH2H 1WIUA 1KPRA 4E5XB 3S3SA 1CYGA 4J4PC 1IAOB 4KMTL 3X13A 5F89B 1UWEH 5HYJA 4X6FB 4PV8A 3WXVH 2X4OB 1IKFH 1KJ3L 1A4KA 3B9KB 3GMNB 1A6WL 5GSVB 5C0BE 2FX8L 1FZOA 1HHHA 3FFDA 3BPNC 2QQKL 1MIML 4ZAKB 5HXMA 3HMXH 3WIIH 4HLZH 5BOPA 1EFXD 4GRMB 5F1OB 1IZJA 3H9SB 3ULVC 1FQ9C 1TVBA 5C0JB 1FL5B 3RGHA 3V5HA 2EH8H 2IAMB 2VLRD 1NBVL 3BEVB 4X9FA 3ULVE 2DWDB 3LZFH 1JVKA 3RWHA 1T4KB 5D96C 4YWGL 1BWWA 1NCWH 3R06B 5J11C 4P4KA 4WI6A 1H3VA 5FYJL 1QLFB 4NKOA 2BC4B 3QO1B 1W72H 4GSDH 3PNWA 4AM0A 3ET9F 4MLSA 1PEZA 3ARBA 1OSPH 2X9XA 3F7RA 3HG1A 3VXPB 4BK5A 1A3LL 1WAAA 4HWEL 2EDJA 4ZXBD 4WI3A 4NQCA 4TUJB 3AS1A 1GGCH 1J1XL 5F72S 4CL7A 5LWYH 3OKKA 2FEDC 5HGGS 4QRUB 43C9B 1YUHB 2YHGA 3GB7A 3GJEA 2BOCB 4HK0A 3WFEH 5D2LE 5DD1H 3F12B 1IAII 3VFVA 2Z31C 1ZLWH 3IGAA 3GSOA 4F57L 1HQ4B 5DT1L 4F7PB 5IBTL 5L2KB 5SWSE 1FNLA 3T0VA 4O58H 1HILA 1JNNL 3U48A 3MPCA 5F7YC 1BAFL 3VXUD 2EDTA 2AXJA 3QXUA 3P9MA 3WDHA 1RJYB 2AJXL 1F45A 4JQVA 2OBGA 3O4OC 3T4YA 1EEZB 4NQEB 4F3FB 1KJMA 1OAZL 5IR1A 1S7UB 3GSVA 1NFDE 3UXFA 1IC1A 3FRPG 2EEBA 5GHWL 3OXSA 4YLQT 2BXZA 2G60H 5EC2A 1YJDL 3T0AA 3ALWA 5DRXA 2YD3A 1AR1C 1F8TH 1MCQA 2AQ1A 2R0KL 3FB8B 2OSLA 1MCIA 5JR1L 1FGNL 4DFHA 1NMBL 2C7UB 4N8CL 3MNVA 5HYJE 1IC7L 4H20H 4BA8A 3QEHB 5TH2A 4H88H 3P2TA 1ZV5A 5H94A 5DRWA 3WFDL 3TV3H 3CMGA 3CH1B 2ZOLB 2A2QT 3I75A 3ZKXC 4M1DL 3U7YH 3OKOA 5FYJU 1XR8B 1BQHB 2EXWD 2HN7B 4XNXH 2MCPL 4HS8H 1U3ZA 5F7LB 4J3OC 2BK8A 1KLGB 3QIUA 5IW3A 1FJ1B 3IDNB 1FNSH 1R5WA 4Y19D 3WNKA 5C09B 2EXYC 2H26B 4FN0A 3TPUB 1DE4A 3QNYB 1G7QB 4UAOB 1Q9KA 3BKYL 3ARBC 1S7WB 4WY7L 3GMOB 3MROA 2DMCA 3SPVA 1JHTA 5F7MC 2ICWJ 1HCVA 3QQ9D 2ADJA 2F74B 3Q48A 3QEGH 3X3FL 3WJLA 4RAVA 1XF3B 1GJIA 3BD3A 2XICA 5H37H 2C3WA 3HG1E 5DC0A 1DUZB 4N0UB 1WAAE 1Q0XH 3O3EA 1ZSDB 4QRSA 4XNMA 4JZOB 4HIJB 4JY4B 5JDSA 3I6GA 1CGVA 3DX8B 4MMZC 5FA3B 1NBYB 5CZXD 2GK2A 1KTDB 2GUOA 4RGOH 5BRZA 4I3GA 4CADA 1KJ2A 4KY1L 4NZUH 1TXKA 2A77H 2NY0D 1IAIM 5FOBA 3NH7H 3V4UH 5FECA 5M95B 3ARDA 4QCIB 5AG8A 4TNWK 5EFIB 3O41B 3SOBL 4YPGA 4LNRA 5KANG 3B9KC 1I3RB 2BVTA 4K9EH 2IG2H 1RK0B 4KTDL 3RKDD 1TTUA 2PNDA 1G9NH 4JQVC 2FJGB 3EYOB 2BHYA 5ESVB 3ULUD 2OLDA 1FC1A 1NAMH 2FIKB 4PG2A 2NY6B 4JFOA 3GMMA 1N64L 4XCEB 2J3SA 3PP3K 3SKJL 1MFDL 4PYGA 2L7JA 5EU5A 1JNLH 3VWJD 4M7KL 4UIKL 1DLFL 1ADQA 3GSWA 3IXAA 3LN5B 4S1SL 4NGHH 4RWYH 1D5ZB 4KROC 1CD1B 1EEQA 1MNUH 2XY1A 1K85A 3RJDA 3IU3A 4UT6L 2H8PB 2PW1B 3MLTB 3PJSA 1WFUA 3S6CA 1XIWB 4YDIH 3JVGA 3ROLB 1G7IA 1GZPA 5DJYB 1JNJA 3A6BL 2X9WA 3QIWA 1CE6A 4E0RA 2OI9C 5IKCA 3M8OH 1FH5H 4Z5RB 2HLFC 1JPTH 2WBKA 5C71A 1LVEA 5K9OA 5FA4B 4Y5YB 1RZGA 2X4PA 4I0KA 4YBLB 5CS7A 3FFCD 3QIUC 4WFEE 5C6TL 4PFEA 3VGAC 4R90L 4ZFOL 5DUBB 5D71L 1HEZA 2A83A 3UO1L 5JHLH 4ZQKA 3TFKD 1A7QL 4JFZL 2EE3A 4JANB 4AJ0A 1S78C 3BHBA 2J5LC 4ACPA 5IWLA 1A3RH 2L0DA 2BCKB 3D0VA 1K8DA 2FBJL 1YEGL 2J8OA 3OHXA 3VJ6B 3CVIH 4PV9B 3WJLC 3BP5A 3EJJX 1MFBH 1IQWL 4K55A 1TJHH 2XQYG 4ZOBA 3G08A 2ICCA 3RP1A 3Q2CA 5ICXB 1EJ6A 1WK0A 4WWKB 5JOEA 4XCFL 4CU8A 2UUDK 3NCYS 4NNXA 2XQYK 3C5SA 3KNBA 3SDAA 2ZG1A 5DO2D 1T5XB 1K4CA 5IM7A 5ADPH 4PJBB 1UXSB 1R5IB 1LP9A 3IF1B 3BQUA 3HNTL 5BRZE 5HYQB 1H15A 1PDKA 4UB0H 5KS9A 2FWOA 3I6LD 2W60B 4CNIA 4P2RD 3WDJA 3MOBH 4XVTH 4YAQB 4U1NA 4ZSOB 2AJUH 2GITB 1F4XL 3EDKA 2N7BA 1C5CL 5F1NB 4YO0A 2ZSWA 2O5XH 3GSQB 1KV3A 4E41D 4JRYA 2VQTA 3QH3B 4HJGB 1I1FB 2HT3D 2XZZA 4JG1H 1UH4A 2EEDA 4QO1A 4UINL 5DLMH 1QNZH 4JPWL 4JZNB 1R24B 4JQIL 3CSGA 1TLKA 1ZA3B 1BZ7A 3RI5K 2PO6A 2IF7A 3V8CA 5JPMA 1RV6X 3RHWF 4HG4K 1ZMYA 4EI6B 3WIHA 3BGFB 2KKQA 1ZHLB 2BSRA 2D03H 3JVGC 2MFNA 3S37X 4JFEA 4JO2H 3WUWG 1U91B 2V17L 2X1QA 3RX5A 1NFIB 3FONA 3QIWC 4PJCA 1IC4L 1EVUA 2FB4H 4H1LH 3V6FB 4XP6H 1BVLB 4TRPH 1I7UB 5I1DB 1FL3A 3KYKH 3U4BL 2BNRB 4NRYA 1T89C 3KR3L 1GH7A 3BIBX 4G7YL 4L1DA 3B9VA 4D0CB 3LPGA 1MCOL 5L0QB 3N1QC 1A7NH 1B9ZA 5EOQL 1EGJH 3GO1L 2H32A 1CXLA 5F71A 1AIFA 1CXIA 3WEXA 3RVWD 3LOWA 3BH9B 1QVOB 5IWLC 1JN6A 4GAJL 4PLKC 4G7VH 1MFEH 4ZMAT 3BW9A 1ZAGA 5CUSH 4LLQA 4YC2B 1BFSA 2X4NB 3QDHA 3MLYH 3W9EB 3GI9H 1JUFA 5TQ2H 1BWMA 3NCMA 5K9JL 4S2SB 4HXAH 3R1GH 2NX5D 2PF6A 3RWCB 3FMGH 4NYLA 1J05B 4LP4A 4GMTL 1O0VA 5KVEL 5GS0L 1CFSA 4OGYL 5EA0H 3CC5A 4Y4HB 2NY6C 4O02H 3SDAC 5CD3B 4XHQA 1J10A 3TA3B 5IQ9A 1N6QL 1CIUA 3GRWL 4U1HB 5TDNB 3VA2C 5I71B 4GS7B 3BQUC 1FIEA 4WO4A 3CXDL 4J8RA 4GLRI 5DJ8B 5DQJB 1RD6A 1SEQH 4Z76B 1PJ9A 3SGDI 3ARYA 2BNUB 1RZFH 2AJZB 1TVHB 2H2PC 4MWFA 4PREB 4KUZH 3L95A 2XN9D 1N7MH 1BD2B 4PY7B 3AC0A 4KQ3L 2EZ0D 1MCNA 3IETA 2GY7B 2WW8A 3ARFD 5ALCL 1XZ0A 1WZLA 4Z7UB 1T0MB 2XWJB 4GJTB 1U3HD 4HQQL 4GKNB 4JDTL 1D5BB 1EFXB 2ZPKL 4GXUN 1D5MA 5LCVL 3NFSH 1TZIA 4Y5YC 3WDIA 4HPYH 4GXUM 4WUKH 1TQBB 4ODTL 4XH2A 3ZL4H 3CK0H 4FQ2L 5FDWB 3BEWA 5FDYA 2R4RH 2DQEH 4P5TB 1X5FA 4FFYH 1TTFA 2H1PH 4KVCH 5DRNA 1DP0A 1I8IA 3MACL 4MJ5A 4MNQB 1D5XB 3LKPA 3PWVA 3NIFF 2FATL 1UWGL 3HPJB 3ZYIA 3LN4B 4O51B 5FV2A 4JPIB 1FVEB 2GHWB 5IVXF 1IT9L 5J1TC 4PRID 1Q9OA 4JFEE 1BX2A 5F7HA 2CDGA 2H3NA 5FYKE 1KLFA 4ZFOB 2ERJC 4ZXBB 4PJCE 1UM5H 4KI5F 2X1PA 3BIKB 1NEZG 5EIQA 4N5UA 1JF1A 1SMAA 2E9IA 2CUIA 5AZ2L 3RA7H 4H8WC 1I85A 3FRPA 2BOBB 5E8PA 2Z93B 5F96H 1R3HA 1JZ4A 3LIZH 4OCWH 3TBYB 4JFDD 1MHHA 4Z7QE 5M94B 3G6JB 3S36X 1HINL 4HUVA 3L3IB 3TZVD 3PXHA 1PG7H 1XMWA 5FYLE 3C2AH 4LASL 2FNBA 1H9VA 3T3ME 4KTEL 5DWUH 3R8BB 1I1YB 4PRDB 3CSPA 4OF0A 4B0MM 2HJLA 5KN5B 3FZUD 2CJUH 2VAAA 3RWFA 1L7TH 3E0GA 3PGCA 3S9DB 3BYYA 4FQHA 1I3UA 2A73A 2VZTA 3DX7B 1J11A 4S10A 4IRSD 4UTBL 1DDHB 2VN7A 5IP4A 1T3FB 1I1AD 2D0HA 2GSGB 4XTRD 5TFSL 1K2DB 2C1OA 2VLRA 1BIIB 1U8OB 1PFCA 1QP1A 4MZ3A 5DMKB 1Z9MA 5EUKA 1WF5A 4HW6A 4X5XA 3T1FA 5GJTH 2GJ6A 3G5XB 4F7CA 3OZ9L 4LLUB 3PQYB 1WBXB 3FTGB 4P5KA 4ERSH 3BXNB 5CFHA 1G1YA 4O2CB 3E2HC 1S3KH 2BRRL 3FO2A 3TBSB 5ECJE 4LSVL 4XZUA 1U2CA 5E2UH 3TEUA 1T03L 4XNUL 3IAPA 3DV4A 1BQUA 3CVHL 5L0QC 2OL3A 1BM3H 5J12C 2BNRE 4FRWA 1DBJH 4Y4FD 4MDJA 3L7FB 5IBLD 4OCXH 1INQB 2XNAA 2VXVL 2F54B 4PJDA 1CZ8L 4Y19B 3MRQA 3GSXB 3SE8H 4NQDD 4TQEH 1VKXB 4A2LA 5B39B 3O2DL 5EZOH 3FB7A 5F6IB 4YC2C 4LCIH 3JWOL 4J7RA 4Z7VB 1A7RL 4NZRH 5HHOA 1GXEA 3CPLA 5T1LB 4FNLH 4TOYL 2VAJA 3VXMD 1J0HA 3QI9B 3VWKD 4URTB 2PYFA 4Q9RL 3VXUA 4MB5A 5JO5A 3P11L 5KTEH 5KZCD 4JKPH 4MQXC 3H9HB 1I85C 1KEML 2X4UA 4N0FB 5GRVL 3CD4A 4MAYD 3SE3C 1DEDA 5I71C 4GS7C 4XC3L 2YBRB 4FFZH 5AAMA 1NBZA 3NA4A 1T04B 3RUGF 3WD5L 1EO8L 1OW0A 4HJ0D 4L1HA 3WSQH 4XXDA 5DFWH 1H3PL 2BZDA 4P99A 5H2BB 1MAKA 1E27B 1AGFA 3PIQA 5GGVH 4R96B 3SGEH 3GMLB 3VRJA 1D5IL 3FCTB 5BVJB 2W65B 1KXTB 5GPRA 1O7VA 4P2OD 4C56B 5T3XL 5D5MB 5E5UB 1U92B 1TENA 3MXVL 4OI8A 1XEDA 1SJEB 3GEWB 4JE4B 5BZDA 3MRLA 4OLZH 3L3HA 3KYAA 1OAYL 5C3LD 2V5SA 4XPFL 4HIXL 2VSCA 4EOWL 4P57A 3VH8B 4WW2A 4HKXB 1LP9F 1JK8B 3HLAA 4OZGA 3KYOB 4QRPB 2W92A 1HYRC 1S5HB 2DJSA 3OQ3B 3QUYD 4OLUL 5KS9F 4HCRL 2WBJD 4MA7H 4ALAL 2VLRE 3WIFB 1DUYA 1FHGA 4TVPD 2ORBH 3MYJB 1T7YA 3OL2A 2CKBB 4OLEA 1KJ2H 1VFMA 2FCBA 4H26A 1RJLB 5EO0B 2PR4L 3NAAL 4OSUH 4Z7WA 1MCFA 4K8RD 4DOHB 4P2QA 1GAFL 2DLTA 3MV7B 4ZXBC 4WV1A 1N26A 2UV3A 5DJXA 2X1OA 3FN0H 2N56A 3AMKA 1RJZB 4LHUB 3BZEA 3RX8A 5JMRA 3K2UL 3RPIB 3LKNA 1CG9B 3BZ4B 5C07D 4KK5D 3JWDC 1K5NB 3M1BA 5LBSL 4FQCL 4HULB 4FXKA 3CZFB 4D2NA 1UFUA 2VLJA 5HHNB 4JO3H 5F93C 3PP4H 4QRRD 1YNKH 3H8NA 3PHQA 3MRDB 5DHVH 3E3QC 2YPLD 1VFAB 4B7IA 3OB0K 4UT7H 3HPLB 5EORL 5E6IB 1CVRA 2BVQA 3SEPA 4S1RH 3E3QE 4M6AA 3D3VD 5IEKB 3S4SB 2XG4A 2BSSB 3UTSB 4JAMB 3VI3E 1FSKB 4NT6A 2EKSA 3VXUE 1SY6L 2ZUVA 1T20A 1QYGH 1F00I 3B2VL 3EOBA 3INUL 3TT1L 3LRSA 3P0GB 4ODVH 4KQ4L 4MXVE 1X5JA 4M5YH 1OW0C 3VWJA 5HSFA 2FX7L 1NUDA 3AB0C 3DMMD 3VXNB 2QBWA 2VDRH 2XKSA 3T77B 3I50L 1E6JH 2VZSA 3NFNA 2DQGL 3D69B 1EAPA 5F1IB 4P2RB 4XAWL 3S7GA 3EO1A 1HXMB 2A6JA 1JZ7A 3MGTA 5ACMA 3S5LB 5I15L 4M7JH 5DK2A 3TNNA 1VEPA 1KC5H 2GEEA 3UBXG 4MNHA 5BV7H 2EXWC 1DFBH 1A22B 3HAEG 2Z91A 2ADIA 1F11A 2XT1B 5JPNB 3FFCA 3KPLA 3X3GH 4Y4KD 1MUJA 1SJHA 2X9YA 4F7MA 4FQJL 4OZGE 4I3RL 3KAAA 2QHRH 4Y19E 1FNFA 2DM7A 2NYYD 3LQZA 3W0WD 5TE4H 2P24B 5ANMA 5LKNA 5SWQB 4OCRH 1ZS8A 5I1LA 3CVHB 3QQ9C 5KSVA 4WV1C 1J18A 1UA6H 4PD4J 2A6KA 3TYFA 1OLLA 2CLVB 1UCTA 2ZP0T 4YXLH 2WUBL 1T21A 1PKQB 3DWTA 3EHBD 4PG9A 5HGBA 1XGQA 1KACB 3UJJL 2ITCA 2WWMD 5CZXC 1ZVSA 3QCVH 2YD7A 5IMKB 1T1WB 1DTUA 2R9HD 5BMFH 5C9JB 4QGYA 1F58L 2ICWI 2NY0C 2HFFA 5DUPL 1S9XA 2KQMA 3NACH 1BF8A 1FRGH 3KLAB 1OAKL 1U8MB 1EHNA 1U8IB 1O7SA 4U3CA 1L0XA 4U1JB 4WTWA 3SO5A 2J8UF 4LLDB 3JWNC 1S5IH 3RKDC 1N5YL 2FHBA 3IJYB 4MQ7B 3O9WD 2Q7YB 1U8PA 1F13A 1P7KB 3VA6A 2I9LB 4UV7H 3P77B 4LSRL 1CD8A 5D5ME 4E41A 3K7UA 3F58H 3LS4H 3MRFB 3LKQA 3VD3A 3RBGA 1CXFA 1JP5A 2ZZUT 3DTXA 3IDYC 1MCPL 2NXYD 3FQNB 3ULUE 2NNAB 2N7AA 3VWJC 4G43B 4S1DD 5CILL 4KPHH 1JJUA 4Z95H 4EXPX 5CKAA 3MRHB 4HAGA 1GGIL 4D9LL 5CEXA 3ETBF 2CGRL 4UDTB 5MEOB 2X4SA 4G9DB 2OXHA 4H8WH 1EEUA 3ARVA 4Q2ZB 5I1GL 4MYWB 2VUYA 3NFPA 1K4DA 4LU5L 2B1AH 4L3ED 5EU4A 5JXEC 1KCKA 5L6YL 3BZDA 4FQLH 3FRUB 1DL7L 3QUML 2E7LA 2X41A 1NEZA 1P4BL 3TO2B 1LO3L 4O2EA 5T1DH 1SBSH 1U3HB 5DSCA 3MXWL 4APQD 4YNYB 2R8SL 3BT2H 4GO6B 1RUQH 3VDCA 4QTHA 4F33A 5MI0B 5FO8A 3V7AE 1WC7A 1PZUB 4NHCL 1TETH 5E94A 1JMXA 4IDJL 3PGDB 3TFKC 1QSFD 5GGQH 5FF6A 3FFCE 4ONGL 1FO0A 1NKRA 4FXGA 3TJEH 1OSZA 2LQRA 3D9AL 3PWPD 5FGBC 4U31A 4U7SA 3MUHL 1KELL 4UDUA 1DBBL 3O3AB 1GZQB 3GMPB 1K9TA 2GJZA 3EO9H 2FX9L 3HC4L 1GIGL 2NX5A 2YUZA 4YE4H 4GMSH 1JGLL 1HSBA 1YN7B 5FKAB 5T5FL 4AQOA 4ZUSB 1FFPB 3LKSA 4TNWF 1AXTH 2R0ZH 5I1HH 3DRTA 1AGEB 2RR3A 4Y7MA 2XWTB 5DO2C 4XP4H 4PJDF 3C08L 4LBEB 3WLWD 4QYOA 2NY4B 1YC7A 4LLAA 1JFQL 4G6ML 4G3YL 3QHZL 1DVFD 1Y0LA 4LEOA 2Y25A 5EUOA 5EPMA 3QCUL 2MOVA 4M5ZH 4RGND 4WI9A 1INDH 5L8JB 3IAGC 2XN9A 4HZLB 3HMWH 5FGSA 2ADFL 1MRDL 3FB5A 1MRFH 1JI2A 4RZCB 4B53A 3G5VB 3STLB 1RUAH 3I6LE 4P2RE 3ARFA 4MS8D 4PJFA 3MJ6A 1MSPA 2VXUL 3F7PC 2HT3C 2GAZB 5IHUH 1ORQB 4PP2A 4R3SA 5D1QA 3SKUD 3P0VH 1IM3B 3PG2A 4E41E 4IIQA 4M6MH 4C55A 2VLMD 3QULB 3C60B 1FBIL 2KQNA 3CU1A 5SWZD 2ED7A 4GOSA 3JV4B 1ZEAH 4KKBD 5I73C 4JDZB 1M4KA 4LMQE 5ERWB 4LSQL 1CE1H 3STBA 5C0CA 2VJXA 3WL9A 5DD3H 1AHWA 4G9FB 3O3DB 1ZVHA 2E7LC 2EYSA 1F2QA 2HTKD 2D7PA 1RZKH 4PRIA 3E6FA 5IFAH 3L3DA 5HDQH 4XCCH 5IJVB 2X5PA 3R0MA 4TULL 3TESA 4KMLB 4M61B 4MQSB 5IOPA 5KW9L 3UJTH 3DSFL 35C8H 3QUKA 1X44A 1ZHNB 4WW2F 4ZS6D 2IFFL 1B2WL 5GRJH 1YEJL 1T83A 2VO5A 3O6LL 5B4MD 3EO0B 1PKQE 1WZ1L 3RVWC 5DS8B 1N4XH 5I17A 4JFDA 1MLCA 4KVNL 3RJQB 4G42A 3TZVA 3PWJA 4ODSL 1MLBA 5MP6L 3L6FA 4Z78A 5F9JB 2VXQL 4HUKB 4GQ9H 1IGIH 4Z7WF 3TO4B 3OG6B 2YWYA 4DTGH 3VWKB 5I8OL 3CDGA 2OMBA 1T1XA 5LJYH 2PW2B 5E9DD 2COQA 5E2WH 3HS0B 5HGAB 1AY1L 3T65A 1FVDB 3KPTA 3KHOA 3SQOL 3OSKA 5DC9B 2NX5E 1MCBA 5HHQA 4XPBH 3SKOB 2YD4A 1BFOB 4IRSA 4GRLD 4Y2OA 4IEFB 1I1AA 2P5ED 1N3NB 2DICA 2Y1VA 2YC1A 3SJVB 2OL3H 2DDQH 1A7PL 1HWHB 4LSPL 1TQCB 2X4QB 2D31B 2VH5L 5EUOE 25C8L 2Q87A 2EZ0C 3HC3L 3JWDH 2Y06H 3I3DA 3ZE1F 3ARFC 3OXRA 5AZEL 1QFHA 3MBEA 2XN9E 2JB5H 4FHBD 4JO1L 4NOFA 4KWUA 3CFEB 1U3HC 1XGUB 4G8FB 4V2BA 3DYMA 3IRZA 3NBNA 1U3YA 3PP3H 4PJFE 4IIQC 3QG6A 2AERT 1NMAL 1ND0B 3TBWB 2DLHA 5JW4R 4W68A 4LOUD 1QZ1A 32C2B 2WNGA 4Z0BH 4X4XB 4AY0A 3H42L 3TJHC 4Y4FA 2XTJB 4L4VB 4XCYB 1LE9A 3QUYB 4ZUTA 3EGSA 3QUMB 1SYSA 1AHWC 2GY5A 4NQDA 3R8QA 3UC0L 1NANI 4B5EA 5D4QA 4J1UB 3CAFA 5ICYA 4XGZB 5MEQB 3X12B 3WS3B 4P3CH 2O61A 1MCWW 3VXMA 5CZKA 2V9RA 2AEQH 1MCKA 3T4AB 4P48A 3U1SH 2AV1A 4PRIE 5DEGB 2OJEA 3E8UL 4K7PX 1KB9K 5L8LB 2BVPA 5A16B 4GG6A 2CRIA 5KVMC 3REWB 3QCTH 1Q9WB 4NKDA 4X4MA 5GS1B 4MAYA 4YGVB 2ZUSA 3I6KB 5EBLA 3VMOA 3TZVC 5MENB 3OAYK 5KG9A 1OB1A 3LQMA 4OZIA 3BP6A 1TNMA 1YEEL 4JFDE 1X5GA 4RWHA 4EI5D 2AV7B 4ZO9A 1FLRL 2JB6B 4PJHB 2YPLB 5DK0A 2C3VB 1FC2D 1XGPA 3ZLQC 3FZUC 4P2OA 4N0YH 3CXHK 4LCYB 4UOW0 1VPOL 3UBXA 3D3VB 3BDYH 1AQKH 1BVKB 3BZFA 2UUDH 3HAEA 4WHTB 5BO1L 1LK2A 4YHIB 2FHCA 3PABB 2WQ8A 3C8KA 4IRSC 3Q5TA 1WT5C 1JRHL 4CN4A 1I1AC 2DD8L 5FUOL 1XGRA 3MR9B 4MJ6B 3GDBA 4NZDA 3DMMB 2HVJB 1ZT7B 4UOW1 1G7PB 3MOQA 2Y7QA 1CBVH 1YPZB 3DNKA 1U93B 2WBJA 2FJHB 4X7TB 2JJVA 2F8OA 1A6PA 3AAZA 4F37F 2FD6H 5JIKA 5H35A 4X7SH 3W2DL 2YPKA 4OGXL 2P46B 5IB3B 2X6MA 5CP7B 2NTSP 5ESAB 1EERB 2Q8BH 1RZ7L 5J6GA 3UCRA 4JN2B 4EQ2A 1AO7A 1S7QB 1LDPH 3RZWA 3CNKA 5KAQG 1IAKA 4M8QB 3NTCH 5CHNB 1OAQL 4OQTH 4X0KA 4NN7C 1HE7A 2R0LL 4MJIB 3VFWB 5IB1B 4JFFB 3AVEA 3G6DL 1NGQH 4Y4FC 4HXBL 4M93C 3QJFB 1II4E 2PTTA 5C07A 1YYLL 5CJXA 1CLYH 1YMMB 4Y4KB 3ULUH 3PDDA 4N9OB 2IMNA 5ILTL 4MLIA 1A7OL 3HZKA 1RMFL 3ZTNL 5JW5B 3IRPX 1KCVH 4QRRA 2QQLH 1Q0YH 3W0WB 1VFUA 3EOYG 3HI5H 4NQDE 2APXA 3IDJA 1ES0B 1CU4L 2FECL 2IPUG 3VWKC 5J3HD 3AU1B 1U8HA 2QQNH 5DD5H 4GW5B 3ROOA 1BLNB 1S7SB 3VXME 5EU6B 2XZQH 3MGOA 2IPUK 3VRLE 1DANT 4ONHA 3F7VA 2DTML 4Z8FL 1QBML 4NQSA 3QXVA 2WWKO 4KKLC 2OZ4L 3OJDB 2WWKT 2B7DT 4MAYC 4OI7A 2VXTH 4L4JA 1JWUA 1UJ3B 4GG6E 2VL5A 3W81A 5KOVC 1NGXB 3I3BA 3ZDZE 3ARQA 1JNHA 1OAUL 3RNQB 2YUXA 4P23D 1CLOH 2RFXB 4F7EA 5E95B 1IGFL 4K3DH 5D7JD 4OZIE 5CWSB 4H25A 4ZOAA 5EIIB 4P2OC 2CXKA 3QPQD 3A67H 3CZJA 4XP1H 3GFUA 1YEHH 4XVJH 4O4YH 1MF2H 2AW2A 4K94C 3WCYA 4X6CF 5EOCH 3IFNL 4QRQA 2YEZA 4XMPH 1CK0L 1MAMH 5T3ZL 3SDCD 5CJ8A 3LHPH 4ORGB 2Z8SA 2YRZA 1A9EB 2NXYB 5GSRA 4TPRL 2VDNH 3FB6B 4W4NA 4P9ML 3SE4A 5KOMC 2XTJC 3FT3A 3VMNA 2V2XA 2MSPA 4M62H 3QUYC 3HR6A 2BY0A 1G6RH 1WEJH 2WBJC 5GGTL 2EC8A 3MBXL 1YMHB 5FIEA 1EEYA 3F7YB 3CFKB 3ILPB 4JR9H 3U0PA 3O8XB 5DR5L 1F4WL 4KGLA 2QSCL 4PJ7A 1VENA 5AEAA 2DYPD 5LAXB 1A6ZB 3V0WH 4P3DA 3RL1A 3BP4A 4KMQA 2C26A 3SDDD 1HN1A 1NCUA 4TVPE 1P6FA 4ZUUB 5HDLA 4K8RC 1MWAB 4LVNB 3MO1B 1WTLA 1CDGA 1YDPA 1OOAA 4YHPB 2E9BA 2O5ZH 1K8IB 2AJSH 4HS6B 5B39G 2BSED 1KB5L 4KK5C 5CJXC 5IQ7H 3TCLB 4HIEB 1GGUA 1W0VA 1LE5B 3KWWA 2W07A 3C6LA 4KK8D 5GQBA 3U2SA 4PYHA 4KXZI 4MCZB 4PGDB 1KCSL 2UVEA 3QIBD 3DUUB 5C07E 3KPPB 4CN6A 3LVEA 1JE6A 4DGVL 4ZFGL 1VESA 2ZOKA 4GFTB 3MLZH 4EDWL 2PYED 4NHUA 3WHXB 3L5WA 4QRRE 4PRPD 5TF1H 2BVOB 3BH8B 2YPLE 1I8KB 1DQQA 3IFLL 3O9WA 1YN6A 1KTRL 4S0SD 1OHQA 1UKSA 5L9DL 4LIQL 4XMKH 3D3VE 3EZJB 4KZEH 3O0RL 3QEUB 5FM8A 5E5RB 3DMMC 1D6EB 3BAEH 1MPAL 1RU9L 4UQ2B 1HSAB 1CCZA 4HKJA 5D2NA 4PJ5D 3H7LA 2VTFA 4U0RB 1MFAL 3ELAT 2XXCB 4CVZA 2I27N 2J1KA 2ESVB 3LQAL 3D25A 3L3JA 4UILL 1YPZE 5KVFH 2XFXB 4L3EA 5D6DA 4AEIL 4L8CA 3DARA 1JGUL 1OTSD 3FQTB 1CFVL 4FTVD 1RUMH 3EOAA 5ALBH 3LEYL 3VH8G 4U33A 3VXTB 2AK4D 4XB7A 1GPOH 4AH2A 1TZGH 3ABZA 3DETD 5CEYB 4APQA 1SJVA 3LS5H 5D72H 1TJIH 2ZUTA 3RL2B 4WJ5A 4QXUL 4HX1A 1W8NA 4ZPVB 2FYYA 3SE4C 5CMAA 4I4WB 4ZO6A 5J8OA 1F02I 1DJSA 4ZPTB 3HZVA 5SWZB 4Y4KC 1QSFA 3JV5A 3QB7C 1TPXC 1WBZA 4OV5B 4MHHG 3BIAX 5FHBL 4AG4H 5FHAH 1HXYA 2ZNXA 2E8YA 2R1YA 4BSWB 1LEGB 3PWPA 2NYYC 4EXKA 5I66B 3ARGB 4JGJA 4LHUG 1T5XA 4PJ7E 1EO5A 4HWBL 3FT4B 1KIQA 1HIMH 1HNGA 3DHMA 1S7RB 3W0WE 4OLVH 1UB5B 4HKBA 1HKFA 4XPAH 4P9HH 2B1HH 1LK3L 1LO0H 3EHBC 3V6OA 3LKRB 4L8DA 2HKHL 5ESQB 2DQHH 1FCGA 2WWMC 1QSED 1UJ3C 2VDPH 5I8CA 2R9HC 5F1NA 4GT7A 1KTLB 3QSKB 2X89D 4Q74A 1DVFA 5I8KH 2OR7A 5C8JB 3MREB 3HE6B 5F88A 4M6NH 2W0KA 2AK1H 1IQDB 3K46A 1JYXA 4NZTH 4G6FD 5GGUA 1BFTA 2IPTL 1MHCA 1ZTXL 4PS4H 5ID0B 5C0FB 3EW3B 1S8DA 4K3JL 3V7MA 3BPLC 3EFFB 1J1OH 1AP2B 1XCTA 4X9GA 3NGBB 4Y1AD 2UZYB 2YD9A 2NXYC 4OJFL 4FABL 4YHML 4G6JH 4GRLB 1OM3L 3VFMB 4S1DC 4NQVA 1G7LA 4U1IA 1V7NH 2P5EB 4O00A 4PJGA 2Y6SD 1JHKH 4GAYA 3VFGL 5D2NC 4Q9QL 2Z4QA 4NJAH 3QDGB 5C2BH 3GI8H 5EO9B 4ZYKA 4NRXA 2EYTA 3S5LG 2ZSVA 3DX6B 5D6DC 5D2NE 3TP4A 1SHMA 5I1EH 4XP9H 1F4YL 3T1WA 3BX7C 3LDBB 5JOPD 1YNLH 2Z0BA 4LVNC 1TZHA 4L3EE 2MMXA 1HZHL 1U6AL 5ENWA 5ABDE 1U8NB 4APQC 1L0QA 3L7EA 1PZ5A 1GGBH 3GBML 3BVNB 5EC1B 1JZ5A 2AEPL 4RAHA 5B38G 4PJXB 5GJSL 4K2UL 5I1CH 2XQBL 1MEXL 1KTKE 4RAUA 4L5FH 5FCSH 3WO4C 4OZHA 4YHNA 5D1XB 4OFPA 3IDIA 4MA3A 5FCUL 1GVIA 4M48H 5J6HA 3UYRH 5T33L 1RULL 1MCJA 3LD8B 2AJVL 4ZUWA 5HVFB 3BOVA 1NGZA 1QSFE 2A9ML 3JTTB 3V52L 3WJJA 4KJYB 5BVPH 1J8HD 4HUMB 1Z6JT 4B50A 1A5FL 4HT1L 5DQ9A 3PWPE 4G80B 5IVNA 5E5MA 4NNYA 3P0YL 5E9DA 4QHLA 5J9PA 1EA9C 2YSSA 2VDLH 1TVHA 1R5VA 4L4TA 1DQML 2YKLL 4OI9A 5EBMB 4G6KH 2LU4A 1EXUA 3CFJB 3WLWC 4BQBA 5DQDL 2GTWB 3GGWB 4Z7OE 3BD5A 4Z7UA 4DVBB 1DVFC 2DQJL 5BW7A 1I8LC 3TH3T 4YXKL 2O5YL 1LO2H 4AIOA 3CMOL 3ZMRA 2D7QA 4EJ1C 1SJXA 3OB0H 4RGNC 5TGBA 4UQ3A 1J12A 3RWDB 4I2XB 1MCSA 5GRVK 2R2HB 1FDLL 4RGNE 1OAXL 4MS8C 3DRQA 4OB5H 2I26N 3GIZL 2X7LB 4N8PA 5IFHL 4R6UA 4QTIL 3VI4E 3O6ML 3BGAA 1A9BA 4M1GL 1IAIL 4HBCH 3C6SA 4PLNC 3TIDB 5F7UA 3RNKB 4KKBC 4YK4B 5FO9B 4R7NB 2VLME 4ELKA 1YEFL 2OJZL 3ZT7A 3G9AB 4PJGE 5SX4I 5SWZE 2DI7A 4DEPC 4HGKC 3ARGC 4WNQA 3ESUF 2HTKC 1A21A 2UYLA 5LGJB 1MVFA 3FOMB 2ZUQB 5DJZB 3RDTD 5GRWA 3U0WH 3AROA 5DI8B 4PRBA 4D0BA 2JE8A 1RIUH 1NDGA 1GC1C 2EIZB 4NOBA 3LSOA 4OM0H 5I19H 4ZS6C 4PGEA 2VDOL 4W6XB 5CBEB 5B4MC 1R3JB 5EDXA 4AZ8A 3HAEH 2AQ3A 3CSYA 4HS3A 2P8LB 1AQDA 1RZJC 1KSRA 3P4OB 1T2XA 4K7FA 4XXCC 1E4JA 4OZHE 1RIVH 2Z92A 4UV4H 3IU4H 3WJJC 3NCJH 3W39A 3D2UD 4JHBA 1AI1L 1P9MA 4EI5A 2I5YH 4LMQI 1DDHA 2IALB 3G6AB 2W38A 4QT5B 2MHAA 3MNWA 2H9GA 3TN0D 4JM2B 2PETA 2F5AH 2VDKL 4NNPL 4L3CA 4CVXB 2IJ0C 4FP8H 5IJKA 4XPHL 3GSNA 4ZUVB 4GXVL 3O6KL 5E9DE 3VXQA 2VQ1B 4PRHD 1PYWB 4XNZB 1PY4A 4CMMA 2CK2A 1N8ZA 4GRLC 3U7WH 3VXSB 1X5ZA 1KENL 2CXGA 4K8RH 4FG6D 3WXWL 3ZKMD 5BW7C 4XAKD 4JKKA 2I07A 1DLHA 1WGOA 2DQUL 1BOGB 2UZIL 2WIIA 5C92A 1E4WH 4KC3B 4X8JB 2P5EE 3U46A 4ODUB 1E6OL 2XZAL 5AAWA 2WIMA 2Z8WC 4XRCA 3O4LA 3Q1SL 4JPKL 5KSAD 3Q0HA 4C83B 4TUKL 4X4ZA 2ILLA 3VD5A 5T1MA 3LRHA 1KPVB 2KZWA 5DDHA 1LO5B 5B39A 2ICES 4FQXB 2M26A 1MELA 2BNQB 3MV11 2VXSH 3KLHD 2BRQA 1XT5A 4LOUC 5IFJA 1LEKB 5IF0B 1KG0B 1I1RA 2W1NA 5DJ6B 2GIYA 1LEIA 4YDKH 1T5WB 4YUEH 4UNTA 3KPNB 4A6YL 4RMUA 4G8EA 2DYPB 4FS0A 4HDIB 4NM8L 2J4WL 3NCEB 3SGJA 9CGTA 1CDCA 3ZSTA 1XF5B 3FQXA 4DW2H 3MV9A 3DIFA 2OR9L 1QO3B 3DLQR 4FZ8H 1HDMA 4KHTL 2L4OA 4U1KA 1CGSH 4JJ5B 3FQRB 4QHNA 2YPVH 3MFFA 1FCCA 2W65A 3ALPA 2V7HA 4YBQD 1B88A 1Y6KR 3P73B 4MXWL 3WKMH 4LPCA 5IB5A 1JPSL 1M7XA 2BY3A 1I9EA 1JGVH 2YZ1A 5CZVL 5F97E 4P59L 4S0TD 5ICZB 5KSUB 3QIBB 3HTLX 1YEKL 2E7HA 4LRNL 2NQCA 3ECBB