4LCUB

Structure of kcsa with e118a mutation
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
212
structure length
212
Chain Sequence
DILLTQSPAILSVSPGERVSFSCRASQSIGTDIHWYQQRTNGSPRLLIKYASESISGIPSRFSGSGSGTDFTLSINSVESEDIANYYCQQSNRWPFTFGSGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein, membrane protein
molecule keywords Fab light chain
publication title Molecular interactions involved in proton-dependent gating in KcsA potassium channels.
pubmed doi rcsb
source organism Mus musculus
total genus 50
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 2013-06-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4lcuB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4lcuB01
3IFOB 2C7UB 5L8JB 4IBLT 2DQJH 2O93L 1T2XA 5KVEL 3QYCA 3TCLB 2UZIL 3GJEB 5JXAH 4R7DB 3HG1A 3D1MC 3EO0A 1WBZA 5DUBB 4LLDA 3CDGA 4QNPF 2Z91A 4G8GE 1QTYT 1F97A 4J2XA 1S7UA 4ONHA 3C5JB 4YHIB 5TQ2L 1J05B 5DMKA 4U1KA 1GIGH 1NFIA 1ORSA 3E3QC 3JV6A 4ZUUA 4LPVA 4YXLH 1RMFH 1IJ9A 4JHAL 1G7IA 3DBXB 3K1KC 2ZCKL 5DQDL 1S7XA 2MKLC 5EU7C 5IEKA 2LU3A 1GL4B 1NBVL 3OGCA 3ZMRA 1MRFH 3CVIL 1TDQA 3OV6A 3VXQA 4OF7A 4P23B 5SWQA 5HYIA 1CGYA 4I1NB 1Q9LB 4GAGH 4NQXB 2D4FA 3MJGX 1ZHKB 3FTGB 4XCYA 1JPFB 3MZGB 3UZEA 3DRQA 5DFVD 5ICZB 5J11B 3PGFL 2X4UA 3CZFB 4OZHF 1X5YA 3QFJD 3DO7B 5GJTH 5CIPA 1MI5B 3MACH 4U6VL 1DLHB 5GRWA 4UIKL 3O0RL 4G6JL 4FXKA 1KCUH 4Q2ZA 5IVXE 1YPZE 1NFKA 1FFOB 1BLNB 2XN9B 5TDPB 1KLFA 1ZXQA 4NM8H 1MIMH 1S78D 4HPYH 4S10A 4XCEB 3GI9L 1ZSDB 1BVZA 1IAOA 2FX8L 3V6BR 1Q9KB 2JJVA 1IQDA 4JJ5A 5F8QC 1ZVSA 5CFHA 3UJIL 4HK3J 4ZUTB 4WI5A 1INEL 3T0EE 3EDFA 3CPLB 4Z78A 2DQDL 2V9QA 4KROC 1U8IA 4NO5B 3G9AB 3W0WD 2Y4SA 2BY1A 4G42A 3WN5C 4PV8A 4H5SA 1A9BA 1RUQL 5I30H 5F9AC 2R4SH 4P2RE 2P7TB 3MLRH 4FXGA 3QQ4A 4RAHA 4WNQB 5BMFL 5IVNA 3QI9B 4PRIA 4UT6H 1FH5L 5E9DD 3N1PC 5IBTH 4YIQA 4UV7H 5BO1H 2J6EL 4R2GB 3PP4H 4K7FA 2Z0BA 4N0UE 4QTIH 3RWDB 1VPOL 3O4OC 3IDYB 4WVRA 2IADB 1YUHA 4JY4A 1OTSC 5E9DB 2ZJSH 1G7LA 1D5MB 3L3JA 3RI5K 3VGHA 3MCG1 4FZEL 2EDEA 1ACYL 3EDDA 4JZJA 4L3CA 4LSVL 2ZUQC 2CDFA 4HZLA 3C60C 4JVWA 5D71H 4I0PA 1FVEB 1KXTB 2IPTL 4WI7A 3S7GA 1XIWB 3V6FB 2Q3AA 1T22A 4OCRH 3SCMA 1U91B 2I9LA 3ZTNH 5KJRL 1TLKA 3OJMB 5E99H 5KSUB 3X13B 3LN4B 3VFGL 5HJ3A 2J8OA 4I3RL 2QHLA 3QUZB 4H1LB 4NIKB 2EIEA 2VH5H 2AJUL 4OM0L 5DEGA 1M1SA 1QD0A 2BVUA 3SQBA 5JMRA 1PX4A 3MRRB 5KAQG 2ENSA 2VITA 4HKZB 5DJ2B 3SE9H 2BOCB 2DI9A 3WHE0 2A1WH 2A6JA 2C3XA 3NTCH 4ODXB 4GLRH 4U6TA 1CL7H 3LN5B 2I24N 3MRPA 3BE1L 4YNYA 1CGSH 4RAVB 3HMXL 4DEPB 3ZO0A 2EXWC 1JNHB 1WT5A 5C0JB 1A4KB 2WUCL 3MNZA 2P5WD 2AV1B 2FR4A 1EXUB 4Z0BL 5EO0B 2UWEA 3GKWL 1AQDB 2NPLX 2OS7A 2EIBA 4OD1H 1A6TB 4QCIA 3P0VL 5HHPB 1PZ5A 3F7PC 2H2SC 3QULA 2ADFH 5DEFA 1MOEA 4R96B 3MUJA 1CXEA 4GG8A 2VYRE 1T5XA 2DM2A 3JZ7A 1YYLL 4F57H 4UT9L 4R0LB 1QHOA 4NQED 1A7NH 2P5ED 3V7AG 1NAKH 3G6JB 5I19H 4JRXD 4TSCH 3OZ9L 2EYSB 4NQEB 1KC5L 3LY6A 3QIBD 2P5EB 1MNUL 1X5AA 3VGFA 25C8L 4DK6A 1MWAL 4AIZA 3LQAC 4NN5C 1S7QB 5H37G 1H3GA 3V6OC 4EEEA 1NBZB 3QZWB 5K9OA 1QYGH 2D7OA 3CC5B 4Q6IC 3T3MF 4WTXA 3QAZB 2UVFA 5D1QC 2ZG3A 4GAFB 4HIIA 1IVLA 3PP3H 5C08A 4UI2A 3FOMB 4DGVH 5C0GB 1WZLA 3RWHA 4Z7VE 1A2YB 1GPOL 1UCBH 1AJ7H 1PG7H 2VDKL 4JQXC 5DDHA 5CD5D 5T1MB 1HYSD 2X4SA 2W92A 1E4WL 4XX1G 5E5RB 5B4MD 3L5XH 2QKIB 3QDME 1XH3A 3HZYB 5EO1A 3D85D 4I5BA 2CKNA 3LEVL 1EERB 3EO1A 5ESVA 1RHHB 2X7LA 5E2WH 3SE8H 5GSRB 4FQPA 2A77H 2WSKA 5DQ9B 3D85B 1Q9OA 4XNYL 2NNAA 4OBRA 3GIVA 1VFAB 4IRJC 3IAQA 4ELKB 3JWOH 3QO0B 3C9NA 3O8XA 4M6NL 4I18A 1U8JA 2NY7L 2HVJB 3U7WL 3F58H 4AEHH 1HQRA 1V7NH 4D0CA 5JQ6H 3LKPA 5TQ0H 5EU5B 5ILTH 4HK0B 3SOBH 3B6SB 2BC4B 1M71B 4OQ1A 4IRSB 3U82B 5I0DA 1MFCL 3V7AE 1PBYA 3MRDB 5IB3B 1HKLH 2D7NA 5E2UL 2R56L 2EDWA 5GGRA 3QA3B 1V5JA 5FA3B 5DJCB 3C8HA 5BRZB 4K7PY 1MH5B 4EDWL 3TZVB 5FOBA 1XGYL 3BDXA 3O9WD 3LRGA 4YEFA 4MA8H 1FE8H 3ARDA 5FGSA 4CRPA 1S5IH 5DJ8B 3K2MC 4DN3H 4WUKH 5KSAA 1NDGA 5CMAA 2B7DT 3UTTB 4L3AA 3GBMH 3QSKB 4ODTL 4K3EL 1NSNL 1BBDH 1D6VH 1F5WA 3ZHLA 3RDTB 1KB5A 3T77A 4Y1AD 5E1AA 8FABB 5F1NB 4ISVA 4AQ1B 1E6OH 2NXYD 3PWLB 3OB0K 4EUPG 3ARSA 4HUXA 1XGRA 4XX1E 3BT2L 1F4HA 4XMPH 3VXRE 1JF6A 5EU6A 1T03H 3F5WA 1B4JL 1CYGA 5I2IB 5I1HH 4P99A 5C9KA 4OZFB 3GM0A 3OL2A 4NKMB 3EOTH 5TE7H 4HLZG 1VACB 3E1F1 1LP9F 3SPVA 1RU9L 4KWUA 1QNZH 2G9HA 1CQYA 1FFRA 1U6AL 3NA4A 1HSAB 2DQGH 2VZUA 3ZDXF 3BI9X 4K2UH 1VA9A 1L0YA 4LLAA 5DD6B 5KS9E 2Y5TB 4HBQA 3WDHA 2EH7H 4GQ9L 5GGTA 1EUUA 2DLHA 2KZ1B 3LSOB 1SMOA 3RNQB 4A6YB 2Z93A 4O51A 3OX8B 2IFFL 3MUY1 3O11B 3OKOB 5BJTB 5GS1B 3HZVA 4TULL 1GH7A 5DFVC 5IW1A 4ZUWA 4X0KA 4M62H 4P2CG 1U8MB 3BAEL 2DQHL 4P5TD 3EYFA 5B8CC 3R0MA 3ESUF 4X4YA 1A02N 4NZDA 1NC4D 4U49A 3U7YL 1J87A 5CS7A 3WHXB 3ALPA 3LQAH 1KBGL 4JFEA 1MJUL 3UBXI 1DBKH 5IMKB 3PL6B 3HI5H 1R3LA 4G8GD 1U36A 5IT2L 2HFGH 5JIHA 1FYTE 3DI3B 4MAYA 3L5WB 3TJEL 3Q2CA 1ZWIA 4KMTL 4ZO9A 4OLVL 4WFHE 2NTFA 3U0PA 4LSSH 5E95B 5DS8A 3S6CA 3WFHA 1UZ6E 5HYJA 5J6HA 4JFDA 3MBEA 2DQUL 4PTUB 5EIVA 3VFNB 1AGEB 2BHYA 4QY8A 2H6PB 3DGCR 1HI6B 1AKJB 4Z7WA 4JGMA 4I48B 3WIHH 4RCAA 2EO9A 3QT2A 5EFIA 1F6AB 1A0QH 4NQVA 1CGTA 4H25A 2LQRA 2BERA 3W5MA 2ESVB 5JIKA 3L7FA 5IHUL 3MRLB 3AREA 3C5SB 1BZQK 1MQKL 4MA1C 2GUOB 3GSUA 4AYFA 3I02B 2GK0B 3W9DB 3I75A 2X40A 1U8LA 4K71B 3ZKSD 4JPIB 1F3DJ 3O45A 2GCYA 4YWGH 3AAZA 3H9SE 2LV4A 1KEML 4L5FL 2VABB 5L8KB 3LIZH 1FGNL 1RURL 4CJ0A 4FFYH 1TZHA 4DGIL 5JDSB 1CDCA 3QG7L 1ZLSH 1YPZB 2AJVH 2OI9B 3MLXH 5FUZH 2BVEA 3WEXA 1SJHA 4KXZI 4F8TA 2DJ4A 3UZVB 4LCCC 3BXNA 5D6DC 4MD5A 3BQUD 3GUTA 5C3TA 3T0ED 2OMBA 1EUTA 1KTLB 4ETQB 1JGUH 3SDCC 2Q1EA 4LCIL 3VMPA 2F8VA 3ILQD 3GMRA 5HHVL 4PRNA 4RWHA 3VGBA 1BBJB 3TVMA 1QFPA 2OLDA 4LLQB 4EZMA 5A16A 1YN7B 2B1AL 3O3AB 2Q7NA 1RFDH 3V5DA 2UY6A 1N6UA 2V2WA 4P2RB 3MC0A 3IETB 1YNTA 2H8PB 3G08A 1ZTXL 4XCCH 1GGYA 4KHTH 4FQ1H 4EOWH 2YD5A 2XZQL 4PB0L 5DHVA 3VJ6A 4IDJH 2NY3D 1OM3L 2VMFA 5IFHH 4N0UB 2OTPA 5JXED 3HCVB 4ZD3L 2D3VA 1W0WB 1I8LC 2FJHB 4NQCD 3BKCL 5D2LF 4X7SH 2NY3B 3TYGH 4DKEH 3EO9H 1SVZA 1J1XH 3IU3B 5DJXA 3QH3B 4LIQE 5C0CD 1T1ZB 4XWGL 2VLKE 2JCCF 5IM7A 4LBEA 1ZA3A 4PJAE 2XKNB 3CFJA 1Y0LA 3BZEA 4MNGB 4ZYKB 5H2BA 5AZ2H 5IOPA 3W39B 5DRZA 2DQIL 1NAMB 2F74B 4G43A 2CK0H 4M3JA 5DJAB 1YEEH 5IEHA 2EE9A 3FN9A 4P9MH 4KI5E 3B9KD 2FJGA 3VFRA 1X5IA 2CLVA 3B2UD 4O5LH 3KJ4C 1BGXH 4OF3A 5H35B 1DQQB 4G80B 5JIIA 4JLRA 2F19L 2QSCL 5C0IA 2R0KL 3HFML 1LEGB 5I15H 4U1IA 5CZXD 3QO1B 1QBLL 5CD5C 4JN2A 3I9GL 4YPGB 5J3HD 5B4MC 2IG2H 2HP4A 5ICXA 1QLRB 3VXSE 5MHSD 2VZOA 3LKRA 1E27A 4NHUB 3FO1A 3WFEL 4NO2A 5DMGD 5TPWL 4V1DD 3V0WL 3RL1B 1BEYH 2VIRB 4KHXH 4FTVA 4XC1L 2F5BH 3OKMB 1XMWA 2P44B 3RY4A 2OK0L 5EZLB 3UP1A 3VWJC 4FQJL 1T4KB 2HT4C 3SDDD 1N7MH 4MMZC 4PGEB 5CZVH 2CIKB 2I9TB 3U0TB 1GGCL 2HKHL 4Q9RH 1M7XA 5AEAA 1SEQH 4XXDA 1J1PL 3BISA 4U2YA 3QDGE 3WDIA 4P46D 2Y72A 3L3GB 4WUUB 4PRHA 1QSVA 4F37F 2V5SA 1JBJA 4BZ1L 1YEFL 1HCFX 2IAMA 1YEIL 1T7ZA 1X4YA 3KPSA 3RTQB 2Z9TA 4AM0A 1I8MB 3FQRA 4QNPE 4PYGA 1QRNE 1QFWI 4NM4L 4FQ2H 1N26A 2PO6A 2RFXB 1QBMH 3O9WC 1JGDB 4WW2B 2D0GA 1UXSB 1DBAL 2CDGA 5TDOA 5FYJL 3FQUA 1CXIA 3UX9B 4MAUH 3T0DA 4EDXA 4AEFA 1NMBL 1ADQL 3QDMB 5F6HI 4X6BA 1U3HA 5E24E 2I60L 1P4LA 1K4DA 2DKUA 1KIUA 2VUOA 1DVFA 4RMWA 2Q8BL 4O2CA 2WAHA 4K3DL 4KK9C 1N3NA 1CICD 1T21B 4XNZB 2ADIA 1Q9WB 1MFDH 2COQA 5FYKE 2NXYC 3PJSB 3OF6A 2PYFB 1KFAL 2AGJL 5IK3B 5B3JF 5DTFA 1I3GH 1RAMA 5SX4H 1A9EB 4JEGB 35C8H 5IWLC 1I85A 2JB5L 4OZHE 1Z3GL 1G6RA 5L2KE 4OV5B 5J9PB 3QB7C 2BVTA 1WF5A 2BOBA 3DSFL 4FQIL 4IMKA 4FFVD 1EAJA 4MWFA 1BFVL 5CILH 2PTTA 5HHOE 1KCKA 1ETZA 5D1XA 2IH3A 4F3FA 4HIEA 3STZA 3DARA 1AH1A 1RZ7L 5D2NE 3WFBH 1U2HA 1XGPA 4X6DE 2CLRA 4JDVA 4U6YA 4DTGH 2QQLL 3MODL 1CGVA 1WZMA 1QOKA 1TETH 4BFGA 3FQWB 2ZG2A 5FECA 4YK4B 3S37L 4JN1H 4CW1A 1X5LA 1IC4H 5FV1L 3CSYB 3RJQB 4BSVB 1C5CH 5TH2B 1KGCE 4U1HB 3RWFA 5EC2A 4C59B 3RFZC 3QUKB 1NUGA 2ITDB 2EDTA 3RBSA 1KJVB 2ATKA 5FM5M 5LG1A 4MXWH 3OTTA 4IIQB 4P5TC 5C8JA 1IKNA 5L7XL 5I1JL 2X9YA 1R0AL 3SO3C 1Q8MA 1N64L 1YECL 1CVRA 1JFQL 2ICWJ 3S96A 2VISB 5CUSL 3I2CH 5F7UA 3X3FH 1FFPB 5CLWA 2ZP0T 1GOHA 3VXRB 4XP9H 1FC2D 1UVQB 2MWCA 1W8OA 1NMCB 4YXKH 4QGYA 2CUMA 3VH8G 1U41A 1CLCA 4HGMA 4KZDH 1LO2L 5EU4B 2WZPD 4UT7H 2M26A 4EN3B 3T1WA 4OJFL 3VXTB 5EBLB 1F90L 5A2KH 4LLMA 1NL0H 3D9AL 1I8KA 4NRXA 3S98A 3KPTA 3MREB 1OSPH 3CX2A 3HC4H 1M4KA 5EPMB 1MHCA 1NBYB 4BFIA 2B5IB 4YEEA 3BGMA 3C6LA 1BAFL 5F96H 5B39A 5KS9B 4XAKE 3QUMH 1RK1A 1FV1B 4WY7H 4B7LA 3AS2A 1ZT7A 4WI6A 4N0YL 3JUZA 4L9LB 4PJDB 1VFMA 4TPRH 4GG6E 1GHFL 4WO4A 2MCPH 3UEZA 1NEZG 4M43L 4JZNB 1IGIH 2VZVA 4HD9A 4H0IA 1EEZA 3BKJL 4BKLA 1D5BB 1OGTB 3UYRH 1WZKA 2H9GB 3GK8L 1FYTD 1GOFA 4GKSA 1PFCA 1IEBB 3O4LA 4XXCA 2BXYA 4KQ3L 2Z31D 3VXUD 3BHBA 4F7PA 1A6PA 1J88A 1NUFA 1KPVA 1NCBH 1KN2H 2E3VA 2JELH 3BQUC 4PJ9D 5KW9L 1TVBB 1XR9A 2E27H 1GJIA 5MENB 4XPAL 3CFKA 4R4BA 4KZEH 4YDIH 4KJPD 2HKFH 1MY7A 3ILQC 4F15C 3IJSB 4EUPB 4YLQT 1R3JA 4Y5XB 3L6FB 4AG4L 1FL5B 2ATPA 4LSPH 4QYOA 2R1XB 1MRCL 2ZSVA 3HRZA 1HE7A 4NFBA 4KROB 4JR9L 2VLJE 3N9GL 4OLZH 2XA3A 3S4SG 5DJYA 3WN5B 4OLWH 1R3KB 4PGDB 4XPFL 5GJSL 2BFVH 1HKFA 2OTWA 1S7WB 4LHUG 3H9SD 3ARFC 4HPOH 4MJ6A 2ENYA 3KLSA 5L0QB 2X4OB 3M8OH 3QEHA 5I1DA 4U3HA 1XF2B 1SM3L 5I8EA 3ZE2E 43C9B 3B5GA 2EDDA 4M93C 4OGXL 1A7QL 4PD4K 4PYHA 4LVHB 1J11A 3QNXB 5FM8A 3SGKC 1E4XH 1CFVH 3LEXB 3BW9B 3C60B 4OD2A 4D0DA 5DR5H 1VADB 4ZSOB 1TMCB 3WKML 3R0NA 4X98B 4WI9A 5ESQB 4LPWA 3BD5A 3GNML 4PRPA 3WFDH 2XZCL 1NFDF 4OB5H 4X6EB 2PCPA 1RZ8B 1JJUA 4NJAL 1KT2B 5ANME 2V7HA 5ID0B 1A14L 1PLGL 1IT9L 1I9IH 1FNGA 2J8UA 2R0LL 1IFHL 3OBAA 5DD0L 4F33B 3B9KC 3TBWA 4H0HB 3B2UC 1TENA 1XGUB 3BH9B 3PXJA 4YHZL 5J4MA 3CDYA 1UJ3B 3VFOA 3OKLA 5C1MB 3G5XA 1QEWA 3IU4H 5T3XE 1Z9SA 1Z2KA 1BVKB 4AEEA 1CBVL 1RUKH 1HXMA 5CZXC 2X05A 4Y5VC 7FABH 1RJZA 2Q20A 4NYLA 2JB6A 3O6KH 1EMTH 2HN7A 2VLME 5DSCA 2VLKD 1RIVL 3IDGB 2A6IA 1SYVA 4LASL 3K8LA 4YAQA 5DMGC 4ODWB 2X70A 3MLSH 1EBPA 3PNWA 2BZDA 5DI8A 3MLTA 5DUPL 4NQDA 1BMGA 1TTUA 4NC2B 2OTUB 3ET9F 3MGOA 4EVNB 3T2NL 4OFDA 2B0SL 2DQTH 5CEYA 2AXFB 1UQSA 2OQJB 5KSBF 1LE9B 3EYUL 1ND0B 1IAIM 2KPNA 4CDGC 2BMKB 2YRZA 3W11D 1T6VN 2BNQB 1T0MB 4PGBB 4P46C 5F9WB 3MJ8A 2GSIA 3DX7A 3I50L 2DM3A 4FABH 3DX8B 4PJHE 3GGWB 4XP5L 1PDKA 2CDEB 3TO4C 4F80A 4Q6IB 5D7LA 2IBZY 4NUGH 5D1QB 1VGEH 4GW5A 3A6OA 3EZJB 1MRDH 1BVLA 1HXYB 3OKEB 1LP9E 1U8PB 3CU7A 5F1KC 3QJHA 3SO5A 1F3JA 1QBBA 5IHZA 1IGTB 3SDXF 5IIEA 1KCRL 5KZCD 2FX7L 1T3FA 3LRSA 1QLFA 4Y16A 3SE3C 3VXSB 3ZDXE 5DJ0B 4Q9BA 4MQ7B 4UTAH 3ZE0E 3CMOH 4HMDA 4F58L 3SDYL 1CICC 3N0PB 3MJ7B 5D9SA 1S9YA 5ACMA 4CMMA 2XA8L 3TBYA 1CE1H 1J8HD 2HTLD 3QCTL 4APQD 1U8NB 3HUJF 5BS0A 4BFBD 3L5HA 3PWNB 3D3VA 5IQ7L 4KVNH 1TJHH 4KQ4H 2UZYB 5IVZB 1MFBH 2QL1A 1ZT4B 1U95A 1G6VK 4JCMA 4LLVB 3V9FA 5JA9A 5C0FB 4OCXH 2D03H 5SX5H 1C8PA 3QDGB 1MCBA 5IMOA 3NMEA 3WIFB 3P9MB 4MA3B 3GI8L 1QRND 4HXAH 4AT6B 1Q72L 5I66A 2R1YB 12E8H 1IGCH 3BD4A 3VG9C 2PF6A 3QUYA 1AGDA 3AM8C 4K7PL 1HH9A 4QOKE 1MHPH 1G7PB 3QR2A 5I1GH 2DMCA 4L4TE 2Y7QA 3VW3H 5ALBH 4Z95L 1YEJH 3Q6GL 5D7JD 5ACLA 1KENL 1S9WB 3IXAA 2W59A 5EOTA 5E1HB 2ZSWA 4L29B 1FL6A 2QSVA 5T3ZE 1K3ZA 3V4VL 4X6CF 3KYKH 2AK4A 5T1LD 4H8WC 4KRPD 1U3JA 5FYKD 3QNYA 1Y18A 3UTSE 5J57B 5FKPB 3MV8E 5DC4B 1KNOB 4OD3H 2NX5B 2UZXB 3IGAA 3PWUB 2EDKA 4X6FA 5F71A 3O3DB 2IMMA 4L1DA 3S88L 1BQLL 3LEYH 3MTRA 4BZ2H 2GAZB 3KJ6H 3KPRD 1E4KA 4G6AD 4P2OD 5C09A 1EAPA 2VDML 3S35H 5GGVH 1FZKA 1TFHA 3ARGC 4OZHB 4KRNA 1HDMB 1T1WA 2AQ1A 3DXAA 5BW7C 1VB9A 3VGAB 3U46A 1INQA 5L2KB 4U6XA 4N1HB 4FQLL 2DQEL 4K23L 3TN0D 4FA8A 1R24A 1JIBA 2ERJB 2AEPH 3PHSA 3GM8A 1NGZB 5HHOB 4OQTA 5E6IA 4X8XA 4YGVB 3QHFL 2YZ1A 5D2NB 2RIKA 1AXTL 2DQJL 3DX6B 5HGHA 5JXAL 1P5VA 1I7RA 1FJ1B 3GMPA 1FLRH 1MUJA 4HKJB 4ZXBB 2VWEC 3B2VH 1B9ZA 2PYEA 1XGQB 3BWAA 3V79C 4P5KA 1GIGL 1KJMB 5I17A 5KTEH 3GSOA 4YXLL 3ULVF 5K9KA 2BSRB 4FQCH 2V2XB 4J1UB 4PJFE 5D7SH 4JZOB 4P48A 3GMNA 3TBTB 3D0VA 1MRFL 3I6KA 1A4JB 3IJYA 3WJJC 5SWZE 5DHYA 4GXUM 1MCRA 5FGRA 4GAGL 4P3DA 5J12B 1LO5B 3G5YB 1UB6A 5GQBA 2DQCL 4PJ9C 4GUPA 4ZO7A 1UCTA 2GFBA 2GT9B 5D1ZB 5GJTL 4ZFGH 3X14B 3MACL 2EYTA 4LCWE 3RWCA 3EYOA 1AR2A 3OWEA 5C07E 1KCUL 2JCCE 5F6IC 4CNIB 2ZCLH 5IW6B 4ZFFA 4NM8L 1MIML 2JJWA 4KJWD 4HPYL 5KSVA 3DETC 4ONGH 4N5EC 1HQ4B 3M17B 1CF8H 2C4FT 1MCWW 5CP7A 3GSXB 5E4IA 3PGCB 4GG6B 2W60B 3GIZH 2AJZB 4ODHH 4MA1B 3HZMB 3KYMB 3OJVC 3HAEG 3WBDA 4LSUH 1IM3A 5I30L 2R4SL 1MEXH 3HZKB 3MLRL 1BJ8A 3HLAB 1K8IA 1CFNB 3MYJA 3G04B 2CGRH 2R29H 2Y9RT 5IBTL 3WIHA 4UV7L 4Y4HA 5BO1L 1DUZA 5HYSG 1A5FH 4MNQB 3KR3H 1YY9D 4QTIL 5MEPB 3HI1A 2VDNH 1FHGA 4M9PA 1LO0L 2NR6D 4NKOA 2CUHA 3I6GB 3RHWF 3P2TA 3RL2B 1AHWB 2ZJSL 4FQXD 5FK9A 1XF5B 1EFXA 4QXWA 5F7MC 1GCFA 3CVHH 1H3UA 3V5HB 5D71L 1JV5A 5MP6H 1MCIA 1EZVX 3M1BA 4PJGF 1JGEA 1S8DB 3QXUA 4X9BA 4OCRL 3QNZB 4NPYB 4G9FA 4C83A 1LDPH 4O2FA 2P8PA 5CJXC 1HHKB 3ZTNL 4H8WH 2VLJB 3VH8B 4I2XE 1A7OH 3CCHB 5MERB 4PRDA 2X89A 2KDGA 3CX5J 4FS0A 1P7KB 2JKXA 1DDHB 4KJQD 1FNEA 1X5FA 4X5WA 5MEOA 4MHHI 2VH5L 3GB7B 4OZGE 5DRXA 2AJXH 3TH3T 3BDBA 2BDNH 3KPNB 4MJIE 1XR8A 4QXTA 4WU5B 4QT5B 3MRFA 3L3OB 3SE9L 4C4KT 3VXMB 1HOCA 2A1WL 4PV9B 1CL7L 1E28A 4ZO8A 2BY2A 1FSKB 1CGSL 2XWBA 3MBXH 1IEAA 4NO3A 1I1YB 2NW2B 3IFOA 1NEZB 3KGRA 3KHQA 5HDBF 2YK1H 2VZSA 1I9RL 4XCFH 3GJEA 2X2YA 4Y7MA 4Y8DC 4N1EA 3BGFC 4R7DA 1CU4H 3JSSA 3GSNB 2OCFD 5ANMB 1PQZB 3RIAK 2EDQA 3BP4A 3VRJB 2ADFL 3QCUL 5J1AB 3MX0A 4UOW0 3W11C 5GS2D 1Z9OA 1H8OA 4PD4J 5EZJA 4MDIB 4HIJB 4F57L 4F7TB 2HFEA 5ICYA 5T3XD 1NJ9B 5HGBA 1JZ5A 1A7NL 1JMXA 1NAKL 1H0DB 5I19L 5JMOC 2IBBA 5C0AE 5JORB 1DL7H 5EH1A 4J4PD 1DFBH 1MFAL 1MHEB 4YO0B 3K4AA 4G6KH 2DLFH 4Q9QH 4JDZB 3D6GA 1IBGH 1Q9LA 3KYAA 4NQXA 3IRZA 4MJ2A 1N5YH 4IM8A 4LKCA 1RJYB 1C7SA 2ZPKH 1JPFA 1QYGL 2NY5C 1M7DB 3S4SB 1OARL 3EIFA 4C55A 3DO7A 2I25N 1MI5A 2A83B 1DLHA 1S3KH 4LHUB 4DGVL 2ICES 2ZOKA 2C26A 3V5KB 4GKZB 2OP4H 4LQ1A 3V7MA 1UZ8B 3P77A 3FB7A 4ZNEE 3QFJA 1FFOA 1VSCA 1UCBL 1T04A 2XN9A 1AJ7L 1PG7L 2HTLC 5CJOH 4JM2D 5TDPA 5B8CA 5J7CC 1C16B 3T3PF 3L5XL 3WNOA 4KPHH 4YX2L 3VWJB 2IC2A 3ULSB 1ZSDA 3KLAB 1N6VA 4HS6B 3TT1L 1KYOK 1KLUB 3PWPB 5C9JB 1QBAA 2FBJH 1GVIA 3BYYA 4M48H 5I74C 2APVA 3CPLA 5E2WL 5HI5C 5E7FA 1H8SA 4NO5A 3JTSB 2A77L 1IM9D 4PJ7F 1KACB 1KN4H 3MLWH 4PREB 5IKCB 1CT8B 3SKUD 2O5XL 1KSRA 1OTUC 3FRPG 3F58L 4WNQA 1V7NL 5ECJE 1ONQB 5DURD 5JQ6L 5TQ0L 3W0WA 1WAAF 1LP9B 2H32H 5E2VL 3RWIA 5EUKB 5ILTL 4ELMA 5HHME 4WWKC 3SOBL 3D25B 3BOVA 1BOGB 2IADA 2VDOH 4KRPC 2UUDH 1HKLL 4J6RH 5E9DA 1WFNA 1SQ2N 3VXNB 2FHBA 4PJEF 2YPLB 4WEMB 2VDRH 2NY1B 1OVZA 5F21B 4UOJA 4XP1H 4L4VD 3D39E 4NRYA 3RIFF 4MA8L 1CDBA 4DZ8B 1S5IL 4TN9A 1U91A 4DN3L 4WUKL 2P42B 2XPGB 1RUAH 3F7VA 3IS0X 4NT6B 5KSUA 4QRPE 3LN4A 3GBML 3RJDA 1HHGB 4D9RE 5F7EH 1JF5A 5BV7H 1BBDL 1VHPA 1PYWB 1D6VL 4LCCA 1WGOA 3RX7A 3TN0C 4H26B 4J7RA 1E6OL 3T0VA 3BESR 1D9KD 3S9DB 4XMPL 1GGIH 1NEUA 3MRRA 4QKXB 1T03L 4HKZA 1U8OB 5DJ2A 5GXBB 5GGVY 4L3EE 5I1HL 4QOKB 3JTTA 3EOTL 5TE7L 4L4TB 1JNNH 3DUHA 3LN5A 2W9DL 4OSUL 5JW4M 2CRMA 1RZGB 2FDBP 4L9DA 4JKPH 3IDNB 4ODVL 1FN4B 5C0JA 4LEXH 3MV8D 3ARXA 1QNZL 1VESA 2AV1A 2X4PA 4KMLB 4NO0D 3SHSA 5D5MA 1EJOL 1V3LA 2ARWA 3CFCH 4B41A 4H88L 4EI6B 2DQGL 5C0BE 2Y5EA 1JNJA 3UTSB 5HHPA 4K2UL 1RSFA 4GKNB 1INDH 2XACC 3MV8B 2P5WA 4R96A 1NCUA 1MJ8H 2EH7L 1I8LA 1OGAE 4Y19E 4LDEB 3LVEA 1T7VA 5ACZB 1C7TA 2JK5A 5IESH 3GSWB 3RKDD 2VQTA 3MA7B 3CK0H 3VU2A 3G6JA 4WHDA 3IXTA 4L8DB 3LH2H 5JPNA 1AO7E 1PG7W 3GMOB 2EYSA 4NQEA 5D7IF 3O41B 1KJ2H 2P5EA 5D8JH 1FG2B 4JRXA 1S7QA 3LQAL 3PUCA 1FZJA 1IRAY 3QZWA 4TRPH 4NN7C 3HI5L 3QIBA 2MOVA 3BGAA 2NY5H 4KJWC 1MAKA 5F7YC 2GEEA 1X5ZA 3TT3L 3F6LA 1YNKH 5K9QI 1NMAL 5C0GA 3U30C 3NIGE 4LSSL 2MMXA 1A2YA 1ZT1A 4XZUB 4U1NB 5I1KH 5M94B 4UB0L 2XZZA 3ZYIA 3VXPB 5GGSY 3RUGA 1PKQE 2MPAH 4PUBL 4YE4H 2YEZB 3WLBA 2R15A 4QTHA 3HZYA 3WIHL 5K33A 1A0QL 3FQNA 3NIDF 4CVZB 1MAMH 1TQBC 5SWZB 2F58H 2CKBH 5JW4Q 3QUMA 5FHBL 1OF2A 3D85A 1YY9C 1QUNA 2NY4D 4NWTH 4LCWD 2P46B 3X11A 4D3CH 3QEQE 1EGJH 2NR6C 3NOIA 4YWGL 4FQXC 5D2LB 5JR1H 1UKQA 2YUZA 1AD0B 1NKRA 3CUPB 3VFTB 1KIRA 4YDLB 2EO1A 4ZOBA 5HVFB 4FFYL 5C07B 2JCCB 3MLXL 1R3IL 5HVGB 4IRSA 1MCNA 3MRDA 3GSRA 4ZFOA 1JRHI 3GHEH 5FYKH 4IRZH 3QA3A 5FA3A 4P4KD 3IVKB 1MH5A 1TTFA 1JGUL 2P24B 2XTJD 5KSBE 3TZVA 2V5TA 2FLRT 2BP3A 4QRQB 2L7UA 1F4YH 3QFDA 1IZJA 5DJ8A 4MDJB 2ZG1A 4LPCA 3S5LB 3H8NA 2E9IA 2YN3A 2W9EL 3UTTA 3C09B 1RFDL 1U8QB 3O9WA 1K5NB 1K8DA 4GAYB 4XC3H 5I73C 3U6RA 2YD7A 3H9YA 3VGGA 3RDTA 1WLHA 5D96C 4KHTL 3CFEA 5F1NA 4FQ1L 3AGVA 4EOWL 4XP4H 3PWLA 4IDJL 3QHZL 2VXTH 5IFHL 2BRRH 2HJLA 1BIIB 2FEEL 2UY7A 1MCPH 2VLRD 4Y1AA 4JO4H 3H7BB 3O2WH 5I2IA 1UWXH 1CXHA 4OZFA 4X7SL 4DKEL 3EO9L 2C4FU 1ZHNB 4OZIE 1J1XL 2RJMA 2VC2L 4I9WE 3W5NA 4N9GA 2ORBH 1BFTA 4JQIH 3QEUB 3T08A 2C3HA 1KCSH 4M8QB 3E2HB 1Z6JT 2CRZA 4XRCB 3FOLB 4RDQF 2MFNA 1HSAA 2QQNL 4I2XB 5AZ2L 5E8EB 1ZLVH 1H5BA 3FONB 4J4PC 2Y5TA 3FT3B 3KAAA 1LWRA 5JOFA 5E03A 3KNBB 5SX5K 4ZS6D 3G5VA 3LSOA 3H0TA 4YFLF 2CK0L 4A6YA 4OZGB 1YEEL 4MA7H 4UQ3A 3O11A 3OKOA 4P9ML 5GS1A 5BJTA 2UWEF 3GSQB 4Y5VB 1WZ1H 3DO3A 4MJIB 1U8MA 1BGXL 3WDJA 5GPRA 1LEIB 2CK2A 2A74B 1A6AA 1AP2A 3U0WH 2HMID 3WHXA 1IL1B 1HHIB 4LSRH 1YJDH 3GMLB 3PL6A 1U8KA 1U0QA 1FFNB 3QDJB 3HAEB 4X6CE 1NC4A 3L5WA 2IG2L 5HDQL 1JYXA 2HT2C 2EDHA 2G75A 5LCVH 3D18B 3CMGA 3RZCC 2RQ8A 3A67H 4G8GA 4JRYE 1T83C 3CLEH 3ZHDA 4W4NA 1BEYL 4KHXL 5C0AD 5HYSB 2F5BL 3O8XD 4PTUA 3VFNA 1O7SA 3MNWA 1AGEA 1EO7A 4R8WH 2X42A 1HI6A 4XP6H 1N7ML 3RWEA 2CLZA 1QZ1A 4I48A 2AP2A 5CZVL 3R4DA 4ORGA 2MCG1 1AIFB 3ZKXB 4KK8D 4Q9RL 3TO4B 1SEQL 5I8CB 4LGPB 1S7TB 3MRLA 3C5SA 1DANT 2GUOA 4NQSB 4LPTA 3H9HB 4L8BB 1I7ZB 3TFKD 4WV1C 3PGDA 5JW4R 2WQRA 3MRJA 1QVOB 5JDSA 2OSLB 5IVXA 2GJZA 1YPZA 4FQ2L 4MB3A 2WIIA 4KKCD 1QBML 4M61B 5DK2B 3D87B 5JIPA 3WNKA 1DE4A 2E9WA 3ULVE 4MAUL 1S9VA 4IMLB 4Y4FC 3FT2A 1KTLA 1A3LH 4ETQA 2NXZB 4YHKH 3X12B 5F70A 1WSST 2PXYD 3BQUA 3EKCA 2C3WA 3FB6B 2LTQC 1OPGH 3T0EA 4PP2A 1NKOA 1MFDL 1D9KC 4XVSH 1YN7A 4JFXB 3N1FC 2PXYB 1I3GL 5DUMH 3IYLW 4P2RA 4PY7A 2XNAB 1Z0NA 35C8L 3T2PA 2H8PA 4GRWF 4AY0A 5F1IA 3JVGA 2OL3H 43CAB 5ABDE 4C58B 3GFUA 4PJ8B 1X5GA 2KL6A 3UTZB 1FORH 5HHMB 3RVTD 4AQOA 3A0OA 3GSNH 4N0UA 5CILL 2H41A 3UJJH 4TUOB 2O61A 4HXBH 2W9LA 3WFBL 5KN5B 2QQQA 2FJHA 3D39D 1N5AB 1A7PH 4DTGL 4JGUA 1TETL 3QH3A 5JXEA 1EH9A 5GS2H 4RFNB 1IC4L 2NW3A 1C5CL 4U1MA 4PR5B 4QRRE 1BZ7A 1T66D 1F42A 1SMAA 3WS3B 5T3XH 3V0VB 4RGOL 4HUUB 4CU7A 4YC2C 4UNUA 5CEZD 4ZYKA 3QUXD 4QRPB 3W39A 5BXFB 3ROOB 3VFMA 4MXWL 3NZ8B 4ZAKD 3ARGB 1LO4H 1G7MB 4YBLB 2J5LC 2BSTA 3MUGA 4HH9B 4PRBB 4L3ED 5DJAA 4OKVB 2QV2A 3I2CL 1NUDA 1YQ2A 3X3FL 1ZHLB 1ZKAA 5KVDH 4XP9L 3FB5B 4YXKL 4P3WA 5HYJD 4IOFD 5H35A 1NC2B 2EH8L 4KZDL 3MBED 3B9KA 2GI7A 3HR5B 4HWNA 5C0BD 4UT7L 1XEDA 2P43B 2XFXB 3QO1A 4DCQB 4F7EB 1C5BH 1NL0L 4YPGA 5JNYB 5ADOH 5F72S 4RNRB 3HC4L 1ZV5A 1QLRA 3BIAX 1OGAD 1SJXA 1JTOA 3PDDA 1EX0A 1EEYB 4NHUA 5F96L 5E8OA 3ARED 3QUML 2P8MB 4POYA 4OV6F 3RL1A 4WY7L 3ZT6A 1UJTA 4Y19B 1OGAB 1OQXA 3V4PH 5DGQA 3SDAB 3OR7A 3ZDZE 1G7QA 3ARQA 4W70A 2NY4C 4TPRL 3SGEI 1F13A 5INCA 3EBAA 1ROWA 2VSCA 4V1DA 2MCPL 1J10A 1IGIL 1AO7B 3U0TA 4I0PC 3UYRL 2EEBA 1KIQA 5DFWH 3MRIB 1UM4H 3SDDA 3SCMC 1BQHA 4IS6A 3BPNC 3ILPB 4CGTA 2A0LD 4QHLB 1VCAA 1NCBL 1QPXA 3L3GA 1KN2L 5JPMB 2GTZA 4D9QD 1QP1A 2GIYA 4L4JA 5IF0A 1RJLB 4BJLA 5JOPE 4P4KC 5IG7A 4Q58C 2XTJC 3GDBA 4KZEL 2YD8A 4YDIL 4Z7VA 4JG1H 2HKFL 2APFA 1JHLH 2Z92B 4NNYB 3P9LB 4LSPL 1WIUA 1RZIB 4P5MB 3IDXL 1ZA6A 2VXQH 2YPVH 3W9EA 3WSQL 2EZ0D 3UPRB 1WT5C 5EIQA 4HS8H 1DQLH 2UVEA 2BFVL 5HPMB 4CAGA 3GJFB 4JVUA 3PJSA 4QRSA 4MNHA 3ZHKA 4HPOL 3ULUE 3M8OL 4QRUA 5IK3A 3E6FB 3QEQB 2F53E 4IOSD 1A9EA 4X9HA 4WDIB 4JG0H 1BD2E 2JIXB 2DYPB 2HJFB 3TIDB 1HZHH 1NCCH 4L1HA 5CBEB 5HBBA 5DVOA 2BSED 4PFEA 1E4XL 1CFVL 3BO8B 2E7BA 3MRQA 3IDMA 4NUJB 5DR5L 4KKLD 1EHNA 4YHYC 1I1AB 1HEZB 3DX9B 1E0OB 4LDLB 3RX5A 1HINH 3T4AA 4OB5L 2VQ1A 4HX1B 1DQTA 1KB9K 3FQWA 3MRMB 3LKNA 5KSBB 1HWGB 3LS5L 1W72B 1FCGA 4JO3H 4AIXA 4QXGL 4U1HA 1I9IL 3QUKA 5F7NC 1B0RB 2V7NB 3AM8A 4CMHC 2ITDA 3IFPB 2XQYG 3IS1X 4PJ7E 3HS0B 1KJVA 3VD9A 3CVHA 3UXFA 4JFHD 1LK2A 3PV6B 3RGVD 4QXUL 1NCWH 2HRPH 3GJFK 1FAKT 2W0PA 4R97C 5EORL 2Q76B 2ZUUA 3MGTB 1WAAE 2EYRB 2HMIC 3Q0HA 2R0WL 2VISA 3R06B 3NACH 4TOYH 1RUKL 1FFPA 3L3DB 3QQNA 7FABL 3IKCB 5SV3A 5I18H 2L7JA 1N0XH 4U7MA 5K9JH 3O6KL 2FEDC 1EMTL 4JHZA 3ZL4H 4HUNB 4X7DC 3ZTJG 4PJEE 4HHAB 3FFCB 1FVCB 1PVHA 2VSDA 2Z35B 4BSWB 4JVPA 4OZIB 2MQ3A 4E0RB 4YDJB 3MCLH 3MLSL 4EN3A 5H94A 3VXTA 5AAWA 5EIIB 3O8XC 4I18C 3MREA 5FYLD 4NNXA 1M7IA 2Q6WB 4X8JB 3HUJB 5EPMA 1CL7I 3MFFA 1NBYA 2R23A 5TF1H 1TCRB 4CVXB 5KS9A 3FQTB 2DQTL 3TA3B 4GW1A 4KK8C 5DLMH 1KPRA 2V5RA 4WI4A 4PRHD 1CK0H 1CDGA 2YA2A 3AU1B 4L9LA 4M1DH 2YXFA 3OQ3B 3DLQR 3TFKC 1GOGA 2IAMD 3ZDYF 5HGDB 5JO5B 4JZNA 3NFSH 1WEJH 4NNPH 4FABL 5I71C 3WO4C 1D5BA 1OTTD 4YHML 1JNLH 2N7AA 3SBWA 2EE3A 2H9GA 4RA0C 2E7LA 1N59B 3ZKQD 4NUGL 1IEBA 1VGEL 2I26N 1MRDL 5KSAC 4NZJA 4KKCC 2IBZX 1U3HD 1A6ZB 1UXWA 4JRYD 1FYTA 4X6CB 4N8VG 2FB4H 2EDOA 2JJSC 3OHXA 2Z31A 1TVBA 4JREB 1F6LL 4E42B 1RJCA 1A1NA 4NRZB 3V2AR 3LZFL 4RFOH 5CWSB 1I4FB 3GO1H 4HAFA 4UTAL 3CMOL 2DOCA 1CGXA 4GQPH 3LKOA 5HI4D 3KDMB 3ALXA 2K1MA 4Y5XA 1FL5A 5E0QA 2R1XA 3P4LA 5J6GA 1CE1L 3QBTB 4ZFZB 2A6KB 5DEZA 5TE4H 5F3HA 5F9OH 1DLFH 2R1WB 4PJ5D 3W2DL 4KVNL 1TJHL 1QFUH 2AJ3B 4M1CC 5D7IE 5T1KD 2YD6A 1S7WA 1MCOH 3H3PH 4OCXL 3RVTC 2D03L 3NGBC 2X4OA 2Y6SD 4OF5A 4FXLA 3CU1A 1XF2A 4WWKB 43C9A 1S5HB 4HXAL 3WJLA 3U4EB 3H9SA 12E8L 4WEBH 3TJHD 1IGCL 1TJIL 5DRNB 4MQXD 1GGTA 2CXKA 3QNXA 1MHPL 5I1GL 1F4XH 3VW3L 3AB0B 3LEXA 1T66C 5ID1A 1NCDH 1VADA 4UNVA 2A9NH 4DQOH 5I1AB 4XNXH 2VR4A 3KYKL 3L3IB 3QUXC 3FB8B 2H32A 2NY6D 4XVUD 1RZ8A 4ZAKC 1KT2A 2J88H 3AC0A 5ID0A 1M6OB 3VGEA 1J86A 2GTWA 3UC0L 2BNRE 4BZ2L 5E8DH 4F33A 3KJ6L 2XWJB 5HHNA 4LCYB 3S35L 3BH9A 4XNUH 4RDQG 5GGVL 3FO9A 4CN4A 1UJ3A 4POZD 4IOFC 2WWMC 3L3HB 3MBEC 2BVPB 4QHUB 1BVKA 5EC1A 5IROA 2AEPL 3LN9A 3GMMB 3C6LD 3VWKD 3O3BB 1RZFH 4ZO6A 2F54B 2YKLH 2WP3O 3PWJA 5ESAB 1QSFE 4QRRD 1FDLH 1CQKA 3AREC 3VWKB 2EKSB 4ODWA 5DK0B 1FLRL 2PR4H 2VLKA 2Z8VC 4QRRB 1HILA 5CINH 4PJAA 3B2VL 2YSSA 5L2JB 5KTEL 3MJ9A 4FQCL 1JYNA 2AXFA 2OQJA 1LE9A 3CJJA 1J1OH 1DJSA 2VXSH 4U1GB 1V3MA 3PABB 4RMQA 3ES6B 1T0MA 4PGBA 2A0LC 1HK6A 4GS7B 4JKKA 1UWXK 4PGJA 1HIMH 2CDEA 3DMMB 4PJBF 3TVMC 3U4AA 4ZFGL 1DBJH 1YNLH 3OKEA 1A6WH 3U30B 4OLUH 2NY2D 4PJGB 1KG0A 4RSVA 1IGTA 1KJ2A 1XF3B 2Z8RA 2ZCLL 3FHQA 1ZLVK 4HAGA 1KB5H 2EZ0C 2ED8A 4MQ7A 4ONGL 5FO7B 4DKAA 1CF8L 1CDUA 2HVKA 3MJ7A 4DKFH 4LHJB 1J0JA 1AGBA 3E6HB 4Z5RB 5IQ9A 2WV3A 1GGUA 1U8NA 2DD8L 1R3HB 1CE6A 3PWNA 3JV0A 3BPLC 3EOBB 1CLZH 5I9QB 1NGPH 3QJFB 3KLHD 3VCLA 1MEXL 1J8HA 5EN2B 2ADGB 5L9DH 5FAAA 1A6VH 3ZZ1A 4APQA 5C0FA 4Z18A 4BSJA 3QDGA 4ONOA 1UEYA 2DTSA 2CGRL 2APXA 2R29L 5JOPD 4PRPD 3B5TA 3RHWK 4HUWB 5LKNA 3KR3L 4AT6A 3QXDB 2VDNL 2CKBA 4HF5H 5GGTH 3TGXA 1QQDB 2YZ8A 3K4DA 2WBJB 3ORJA 4MVBD 4NN6C 1KCLA 1QRNA 1EGJA 2P49B 3CVHL 2C1OB 5MP6L 1MCFA 4L29A 5CSZB 4HGKC 2W91A 4HFWB 1U92B 2R9HD 2WINA 4Y2OA 5CEZH 4ZQKA 5D7JA 4EI5B 1CXFA 3D69B 5C08E 2IF7A 4H8WL 1A3QA 5I75B 2GSGB 4HJJH 1A7OL 3ULUD 4QLRA 1KNOA 3UDWC 4N5UA 4BQ8A 3PWUA 4EQ3A 1O5DT 5T1LA 4TTGA 4G8EB 5I1EH 3CXDH 2BCKB 2AJXL 1YMME 2F53B 2C1PB 4RAUA 4U0RB 2BDNL 2P48B 3O2DL 1BD2B 2BNUB 4URTB 3WLWD 3KPRA 5L2KA 1A1OB 4P2OA 1T89A 2R2EB 2X4QA 5F7DB 1SJVA 2J8UF 1AQKH 2AXJA 3MBXL 3FRUB 4Y5YB 3MR9B 2CR3A 3K46A 3DIFB 4R7NB 5IB1A 5D2NA 3QIWD 4KXZH 1OP5K 3P4OB 2YK1L 4X6DA 3TN0A 4JHWH 4BQCA 4ERSH 4OF0A 3ARBD 3LPWA 1CU4L 1TITA 2LE9A 1FJ1A 4GBXB 5FO9B 1ZGLB 2DQFA 3DROB 3CSGA 4UDUB 1XGQA 3G6AA 2IAMC 4PJ7B 1ERNA 5D7LD 2BSRA 2VERN 3SY0A 3G5ZB 1OTTC 2CO7B 3O6FB 1RI8A 3FQXB 2PO6C 3L95B 1DL7L 3TBTA 1DFBL 1G1YA 3TPUB 2FIRT 3AS0A 3MRCB 1VEMA 2DLFL 4Q9QL 1KB9J 1IBGL 3F7QA 4K8RD 1U3HC 3BKYH 2B2XH 3NN8B 1IC7H 3DVGA 1TCMA 4LAJH 2AI0H 1DVFC 2ZPKL 3RVUD 5D1ZA 4UOW1 5E8NB 4PJEB 1KTKE 5FYJE 3QIUB 1GZQB 5C0DB 3ZE1F 1S3KL 4N8PA 2H2PD 5HI4C 3QXWA 3RZCB 4G7VH 5BS0D 1ITBB 3QQ3B 1H3PL 5FYKU 3WD5H 1I85C 1RD6A 4XCNB 5CJOL 3PQYE 4GFTB 3T0WA 1UT9A 1UM5H 4KPHL 4IMKC 4MJ5B 3C6SA 3RZWA 4ONFL 5D1XC 1CFQB 2B4CH 4WRLA 2FX9L 4O4YH 4M48L 5DWUH 1BF2A 1F11B 3PGCA 4GG6A 2Y6SC 2W60A 1MJJB 1UH3A 3RX8A 5BVJB 3HZMA 3L9RB 2G5BB 2APWA 3T8XB 1ES0B 1KN4L 1X4XA 3LKSB 3MLWL 3BH8A 5CHNA 3TJHC 5LJYH 4WV1B 2B20A 4JKMA 5GRJH 4JO2H 4WHCA 1CFNA 1IAIH 3BWUC 3HPJA 1MVUA 2R2BA 4LDOB 3G04A 1K3IA 4X4ME 1OT1A 4TUJA 4LPUA 4LF3B 3WE6A 3STLB 1IKNC 4M7ZB 2CO6B 5MEPA 1I7TA 2GJ6B 4B5EA 2VDOL 5ITFB 2NY6C 4XVUC 5LQBH 3I6GA 4J6RL 1DEDA 3B8SA 3BUYB 1P7HL 3ROLA 2VDRL 4JANB 4Y4FB 3RIFK 1BREA 4YBQD 5C09D 4LMQE 1D5ZB 4XP1L 4JFEE 2FL5B 4FQXA 1S8DA 3DXAD 1I9JH 3QNZA 4NPYA 2J3SA 3HG1B 5F88B 1RUAL 1CN4A 2DJSA 3CCHA 1WBZB 4LLDB 4POZC 5C7XH 2B8OT 1YEGH 3CDGB 3EGSB 2Z91B 4XBPA 5D7IB 5F7EL 5BV7L 1S7UB 4FQQA 1Z9MA 4QRTA 1LEKA 1JN6A 2XTLA 5DMKB 3C6LC 1JP5A 3JV6B 1QSEE 1R6VA 1GGIL 1S7XB 3T2QA 4LVOC 4P3CL 4KKAD 1NH6A 1F4AA 3L3OA 4M6AA 4OUOA 5ISZE 4NCC1 2PYED 1JNNL 3LD8B 4WO4C 3VXQB 3S35X 3P4NA 5E4EC 2M2DA 5SX4I 4JKPL 4KKNA 3UO1H 3NFPA 2NW2A 2Y06H 4X7FC 2OL3A 4ZS7H 5FYLH 4OF6A 3DYMA 5B22A 2N1KA 3MO1A 4GMSH 2X4UB 4FMFA 4XXCC 3VXOB 2V2TB 2BNRD 3CFCL 5CIPB 1T20B 3EOAB 3GSNA 4OM1H 5ANMA 2HLAA 2P47B 1C1EH 3RVWD 3TBSA 4KTEH 1INDL 2QR0A 5FUCE 3BDYH 3OKDB 4FXKB 4Q2ZB 3N85H 3EHBC 4MMXC 4WFGD 2F15A 4FHBD 3A6BH 2BNRB 1DBML 1XT5A 2J5LB 2W1NA 4S1SH 5GS0D 4HIJA 4F7TA 4N8VB 2CMRL 5IESL 4U6HA 4PP1D 4FFWD 5IMLA 2PUQT 3CK0L 1H0DA 5T5FH 3LH2L 4YXHL 5JORA 1IQDB 3MRBB 1ZVSB 1VKXA 1OAYH 1MHEA 2HWZH 4LLWB 2YN5A 1AE6L 1KJ2L 2NY0B 4UTBH 4MSWB 1QSFD 3S36H 5D8JL 4XAWL 3GRWA 2NY2C 2O5YL 8CGTA 1OY3B 4G42B 5D72H 4PV8B 1A9BB 1T7YA 4TRPL 5GGRY 2NY5L 2ZUWA 4KAQH 4MQSB 1CDJA 3IAGC 1YNKL 4PRIB 5IHLB 4LHUA 4NHCL 5E2JA 4YIQB 1JWUA 3V5KA 5BRZE 2FZ3B 4MZ2A 2WUBH 3S3SA 2VKXA 4Y2DD 4JY4B 4TYUA 4AENA 1G6RH 4L8CA 1G7LB 3HE6B 3L3JB 2AXGB 5FKAA 1JK8A 3ULSA 3KLAA 5D93B 4JZJB 4YE4L 4HZLB 4TVPD 1NLBH 3DNKA 4Y4HD 4JM2A 2Z8SA 3FT4B 5C9JA 4I0PB 3EYQD 3H2WA 2P8LA 1T22B 2NZ9D 1MAML 4FQHB 2CKBL 2QADC 3SCMB 3JTSA 1FO0L 5I1IH 3BP5A 1A8JH 1EFXD 1T83A 4PJHA 3B5HA 4D3CL 5IKCA 1CT8A 2CRIA 4Y4KB 5JR1L 3TNMB 5EWIH 3GHBL 4MVBC 4DVRL 4ZUVB 3RU8H 1MCKA 1LP9A 1NCNA 4J3UA 4RGNE 4G6FD 3D25A 4PJXE 2X89D 5CBAA 2R9HC 2VITB 1KJ3H 4UUJB 2CR6A 1GXEA 3VXNA 4IRZL 4RISL 4MXQD 3MRGA 3MRPB 5HXMA 4X7TA 2UYLB 4S1RH 5DT1H 1F4YL 4YHOH 5GHWH 1OWWA 2FR4B 3BUTA 3ZDYE 2UWEB 4JFZH 4ZTOH 2DLGA 3AS3A 2XPGA 4NT6A 4HZAA 3O2VH 1PZ5B 2VXVL 3QULB 3P4MB 5DEFB 3TIEB 3WLWC 2VAAB 4XC3L 1PYWA 4GG8B 4WU7A 3IF1B 5FCUH 4H26A 5GRZA 3OAYH 4Z7OF 5CKGA 1X4ZA 1NDMA 1J12A 4XP4L 1RIUH 2VXTL 4OLYH 5LGHH 2B39A 2BRRL 3TF7C 3DYOA 3QWOB 3MMEB 4LLYA 4JO4L 2P4AB 4QOKA 5IP4A 1D9KA 4L4TA 4NCC2 2HG5A 1NANI 4N0FA 2FBOJ 4ESKA 1LD9A 2ORBL 4JQIL 3JV5A 5K9OB 1KCSL 1RIHH 3PGFH 4XNMB 1LVEA 3KVQA 4HIHB 2D7TH 2ICEB 3DRTB 1YEKL 5C08B 3IRPX 2IFGA 1E4XI 4G8IB 3BN3B 4UIKH 3RWHB 3MV8A 4P23D 1YMMD 4OT1H 1SYSA 4NO0A 2V6HA 4Y16C 1LHZA 4K8RC 2X4SB 5D7KD 4J3XA 2ESVE 1BZ9B 1YMMB 3GSWA 2DDQH 1MI5D 3MA7A 3RVUC 1WZ1L 4L8DA 3HTLX 5EO1B 4I5BB 3HE7B 3GMOA 3OJDB 3FAXA 1WJ3A 5ESVB 3O41A 2XN9D 4P9HC 2N4IA 3U0WL 3SJVE 2D9CA 4AH2B 3MXWL 2YPKB 1Q9OB 1XZ0A 5I8OH 4LSRL 1YJDL 2NNAB 1WICA 4J3OC 4AK1A 4PBVC 4X99A 3SKJL 1HQRB 3D2UB 3RVXC 4I0CC 4D0CB 3LKPB 5LCVL 1IQWH 5M95B 3A67L 4Z76B 5A3IC 5A2JH 3NCJH 1VPOH 4OAWB 1MCDA 4OFYA 4Z8FH 1WK0A 5GISL 3IT8D 5DD1H 3QUYC 3VXPA 2CD0A 5IB4B 3EJYD 2VE6A 4R8WL 1RZKC 5GGRB 3QI9D 4XP6L 4PJFA 4LSVH 3VDAA 4JB9H 3JWOC 4NKIL 2NYYD 4GRWB 4KV5F 4R2GD 3WO4B 4C54A 4U3CA 2IANE 5CP3A 2AKRB 3F7YA 4HC1A 4CVZA 5SWZA 1BECA 3ARDB 4Q7DA 5FYJD 3TNNB 3NFNA 4GAJH 1XF4B 4PY8I 5KSAB 1A21A 4NOBA 1X5KA 3U9PH 1LO3L 5J13C 1XIWD 1UFUA 3CUPA 3VFTA 3T77B 5E1AB 1E4KC 1EZVY 4LCWA 4KGLA 5SWSE 1OB1B 2F8XC 5I6XB 2K7QA 1NLDL 1XGRB 3MZTA 2YA1A 3RQ3A 4DUWA 3QEGH 2OYPA 3PQYB 5HGAA 1D5XB 3QUZD 1HNGA 3LDBB 3N1MC 4MNGE 1TVHA 4G9DB 1GC1C 3ULUH 3IVKA 2P24A 4PLNC 4YHKL 7CGTA 5E6IC 3P11H 4QRQA 2X44D 5GGUA 4ELMF 1QR1B 1UKTA 2QLVB 2WUCH 3BVNA 3K8MA 4P4KA 2QBWA 2R2HB 4KY1H 3S5LA 3NGBB 3DVNA 4KKAC 5DUML 4LRNH 4GAYA 5C6PB 3DV4B 4PJBE 1A7RL 3X3GL 1CVSC 3MV9E 3WUWA 2OL3L 1YYLH 2Z93B 3BN9D 1JHKH 3LOWA 3N1QC 1EIBA 4TSBH 3HN3A 5FFLA 2YS4A 5IW1B 4N0RA 3UJJL 5IBLD 1I3RB 3RVWC 4X4YB 3NPSC 4CDHA 25C8H 1MWAH 2H26B 4NCDA 4LPYA 2VLRA 4K3GA 3FCTB 4UAOB 4JFEB 4L8SA 5GS0C 1K9TA 5HI3C 4I3SH 1OW0A 3RIAF 4LCUA 4MAYB 4AZ8A 4KDWA 4PRAB 4WI3A 1X7QA 4PLOB 1Q94B 1ZWIB 3OB8A 4I2XA 4CJ1A 5E8EA 5I1CH 1QSZA 5J89A 1TVDA 3FONA 3LQZB 1QSED 3FT3A 5DS8B 1WISA 1LO4L 2I5YH 3KPPB 3WFHB 5J6HB 2VDKH 2HTKC 4JFDB 1VFUA 3Q6FB 5EZIH 1JI1A 4S1DD 4OZGA 2VL5A 4K8RH 3B3IA 1QSEB 1DN2A 5D5MF 2ZNXA 4IJ3C 2XG4A 3GSQA 5I16B 4MJIA 3WO3B 5KVDL 1WTGT 4WUUE 5JW5A 3MV11 4GRMA 5ISZB 4KTYA 4NQVB 5GSVB 2A74A 2ARJB 4D8PB 1FIEA 4Q6YA 3MXVH 4LFHD 2ICWB 4P9HH 1JWMA 3GSUB 4N0CD 1HHIA 3K4ZA 3TM6A 4RIRB 1U8LB 4X4XA 1C5BL 1FFNA 4X80H 3HAEA 5ADPH 2NY7H 3AAZB 4RGMC 5ADOL 1TQCC 5TGBA 4H20H 5MEQB 4Y4HC 4GW4A 3VI4E 3EYQC 3WEXB 3IDIA 1SJHB 4YDVB 5AAMA 2JLLA 2NZ9C 5HYSA 2EDJA 2D9QB 1P1ZB 3V4PL 5ALCL 3ME0A 4YFDB 1OLZA 3GUTB 4WHYH 4WTWA 1RZKH 2ITCA 5C0AA 1EFQA 2X5PA 2WWKO 5DZLA 3OMZA 5C6TH 2IGFH 4HIXL 5TDNA 4IRSD 2VJXA 3TVMB 3T2OA 1UM4L 4C56E 5I8CA 2EE6A 3NCEB 1S7TA 1CFTA 1FZMB 1NCAH 3NCYS 4NQSA 5FUOL 4L8BA 1I7ZA 4TTDD 3RUGF 5DVKA 5BRZD 3H6JA 2OBGA 3TZVD 2V2WB 3KG5A 4YZFF 1YNTB 3BX7C 4WTZG 4CKVX 4JFFE 1B90A 1DSFL 4GMTH 1RV6X 2YOCA 4JG1L 5DHVB 3VJ6B 2OSLA 1KUMA 3ARZA 4LVNB 4ZNEA 1JHLL 1HNFA 5DK2A 3UTTD 5HD8C 3BPCB 5HVHB 5DK3A 4OFPA 5FDWB 2VXQL 1M05A 1OT2A 2YPVL 3RDTD 4D2NA 3F8UB 4IMLA 3RA7L 2VKWA 1GC1H 4F7MA 1DEEA 4NJ9H 5DJXB 4RMRA 4HS8L 1DQLL 4O2EB 2H3NA 4OQTH 1ZLWH 3KXFE 1RU9H 2JJSA 4MXVF 5IM7B 5D6CA 1CDHA 4LBEB 4NQDE 3C2AH 3CFJB 3BZEB 1KF9B 3MJ6A 1TPXB 5KVMC 1EEUA 1G9MC 2PXYA 2DWDB 2PTUA 3A6CH 4QGTA 5DRZB 4JG0L 1JPSL 4G43B 3RY5A 1L0XA 1DP0A 1HZHL 2V5MA 4PJ8A 4RGNB 1NCCL 2AEQH 4DUVA 2QJDA 4ETYA 4TULH 4KUCD 2FJGB 4PJXB 3VFRB 3F65A 1WC7A 1VFOA 2QHRH 3IKKA 2XT1B 4W6XB 5KN5A 1N5AA 1G0XA 2D2OA 1JE6A 1HINL 4R6UA 4P23C 2A9MH 3E3QE 5C0IB 3U83A 4EJ1C 3UBXA 4JO3L 3WFCH 4U1IB 5EU7E 3D39A 4M3KB 4PR5A 5GS0H 5J11C 1OL0A 5D70H 3V0VA 1MCSA 4KI1A 4HUUA 2BJMH 5A2FA 1ZHBB 4PJDE 4KMTH 2KQNA 2D31B 4HQQH 1FIGH 4QRPA 2DLEA 3FO1B 3VMNA 5JUEH 4PJCA 2IH1B 2XXCB 1G7MA 1F8TH 1NCWL 2M8XA 2HRPL 3PL6D 4FTVB 3RAJH 3QUXA 4HUVB 4FRWA 1BX2B 4OKVA 3NACL 4FMKA 4TOYL 4ZAKA 4AL8H 2I07B 3RY6A 1VFBA 1ZHLA 2YHGA 5I18L 5K9JL 3ZL4L 1J5OH 1S78C 4YQXH 4O02H 4L3EA 3CGTA 5EBWB 1NC2A 2QSTA 4JDTL 1CR9L 2XICA 5MENE 3HR5A 4NWUH 4XB7A 3MCLL 4HMEA 1CD1A 2HJKA 3FN3A 1AKJD 4N90E 3IB4A 1K2DB 3Q3GA 3EJYC 4RNRA 4UQ2B 3ARVA 5C0BA 4L5FH 5LXGH 2NMSA 5TF1L 2ESVD 4HFUH 3FQRB 4TVPH 3D5OF 4R2GC 2P8MA 3FKUS 5DLML 1T1XA 3KPOA 2CRYA 1OGAA 2V17L 3SDAA 4S0TD 4MCYB 4F9LA 5E00A 3FO0H 2CDGB 1CK0L 3C5ZB 3FQUB 4GRLB 4M1DL 2YWYA 1AD9B 2DI8A 4WFEE 4X6BB 5BQ7A 1P4LB 1K4DB 5F7HA 3NFSL 1AO7A 4CU6A 1MPAH 1JNLL 1XIWC 4OCLC 4O2CB 3HNTH 3SE4A 4UMGA 4PPTA 3SJVB 3BIBX 1I8IA 2E5EA 1F3DH 1YZZA 4QHLA 3DURB 5BOPA 1I75A 4YHNB 5DTFB 4CUCA 1JZ6A 5JPMA 5C70A 2FB4L 4P2QE 4ZSOE 1N2RB 5LVEA 1RJLA 2MTPA 5HSFA 4YH6A 1J0IA 4RFOL 5DXWA 1YEDA 3BFOA 3GO1L 1OCWH 4MWFB 3TCXA 1OAUH 3HPLA 2JJTA 2PTTB 4MS8D 2L0DA 5D1XB 2IH3B 4F3FB 4HIEB 4HUMB 4P2RD 4RMTA 1RZIA 1H15A 1VERA 3L3KA 1XGPB 1PKQA 2CLRB 5TE4L 3TPKA 4JDVB 2F5AH 4WWID 3TH4T 4DK3A 2YXMA 2D7PA 2E6JA 5F9OL 3UTOA 3IDUA 5FM4A 1Z5LA 3MRNA 1YY8A 4DZBA 4XWGH 1L7TH 2XIDA 1AY1H 2IANB 4O9HH 4LSQH 3VE0A 1QFUL 3WNMA 5IVXF 4PB9H 5E8PB 1MCOL 3BN9C 4OUUA 3H3PL 4Z7QE 3LV3B 1R5IA 2A6DB 5SWSD 1G9MH 2MHAA 4LKXB 1D6EB 2JIXA 4WEBL 2VLLA 5EBMB 3TIDA 3P3YA 4R0LC 2ICCA 3S96B 1S9XA 5SWSB 3EYVB 5EOCH 1FNHA 4TNWK 3OJ2C 3WXVH 1BJ1H 4AIOA 3QP3A 3UROR 1YEHH 1NCDL 3BPOB 2A9NL 4DQOL 4YR6B 1A7BA 3MLVH 3RWJA 1HEZA 3DX9A 4FP8H 4XNXL 3AVEA 4LRIC 3KPMB 3N1GC 4OCNC 4PJIA 4HX1A 5L6YH 1PAMA 2XY1A 1WCBA 3ZKMD 1MLBB 3QIBC 4KK5D 4MD0A 2IQAB 1PJ9A 3QAZC 1EEQA 1QLEH 2V7NA 1FYHB 2BNQE 1L0QA 5E8DL 3IFPA 3UJTH 1MHCB 4PGCB 5BZWA 3BGMB 4Z7UF 3W81A 3LCYA 4XNUL 1RK1B 4PJBB 2FHCA 3PV6A 3EW3B 3V6OE 4KJYA 3BP6B 1ZLUK 3MV9B 2Q76A 1WFUA 4E41E 2EYRA 4N0CC 3R06A 3TWCH 4OCYH 2I27N 3RGVA 1FCCA 3IKCA 2XWTB 1RZFL 3UDWA 1BFOA 2RAMA 2YKLL 1HYSC 1I1FA 4M5ZH 5FXCH 3AXLA 5HVWA 3HC3H 1CD0A 3MV7E 4HHAA 1FVCA 4GKSB 4BSWA 2Z35A 3O4LB 1AGFA 5F7KC 4OZIA 4E0RA 2DJUA 2CUIA 4F7PB 5DD5H 2CIIB 2PR4L 2W65B 4HS3B 1KPVB 4YUEH 5FGBC 4HKXB 2NTSP 3TV3H 3HNSH 5CINL 5AG8A 2Q6WA 1PD6A 4X8JA 4MLIA 4WHTB 1XR9B 1GAFH 1MJ7H 4R4BB 4CVXA 3FQTA 2XZAH 4IRSC 2VZ3A 2VXSL 3KYNB 3OAYK 4HJ0D 4WUUD 2ATPB 2FJFB 4Z7OE 1IGMH 1YN6B 2ZSVB 3AU1A 1NMBH 2KBGA 3RTQD 1RULL 3CFDA 5JO5A 2I60H 3TZVC 2GKIA 1XCQA 3GMQA 4DWHA 3GBNH 2Q8BH 1HIML 4NKDA 2OTWB 4F9PC 3L5IA 1DBJL 2FO4A 3FN0H 4MJ6B 1JWSA 1A6WL 2PKDA 4OLUL 5CLTA 3QEHB 3QDMD 5KOVC 5I8EB 2FWOA 3K80A 2JB5H 1Q0XL 4ZDHB 3RDTC 1OAXH 4H1LH 1KB5L 1E4JA 4E42A 3VRIA 5CWSA 4NC1C 4JRYA 4DN4H 5FB8A 5IUSA 1BFVH 4XPGH 1D5IH 2NX5E 4DKFL 1ZE3C 4KH2A 3LPGA 3ABZA 3U36A 4BYHA 4GSDH 1NQBA 2QADB 3MODH 5BVPH 3E0GA 2H1PL 2PCPB 2R1WA 2V7HB 3S37H 2BX5A 4Z7VF 2AJ3A 4LOUD 5L9DL 1CLOH 2J8UB 4QF1A 4J12A 4C56B 1A6VL 5DJ6B 3SKMA 3NZHH 4PJ5A 5IFAL 2RCSH 3TBWB 1H5BC 1UA6H 4X5XB 5T1KA 1OP3H 1S5HA 5L7XH 3U4EA 3MROA 5ETUA 3VFOB 3OKLB 1JZ3A 5DRNA 1QEWB 4HF5L 4W4OC 5GZND 4BZYA 5GGTL 5C0ND 4JFFB 3FZUD 1DN0B 2X4RA 3RGHA 3ARRA 5GS1C 4RQQA 5LAXB 3T0AA 1H8NA 5A40E 1OAZH 1RJZB 2R69H 4NYLB 2HN7B 4D0BA 4XNQB 5C3LD 5DSCB 3U9UB 1TZIB 3KXFD 5B38A 5I1AA 3L3IA 4D94A 1MF2H 5EUOF 5CEZL 3KPQA 3NVQA 1LO2H 1B0GB 4WEUD 4HJJL 5E2TH 4KV5E 1M6OA 1QO3A 1JHTB 1X5XA 3PNWB 4OJFH 3PL6C 3KXFB 5MI0C 1F90H 3D9AH 3K81A 1IAKB 1S7RA 2WW8A 4J8RB 3VXRD 4NQDB 2X4TA 3O3EA 4TSAH 5I1EL 3CXDL 2SEBA 3MGOB 1MCLA 2DB8A 3GBLA 3ZT5A 2VDLH 2OZ4H 5F89B 5CEYB 5E94B 1OD9A 4EN3D 5A2LH 3L3HA 5HHQA 5AD0B 4N0YH 1KIPB 2W0LA 4NDMB 2DKSA 1AQKL 2B1HH 1WBYA 4CU8A 3DX7B 5TE6L 4CVWA 3T4YB 4M43H 1BPVA 5E08H 4M7JH 4JHWL 3GK8H 4ERSL 1JRHH 1T0NB 1MELA 3VWKA 4KQ3H 3BEVB 4GW5B 2EKSA 2E7CA 1K6QH 2VQUA 4K71C 1IGFH 4QRRA 1FL3A 3OB0H 3CDCA 5IHZB 1S7VA 2X1WL 5DZNA 2X6MA 1T3FB 3LRSB 2PW1B 1QLFB 4Y16B 1MQ8A 5L2JA 2CQVA 3V8OA 3FO2A 3DUUB 1G0YR 3ES6A 4CMMB 3OXSA 3TBYB 4JPWH 3WL9A 4YJZL 2HAZA 2YR3A 2L4OA 3BKYL 5MEND 1UH2A 3MRKA 4WFHD 5CZKA 5KBNC 2AI0L 4V2BA 3D3VB 4MNQE 3CX5K 2AQ3A 4N90D 4HEPG 1NGYB 2DN7A 3T0EC 3R1GH 1WTLA 2AK1H 4RMUA 4GOSA 1CCZA 1U95B 4Z77B 4P57B 4NP4L 5IMMB 1QRKA 3TYFA 3CFIC 2C5DC 3WCYA 4G7VL 4KROD 3B8YA 1HCVA 3CD4A 2FH8A 3WD5L 5GS3A 2R8SH 1XF3A 2DIBA 3NIFF 4ODSL 3JVGC 1J0KA 1DQMH 3QUYB 4WW1B 2AEIT 1HH9B 4IOIB 4WFED 2J7LA 3IXAB 5EOTB 4RX4D 1P7QB 2ZSWB 1FL6B 4O4YL 1OAQH 2A38A 5DWUL 1WFOA 2NY3C 4DAGH 4OZFH 4Z5RA 2E8YA 3NAAL 5D5ME 2J6EA 1R3HA 4M6MH 3QWRD 4NJAH 1Y18B 5JXEC 3T3ME 1JI2A 3NA9H 3O4OB 3PP3K 4XPTH 3IGAB 3C60D 5EN2A 5GRJL 1TTGA 4JO2L 4P2QD 1KELH 1IAIL 2WBKA 3VXME 4HK3N 5J13B 3IJHB 3F6IA 1AGCA 3HR6A 1EAPB 2ZUQB 1BHGA 4HUWA 4NSKA 4XPBH 4BK5A 4OFIA 5JHDE 4P2QB 1FZKB 3DUSB 3QXDA 5DJZA 5ITBH 2VTFA 1T1WB 3NCYP 4ENED 3U46B 1QQDA 4U6XB 4CADA 1FLTX 1OSZA 3MCKB 2WBJA 4A6YH 5JHLH 1CBVH 4I13B 3ZKMC 4JRXE 2XG5A 2C1OA 4YDKH 5C0EA 5E6IB 5CSZA 3FAWA 1YA5A 4MD4B 3T09A 2D7QA 1U92A 1I9JL 5F7FA 4LASH 2BRQA 3VD4A 4OGYH 4JPKH 4U1LB 4RMSA 4U1SB 2GSGA 1I7RB 3GMPB 2X1XR 5C7XL 1YEGL 4XH2A 3DYPA 3KPLA 4JAMA 2HFTA 5INDB 2BY0A 4G8EA 4Z7NF 1J0ZA 3THMH 1L7IH 3HMXA 1KCVL 5I17B 3FL7A 2F53A 3DHJA 2B0SH 5C2UB 5K9KB 5J3HC 3AFLA 3WIIH 4YZFE 2H2SD 1Q0YH 3GMNB 4OZ4A 1A1OA 4PG9A 2ADJB 2KQMA 3IJYB 3MNVB 5DHYB 4HSQA 1DUYB 4P3DB 3FRUA 3UO1L 3I50H 1EO5A 4OF8A 3FMGH 4GUPB 2Y06L 2W0FA 4ZS7L 2GFBB 5FYLL 4KVCH 1FAIH 4Z0XB 4GMSL 1RQ5A 1TJGH 4S1QH 3SDDC 5GRUH 2BNQD 2BVQA 1X5HA 4OM1L 5FO9A 1C1EL 1ZLWK 2J4WH 3EYOB 3PHOA 4KI5D 4HJ0C 3QIWA 5IVOA 3S3JA 3LKQA 4PBWD 4MXVE 5IR1B 3PWPE 3ARBA 3N85L 1I7UB 1UENA 1VGKB 3DROA 3MA9H 5EO9B 4S1SL 5F1SA 1CZ8L 3A6BL 4UDUA 2FX7H 3MYZA 5CKAA 1MWAA 4PJ7A 4ZFFB 3RTQC 4NZRH 4TUKH 5D1QD 5DQJA 4NN5B 3RVVD 4EXPX 3FQXA 3L95A 5L8LB 4E41B 2HWZL 3TPUA 3REVA 3MRCA 4R4ND 4UTBL 1PW3A 3MV7D 4PJAF 3VXSD 2VNCA 4QHNB 5HY9B 1MIEH 1J18A 3NN8A 4HBCH 3TO2A 2GK2A 2MJWA 4X7CC 5D72L 1IM3B 4KUZH 4F7CA 4PJEA 3MV7B 4ZUSA 4KAQL 3REWB 3QIUA 1GZQA 1K8IB 4DGYH 4I0KA 3MYJB 2YPLE 3PIQB 3RPIB 5EA0L 5FGCB 5IGXL 3I6LE 2WUBL 1P2CB 1YDPB 2O26U 2VXUH 3QQ3A 3PF2A 3HI1B 4XCNA 1F2QA 1G7JA 1G6RL 4D9LH 4RFEB 1X44A 2BSSB 3BP7B 4MJ5A 3S97C 4X9GA 3QDGD 4Z95H 1VEPA 1SBBA 2ID5A 4LOUC 3KYOA 3FHAA 1NLBL 4IRJB 4KDTA 3SGJA 1JV5B 1CFQA 3B43A 3GEWB 5I1LB 1JGEB 3V4VH 4FFVC 4G9FB 3VI3F 4O2FB 2P8PB 1L6XA 1RK0B 1MJJA 3AY4C 5I1IL 2G5BA 1QFWM 3T8XA 4YK4C 4PRDB 3BRGC 3LKSA 3LPFA 1UACH 1WVZA 3NPZB 4Y89A 4BQBA 5EWIL 2XRAH 3IFLH 4JY5H 1FNEB 2PN5A 1P4BL 3RU8L 5MEOB 4BK4A 5DRXB 1RVFH 4LF3A 4IIQC 4JFPA 2FD6H 2ZUXA 4RZCA 2HT3D 2R39A 1NAMH 4QXTB 1KLGB 1P84J 2NX5D 1U8HB 5CGYD 1HOCB 4M5YH 5DMIH 5FO8B 5IFJA 4PGZA 2XWBB 4S1RL 4U4BA 1D5ZA 5DT1L 2VR9A 2OMNA 1IEAB 2FL5A 5KOMC 1HH6A 1NMCC 4YHOL 1AXTH 5GHWL 5L2KD 3I3BA 4JFZL 4ZTOL 5F88A 2X9XA 3V4UH 3SGEH 5FF6A 5DRWA 3S8WA 3O2VL 4EN3C 3BP4B 3BEWB 4DW2H 3CNKA 3EGSA 5IV2B 5D7IA 3LHPH 5HHOD 2CH8A 3SGDH 32C2A 5EZJB 5FCUL 2HFEB 3F12B 2B5IC 5ICYB 1SJEB 3B9DA 5HGBB 1RIUL 1XCTB 4OLYL 5LGHL 4PS4H 4CN1A 5LGJA 4ZXBD 1KGCD 2XYCA 4L9LC 3WYRA 4Q0XH 4ZG1A 1KTDA 2YD9A 2FGWH 2V9TA 4LPXA 2DQCH 5I76B 4LKCB 4I77H 3SBWC 2HFFA 2E7LC 1RIHL 4HCRH 1EA9C 2D7TL 2APTA 3VXOA 2V2TA 1T20A 3EOAA 4KC3B 1RMFL 3DOSA 1A64A 2ZOKB 3HI6H 3OKDA 4OT1L 3P77B 3FB7B 1MREH 4JFQB 3QFJB 2BNRA 2Z31C 1T04B 3AROA 5B8CB 3S34H 5D1ZD 4N8VA 2EIZA 4E5XA 4X6DF 2DDQL 3JV4A 4I4WA 4V2CB 4KRLB 2BHZA 3MRBA 4G5ZH 1UB5B 4Y5XC 4LLWA 5D2LE 3VD7A 1R5VB 3BZ4B 5JW3H 4KJPC 4MSWA 3VFVB 3V95A 1FVDB 3HNVH 3HB3D 2IJ0C 5I8OL 1QA9A 2VN7A 4XAKD 1CFSB 5E5MA 4YHLH 1QSFA 1ZK9A 2AERT 1H3TA 1Q1JH 3W0WB 3DGGA 5L0QC 4LNRA 1HHJB 1IQWL 2ILLA 3RWIB 3BRFA 4ELMB 2DWEA 2FZ3A 3WJLC 3NCJL 1ZVHA 1LO0H 4Z8FL 5CEXB 2IALA 4LVHC 5DD1L 3WS6A 4DOHE 2OJEB 4JY6A 3HE6A 3LQMA 4Z7UE 2AXGA 2XQBH 5ERWB 4U3XA 4XBGB 4JB9L 4Y2DA 3HMWH 2IPKA 3FT4A 5CJ8A 4MNQD 2ZCHH 1R5WA 1BQHG 1RZJC 4NQCE 4NRYB 5F93C 3B9AA 4M6OH 4FQHA 4UT6L 4I3GA 1CG9A 4AMKH 4GAJL 4YGAB 5C0CE 3F7VB 3PP4L 2FSEB 4GKOA 1JGLH 4ENEC 1AXSB 4UBDD 5H37H 4G3YH 4JGJA 2VO5A 3SDCD 4Y4KA 4LCCB 4ZPVB 3TNMA 3U9PL 4ZUVA 1X9QA 1ORQB 2YUXA 2FECL 3P73B 4GG6F 3QWQB 2VLJD 3SDCB 1UJ3C 1LMKA 3QEGL 3KS0H 4UUJA 2HH0H 2YA0A 9CGTA 3JTTB 5IB5A 5IROC 5E99L 3ULUL 2UYLA 1UWGH 5BV7C 3TH2T 3P11L 2DL9A 2M1KA 2EXYD 2EC8A 2X4PB 1I9RH 5D5MB 3VXMD 4KY1L 3UYPA 4ZPTA 5FDYA 3BZFB 1AC6A 3P4MA 3QCUH 3TIEA 4X7EC 4LRNL 2P5WB 2VAAA 2Q7YB 4KFZC 5JHDD 3IF1A 5MHSE 3NTCL 4XPHH 3EDEA 2JK5B 4KRMB 1JHKL 1SEBA 4TSBL 2Q3ZA 5JHDB 4V1DE 4F8QA 3IXTB 2C7UA 4YFLI 5JPNB 3QWOA 1S7SB 3MMEA 4FG6D 3QDJE 1WCQA 1MFAH 3TCLA 1KPUB 5J0BA 5F9WC 4KI5C 4OD1L 5DUBA 4JRXB 1C5DB 4Q74A 5J1SC 5D4QA 1FZJB 5HHXH 3RPKA 6CGTA 3C5JA 4I3SL 3QIBB 4YHIA 3ZE2F 3VG0H 1J05A 1OARH 4M03A 4XNMA 4HIHA 2ICEA 1EBAA 2FHFA 3DRTA 3CXHK 3RVVC 3WHE1 5B3JE 1WV7T 4G8IA 1J9CT 1N8ZB 5I1CL 5DMYA 3DBXA 1EJ6A 4TSCL 5BOZG 3KJ4B 1ZT1B 4R4NC 2I5YL 2VLMD 1SHMA 5EZIL 3HRPA 4P23A 1BZ9A 4K8RL 1YMMA 4YX2H 2H45A 3RUGB 1OP3K 3TT1H 5CCKH 1ZHKA 3FTGA 4LHUD 4Y8AA 3WLBB 4QTHB 1U58B 1CI5A 5ICZA 3HE7A 4XMLH 3CZFA 4EUPH 3OJDA 3FQNB 3OKYA 4LVEA 2RR3A 3D48R 3MXVL 3UZQA 4P9HL 5HTSA 3QUMB 4AH2A 1OF2B 2YPKA 3VWJD 2AAVA 2FH6A 3VRLF 2HT4D 3QG6B 4HLZH 3X11B 3ZYZA 1BQSA 2O5XH 1BLNA 4X80L 3PWPD 5ADPL 5EUOE 3S36X 4APQC 3D2UA 4XCEA 4U31A 3V6ZB 4H20L 1KIRB 5E2VH 5AZEH 4FFZH 5A43C 4O58H 4Z76A 1Q9KA 1E6JH 4HWBH 1UWEH 4J3TA 4OAWA 4ZUTA 3GSRB 4ZFOB 1O7VA 2IPUK 3SE8L 3V0AC 5IB4A 4BQ9A 1ZGLM 1RZKL 1MAJA 5BCAA 3T04D 3JWOL 5DGRA 2P7TA 4HWEH 5C6TL 2IGFL 3QFDB 4AEHL 2AKRA 1RZJH 3QI9A 4JFOB 3TNNA 5D7JC 1HSBB 1NCAL 1XF4A 2YPLD 4GH7B 2HT3C 2NY1D 3RWDA 3I6LD 3O9WB 1K8DB 5CGYC 3U6RB 3HC0B 4JM2F 1D5MA 1ADQA 4KK9D 3CFEB 4GMTL 2Z4QB 1OB1A 1UGNA 5JQHC 1FVEA 5KG9B 3SQOH 2HJLB 2NLJB 3Q1SH 3V6FA 1XIWA 3K8KA 3PQYA 3U4BH 4Y1AB 3VGAC 4PJHF 4ACPA 4G6AC 4P2OC 1D5XA 1FE8L 1T89C 2NXYB 4G9DA 2X41A 3PXHA 4OSUH 2W9DH 2AV7B 2ERJC 3X13A 4UIMB 1GC1L 5LBSH 4NJ9L 3UYOD 4ODVH 4N9GB 4OQTL 3QUZA 1QR1A 5D2NC 2FIKB 4H1LA 4ODBD 4IHOB 3C2AL 1EJOH 5LWYH 4QOKD 4H88H 2R2HA 4L4TD 1NGQH 3A6CL 1H5BB 4LIQH 4ZXBC 3ZE0F 3DV4A 2OR9H 5JOFB 1YMHB 2BOCA 5T3ZD 3G5VB 5KANI 3H0TB 4ODXA 1V7MH 5DJDB 4X4MA 4RAVA 4UQ3B 2AEQL 3MJ9H 1JNHA 3P9WB 3UTSD 2EIDA 3NIFE 1A4KA 1DQDH 3I3EA 4XHJD 2QHRL 2VWEE 1I3RA 1EXUA 5EO0A 4U7KA 1AQDA 1A6TA 2H26A 1A6AB 1AP2B 2A9ML 5J12C 2E6PA 3FCTA 4P5TB 3WFCL 1P5UA 5D1ZC 1U8KB 5MI0B 5GS0L 2HA1A 3OSKA 3SO3B 1KEGH 3ALWA 2ED7A 5D70L 1NC4B 4TNVK 1DR9A 4OKDA 4R0LA 4PRAA 4TVSa 4NZTH 3VXUE 2BJML 1QG3A 2Y1VA 2G75B 1Q94A 3ISWA 5EOQH 3TT3H 3TEUA 3BYTA 1NMAH 4HQQL 1FIGL 1ACZA 4OI8A 5JUEL 5GIRB 1N6QH 3LQZA 4G8GB 5FYJU 4M62L 1MFEH 4P2YA 1F8TL 1YQVH 3KPPA 4LEOB 4DKDC 3LMJH 2AQ2A 3Q6FA 4JPVH 4LRIA 4UB0H 3RAJL 3HB3C 2FATH 3NABH 4S2SB 2D0HA 3MNWB 1MY5A 1QSEA 4AL8L 4LMQI 4PUBH 1YJDC 3ZSTA 3T1FB 5I16A 1NBZA 3RWEB 3SEPA 1DBKL 2CLZB 5K59F 4ORGB 4OBSA 3CC5A 1J5OL 2HFGL 4YQXL 4O02L 5B3NA 5ISZA 4LGRB 5AUMB 3QXAB 5GSVA