4LCUB

Structure of kcsa with e118a mutation
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
212
structure length
212
Chain Sequence
DILLTQSPAILSVSPGERVSFSCRASQSIGTDIHWYQQRTNGSPRLLIKYASESISGIPSRFSGSGSGTDFTLSINSVESEDIANYYCQQSNRWPFTFGSGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular interactions involved in proton-dependent gating in KcsA potassium channels.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transport protein, membrane protein
molecule keywords Fab light chain
total genus 50
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 2013-06-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4lcuB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4lcuB01
2DM7A 4GXUN 2NY1D 1WTGT 4YX2H 3KXFE 4LOUC 4E41D 3T3PE 1EHXA 4XCNA 3TV3H 2YXFA 1MJJB 4S0SD 1RU9L 2R56H 3ZTJH 3QI9A 5GGVH 2ZCHL 2GY5A 1G84A 4KV5F 3CXHK 5CJ8A 2Q3ZA 3AS3A 5TQ2H 4RGND 5KZCD 1E4XL 1JZ8A 5KVDH 5AYUH 1T7YA 1OF2A 1HOCA 2AJZA 4KZEH 5TDOA 4B50A 3MRGB 4MNQA 3T1FA 5T3ZD 5CJXA 1VFBB 3KS0H 5ECJE 3T2OA 5DD5H 4QWWD 4K7PX 4JGJA 3GHBH 4X5WB 3B9VA 1J8KA 1V3JA 1CG9B 12E8L 1ZKAA 4APQC 1DBML 2OTUA 3MMEB 1NBYB 1CTNA 4LFHG 4YHIA 2C7UB 3CMGA 4AG4L 2FH6A 4JO3H 3A6CH 1QO3A 5DUMH 2OJEB 3HR5B 4NRZB 2V2TB 2R2HA 4XCCH 3WFCH 4HIJA 3TESA 3ZZ1A 3V6OE 3HI5H 3DGGB 1ZEAH 3EO0B 4BH8A 1OD9A 1XF4B 4QTHB 3HR6A 4LAQL 5C9JA 1U8IB 5DHXB 4OZHF 3L5WA 5IVOA 2BHUA 1ORQB 1CTOA 4P4RB 4RFOH 1CLCA 3M07A 3LIZL 1FP5A 3RTQD 4G6KH 3U6RA 3P4NA 3TT3L 3OKNA 5IVZB 1NGXA 5I1IH 1QBMH 3PP3H 1T20A 4JHAL 5FKPA 5D7LE 3D2UD 1JWSA 3EOAA 1MFNA 4OLVH 1OP5H 2P5ED 3QNZA 3RP1A 4AQ1B 2WV3A 2A6IA 2FEEL 1EHLL 4NN6C 4RGOL 4EN3D 4F7PA 1YN7A 1P84J 2R0KL 1RUML 3AAZA 1G7IA 2E7HA 3TNNB 1WTLA 2B4CL 3GJFH 3BKJH 3QUZC 4JO1L 4JZNB 4AENB 4R4ND 2MCG1 3AY4C 5TDOB 4H1LG 3WNNA 3K46A 2X4RB 4XT1C 4GG6E 3MRQB 4HSQA 3STZA 3VFUB 1A7RH 4ONFH 3TBYA 1ZA6B 5MP6L 4Y16C 4LVHB 5DVKA 3OHXA 1U8QA 2FB4H 3IKCB 4J7RA 3IJSA 4PJBB 4IRJA 3F7PC 1SYSA 1AD9B 1ZT7A 5C0AE 4OSUL 4PGJA 4JFDD 4Y2OA 1BZQK 4QOKE 4TNWF 5F7UA 4QHKJ 4QT5A 5IVXF 3NFNB 4YPJA 1HH9B 1NAML 2IAMC 1NGQH 1L0YA 2R1WB 5FYKD 3P4MB 3S3JA 3BZEA 3M1BB 4HXAL 5DS8A 5F96H 2J4WL 3CFBA 3ULVE 1JF1A 1J8HB 2HFFB 2FR4B 1CXHA 4LLWA 3SHSA 4QHUB 5JXEC 2W9LA 1PG7X 1WWCA 3K7UA 2CLRA 2OR9H 1QFUH 4OFYA 1IMHC 3CZJA 3GMQB 2FX8L 3N0PB 4G6FB 2JIXB 3WXVH 2Y06H 2DLGA 4EUPH 4RAVB 3FONB 3QH3B 4A6YL 4KKCC 4KGJA 5EZIL 2OCFD 4U6TA 5T3XD 3MGOA 1HZHH 2BY3A 1DN0A 1X6NA 3LCYA 3MODL 3OSKA 1C08A 5HHOB 4XNMA 1P7QA 2CGRL 1WC7A 1KTDA 4RIRB 4PLJC 5CHNA 5EO9A 3U7AA 4PJFE 1LEIA 2AK4E 5F7EL 4MA1C 2ITCB 3B3IA 3BDYH 4DOHE 5D7SL 5E1AA 4IHOA 4OF6A 3GO1L 2NY4B 3KS0J 3H0TB 5D1QD 5GGUA 4RA3A 3TFKD 2P8PB 4L3AA 4DKEL 2ADGB 5HGDA 1I9EA 1MLCA 3KPQB 5KZCB 5GSVB 3RUGF 1I9JH 3ULUD 1OAQL 2Q86A 5CP3A 5IT2L 3RWDA 1R0AH 2ERJC 1IC5L 2Q7NA 4PLKD 3RY6A 1YECH 2YMXL 5E8EA 3BSZH 2BNRB 2GTWA 4BSVA 1IKFL 2R0ZH 4ELMA 3O3EA 4IRSB 3SOBH 3GSNL 5E8NA 1OSPL 5FUOH 3VXTB 2GFBA 2ENSA 3I3DA 4XC1H 2HN7B 1A6UL 3KR3H 4M7JH 4R2GC 5EIIA 1P9MC 2AQ3A 3VXNB 4LQ1A 3CFKA 1HXYA 1S7RA 3VGDA 5CGMA 3GI9H 4LF3B 4XNUL 3WE6A 4DGYL 1E6OH 2AJSH 1A9EA 5EN2A 3DMMA 3V6ZB 3MTRA 2WUBL 4FQXA 4S1RH 3OKYA 3T0ED 1MCEA 4WFHD 4EZMA 1OGAA 1QLEH 4BKLA 3JZ7A 4HIXL 1BREA 1X5XA 4FQXB 2DOCA 2IFFH 1IQWL 4LLUB 4Z77A 4XMPH 4ZUTB 3T0DA 1F4WL 3VXSE 3PGFL 3WHXB 1X44A 2HJFB 4HFWA 3VA6A 4XPTL 3UZEA 3LKRA 1P5UA 1WFOA 4MDIB 3U0PB 1JK8A 4R96B 1MFCH 2X1XR 5I17B 1RZJL 3QAZC 2PETA 1IAOA 5ACMA 2OL3B 4ZOEA 3STBA 3KYOA 3N85H 3H7BA 2HLFD 3DVFA 1KIRB 3ILQC 4YHKL 4L8CB 1PLGH 2NZ9D 1MI5A 4TRPL 4HZLB 1GIGH 3O3EB 1AKJB 3ARFD 4IRSA 5EUKA 3Q1SH 3SDXA 2NYYD 5AD0B 3MCKA 1EEZB 3CDGB 3EYQC 5EU6A 4HWZA 3SDDB 4QHLB 2BZDA 4CVUA 4PS4L 3TPUA 4YK4B 2E9BA 4JFFB 4CNIA 1DQML 1OAKH 3FB8B 3GJFA 1JYWA 4M00A 4Q9QL 5INDB 2BC4B 3DPBA 1I75A 1N5YH 3P11L 3KHQA 1PSKH 2R2CA 4JJHA 4HULB 2HT2C 1BQHA 1OT2A 2XOTA 3ARUA 4KZEL 2YK1H 3SGEI 1I8IB 1T83C 2APVA 3HMWL 2VDNL 1Q72L 1SQ2N 3MRPB 3STLA 5IQ9A 3BD3A 1D6EB 2C3GA 1RUKH 2YD7A 1U3ZA 4ODVH 5HYJB 4X4ZA 1J8HD 12E8H 4RGNC 3PL6C 3TBVB 2PYFA 3OXRB 4PG9B 1JPTH 5JHDE 3RVWC 5KSAC 4HWBA 1CXFA 1BWMA 4AG4H 2VH5L 4PBVC 1EBAA 4NO2A 3OKMA 4BQ9A 1EO8H 5EO1B 5D7LD 5JXEA 3VD3A 3WFCL 5DJ6B 4PP1C 3PABA 4LPVA 4KJWD 3LN5B 4MX7B 2XFXB 3O81A 4HUUA 4PRPD 2ESVE 5MEQB 1FG2A 1D9KB 3N06B 3CLFH 1JBJA 4DGVH 2HKHH 4MJID 5CFHA 4G5ZH 2WWMD 5ANMB 3RU8H 2R8SL 3U30B 4OFYD 3H9SD 2MPAL 1JRHI 3TT1H 3FRPG 4P23A 4QCIB 2FATH 2D7MA 4KRMB 4XMKL 5F9OL 2HVJA 3MXWL 3PXJA 4U4BA 1JPGB 3TCXA 4ORGB 1S9XA 2CLVA 5A40E 3UZVB 3O0RL 1KJ3L 2YD1A 5I19H 4P9HH 5L2KD 1UYWL 1CD1A 3C2AH 3F12A 4MB5A 4L4TE 1IGJA 4OCXL 4U6VH 3UTQB 1HHKA 3PWNB 5JLZA 4XCYB 3VMNA 1MCBA 1NGYA 4DAGH 4FQLH 3L3HA 3ROOB 5J1AA 4LPTA 1CE1H 4L9LC 3E2HB 4FFYH 4NM8L 2FEEI 5F1IA 4HJGB 4I3RL 3REWA 2OM5A 5I2IA 1JV5B 1XGYL 1UFUA 3MJ7B 1SJHB 3CVIL 3QEHA 2HKFH 4J3TA 5J12C 3C87A 4HMDA 3NAAL 2WMPA 2FSEB 2LE9A 3K80A 2LFGA 2V5YA 4OM0H 3I6LE 1BOGA 2CUHA 3FQUA 3VXRD 4KTEL 4KUZL 5EDXA 4ZD3L 5F7HA 2F54D 3X13B 4YR6A 2N7BA 2CIKA 5CKAA 1H3UA 1RZ7H 4JQIL 4PRIA 1EERB 4HC1A 3QRFM 4G8GE 5F96L 4QKXB 2B39A 1PYWB 2C1OA 2W0PA 4M6OH 5GS0H 4UT9L 3OKNB 3MRNA 5F3BB 1UKSA 1CVSC 5CEYB 2ZOKA 2I5YL 1ZHNB 1B0GA 2Z4QB 3GMMA 3EYVA 2F53E 5EOTA 4E0RB 3JTSB 1MCIA 4U1JB 2R4SH 3DVGB 1JGEA 5F9WC 5GGQL 3WFBH 4ZFOL 3D2UA 5TQ0L 3EO9H 2VXVH 3GSQA 5DUBA 1HZHL 4LLQA 2ZPKH 5IW3A 4GKZB 1IGIH 4KUCF 2EYRB 1EFXD 2FL5A 3VRIA 5HYFA 1KJMB 4LLDA 3ROLA 3QG7H 3SDXE 4NWTL 5SWSE 3WFHA 5JW4M 3TVMD 3JUYA 1MHHB 5KS9B 4WI6A 3RY6C 1NGZA 3NN8B 3C60C 4K2UH 5GSVA 3QIBB 3ETBF 4BK4A 3DBXB 3BDYL 4YAQB 3TBYB 1U6AL 5GRUL 1P7HL 5E5UB 5GGUB 5HGHB 2DM2A 3HE6A 1U8NB 1TTUA 5I1CL 4P9MH 3EOBA 1DN0B 5BO1L 4EN3C 4NFCA 2V2WA 4EDWL 3QSKB 5KVGH 4M6NH 4KZDL 5IB3A 4Z0XA 4KROB 3RVWD 4LU5H 3WIIH 1P4LA 5T3ZH 1PY4A 4K55A 4NNPH 1HHIA 1ACYL 1IM3A 2VDPH 2J2ZA 1IC5H 5JO5B 4RQQA 3JBG7 3ARQA 1YC7A 3V5DB 3HA0A 1TENA 1A7NL 3VMOA 5I1JL 2HFFA 3O2VH 4IS6B 2DD8H 2P5EE 2BY0A 5FUOL 1KPVB 4R3SB 4L9DA 2GQHA 2DLFL 1KTLA 1BZ7B 3CXHJ 2EE9A 5FV2A 5HYSB 2BRRH 3S5LA 1KLUB 2V6HA 4DVBB 2ZCHH 5KW9L 1QQDA 5TPWL 2P48B 4KI5D 1SJHA 4OV5A 1INDH 4OLXL 4AEHH 3DARA 5FO7B 2DQTH 3GI9L 3O3BB 4E42B 3IF1B 4I4WB 2RAMA 2ZG3A 5HTSA 4KI1A 4IOIB 2N1KA 5ITBH 3RVUC 3NIGE 2E7LA 2L0DA 2VABB 3DGGA 4BH8B 5HYJA 4MGXA 1Z9MA 1ZS8B 3L3GB 5EZOL 5DD6B 5FYJD 5FB8B 2F54B 1BF2A 4XBPA 5D7LA 4KUCD 1A14L 2YSSB 4CL7A 3ALXA 3B9KD 4LEXL 1CWVA 1URLA 4K8RL 2XQYK 3RIFF 1WT5C 3VD4A 1WICA 3WLWD 5E2JA 4QRRD 1ZA3A 1S9XB 3HMXA 4RMSA 3ZTNH 1G1CA 4M1CD 4P5MA 4Z95L 4Y2DB 1H3PH 3RWCB 4PGCB 2YPLB 3T1FB 1YNKH 4RFOL 1DQJB 4YHML 4GAJH 3QXWA 3SGJC 3PWNA 4UV4L 3K4ZA 4ZUWA 5GSRB 3TBWA 4EXKA 3BXNB 4KTDH 3EYOA 5D72H 4QXTA 1MJJA 1KCRL 1CI5A 2HT3D 1NC4D 4HUUB 5MEQA 3CD4A 4H88H 1I1YB 4Y5YA 5DR5H 3AAZB 5MENB 4OGZA 2FJHA 1FSKB 2XQBL 4LSSH 4MYWB 5DXWA 1UH2A 3OR7A 4LLQB 4N0YH 4RFNC 1KGCD 3OB0K 4NZTH 3E3QC 4JPWL 5KTEH 4WHDA 5EUOF 4F57L 4G6AD 2VAJA 1JWUA 3TJHC 2R4RH 4JDZA 3BJLA 3PUCA 4PRHA 5DQDL 1AE6H 4L4TA 4OLWL 4UV7H 4G80B 2BY1A 2R0KH 3QIBD 2R0WH 3GDBA 3TO2B 3V4VL 1YEGH 3MRMA 4JKWA 5HD8D 2KZWA 3HE7D 1C12B 1QA9B 4Z18A 4DCQB 3HPLA 1JHLL 1U91A 4XPFL 3STLB 2AEQH 4MLSA 1HSAA 3B5GA 5IFAL 3LN5A 2CMRH 5SWQB 3MJGX 2KKQA 1JFQH 4ODVL 1OM3L 4X5WA 5DJZA 1VACA 3OKMB 4LRIA 3TGXA 1PW3A 2QV2A 3T2NH 5B22A 2PYED 1PG7H 1AY1L 4L5FL 5C0AA 1IRAY 2VO5A 1A1MA 2NY5L 4Y8DC 4F3FA 1F02I 3MUGB 4ZYKA 2E27L 3S9DB 3L6FB 2E9IA 4M61B 3PL6D 4PRID 3TCLA 4I3SL 4JO4L 4DVRL 3L9RB 1TXKA 3VFVB 4HMEA 1QYGL 2EYRA 5BMFL 2IFGA 4HS6B 1PD6A 3MRFB 3MRIA 3ZE0E 1IM9B 3X17A 2IAMB 3CVHA 3B9AA 2A0LC 3NIGF 3QI9D 5IG7B 3U7WL 3SE9L 3NGBB 3B2UD 4JFFA 4CNIB 2MMXA 3DXAE 1XGTA 5DT1L 2B20A 3F12B 4NO5A 1CD1B 5CEZH 4A6YH 5IMLA 3CZFA 3QR2A 3CVHB 4FQQA 3DGCR 2D7PA 2QQKL 4U6YB 4NQVB 3WS6A 2H26A 5H35A 1A8JH 2QBWA 5C6TH 2BDNH 4CDHA 3T0EE 3T3MF 5L88H 3G6JF 2NXYB 3Q6FB 3M45A 3O3DA 3ARFC 4UMGA 3RPKA 4WGWB 2Y6SD 2CGRH 3TEUA 2EECA 2FH8A 1CE1L 3GMNA 4K23L 4KGLA 4LL9A 4Q58C 1IKNC 2UZXB 4CGTA 3MCG1 2IF7A 5EFIA 3RI5K 1FSKC 2IH1A 5D7SH 2FEDC 4LSPH 4PJDA 2EXYD 5J3HD 3C8KB 1QBLH 3DX7A 1SM3L 2EDBA 3F6IA 5HJ3A 3V52H 4AQOA 4U33A 2OQJB 5JIIA 4FZEL 2ARJQ 4PJEA 3V7AE 1T03H 5CS7A 2XG4A 4PG2C 1T5XB 1Q9OA 2ICEB 3WJLC 3PL6B 2XNAA 1GOFA 1RZ7L 4HEME 4APQB 3VI4E 5MEPB 3BGFB 1FQ9C 3MO1A 1VPOH 3UTQA 2VITA 1J0IA 2GAZA 3ES6A 3LEXA 5CJQH 4UT9H 2R0ZL 4HBCH 5DMIL 4DEPB 5IG7A 4HWZB 3TH2T 2YD9A 4LPUA 1AO7B 5I8KL 3UBXG 1S7XA 1BQHB 3L3DB 1ETZA 3DURA 5JOPD 1NCBH 3SDAA 4JANA 1NCDH 3H0TA 1FZOA 4OJFH 4YE4H 2OYPA 3ZKNC 2SEBB 1RIUH 3VDAA 4M62H 2QTEA 3I2CL 4Z7VA 1FV1B 4MQXD 1DEEA 1DP0A 4RRPG 1IAOB 4WCYH 3C9NB 5FYKU 3MROA 1IGIL 1S9VA 4XP9L 3RWDB 1LGVA 1KB5B 5I73B 4HIHB 4MJ6B 5D8JL 3S96B 1J0ZA 2D7NA 5L8KB 1FDLL 3S36H 3QP3A 5IVXA 3IXAA 5C2BL 4QRTB 4UAOC 1NAMB 3HPJB 1H5BA 2P43B 4ZTPH 2HJKB 5B39B 5LGKA 4FQHA 3O3BA 1JZ3A 1KIRA 4N0UE 3T4AA 2DI8A 2FNBA 4L9LA 3L3KA 5EO1A 1DSFH 4KVCH 1FE8H 3FB5A 1KNOA 4KK6C 1QLFB 4UU9B 1B2WL 2VSCA 4BH7B 5LXGH 4NP4L 3PV7A 1Q0XH 3DIFB 3ARPA 2IPTH 3N85L 2R1XA 1BQLL 1EJ6A 1T1YB 2EIBA 4U3HA 3U79A 2Q8AH 4UINL 3V5DA 1C7TA 3WKNA 4CDGC 2I60L 2MQ3A 5JIPA 3VW3L 5K59F 1RURH 5JIKA 4JQXA 1R5VA 2Z31B 4KTYA 4P3CL 3S37L 5KVEL 1PDKA 3U0TB 2CLZA 4DFHA 3RTQB 1Y0LA 3O6KL 5IBTL 4Y4FB 1S5HA 4HLJA 2AVGA 5JMOC 4WJ5A 1Z5LA 4ZFZB 2VJXA 1NCTA 2FECI 4OLUH 1WBXA 1A4JB 3IGAA 3W39A 3QHZH 1WFTA 4XC3H 2EC9T 5FOBB 1EJOL 4QY8B 2DQHH 1A64A 2W1NA 1MI5B 4HH9B 3BE1L 4GRWB 1WCBB 3NFPA 1Q72H 1FVDB 1KEMH 3E6HA 1YEIH 2DQGH 5DD3H 3TN0D 1J86A 1NGWB 2ZUQC 3WIHA 2HP4A 1T89C 4X5XA 4ZPVA 1LO3H 1G0YR 1BHGA 3H9SE 1K6QH 3O4LA 1G7MA 3W11D 1AC6A 5D4QA 1MLCB 1FO0H 3L3JA 2OP4H 3ARGC 4LRNH 4YAQA 4D8PB 5CZXC 4HFUL 4LCCB 1CVRA 4RGNB 4NRXA 4Y4HA 4Z95H 4W68A 1YMHB 1I1AA 3F58L 3BJ91 2HRPH 2V5MA 4G8GD 1H0DB 4R0LA 1GC1L 4QRPE 4ALAH 5F6IB 5I66A 2V2XB 3U9PH 4G6JH 1MPAL 1IGFL 2E7MA 1H8OA 2BRQA 4LCWB 1R3HA 4ODWB 5D72L 5GS0D 4BFGA 1TMCB 3CFIC 5I1AA 5GGRB 1S7QA 3VFMA 5FYJL 1F97A 3LKQA 3KPRD 1IAKB 2XN9A 1HH6A 5B38A 1BMGA 2NW3A 4KY1H 1RJLB 4F57H 2PR4L 2C4FT 3HNTL 3KXFD 3W0WB 4PJAF 4N0CC 2MWCA 4UOW0 2AK1L 5C0RH 3HB3D 4DN3H 2R0WL 5SWSD 1CGSH 5EU7C 5HYQA 3MOQA 4NT6B 1Y6NR 2FX7H 4W6YB 4HCRH 4NO0B 5IMMB 1MCFA 2H1PL 1KEGH 3BKCL 1J10A 3IFLL 2BNQD 2IEPA 1QFPA 4LASH 4KKNA 3E1F1 5T3ZE 1CLOL 2VLJE 5HGBB 4W4OC 5A2KH 5FM5M 4S2SA 2P42B 3FN9A 1WSST 2HFEA 5IMOA 2ZKHL 1U92B 3SY0B 3F5WB 5BVPH 4X0KB 5DUPH 3T8XA 4FQXC 3D85B 1BAFL 2CDFA 5A16B 5DEZA 3UZQA 4MAYA 4C56A 3QUML 2VR9A 5H2BA 2VMFA 4ZD3H 1C7SA 5IHUH 1WIUA 3K8LA 1WEJH 3MV7B 1OD7A 1U92A 1NSNH 4TNWK 4HIEA 4EI5D 4LVHC 1DUYA 3UAJC 4YC2C 4EI6B 4JFHE 1ZTXL 5EU6D 4U6XB 1NQBA 3U1SH 4MXVE 1T0NB 3RAJH 3P40A 3SCMC 5DJCA 3C08H 3QUMB 3NMEA 3BH8A 3HRZB 5DK2A 4L3EA 5JA8B 4Y1AB 2FIRT 1IKNA 1JHTA 2NY5C 1ZV5A 1NC4B 1N59A 5DA4A 3SE9H 2NCMA 2OLDA 3ARVA 3D0LA 5EZLA 3WD5L 3A67H 4OZIF 4YFEA 4LARH 3W0WE 4YHNB 4PRDA 1GGUA 4HKJB 3JTTB 1F6AB 1WIOA 1EUTA 4NNYA 2ZPKL 3FTGB 4PJ8C 3MNZB 4YZFE 4TVPL 3CVHL 1YYML 1SY6A 2HLAA 4R97C 4WFHE 3OXRA 4PG9A 3HC0A 4O4YL 1X5IA 3SDCB 5JPMB 4HIJB 3WUWG 4YHPB 2AGJH 4Z7VF 1RZKL 1FL3B 3LZFL 4NC2B 3UDWA 3D48R 1XGPA 3OXSA 4I77H 1RHFA 4XPBH 5J9PB 2B5IC 3C8HA 4HJGA 1E0OB 3SBWC 1A6WH 1ZANL 4UT6H 4LSPL 5F9WB 4KV5E 2CKBH 4P57A 1TZGH 1MUJA 4YXLH 1ZVHA 2KBGA 5K93A 4DK3A 2GUOA 2WQ8A 1GPOH 1MJ7L 2EDWA 1OF2B 1V3LA 3DUSA 4X7CC 2QADC 2YN5A 3QO0A 4JHWH 1S7WA 5FGCE 3LDBB 4OZGF 4PV8A 2EYSA 1GGTA 1IGJB 2C1PA 2H32H 4R7DA 3BYYA 3IDXH 1P4IL 4HPOL 4WW2F 2F74B 1V8HA 4PP2B 5H2BB 1RZIB 1AXTL 5MI0C 2SEBA 2VN4A 3BMWA 4GS7C 5CZXD 3O6FA 3RDTB 2IBGA 4X9IA 5CJQL 4KKLD 3EBAA 4L3EE 1S7XB 2DD8L 4K9EH 3QIUA 5F21B 2D31A 3GSQB 4JRYD 5A2JH 3MV9A 1AO7E 1D5MB 1YMMD 1D5BA 2CR6A 3DSFH 1GGCH 4FFVC 1PX4A 3V79C 4N0UB 1FGNH 3DECA 2ZUTA 3LKPA 4M62L 5EU5A 5TPWH 5EWIH 3MCKB 2IPKA 2IPUG 4ZUTA 1W72A 1RSFA 3ZKMD 3CXDL 2NLJB 4JM2B 4NQEA 4MJ4A 1ZLWK 3RNKA 4ZFGL 2VLKD 4ODXA 1OQXA 2D7OA 2X41A 4U49A 4UDUB 2AKRB 3TN0A 2AABL 3QDJE 3MRDA 4X6DB 3ARGD 2W9DL 1BWWA 3KPTA 3QWRD 2WQRA 2PO6B 4U1SA 1I1RA 3ALWA 5BVJB 1FDLH 5DRNA 3PQYA 4OD3H 5IB2B 4NHCL 2NTFA 1GZQB 1JGVH 2Z35B 4AT6B 5DWUH 4PRPE 3KVQA 3S8WA 1MHEA 2EC9U 2AP2A 3C2SA 4Z76B 3WNKA 3MXVH 3H9HB 5GS0C 1ACZA 1Q0XL 1I8LA 1G7JA 1ADQH 2IGFH 3HAEG 5I1HH 1XGRA 2BOCB 1OARH 1LO2H 3N1FC 5HDQH 1SY6L 4HJJL 2B0SH 3GSOA 4YQXL 3DETC 3VH8B 1SEQL 2VDQH 3NH7H 2OL3L 1KCRH 4K7PL 3ULUE 3PNWB 4ZXBD 2JB6B 4N0CD 3EYFB 1KB5A 1YNLL 1HKFA 5E4IA 4N0UA 2ADGA 5HGDB 3JWDC 2XQBH 1WQVT 4BZYA 2NY2C 5DC9B 3QBTB 1JGDA 4U3CA 3TYFB 4CU7A 4KI5F 1RJYB 5IVXE 3UJIL 1CGWA 1LDSA 3QYCA 4PJHB 5GGTA 5IK3B 4D0DB 1MCOL 1CDIA 2VSDA 3EFDH 4K7PY 1FBIH 3SJVA 3V4VH 3WJJA 4Y4HC 5I17A 2J6EH 1SEBA 2VR5A 2CDGB 4KMQA 4MAUH 1AQDA 5EUOA 3KPLB 2W60A 2H6PB 2VXTH 3MCLL 4PV8B 4L29B 3IU3A 2O61A 2QHRL 2X4NB 1VA9A 4XB7A 4AM0B 4U7KA 3U9UA 3NA9H 5MEOB 1YEFL 5E99L 3VWKA 1SJEA 3O4OB 1T22B 2JK5A 3MBXL 4C59B 3MRCA 3D18B 2GSIA 4X7FC 3FRPA 2XYCA 2QHLA 5IJKC 1P6AB 2DQUH 5KVMC 2Y4SA 3U2SA 4LMQI 4XNXL 4BQ6A 5CAYB 4OIAA 1IGTB 5CEZD 1DLHB 4QYOA 5TE6H 2GSGB 5GRZA 1G9EA 4QHKI 3RL1A 5ESQB 1D6EA 2UZYB 1NGPL 2PXYA 4WW1B 4EUPB 2J8HA 1FRGH 4P2OB 1R5WB 3PXHA 3I84A 3IDGA 2JJTA 1VGEL 4MXWL 5C0DB 4WRLA 2QQNH 4P5TA 3WFEL 3C5SB 3EDEA 1ND0B 4K7FB 1CIUA 2ZZUT 4JHAH 2GYSA 1E4WL 4JFED 2DBJA 1DBAL 2K3TA 3DI3B 1K8IA 5A3IC 4OGYH 3U7YH 3MACH 5I74C 1VDGA 1IL1A 4JDVA 5T1LB 4L4JA 3GSUB 1ZLUK 3MGTA 3AM8A 4NN5C 3KPPA 4HPYH 1ZHKA 1GC1C 1U8PA 2DDQH 2Y72A 2AK1H 4IRJD 4OTXH 3WDIA 3RUGB 4YEFA 4J3SA 3LSOA 2DYPB 1MHCA 1JZ4A 4GKNA 4JFEE 3BRDA 1Y18B 2LV4A 1V05A 2D0FA 4OFDA 1CQKA 2HT4D 2R23B 1W72H 2LU4A 3I9GH 3HZMA 4MSWB 3QEGH 3VJ6B 4X0KA 4UTBH 1YN7B 2ZKHH 5HGAA 4PTTB 2PN5A 4WFGE 1SYVA 3QULA 3CFCL 5IJVA 1ZA6A 3G5ZB 4M48L 2IBZX 3GSXB 4DW2L 5GIRA 3D69B 3BQUA 1FZMA 3WYRA 1JWSB 4HK0B 3IRPX 4I0PA 5KSVA 1NFIA 4TNVF 4QRSA 4C56D 4YDIH 3ARGB 3FAXA 1Z9SA 4Z7WB 4LSDA 1WWBX 3SKNA 1IGML 2JB5L 1QP1A 1OY3B 2AV7B 4WFFD 2A6DB 5LBSL 4X6FA 1F42A 3F65A 5IB2A 3EO0A 1TCRB 5JO5A 3FTGA 3SJVB 3VD5A 4IOFD 1F6AA 2YS4A 3GK8H 4HXBL 3FRUA 2UYLB 1HH9A 3LKOA 4DQOL 1RZFL 3FO9A 4M8VA 4JAMA 1R3LA 4PGDA 4IOSD 4LAQH 4UUJB 3D39B 5C0FB 4XP9H 3SGEH 3LS5L 4BA8A 4HWNA 5FYJE 3RZWA 2UVEA 1PEWA 5E4EC 5F7DA 2WAHA 3AGVA 5I9QB 3TT3H 2WP3T 3MRRA 3VXMD 4FXGA 3U36B 5GSRA 1VEPA 4F9PC 4EQ3A 1A3RL 3QDGA 4OKDA 5AZEH 1JN6B 1NLDH 3S88L 5ITFB 4NJ9H 3SDDD 1CGTA 4TVPE 1MWAB 2D2OA 1T4KA 3S97C 1DSFL 3QWOB 3PGCA 4KK8C 3WS3B 1OAXH 1NBYA 4WY7L 4U7MA 2QR0B 3VRIB 5KVFH 1V3MA 3VXME 2GTZB 5JQHC 1JNHB 4FTVB 5KN5B 4L8SB 3FT4A 1RUMH 3KLSA 5IW6B 3GB7B 5EZJA 1LK2B 3OGOE 5T1KB 1QEWA 4DGIL 3HG1E 2I60H 2F54E 1B6DA 4BSJA 1OW0C 3O3AB 5C0JA 4HS8H 4JFPB 5F88A 2A6DA 5FKAB 1DQQA 4M3JA 3MR9B 2X42A 2NY6D 3PV6B 2H8PA 2NXYD 4QF1B 3MJ6A 5MP6H 4LGPB 3VWJA 1BGXL 2NY1C 4NQDE 3IS0X 5JW5A 1YN6A 4OKVB 5E8PB 4XPHL 1I85C 1OCWL 1G6RA 3LKNA 1DQTA 1YC8A 4U1LB 2Y5TB 4JAMB 2XIDA 3HFMH 2NLJA 4JM2A 4LBEA 3GRWL 2VDKL 3GIVA 4Q74A 3F62A 4F7TB 3LMJL 5C92A 1MREL 1QBBA 1NGQL 3DROB 1S9WB 5E8DL 2DAVA 3O9WB 4Y1AE 3D69A 2I07B 4X7TA 2DWDA 4X4XB 3MGAA 5DRWB 1KB9K 3REVB 4P0DA 4FFWC 4NQDB 3T1WA 2LABA 1NKOA 3NGBC 1T1ZB 2B1AL 3RVVD 5HGAB 4E41E 3E8UL 2X09A 1LP9A 1MRCH 3T65B 4APQD 3O8XA 3ARGA 4HKZB 2OR9L 3CMOL 1N2RB 2UY6A 1H0DA 4R0LB 3WDHA 2F53B 3WJLA 2VB5A 4I5BA 3BDXA 3MLPA 4M6AA 3JV6A 3JV4B 4XPTH 1TTGA 5D7IF 1BJ1J 4Y1AD 3T09A 1ULVA 1MWAA 1KPUA 1MJ8H 2D4DA 1QUNA 2F9BT 3OKEB 3PHSA 2IGFL 4FTVE 3JV4A 3RX7A 3FB7B 1JYVA 1KCVL 4LCCC 1FZJA 3RGVC 3U0WH 3TIDA 5D1XD 2ZSWA 3TA3B 4JY5L 5CP7A 3NH7L 5JOFA 1FV1A 1KG0B 1IGCH 3IFPA 3KYKH 3D87B 4HKBB 4PTUB 4ZUUA 1FL5B 4JY6A 1YEDB 1F3RB 4JN1H 5FCSH 5FB8A 2F8OA 3WDJA 1IAIH 4X8JA 4E5XA 1F3DJ 2H2PD 3K8KA 5KJRL 1ZHKB 2HVKA 3P11H 1T20B 2Y7QB 5ENWB 3PGDA 5IV2B 4X99B 1T2JA 2XKNA 2OZ4L 4FOMA 5I30L 1ITBB 4NKOA 5DQJB 5IT2H 4G9FB 3T3PF 4GRWE 4IMLB 2VDNH 4E41B 2MOVA 1N8ZB 2F5AL 5HYSA 5C0CA 2QHRH 2YA0A 2XTLA 5E7FA 2DMCA 1DZBA 1YEEH 3TBSB 1MCJA 1KFAL 1S7QB 2X9WA 4JM2C 5B8CA 1ZSDB 4L4VE 2RJMA 3MRLA 2OJEA 32C2B 1CGXA 5LGHL 3ULVL 3NTCH 1I8IA 3DTXA 5DJDB 4FXKB 2IH3A 2OTUB 2VNCA 2G5BA 5AWNH 3S5LG 4CMMB 2ILLA 5EU4B 2ZP0T 4UIKH 1MCHA 5CILL 3GM8A 1N6UA 2XT1B 3F7YA 3T4AB 1FRGL 1RIVL 2KL6A 2H41A 1MRDL 3PDDA 3OAZK 1B9ZA 2LVCA 5D2NC 1C16A 5D5MB 1LHZA 4I13B 4D2NA 3D3VA 1G7HB 2K7QA 1M7IB 5T1LD 1PQZA 1KOAA 3I50H 1BP3B 3EYFA 4ZSOA 4GXVL 5DHYA 5DLML 2OBGA 1DBAH 4DJMA 1CBVH 1F58H 3BPCB 4JPVL 3PGFH 3LOWA 3WD5H 2X89D 5E6YA 1U8LB 3ULSB 3E6HB 1FNSH 1F11A 4PB9H 3RRQA 4YJZL 4GT7A 1R5VB 3RWFB 3ARBD 5FF6B 5IM7A 1JPFA 4O4YH 3DURB 3PHQB 2Q87A 3DX9B 3GNMH 3RVUD 1JF6A 5I8CB 2Z93B 3RTQC 5JHLL 3W5NA 1QBML 2UZIL 3JUZA 1UZ6E 4MQTB 4ZFOB 4I77L 4RDQF 3VRLF 1AH1A 1BVKA 4I3RH 3DYPA 3O2WH 3SGJA 2EDTA 4JREB 3EFFA 3P4OA 1AXSA 2BSTA 4LFHD 1XGRB 4FA8A 4NBXB 1OGAB 4YXLL 3WMSA 4Z7UE 5FA4A 1IAKA 5C07E 4OIIH 4FQHB 4GG6F 4P49A 1FYTA 2PYEE 4NQEB 3VA2C 5D2LB 4P99A 2CJUL 1LEKB 2YN3A 2B4CH 2YUXA 3K74B 3GMPB 2G60L 2V17L 5JW4R 2VLKE 4WHYG 4CW1B 5HBBA 4XTRD 1OSZB 2WIMA 4UB0L 3R0MA 4F7MB 5F1OB 1M71A 3C6LC 1UB5B 2P5WA 3H42L 1YMHA 2EEDA 43CAA 1U8LA 3ULSA 1ZHBB 1O7SA 1CL7I 4QWWC 3QCTL 1QSFB 2XA3A 2VC2H 5CSGA 1FAKT 1A9BA 3ZDZF 5D1XB 2X7LB 5D93B 1I9RH 1KC5L 1WZ1L 3Q3GA 1Z6JT 3KPPB 3L7EA 2AK4A 4K3HA 4KK9D 4NKDB 4Y4FA 2IALA 3U83A 2LU7A 4APQA 2YPLA 5JNYA 1H15A 3MOBH 3SBWA 4P2YA 2H2PC 1AQKH 3KPSA 1A5FL 1FZOB 5C0EB 1ODAA 2NY4C 3HG1D 5AZEL 1JPGA 4GW5B 4EXPX 5JXED 3VFVA 5BS0E 2KPNA 1U3HC 5F7MC 4KROD 5I15H 1BEYH 2CDEB 2W59A 5HVFB 3QT2A 2AJXL 5IOPB 1QHPA 3MBEC 2WIIA 3UROR 3WIHH 4HWEH 1N26A 5IVNA 5DK0B 3HZVA 4QXWA 3C2AL 5IMKB 5D2LA 1AP2A 3U4EB 3CNKA 3O45B 4UQ2A 3DUSB 4M3KB 5FYLE 1FNGB 1LNUB 1U8KA 3MNWB 3MNZA 3ARTA 3BEWB 1IJ9A 5KSVB 3EYSL 4ZAKD 2I9TB 1RJZB 5GZOC 3D0LB 3AROA 3PDOB 3P9MA 1NBVL 4I0CC 4KDWA 5MEOA 1FHGA 3QJHA 1X7QB 2Z91A 1U41A 3LEYL 3SCMB 1PZ5A 2YHGA 3WFDH 2HG5B 1BGXH 5DJ0B 3SDCA 5JPMA 4JM4L 5AG9A 4PJBF 3WO3B 4MS8D 5DFWH 4OM0L 3IDIA 3NBNA 2RQ8A 3UTTD 1XF1A 3MV7A 3X3FL 3IU4H 3SO3B 3DRQA 5KOVC 5MENA 4Z0BH 4OIBA 2VXTL 3MCLH 2EEBA 3V7AG 3BN3B 1E27B 3GMRA 2F74A 2JCCA 2AEPL 4JG0L 3GIZH 4LCIH 2A9ML 3I02A 2V7HB 5JHDA 2E6PA 4DTGH 3HHRB 1P1ZB 4HQQL 3VFGH 1C16B 3CMOH 5D5MA 4D94A 1GAFH 3GHEL 4R4NC 3FQXA 2EO9A 4PRPB 5I1DB 3WBDA 2VR4A 2YZ1A 1C5BH 4AENA 1VACB 1UM5L 4PJIB 2IC2A 3VFSA 3HN3A 1BQSA 2AJSL 4QRPA 1GGIL 1OPGL 1CLZL 3DLQR 1IBGH 1NDMA 4PRHD 4XI5D 3TBTA 3NZ8B 4K71B 4X6DE 1NFDE 3HMXH 4YXKL 4MD5B 5C0AB 1S9WA 3M17A 2QSCL 1XH3B 1IQWH 1KT2B 1NEUA 4XPGL 1U3YA 2PYEB 4XH2B 5C09A 4OZIB 4UOW1 3QQ9C 2AKRA 3TN0B 1S7UB 4G9FD 1RAMA 1X4ZA 2VLKA 1G6RB 4U1LA 2P46B 3OG4B 4PJ5E 5E6IB 3QIWC 4PRHE 4EDWH 5C0IB 1NAKH 4L3EB 2O61B 2G9HA 3EYOB 1NFKA 4NO5B 1OQOA 2GJ6A 5IMLB 5FYKL 4D3CL 1DE4A 5J1TC 2J12B 4GG6B 4XPFH 3VXOB 4FMFA 2XWBA 3CPLB 3MFFA 3RI5F 1H3XA 3MV8A 3CSGA 4OCMC 1BFOA 1HK6A 1YEEL 1G0XA 5KN5A 3BMVA 2DKMA 4AK1A 2ADIA 5FGCB 2E6QA 4KVNL 3C60A 2XZQH 1LO4L 4U1NA 2BRRL 5DJYB 4DW2H 2MKWA 5LGHH 5GXBB 1AHWB 3OAYK 3BIBX 1WCBA 2D9QB 2CSPA 1IVLA 1INDL 5D7LB 1J87A 4KPHL 3L1OL 4X6CE 1B90A 4NHUB 3RVTC 4F3FB 4S10A 1HQRB 4ODSL 3OQ3B 2O5ZH 5BV7B 3MLYH 2NNAB 1NCUA 2P5WD 1X5FA 4NO0A 3KXFB 1RUKL 4N9OB 7CGTA 3CSYA 1FNHA 1IGMH 5KSUA 3QQ3A 1PVHA 1Q9KB 3UPAA 1T83A 1KELH 3FO0H 4JFDE 4PJHF 4M61A 2HTKD 1UA6L 4S2SB 5DHVA 1GZQA 1FFNA 3V0VA 3T2PA 3TO4A 1DVFB 1A4KB 4LGSB 2VL5B 4MMXC 2Q7YB 1LE5B 1KPVA 5D6DC 1B4JL 5ADPH 3VXPA 1WVZA 2QQKH 3O11A 1ZSDA 3CCHB 4PUBL 3NCCB 5FIEA 3QPQD 3ULVD 1JHKL 3MRJA 4FQ1H 3GMMB 2JE8A 5D7JB 2J6EA 5EOTB 5FGRA 5L88L 4BH7A 5I8EB 1VADB 3BPNB 3GNML 4PJCA 3HG1A 1OAYH 4RGMB 2XY2A 2YC1A 2GEEA 1KSRA 5J6GA 4N1HB 3KPSE 2WSKA 1NMAL 4G42A 4NJ9L 1MY7A 5T3XE 3QQ4B 3S4SA 1FZMB 1WWWX 3KLHC 4DZ8B 1VB9A 3MV9D 2BOBB 1JWUB 4C4KT 1KJ3H 3PQYE 3EZ8A 4GRMB 4U1HA 4P3DB 3OL2A 3V52L 4KJWC 1MCSA 3FO2A 4F9LA 3GSVA 1IM3B 4CADA 4JY6B 3RZCD 5E5MA 1YEGL 2CK2A 4HJ0D 4M7LL 2DBLL 3P73A 2G60H 4XHQA 5KSUB 5EIQA 5DVLA 3D25A 4L1HA 1MHCB 5GJSL 1TIUA 3FAWA 1JNLL 1LMKA 2AXJA 3CFDB 4WUUD 1FNEA 1KCUL 3AMKA 4D9QD 4OI9A 3VXRB 1KTKE 2VQUA 3AFLA 4YFDB 3BT2H 3QUZB 4KQ4L 4D9RE 3QHFH 1AY1H 3MYZA 1K4DA 1XCQB 5E6ID 4R7NB 3I2CH 2D3VA 4HGWA 1F00I 1FLRH 2V9QA 4GMTH 2XNAB 4O5LL 1N2RA 1IQDA 5I74B 5T3XL 4GLRH 2APBA 2PTUA 3HG1B 4NN5B 1NCNA 1A02N 3DV6B 3VGFA 4O9HH 1HNFA 4JFZL 1OTUD 5KOMC 3ZHDA 1CU4H 3S36L 2X2YA 3F8UB 3OGCB 5DEGA 4ZMAT 2I27N 4DZ8A 2JTDA 4GRLA 1X9QA 5IB1A 1KIPB 1L6XA 3O9WC 4H8WC 4ZXBA 5HHNA 1N5AB 3V5HA 2VDRL 5FGBA 5GJTH 3ARDD 3PWVB 4G43B 3DMMD 4LBEB 3P9MB 1U58A 3EO9L 3TZVD 2AJYL 2DQFA 5FK9A 2DM4A 5IBLC 5AEAA 1F2XK 3CUPA 1MJ8L 2PF6A 4DKDC 3GBML 3QO1A 1MFAL 5ID0A 1NC2D 1U8MA 2BDNL 1IFHH 4BUGA 2DLIA 2VDMH 1NAMA 1MIEL 3HPJA 5B39A 4XAKD 1I9IL 1HHGB 3D39E 5CLTA 5FA3A 5JW4N 5C0BA 1DVFD 1HXMB 1SYVB 3QULB 3O6LL 3SPVA 3BP7A 5EPMA 3UC0L 4K23H 1NMBH 4HC1L 1IEAB 3X12B 1UH4A 4MVBD 4GBXC 4G6MH 4YHIB 3L3KB 2W92A 4YGVA 3FFDA 4ENED 1R5IB 3MRIB 4KJPC 2RFXB 2O5XH 4O2FA 1HCVA 4XAKE 5C0EA 2R1YA 2YD3A 4JRXE 2OXGA 4N5UA 2LU3A 3MUJA 3GKZA 3WS3A 1T1WA 1TITA 4HLZG 1IILE 4KZDH 1T3FA 4P23B 3OKDA 2OZ4H 3Q6GH 3VXMA 1UKTA 5ITFA 1K5NB 3VXOA 1GH7A 3T77A 2CRIA 3ARFB 4JFXB 2V7HA 2DLTA 4R97B 4TSAL 2D7TH 3B2VL 1JL8A 4GKOA 5E00B 1MCWM 4HUVB 2HLFC 4DTGL 1KFAH 1J1PH 1JTPA 4JANB 5C70A 1JNJA 4OD1L 1ZGLM 3GHEH 5EH1A 2OP4L 3MFFB 3NTCL 3QDME 2M26A 1CD9B 4QTIL 1ORSA 4O02H 5AWNL 5DJXB 2O26U 3UTSD 4KKBC 4BQCA 2NY7H 5MEPA 2PNDA 1D9KA 3BPLB 4JFEB 4U2YA 3AU1A 5ISZB 4HUMB 1RIVH 3QIUC 5TF1H 3THMH 3VG9C 1PKOA 4PJEB 1U8MB 1JGUL 3WLBA 1MPAH 5ILTL 2GSIB 5HPOA 5EZOH 4MB4A 4K3GA 3A6OA 3OKOA 4ZTPL 5SX4H 1E4JA 2Y9RT 1KT2A 1KF9B 2QSCH 4XPAH 3OPZH 2VLLB 3CFJA 4HKXB 4YNYA 4JR9L 4OLYH 5I18L 5J7CC 4NRYB 5FYJH 3TBWB 1FE8L 4LK4A 4PR5B 4ZUWB 5LXGL 2HN7A 3HZKA 4W70A 2ARJB 1NAKL 2YRLA 3UTOA 2HJLA 4JFFE 5LJYH 1TJHL 5T1DL 2Q8AL 4RMQA 3QQ9D 3UTTA 4LSVL 4RBPK 3GMLA 3W39B 4OCSL 1WBXB 2GJ6D 4WHTB 5DF0A 3U4BL 2P5WE 4YBLB 3GSRB 5JOEA 3S37H 4Y5VB 3QUYA 4H26A 5E2VL 5EPMB 5IBTH 5TDNA 3SDAC 4LLUA 4Z77B 3VGHA 1UXSB 4MX7A 1GHFH 1MCPL 3MREB 3C6LA 5IGXL 5CJBA 1F6FB 4ODUA 4YO0B 4YHYB 1MFBL 3OXSB 3KYOB 4R90L 1F90H 3NPSB 4AZ8A 1T7VA 1IEAA 5J13C 2NY3D 5B3JE 1J0YA 4GG8B 1YEIL 2DQGL 2R1XB 1BQUA 5GRVK 4QRPD 5IROA 3GHBL 3FJTA 3S3PA 5FECA 4QXUL 1MELA 1N6QL 3PWPA 4LNRB 5E2WL 4IS6A 3G5VA 3QHTC 4P2RE 3OGCA 2GSGA 3MRBB 4B5EA 3A6CL 1FNAA 5EG6C 4P2RA 1EEUA 4YPGB 1H3GA 5IB5B 1CF8H 1NJ9B 4EKXA 2OR7A 4EVNA 5JIHA 3LHPL 2GITA 2ICWB 3NCYP 3MUY1 5D2LE 1TFHA 1CDJA 2E27H 1N8ZA 1JE6A 2E9WA 4PV9A 1J1XH 5I0ZA 5DD0L 2A83B 4JO4H 1JNNL 5IEKB 2ED7A 3BH8B 5EU5B 3DV4B 2VXSL 4JDTL 1RZKH 2H32B 3SDCC 2EEAA 4G6JL 5D93C 25C8L 1D5BB 3TZVC 5I1GL 5IBLD 1LDPH 1J18A 4HS3A 1FG9C 2A0LD 1ZT4B 3BDBA 4M1DL 4R8WH 1E28B 1ZHBA 5I15L 4OLVL 1BEYL 1RZGA 4RMRA 1UWXH 1TZGL 4JKKA 4LSTH 4Q6YA 3W2DL 3QXDA 4PJ5A 1F8TL 2WBWB 2R15A 1MJ7H 3G6DH 2BVPB 4WUKH 2V2WB 2OXHA 4GSDL 4J6RL 3QUZA 4MVBC 5BS0B 1T3FB 4LLMB 1DQDH 3B5TA 4PJAB 3T0AA 5SX5H 1WBZA 3HLAB 4P2QD 3QXAB 3HE6D 4LASL 2G75B 5ID0B 4D9LL 4KQ3H 3LEYH 1KCLA 3MRNB 4ZS7L 3B2UC 3IETA 5SV3A 1CZ8H 1RJLA 3P4OB 1KYOJ 5CHNB 5BVPL 4WHYH 5F1NA 1QSEB 4PLOB 2Q8BL 3G5XA 3QPXH 1KIPA 1FLRL 4POYA 4QRQB 1WEJL 2BOBA 4GQ9H 1NAMH 2X4UB 3X3FH 5I71C 5MENE 3O3DB 1LP9F 2Y36H 4YHNA 4NUGL 2H9GB 3X3GL 1DUZA 4PJ8A 2VZSA 4N1CA 1TQBC 2ZCKL 3UDWC 3GGWA 1FGVL 1JHTB 4PRNA 3V6ZA 3X11B 2A38A 4HDIB 1WWAX 4KDTA 1CXLA 1IC4H 4Z0XB 2IQ9L 5L2JB 1KJVA 3O41A 4HX1B 1MF2H 2W07A 1YJDC 5DMJB 2VIRB 4PJ7E 4LARL 2YD5A 5EZIH 3V8OA 3HUJB 4WFEE 4HIEB 5HVGB 2E9JA 4P5MB 1YYMH 3ARDA 3VGAB 3P4MA 5D1ZD 3BGFC 4X9HA 4PY8J 2VWEE 1QFWI 4Y2DD 2MTPA 4YHOL 4F8QA 3VFOB 1J1OH 1I4FA 3L5JA 4MXQD 3HE6B 4JLRB 4QRUB 4YBHA 3VXUB 5CD5C 2YD8A 3OJMB 3KLHD 3IKKA 4MNHB 4QHMA 1JWMA 4Z78B 1GYAA 1P7QD 1UH3A 4ZFZA 4U1JA 2PCPB 3TA3C 4E0RA 3QO1B 3BPLC 3EYUL 3QISA 5HYQB 3JWNC 5FO7A 2UWEE 2JCCB 3U0TA 4WWKB 4ELME 5JW4Q 2P1YA 1FBIL 4IRSD 3OR6B 5EBWA 4CRPA 4JCMA 3P4NB 5EO9B 1IT9H 4JFDA 2IH3B 3HPLB 4MA1B 3SKJL 1NPUA 4CBPA 2A77L 2C3XA 5FYKE 1UENA 1YECL 2LAAA 2YMXH 2YUZA 4WW2C 2IANA 4U1HB 1U8IA 1A7QH 2EIEA 1QFWH 5J4MA 3BPOB 4P3CH 5KVEH 3V4PH 4XNYL 5D2NA 3FQTB 3VFWB 4OD1H 5I16B 1EHAA 3F7QA 1IEHA 4FFZL 2XFXA 1RZJC 1J11A 1S7SB 5ICXB 4WWKC 4D0BA 2YWYA 4PJFA 1FPTH 3PDOA 4UI2A 4XC3L 4YO0A 2KZ1B 1T21A 2WUCL 1NEZG 4O58L 4GW4A 3RA7L 4L4VB 2GI7A 4FQ2L 4O2EA 3QUMA 1J8HA 1ED3B 3MYJB 2EE6A 2EDJA 4LKXA 2WK2A 3ZKND 4TUJB 4P2OC 4D9QE 4XCEA 1TZIA 3ILPB 4LDLB 2RB8A 4U0RB 3IRZA 5LGJB 2GJ6E 4FQIL 4U1NB 5LQBH 4JZOA 1CFSB 4EBQH 4OGYL 5GPRA 3U7YL 1KIQA 2VLRD 2X70A 3HI5L 4JE4B 4P9HC 3E6FA 4IIQB 3LD8C 4FHBD 5FOBA 4JKPL 3QWOA 4OGAC 4UAOB 4N8CL 5GGTH 3OJDA 3MOAL 4HAGA 1DVFC 1OARL 5IBUB 1KJ2A 2HFGL 4I4WA 1OAYL 2MSPA 1R3KB 1KYOK 3FCTA 4WV1B 1UVQA 2X7LA 4UDTA 5F3BA 5EUKB 3BKML 3SDXB 1XT5A 4J8RB 5E70A 4UTBL 3W0WD 1ROWA 1VSCA 2UYLA 3H7BB 4FNLH 5FYLD 1J5OL 1SJVA 3PV6A 4NO2B 3H9SB 4D9RD 2VL4A 3O11B 1PKQE 2BCKA 3HNTH 1FVEA 3QNXB 3P0VL 3PWPB 3EFDL 4NQCB 3AMLA 4OZHA 2UWEA 1A1NB 1T0MB 1I7ZB 3G6JB 5K9QG 5C8JB 2J6EL 2G9HB 4XBGA 4GG8A 4X80L 2G5RA 3QJFB 1F90L 4XXCA 1L0XA 4G8IA 2C4XA 5DJ2A 4NBZB 1KPRA 1KXTB 5TDPB 1F5WA 1HSBA 2RBLA 1CG9A 2X1OA 1W0VB 1WAAA 1Q0YL 2GFBB 4B0MM 4Y4KC 2AXGA 1NFDB 3SN6N 2VH5H 1ZE3C 5TE4L 3UTTE 4X6EA 1LK3L 3AB0C 3FQXB 5SWZD 3EGSB 1NFDF 2Z8WC 1X5HA 1ZMYA 3TPUB 3V95A 1CT8A 1J1XL 4O5LH 1C1EL 5L9DL 3OKDB 3UBXI 3V7MA 1NGPH 4ZUSB 4PJ5B 2NXZC 4RMVA 5CLWA 3L5XH 3ET9F 4HXAH 3FQNB 3RU8L 1XGQB 3P4LA 1FVDA 4N5EC 4DK6A 1AGBB 1U3JA 3TT1L 1ZWIB 1AO7D 4JQVC 1LE9A 5B39G 2CRZA 3LN4A 1MI5D 1A6ZB 1GCFA 3OBAA 1M71B 5F9OH 2WBKA 4ONGL 5GJTL 4ZYKB 3TYGL 1WBYB 4MDIA 4NN6B 4YWGL 4RWYL 5FUZH 4J3XA 4PJGF 1PZ5B 1F8TH 2CH8A 3S34H 3VWJD 3LS4H 4WFGD 1HHHB 1OLLA 1SBSH 4GRWF 4PJ9A 4GSDH 1XR9B 3LAFA 4WI2A 3W11C 3WKMH 2VDML 5ERWB 1BLNB 1MIEH 3H9ZA 4J23A 5TDPA 1DBKL 4QGYA 3KLAA 2ZUSA 3IJYA 3ZHLA 3TH3T 2Z8RA 3C8KA 3RNQB 3ZKXC 5B4MC 4Z76A 1A9EB 1EGJH 4FFYL 4HC1H 4GO6B 3SGKA 2D03L 3RPIB 4W6XB 5F9JB 3PG2A 5E03A 3I9GL 4KRPC 5IIEA 2CUIA 5FO9B 4PRHB 3G5ZA 1KCKA 2BSED 3MRPA 3KYMB 3GO1H 2CKBL 3MLWH 4C54A 3IFOA 4FG6D 1OVZA 2O5XL 5FUCC 2NY2D 3PF2A 4MD0A 2HH0H 2EO1A 5DVMA 5K9KB 1GPOL 2ZUXA 2CO6B 4NKIH 4OF8A 3CH1B 2FLRT 5JW3H 4U6YA 1MREH 1LO0L 3SO3C 4Q2ZA 4JQIH 5HHNB 1AD9A 1ZT7B 3X3GH 4P46D 3JWOH 5HYJE 5ISZD 1W72B 2OK0L 5IUSA 1FGVH 5F93C 2FR4A 3MRKB 4LIQH 2B1AH 3SOBL 1Q9LA 5E9DA 1JTTA 1WBYA 2R2EA 3JWOC 5D1XA 2IQ9H 4E5XB 3OJ2C 1AI1L 3P30H 4HG4K 4HCRA 4LLYA 4N8VG 3TJEL 3HAEB 1EBPA 4WU5B 1BBJB 1MF2L 2IG2H 3BISA 1C5DB 1LE9B 5E8NB 1RK0A 2M2DA 1F4YL 1GGBH 1R24B 3B9DA 3QUYC 3TNMA 3QCUL 4I0PD 5M95B 3E0GA 4OLZH 2X4QB 3GK8L 3T0EB 4HXBH 2JKXA 2GKIA 5I1KH 4NO3B 4P5TB 4X7SH 2FHCA 3W82A 1KCVH 1MWAL 3ZDYF 2VDOH 4TPRH 3MLVH 4DUXA 4XTRC 3VH8A 5ILTH 4G7VL 5FO8B 1KACB 1EFXA 5DI8A 1DBJH 4P48A 4ZNEE 1H3TA 4YDVA 3RX5A 1T0PB 3LV3B 3MRHA 3SE4C 5E1AB 4P2QA 1HI6B 4OV5B 1RY7B 5CBAB 3ZMRA 1OB1A 3TN0C 5IESH 4I1NB 1WC7B 5K9JH 1S7RB 4GW1A 5KVGL 4MCYB 1MEXH 3BZDA 1RFDL 4TSBL 4Y4KD 4JFQA 5BQ7A 5IOPA 4LU5L 3HZYA 1G0DA 5E6ZA 1IT9L 2B4CC 4NQCA 2VKXA 5HDQL 2VDPL 2GIYA 3P0YL 4LCWD 3SKUD 1BZ9A 2OL3H 2FDBP 4NO0D 2ERJB 2EKSB 4XXCC 4XNZC 5E94A 1YNLH 5IFJB 4PS4H 3LKNB 4ODBD 1YN6B 2EDHA 3G5YA 1BBDL 1ORQA 1V7NH 3CX5J 2I24N 1HINL 5F97E 4I0KA 1BVLB 3RWEB 4FFZH 1UVQB 3L7EB 2HVKB 1DQJA 3HFML 5FXCH 1JYXA 1CE6A 7FABL 1RUAL 1FPTL 4L1DA 3ZDXE 3LMJH 1DVFA 2DQTL 1MFBH 4ISVB 3RA7H 2VLME 4GAGL 3AXLB 2NZIA 5H8DA 3B9KB 4AY0A 3ZE0F 1G7PB 3V0WH 5BJTA 3O8XB 2BJMH 2FL5B 2HYMA 5D5ME 2DL9A 5DEFB 5LGJA 3DTXB 3L3GA 3LB6C 1EO8L 5J13B 5LQBL 1CF8L 3P77B 3CU7A 1WISA 2VLMD 3WEXB 2ADFH 3WSQH 3NACH 2EDRA 1FNSL 4X9FA 1MCKA 4TVSa 1YMMB 3MGOB 1T6VN 3F7YB 4N8CH 5GGTL 4UNVA 4PJXE 5DGRA 5J1SC 4YHMH 3B9KC 2XZAH 4UDUA 3CH8A 4PJFB 1JVKA 4BSWA 4PBXA 3LKSA 5CUSH 2R2BA 3HS0B 5HDBE 4TSCL 3ZKMC 4WGVB 2IPKB 1VFAA 1IGCL 3KYKL 5C8JA 3RWIA 1G7LA 2I07A 4X7TB 1E4WH 2BSSA 4WU7B 1J12A 4X6FB 4LKCA 1A0QH 4Z7UB 2AJ3B 4XP5L 3BRGC 4GKSB 5IKCA 2IQAB 1OGAE 4NZTL 2DQIH 4OIIL 3OR7B 2LQRA 2R4RL 2YPKB 3QUXA 4J6RH 4OAWB 2VRAA 2AJUL 4XWOD 2CUMA 2W9EH 2MQCA 1KB5H 2Z92B 4DAGL 4LPYA 4LHUA 2XQYG 1I1AB 1OP3H 4MCZB 4WV1A 4LNVA 4G6FD 4XI5C 1XCTA 3SGKC 5IFAH 4XWGL 5IW1B 3L3HB 3QIBA 2VZTA 3K2MC 1JFQL 4U6XA 1BECA 2EH8L 5HHXH 4K3DH 1Q0YH 1E6JH 5F7FA 3H42H 5L6YL 3QIBC 3QEGL 5E8OB 5JPNB 2D31B 2NY6C 1MNUH 3CFCH 3BIKB 3JWDL 3DX6A 3LQZA 3C5JB 3DVIA 4PGBA 3QIWD 4I8DA 5E1HB 5HSFA 3CIQA 1BFTA 4NQDA 1NH6A 1NC2A 4ZOBA 4MD4B 1GOGA 4WI5A 1J05B 3V9FA 3NIDF 1TCRA 2E7CA 4Z7QE 2GUOB 3HUJA 4I2XB 1JPSH 4HH8A 3ZLQC 3MLRH 3QUYD 3EYVB 5J11C 1G7LB 2V7NB 1U95B 5F71A 5E24E 4WTZA 1A5FH 1LILA 4JDVB 1FG2B 3QDMD 3ZE2E 2C1OB 5FCUL 4M6ML 3RTQA 1BM3L 5DLMH 5FV1L 2YBRB 1A7OL 2Q1EA 5D5MF 1QRKA 4RMTA 1YQ2A 2VZUA 4F33B 2XZCH 3LS4L 4LLWB 3I75B 1RZFH 1I3GH 1Q94B 3WKML 4N90E 2QLVB 1AP2B 4FQPA 3KJ6L 4MDJA 5EZJB 2WZPD 1U3HA 3SKNB 2VZ1A 4PBWD 3ZTJG 3RPIA 4RFEB 5HVWA 1EGJL 2GTZA 1IGTA 2F53D 4XP6H 5J12B 1RJZA 3O2WL 2J88L 5GZND 4HV8B 3HC3H 1RIHL 1PGRB 1U6AH 2VLRE 1XR8B 1F3DH 4X98B 5BRZB 2RCSL 5CZKA 4JM4H 1OAXL 2EH7H 3L3IB 1TJIL 4MQ7B 5INDA 3RBGA 3U4EA 3FOMA 1UM4H 3GSXA 3KDMB 4NWUH 4FZEH 5T33H 2EE2A 4NDMA 4Y8AA 3RVXD 3W9EB 4Y4FD 4ETYA 1AGFA 3MUZ1 3WIIL 2X9XA 2JJSA 4GUPB 4WI4A 2BVYA 3GUTA 1OAUL 2JELH 4PGBB 3LB6D 5JORA 4WTWA 3VFOA 1XF3B 4RGNE 4K3JH 3JWOL 3QG6B 1JTOA 3U46B 4JG0H 1ZT1B 4P4KB 4NGHH 4O51A 1H8NA 5E94B 5D2LF 1MSPA 5TFSH 3FQWB 1KTRL 2Y1VA 3QA3B 4LLAA 4N0FA 3SDDC 2IQAA 4OGXL 1J0HA 4AIOA 4Y19B 5DO2C 4WO4C 3RUGA 1KIUA 3BHBA 1KXQE 4YHZL 4K94L 1AO7A 1Z0MA 4OJFL 3UYOD 3Q3GB 3S98A 1TJGH 2GJ6B 1L0QA 2VDKH 3RX8A 1I9RL 4Z8FL 1ZHNA 3B43A 4KJYA 4QYOB 3G5YB 2A83A 4FQ2H 3SO5A 2BOCA 4GJTB 4YFLF 3H3PL 4HJ0C 3EJJX 4XNZB 5D8JH 1XIWD 3BP6A 3HMXL 4YXKH 1DQQB 3SEPA 2J8UF 4QLRA 1I7RA 1AQKL 4YDVB 35C8H 4K3EL 4P3WA 3BQUB 5DK3A 5F8QC 1A14H 3HZYB 1NDGA 2GK0B 4HWUA 2W0KA 4M43H 2QKIA 3N1MC 1UB6B 4ZDHA 4P59L 1ONQA 1E4XI 3VMPA 2BFVH 3BD5A 1I1AD 4HWEL 1B2WH 4NO3A 2EXWD 5FUCE 1DDHB 2ESVB 2QR0A 3WIFA 2PO6A 4U1SB 4MNGE 1I7UB 4R4BA 3FFCA 4NM4L 4OM1H 4N8VA 4NCC2 4U1KA 5ANME 5KSAA 1UADC 2DYPA 1FORH 4ODXB 2EDEA 3BUYA 5HDOA 2DQDL 1MI5E 1WBZB 3DUHA 4N8PA 1HCFX 3L3JB 3GUTB 4UZGA 4Y4KA 5HY9A 4XWOC 5DQ9A 5JZ7D 3K4DA 3GKWL 1RD6A 4LSSL 4RAHA 4X9BA 4X5XB 4RZCA 3VU2A 1YPZE 2YRZA 4HZLA 4FNLL 4XNQB 1J5OH 5F7NC 4F2MA 2CLZB 2XZQL 4R2GB 3QA3A 3VFRA 1D5ZB 3QDHA 1YMME 5SWZE 3JVGC 2UVFA 4P2QE 1E4XH 4C57C 2ARJA 1I8LC 5B21A 5B8CC 5GISH 5HHOA 1OTSD 1C08B 1OM3H 3FFCE 1KELL 1M6OB 3T2NL 4JO3L 1M7DB 4PV9B 2EDKA 1KN2H 2YXMA 3UYRL 4J3VA 1HI6A 1HYSD 2NZ9C 3IT8D 3H3BC 8FABA 3DMMB 2ADFL 5SWQA 4HUWA 3TFKC 3IDGB 4PJ9B 5L9DH 4FABH 1DN2A 4J1UA 5CILH 3GBNL 4ZG1A 1BFVL 1IGYB 2IAND 4XBGB 3F58H 4CU6A 3ME0A 3ULUC 1GGIH 5JHDD 3FQTA 4U1GB 2CDGA 3HNSL 3LDBC 1ZXQA 1QKZL 4DN4L 1MQ8A 4NSKB 3RWGB 1U2HA 3RWFA 4HG4J 1NMAH 6FABL 3IFPB 2XG5A 3VFRB 5JTWA 1W8OA 1CDBA 1QSEE 3VWKB 3VXSB 1MCCA 4XHJC 3ULVF 4IRJB 3DSNA 1MAJA 1TQCB 2MHAB 4R2GD 4R7DB 1SBSL 3T77B 4MNQD 5FAAA 4YLQT 1QFOA 4DN3L 4RSVA 3IAPA 4GXUM 5EU6B 3SDDA 1DEEB 5IW1A 2JF1A 2H1PH 1KEGL 4IOFC 5J89A 1INEH 4ODTH 4ZO8A 3MRFA 4ZAKC 1QSED 2UZIH 4R4BB 1XGUB 1TCMA 1RJYA 2VQTA 3MLSH 2ICCA 4PJAE 1H3VA 4HV8A 1XF3A 1ND0A 5LG1A 1FL6A 4Z7NE 5DC0A 2K9UA 3BIKA 3FO2B 3SKMA 4EIGB 2OSLB 1RULH 3IYLW 5EB9A 2IH1B 3MRLB 1QSVA 4HFWB 4PY7B 4OSUH 3R8BB 5IHUL 3J7HA 4DFIA 2BCKB 5F7YC 1NSNL 4OZHE 3JTTA 5HHMD 5BVJA 2CIIA 5IMMA 2BK8A 4BM7A 1QRNA 1QHOA 2OQJA 3UPRA 3OKOB 2FGWL 1JI1A 2DJUA 3MRCB 4O9HL 5J9PA 3EZJB 5INCB 2Q3AA 3W0WA 1P2CA 2Z0BA 2Y7QA 5ENWA 4DKAA 5F6HJ 5TGBA 4PLNC 1JGLL 1G7QB 5ICYB 1UZ6F 2APFA 1NCBL 1ZHLA 2Q7YA 1LE5A 1TVDA 2ICWJ 3C09B 2ZUYA 2X4UA 3TWCL 4OCYH 4PD4K 3QCUH 3KLAB 1HKLL 1U8OA 2XZCL 1V7MH 5GGVY 3RZCA 4U1IA 4CVZA 1UXWB 1T2XA 3CFEB 5F1NB 4L8SA 1F11B 3W9DA 1KG0A 3G04A 3K3QA 1ZVSA 1G9ML 2AERT 3C5JA 1JI2A 3TIDB 1NMCB 4G7VH 3N9GH 5GRXG 5C2UB 1YEKH 4H1LA 5I75C 1HOCB 2AJZB 4NKMA 3E3QE 5IWLC 1ZANH 1MCRA 3DBXA 5KSBA 1U3HD 1ED3A 3RWJA 4LQFL 4NQSA 4F58H 2PO6D 4FTVD 4PP1D 1KBGH 4KK5D 3SQOL 2EKJA 3MFGB 4NP4H 2IMNA 3DYOA 1HSBB 5DDHB 4NC0B 4P4KD 4RAUB 3BP5A 3DXAB 5BZWA 1S7SA 5ICXA 3FRUB 4XVUC 1ONQB 3MV8B 2P47B 4UINH 1I3VA 1U93B 2DBLH 3GI8H 1XZ0A 4X4XA 4AH2B 3P0YH 4J4PC 3SPVB 5ACLA 4LP5A 1R3JB 4GRLD 4N0RA 3SKOA 1RURL 2L7UA 2DJ4A 2NXZB 2LAGB 1CE6B 4Y5XB 5I1AB 1IKFH 2OI9C 3MYJA 3ARBC 2P4AB 5D2NE 1Z5LB 1EK3A 3QHFL 2BY2A 3HTLX 1ERNA 5F7LB 4QRSB 2HWZH 3CX5K 3IXTB 4QXTB 4F7EB 2FGZA 5I73C 4O02L 3QHZL 1YMMA 1N5AA 2RR3A 3O3UN 1EJOH 3LKQB 1T7ZA 4POUB 1KTLB 4XP1H 5CZVH 4G80A 3QDJA 5C0JB 5DI8B 2F19L 5J6HA 1T0NA 1MIML 2VAAB 2WUBH 2BVUA 3PWJA 2D9CA 9CGTA 3ZKQD 2YD4A 3M1BA 2AXFB 4PJEE 4F8TA 1QLEL 1CR9L 4HKBA 35C8L 1FFNB 3UO1H 1NC4A 3D3VE 4KRLB 4KI5E 1W8NA 1GAFL 3D85A 4LRNL 1JGVL 5D1QA 4OCWL 1F4WH 3QIWB 4R7NA 1RZ8A 4UILL 4ODUB 5DJAB 2Y07L 1KB9J 5F89B 3QDMB 4G8EB 4TVPD 2EDLA 2J1KA 2VZVA 5EOCL 2C3WA 4OF0A 4EI6A 4PJAA 1D6VH 5KS9F 4Q9RL 2R2EB 3ILQD 2E8ZA 5E9DB 3QPQC 2HRPL 1I9IH 4MNGB 3LQMA 3VXUA 3BRFA 2DWEB 1VKXA 3I6KA 4MCZA 1FORL 5IQ7L 1SVZA 3LRSB 4M93C 5BJTB 4NN7B 3Q1SL 2DQCH 4ZQKA 2ITDB 4HIIB 4IRZL 1RI8A 1QFWM 3VRJA 1S5IL 2DYPD 1ZAGA 4POZC 1A0QL 4K7FA 4PJCE 4XVSL 2VABA 5TF0A 4OZFB 1YYLL 3NCFB 3VFPB 3ISWA 4N90D 3I75A 5FHBH 4UTAL 3MLTB 4FN0A 3HCVA 1QSEA 2IPUK 2JJUA 1DLHA 3WN5B 4Z7WA 2NMSA 2WWMC 3QFJD 8FABB 1WAAF 1LQSR 3TP4A 5CBAA 3G6JE 5GISL 1PKQB 3PABB 2D7TL 3ARBB 1U95A 5EORH 4MXQC 1RK1B 1TTFA 5DO2D 2VDLL 2EYTA 3MBXH 2VUYA 4JFQB 5BQ7B 3DOSA 4IJ3C 4KVNH 2FYYA 2BVOB 5DUPL 2ZUWA 2DQUL 3OJVC 1A4KA 3OX8B 4ZTOH 1N64L 1OTSC 2QADB 4QTIH 3NZ8A 3QFJE 1LEGA 3A0OA 4RMUA 2A6JA 3MX0A 1JUFA 3DXAD 4H1LH 2CDFB 5A16A 1RPQA 2NY0B 4JJ5A 4G3YH 4R26H 1BOYA 2P44B 3MRHB 1P53A 2XICA 4PJIF 3GBLA 5DSCA 5CGTA 3A6BL 3FHAA 5DMKA 1VFBA 2NY3C 3HI1A 4DN4H 4Z78A 5DUBB 2YOCA 4DEPC 4XPAL 1EA9C 2D0HA 2DTML 5CWSA 3VGEA 3MXWH 5EUOB 4M1DH 1P1ZA 4WJ5B 4OLYL 2AK4D 5I18H 1A7OH 1QSFD 2J3SA 3O0RH 4BFIB 3QI9B 4HUKB 2XRAL 2YRPA 3GMRB 1JZ2A 1UYWH 2EDXA 2F5BL 4OQTH 2W65A 1UGNA 4ORZC 1FFPA 4PUBH 1A7PH 2ZSVB 2WP3O 5DD1H 1MFEH 3NABH 1TJHH 2OMBA 4JHBA 3H2WA 5HHME 3OV6A 5T1KD 4N9GA 3KYMA 1WIPA 4KK5C 3MLSL 4OB5H 5C86A 3BP4B 5IHBA 3SCMA 3WNOA 2P24A 5IBUG 4F80A 4BZ1L 2HKFL 2RCSH 3PQYB 1N3NA 3X14B 5ESVB 3L95A 3CUPB 4JHWL 1KPRB 2Q76A 2YUWA 4MJIA 1K8DA 5I1EL 1MCNA 1MHEB 4GQ9L 1HHHA 1XH3A 3IDXL 4L29A 4NZJA 4JO1H 4UQ3A 1CD8A 3MBED 1YEHH 1QLFA 4UU9A 3P2TA 1QZ1A 1XF5B 4YC2B 1A6VL 3QUKB 4JPKL 2D4FA 2F15A 4ONFL 2DKUA 2FJGA 1WAAE 3EDKA 4P5TD 1IM9A 5DYOA 2VE6A 3DI2B 3E6FB 3QXAA 1FFPB 5GGQH 3WFBL 4OCYL 2Y6SC 5IR1B 3FQRB 1IAMA 3CK0H 1BD2D 3FB8A 3GJFB 2YA2A 1S9VB 3LS5H 1K5NA 4XZUB 5DJ8A 5J06A 1TVBB 3EGSA 1G9MH 3NPSC 4X4ME 1Y0LB 4YDJA 2VXSH 4JDTH 5DHVH 4WEBL 5IR1A 5BV7H 4NWTH 1KULA 4Z7VB 5C6WH 1U8HA 4OD3L 1WZLA 1LDPL 4O2EB 4J4PA 1NUDA 4OZIE 5GS1A 1EZVX 1V3KA 4O00A 1E28A 1MHPH 1FIGH 3FN3A 3T0XA 3KNBB 5D9SA 2FX8H 3FFDB 1P69B 1GZPA 3CLEH 5HVHC 2XTJC 5DWUL 2X4TB 4PJDB 2VITB 3D5OF 5FDYA 4ONHB 3LPWA 1I7ZA 3G6JA 3MV01 2A74B 1G9MC 4IEFB 5DJXA 2IMMA 5MI0B 1KGCE 2DQEL 2C9AA 4Z7WE 4HKXA 1ZLSL 1PAMA 1M05B 1DQDL 1MQKH 4L3CA 3O6LH 1GOHA 4JQXC 5LWYH 1U8JA 3MV11 2P8MB 5FOJA 2ZG2A 3KPNB 2N4IA 3MJ9A 1L7IH 4UNUA 1UCTA 5FO8A 2A9NL 4LVNC 3BWUC 2HMID 5TDNB 5D70H 4X6BA 5D7IB 2JIXA 4ZS7H 4MA8L 3ARDC 3TO2A 1VGKA 1HXYB 3IFNH 3K2UL 4TOYH 3NIDE 1OLZA 3OJDB 2H3NA 1YQVL 2BSRB 2VUOA 3QIUB 4MNHA 1HIML 2BX5A 1S7TB 3IVKA 4XP1L 5CZVL 1SMAA 4RA0C 4K94C 5JOFB 4M5ZL 1U8HB 1T1XB 5GS1C 4IMKA 3LH2L 3Q2CA 4PLKC 3OB8A 3VDBA 3BXNA 3CSYB 1YEFH 5E99H 3V2AR 3CGTA 1U8NA 3PP3K 5LVEA 4LMQE 1MOEA 4I18B 4MWFB 4BYHA 1UCBH 1KN2L 1EEZA 3CDGA 1G7HA 4KJPD 4OCWH 5CD3B 4PGCA 4ZNCD 1T1WB 2ARWA 5EBMB 4QRUA 3GSNB 1JZ7A 4I5BB 2ZCLH 2VE6B 1I85A 1U0QA 1H3PL 4HT1H 4FABL 4GMSL 4JZNA 4YDKH 5I71B 3HE7B 5DJ2B 3N1PC 3WIFB 3NIFF 3MOAH 3TO4C 3BO8B 1U91B 3GJFK 4P46C 3WE6B 3HNSH 2O5YL 4CW1A 5IIEB 4B53A 4EDXA 1BZ7A 1SBBA 4Z7UA 4H20H 1HXMA 2CKBA 4AL8L 2AS5M 3GFUA 3DJ9A 3N50A 3BKMH 4UBDC 5C09E 5DJZB 4XMPL 3S4SB 3TBSA 1T80A 5C7XH 1NANI 3DV6A 3ARBA 1NCAL 3OAUL 2VLJD 1QR1B 5FGBC 4RRPA 5A1AA 4CVWA 1EDQA 2OS7A 3WN5A 3RHWK 2VN7A 5GS3A 4V1DE 4ZXBB 1PLGL 4OD2A 3PGDB 2NY3B 2P8LB 5F1KC 2AEQL 4NYLA 1MVFA 4N9GB 4ODTL 3CSBA 3DX9A 3ZL4L 3HE6C 2JJTC 3ULVC 1EEYB 4JEGB 4L8DB 1FNEB 3V4PL 1R3IL 1DQMH 1OAKL 4N0FB 1G6RL 2VLRA 4PJXA 3T8XB 1PG7L 2BNRA 4HIIA 4L5FH 1A2YB 2NX5D 2YSSA 3TCLB 4GLRI 1GGYA 2A6JB 2G75A 5FYLL 5IGXH 3QO0B 1U8QB 1QVOB 3IKCA 4LCCA 4F9LC 4WUUA 3GSWB 5BS0A 1U42A 5EU3A 3D2UB 2YD6A 1VFUA 3KPMB 4P57B 3VRLE 1BIHA 1NFDA 3MLUH 4RFNB 4MQ7A 1A3LH 4EI5B 1PEZA 4YBLC 1EGJA 5B3NA 1KJVB 3O41B 5HYIA 1FJ1B 2JB5H 3EJYC 4QXUH 1N6QH 2MCPL 1FFRA 1S9YB 3N1GC 2F53A 1KJMA 2DTMH 3T4YB 2G5BB 5LBSH 4CMMA 4GXVH 1RZGB 2QEJA 4FQIH 1QR1A 3FHQA 2I9LA 3OG6B 1HH6B 1WITA 2UY7A 4YHPA 1DUZB 5FUZL 1FO0A 4WENB 1I8KB 3DYMA 5E56A 4MDJB 3EDFA 2CIKB 3IDIB 4DQOH 4NNYB 2QQQA 5EOCJ 5D7KE 3HAEH 5C6TL 4NZRL 3QDJB 3I6GA 4G5ZL 4ELKB 5GRVL 2XTJD 1YPZB 3LQAL 3NFSL 2DMKA 4XVTL 3FB5B 3FB6A 5CCKH 2WBJB 2YBRA 2CXKA 5D71L 2VLKB 1A3RH 5L8LB 4NKOB 2PUQT 4XMKH 4YBQC 4N1EA 2EXYC 5HI4C 3V6FA 3LEVH 3MREA 4YPGA 3QIUD 4BZ1H 2DWEA 2VZOA 3CCHA 1VKXB 1T1YA 2BNQA 3BVNA 3MLWL 5AYQA 5F70A 1J0JA 3X13A 4EJ1C 3IDNA 1KBGL 3OZ9L 3IB4A 2XTJE 1M1SA 4U6VL 3VJ6A 4LDOB 4MSWA 5CP3H 1CFSA 2CJUH 8CGTA 5J56B 3WFHB 5T5NF 4AMKH 5L0QB 4H0HB 3B6SB 2ADIB 3D6GA 2YPVH 4IJ3B 5AUMA 3UTTB 4QNPF 1W2KT 1XIWA 5EOQL 3RHWF 3SDAB 3IXAB 4HBCL 4JPKH 5BZDA 5JNYB 4Q0XL 4KQ3L 2CRYA 2X44D 1AXIB 4AYFA 3TJEH 2VAAA 3KAAA 4WO4B 4HMCA 1IL1B 3D3VD 5T1LA 3QQ4A 1F4YH 1GGBL 1OTTC 3FT2B 5F89A 4AEEA 3BD4A 3GRWH 5DURD 1TNNA 5C0ND 1G1YA 3ZO0A 3GMLB 3BUTA 4IDJL 4BFBD 1N0LA 1QSFA 5I1KL 5L8JB 2F19H 3BOVA 2Y36L 3W9DB 3O4OC 3FT3B 3FFCD 4KH2A 4WWID 5DJ6A 2XPGB 3L5XL 2VDOL 4F9PA 5BV7L 2ZCKH 2E7BA 3DX7B 3VGGA 1TVHB 2BMKA 4P2OD 5FHAL 4LKCB 3DVGA 3C5ZC 4QGTA 5C0AD 5HYEA 1DQLH 2HTLC 1EEQA 4OCRL 5TGBB 4OCLC 3HS0A 5CEYA 1X7QA 3RNQA 3PL6A 3KPSD 4FQXD 5EU7E 1UWEH 4ZPTA 5F6HI 2F58H 3L5WB 4Q9RH 1M05A 4CKVX 1X5JA 4NQVA 4X4YA 4P46A 3QG7L 3MRGA 4MNQB 1MQKL 2IADB 2PTTB 2RGSA 4D0CB 3MBEB 1HHKB 3TVMC 4Q6IB 2DM3A 1C8PA 2L4OA 2V9RA 3FT4B 5DJYA 5HGGS 1L7TH 2BNQE 4JN1L 4KKAD 4C4KO 3HZMB 5FYJU 1T1XA 4I9WE 4MNQE 4LCUB 1AGBA 1V7NL 3IFNL 3K2UH 4NN7C 4TOYL 5ELIA 5CBEB 1YYLH 3RWJB 4NKIL 1RZKC 1YUHB 4FQCL 4ZUVA 2HMIC 2OL3A 3BIAX 4CMHC 4MWFA 2DRUA 1AD0A 1AGCB 4M5ZH 1NCCL 2WNGA 3NOIA 1LD9B 2PW2A 2WANA 5ADOL 3ZE2F 2X05A 5FA3B 5DMKB 3NZHH 5EORL 4DZBB 3GGWB 3C60D 2R1YB 4ORGA 1GVIA 1AI1H 3P30L 4JG1L 5IHLB 4HQQH 3VFGL 4I2XE 1CS6A 1UCBL 4I3GA 5K9KA 2I9TA 5K9QI 2NYYC 5C3LD 4R4FH 3TA3D 4GG6A 3B83A 4OLXH 1UM5H 3MLZL 4S1QL 5AZ2L 1N0XL 4PR5A 4HT1L 2UWEB 4UIKL 5DJ0A 4O58H 2PXYB 4WW1A 4G3YL 4R26L 4MAYC 1NDGB 4FRWA 1IBGL 4TQEL 4QRPB 4P2RD 3U82B 1CFQB 3IDYB 2PKDA 4BKLB 1CL7L 3REWB 1UQSB 4OZGB 3QEQB 4LLVA 5HHMB 4XVJH 1HSAB 4AEIH 5D1ZC 4KAQL 1S7VA 3R1GL 3FONA 1G6VK 4PRPA 1F58L 4JPVH 2D0GA 3VWKC 5K33A 1FZKB 1CDCA 3QUYB 2X4NA 4ZO6A 2W0LA 2PR4H 2OSLA 2CR3A 4LPCA 3G08A 1RFDH 4OGAD 5HI4D 4EI5C 3B8YA 3S4SG 4EOWH 1PG7W 4HCRL 4UV4H 4A2MA 3UTPE 3KPSB 3DUUB 5JHLH 4XX1G 1CICA 2JJVA 3SJVD 2ZJSH 2IALB 3K4AA 4M03A 3NCBB 4S0TD 4OFKA 1R3IH 2FD6H 4YX2L 1WK0A 2DIBA 3VXMB 5KANI 4YFLI 3EKCA 3WLWC 4QXGH 1BX2B 2COQA 4XXDA 3G9VA 3VXUD 3L7FB 3KPNA 3TJHD 7FABH 1YY9D 5JQ6H 3KLDA 3F6LA 4FP8L 2X1QA 1OWWA 1DBBL 1NEZB 1KLUA 4DVBA 3C5SA 1CXIA 4FXKA 3RAJL 4WWKD 5DJDA 5I8EA 5E9DE 2DLEA 3V5HB 3BP7B 3TIEB 2E8YA 2R29H 4MJIE 5LKNA 4GRMA 1ORSB 5FO9A 5J11B 5IFHH 1HNGA 2DWDB 4HUXB 1D5XA 4Z5RA 5E95B 2R0LH 4C56E 4OF7A 1P4LB 1UXSA 3CK0L 1N7MH 3SDXF 4QT5B 1KCSL 2HT4C 3EOTH 4G9FA 5EC1B 4ELKA 3QQ3B 3AREC 4FQ1L 1J9CT 1R6VA 3TO4D 2YWZA 5KG9A 3BP4A 1S8DB 3RL2B 2P7TB 4U0RC 2ATPB 3LZFH 3O4LD 4UIMA 3B5HA 3VFPA 1NLBL 5CINH 2CDEA 4JVPA 2VL5A 5F3HA 3HI1B 3V6BR 2GJJA 4ZFFB 4WFED 3TZVA 4U6HA 5DHVB 3V0VB 3VFTB 4RWYH 4YWGH 5EULV 5IW6A 2AJXH 4XP5H 3QFDA 5KSBE 3BP5B 3DXAA 4FS0A 2YKLL 3S34L 4QHNA 1EHLH 1Q9KA 2DQIL 4KFZC 1G7IB 4BFIA 2J8UA 4KHXH 4NQDD 2X9YA 1C5CH 4RGMC 2GCYA 4NWUL 1X5ZA 5T33L 3SDYL 1EXUA 1TZIB 3ILPA 5HVHB 2FWOB 4K8RC 1CDYA 1QD0A 5CGYC 4BQBA 1F2QA 2XWTA 1HQ4A 3MA7B 3FN0L 3I3BA 1DBKH 2NXZD 3BKJL 2W0FB 3INUL 3GMPA 3EYSH 1B0RB 1S7WB 4M7LH 3CPLA 4ZODA 5FM4A 3ESVF 4NHUA 5J6HB 3O6MH 4G8EA 5B38G 3SE4A 3LN9A 3L3IA 1M4KA 5KSAB 3QCVL 4X83A 3C60B 4PRNB 3WHE1 3O8XD 3X11A 5DGQA 15C8H 2NPLX 1RUPH 4TTDC 5A3ID 1ZLUH 5C08A 5KAQG 1YNTB 4RFEA 2YPKA 5C08E 3QNYA 5ACZA 1DFBH 2XA8H 2Y23A 4LVNB 4M1CC 1WJ3A 2WLYA 4YR6B 1EVUA 1F6LL 2AJ3A 1XFPA 4X6CA 5T3XH 4OZHB 1LO0H 1G9NC 3OTTA 3U48A 3CAFA 4MA7H 4H8WL 5FKPB 2F8VA 1GRWA 1KXVC 2CK0L 2X1WL 5CEZE 4KK8D 1OTTD 5E6IC 1YEJL 4E41A 4M7ZB 3IETB 5DMIH 2HT3C 4RAVA 5ALCH 4JVWA 1I1FB 1XEDA 5I8KH 3R06B 3KJ4B 2XACC 3BKYL 2MQ0A 2NX5E 1IZKA 3BWAB 5T1MB 4MAYD 2B1HL 5FCUH 5JORB 4WNQB 4ZOCA 4NKQB 1YJDL 4QHUA 1LO5B 1NBZB 1M7XA 5HHQA 1CCZA 3CC5B 3GMOA 3MA9L 4OFPA 1T66C 3O3AA 3OB0H 2LVEA 2XWTB 4NCC1 1I3GL 1K4CA 1QVOA 4XCYA 2F58L 2I26N 1MCLA 1VEMA 3O9WD 4KJQD 4MA3B 1OPGH 1KJ2H 5I1HL 1IAII 3DHJA 5GS2H 1GXEA 3VGBA 1E27A 4V1DD 4HJJH 4NOFA 4Z7NF 4YQXH 4M7KH 1RZIA 4HH9A 4PYHA 3P9WB 4GUPA 3RGHA 2AXFA 1PQZB 4G6ML 4XPGH 2Q6WA 3FZUD 3O2DA 1VEOA 4JPIA 4PJDF 3STZB 2B2XL 3VFUA 3LSOB 2CKNA 4GBXB 4IOIA