4LCUB

Structure of kcsa with e118a mutation
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
212
structure length
212
Chain Sequence
b'DILLTQSPAILSVSPGERVSFSCRASQSIGTDIHWYQQRTNGSPRLLIKYASESISGIPSRFSGSGSGTDFTLSINSVESEDIANYYCQQSNRWPFTFGSGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab light chain
molecule tags Transport protein, membrane protein
source organism Mus musculus
publication title Molecular interactions involved in proton-dependent gating in KcsA potassium channels.
pubmed doi rcsb
total genus 50
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 2013-06-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4lcuB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4lcuB01
1AD0B 3F6LA 3CMOL 5EU4A 4LNRB 4JN1L 2BVPA 2HRPH 5E56A 2FJHB 3U6RB 1QZ1A 4EBQL 2ZOLA 5LGHH 4Q6IC 2H9GA 3VJ6A 5T1LA 5I1LA 4I13B 4OM0L 5IMOB 3W9DA 1I9EA 1RV6X 3WSQH 3WL9A 1AI1H 2A77L 4NHUB 2C3VA 1F2QA 1U41A 2VAAA 2EE3A 5DQJA 1AKJD 1HOCA 5FGSA 1FQ9C 5JO5B 5J1AA 1RZJL 2XTJE 3JV4B 2CGRH 5J11B 4U1IB 2WLZA 3VXPB 1FORH 5D2LB 4OTXH 1MELA 4Z95L 3BH9B 5ACLA 3ULUH 4DTGL 3QDJA 3V79C 2N1KA 3HR5B 3LY6A 1DBAL 3NIFF 1U8HA 3DO3A 5T5FH 5I8CB 2BOCA 2HFGH 1TPXC 2FJGA 4FG6C 4XVUD 3JUYA 4LSVH 3L3IA 3NN8A 2O61B 4GRWF 1UJTA 3G5ZB 2D9CA 3MRBB 3M17A 4YFLI 4B41A 3GMNA 5E8NB 1LO2H 4BSJA 4G9FD 3FTGA 5D2NC 5HI4D 1RZKH 3BZ4A 4Q0XL 4JO2L 1S3KH 5C07A 1OLZA 3G5YB 1IEBB 4XBEL 5E1HB 3Q3GB 1ZVYA 3OV6A 1T1XB 3CC5A 4P2RE 4KC3B 1T22B 4L8SB 1LP9B 1FZMB 5JDSA 4AL8L 5IEHB 3RL2B 1IC5H 3V0WL 3C5ZC 5T33H 4PLNC 1IARB 5FYJE 2COQA 2BNUB 1N0XL 4I3SL 3OXRA 4PTTA 2DQFA 4M3KB 3FT2A 3WNNA 3BW9B 5JORB 3MCKB 4WFFE 3E2HC 2BNQE 3DIFB 5GS1A 3EYVA 4O51B 1ZHBB 1MFAH 3ZYOA 3O3DA 5DRNA 4OZIA 4HJGB 3LKOA 2R2EB 3RY6A 2RIKA 5C0JA 3V4PH 1B90A 1D6EB 4OT1H 3JWOL 4R4BB 4XP1H 1R3IH 2NX5A 3QAZB 4F33A 1KPUB 3O2DL 1PSKH 4OZGE 4YDIH 2FX7H 4MJ6A 1RZFH 4FQQB 1FZJB 4KGLA 1R3HB 1YJDC 1ZOXA 2RFXB 3WFBH 4NRYA 4YBHA 1CXLA 1FLRH 3CDGB 3T3PF 1P84J 3TM6A 1J05B 3RU8H 1OPGL 4LAJH 1KLUA 3SE8H 3BGAA 2OQJB 1FZOA 3MRMB 2EIDA 4NPYB 1MHEB 3TBVA 3KPLA 4N5ED 5CJBA 1FO0A 5DSCB 1ZS8A 1VA9A 3I50H 1R3LA 3S35L 4HWZA 2XI9A 3QFDB 3NCFB 3B8YA 3MUZ1 2V7NB 4YWGL 2GK0A 5I71C 4IRZL 2A6KB 1MPAL 2D3VA 1BX2A 4PJEB 4XAKE 5TDOA 4ZTOL 2P8LA 4MA3A 3T2NH 1R3KA 1IAKA 3MA9H 4OZHF 2HVJA 3QDJE 3QUXD 1UCTA 4GJTB 4YJZL 5A2KH 4PJBB 5E9DA 4I2XA 1D3CA 3X12A 4PLJC 4OLWH 3IYLW 3IVKB 1YJDH 4ZQKB 2Z31A 5FO8B 5TE6L 4LSUL 5EOCH 2AJVH 3A0OA 3T4YB 3G9AB 2VLJB 1R5VA 4XMPH 3SE9H 5EULV 5BVPL 4F15B 2DI7A 4QOKE 3QUMB 2YKLH 4FMFA 5CIPB 2XACC 3BD5A 3HTLX 1MY7A 3PXJA 2GT9A 2WP3T 3VWJB 5SWSD 4MGXA 4YDLB 3WYRA 3KPNA 4GW1B 5GS0D 2FZ3A 4YXHL 3MGAA 5FM4A 3GIVA 4PJFB 4HJ0C 4Y4HA 3VFRA 1VB9A 2P8LB 2P44B 3BPCB 3OPZH 1RUQL 1KEGL 2E7HA 2ADJA 4OLXL 4FXGA 3KHQA 3R8QA 1FYTB 5IFJA 1RUMH 3HZVB 1MQ8A 2JELL 1KN4H 3HC3L 4Q9QH 5ANME 4QF1A 5IB3B 1FIGH 1T20B 4OAWA 5DJCA 5EC1A 2F54D 2OXGA 4WHTB 4I0KA 4D9QD 1RHHA 3U0PB 3ZE2F 1BJMA 5D2NB 2XG4A 1F90H 3G6JE 4PRPD 5DJ0B 1PQZB 1J18A 5GRWA 5F9JB 2OR8A 4AL8H 4OLZH 5ISZB 3STLA 4M9OA 2VXUH 4NO2A 1J10A 3INUH 4S1QH 5DEGA 4BYHA 3K74B 4LLMB 2HFEB 4OF8A 2HFEA 4YHOH 3G5XB 4ZUTA 1Y6KR 5L6YL 4Y4HB 3NIFE 3MBXL 4I4WB 1HNFA 3QH3A 4RMWA 1NLBL 3QNYB 5K59E 3DI3B 2W92A 1SYVA 4IRSA 5GGSA 1AP2A 2QKIB 4WHTA 3PABB 3MROA 2P49B 4H1LA 3SDXF 1OSPH 3R1GL 1TCRA 1EO8H 3FCTA 5H94A 4FTVE 1VFUA 3MV9E 4HH9A 2FIKB 1XR8B 5K9JH 5AYQA 1XR8A 3NFNA 5AD0B 5E08L 4LPCA 3I3BA 1ONQA 2IQAA 4C59B 2DKUA 2YD3A 2AAVA 3O2DA 5I74C 3GIVB 4PJFA 2IF7A 4MXVF 5DFVC 1IAII 3QDMB 3G5VA 2UZYB 4F58L 2EXWC 5H37H 4OZIE 5IMKB 2W9DL 4WTWA 2AP2A 1C08A 4HD9A 3KYMA 4D9RD 1YY9D 1SEQL 3IDUA 3MRPB 3L3HA 3WLWC 1KCRL 3WFCL 3TCLA 3RY6C 1FRGL 2CDGA 4JLRA 2IBGA 3HCVA 2CSPA 2H6PB 1Q94B 3ZHLA 3S36H 1CIDA 3HE6D 3GMNB 3MJ7A 3QDGE 1DP0A 3S8WA 3TN0D 3IJYB 3KPPB 4QHMA 1FNAA 2NY5L 4PJAE 3BHBB 5I17A 4LGSB 3BUYB 5I1IH 3KPRD 4ODWA 2Y72A 3VDBA 3VXNB 3DPBA 2IMMA 3BP4B 1Q38A 2FX8L 3UX9B 4ONHA 5TDOB 4MX7A 3OX8A 3VXRD 2ZCKH 2FBOJ 4QTIH 1P2CB 4OLWL 4D0DB 1H3GA 4OFYD 3OB0H 4POZC 5BRZA 5C0IA 2WWKO 5GRJL 4LHUB 5T5NF 3ULSA 1JZ2A 1ZGLB 4KJQC 1X5YA 3FB7B 3EJZD 5EZIL 1TVHA 3O6ML 4K8RH 3T8XA 3DGGB 5DFTA 4Z7QF 3A6CL 4XMLH 3CDGA 4D3CL 2DIJA 2IH3B 4Y2OA 4HMCA 5LG1A 1MCWM 3VXUE 4G9DB 3HNTH 1FZJA 4PTTB 1OSZB 4JFEA 4PB9L 5F3BB 3GRWH 4PG9A 4JAMB 3QJHB 1JYVA 4NRYB 3WXWL 4PJ7B 2VDPL 1WWWX 1V8HA 2DBLL 4XBEH 4ISVA 5FGBA 2IAMC 1LE5A 3AU1B 2APBA 2EECA 5JHDA 3GEWB 5MI0C 1Z9MA 3WNPA 3LV3B 3MJ8B 4DTGH 1T4KA 3RWFA 1BZ7A 3H6JA 2R0KL 4Y16B 4MDJB 5L88L 1O7VA 3S96A 3EYVB 3FOLB 4RISH 1PZ5B 1IBGL 2CDFA 2X4SB 3IT8D 3OAYH 4ZTPL 3WFZA 4I3SH 5F97E 4MWFB 4W6WB 4NKOA 4MB3A 2Q6WA 1IGCH 5MP6L 2FWOB 5FYLE 5CEZD 2X70B 4P5MB 2FLBT 1DSFH 3TH3T 3V0AC 3SDDD 4R96B 1F4XL 4K2UL 3HUJB 3DRTB 1FFPB 3QXDB 5I1AB 3IFNH 5CCKH 3S7GA 4GXVL 1XF3B 3MRDB 2CK0H 4XBGA 1NUFA 4MD5A 4R97B 4UQ3B 4YUEL 2ZOKB 4U1HB 4UMGA 4M61B 5F7YC 1AQDA 4I0PB 1ZSDA 2AJSH 2A74A 3BZ4B 4WHYH 3L3GA 3VMOA 5IW6A 5J3HC 4DGYL 5DVKA 5EU7E 3A6BL 4HC1L 3WFBL 4MHHI 3KJ4C 3I02A 1D6EA 5HVGB 4JY5H 1MHHA 5D7JA 3SCMD 4EDXA 3PQYD 5EUOB 4HAGA 4HT1L 5EU6E 1A4KA 2VDRH 1JIBA 1AGCA 3U30B 5FUCC 2AJXH 4G9FA 3W9DB 3CDFA 2JCCF 4G9FB 4LLWB 1GZPA 1QQDB 3FT2B 4NUGH 3TCXA 1NGQL 2Q76A 2BOCB 4YGVB 1HYSD 5DJDB 4HGWB 3VRIA 5ALBH 2EDNA 1FVCB 3B43A 4X99A 1AR1D 4S1SH 4L9LC 4OZ4A 1HHGB 1U91A 5J1TC 1KULA 4PJHB 1YC8A 3HG1A 1FG9C 3GGWA 4XNUL 3PWVA 3E6FB 4NBZB 1BQUA 4ETYA 1UXWB 5I1CL 4JKKA 1II4E 1L7TH 1RHFA 2HLFD 3T0EE 4EQ3A 3SE8L 2BVOB 1M4KA 3A67H 4DKEL 4MXWH 4J1UA 1QFWM 3B2VL 3B4NA 5C6TH 5EOCL 1BFVH 2FX8H 2ICEA 3L3IB 3HNSH 2FJHA 3I6LD 5F6HI 4JQIH 1QSFB 4LMQE 5ESAB 1AO7B 1UGNA 2GJ6E 3FN9A 3O6LH 1C7TA 1HSAA 1G0YR 2EDWA 4E42B 1B2WH 1AXIB 5FXCH 1PZ5A 2X4SA 3LHPH 1PY9A 3P2TA 4LPVA 5IFHH 1IKNC 3QQNA 4PJ8B 4LKCA 1HI6A 1L0QA 2NXZB 4OZFG 5BO1L 3BQUD 4M48H 4ZYKA 3P4LA 1TJHH 2AXHA 4EI5B 4PP2B 2FYYA 1FIEA 2OL3A 1R24B 5DVMA 5CKAA 3FQXB 3UAJC 3NFSH 3E3QC 3SHSA 1ZT7A 4HHAB 1IZKA 1RI8A 4YGVA 5I2IB 3IS0X 5I0DA 1K4DA 2CLZA 2YKLL 3G6JA 4MNGB 4Q9BA 4MCZA 4RFNB 3MR9A 3BESR 5KTEH 1XCTB 2JB6B 3IXAB 3EFFA 3NFPB 2PO6D 3C5ZA 3NACH 1K85A 3TPUB 5F9OL 3FB8A 1I8IA 3VG9C 1LE9B 3E6FA 1ODAA 2IADA 3TA3C 5L88H 4F2MB 2VB5A 3HMWH 1RK0A 1OGAA 4XGZB 3HB3C 4X6BB 1QQDA 3H3BC 3QIUB 4QHKI 3RBSA 4TPRH 3OR7A 4UT9H 4PJ5B 5J06A 4O5LL 3KPQA 2HFFB 2DQTL 5BW7A 4R9HA 1HINH 2FB4L 5HYSB 3C5SB 2V2WB 5D72L 1D5BB 1YNTA 4J7RA 2DWEA 5CCKL 3GSRA 5GGTL 4LHUD 3I6KB 5F1SA 3N9GL 5MENB 4OB5L 4R2GC 2OZ4L 1KENH 2C7UA 1YEDA 2JKXA 4JPWL 2H45A 1N5YL 2GAZB 4BUGA 2DMKA 1NBYB 4QKXB 3MJ7B 3RGVD 4M61A 5J12C 5HHOB 2ZUUA 5J4MA 4P2QE 1UA6H 4P3CH 4IRJC 5GZND 1FFOB 3DV4B 1H5BB 4DWHA 4RWHA 5HVHB 5IHUH 1QRNB 3NCEB 2E3VA 3IDYC 5L9DL 4NO5B 3BGMA 1JWSB 5KAQF 3GSVB 4I5BB 5E6IB 3HMXH 5LAXB 4APQC 5L0QB 2F15A 4Y8DC 4HPYL 1OTSD 2P43B 1IC7H 4HWEH 5MERA 4KZEH 2VDOH 4X98A 3L6FA 1RVFL 4KZDL 3HI5L 3RVVD 3QJFA 1MFNA 4OCYH 4NQUA 4OQTH 2BHUA 1NJ9B 2MOVA 4PJAB 1F6LL 4D0DA 2VITB 3TBSB 3LEYH 1G7JA 4OV5A 4NM8H 4CDHA 4UZGA 5DMGC 1N0LA 1SBBA 4X5WA 4F9LC 1I85A 5C0AE 1RIHL 2QJDA 4OFYA 3GUTA 2OM5A 5IVXB 2EO9A 5E2TL 4Z7OF 4Y2DC 1VFBA 3ARGC 4XCYA 3T0AA 1AQKH 3S34L 5CEXB 3OWEA 4GUPA 1S5HA 3S36L 4GKZA 2IPTH 3B6SA 3WJJA 1UYWL 3C2AH 1EDQA 4NSKA 3RWGA 4Y19E 4GQPH 1G7IA 5D1XC 1ED3A 5FB8B 4AK1A 3KYKL 3D69B 1PW3A 1EFXB 5C0RH 3PGDB 4JPIA 2QQNL 1MWAB 1T20A 5F89B 1NDMA 1EXUB 5CEZE 4K94C 2LTQC 3NIGE 1CZ8L 3NCCB 4WEMB 4Y4FA 4HF5L 2BJMH 3EYSL 3U79A 4OBSA 4ONHB 2YA0A 4X9IA 3MLUL 1DQLH 1XGTB 1Z9SA 4JRYB 2OJZH 1UKTA 1IAOA 2X4TA 1IT9H 4OCXL 1L6ZA 2J5LC 3ZKQD 2YPVL 3O6KL 4KKBD 4YHLL 2E6PA 1E4KC 1EEYB 4JRXE 5IJVB 5I75B 4Z7WB 3UTZA 1S9XA 3FQUA 3Q5YA 1BVZA 4EIGB 4N0UB 5KVDL 2PYEE 1G6RB 2W1NA 2YPLE 4AENA 1F45A 3FO1A 3UXFA 1JGLL 2ICWI 4I2XE 1CFNB 1AO7D 2QHRL 3IDXL 3MJGX 2DQUL 4D8PA 2VR5A 1DQQA 5CJXC 4HKBA 3RHWK 4OGAD 3CSGA 5IGXH 1MLCA 2E9BA 5SWSA 3BWUC 4YHNA 4LOUC 1YY8A 4EI6A 2EYTB 4DGYH 3N0PB 2D2OA 3BQUB 4V1DB 2ICWB 5E8PB 1J12A 4RGOH 1FAIL 3LQMA 5KS9E 5ADPH 2DM4A 3P4MB 1YEKL 1DEDA 2NY6C 2DICA 3T65B 2MHAA 3V95A 3FCTB 4YDJB 4U2ZA 4AQ1B 4NQXA 2R2HB 1IL1B 4KQ4L 3WIIL 3BGFB 4FOMA 4PYHA 1T21B 3VE0A 3IDIA 5J1SC 3SY0A 1IC4H 4FQ2L 2ZCLL 1RJLB 2APFA 3BO8A 3E1F1 4PJEF 4WI6A 1DQQB 4JRYA 4M1GH 1BFTA 3L7FB 3WO4B 2VC2H 5IQ9B 4XNUH 2LQRA 4FQQA 1ZGLP 4Z7OE 4JM2F 3C08H 5IJVA 2IPUG 4KPHL 4PB0H 5HBBA 3ARED 4HIIB 3O3UN 2ZUWA 5I30L 4PJ5D 4TQEH 5JXAL 5FO9A 4L3ED 2ARJA 3QHZH 5E94B 4JY6A 1A2YA 3VGDA 2BCKA 3PWUA 5CUSL 4K07A 3S35X 3HNVH 4JFHE 1RUPH 3ABZA 4RQQB 3SDCC 3Q1SL 5DZOA 2J8HA 2FD6L 4ZSOB 1A7NL 2Q8AH 2OTWB 2V9QA 1HYSC 1S78C 4U6XA 4YQXH 5C09E 3HE6A 3RGVB 1EO5A 3X12B 3QA3B 5FECA 1V3LA 4BKLB 4BZ1L 2YWYA 5EA0H 2NY2D 1MCLA 3CMOH 2ED9A 2QSQA 2Y5TA 4MNHA 4PJCA 4PGDA 3PWNA 1CICD 2P24B 1KTDA 3HC0B 3GHBH 4O58L 3KPLB 3ARVA 5IP4A 1OP9A 5BQ7A 3X14B 3BUTA 4P57A 3ARTA 3L5JA 3MC0A 2VLJA 4TSAL 5CD3B 2DTML 4HIEB 4RFOH 1MJ7H 3DUHA 2P1YA 5E6YA 2ZG3A 5J7CC 1JZ5A 3RVWD 4XP9L 1D6VH 4WO4C 5HGAB 2XWJB 1R3KB 3DO7B 3PP3K 3BMWA 1SJXA 5F70A 3R4DA 1C5DA 3GI8H 5FCUH 2HVJB 1QRNA 1ZLVH 1EAPA 4KH2A 4TNWF 5JIPA 4G6ML 4P9ML 2YR3A 1FBIH 1ITCA 1JWSA 4KRNA 3BYYA 5IHZA 1DBAH 4FZEH 2FEDD 4WWID 2YZ8A 1MQKH 2IEPA 1NAKH 1S7VB 3BEVA 4WEBL 5AWNH 3RKPA 3QIWD 1S7XB 3ALWA 3IXTB 4OSUH 3ZT6A 2PUQT 1HKLH 4YPGA 2K3TA 3UBXI 1S7QB 2FB4H 5ID1B 1IM3B 5E5UB 3RDTD 3MXWL 4EIZC 3GFUA 4IOFD 3TFKD 5C0JB 3OKMA 5F96H 1Z9OA 4M7KH 3ARFA 1CE6B 1JK8B 5MHSE 4AEIL 5HYQA 1C16B 4X7TA 4KTEL 4MYWB 5GRZA 4M8VA 3SJVD 1UT9A 5DT1H 4F33B 4YE4H 4EOWL 4EN3C 4X6CA 2IAND 2VE6A 8FABB 5EG6C 3V5DB 4JFQA 3VWKB 4NC2B 5DVLA 1U8QA 1YDPA 1T3FA 4RGMB 5HI5D 4LLDA 2NNAA 3ULVC 4QRPD 2X4QB 2IALB 1CICA 4PJFE 2VZSA 1U93B 4NFCA 1AY1H 2NY1D 4G8GE 4P2OB 3B2UD 4YFDB 5EUOA 4MXVE 3HG1D 4LVHC 4OI8A 2CLRB 2PW2A 3O45A 3VXTB 3BN9C 5ABDE 2C1PA 2XQBH 2WUCL 3TA3B 5D7IA 1JHTA 1S7SB 3TJHC 2BY1A 4XB7A 4KU1A 4GW4A 4ZODA 5DRXA 2H32H 4U1LA 4OZFB 3AY4A 4ZNEE 1XZ0B 5FV1L 5CD5D 2GCYA 4JFFE 1YN7A 1YMMA 3NN8B 3S5LB 4OI9A 1UQSB 3V4VH 4LCIH 3Q1SH 5JO5A 4XC1L 3ZL4H 5HYJA 1IAIH 2OL3B 4F3FA 3D25B 4X9GA 5FHAH 4Y4KC 3V5KA 2CDFB 3MFFA 5T1LD 5CJQH 3RNKA 4FP8H 4O2CB 4F80A 3GB7B 4PY8I 3BPNB 4ZFZA 3QDJB 1BGXH 2HTKC 4W6YB 2IGFL 1S9KC 2W59A 4RIRA 1H15B 3LEYL 3OKLB 3OKLA 1RK1B 4M93B 2G75A 1NPUA 4ZUUB 1N3NA 2GFBB 2OXHA 4E41D 4I1NB 1HOCB 3LQAL 3SDDA 2VNCA 4KHTH 1AJ7H 3CFBB 4R0LC 3KLHD 4ODSL 3EYSH 2K7PA 3JTSB 4XHJD 4ZFOB 5E6ID 3WIFA 1OF2B 5DK3A 3WS3A 3O2WH 4FXKA 4L9DA 4LPYA 2VAAB 2Y5EA 4YBLC 1CDGA 2DJ4A 4XP9H 3BEWB 4ZFZB 4R26L 1ROWA 3F58H 5FM5M 1E6OL 3FB7A 2XN9E 5KSBA 1LO0H 3KYKH 4G6MH 4P9MH 3RBGA 1U36A 1E0OB 3ULUC 3LKSB 1AE6H 4NN6C 1GIGL 1YDPB 2WMPA 2FLRT 3MNZA 1U95A 3U46B 2V2TB 1Q9WA 4OZFA 5JPNA 3VD4A 4JFZL 2JE8A 1FO0H 1XZ0A 5DJDA 1PG7L 3VRIB 5JTWA 2FR4B 5SWSE 4PP1C 5IW6B 3VFUA 3MRIA 4RAHA 3MXWH 3O45B 4GAJH 4YAQA 3GBNL 3R0NA 4Z8FH 4X6DF 1I3RB 2BHZA 1H0DB 1P5UA 4LRNL 2XIDA 4PV9B 1IM9D 3LMJH 4XCNB 1KXTB 1NGYB 4NP4H 4KTEH 3BQUC 3SOBL 5BRZE 2AEPH 1ORSB 3JVGC 4NC0B 5E4IA 2BRRL 1RFDL 3F62A 3VXUB 4QHLB 3LZFL 3N85H 4NKQB 4XC3H 3UTPD 3V5DA 1PG7X 1HIML 2PYEA 2DAVA 4OCRL 2VZVA 3RPKA 1CFSA 2QHRH 3IDXH 4AQOA 1T3FB 4U1SB 5JHDB 1SQ2N 5BV7L 3VA2C 4UQ3A 1K8IA 5K59F 4RMSA 1S7RB 3MRCA 1FFRA 4MXQC 3SQBA 4OLYH 2UUDH 5EU5B 2NY0C 4JFYB 3H9SE 5DTFB 1OTTC 1C5CH 2W60B 4NO0A 3E8UH 4JM4L 4C56E 4PRAA 1PAMA 4JM2B 1NLDL 2Q6WB 2V5YA 4R90H 5CD3A 4R7NB 4Y16C 2DM7A 2G9HB 4KVCH 1OGTA 5KN5B 1NC2A 1X5FA 2BSRB 4ZS7L 4FQLL 3MV8E 2JLLA 3CK0H 3SDYH 2YD1A 4JHBA 5TE4L 4WU5B 1X6NA 1Q9KB 4WNQB 5IOPA 4DFIA 3VCLA 1XGPA 1RJCA 3ILQD 3K2MC 3UC0H 3T3ME 4FQPA 2BNQA 3QCVH 3O6FB 5K9OB 1XH3B 5J0BA 4YXHH 4OLVH 4OUUB 1LE5B 2UWEF 2HA1A 3AFLA 4YHKL 3VFWA 1S7XA 3IXTA 1JTPA 4N1CA 1J1PL 5DFVD 5D9SA 1RD6A 4F8TA 3D39E 4R4FL 4NZUL 5A43C 3QB7C 3V2AR 3T4AB 3HC3H 4FTVA 2EDYA 2R23A 1KCKA 4X7EC 4Q9QL 4H25B 2R0WH 2E9JA 1ZGLA 4O58H 1S9WB 2D0HA 1P7HL 2ESVA 4ONFH 4KJPC 1TPXB 2DLTA 4U7KA 4JZOB 1VACA 2VDNL 1ES0B 5J6GB 3IRZA 4HZLA 4FABL 4P3WA 1MI5D 3HNVL 3UJJL 4NBXB 2BNRD 3CNKA 4KWUA 2F58H 3U36A 3HCVB 1CVRA 1FYTA 4BFBD 1KN2L 5L2KE 2W9EL 2X1QA 1CLOL 1DLHB 2WANA 3RPIA 4U3XA 1F4YL 2EXYC 1I7UA 1U58A 1QO3A 1KTLA 2ORBH 4JO1L 4HFWA 3SPVB 4I48B 3F58L 1XIWA 4QXGL 3V8OA 3ZSTA 5AG9A 5LKNA 4W81A 4YDIL 2EE9A 2VXTH 5HHXL 3DVFA 4KXZI 1M7XA 1DQMH 3GK8H 4EXKA 1LDPH 1SMOA 4MJIE 1TQCC 1BM3H 3UPRB 4GQ9L 3JZ7A 3CFEA 2NW2A 1XGUB 3BE1H 3BH8A 4JQVC 2UYLB 4L3AA 1AP2B 5L0QC 1YN6A 4JCLA 4H1LB 4OZIF 4P3DA 1T21A 3VE0B 4GAFB 4YHIB 4IBLT 3VXMA 1KTKE 1MREL 4M03A 4YR6A 4HJ0D 4KKCC 5TQ0L 1Y6NR 1RIUH 5E99L 2UWEA 4OFVA 3NFNB 2H2PD 1BD2D 1CCZA 3O8XA 1HZHL 3VA6A 5DEGB 1KELH 1FCGA 5ETUB 4PPTA 2VABB 3ESUF 4CDGC 4DVRL 4NJAH 3PL6C 3KLSA 5IB4B 1QLEH 4P5KA 3BQUA 1MCKA 3RI5K 1HIMH 4EKXA 3SO5A 3LN4A 4IRSB 1ZVSA 1H3WM 1RULH 1BAFH 1HILB 4TUKH 3MRRB 3MOBH 2NMSA 4ORZC 2RBLA 2I27N 4LSQL 4BUHA 5F9WC 4HPOL 4YHML 4WVRA 3EO0B 4DEPB 3CIQA 3JWDL 2VLJE 5CINL 3WNMA 3QIUC 4JZNB 4OF7A 5GRVK 1PQZA 3UMTA 2W65B 3NAAH 4YR6B 1DJSA 3EJYC 4CN6A 4KVCL 1K3IA 2OP4H 2XKNA 4NT6A 1RMFH 1CLZL 4GRMA 1QFPA 4MJ2A 3OSKA 2DLHA 1CFBA 3OPZL 3ARFD 3UPRA 5IBTL 4WI2A 2CXKA 3B2UC 2YBRB 1Y6MR 5F88B 3DX8B 2EXWD 2YD4A 4C56B 5I9QB 1WZMA 2Z8SA 5F7HA 5EU6D 1I85C 1XGYL 5IVXF 1UJ3A 5E6ZA 3RY5A 4YDLC 5D1ZA 1KIPA 3X11A 5I1EH 1N7ML 1IAKB 1U8MB 3WUWB 1BOGB 3CZJA 1EHNA 5HHNB 4XMKL 5IMLA 1EUUA 4CJ0A 4CU6A 3SDXA 5HYSG 2AK4D 5F7DB 4LSSL 4KHTL 3BP5B 4LLYB 5CJ8A 3BT2H 3MNVA 1BFVL 2BDNL 4F7TA 1ZWIB 4Y4KA 2P8MB 3PGFL 3TT3H 4OF6A 4TSCH 5C2UB 4K55A 1YMMD 4FRWA 3AXLA 3PGDA 4YBQC 4BQ9A 5KS9B 4G6JH 4OCWL 3B6SB 2AEQL 3O6LL 3WLBB 4PV8A 4MNGE 1MHPH 5FGCB 2A2QT 3LIZL 2HJLA 1KLUB 3CH8A 4PRPB 4IS6B 4L8BB 5JXEA 4XNMB 2VDMH 3ZTNH 1KTLB 4M93C 1FZOB 3MRMA 3WHXA 1WQVT 2QTEA 4LP4A 3H9ZA 5CMAA 2CK2A 1ZHNB 4JGUA 3E6HA 3PJSB 1BX2B 4PJEA 2PO6A 3LEVH 4G5ZH 4MJ6B 3VXMD 4CU7A 1J5OL 5GPRA 1R3HA 3S4SG 2Y7QB 4OGYL 1ES0A 3VCLB 4UT6L 4JDTH 3IDGB 3O6FA 2EDFA 3JTTA 3U9PL 5K9OA 5C08E 4XCCH 5I8OL 5HHPA 1A1MA 4WNQA 4X6DE 4WY7L 3PGCB 2UVEA 4YO0B 2NLJB 3MV7A 1AGBA 1KB9K 4P48A 3DIFA 4NUGL 4HWBL 3OXSB 3H3PH 2BRRH 1JPFB 3ROLB 3FHQA 1KB5H 3VFWB 3HAEB 2YK1L 5D4QA 3I3EA 1V7NH 3RP1A 3VRLE 2AJUH 3U4EB 1CGVA 3VFGL 3RL2A 3KYOA 1CFQA 2EH7H 2M2DA 2KDGA 5ITBL 3TVMC 4JGJA 3PWPD 4I3RL 5JUEH 2ILLA 1EPFA 4LSTL 1QLEL 1JHKH 3REWB 3TF7C 4Q2ZB 3G08B 5EU7C 2HKFL 1WK0A 5F1NA 2JB6A 3IXAA 3NA4A 4MNQE 5IT2H 4N0RA 1NANH 4OZHB 1DFBL 3G6JB 1ZA6A 1KENL 2H1PH 1N6VA 1HHJA 1MI5A 3KR3L 5F93C 3RZCC 3S4SB 3HNSL 2AEPL 4L29B 2C26A 4ZPVA 3QFJB 3BDYL 5DMJB 1PX3A 2DQJH 3O9WA 1QRNE 1RK0B 2DB8A 3MOAH 5HYSA 1NGXB 2FIRT 3HC4H 3IJHB 2LU7A 4L8DB 3NCMA 4ZS6D 2DYPB 4YHZL 1Y0LB 3VXPA 3OGCA 4HUWB 4UOW1 1L9MA 2PYEB 5EC2A 5IUSA 2CLZB 4XAWL 1A5FL 1J1PH 2IFFH 3LS4L 3MRBA 3IETA 3GJEB 5JPNB 1AO7A 2AJZB 4HGKC 1I8IB 1FL3A 3C9NA 4LMQI 1G84A 43C9B 2A83B 1Q9LA 1BJ8A 4DJMA 4LSPH 1HHIA 1K8DA 3EBAA 1J86A 3BEWA 3WS6A 1EHLL 2NY6D 5IFAL 5AZ2H 5JIIA 3U4AA 1S78D 5IHBA 1N7MH 3DUSB 2NY7H 1EX0A 2Y23A 4OD3H 2OR9L 3NACL 4MMZC 5HDQH 3OKNA 5D2LA 2VO5A 3MLYH 4BQ6A 2OCFD 3NA9H 3QBTB 4I18A 3SDAC 1FHGA 4ZOEA 3ARBC 2AI0H 2ICEB 1FVCA 2AXGA 2AEQH 2VOTA 4M3JA 1EJ6A 3MR9B 5IMOA 5JDJA 4JFDD 3O3BA 5C0AD 3O3BB 2MMXA 2BRQA 4NHUA 3DV6A 4LVNB 1GAFL 5B38G 4FXKB 3NOIA 2DQEH 3HKFA 5TGBA 4DOHE 5EO9A 15C8H 4R0LB 1S7WB 1A4KB 2V5SA 4PJ7F 3CH1B 3MYZA 4LQFL 5HYJB 5GSRA 4LBEA 5DC9B 5IG7B 1CZ8H 3U2SA 5BJTA 3FQRB 2ZUTA 3JUZA 3QNZA 3KPRE 2R4RL 5FM5O 3X17A 4MDIB 4XBPA 3VXTA 3T3MF 4RFEB 1H15A 5DR5L 1A1NB 1I1FB 4U6YB 4XPHL 3HB3D 1FNGA 4XCCL 2WK2A 3LPGA 3GGWB 5CZXD 4WY7H 2Y06H 5E95B 3KJ6H 2AK4B 5FF6A 2P5EA 3O8XD 3GMOA 4P4KD 1HHIB 1K8DB 1PG7W 2I07A 2PXYA 1K5NA 1LNUB 2OK0L 4LIQL 3MCG1 2MTPA 2VSCA 1MNUH 3BISA 4M7ZC 5I1CH 5D1XD 4YWGH 4EDXB 5T3XL 3GZKA 4TVSa 1U3HB 2VWEC 3RZCB 4QWWC 3WSQL 5DD6B 2A77H 3DHMA 4WENB 1F58H 4MD5B 3B2VH 4YDVA 2P5ED 5T1KB 1KG0A 1JFQL 4HS6B 1U8IA 2ICWJ 1MREH 2BOBA 2HTKD 5CJXA 2YPLD 5E2TH 2BC4B 2YOCA 5IK3B 1NGPL 4X0KA 1G9MH 3IB4A 4JAMA 3TVMB 3MBEC 4I0PA 3V6FB 2F8XC 1BJ1J 4PY7B 5E5MB 1W8OA 2AJ3B 5E9DD 5FOBA 3O9WB 1MJUL 2GSGB 5JPMB 2W0FA 1CE6A 1BZ7B 1T4KB 1B0GB 2DM2A 3UYRL 3BPOB 1CDUA 2YUZA 4I0PC 5JMRA 5TDNB 4CVWA 1L7IH 2D4DA 3C09C 2NYYC 3MLXH 4UDUB 2AV7A 3RGHA 3GJFB 4GLRH 4FNLL 1C5DB 1BIHA 3ELAT 3QJHA 5IM7B 5EH1A 5IHZB 1S3KL 2I25N 5JXEC 1F8TL 4PJXA 1GC1C 1HHHB 4U1KB 1A14H 3ROLA 3CFJA 3IFOB 4TQEL 1CXHA 5EU3B 1A1MB 5DUBB 4X6FA 1OWRM 3VDCA 4YO0A 2X1WL 4URTB 4FQHB 3O6KH 4YHLH 1MFCH 1JPFA 3ARFC 1JNHA 3SGEI 1MCNA 2C4FT 3VGHA 1DBKL 1H3UA 1A7PH 4N1HB 1UVQB 3QUKB 4LLUB 1F3DJ 3QO1A 4K7PH 2KUTA 5DHVB 4JFXA 5GJTL 5CGTA 2R69L 3MJ6A 3QUML 4HLJA 4L3EE 4LLVA 2EYSB 2H32B 3VGGA 4G43B 3B5TA 4NN5C 2PO6B 2NY3D 2AERT 4HUUB 1IM9A 4PRID 4JG0L 3BYTA 3VXSD 1DBML 4H0GA 1RZIA 2F53A 3MMEA 1OP5K 2OZ4H 5C0IB 3T1WA 4JR9L 4YZFF 4O2EB 1VADA 1GAFH 2DYPD 1ZEAL 1KEML 1ZANL 3G6AA 1TITA 2W0LA 3GKWL 3X11B 5FKAB 2CRMA 5CSZA 1OAKH 3TO4A 2XWBB 3WHXB 3QRGL 1BEYH 2GHWB 1T89A 3BP5A 2A0LC 4GAYB 3ZE2E 1JGEB 3OZ9L 4PJFF 4Y2DB 4WUUB 3MRGB 5B38B 4JVPA 3QWOB 4PGDB 1P4IL 1N4XL 4NQEE 4KV5F 1K4CA 1KTDB 3I50L 3SDAA 3MQIA 5D7SL 5F7LB 3WHE0 1N59A 5IR1B 1IC4L 2EDHA 1MI5E 4ZDHB 4Z0XA 5ESVA 4QCIB 4OGAC 5IQ9A 3DX8A 3FT3B 3LEVL 4G5ZL 4G8FB 1X6LA 3ZKXB 2M26A 3T65A 3FO9B 2D7TH 3DX6B 1X5JA 1EGJA 2A9ML 4RQQA 4X6EA 1U8PB 1XGQA 3AM8A 3MACH 3B83A 4TOYL 1RU9L 5C0FB 2R2HA 4FFYH 5FO9B 3O81A 1GL4B 2ATKB 4QT5B 1ZE3C 1X4XA 4PS4H 1UEYA 3N50A 3SGKA 5MEQA 3UZEA 5MEQB 3EIFA 3MUJA 5C0AB 4POYA 1IGJB 1PZUB 1QLFB 5MEOB 1BIIA 2XTJB 4OKVB 5JR1H 3SE9L 3Q48A 2VZOA 4LLMA 1R5IB 1TZHA 2DQJL 5AAWA 1EBPA 2HLAA 2EKSB 3D39B 3BGFC 4NQVA 4JG1H 1NFIB 4JM2C 4UB0H 4JQVA 5D7LA 3NCYS 3IU3B 5JUEL 1HILA 2ZNWA 1NUNB 3F7YA 5FIEA 4NCC1 32C2A 1AXTH 1E28B 1IC1A 3WCYA 1F13A 3EOAB 5LBSH 2HT4D 5LWYL 3U7WL 3ZT5A 4XXDA 5DJCB 1QYGL 4P46B 5E24E 2B4CH 4HUMB 4GSDL 4P4KB 4E41A 1JNNL 2VABA 2XQBL 3B9EA 2OJZL 2XWTA 4KMTL 5F8RC 3OGOE 4ZOBA 5D1XB 1A9EA 2DBLH 5DJXB 4YK4C 4ODXB 1PY4A 2R1XA 4LASL 2HRLA 4N1EA 3T0EB 5J11C 4OD3L 4UT7H 4XNYL 3GSQB 4OLZL 3KXFD 3ROOA 2HH0H 2VH5H 1QACA 5GRXG 2VLMD 2QR0B 3IJSA 5EORH 4TNVK 4R7DB 1J1OL 4JB9L 2GJ6A 4LEOA 1WIOA 2V7NA 3GMPA 3S97C 2FZ3B 1LO4H 1BWWA 3H3KA 4GKZB 4UTAH 1XR9A 3F7QA 3TVMD 5IBLC 4M6OH 2JELH 4MNQD 4JFDA 4NWUH 1ACYH 3O11A 1NEUA 5GS2D 2ICES 4NQEA 3RL1A 5DDHA 5I6XB 2Y6SC 4NO0D 4PJBA 4ZXBB 1VACB 3HZVA 4HGMA 3PWPE 2F53B 4KDWA 1QBBA 4PLOB 3DRQB 3QULA 1NEZG 2PR4H 1LD9A 1UADC 4HBCL 3DWTA 1H3TA 3C6SB 5CZVH 4K3EH 2VUOA 3W11D 4M6ML 4JN2A 4GRWB 4CW1A 3W39B 5M94B 4F58H 2VITA 2W9DH 4H26A 1O0VA 4L1HA 3ZYJA 5SX4I 4RZCA 5DHVH 1FGVL 1KJ2L 3KJ6L 2DBJA 3RIAK 1SVCP 4K7PY 5AUMB 4ZAKD 2R15A 3BPLC 3PE9A 3MLZL 1JCKA 5I0ZA 2AK4E 2DD8L 2VC2L 1Q0XH 5FUCE 3R0MA 5C09A 1B88A 1RZJC 4K7PX 1SEBA 3BPOC 1ZHKB 5I1JL 1MHEA 1CS6A 2RR3A 1T04A 5EU5A 4PP1D 2AXFA 2KKQA 4LEXL 1F58L 3TLRA 3MACL 3SDXE 5DVOA 5C86A 2PTTA 1WAAA 3QSKB 3UZVB 3G5YA 3UPAA 1V7ML 2GSIB 1LEIB 2NR6C 4LKXB 2UZIH 3QI9D 4BH8B 4JRYE 4LDEB 1HQRA 5FA3B 1T6VN 4ZFFA 3LKRA 3VI4F 3K2UL 5TDNA 3LZFH 2C7UB 2V7HB 4YIQB 3KPSB 4M6NL 3UAJD 1A7RL 1NAMB 4JG1L 5JHDE 5DRNB 4UB0L 4KY1H 1T6WA 2R2CA 2F9BT 1DEEB 4LAQH 1QFWH 1GPOH 2QADB 2YD7A 3QIUA 2HFFA 3E3QE 3TZVD 3WBDA 1ZGLM 4TTDD 3CFKA 4JFED 4PB9H 3DETC 1PD6A 5EO1B 3LQAH 4MVBC 1P1ZB 4LCCB 4UU9A 3EFDL 1ZT7B 3VRJB 1JNNH 3LKSA 2C1OB 3LQAC 2VSDA 5D7JD 3U46A 2HN7B 4Q6IB 5GRJH 3CK0L 1YNLH 3WL9B 4Y1AA 3H9SD 4FQIL 1FNGB 4GG6F 4UAOB 4WEBH 3MRHB 3DX9A 5IWLA 1YYLH 2R8SH 1UCBL 3FJTA 5FK9A 1WFTA 4IMKA 1CD1B 3D5OF 4OM1L 4XGZA 2CIIB 1OGAB 1Q72H 1TJGL 1X5AA 5DWUL 5ISZD 3VI3E 4B7LA 1NCDH 3MBEA 4X4MA 1X5XA 4B5EA 3D9AL 4L8SA 3IFNL 5IROA 4LARH 3VFUB 4EDWL 3MLTA 4NZUH 4ZUVB 5J1AB 4NWUL 1PKQE 3H9HB 1F6AB 3AREA 1YEHH 2L7JA 4RA3A 4EEEA 3V5KB 1JN6A 5I2IA 1CDCA 3EOBA 5GGRY 3TBWA 5DFWH 3WIHA 1NC4A 5C0BB 4RFNC 3M07A 4X8JB 1K5NB 1LNUA 2HYMA 3ARBB 4M7ZB 4WFHD 1S5IL 2BSTB 2C3VB 5GISL 4CJ1A 3ZDXE 4WW2F 5HI5C 5EIVA 2ED7A 5K9QI 2FNBA 2VMFA 3T2PA 2XY2A 4GMTH 2WAHA 3SJVB 2C3HA 4JO1H 5I76A 2YPKA 4PRNB 3KJ4B 4QXGH 4NDMB 4NIKB 4NUJA 3KXFB 1C5BL 2CJUL 1P69B 1UZ6F 4RRPA 1IKNA 5DD3L 4D0BA 5L2KD 2JIXA 2EDLA 3QT2A 1MFDL 4PRHE 2ZUYA 1JI1A 2QBWA 4TUJA 3QI9A 3FAWA 2DL2A 1R5WA 1KPRA 4R3SB 3UTOA 4GQ9H 4HDIB 2XZQL 4POZD 5EWIH 1A6TA 2J6EL 2A1WH 5EZOL 4FFWD 4U1MA 3D18B 3DX7A 2AJZA 5C6TL 3ZYIA 1DVFC 3X13B 2AJXL 3PWVB 3WE6A 4N0FA 1F4HA 1KC5L 1NCWH 2XZZA 5ICZA 2SEBB 4ZXBD 4UINL 5IVNA 5ALBL 4LCUB 5JOPE 3DXAD 2Z4QA 3LRHA 3TNNA 5FGRA 4NZRL 1S7SA 3DRTA 4J4PA 1I8MA 4XNXL 1EAJA 2C4FU 3K2UH 1ZT1B 1UH3A 3LAFA 5LGHL 2JCCE 5SWQA 2JJTC 2NLJA 1SHMA 1VKXB 4Y16A 4KRLB 1NGWA 1WTLA 5GGUA 4KUCF 1NAMA 5L2JB 2QSCL 2NNAB 1M05B 4F7MB 2LVEA 2Y6SD 2X70A 1T7WA 5CBEA 1S7QA 2BSED 3ALPA 3DJ9A 5CINH 5KW9H 3PG2A 2WNGA 3FOLA 5HPMA 2N7AA 5KTEL 1NBZB 1B2WL 1P4BL 3MV9A 4AIXA 2X44D 4L4VD 1WWBX 4M8QA 3L3JA 2WQRA 2AV1A 3IFLL 4X7TB 2HH0L 3HZYA 4DOHB 4PGBB 4IDJH 5JLZA 2VJXA 4KHXL 3X3FL 1WBYA 1YY9C 3D1MC 5C09B 4GH7B 3LEXA 5J6HB 3ZTJH 4O2FB 3WD5H 4QY8A 5KS9A 1KJVB 1MFEH 1WISA 3CCHA 1PEZA 3CXHJ 1XF2A 3OR6A 3LN5A 2OS7A 3KPSD 4EDWH 1DANT 4J4PC 4S1DC 2GW5A 4K71B 1CFTA 4MSWA 3NBNA 3QDGD 4OGXH 1OP3K 4HBCH 3JXAA 4MA8H 4PG2A 1N0XH 3LH2H 4MXQD 1ORQA 4WFGE 1A1OA 4I0PD 4K7FB 3HPLA 2DLFH 3U4BH 3UDWC 1FAIH 4PJ9B 1N5AA 4A6YA 3LKPA 3WIHL 3QDHA 5D8JH 4UTAL 2KPNA 2R9HD 2YBRA 4I0CC 5GGQH 3U0TB 5DJAB 3ARZA 1MCPL 3B9KB 4L4TA 3QI9C 3JWOH 4JRXA 1VDGA 3QO0B 4OLYL 2IJ0C 3WIIH 1X7QA 5ILTL 3MLZH 1LO3H 2XFXB 4GKOA 5IMLB 4MCYA 3T77B 4HPYH 1WZLA 3O2DH 1A6WH 5C3LD 1ZTXH 3W39A 4Y1AD 4LLYA 43CAB 3PWNB 4NGHH 2NQCA 2J88L 4LOUD 2BNRE 2YRZA 5I71B 4IOFC 2Y9RT 5JHDD 3VFNA 1XEDA 1LD9B 5J9PB 2HT3D 2Y5TB 4MNHB 1IGYA 3WO4C 1CI5A 4P2RB 3B9VA 1SYSA 1QBML 3CVHB 4UNTA 5E8EB 4PRIE 2OYPA 4LRIA 3CZFB 4MNQB 3L5HA 5HGGS 3JV5A 4HIIA 1EJOH 3P4OA 2V2XB 3ULUD 2UZIL 4RWYL 5EOQH 4H20H 1BVKB 5E2WL 1KB5L 1C7SA 1CG9B 3OKDB 3UZQA 1ND0B 4Z78A 2YMXL 1B6DA 2CD0A 2RCSH 1DE4B 2F5AH 1LK2B 2I26N 4NOBA 3VFGH 1T7ZA 1U8NA 1BOGA 1KV3A 2XKNB 1TQBB 2K9UA 5F9WB 5I1HL 3VWKC 1BD2E 1UM5H 1Z9LA 2GIYA 2J2ZA 3LN9A 4EN3B 5GGSY 5IBUG 3P77B 3CFEB 4H88H 5F88A 4LSUH 2E5EA 3RWEA 4XP4H 1TZHB 3MRRA 3P4MA 1A3RH 3IDIB 4UDTB 3PGFH 4CVXB 3IGAA 3QP3A 4M43H 1GHFL 3GSXB 3ZYZA 3TPKA 1XGRB 1D6VL 2IG2L 1W0VA 1BVKA 5DJ2A 1A6AA 1CE1L 3LIZH 4IHOA 3VXQA 1OM3H 1JV5A 4U6VH 1MCIA 1WTGT 4LCWD 2R0LH 3UTTD 1CVSC 5F7WC 1YEIH 1GPOL 5DA4A 3PP4H 4OM1H 1LEGA 3BH8B 1TJGH 4HKXB 1NAKL 3PQYA 4OZGF 4P2QA 2X89A 3VFSA 2GJJA 5F44A 2ADJB 3LKQA 1BM3L 4P3DB 5SWSB 4DW2L 4OLXH 1MHCA 3Q5OA 5IKCB 5K9KB 2F19L 1E4WL 1MAKA 3UTTA 1EZVY 2GT9B 4UT6H 1FE8H 3VWJA 1QSEB 4OCNC 2A6DA 2EEBA 5GS3A 4JZJB 3AB0C 4TUOB 3QUMA 1EFXA 4LF3A 2NY0D 1ND0A 3DX6A 4NCC2 3OTTA 1KBGL 2AABL 4Y2DA 4EVNA 1FN4B 4KJWC 1ZLUK 3VMPA 5TF0A 1UWXH 1R0AL 1AC0A 2QADD 4R7DA 3VFSB 1YEKH 5A2LH 2A6JB 4X7CC 2XRAH 3CZFA 3HZMA 4S1QL 1NDGB 4A6YB 5CAYB 4M1DH 3HE7D 4U1NA 4HUUA 1N8ZA 3TIDA 3EAKA 4LSQH 3TYGL 2N56A 4ZFOL 4BQ8A 2O5XL 2E9WA 3HI6H 2V6HA 3UJIL 1QRND 2FL5B 1F4WH 4MJ5A 2DQEL 5C9JA 5CLTA 4CNIB 3KXFE 4S1RH 3T4YA 3I84A 4OZGB 4FTVB 2WM0A 2MPAL 1JZ8A 4UAOC 2XPGB 5J6GA 3TV3L 5IVXA 5LAXA 1K2DA 4AT6A 1N6QL 4PRBB 4NFBA 4H0HB 2ESVB 1J87A 1WFOA 2R4RH 3CFJB 5JZ7D 4IDLA 3DROB 1RZIB 4X6FB 1EGJL 2FATH 1NFDE 3JBG7 2UY7A 4PGBA 4PR5B 3BDXA 5JLZB 5FYJD 2AVGA 5GS0C 4U1KA 3HFML 1U8JA 5CWSA 4MAYD 5JW3H 5HVHC 1T2JA 4YX2H 4LPXA 4BZ1H 2ITDB 4LSDA 4FQHA 4WIQA 4CMHB 3TJEL 1KB5A 2HKHH 2XV6B 4B7IA 4HUXB 4UV7H 3SDAD 1OY3B 3K3QA 1MH5A 2GKIA 1WAAE 4GRLA 2AV1B 4DUVA 3QJFB 3B9KD 2AK1L 4P4KC 3P40A 1UC6A 4OJFH 5IEHA 4GXUM 3T0XA 1NBZA 5LVEA 1YNTB 1P53A 1HHHA 1TQBC 1EFXD 4KK5C 1BBJB 5ALCH 3OXRB 3PWJA 4ZSOE 1HK6A 4KTDH 5I1KL 2ZUQC 5FHBH 4ENED 1FVEB 1QKZH 3DMMD 1HXYA 2EC9T 3O4LE 1DLFL 3QDME 1YMHB 4F2MA 2H26B 1DL7L 5L6YH 4M43L 1JPSH 1FBIL 2WIMA 1DBBH 1T1XA 2BHYA 3CC5B 3RIFF 2AXJA 5GGVY 1H0DA 3WFHA 3U1SH 3WJLC 4WJ5B 1OGTB 4ZMAT 5KN5A 2DIAA 1VGKB 1OAQH 4WV1B 1HE7A 1OSPL 1U3HA 4HHAA 3IU4L 4I8DA 4JFOB 2WIIB 1D5BA 2XTJC 3A6CH 1U3HC 2JK5B 1AE6L 4MNGA 1VHPA 1JGVL 1ORSA 1R24A 1HH6B 5TH2B 5CEYB 5CHNB 3KG5A 2D7QA 4TNVF 5E2JA 1QR1A 3RAJH 5JXED 5KW9L 5EUOE 1UM6L 3MREB 2V2TA 2KZWA 1P7QD 3IAPA 1WBZA 4FQJL 1U8LA 1FCCA 5F7UA 3O0RL 4U6YA 3DX7B 4X6BA 1WZ1H 3TPUA 3C5JA 1NMBL 2YPKB 5B3JF 3D85A 2VZ3A 4FZEL 3D0LA 4YEEA 4ZO8A 1LO5B 3LMJL 3MPCA 1MFCL 4O2CA 5TF1L 4LDLB 1A7OL 3U2SB 2P5EE 2EIBA 3O4OB 3RWJA 3S37H 4MD0B 3T0VA 1EV2E 4XCNA 1G7PA 1F4XH 4K2UH 1JHKL 4NNPL 1LK3H 4EI5A 3AM8C 2DQCH 4AMKL 5ILTH 1NC4B 2LABA 5C0BA 4C4KT 4ELME 1S9VA 4J12A 2MSPA 3DV6B 1FVDA 1I1FA 1MCQA 1DFBH 3WIFB 4LVEA 2DQHH 1MY5A 6FABL 3NH7L 3ZHDA 2HTLD 1N64L 3GMQB 4LCWB 3SDDB 4L4VB 4HEME 1MRDL 4KKBC 4ZFOA 1I8KA 1L6XA 3OKYA 4IOIA 4XPGL 3HI1B 3QEHB 2DI8A 3FHAA 4HH8A 3OBAA 3EYUL 5I76B 1IGIH 1SM3L 2YSSB 3PXHA 5EO9B 4DZ8B 1W8NA 5DEFB 5DUML 3MLRL 2NZIA 1FL6A 2B0SL 3ARWA 1RUAL 4NNYB 3U6RA 3C6LA 5EOCJ 1UWXK 4Z7VE 1KGCD 5J89A 1N4XH 5C08A 1CDBA 4MD0A 3TO4C 2JCCA 2BVPB 1GGUA 4OQTA 2CH8A 2Q3AA 4Z7NE 4CAGA 1S9YB 1IAIL 4Q6IA 4R8WL 4JJ5B 1E4XH 5GGRB 3EOTH 2WW8A 5L2KA 1KF9B 1MHHB 4K9EC 4RRPG 4ZUUA 3L3GB 4D94A 4NQED 3QR2A 3IDMA 3TT1L 2R1YA 4AM0B 2LE9A 3FQTB 5DJ6B 3GIZH 4PJ9D 1UJ3C 4MXWL 4P5TB 4L8DA 5KSAA 2Q76B 1JNJA 4NKMB 4C57C 4NNXB 5D2LF 2GITB 3GSNA 4RISL 1MAML 3ZDYF 1RZJH 4CVZB 2JIXB 5E0QA 1CD8A 2MWCA 4L29A 3DMMA 4YFLF 1A64A 5TPWH 5C08D 5DRWA 5D1QB 2H26A 5TFSH 3O41A 3FQTA 1ZLWH 1RZKC 4DVBA 3U7YL 4HK3N 2FX9L 4GOSA 1DBBL 5DJ8A 4JDZA 4OKDA 1RUKL 3T08A 1UM5L 2AJSL 4WHDA 2D03H 3T2OA 3NFSL 3VGAB 4XP6L 1SEBB 5HYQB 1CD0A 5SWZA 2GJ6D 1A3RL 4Z7QE 5C0CD 1FE8L 2BVUA 1TVBA 4GG6B 5DO2D 3DSFL 4P57B 5KSBF 1MUJB 3G08A 2VDQL 2NX5D 4OZFH 3REWA 4IJ3C 3PGCA 4EI5D 5F1NB 1CE1H 4YPGB 1KUMA 2YSSA 4CBPA 4ISVB 3WKML 4WI3A 5SX5H 2DIBA 1I1AD 1ZXQA 1U8JB 2VZ1A 1LEIA 1GIGH 1QFUL 2FHCA 3CVIL 2N4IA 4S1SL 1H3XA 3RWFB 3O3EA 4M4RA 2F54B 1J88A 2KZ1B 2EKJA 3EUUA 3MBED 1SBSH 2P8PA 4HKZA 1P2CA 1A4JB 1OW0C 3H0TA 3QXAB 4QXWA 4XCEA 5F9DC 2VXSH 4YBLB 3DROA 4LU5H 4RAVA 4QO1A 5I15H 2I60H 1PYWA 4TTDC 5EPMB 4PGCA 2RJMA 2P24A 3AS1A 2E7LA 3BIBX 4GBXB 4NO3A 4YC2B 3OKOA 1XIWC 4KUZL 3ILPB 5F7DA 2R29L 1G7HA 4HW6A 3ARPA 2YA2A 4YC2C 5EFIB 2R2BA 2DLEA 4KKLD 1JWUA 3VXNA 5IHUL 3ZKMC 3SY0B 4DK6A 1FDLL 1JL8A 2X7LB 2IWGA 3BKML 3K4AA 1QR1B 4YHKH 2Z35B 2HJKB 2FHFA 5C6PB 1I75A 2N7BA 4JM4H 4S1RL 1NSNL 1A9BA 3P30H 4ZOCA 1I1YA 1WLHA 4NWTL 5D6CB 2ZJSH 1MPAH 4HIXL 3WDHA 5LQBL 1AGDB 3O9WD 3T0DA 2IAMD 1WT5C 4OZHA 4MJ5B 5C9JB 1T03L 3QCTH 4GG6E 2CRYA 4QNPE 1CGUA 5FDYA 2P5WA 2D4FA 5H8DA 3F7PC 5DMKB 3CX5K 1NC4D 1NQBA 2Q86A 1DQDL 4NM8L 3VFPB 3T0EC 4BFIB 1E28A 3VXOB 3HE6B 2WWKT 3RGVA 1LDSA 5HYJE 1C12A 3V0WH 1INEH 4JANB 4U6XB 1QSFE 3L7FA 4XRCA 4Y5XB 1P4LB 2WBJB 3EYQD 4P2QB 4KJYB 4E41B 1CLOH 3TT3L 1T66C 2VLLA 3KPRB 4AIZA 2HLAB 2XT1B 3GSNL 2ITCA 5E2VH 3RFZC 2XXCB 1KSRA 3EO1B 3Q0HA 1LO4L 3MNWB 1XCQA 4HIJA 4DKAA 4O5LH 5DJXA 1I1RA 1A2YB 2CDEA 3LSOB 4KDTC 1JI2A 2A6DB 3LSOA 3PV7A 4KQ3L 5GSVA 2A6IA 4ODTL 5KSBE 4UDTA 3U0PA 2IANE 4OT1L 2D7MA 1ZHLB 4FXLA 5HHXH 1RUQH 3MV7D 4ZO9A 1DQML 5IVXE 4Q97A 3ULUE 1CBVH 4D0CB 3OG4B 2R1WA 1A7QL 2AJYH 2R1WB 2F58L 3RAJL 1RJZA 2MNUA 3X3GH 2EYTA 3K4DA 4NM4L 4M7LT 4MAYB 2OMNA 4L8CB 1DQLL 1WZ1L 4I9WE 4NQEB 4WTZA 1A6PA 3OKEB 1I3UA 3S98A 1YNLL 4X9BA 2MHAB 4QYOB 1FG2A 2VLKB 1QNZH 3EO1A 1EO7A 4XH2B 3FQUB 1IGTB 4HWBH 5J13C 3B9KA 3H3PL 1ADQA 4FXGB 5DZLA 1TQCB 4MB5A 4YHOL 1B0RA 1IC7L 3TO4B 4MNQA 2FL5A 4XNZC 3GK8L 3ZLQC 3ZKSD 2OI9C 2V2XA 3AC0A 8CGTA 5DF0A 4LARL 1UM6H 1YMME 5B8CA 1I7UB 1SBSL 2X4TB 3DECA 3R1GH 2B7DT 2MQ3A 4LSTH 5C8JB 1G7LB 1MCCA 3KYAA 5F1IB 3NZHH 3HZMB 3W5NA 4LLQB 3CAFA 4QRUA 4EZMA 1NMBH 2E6JA 5I66B 2Z93B 5T3ZE 1UM4H 4UBDC 1R6VA 1G6RA 5HGHB 3BRDA 2BFVH 2ZSVB 1DVFA 2XWBA 2KH2B 3D69A 1HZHH 4WWKC 4OIIL 5EPMA 1SVZA 5HY9A 1F97A 5GS0H 3OAZH 4GRLD 2GY7B 3EDFA 1BHGA 1QO3B 3EYQC 2F5BL 1PFCA 1JWUB 4WI7A 4S0SD 2WWMD 4HFWB 3K1KC 5LWYH 1BMGA 3VFNB 2PO6C 2WINB 1G9MC 3QXAA 2EYSA 2H32A 3H0TB 4XCEB 2IQ9L 3MV9B 4XAWH 3S36X 1A6VH 3V9FA 4JEGB 5DHVA 5C07D 4XPGH 4Z18A 4HUKB 4HZLB 2EDQA 2ARWA 1DUZB 1QP1A 3CFDB 2ZPKH 4BSWB 4F7MA 1RUAH 5FEBA 2MCG1 4ZXBC 5GGUB 2VH5L 4ZAKC 1RQ5A 4UIKH 4QEGA 3T4AA 2C5DC 5DJZA 3UBXB 4JANA 2GQHA 2VLJD 5SWZB 3BW9A 1QLRA 2RFXA 5J57B 4YNYB 4Z7WF 3GSNH 4OUUA 2I9LA 1RZKL 4Q0XH 1T0NA 3MBXH 4JO2H 4UTBL 1GYAA 5DGRA 3TT1H 4X4XB 3O6MH 4K8RL 3ORJA 5HHOA 1O5DT 5C9KA 5IGXL 5MENA 2FH6A 2VXVH 1ZHBA 5JOPD 5L7XH 2FO4A 2WWMC 1F3DH 3VH8B 4NRZB 3KYNB 5DRWB 4I77L 1YPZB 4M6AA 5IWLC 2W0PA 3NCJH 1NKOA 4O2FA 4BK5A 2FCBA 4DK3A 3VGBA 2IMNA 2BNRA 3L5IA 4LGPB 5IB5A 4P46C 3DLQR 2NXZD 3FB6A 5E8OA 1T2QL 4D0BB 1ZT1A 1W72H 1T7VA 3CVHA 1R3JA 4KUCD 1DN0B 2XG5A 3SE4A 4YGAB 2DQFB 1LP9A 3U7YH 4ZTPH 4WUKH 5AWNL 1UZ8B 2YHGA 1INQB 3MZGB 3OJMB 4XNQB 4UV4H 3ARGB 1Q9WB 1F3RB 2H8PA 4J3UA 1EHAA 1PSKL 3EFFB 2DM3A 4X7SH 5EBMB 3PDGA 1PYWB 5IBUB 5KVFL 2XFXA 5L2JA 4PV9A 2SEBA 4P49A 4PGCB 2JIXD 1ADQL 2CK0L 1NGYA 3THML 3PIQA 1YYML 3CH1A 3KDMA 4U1JA 3RU8L 2GTZA 4ZAKB 1S9WA 2VDQH 3RRQA 1W0WA 5CP3A 1B0WA 1JWMB 4X80H 5C08B 5DEFA 4LNRA 5D1QD 3WEXA 4NQCE 4O02L 1X3DA 4EOWH 1YEGH 4DAGH 3WKMH 3QQ4B 4GXUN 2FD6H 4I18B 3MODL 3Q6GL 1U8HB 5I8CA 4PJHE 1P7KA 4U7SA 1G9ML 2G75B 1FNSH 5F72S 3SKOA 4I3RH 4LNVA 4AG4H 2VAJA 3D18A 4WO4A 4BQCA 3BIAX 3ARDB 5BJTB 2OMBA 4QOKA 2APVA 5B22A 5LGJA 3BPNC 1L7IL 3HZKA 2UY6A 1BREA 1JPTH 2X9XA 2BVOA 3MUY1 1KOAA 1KPVB 3QCUH 3UO1H 5ERWB 1A7BA 1IEAA 1KG0B 4NDMA 2X1OA 4QXUH 3OKNB 5T3XD 3RVWC 4ZG1A 3O41B 3QHFL 5D1QA 3WKNA 4PRHD 3TBYA 3QWQB 2OR9H 2YWZA 3MBEB 3MRLB 1EEQA 1NCNA 1UWGL 1TTFA 1IRAY 2VTFA 4JZJC 5B39B 4F7PA 3UROR 1CT8A 1NGXA 1X4ZA 2Y36L 4H20L 5EBWA 3SDCA 3ES6A 4Q9RL 3QUXC 4LCIL 4QHNB 3D9AH 3BZEA 1Q1JH 5D7JB 1G9NH 3ZDYE 2AI0L 1AXSA 2E6QA 3LKRB 4K7PL 1JN6B 4UIMA 3HE7A 1PBYA 1MFEL 1CL7I 2CKBA 5DJ6A 1AHWA 3FB5A 3D85D 4HIHA 5BO1H 1EVUA 5F6HJ 3TZVA 4P5TA 3OAUH 3TBYB 1AQDB 5F21B 2FEEL 1IGFH 1DBMH 2CUMA 5GRUL 1DQDH 4MQ7A 1HDMA 3LD8B 5HJ3A 3SDCD 4WW2C 1HHGA 4U4BA 1KEMH 1CD1A 4U2YA 2VE6B 5FDWA 4ODSH 4Z9KB 3GDBA 3KYOB 4Y4KD 1GZQB 3DARA 1J9CT 3W9EA 3QRGH 4M5YL 5D8JL 2X4QA 1AGCB 2BY2A 1W72L 4MAUL 5AUMA 5BV7B 5FKPA 3MRJB 1UENA 5FFLA 1LO3L 3HMWL 4U0RC 4Y19A 4L4VE 3DTXA 4LIQH 4F7CA 4WW1B 5BOZG 4RX4A 2YD9A 3JTSA 4JFZH 4JRYD 1BBJA 3VG9B 5D7JC 4UI2A 5D5MB 2ENSA 2ITDA 5CBAA 3AREC 1ZSDB 4RMRA 5SWZD 4PUBH 2D7TL 2F19H 3KLAA 4CN1A 4JCMA 1DEEA 1P7QA 3HN3A 5HDLA 2B1AH 1YYMH 4ZAKA 4PS4L 4NC1E 3WNLA 2YXMA 3P9LA 4LRNH 3D25A 1UM4L 5DD0L 1GGYA 5I17B 1AO7E 1U8OB 2BX5A 3HUJF 5HHQA 3QIBB 4PRBA 4X8JA 4MB4A 1J1XL 1TTUA 4ZS6C 4LL9A 3CPLA 2NXYD 1F11A 3G6DL 4PGZA 5E2WH 5BRZB 2DMCA 3MV7B 1H9VA 3CSYB 1BVLA 1VFMA 5HI4C 4WFGD 3MNVB 4K3GA 4K94L 2H41A 1K9TA 1CIUA 3SKOB 2KQMA 4XXCC 3MRPA 5FA4A 1C08B 1S7UA 3MLXL 3OMZA 3E8UL 4NHCH 1OD9A 1D9KB 1FJ1B 1T04B 2LU3A 3DO7A 3FFCA 4ZD3L 1U8MA 5ADOL 1UXSA 3UYOD 4KVNH 4P2OC 5CEYA 3IJYA 3BWAA 3DGGA 1CU4L 4DQOL 3DRQA 4JKPH 3SDYL 3FMGL 5GGVH 1H8NA 1N6QH 3ME0A 4N0YH 1G1YA 5DDHB 2E7BA 1N8ZB 3TIDB 1UB6B 3QHFH 2F5BH 2V17L 3H9YA 3QHTC 4WU7A 5E1AA 2Z0BA 3RWDB 4JLRB 3PHSA 3ARGA 1G1CA 4O4YL 2BVQB 2WUBH 2EH8L 2NY3C 3C8KA 4KI5F 3PWPA 4QWWD 5BXFB 4IJ3B 3V0VA 4JZNA 4JB9H 5MHSD 1TJIL 2XXMB 3R06A 3MGTB 5F7NC 3MX0A 4ODWB 5MENE 4E5XA 4J23A 2ADGA 4K3JL 4UV7L 4IHOB 5D72H 1ZMYA 3I9GL 3BSZH 3RL1B 3KPOB 2O5ZH 4PJIA 5D2NE 1W0YT 1H3VA 1CXFA 3HG1E 4JFDB 4HZAA 2R0KH 5AEAA 1KIQB 1BBDL 4NP4L 2RQ8A 4APQA 1DBKH 3V7AG 5MP6H 1P6FA 2FGWL 4K3EL 4BFGA 4CVXA 2D0FA 2BZDA 5CMAB 5F6IB 3P77A 3PHQA 3K46A 1CLYH 2EO1A 4YBQD 3L3KA 3TWCH 1F4YH 5F7EL 3VFPA 1QLRB 4JO3L 4GW1A 4P2CG 5CD5C 1TFHA 3MYJB 1I7TB 9CGTA 2XWTB 3MCLH 4P5KB 5ISZA 5EU6A 2DQDH 1F4WL 5DRZB 1I9RL 1W72A 3RVTD 4FQXA 2ZSVA 3ARDC 2G5BB 5HGHA 4Z7WA 1YEEH 2VIRA 1QLFA 5MEOA 1HEZB 4DKDC 3JWOC 1MCHA 5CSZB 4ZS7H 1FH5H 3L1OH 5E2UL 3CDCA 1SYVB 3EDJA 2NY5C 5D71H 5GGSB 1KLGB 1FZKA 4BZ2H 4PJAF 2HT4C 3SPVA 4GMSH 3FO9A 3V6OC 1U3HD 3OJDB 3QEUA 4JN2B 1NKRA 4IMLA 1EGJH 2FATL 3CD4A 4HS8H 1UJ3B 3MJ9L 4LCWE 2DL9A 1EERB 2X05A 5MEND 5ENWB 1C1EH 1FPTL 3RDTB 5T1KD 2YMXH 5B3NA 3GJFK 1NCAL 4NZDA 4DGVH 5T3XE 2YPLB 1FLTX 1FN4A 1HH9A 2Z92B 3QG6B 2Z31B 3D2UB 5FO8A 2NW2B 3EHBD 3MOBL 1K4CB 4JRXB 2VL4A 3OKEA 4JY6B 5D93B 3RVXC 1RULL 3QDMD 1VESA 2QHLA 5IKCA 2VIRB 3K8MA 1CXKA 4X6EB 5I6XC 3DXAA 4NSKB 3RWGB 4F7EB 3JWDH 1J05A 2E27L 3PQYE 5FKAA 5I66A 4XI5C 4GSDH 4XP4L 3AVEA 2PYFA 2X4RA 1YQVH 4TULH 3V52L 5DK0A 3QIWA 3N1MC 3MRNB 3MYJA 3FFCB 2OP4L 1EXUA 2YC1A 4GO6B 2D31B 5I1GL 3PDOB 1CFTB 4MSWB 1M71A 4WGWB 1T7XA 2BK8A 4KK8C 5IEKB 5D7LD 1FNEA 4WHCA 1P9MC 3K1DA 3UTSB 1XCQB 2Y36H 2KBGA 3VXRE 2IFGA 1JGDB 1IAMA 5J6HA 3CUPA 3HPLB 5JZ7C 1FP5A 5EN2B 4NPYA 3TBVB 2B5IC 4RAUB 3RWEB 1FV1A 5JORA 3EYOA 5INDB 3GUTB 3CLEH 1VADB 3PHOB 2UWEE 4ETQB 1KPUA 5CLWA 3SBWA 3GHBL 4PJBF 4E5XB 1OVZA 1QHPA 1FZMA 4LSSH 3WV0A 2HJFB 3LS5L 3J7HA 1K6QH 5JNYA 35C8L 2ZUXA 1IC5L 4Z77B 1T5XB 5AAMA 5IVZB 4TSCL 4U1SA 1NBYA 3DNKA 3KNBA 3KWWA 1OB1A 5D6CA 3ZO0A 4RGOL 4YHYB 2ED8A 1UZ6E 5E8NA 3K7UA 1MCBA 5D1ZD 5B39G 25C8L 3O3DB 4Y19B 4OZIB 1JTTA 3IKCA 4TRPL 2PXYB 5FOBB 3V4PL 2R2EA 1LK3L 1I3RA 1MCWW 4JFPB 4Y2DD 3TWCL 3WDJA 1SJHB 4MQXD 1GOHA 2DD8H 3OR7B 4O9HH 1IGFL 3PNWB 2X41A 4KI5E 4WEUD 3W9EB 5JOFB 1IEBA 1CD9B 1C5BH 2CJUH 5DD3H 2IPKB 1NUDA 3QPQC 3TV3H 3WXVH 2GUOA 1YEDB 2W07A 2DWEB 3FZUD 4G7VL 3REVA 5DUMH 4CMHC 3MLRH 4U1MB 5FB8A 4BSVB 3I6KA 1FH5L 1VFOA 4Z7VF 5E03A 4N0FB 1OL0A 4BZ2L 4G8IA 1AGDA 5DT1L 1OAXH 2J4WL 4MQTB 2EDOA 5KG9B 1JTOA 1AR2A 1AIFA 1IILE 2VN4A 3GMOB 3QEQE 1Z0MA 4V1DD 2EEAA 5E00A 3WS3B 4J4PD 1EZVX 5I8KL 2J1KA 2EH7L 3MJ9A 2ADIA 1D9KA 1FJ1A 3P9LB 1HHKA 4E0RA 4QRTB 1G6RL 5E7FA 2BMKB 4RMTA 1RAMA 1LP9F 1Q9KA 3EO9L 4WU5A 4OJFL 3MRKA 4CGTA 2R56L 3BKJH 4MVBD 3FOMB 3QNZB 2W91A 3IDJB 1K4DB 2H9GB 3VJ6B 5ALCL 3MSPA 1OQOA 5D96B 2IH1B 2WUCH 5CSBA 3BT2L 3C87A 4JJ5A 5GGRA 4XWOC 1YPZE 3EFDH 2NY4D 4AH2A 1E4KA 2FECL 1CGXA 3KGRA 1S8DA 2HT3C 4B50A 5CIPH 4GS7B 5HTSA 1MJ7L 1UQSA 4MA7L 3P73B 1UYWH 2BVTA 3HC4L 4X6DB 1LO5A 3VFOB 3QQ3A 2P8PB 1GC1H 3C6LB 4PJGF 4MAYC 4FN0A 1DZBA 3OB0K 1P4BH 3MOAL 5F3HA 3MRKB 2F54A 1Z3GL 4J3XA 5EUKB 1A5FH 1WCBA 4E0RB 1WGOA 4JPVH 4F57H 1J7VR 4OZ4B 4UQ2A 3L7EB 1W2KT 3DMMB 4PGEA 1KEGH 4NZTL 1NSNH 2YZ1A 4ONGH 2CUIA 1X5KA 3QFJA 1BF2A 4ZPVB 1DBJL 2JJWA 4PJDA 2QSTA 5KG9A 1FIGL 1L0XA 2FRGP 3S4SA 3BSZL 3VFMB 2FBJH 2GSGA 3O6FD 5JPMA 1NMAH 3MXVL 3FAXA 1CICB 3P0VH 4OFPA 5CILH 1BBDH 5GS2H 1JJUA 2GUOB 3LS5H 2XQYK 1LWRA 2G5RA 5B21A 3W0WE 2VXUL 1VFAB 4NYLA 4NQSA 3S37L 3L7EA 1JHTB 1HWGB 2W0KA 2Y4SA 3IETB 3QFJE 4JFFA 8FABA 2DQIH 3FRUA 5TJWK 4OF0A 2OZ4A 4XPAH 2DLFL 1RZGA 3U4BL 4YDVB 3DUUA 4JHZA 4AMKH 4XNQA 4WWKD 25C8H 2DWDB 3JV0A 1OTUD 5GGQL 3P0YL 1XCTA 3JSSA 3FN0L 4U1HA 3VD3A 1QG3A 3MCLL 1D5XB 4X4ZA 2WZPD 2C3GA 1EO8L 3V7AE 4CKVX 5IT2L 1PLGH 1MCRA 1ZTXL 3OKMB 4QHNA 4LCCA 4UU9B 4ZFFB 2H2SC 1KJ2B 1JF6A 4XVTL 3LB6C 5EUKA 4XVJH 2DKMA 1D5ZB 1QSEE 2Q7YA 2R29H 3GBNH 2ADFH 3BZFA 1XF4B 5DQDL 5C0NC 2EDXA 2CLVA 3LRSA 5BOPA 4HC1A 1XMWA 1B9ZA 2CMRH 3N06B 4JFFB 4L1DA 5I19L 2HG5B 2VZUA 3ZKXC 3T3PE 1GGCL 2V7HA 3T09A 3AU1A 2X40A 3RA7L 3PHOA 4RGNE 2AXFB 3WN5C 2K7QA 2DOCA 4OF5A 2DQDL 5C0GA 2OK0H 4RAUA 3B3IA 3HUJE 1YUHB 1AGBB 4XNXH 3QUYC 1LEKB 3S96B 1GOGA 3WEXB 2B5IB 3OJ2C 3WS6C 2NY5H 1G7QB 3PWLB 4BJLA 3WDIA 3D0VA 3L3OA 4WFEE 4ORGB 5CZKA 3HC0A 1OARH 2O5YH 5CKGA 4Z7UA 3SGDH 3DBXA 5J3HD 1MRFL 4HXBH 3IDGA 5JA8B 1NLDH 3SCMA 1AJ7L 1QA9B 4H88L 5CS7A 5CHNA 5LCVL 2JB5L 1WICA 3MRFA 5ESQB 2GTWA 3TYFA 3STZB 3ULVD 3LKNA 1BPVA 1U8KA 2VDLL 3PIQB 5CSGA 5EZIH 5ELIA 1HWHB 2GTZB 4U1JB 5EBLB 1TVHB 1P9MA 2QQKL 3RUGB 4KROC 3VGAC 2XPGA 1O7SA 3KPPA 2B4CC 5IB5B 1U2CA 1JZ6A 2D03L 5EB9A 4N68A 4PJXE 5IW3A 4Y5VA 4XPFL 3H9SB 2Z93A 1JHLH 3V6ZA 5CJ5A 4HUWA 1NMCB 4YXKL 3L3HB 2A74B 4XCFL 4OCLC 1A14L 5AYUH 2F8OA 5KOVC 4ELMB 4GBXC 3K80A 5C1MB 1WBZB 1T1YB 3QNXB 1Z2KA 3KPMB 4U1NB 3ARFB 4QTHA 4OGXL 1UH4A 2NY4C 5KANI 1F3JA 3OAZK 5L8LB 5ID1A 2GI7A 2CKBL 3BD3A 4QHUB 1AIFB 1IGCL 2ZUVA 3IKCB 2OTWA 2WLYA 4HQQL 1XGRA 4CMMA 2BXZA 4LKXA 2GJ6B 4LEOB 4KJQD 3D3VB 1A7PL 4GRLC 4XZUB 3F7VA 5E70A 3WFHB 3LDBC 4GRMB 3BXNB 4TRPH 3EOAA 1U3JA 5E8PA 3D48R 1T5XA 4OCRH 3NIDF 3I85A 3QNYA 1RIVH 3MJ8A 2AEWA 4XWOD 1AFVL 2B39A 4UNVA 2A38A 4RA0C 3V6OA 3U9UA 5HYFA 3D87B 2O5XH 2APTA 3GKWH 5FYKH 2APXA 3NVQA 3OHXA 4M4PA 2FJFA 1YN6B 4XVSH 3HAEA 4JFPA 4K8RC 3VXSB 4JO4H 2BFVL 1WFNA 1H3PL 4HUXA 1EMTL 3C8DA 1OLLA 5ICYA 5BV7C 5GS0L 3QXVA 1KCUL 4GAGL 4XP5H 1OAXL 3JV6B 3T04D 4RWYH 5IB4A 5AZEH 1NFIA 4WUKL 1CLCA 5CWSB 5IQ7H 3MLWH 3TN0A 3I6GB 1F42A 2LAAA 3QDGA 3RZWA 4X5LA 1YECL 2EZ0C 4FNLH 4RX4D 3LDBB 4G6FD 3DXAB 3AROA 4IMLB 1F8TH 1ADQH 5D1ZC 5EC1B 1KLGA 3SN6N 3FFDA 4WUUE 4LQ1A 4G7VH 5D2NA 4N8CL 1RHHB 4I9WD 1F00I 5E8DH 2BY0A 1LK2A 3VI4E 4DGIL 3OF6A 2YPLA 1MRFH 4HXBL 3FT4B 4JFDE 3QWOA 3J8F7 2J4WH 3ARSA 2GEEA 4GUPB 1SJVA 3H42H 3VXME 1RY7B 1OAYH 1I1YB 1N5AB 5HI3D 1EEYA 4LCYA 3TCLB 2F54E 1NH6A 4ZQKA 5GJTH 2R69H 4H8WC 1X5LA 2BP3A 4U6VL 5T5FL 4PRPE 4AG4L 5I73B 3MUGB 5I9QC 4NQCD 3RKDD 4Y4FB 3BKCH 1DLHA 4LPTA 4R6UA 4MA3B 5ID0A 3FT4A 4P2QD 3QFJD 5DJYA 3IU4H 2VQTA 4LLUA 4ONGL 5AD0A 2Z91B 1IJ9A 2W38A 1EIBA 2BSSB 3ARRA 4LF3B 4A2MA 1TMCB 1DUYB 5C6WH 2FHBA 2NPLX 3O2WL 3OG6B 3QG6A 2VQ1A 1TZIA 3WNKA 3DVNA 1GHFH 2EDKA 5MERB 4XMKH 1BOYA 3OZ9H 4L4TB 4PREB 3PABA 3PL6A 2CDEB 4WI4A 1TVDA 2OQJA 4FQJH 2LV4A 5DD5H 2EKSA 3O2VH 4NQVB 1HXMB 1IVLA 1X5GA 4FZ8H 4TYUA 2EICA 4UT7L 4XNYH 3O8XC 4XVUC 2Y07H 3VFVA 1HSBB 2X9WA 3NTCL 1J1OH 5TQ0H 1FL5A 3CDYA 4HMDA 2DQGL 4PGJA 4UOJA 4M6OL 3EYFB 5C0AA 4FQ1H 5A2FA 1ZK9A 2VKWA 2AQ1A 1I3GL 3WN5B 4J3OC 1TNMA 1ZVSB 2ADGB 3HI6L 4ORGA 2DQCL 5T5NG 5DD1H 3KPRA 4AIZB 5C0EB 1KCSH 1OAUL 3F5WB 3CCHB 3ZDXF 3GHEH 5E5MA 3A6OA 2JJVA 1WWAX 5CZVL 3TO4D 1JF5A 4PRAB 4QCIA 3M8OH 1HCFX 2B1HH 1A9BB 4MLSA 2HP4A 1MRDH 4FQCH 4Y5YC 4JQXC 4LSRH 3V6FA 5DO2C 5F7KC 4PBXA 1BLNA 1NCBL 1NDMB 1YEJH 4YHIA 5SX5K 2J5LB 3RI5F 5IBLD 3VXOA 3S88L 1IGIL 2F53D 3FFCE 4KK6C 1U8NB 4IIQA 1WSST 2B2XL 2CMRL 1U92A 4EXPX 5IOPB 3ARUA 3LD8C 3RUGA 1MOEA 4JHAL 3SKJL 1INDH 4RMVA 1RMFL 5BV7H 3BXNA 4P2RD 3V6ZB 1AXTL 3HRZB 2XY1A 4CVZA 4QHLA 4P2YA 5IK3A 1T80A 2VDOL 1CICC 1QYGH 3HI5H 3TNMA 5IW1A 4HCRL 5DZNA 5DYOA 2WBWB 2H2SD 4HK0B 2H3NA 2MPAH 4F7PB 3VXSE 4ELMA 1LHZA 3RVUD 3CFBA 4AM0A 1M6OB 3Q6FB 2ADFL 1ULVA 3M1BA 1DQJA 5TE4H 5A16B 4IRSD 3T2QA 3I75B 4JDVA 1X44A 3STZA 3FTGB 3C5ZD 3QWRD 4ELKB 4G43A 5C07B 1A8JH 3W0WA 4OLVL 3TNNB 4TVPE 3U36B 1UH2A 1HN1A 1KPVA 3QO1B 5CP3H 5EBLA 2BDNH 3FQRA 3LOWA 1I1CA 4KFZC 1YC7A 2ZSWA 2VDLH 1HSAB 2WQ8A 4M7JH 2O61A 5DQJB 3QRFM 3QPQD 5DK2B 4Z7VA 1D5MA 3R8BB 2OL3L 3IFOA 3U0TA 1A6TB 3BN9D 4JVUA 1A1NA 4ZUWB 3TO2A 4JVWA 2Y1VA 3QI9B 4U1IA 5D9SB 2VDNH 4U49A 3MO1A 4P4RA 1J0ZA 1URLA 3NCJL 3PDDA 1VCAA 4JFFD 2HT2D 1CDYA 1OCWL 2BVYA 3CFCH 3NIGF 3MLUH 2XA3A 4HX1A 2LFGA 4C56D 1WZKA 4HF5H 4YEFA 3F12B 2W9EH 1BZ9B 1QKZL 3BZFB 3TZVB 5HHMB 5T1LB 5BMFH 5DVNA 5IESH 1IT9L 2VLKE 1JYNA 1GZPB 3W2DL 2R8SL 3N1GC 1QSED 4X4ME 3JVGA 4IEFB 4AEHL 2BC4A 2OTUA 2Y07L 4OIBA 3ES6B 5KVDH 1U9KA 4PJHA 1Q0XL 3VXRA 4HXAH 3UBXG 4U6HB 3BOVA 1V7NL 1MIML 2MQ0A 1LVEA 4RGND 1YMMB 1YN7B 5ICXB 2X4NA 4P9HH 3O3AB 4YDKL 1J8HE 3IS1X 1XF4A 4HIHB 4RIRB 3DVGA 1MJJB 5T33L 1VGEL 2DYPA 4J3SA 5IB2B 1I8LA 5FYKL 4A6YH 4FG6D 3OB8A 5DD1L 1JRHH 4NN7C 4N9GB 4NQCB 1I9JH 4Y4FD 3C60D 4F37K 5T1DH 4HV8A 3MODH 3Q6GH 1XF3A 1V7MH 5DUPH 2Q87A 3GJEA 2XA8L 3GSUA 2B1HL 3BX7C 4M00A 1HQRB 5FA3A 3EDKA 3BN3B 4ODBD 2E8YA 1D5XA 5BS0E 4QOKB 2XKUA 3G6DH 2GCYB 4RDQF 4P2OA 3NZ8A 1GOFA 3MGOA 5DR5H 2X10A 5F8QC 5IHLB 4PJGA 2VUYA 3MLSH 3QAZC 3SJVA 2M8XA 2F74A 4OM0H 5FDWB 5HGBA 4FQ2H 3TH4T 1FFQA 3NABH 5SV3A 1AFVH 1JRHI 1TENA 3SGJA 3VRJA 4JHAH 1IEAB 3L5XL 3FKUS 3GJFH 3F12A 4PJHF 1EAPB 5H35A 5JW4R 4NQSB 3NPSC 3FZUC 1CK0H 1FLRL 3WO3B 4PG9B 3E2HB 2ZJSL 4HIXH 3VWJD 1A0QH 3MO1B 5IV2B 4H8WH 1RZ8B 3WUZA 3D3VD 3SEPA 1S9VB 3W81A 4HCRA 3Q2CA 2NTFB 1EHLH 3FRPG 4G7YH 4YXLH 3L5WA 1JFQH 4HULB 5GHWH 4HX1B 4MQXC 3U0WL 4D2NA 1QPXA 4DZ8A 4K23H 1IGML 4CVUA 4HKJA 4H26B 1KTRL 4NKOB 3W0WB 3MLYL 3TP4A 1EEZA 4CN4A 1FYTE 4K9EH 3EOTL 3QA3A 2WP3O 3AS3A 4IRJD 5IIEB 1UZ8A 4WHYG 2RB8A 1TJIH 2UUDK 3ZDZF 4ALAL 4M7JL 1J0KA 2CUHA 3BRFA 5DXWA 1DN0A 1U8LB 4J3TA 5HHPB 1ETZB 5CFHA 5IJKC 4ZXBA 2LVCA 4K3JH 1YJDL 3I9GH 5TE6H 4PV8B 5M7QA 1IM3A 5E8DL 2A83A 5LGJB 4FA8A 2GY5A 4WI5A 4Y88A 4OD1H 2EE6A 2QSCH 4G6KH 2EDJA 2H8PB 4RFOL 3TFKC 4PJXF 3GMRA 4QHMB 2DDQL 4QRSB 4OFIA 3CFCL 3D85B 4WV1A 5HD8D 3QIBC 4NM4H 4LHUA 3ULSB 3W5MA 1GJIA 4NN6B 3REVB 4WTZG 5HHNA 4AYFA 3MRDA 5TFSL 3GRWA 4Y4FC 4XNZB 2VDML 4PYGA 5CGMA 5CEZL 2E7MA 4IDJL 4OUOA 3ZTNL 4WFED 5I16B 5DS8B 3TNMB 1VPOH 3QEGL 1L4IA 3OF6D 2DQGH 1A9EB 1AHWC 4NN5B 3RKDC 1MI5B 3WD5L 3IKKA 3UTPE 1B0RB 1HKLL 3QUMH 4GRWH 1SJHA 4Z0BH 3FQNB 1PJ9A 1IGTA 1YEFH 3CLEL 3IDYB 3QUXA 4TN9A 4NRZA 2G2RA 5HDBF 2HVKA 4P9HC 1MH5B 3FFDB 4JR9H 4JZJA 5I8OH 3QZWA 5I1DA 1NGZA 5T3ZH 3VW3L 4ODUB 3EYFA 5DD0H 5J12B 1KNOB 2V5RA 3M8OL 5JOFA 4BKLA 3QXWA 2IC2A 3RVXD 4OF3A 4C54A 1G7MA 2PTVA 1KXVC 1OAKL 1ACZA 3GMLA 4OCSH 4F37F 3RWCA 1A21A 2EDTA 3S88H 4H5SA 2R9HC 3ROOB 2VLRA 1MCDA 2C3XA 3RWHA 4YHPB 1Y18A 3Q5TA 1MCPH 4C4KO 1XF1A 5ITBH 4LIQE 2X4UB 4HG4K 3SKJH 1DDHB 1FZKB 2EDDA 1C8PA 3RJDA 4LU5L 5HHMD 1OAZH 1A6WL 2FEEI 5DJ0A 2JJSA 1OAUH 3RTQB 1GXEA 3L3DA 3TIEB 4S2SA 2GSIA 5EZLB