4GS7C

Structure of the interleukin-15 quaternary complex
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
196
structure length
193
Chain Sequence
PLPLPEVQCFVFNVEYMNCTWQSSSEPQPTNLTLHYWYNSDNDVQKCSHYLFSEEITSGCQLQKKEIHLYQTFVVQLQDPREPRRQATQMLLQNLVIPWAPENLTLHKLSESQLELNWNNRFLNHCLEHLVQYRTDWDHSWTEQSVDYRHKFSLPSVDGQKRYTFRVRSRFNPLCGSAQHWSEWSHPIHWGSN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Interleukin-15
publication title Mechanistic and structural insight into the functional dichotomy between IL-2 and IL-15.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 36
structure length 193
sequence length 196
ec nomenclature
pdb deposition date 2012-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF09240 IL6Ra-bind Interleukin-6 receptor alpha chain, binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4gs7C02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4gs7C01
4MQTB 4OCYL 2ARJQ 2LTQC 2W0FB 4PGCA 1FG2B 3IJHB 4D0CA 2Y23A 2FX7H 3JWNC 1KCKA 4KK6D 3WNOA 2FZ3A 5DJ0B 2VN4A 3ZE0E 2WBJB 3W9EB 3OJVC 5CEZL 3X3GL 1CFVH 2NR6C 2CK0L 5C92A 2VQUA 4TNVF 3SHSA 3B9KA 1E27B 2AEPH 4IRSD 6CGTA 4GOSA 3FB6B 4X8JB 3CH1A 3V52H 4EN3A 3MUZ1 1NCAL 3OF6D 4X6EB 4PP1C 3HE7C 4TRPL 3QJFB 3TWCH 5EA0L 2VR4A 1AXTH 3EUUA 5I16B 5IROC 4DVRL 5CGMA 4QNPF 3LPGA 3GB7A 4FZEH 3BHBA 2FHBA 1LP9B 5B39A 2ZUXA 2DIJA 2VDML 1RVFL 2XQYG 3DV6A 3PV6A 4MJIB 3S37X 4YPJA 5FGBA 4BQ9A 4WFFD 1U8HB 3U2SB 1N7ML 5BS0B 5KSUA 4KH2A 1IKNC 3AS0A 4OLWH 5LAXA 2VUOA 4BFIA 2W9LA 5AAMA 3GHBL 1F4AA 3MACL 2MQ0A 4H1LH 5D5MA 4YHNA 2H3NB 1OLLA 3ZDZE 1EAPB 1JTOA 3X3FL 1BBDH 3LB6D 3MLSL 1HHHB 5H8DA 3WHXA 5FYKU 2VZSA 1T7YA 3IFNL 4Y4FB 5EU6E 3B5HA 3DOSA 5BW7C 4Y4KD 4GRMA 2W59A 3DMMD 4O2FA 2HJKB 1E6JL 5LQBL 3OWEA 2EDRA 1IMHC 5I1AB 3IKCB 3OKNB 3P11L 1UYWL 4U6YB 4OZHF 1XGYL 5ESVB 1NC4B 3HA0A 3BH8B 5I2IA 2VLJD 2H6PB 4OT1L 3BSZH 1SMOA 5I8KH 4M62L 2B0SL 4UTAH 4A6YL 4Z7UF 1RJZB 3QFJA 4XPTH 1YJDH 2R4SL 3A6CL 4ONGH 3VW3L 5CFHA 1HZHL 2YA2A 3OHXA 5DSCA 4Y4HD 3NIFE 5DQDL 1HWGB 3GM0A 3KYMB 4OUUA 3QDJD 1S9VA 2HRLA 3PIQB 2DTMH 2PR4L 2CUMA 1NFDF 3CDGB 4GG6F 4LCCA 4KUZH 4FQ2H 2QSCH 4WUUA 4X9GA 2GJZA 3SKUD 1JGDB 1KYOJ 1HDMB 5ADPL 4I5BA 5D8JL 4CU6A 4J3WA 4Y5YA 5DA0B 4UDTA 5IHUL 5ANMA 5HDQL 1K6QH 4BFEA 3S9DB 5GRVK 1U3HA 4MA7L 2Y07L 4HXBL 2OTUA 4GQ9L 4PYGA 1JYWA 5EOTB 5I6XC 1AKJB 3VRIB 5INDA 1KTRL 2FBOJ 3FN0L 5HVWA 3ZTJH 2NY6D 3R0MA 4OZFG 5E9DE 2XN9B 3EYOB 2J8HA 1TZIB 2FB4H 4K71B 4NT6B 3JTSA 2XA8H 2EKSA 5D7JC 5AAWA 2RQ8A 3UTTD 1RURL 1GGCL 2AJSL 2PW1B 2Q7YA 1MPAH 2D0HA 1KIRA 3HI5L 4XP5L 1IFHL 3DX8A 4QT5B 4PG9A 2O61B 3OAUH 3SE9H 3BUYB 4NNYB 4U1HB 1DFBL 3E6HB 3IT8D 3DVGA 3CFBB 1WBZB 5C0AB 4EBQL 3RI5F 1WFUA 5T1LB 1I1AD 3MCLH 4WUKL 4CADB 2JB5H 1FNGB 4DUXA 5DDHA 4YHLH 1CE6B 5TQ0L 3O11A 3CFKA 2R56H 3O8XB 5F7DB 5C0GA 3SDCA 1OTSD 4WEMB 1ED3A 2VLKD 3BP4A 2ADJA 3TCXA 2Y5TB 4FQCH 1MY5A 5TQ2L 5K9QI 3QG6A 2BNQA 4R6UA 1WAAF 4J3VA 1JZ5A 4R96A 1RZJC 4OKVA 5BJTA 2OTWB 1RIUH 4AMKL 2Z91B 4MDJA 3VXRB 3WHE0 5T1DL 1L7IL 2R9HC 4XB7A 1JP5A 3TA3A 4OJFL 2EDEA 3TBWB 5FB8A 2X2YA 2CSPA 3ARYA 3MRLB 3OXRB 2VLLA 5D6CA 3EO0A 4LLDB 1M6OA 2F53E 7FABH 3LQAL 3VRJB 3GSRA 5INCA 2C4FU 3PGCB 3HC4H 1J7VR 4KAQH 2O5YH 1QACA 4WDIA 2GITA 4UZGA 3HUJB 3DIFB 1P4LB 2X1WL 3NFSH 5CSZA 4OCSL 5JHLL 4JO2L 4LDLB 2CLRB 2NYYD 2O5ZL 4FFVD 4OZGF 3ULUC 5J0BA 3OB0K 1RULH 1TFHA 3NFNA 5BO1H 3KR3L 1U42A 5JXEC 3MZTA 5GGRA 1AO7E 3D85B 2I5YL 5FYJH 1KJ2A 4NRZA 3C2SA 4MNHA 4NC1C 2B1HL 1Q94A 3OKYA 1QYGH 5HYJE 2B8OT 2O26U 4EOWL 1G6RL 2EIZB 3ZKMC 4JREB 2V7NA 3EOAA 5IVXE 4N5ED 5B38A 5E94A 5FDWB 1KLGA 3KPSB 1ZEAL 1CWVA 3T0WA 2MCPL 4HLJA 1NC2B 1QBMH 3V4PH 4YDLC 1YNKL 2YS4A 1OWWA 5BRZE 5IJKC 5EUOB 3U7AA 4JLRA 3BP7A 1ZT7B 3RX5A 5HPOA 1U91B 3IFLH 1T04B 4L8SB 4Y1AD 5HSFA 2E7LC 4OQ1A 3WL9B 3BDYL 4NQVA 3MRMA 5C0RL 3T3PF 2PETA 3FO0H 5DEGA 4KXZI 3T0EC 3D3VB 3TP4A 1GH7A 4ENED 3HN3A 3GI9L 1U8PB 3MXVH 1YEFH 3UO1H 4PS4H 5I1HH 4FN0A 3WUWG 1HHIA 3JZ7A 5JW4N 5CBEB 1SY6A 4LVOC 4Y16C 5FUCC 1U8JA 1ONQB 1DQJA 1EEQA 1I8KB 3K81A 4ODVH 4AIOA 3VWKB 4HWBA 4PJIE 3IAPA 5D1XD 3VA2C 1EO5A 3VFGL 2IH1A 1CT8B 1KCSL 4ZTPH 4ODSH 5I8CA 2DQUL 3FQUB 5F3BA 3VXME 2R1XA 3MFFA 5H35B 4JPWL 4D2NA 1MIEH 2ZG3A 1II4E 4U1JB 5EU5A 3TPKA 1J05B 1FGVL 3PE9A 3NFPA 4URTB 3S8WA 1NBQA 5EO1B 3UC0H 3RUGE 2NXZC 2XQBL 4UQ2B 1T7XA 4D8PA 4PJBF 3TN0C 1UB6B 4XH2B 5CIPB 2M8XA 1W0WA 4YWGL 3SQOL 3KJ4C 4K94H 4LPVA 1PLGL 5JORB 4GS7B 4YXLH 3T0EE 5KBNC 3OSKA 4XNZC 2GSIA 3HG1D 4GAGL 3N0PB 3CXDL 3SY0B 5J1TC 3HZMA 1CQKA 2DQGH 4X7FC 4ZOBA 3RWIB 4PLKD 4KJYB 1BFOB 2ZUWA 5KVFH 3VI4F 3VMOA 4TULL 4W4NA 5M7QA 4KVNH 3WNNA 3TBSA 1S3KH 3L9RB 2BNRE 1OAKH 1W0VA 3KPLA 5HYFA 3L95B 5EIIA 1KGCE 1KENL 5BVPL 3CCHA 1HQRA 4HUWA 1EK3A 4GG8B 4AL8H 2B7DT 2MJWA 4XMLL 4FFWC 5KAQG 3QEHB 5DRNB 3WNLA 3PGFL 4HKBA 3O4OB 3HMWL 1LO2L 3E6FB 1DVFB 2F54A 3Q5OA 4JN2B 1S7TA 5DVOA 4W4OC 2PXYC 3DBXB 4NO0A 5SWZE 5A1AA 1S9KC 1AGEA 1B6DA 1H3UA 5EFIB 1SJEA 2CGRH 2JCCF 1S9XB 5BOPA 4ZYKA 2VZVA 5IG7A 3RJDA 2OL3A 3JV6B 4M93B 3OKEB 1HOCA 1KB5A 4FABH 3OXSB 5F96H 3L7EA 4HWEL 5EBLA 1X5HA 4KHXH 3GK8L 1BMGA 3CSBA 4G43A 1SYVB 2DD8H 1S7VA 4PJ8B 4UTBL 1G7LB 2NY0B 3VXNA 4JY4A 5DK0B 8CGTA 4HX1A 4QO1A 3NTCL 1ERNA 2APVA 1FYHB 3P9MA 2FX8H 2M1KA 3D69A 1D5BA 3NCYS 3DUSA 2R15A 4D0DA 1T5XB 2BRRH 2WWMC 3ARFA 3B4NA 3WXWL 4BQ8A 4M61B 1QG3A 3MRHA 1FAKT 3QDGB 5KG9B 5IQ9B 5C08B 1ZLVK 4AG4H 1T03H 5MEPA 1J8HA 2VO5A 3G5ZA 3VFWB 3RU8L 1KJ2H 4TN9A 3VG0H 1UT9A 3GSWA 4PJ7A 4XVSH 4M6OL 4MJ5B 2PYEA 2QHRL 3KYNA 1I1FA 3M07A 1W2KT 1DQDH 3GSUA 5CP3A 4JZOB 1Y6MR 3H7LA 3VDBA 3QFJD 4PRBA 5D7LB 2QQQA 1A6ZA 4P5MB 4ODUB 5BXFA 2DKSA 2NX5A 5JPNA 1WSST 4HHAA 3RVUD 4ESKA 5DJ6B 2YD4A 5J9PA 1U2HA 3C8HA 5DI8B 3IDMB 3VA6A 4Y8DC 3NCJL 1DE4B 1AGBB 1NBVH 3VFMB 5JDJA 5LGHH 4MNQE 4G80A 4LVEA 2EDDA 4NKOB 4JY6A 3O4LA 2PO6B 5FKAB 2VIRB 1BQHA 3MV11 3HC3L 4WUUD 2FH6A 2HRPH 2YKLH 4CN6A 4XI5C 4Z5RA 3GZKA 3TNMB 3HZVB 5IMOB 4CU8A 4LOUD 1XF2A 3PHQA 1JYXA 2MOVA 2AV7B 4OLXH 4HGMA 4MHHI 1KN4L 4RNRB 1OAYH 3NN8A 4NM4H 2RJMA 3SDXB 3LQAC 1FL3B 1DEEB 2FEDC 4P2RB 1BHGA 1ZVSA 3QUMB 5SX4H 1SY6H 4JG1H 2VISA 5KN5A 2JJSA 1HEZA 4UDUA 1I9RL 3GHEL 2XTJB 4HS8H 1A3RL 2P24B 1FFPB 5F1SA 4CU7A 4HWBH 3E3QC 5EZOL 1UZ8A 5E6IC 2CRYA 4K7FB 3QJHA 1KEGH 3AROA 1MQ8A 1Z9OA 2Y7QB 4NNPL 1GC1L 2HG5A 4KZEH 3IDNA 3OJMB 4N68A 2BHZA 4JO3L 3BKJL 4OM1H 1ZVHA 2A0LC 1UJ3C 3SDCD 4WEBL 1TZGL 3FB8B 5DJXA 4UINL 2AQ3A 4GAJH 2F74A 2BNQD 1BIIB 1MCBA 1MQKH 1AC6A 4XAWL 4G8FA 4RGNB 4GBXC 2H32H 3VGAC 4HK0A 3J7HA 3P73A 4MXQC 1YZZA 4Z9KB 2AJZB 2BSTB 1MCWW 1G7MB 3TA3D 4MCYA 4ZPVA 2VZ3A 1KCLA 4G42A 3U9UA 1CIDA 2OZ4L 5BQ7A 1EHNA 4L8SC 3KPTA 2IH3A 3S96A 1NMAH 1CD0A 3QUYA 1NGXA 1EHLH 1SEBB 3E3QE 1T7WA 2AERT 3AAZA 4LSQH 5IEKA 2VR5A 4L9LB 1C08B 1A6WL 3QG7H 4HMEA 2YPLA 1CYGA 3TPUA 2ZUYA 5DXWA 5H2BB 5IBUB 2P8PB 4JFEB 2C1PB 4NDMA 4M4RA 3VRLF 3RVXC 5GIRA 4CMMB 3W0WE 2X4RA 4KZDH 3MRGA 4LCYA 3GMPA 2PNDA 4NQEA 3TBTB 4HFUH 4K8RD 3VWKC 1MCLA 2XNAB 4X83A 1YEJH 2Y4SA 5T3ZD 2OL3H 2VDNH 3X11B 1JPST 3FT4B 2H9GA 5MEQB 1QFUH 2V7HB 4XCCL 4ALAL 4X6FB 5T1KA 1NBYA 2Z31C 3KPPB 1MCOL 3PV7A 2BSRB 3GIZH 2BVYA 3ZE0F 3PL6A 1WF5A 4LHUA 1QZ1A 3TNNA 1ADQL 2BK8A 4JQVC 3K0WA 4LSUH 5CUSL 2K7PA 4BH7A 4QF1B 4ZO6A 1WEJH 5LGJA 1A1NA 3CX2A 1CLZL 4GS7C 3VXOA 1C5DB 3BPCB 3HRZB 1WQVT 5AD0B 3N1QC 5CCKL 5CSBA 2M2DA 2X4OB 3WFEH 4ZAKC 1T0NB 4Q9QL 3T4AA 4QXTA 4XVUC 4E0RB 1XH3A 3H3PL 2EYRA 3AU1A 5EOCJ 2UVFA 4R7NA 2P42B 3MLXL 4NZTH 3DSFH 3FT2A 5HHOA 3ARTA 1IRAY 3TJEL 5D7IF 4I0PB 3BKYH 4LLWB 2ZCHL 1NFIB 5CP3H 4BH8B 2X09A 3MRBB 4FOMA 3C9NA 5E24E 2GYSA 3DX7B 4HW6A 1EEZA 1A7RH 4KPHH 4YBQD 3ZDZF 1V8HA 3L7FA 3O3EA 4YHIA 4QCIA 5JQHC 4UNTA 3D48R 1UM4H 1CLOL 2W91A 1QVOB 2CLZB 4NRXA 5K9JL 3TLRA 4JG0H 2FWOB 4PJXF 5CAYB 1HKLL 3PQYB 1DSFH 1PZ5A 3H3BC 2BHYA 3DHMA 4Z7WB 3O3AB 2SEBA 1CFTA 1X9QA 1IC1A 4YHML 5DK2A 4HPOL 5IFJA 4DGVL 5EU6B 5F9AC 5FEBA 5LXGH 1MFNA 4Q9RL 1N6QH 3SOBH 2XV6B 5IB4B 3U79A 4MD5A 3ZDYE 1QFHA 5TPWL 4XNQB 1YEDB 4AK1A 1DL7L 4MA3A 3TT1L 5I30L 4NBZB 4PJ8C 1U93B 3ABZA 3QHZL 3DRTA 1H15A 2QBWA 3CFCL 4M1DL 3O2WL 1JJUA 5JHDD 5A3ID 2A1WL 1S9YA 5L0QC 1I3UA 3SQBA 1QFOA 1S5IH 3V0VB 3S36X 3CLFL 3OKLB 3U4BL 4JO4H 4P3CL 1WISA 4ZS6C 2R0KL 3UTOA 4EDWL 4X7DC 5DQJB 5ERWA 3RWGA 4WTWA 5E8EB 5JDSB 1U58A 3PWLA 4LKXB 4L4VD 12E8L 3AY4C 3OKKB 1TPXC 1B4JL 4R26H 4LPCA 1RHHA 1S9WB 3MGTA 1BFTA 3DHJA 4M8VA 1YUHA 1OL0A 3L5HA 4NQDE 1MLBA 3C6LB 3RGHA 4XP9H 3RDTB 4NO0D 1EUTA 1OQXA 1S7QA 3IFOA 2N4IA 2VLRA 4PRHB 3HNSH 3OR6B 3RWFA 2WUCL 4GKNA 3KGRA 5E2WH 2DLFL 2AI0L 5SWQB 4OKDA 1XF4B 1I85C 1GIGL 4XBEL 4LLVB 4WI6A 3HNVH 4HIEA 3T0AA 2GJ6D 4GXVL 3VFUA 1F11B 5CBAB 4WY7L 4OCRH 3TV3L 3NGBC 1DBJL 3K46A 5FM4A 1YPZA 3VJ6B 1SYSB 3VXPA 1J87A 2A6KB 2HKHL 5CJ5A 1TVHB 1HINH 1JF1B 1Y6NR 3MO1B 5SV3A 5DUPL 3LIZL 1TTGA 5K9QG 1DANT 4YJZL 5BZDA 4IRZH 2VH5H 3IXAB 4HIXH 4UB0L 5DEFB 4JDVB 1GYAA 4PB0H 2YEZA 3ARFD 2CIKB 3LN4A 4K07A 3IDYB 5FDYA 5DJAA 2MMXA 1GZPA 3TBYB 1BX2B 1KTLB 4O00A 4MXVE 5J11C 5AYUH 3U9PL 5FFLA 3WNMA 3EOTL 3QUZB 1L6XA 4MD4B 5E2VL 4Z7QE 1T2JA 2MTPA 3W9DA 5KTEH 2PYED 2VSDA 2UWEA 2V2XA 4PJAE 3U83A 4D9LL 3H7BA 3I02B 5EBGA 2X7LB 1NCNA 4A2MA 1NGQL 2P5WE 4PY8I 1GC1C 1VA9A 4QOKE 1BIHA 3AXLA 1XGTA 3BZEB 1EXUB 2UVEA 2NX5D 4LSTL 2HH0H 5MEOA 5F97E 1NAMH 2AXGB 4OZIA 3UYRH 4G8EB 4W70A 1RZGA 4P46A 3S5LA 5BVJB 1QQDA 5ESAB 2XRAH 3TC9A 2IG2H 3DVFA 3NACH 3TZVB 4LMQE 1FFOA 2F53B 2W0PA 4W68A 5D7SH 4YR6A 3STZB 3O4LD 5GGSB 3RWEB 1FHGA 1A64A 2H8PB 4FQIL 4JGMA 5DZOA 1DN2A 5BZWB 4OLYH 4Z76B 1DQML 3T1FB 5J3HC 4XCNA 5ELIA 3C87A 1PEWA 3SCMA 4YHZL 5EOCL 2X42A 1PBYA 1Q9LA 5CEXA 1N5YH 2DWEB 2AEPL 1GGIL 5GS0D 2Q7NA 5K59F 2VLKB 5HYSB 1J88A 3V52L 1AO7B 5JIPA 3BE1L 3TWCL 2OR8A 4Q0XL 3F7PC 3KLSA 4CW1A 2KUTA 2C3VB 1N59B 2O5XL 4ZUUB 2YMXL 1MCWM 1RJYA 1X7QB 1M71A 4FZEL 4QRRB 5FF6A 4X6DF 5ISZE 1JYVA 4JM2A 5EC1A 3AC0A 3BGFC 3BT2L 1J0KA 3O3DA 5IVXB 5D96B 2W65B 3HPLB 3VXSE 4UQ3B 2EDFA 3P9LA 5C0BA 1QSFD 1UFUA 3DXAA 4U1MB 4M7ZC 32C2B 3V5DA 5HHQB 2XFXB 2BMKB 4H1LB 1BP3B 1WWCA 2DB8A 1YECH 4PJFF 5BRZB 4XC3H 1H5BC 2LABA 5D2LF 3O2VL 1AHWC 1U3JA 1OM3L 1E4WH 4QHKI 3ULUF 2V5MA 3HFMH 4N8VA 1YQVH 1ZWIB 3BQUA 3MRCA 5GISH 3UEZA 4MNGA 5IB3A 1M7XA 3WKNA 1MCSA 3T77B 1NGYB 3QQ4A 2YR3A 3DV4B 1INEL 2ESVA 4QHKJ 3O6MH 2QQNL 4PLNC 4HG4J 5IUSA 4N9GA 4S2SA 4BSJA 1K3ZA 3PP4H 3F8UB 3IS0X 1ZSDB 5E8PB 1MCDA 2IANA 3LH2L 2JJVA 2J88H 1HI6A 4EI5C 1RUQH 1QFWI 1XT5A 4TSCL 4Y5XB 1EJOL 1C5BH 1RZIA 1UKTA 3L3OB 1VKXB 1UXSB 3BSZL 3QNXA 4P57A 4J8RB 5I8KL 1N3NB 2JLLA 3QEUA 5D2NB 4HZAA 5E56A 3DURB 5KAQF 1GXEA 3WNKA 3VGBA 4GRLB 4P4KA 5DT1H 3LAFA 3FQXB 5JW3H 1WZ1L 4Y88A 3VD4A 5IB5A 4HEPG 2CDFA 1LK2B 5GS3A 3RUGF 3V6FA 4GKSB 3D0VA 2YPLD 4K9EH 4MD0B 5E4IA 4KQ4L 1WZMA 3ISWA 1R5IA 5CZVL 4S1DC 1G7JB 25C8H 3MV8E 4I0PC 1NL0L 1KELL 3LKQA 4OLZL 3G5YB 4KDTA 3HB3D 5HXMA 4DZBA 3U0TB 2V17H 3MRFB 4YBLB 4NQED 2VKXA 5GRVL 3TF7C 4PGBB 5HVFB 5KANI 3ARGC 4GJTB 3LHPL 4DQOH 3L1OH 5ETUA 4JFZH 3D87B 4IMLB 1MRFL 2DQTL 1UQSB 4KK6C 4NKDB 4JRWA 2F19H 3BFOA 1CXLA 3DUUB 5GZOD 1OP3K 4LHUD 1FZKB 2XA8L 1RZ7H 2OR9H 3S3PA 3TYGH 4XNXH 4IRSC 3QNZB 5IBUG 2W0LA 2BNRB 1MPAL 4HUUA 4YIQA 3TH4T 1MJJA 1MJUL 2ATPB 4BFGA 4V1DA 2AJ3A 3OAUL 2YC1B 5FO7B 1R3JA 4PJCE 4XNUH 4XGZA 4OI7A 2HN7A 2X4TB 5EUKA 5I76B 3GM8A 1MHEB 4U1KA 2JB5L 3P4NB 4O02L 1TZHA 3O45B 1SBSH 3MPCA 3S36H 3V7AE 1QR4A 4E41A 1S8DB 3WFDH 3QNYA 1Q1JH 3LRSB 3IYLW 3LKPA 3LS5H 3G04B 1J1OH 3HG1B 3MJGX 4B50A 4WGVB 4U0RC 4NUGL 1O0VA 2DMCA 2VL5A 4XP1L 5E8NB 3QEQE 1IM9B 3BZ4B 5HHMD 3ZE1E 3MREA 3IDJA 3EGSB 3HI6H 3F62A 4AZ8A 1V05A 3LB6C 3SDAB 4P3WA 4ZXBA 3UTSA 3BGAA 4PRNA 2FIKA 5F44A 5L8JB 1FNEA 1AE6H 3PXJA 4F58H 4HJJH 1URLA 4Y4KC 3DMMC 2YD1A 3B2UD 4OQTA 5CINL 3EOYG 4X5WA 3HC4L 2KL6A 4M7JH 3WSQL 1G1YA 2FGWH 4GSDL 4QRQB 3B9KB 4YQXL 1YEEH 1A7PH 3RY6C 4RZCA 4EN3B 3NVQA 4KK9D 2YXFA 1KCVH 3EO9L 1FVCA 1RULL 4OZ4A 3WIIH 1CXEA 3MRNA 3MJ9A 4F7PA 1HCFX 1AR2A 1OCWH 4E9LA 5FGCB 5FYJL 4KTYA 3QO0A 2QKIB 3BHBB 4F37K 4Y4HC 5HDBE 5B39B 3DV6B 3PV6B 4CRPA 4UT7L 3INUH 1YY8A 5AEAA 4O51A 1ETZB 2OP4L 2YSSA 1FO0A 2R2HB 1S7UB 4OCXH 2X6MA 5KSUB 2OI9C 3LS4H 2EDKA 1CFNA 2KPNA 1ZLUK 4GRWH 5JR1L 5LAXB 1S7RA 4OCMC 3IDYC 1E0OB 1CVRA 1Z0NA 4KMQA 3SDYL 2KDGA 2RIKA 4CKVX 1QBML 1Q72L 2GIYA 5D5MB 2NY1B 5C1MB 5C0CD 1G0YR 3ARVA 4YHNB 3GSOA 2J8UA 4MHHG 1JFQL 4QTIH 3L5XL 3QISA 3VFOB 3WHXB 3GI8L 4NFBA 1RZ8A 4YHPA 5GGQL 3EYSH 2IALA 4N0UA 2VN7A 3IGAA 2R8SL 1IC5L 2NY6C 4CN4A 3FO0L 2VLRD 1CTOA 1S7SA 1JNJA 5HHVH 3RWDB 1F8TH 4LIQE 1QFWL 2LVEA 3O0RH 1RQ5A 5F9JB 4XPBL 4CVZB 4WU5A 3QDJE 4M3KB 3SKJH 1D6EA 3QCVH 3RPIA 5ITBH 2XXMB 5E70A 3QXDA 2VDRH 4D3CH 1MCHA 5EU7E 4HEME 1AFVH 1ZV5A 1REIA 1I1AC 2X4SA 5LBSH 3GKWH 3OHXB 5FYKH 4ODVL 5DSCB 3BWAA 3GFUA 2E27L 3DI2B 3G5VA 1YMMA 3V95A 3O41A 3QCUH 2N7AA 4QY8B 1OTSC 3MV7A 4OBRA 4EIZC 1CE1L 4JR9H 2C1OB 3UPRA 1FBIL 1MIEL 4LGRB 3B2VL 3MV9D 1R3LA 1NGWB 1GGYA 4OV5B 2GJZB 3ILQD 2DQCH 4I5BB 2VXSL 3LSOA 3UC0L 4Y5YB 3ZKSD 4IJ3C 4UDTB 2GQHA 5ANMB 5DJCA 1YNLH 3BRGC 1HCVA 1U3HB 4I18C 4GMTL 1B3JA 2YZ1A 5FV1L 5IB1A 3PHOA 1VFAA 4LF3B 5INDB 3T2NH 3WFBH 2XWBA 1FSKB 2EDYA 3GBMH 2ICWA 5D4QA 3JTSB 2EKSB 4LBEB 4P46D 1CICA 3MLZH 5HY9A 1ND0A 2Q7YB 1KIRB 4N1HB 3DX8B 1KTDA 2NYYC 3OKOB 4FFVC 4PG9B 3RIFK 4KVNL 1GL4B 1YC7A 4PRPA 4ISVA 5B8CB 3AS3A 2VDLH 3P0YH 5IT2H 1O7VA 1PEZA 4OAWA 4HFWB 2VYRE 1L0XA 2MPAH 1PG7H 2LV4A 3SCMD 2X40A 2FDBP 2LU4A 5DDHB 3CFKB 5C0GB 5KS9E 3SDCB 4Y5XC 1P1ZA 1U8MA 2DQJH 4K2UL 5L7XH 1VSCA 1ED3B 2E6JA 3BP4B 2ADJB 2PYFA 3T3ME 5IOPA 5JPMA 1OP5H 4TUJB 4YZFF 4N5EC 3W0WB 3QG6B 4XNYH 2BNQB 3EO1B 3KXFA 3BEWB 4TNWF 3DO7A 1S7XB 5D2NC 1OP5K 5DMYA 1FGNL 4R96B 4OKVB 4PJ5E 3KLAB 4OCWH 2Y72A 1CDHA 1EH9A 4JM2D 4M1GL 2MCG1 3VGDA 1ZTXL 3UPCA 3TA3B 3CVHA 5E00A 1DCLA 4HH8A 3TO4A 2VLLB 1JWUA 4NUJA 3EO0B 4HS3B 5D6CB 5F96L 2VXVL 5DTFA 4DEPC 5C0BD 4JFDE 2IAMB 5IVOA 3GSRB 5INCB 2DD8L 1U8IA 2YD3A 3T04D 4WNQB 2HWZH 4WDIB 4Y19A 3C8KB 5KW9H 3P4OA 5ICYA 4YBLC 1JGUL 1Z9MA 4ENEC 5CZXD 5HYSG 4MSWB 5CSZB 4KJQD 3DARA 2GTWB 3M17A 2A9NL 2ESVD 2BRRL 5D71H 4PGDA 1MFDL 5IEHA 4XB8A 4D9QD 1BPVA 3G6JE 1X5GA 4ODWA 1ACYH 1KJ2B 4QHLA 4NRZB 1RZKH 4MNHB 2IAND 3HS0B 4QEGA 4KROD 3SE3C 4XP4H 1F45A 1Q94B 5C07A 5D1XC 3VG0L 4XX1E 4P9MH 1P7KA 4QHUA 4XWOD 4K8RL 2G9HA 5A16A 2V7NB 3EOAB 5DGRA 5T33L 5B38B 2EYTB 5E94B 1FO0H 4H1LG 3RFZC 1KLGB 5T3ZL 4JHWL 1OQOA 3ARPA 2WIIA 4GRWE 2J4WL 3EFFA 2VXTL 1DDHA 3CDYA 2Y6SD 1VHPA 4W6YB 4PJDE 1OAXH 4H5SA 3GSXA 1KNOA 4JLRB 3BP7B 3FHQA 4GMSH 4MVBD 4RWHA 2ICEA 3PG2A 4RWYH 4N0YL 4D0BA 4G6FD 2HFEA 2FGZA 3MMEA 3BAEL 3VH8A 1A4JA 3MODH 3LEYL 2BZDA 4NQVB 3BDXA 1QTYT 2XA3A 4I3GA 5DEGB 1LMKA 4RFNC 4OGXL 1IC4L 5C09E 3DETD 1S5HA 2GJJA 1T89A 4PLKC 2AK4E 4JAMA 1EDQA 1NAKH 5HGHB 3GBNH 4NM4L 3M8OH 4O5LL 1A02N 1AD0A 2EC8A 1MAMH 3I2CL 2IWGA 1U8JB 1DQJB 1JWSB 1ZLSL 4JG1L 1NCWH 4J1UA 4Z8FH 4NKQB 2AJVL 4WI9A 1A7QH 2IH1B 3UX9B 4XHQA 4FXLA 5I8CB 1N4XL 4NN5B 4HF5H 4PV9B 4HWBL 4O9HH 3MFFB 4X99B 5D70L 2EH7H 4V1DD 4KFZC 1IL1A 4HK3J 3VU2A 5EU5B 4HH9A 2WAHA 3WLBB 3U0WL 1KN2L 4J3XA 3B3IA 2IF7A 1KEGL 1D6VH 5BMFL 1NCDH 5F7EH 1IGYA 1QSED 1Q9WA 3PGDB 4I1NB 4D8PB 4PBVC 4TTDD 2C3WA 5DJDA 4E41D 2HTLD 1W0WB 5HJ3B 4L4JA 1WZLA 3ZTJG 1B2WH 1BFSA 1OARH 4I0CC 2H32B 2HP4A 1AQDB 3NZHH 4U49A 4NO3A 2AEQL 2DM7A 3WDHA 1EBAA 3C09C 4FQQA 2E7BA 4M8QA 2BVTA 1INQB 3C08L 3S35H 1K2DA 4RGOH 5JA8B 1OGAA 5LVEA 4ZXBD 5HGAA 1F3DH 2NLJA 3RKPA 4ZS7H 2JELH 5DD5H 4HPYL 4HKZA 2C5DC 3UTSD 4PLJD 1UACH 4KU1A 3RKDD 2R4RH 3GMRB 2FSEA 3TBSB 4PJHE 4MYWB 4YHYB 1NMAL 3QWOA 1PAMA 2WWKT 1W0VB 2NY7H 5EIIB 3GMNB 2X5PA 1VFUA 4NRYA 3STBA 3CCHB 1HQRB 3EDDA 4HUWB 1U3ZA 4GAFB 4RBPH 1KCUH 4KI1A 4LSQL 4ZOCA 4RBPK 5DYOA 5CD5D 4HKBB 5E2UH 1RMFH 4YHOH 2Y1VA 2F15A 5IHBA 4LARH 3S34L 1DTUA 2YD2A 2F54B 1S7TB 4NO0B 3DROA 1L0YA 4DAGH 1AGEB 4LCWA 3IU3A 1SJEB 3RVUC 3OKMA 4ZYKB 4U1IA 5MP6L 4HKXA 2W0FA 1A21A 2A77H 1YEIH 2OL3B 1FG2A 1XGQA 3IJHA 1JI2A 4PJAB 2ZP0T 1CD1B 3ZKND 5DJ0A 2P5WB 2FATH 2P46B 2WBJA 3CVHH 2VDNL 4QOKB 1CXHA 4WI5A 3L7EB 1T21A 3EOBA 3PWPE 4LCCC 4WJ5B 3Q1SL 1KB5L 1UWGL 1S7VB 2CDEA 1CTNA 1MLCB 5TDPB 2IBZX 3NPSB 4LOUC 1TETH 2DI7A 1FDLH 4JY4B 3BYTA 4X6EA 4HX1B 4Y5YC 1A14H 3D69B 1D9KB 2GCYA 5I16A 3GSNA 3KPRE 4RX4D 3W5MA 5IK3A 3D9AH 3A6OA 4O4YH 1N0LA 3F7VA 5DMIL 4MB3A 3MRHB 4DZ8A 5DR5H 4MJIA 2HFGH 4WTXA 1FSKC 2CD0A 3FMGH 3ET9F 3TYFA 1EERB 5MEPB 3WFEL 5B39G 5IKCB 4J3SA 1J8HB 3U7WH 3LVEA 1J1XL 5GXBB 4NYLA 4PJ7B 4DW2L 2PYEB 3KYNB 5CLTA 1I1FB 1Q9OA 2WBKA 3BPOB 3TVMA 4Z7NF 1A7OH 2BFVH 5C0JA 4Z18A 4PRBB 1BJ8A 1EAPA 4JEGB 4QYOA 1A6ZB 4QRTA 5ISZB 4Y5VA 5BXFB 5E2TH 2DOCA 1ZHKB 1QA9A 2NX5B 5I71B 4XCFH 4HHAB 3U48A 5J9PB 4L5FH 4Y4FA 3ECBB 1YMMD 3SDCC 1IGTA 4G80B 4TVPE 2HJKA 2P5EE 3HAEG 3MV7D 4JY6B 3IKCA 5T5FH 4U6YA 3SBWA 1BQHB 2VLMD 3QPXH 5ESVA 5CEYB 1NC4A 3AS2A 1CG9B 4NC0B 1DSFL 2H6PA 4WGWB 5TE4L 4N0UE 2KQNA 5C3LD 5I1LB 5M94B 3PHQB 2CKBH 5L2KE 1RJZA 3TA3C 1WBYA 1DLHA 1M7DA 3CLEL 5E4EB 2Y06H 3P4MA 3NN8B 4C56A 5GS0L 3LKSA 3H6JA 4N0FA 1EEUA 1PD6A 1ZVSB 1WCQA 4GW1A 5ACMA 2D03H 4U2YA 1HEZB 4UDUB 1G0XA 1WZKA 4P0DA 3PXHA 5B21A 3A67H 4W81A 2ICCA 5CJXC 1S5IL 5JIHA 1QSZA 1TNNA 3GEWB 1QLFA 1OAQH 3SDDA 1E4KA 2OM5A 4Q6IB 4PRPD 2HLAB 1UZ8B 3QJHB 2DICA 1CZ8L 4HBCH 3IJSB 5KANG 4X6CE 4EJ1C 5FYLH 3D2UA 4M6NL 5EOTA 3KVQA 4K8RC 4QKXB 3DRQA 5LWYL 1AKJA 3VRIA 4JPVL 2PTTB 3NH7L 3OZ9L 5TFSH 1KPRB 3MV8B 2F8VA 5B22A 1TZIA 3RPKA 2F74B 2XZQH 5L8KB 5DLML 3KXFD 5LG1A 4G8FB 1JHKH 4LLUA 2EH8L 4ETQA 2JKXA 3PJSA 4YK4B 3V8OA 5E2WL 5I8OL 2O61A 2NY2D 3CVIH 4FXKA 1MELA 4MCYB 4ZPVB 4G42B 2CXKA 1A3LL 3U9UB 3TO4D 4JRXE 5BQ7B 4G7YH 2IH3B 2A38A 2D7OA 4M7KH 2NXYD 1CE6A 4HZLB 3QUYB 1NGXB 5TE7H 5JXAH 4N1CA 3SO3B 3ALXA 2Q87A 1FVEB 3U1SL 2Q76A 2Y5TA 4MGXA 3AAZB 4Y19D 1XF5A 5IEKB 4RGMB 1EIBA 1HINL 4P99A 2BSSB 3RGVB 2E9JA 4N0RA 3TPUB 3WKML 2EE2A 4XAKE 2OTWA 1R5WA 6FABH 2IADA 4KHTH 3VXRA 4N9OB 4NDMB 4XXCA 1D5IL 4NJAH 5T3ZE 5GIRB 2X4RB 3MRGB 4LCYB 3MRLA 1S7WB 2ENSA 2EZ0D 1FVDA 3GNMH 4QTHB 5J13C 4LLDA 3N9GH 4J6RH 5C07D 5JLZB 4YBQC 4LCIL 4NN5C 3QDAA 1ZE3C 2RAMA 4N8CL 2H9GB 1WFOA 4Z7WF 2NNAA 4GO6B 4NP4H 5HGBA 3WDIA 3AS1A 4HV8A 5GGVH 1NAMB 3HUJA 3DIFA 3OGOE 3MLRH 4NKIL 5AZ2H 5T1KB 2PTUA 4L4TD 5HVGB 3PL6B 3GMOB 3UAJD 2DF3A 4LHUB 4XPGL 3T0DA 3TNNB 5E2JA 4S1SH 5LGJB 1A1NB 5D7SL 5KVEL 4LL9A 4M1CD 3ARUA 4XCYB 3GSNH 1M1SA 1T20A 2ITDA 2AEWA 2D7MA 4OZGA 2GT9A 5JW4M 4OLYL 4TNVK 1F4XH 2I9LB 3T4AB 2VE6A 1BZ9A 4QXTB 4HJ0D 5A3IC 5IQ7H 3MJ6A 4P2OD 2EYRB 1I7UA 5FDWA 2Q1EA 3KPSA 1N5YL 2APXA 3AU1B 4KMTH 2H41A 2CUHA 5B38G 1NC2A 3VDAA 3FT2B 4OI9A 4Z95H 5HHOB 4Y7MA 3QI9B 2NTFA 1EBPA 3V6OA 5F70A 2J1KA 5HHMB 1QRKA 2W92A 3MNVB 4MQSB 2HLFD 3ALPA 1E6OH 1XFPA 1P7HL 3BKCL 4LNRB 1EEZB 1MAKA 3L7FB 3O3EB 4YHIB 4QCIB 1FIGL 1NDGA 5DURB 5DWUL 5I1IH 2AKRA 4B41A 3NCEB 1LDSA 4NRXB 4G6KH 3U30C 3K74B 3QZWA 3KPOA 1EFXA 2XPGA 4JGUA 4M48H 2CPCA 1PZ5B 4XC3L 1JNHA 4KI5D 3BKMH 4S0TD 4H8WL 2SEBB 5D1ZD 1MI5E 1CFTB 1E4WL 4KC3B 3VXTA 5DK2B 1GGTA 3B6SA 3HFML 3MLUL 5IFJB 3OAYK 3HR5A 4P23D 4BZ2L 4FFZL 5J89A 3DPBA 3E2HC 4DOHB 4R0LA 3D0LB 5HI4D 1ONQA 4K3GA 4UOW0 3QO1B 1MFCL 4FA8A 4MA3B 3HI1B 4LSPH 4H88L 1IQWL 4LP4A 3DRTB 4DUWA 1SMAA 1GAFH 1XIWB 2J88L 3ZE2F 3QDMA 3M1BA 4L4VE 1S9YB 4U1JA 1OGAD 4KVCH 2VXUH 2YWZA 5JW5A 3WLWD 1JNLH 1FP5A 5AUMB 3ARFC 3QA3A 1E4JA 1U58B 2N56A 2NZIA 3PWLB 4YXKH 1KIPA 5IJVB 4HIJB 1UB6A 1SJVA 5MERA 1AXIB 1JTPA 1VB9A 1PGRB 5JORA 5LJYH 1CD9B 1FN4B 1RHHB 5JW3L 1CBVH 3BJLA 3MGTB 3EDFA 2G2RA 3BWUC 4NO2A 3SN6N 4K9EL 1YUHB 4TOYH 4DKAA 4UOW1 1MLBB 1X5AA 5JUEH 5K9KA 4HK3N 3C60A 3BN3B 4NO5B 1XMWA 2B4CH 25C8L 4LEOA 4U1LA 5HDOA 4CN1A 1S7QB 4LCWD 2R0ZH 3IFOB 2GJ6E 1BFOA 4JM4L 5E7FA 4GKNB 2V17L 3SE8H 4OD1H 4HQQH 3DUHA 4UV7H 1I1CA 4MXWL 2HVJB 2HT4D 3C8DA 4ERSH 1AP2B 3N06B 2DMBA 2WBJD 4MX7A 4PJGE 3VFUB 2VWEC 2DQIH 2EDWA 1FE8H 1NGPH 5E0QA 2A9MH 3WNPA 5J6HA 1YPZB 2F19L 4CL7A 2FECI 4CVXB 1W72H 3VXPB 2RCSH 2ZUQC 2DIBA 3OPZL 1RUMH 1DVFA 2OR9L 4JN2A 3TYGL 4XNXL 5GS0C 4I4WB 1RUPH 4G8IB 4R3SB 1OT1A 1CU4H 5HHNA 1NCCH 3I84A 8FABA 4YBHA 3LN4B 5DJAB 3EYUH 2WQ8A 1NEZG 2EDOA 1GZPB 4XNUL 4MJID 4G8GA 3JWDL 3P30L 1DBML 1KEML 4EEEA 3OXSA 2JJSC 2DBJA 3V4UH 5A2IH 4BA8A 3WFDL 4LLAA 4WWID 1RY7B 3IDXL 5GGUA 2V2XB 5CMAA 3H7BB 2HJFA 1HYSD 1G7LA 4PJ5B 3TIDA 4M5YL 4ZPTB 3TVMD 2NW3A 5HHPA 1OTTD 5SWSA 2LAGB 5EBMA 4NBXB 4R90L 3AXLB 5DFVD 1LO0L 1CF8H 3LZFH 4OZIB 3D39E 1EGJA 4NPYA 4P46B 4Y4FD 3S5LB 4MA1C 1T5XA 3NAAH 4WFHE 1HIMH 4WHTA 2VDPL 4YR6B 1FFOB 1C16A 1BEYL 2XWTA 1BZ7A 4O2CB 5CJ8A 3LEVL 4ELKA 4HJJL 3MA9L 4X4XA 1NC4D 2FD6H 4XCNB 3T1WA 4PRDA 4G9FE 4MJ5A 2B1AL 3SCMB 2C26A 2F5BH 4HC1A 1WWWX 2FO1A 4YK4C 2G75A 3GMLB 3WMSA 1Q9LB 5CEXB 4FZ8H 1DQLL 2A74A 4QNPE 1YEEL 1A7PL 2AABH 4P5MA 1TDQA 2ZKHH 3WO4C 1P69B 3G6JB 4IDJH 4JRYE 5D7KD 5GGTA 4C56D 1KCVL 4JFXA 5DI8A 3WIIL 3IDMA 2UZYB 2EIBA 4WV1C 3S97C 4XP6H 1FYTE 1CCZA 4CW1B 4XPHH 3VFMA 1NBZB 4X9FA 1RJYB 5FF6B 3QAZC 3SO3C 4NKOA 3HNTL 4JO1H 5EC1B 4PJDF 3O3DB 1UC6A 2E7MA 3FB5A 2YK1L 1A6AB 4GRWB 4YE4L 1N6VA 1BQHG 1QKZL 4JB9L 4I3RL 3FFCA 5A2KH 3P0VH 5C0BB 2CJUL 3DXAB 3V5DB 3QBTB 1G7IA 2AV7A 5EIQA 2VC2L 4RNRA 3HB3C 3W39A 1AR1D 3D2UD 2HVKA 3MYZA 2K9UA 3BQUB 1FL3A 3U46A 1DEEA 1YNTA 4ZNCD 3ARDB 1AKJD 4LKCA 4MNGB 5IB3B 3KHQA 4OTXL 2Z8VC 4OZHE 1OD7A 3QUMA 4HMCA 3DTXB 3QQ4B 2C3HA 2ESVB 2AJYL 3V0WH 3FN9A 4ETYA 1GOHA 4N9GB 4S2SB 4NFDA 3E1F1 2X4NA 2AK1L 2JB6A 4POZD 5C09B 2APTA 1F6AA 1ZAGA 4Z7UE 3SO5A 1HI6B 5GZOC 4JHBA 1HQ4A 2N1KA 4H0HB 4NSKA 5F9OH 4P2YA 1RZIB 3WJJA 4XMKL 1ZVYA 4WI3A 4K7FA 4P57B 5C0AD 1UWEH 2DIAA 4L1HA 4NKMA 4WO4A 5T1LD 1U8LA 3QEUB 3QCVL 1N0XH 3FZUD 3MJ8A 3VD3A 3EKCA 2VDRL 3O8XD 2BVQA 1NFDE 1BAFL 5TF1L 4HLZH 4GG6E 5D72H 3KPMA 3FB8A 4P4KB 1LK3L 1V3JA 3GKWL 4PJEA 4ZUTA 2VZTA 5LBSL 2VR9A 4D9RD 5AZEL 3HMXL 1TQBB 5IB5B 2CDFB 3V6FB 2IMMA 2R29H 3D0VB 3QCUL 4LCUA 4LASL 1FH5H 2H26B 4B53A 3VXRD 1R5IB 4DWHA 2AS5M 4PUBH 5DD3H 1TCRA 5IGXL 4ZFFB 1WFNA 1FNAA 2BSTA 1NKOA 2EECA 3ME0A 1ZT1A 2B5IB 4FTVE 4DZBB 2YPVH 4J3UA 3KHOA 1M4KA 1SEBA 1YY9D 5AWNL 4DTGL 2FO4B 1P2CB 4JY5H 4OM0H 1U8KA 5FGSA 1MCPH 2DM4A 3B2UC 4ELMA 3QQ3A 5IESH 4H8WC 4L9LA 1C08A 1QNZH 2VOTA 4G6MH 1UM5L 3P40A 5ECJE 3KWWA 1HXYA 4JFEA 2ICWI 3P3YA 4R8WL 2FECL 3EYVB 4Z0BH 1X3DA 5I9QB 1YEHH 3MLZL 3JUZA 2Y5EA 1FNHA 4YIQB 3SGDH 2DTSA 2IQ9H 4CMMA 1MJJB 5J12B 5K9OA 4KK9C 3FOMA 4V1DB 2AJ3B 1R3JB 4YDKL 2IJ0C 1BD2A 2ICWJ 2VDLL 4XGZB 2HN7B 5EUKB 3C2AL 3X11A 3MUHL 1WAAE 3DGGB 4JZJB 1XEDA 1R3HB 3KPSD 4LEXL 3BEVA 5E8OB 2DQJL 4F7EA 2FX9H 4V2CB 1NC2D 3LKPB 4PRIA 3UJIL 1Y18B 1CIUA 2VL5B 1X5IA 4LHUG 3MREB 3IDJB 3BH9A 4OCWL 3H9SE 3MC0A 2XZCH 4UIKL 2CLVA 5DRXA 4K9EC 4ZXBB 4NN6B 4YHKH 3HRZA 3P2TA 3OL2A 3ZSSA 1EGJH 3UTSB 4JDTH 4PRNB 3FFDB 1FNEB 1T22A 2DDQL 2YD9A 3N85H 2DJSA 2J6EA 4G6AD 1T0NA 1C5CH 1A22B 5KJRL 1Q0XH 1ZKAA 1CQYA 2EC9T 1BJ1H 1H0DA 1EFXD 1PQZA 1EZVY 1IKFH 4OZGE 4OQTL 4CMHC 3KPRB 4GXUN 3Q0HA 2UY7A 5GS1A 1A4KA 15C8L 5EZIH 5GRJL 4HC1H 4K3JL 4JJ5B 1SEQH 1XZ0A 4BH8A 4R4FL 3O9WB 1FVCB 4OZ4B 3MRNB 5D71L 5B3JE 2P1YA 4F7PB 1VESA 5AYQA 1FZMA 1HWHB 5SV4A 1ACYL 3QO0B 3MJ9L 1V3KA 5FM5O 4YGAB 1ZGLA 3VWJA 3KLHD 2IPKA 5TE6L 1IQDB 4AEHH 1QVOA 4F3FA 1T2QL 4JQIL 1YY8B 4LLQA 4O51B 2YSSB 1FO0B 1GOGA 5C0CE 4JHAH 1FO0L 2JJUA 3QHTC 4JKWA 3JWDC 4LSSH 3ILQC 5EU6A 1MAJA 5C2BL 5CSGA 4W6WB 1OAXL 2J8UB 1I9IL 5F1IA 3VFSA 3MRDA 3U82B 1OSPL 1H3TA 2QADB 5GGVY 3T3PE 4XC1L 1AJ7H 4QXGH 5CJQL 4NWTL 1MREH 5IROA 3PWUA 3PUCA 4UT6L 4JPKH 4YHPB 1JMXA 3MODL 3C60D 2XZAL 2FIRT 5EORH 3EDJA 4N0UB 1JHLH 3IGAB 3RA7H 1CLYH 4XCEA 5I1EL 3V0VA 5L2KB 3OJDA 3LRHA 1PW3A 1JRHH 4ZOAA 1HKFA 1XF3A 4P46C 3ES6A 4C59B 1XAUA 2Q3ZA 2EDLA 3GBNL 4WU5B 3M8OL 1D6EB 3ILPA 1L4IA 3RPIB 1ZK9A 4AM0A 1S9WA 3QXDB 1PJ9A 2ARJA 2X4SB 1CGXA 4LHJB 4WFGE 3SCMC 1NCWL 3BWAB 5FCUH 5I15L 3MV9E 2YXMA 3G5VB 3C6LA 1A7QL 1DVFD 5I18H 4P2QE 3RDTA 2CDGB 2OQJA 2QHLA 2YD7A 2Q8BL 3UPRB 3OR6A 3MBEB 1VPOL 3O2DA 4PJBE 1RIVH 3FRPA 1R3LB 3MNZA 5SWQA 4NCDA 3MRIA 1XF4A 1D6VL 5L9DH 1C1EL 1LO3L 1SQ2N 2YRLA 4LLVA 5ALCL 2RFXB 3MBXL 2IMNA 3FQNA 4JM2C 5DJCB 3REWA 5E9DA 1F11A 3BZFB 1QBLH 3KDMB 4JKMA 5FK9A 5CBAA 3NIDE 5E95B 3MOBH 4WENB 5IB1B 2IGFH 3PHOB 2NY0D 2HT2D 1JZ7A 3BD4A 2XWJA 2B2XH 5SWSD 3OMZA 1RFDH 2B20A 3VI4E 3QEGH 1DANU 4U6HA 1JGEB 43CAA 3IXAA 2AXHA 3FQRB 1LE5B 4JRXB 4KJWD 4X6BA 5DEFA 1CICB 2E3VA 5HY9B 5CZXC 5MI0C 2IBZY 4KJQC 4ZS7L 5C0DA 3WFCL 5DD5L 3CX5K 1BX2A 3TBYA 1KTDB 3RL2B 1U6AL 5C08D 1R5VB 1E4XI 2AGJH 4ISVB 4ACPA 1JTTA 4R4ND 1I9JH 3QUZA 2NY7L 4OAWB 4MD4A 3CZFB 4DKFH 1EAJA 2ID5A 3WS3B 3R06A 4KROC 2X7LA 4YAQB 4BYHA 1KCUL 1P1ZB 2WM0A 1RZFL 1U8MB 2HFFA 2DLEA 2JCCE 4XWOC 1I8IA 4ZG1A 2IFFH 2PYFB 3VFNA 1EXUA 5IOPB 4ZSOE 2PTVA 4LARL 2AXGA 4NM8H 3OR7A 3DO7B 5C6WH 1MHHB 1Z2KA 3RY5A 5BVJA 5D7JA 2Y6SC 1XR9A 1I1RA 3LN5A 3KPQA 2PO6D 2H8PA 3CVHB 2A77L 4YUEL 4MVBC 4JZNA 3FB7B 2ADIA 5ALBL 4R4BB 2FATL 4Z76A 3T1FA 4ZNEE 3RTQB 3CVHL 4RMUA 1TITA 5F7WC 1R6VA 1J9CT 3DI3B 3FFCD 3JUYA 3ORJA 5ILTH 1NEUA 3BVNA 1NH6A 3CUPA 1CS6A 1GHFH 2J6EH 1U8IB 2APBA 1QRNE 4X7SH 3ALWA 5FUZH 3SJVE 5DC9B 1DLFL 3DLQR 1AO7A 1T2XA 1X6LA 4FRWA 3P4OB 1A7NL 3DETC 3OGCA 5DHYB 3ZYIA 5EULV 4P2RD 2C3VA 5JQ6H 3M17B 1G7QB 1Y0LA 4NHUB 3D9AL 5F6IB 3IF1A 4Z0XA 4P4RA 1PSKL 5HYJA 4DGIL 2OLDA 4PGDB 1WWAX 5IEHB 4ODWB 1M05A 5IVXA 1P5UA 4M6ML 2XTJD 2JF1A 4QHLB 3K1DA 1O7SA 2APWA 2V2TB 4ZFOA 5ICZB 3RY4A 5CLWA 5C07B 4U1MA 5I9QC 4QHUB 1KTKE 2XFXA 2BMKA 1KIUA 1I7TA 2G9HB 5A16B 4MA8H 1TJHL 1PKOA 5F71A 4CAGA 4XVTL 1A7OL 3NCCB 2WIIB 2XI9A 2QQKL 1DR9A 3EFFB 3ZDXE 1DDHB 5C6PB 5E2TL 4FQXB 4XCFL 1OPGH 4N8VG 4H5SB 3DV4A 5BV7L 2UZIH 4TTDC 1I7RA 1KNOB 2CO7B 1KUMA 2BSED 2HTLC 2ICEB 2HFEB 4RGND 3MMEB 3VH8B 4JFFE 1A4JB 1HSAA 1P4BH 3KYOA 1ZSDA 2ED8A 3QPXL 4C58B 3EYFA 3JBG7 2X44D 1MI5B 3ULVD 5L88H 1KJVA 5DRZA 1EO8H 4DKEH 3L3OA 2CKBB 3ARWA 4L29B 4OZFH 1C12B 4J8RA 1S5HB 1N3NA 3ZHDA 3G08A 4JAMB 4NN6C 2VAJA 2HKFL 3F58L 2WSKA 1V7NL 2Y06L 4PLJC 4PJIA 1PG7W 5ENWA 5CJBA 4N1EA 4GRLA 3RKDC 1F4WH 4DCQA 5I73C 1AD0B 2PCPA 4FFYH 2V9QA 5MHSD 3VXMA 4S10A 5IJKA 4YNYA 5E6YA 4MD0A 1F5WA 4J1UB 1MFAL 1CGUA 2XIDA 4JFED 1PDKA 4PR5A 4K7PH 5CD5C 5KSVA 3RUGA 5JOFA 5T3XD 4XPAH 1QSEE 1OAQL 3MRKB 1IL1B 3U0TA 2BOBA 1QSVA 1UWXH 3T0EA 1K5NA 1NUDA 3ZYZA 5IMMA 3BMWA 3E8UH 2BY2A 1IGYB 5FYLL 4S1RL 1YYLH 1Q9WB 4Y2DA 2ADGA 2ADFL 3GJEA 2AJXL 2NY5L 5DJDB 4C54A 3ZKNC 1IGJB 4BZ1L 3IS1X 3KYKH 3F7YA 4Y16A 5TFSL 3WV0A 3K4AA 4P2CG 2LFGA 2C9AA 2XZQL 1FZKA 5C9JA 4NO3B 3I6GA 1B0GA 3QIUB 5HI5D 3N1GC 4X5XA 3FQTA 2BNRA 3JTTB 3FO1A 4M8QB 4X4ZA 4NN7C 1K2DB 2ED7A 1OGAB 3CVIL 5HGAB 2NLJB 4ZUSA 1CI5A 3BIKA 1I8MA 1NCBH 2GK2A 2YRPA 5JO5A 2OX5A 1MHEA 2FSEB 5JNYA 3RNQB 3QWOB 5EOQL 4XRCA 1FPTL 3BPNC 3CPLB 1E4XL 3IU4H 4PTUB 2Z9TA 4KMLB 1BZQK 4DFIA 5ADOL 3PP3H 3S7GA 3VRLE 1IARB 5SWZA 2Y36H 2ZOLA 3OX8B 3PP3K 4OLVL 3UTZB 1GZQA 2R39A 1V7MH 1IM9A 1RSFA 3BZ4A 4KHTL 1FNSH 1B0RA 4IHOA 3EGSA 2XY2A 3AREB 4HAGA 3G5XB 4CUCA 1IGFH 1P7QA 3KPNB 4NJAL 3SDAA 4WW2A 3DROB 4Z7VE 1CGWA 3VD5A 3IU3B 4K23H 1LDPH 3OKMB 3SE4C 3VWJD 4U1IB 3STLA 4HKXB 1XGQB 3VDCA 1P6AB 4OGZA 4G7VH 5DUMH 5I1KL 2D7QA 4P5TB 3R8BB 1L7TH 5JOPD 3PQYD 3IVKA 1J0YA 1T21B 3EOBB 5KSBE 5LGKA 2EDJA 1Z3GH 4NP4L 1MNUL 4QRQA 5GGVL 1NPUA 4R97C 2KQMA 3D39B 3MLRL 2CDEB 3I9GH 5EU6D 1J0IA 2DAVA 1JPFB 2VITB 3OV6A 4J4PD 5EU4A 4OUOA 2GCYB 4FQLL 3GSNB 4APQA 4JCLA 4NQCE 4S1SL 4NCC2 2PXYA 5IK3B 1I3RA 5I75C 4M7LL 2QKIA 2BC4A 3F7VB 3GSNL 5F72S 3H2WA 1LO4H 4G9FB 2WNGA 4QHNA 4OFKA 2VMFA 4DZ8B 4G9DA 1ETZA 3TYFB 2R2HA 1S7UA 4RAHA 1IJ9A 1KCRH 1R0AH 5ID1B 3LRGA 5D7IE 4JRYB 5F7MC 4NYLB 3A6BH 5E8DH 5CJOL 3AFLA 5CWSA 2J5LC 3UBXA 4KMTL 2CK2A 1CK0L 1FYTB 1Q9OB 3TVMB 5C0JB 3F7RA 4MNQA 5DRWA 2A6JA 3JVGA 4HJGA 2F5AH 4QYOB 4QRTB 1RIHH 4Y5VB 1MCIA 2YA1A 3P0GB 1QA9B 2CR3A 3VFOA 3NABL 1MOEA 1CL7I 3DX9A 5LKNA 4PJXE 4P48A 5C0ND 3S3JA 1IGTB 3C6LD 3IDUA 4QGYA 5CILL 3RDTD 3MGAA 5I1IL 3ULUH 1VGKA 2ZWLT 2J2ZA 3QH3A 4PRHD 3UJTL 4U1GB 4JPIA 2BVOA 1BQLH 4OLUH 4PPTA 3MXWH 4M48L 1H8OA 3RWDA 5DD0L 2NY3B 2QL1A 3BKML 5C7XH 1MFEH 5F9JA 4NWUL 5EO9B 5F7LB 2NY2C 4OZHB 4CVZA 1DZBA 1J8KA 1WBYB 5E9DD 1M7DB 1DLHB 3MOAL 3P4MB 1BM3L 3TO4C 1ZXQA 1MF2L 2AJUL 4C56B 2QTEA 2NXYC 3LKSB 4MB4A 5DMKA 5F7FA 5I8EA 4N0FB 4Z7UB 4RRPA 2HTKD 3I50L 4LU5H 5C0EA 4LSPL 4QY8A 4GW1B 1GAFL 5I1GH 2C1OA 1B90A 1ZMYA 2D4DA 5CHNA 1NGWA 4OV5A 1IT9H 1F4YL 1QLFB 3SDDB 1YQ2A 1JNLL 4P9HL 1Z9SA 4GG6B 1JL8A 1JGVH 3QXUA 4FNLL 1HHKB 3QUZD 4QGTA 2X70A 2YBRB 1F13A 3D2UB 3NCFB 2EZ0C 1CBVL 1MJ8L 4R2GB 4LSRL 3DRQB 4LF3A 2NY4D 3K4DA 4OCYH 1VACB 3NA4A 2DL2A 1G7PA 2QLVB 4TOYL 4DJMA 2XYCA 4YDJA 1YN6A 4N0CD 5CEZH 1UCBH 3AB0B 1TTUA 4LBEA 4LLUB 3TFKD 5BV7C 5IV2A 2R0ZL 4ETQB 3TZVD 3PJSB 1K3IA 2F53D 3UAJC 3OKOA 3I85A 4XMPL 1NCAH 5EH1A 4TRPH 5B8CA 4FXKB 5D9SA 5EA0H 1F58L 3PHSA 4RDQG 5E6IA 4HFWA 4M1CC 4UV4L 1DUYA 4DVRH 4OV6F 5HPMB 3HR6A 2R0WL 3NCYP 2H2PD 4ODTL 4ODHL 5F9WC 1W72B 3W2DH 1FE8L 1NGPL 1QLRA 5I1JL 1RVFH 3LQMA 1UJ3A 4ZD3L 3D25B 2Q76B 2ATKA 1WC7A 2RCSL 1AO7D 4HJ0C 4TUJA 3P9WB 1XF5B 3W0WA 4P2OC 5CP7A 3EO1A 3BEWA 1N7MH 1T89C 1S7XA 2X4UB 3TT3H 1R5WB 4I77L 2IADB 3KLAA 3WD5L 4GBXA 1NCCL 4U6VL 4QRRD 4TTGA 3GHBH 3MACH 2QQLL 1WFTA 2VSCA 3HZYA 1UZ6F 5FO8A 3MRJB 2HLFC 1OOAA 4HS3A 1FVDB 1PKQE 3IFNH 3MFGB 3LN9A 2IAMA 4L4TE 3BP6A 5BRZD 2P8LA 3ZTNL 5LQBH 4LGSB 2NNAB 3ZKXC 4WNQA 3P11H 1UYWH 4XPFL 3LY6A 5HGBB 2R0LH 4HV8B 1H3XA 2EDXA 3C8KA 1XGYH 5BOZG 1KG0B 3H9SB 1ZA6B 4MSWA 4LAJH 4KI5C 1ZS8A 4P3DA 2NY5C 2GTWA 4OT1H 4WHYG 5D1ZC 4ZUWB 5MENE 4MS8D 3VG9C 4F15C 1HYRC 2BRQA 4A6YH 3W11D 4P23C 3CFIC 2I07B 4GLRI 5HI4C 2HMID 1VFMA 4Q58C 4PJ9A 2R4SH 3A6CH 4HKJA 1T20B 2ITDB 3HS0A 2Q8AL 3VW3H 4OZGB 2GT9B 1HZHH 5K59E 3MX0A 5B3JF 4FQJH 4AYFA 2VE6B 2PR4H 5GPRA 1BZ9B 4HXAL 2ARWA 2EYTA 3BN9D 1I7UB 1X5XA 4H0GA 1IGML 4Z7OF 1W0YT 4AEIH 5IFHL 1DBBL 4KGJA 4X6DE 3WLWC 2NTFB 4GRLD 2CKNA 5F7HA 1WGOA 4XP6L 1VEMA 1QFWM 3WJLA 3VXMD 5IHUH 5HDQH 1KSRA 1RU9L 5GRXG 4MA7H 1ACZA 4JO1L 2Y07H 1CL7L 4HXBH 2ILLA 4PJFE 5D2LE 3ZYJA 2E9IA 5E7BA 3VH8G 1NDGB 2AKRB 1CGSH 1WITA 2A73B 3ULUE 3T65B 4ZOEA 4ZAKA 3QZWB 3LD8C 3KPOB 1EFXB 2XPGB 3S3SA 5IIEA 1OLZA 1T66D 5C70A 1JNHB 5HYIA 1RURH 1GGCH 5HGHA 3S98A 1HNFA 5JW4Q 3VXTB 4NC1E 3HI5H 4XP5H 4Y2DD 3B6SB 3TESA 1IFHH 3HR5B 4BSWB 1VADA 4R0LB 1DFBH 2HT4C 2WBJC 1JWSA 1YPZF 4EBQH 4KTDL 4WUKH 1J12A 4PYHA 2WUBL 5TQ0H 4ZFGH 3MLWL 3MSPA 1UJTA 2JIXA 2BNRD 4PV9A 2W60A 4X99A 4UOJA 3QDMB 3M1BB 4OF3A 1KGCD 2DYPB 5TQ2H 3WLBA 1A6VH 1NKRA 5JW5B 1EVUA 2L0DA 5FOBA 3CSGA 1YN7A 4AMKH 1MY7A 1X4YA 4EDXB 1V5JA 3QA3B 3S37H 1OF2A 2BDNL 3PGDA 1W8OA 4NNXA 5T1DH 1KIPB 1L7IH 4NQDA 5MERB 3U7YL 4JJHA 2WZPD 2OR7A 2XG5A 5HJ3A 3MLTA 2UWEF 3HCVB 4P2QB 4B0MM 4F8TA 2H32A 1AQDA 2G2RB 4KY1H 3CGTA 2VNCA 4NO2B 4PJBB 1M7IA 3LQAH 3ZT7A 1IM9D 5D93B 5K9KB 1HYSC 3CMOL 3NIDF 3RVWD 3ARXA 4OZIF 3C60B 1WT5C 3TVMC 1JZ8A 5CEZE 4LEOB 1OTTC 4U1LB 1INQA 4YDVA 4YO0A 5FUCE 3SDAD 4Y5VC 5DFVC 1DQTA 3WDJA 5KZCD 4ZTOH 1JPTL 3N1PC 4Y4FC 1C8PA 3GMRA 5ACZA 4AH2B 5DS8B 2D0GA 3CH8A 3GMNA 3KR3H 4MX7B 2FHCA 3JV4A 2OMBA 2I5YH 2D0FA 4QRUA 3SBWC 2COQA 3DWTA 1MWAA 5IESL 3B9KD 2B1HH 2FBJL 1QNZL 5J6HB 2X4QA 2ORBL 3QUXA 4EN3D 1G6RH 4EOWH 1LP9E 4F37F 1P9MC 2FHFA 5FYJD 1YEHL 4H26A 3RZWA 3R0NA 3ARSA 3WN5A 4APQD 1ZEAH 5GS2H 2MCPH 3PWVA 5HHNB 8FABB 5BS0E 3CX5J 4JM2F 4Z78B 35C8H 4PJAA 4K7PY 1CD1A 4KKLC 4G8GB 1HH9A 1I85A 2P5WA 5DHVA 3LV3A 4B7IA 4WTZA 4QOKA 3KNBA 2JCCB 1IM3B 4WJ5A 4JQXC 1KC5H 2E7HA 4RISH 4TNWK 4ZSOB 4CNIA 3BDYH 2FX9L 4P9HC 5GGUB 1MLCA 5TDPA 5CMAB 3T0VA 2HJFB 5C0RH 1N5AB 3TIDB 2NY1D 5F7UA 2NW3B 5HHPB 3IKKA 4MNQD 5SWSB 3WFHA 3MRRA 3BXNA 1ZANL 3QSKB 5EBMB 1D9KA 3VGFA 3MR9A 3V6ZA 5ITFA 5E1HB 2F8XC 1AR1C 4NPYB 2EEDA 2VABA 3I6LD 2ZCLL 4UAOB 1EGJL 4WHTB 5J1AA 4LLYB 4MCZA 5JW4R 1C16B 5E1AA 2XWTB 1BZ7B 4DN4L 4ELKB 4RMTA 3S4SB 2GK0B 3GGWB 5IKCA 3MJ7B 1P84K 1QRNB 3ARQA 1ORQA 2G60H 2K1MA 3B9EA 4K71C 4X4XB 3SJVB 5JMOC 1IKFL 4PRDB 4POZC 3VFGH 1KCSH 3EZJB 3BD3A 2G75B 3NA9L 4JPWH 2A74B 2YZ8A 5ISZA 2JJWA 1KYOK 3L3GA 1ZHKA 2I25N 1SEQL 5FHAL 1FGVH 4JFXB 5C6TL 4HT1L 1U95A 2YUXA 3FZUC 3ECBA 5GGTL 3VXSA 2XQBH 3O8XC 1JBJA 4U6TA 5EG6C 3ZDXF 4YWGH 3SQOH 4EVNA 4AEHL 3BPLB 2VL4A 5CEYA 4QLRA 3FB5B 1CG9A 3IRPX 1QFPA 4J12A 3MYJB 3FFCB 1FJ1B 4LSDA 5I1LA 4XXCC 4QRPE 1K85A 1G7IB 1RK0B 4LSSL 4M43L 3O6LL 4N90E 2OZ4A 1U3HD 1QLEL 2XN9E 3W39B 5GSRA 2HVKB 2CMRL 1AGCA 3U46B 1YNTB 1MJ7L 4LKCB 2ZUSA 2ZSWA 2ZOKA 4QXGL 1YY9C 4HWUA 4QXUH 1KENH 1J86A 4JPKL 5BVPH 2JTDA 3RBSA 3QUML 2VXQH 4YXHH 5EORL 4XMLH 3T4YA 3RA7L 4YLQT 5C0AE 2X4NB 2JB6B 4P49A 1F6AB 3PGFH 3MOQA 2IBGA 2NQCA 3HMWH 1G7HA 1HQ4B 3BI9X 5DK3A 1LO2H 4Q6IA 4NSKB 3RVTD 1ULVA 2HLAA 4WI2A 3RX7A 3DX6A 3SGEI 1G9NL 4EI6B 5CD3B 3E0GA 1DJSA 5CKAA 2P48B 1H3WM 1ZGLP 4NKMB 3IJSA 1H5BA 4WO4B 1U8LB 1L9NA 3ZO0A 3MJ8B 1T6VN 2BVQB 1HSBB 5GHWL 3KPMB 2JK5A 2PTTA 4ZUTB 4PJEB 1KPRA 3RL1A 3MV8A 3SGKC 2EXYD 4JREC 4M02A 1HN1A 1DQQA 3W0WD 1BFVH 4L8CB 1DUZA 4Z77A 1T0MB 3GK8H 4IRJB 4LCUB 5L8LB 1HK6A 1P6FA 2DQHL 2EE9A 5F9DC 3IAGC 4Q7DA 1VFBA 2X1XR 4PTTB 4BELD 3WO3B 5B4MD 2YD5A 4UTBH 4DK3A 5DD1H 1TCRB 4NQXB 3V6OC 1LE9B 1UGNA 2OMNA 3LDBB 3GO1L 4EI5A 3NTCH 1ZT1B 1JYNA 3ULVL 3LPFA 4XTRD 1U8OB 2IAMD 3WXWH 4HZLA 2VZUA 3MOBL 2ZJSL 3V5HB 2IGFL 1FVEA 2ZCKL 1U8KB 4G6AC 5KVDL 5TJWK 3UXFA 4JN1L 4ELMB 3QQ3B 5DFWH 3EFDH 1JPGA 4TSAH 2BSSA 3RGVA 3VXUE 3NIGF 3QEGL 5FA4A 1MWAH 1HHGA 5A2JH 4PJCA 3QWRA 4M6OH 4UT9L 3KWWB 1GJIA 4OB5L 1HXYB 2QHRH 3BDBA 3IDGA 3GMMA 1XGPA 1Q38A 2EYSA 5K9OB 4R0LC 5GRUL 4RFOL 1T1WA 3FOMB 2XXCB 4PJ9D 3MA7A 3RIAK 3OJ2C 1BD2B 1S7WA 5T3XL 4QTHA 4OGAD 2KKQA 5I19L 3MTRA 1ZHNA 3NCJH 4GUPA 1I9JL 5DEZA 5JLZA 3BESR 3ARGA 4YZFE 4NZJA 4Z7VF 3KLHC 5HI3D 3QIBB 5EUOE 3QEQA 5DHVH 3BEVB 1NAMA 4GAYA 4I3SL 4F7EB 2A83B 1RUAH 4PRIB 3CFEB 1RJLB 3GMOA 1N8ZA 4J2XA 5KSBF 2J8UF 4U6XA 4X4YA 4CJ1A 3BH9B 4KXZH 3UYOD 4F9LA 1MCKA 1AXSB 3D3VE 5DJ2A 4XCYA 2CLVB 2IPUK 3OF6A 5DRXB 4JFQB 3WCYA 2X9XA 5TH2B 4K3HA 5EZLA 3MCKB 1T22B 2I9LA 3UDWA 1JPSH 2ERJB 3C60C 1Q0YL 1H0DB 2A6IA 4LQFL 1BVLA 5HHXL 1PQZB 3GHEH 2XICA 4X7SL 4DVBA 1A3RH 1UH3A 2V2WB 4NQCB 3QI9A 1UVQA 4LPXA 5GS1B 1A4KB 3QXTA 4EZMA 1P4IL 2R69L 5EZOH 1GGBL 2Z35A 5LCVL 1NCTA 1S78D 1XZ0B 3LKNA 5FCSH 5IW1A 3EYQD 1XCQB 3MNVA 1J1PH 4NNPH 1UM6L 2VZ1A 4LNRA 5IFAL 3RQ3A 4ORGA 1FZMB 3BKJH 5TDNA 1FORH 4H0IA 3O4OC 2JIXD 3LEXA 1ZGLB 1MCRA 4LP5A 1TVDA 2IPKB 3VWJB 2WP3O 1TZGH 5GJSL 2IEPA 1NMBH 4F3FB 4UINH 4MB5A 4LLQB 4I8DA 2LTQB 1DVFC 4X0KA 3SKNA 3DMMA 3FT3B 5FECA 4XAWH 3QZWG 2BVEA 2OK0L 4M93C 4PJXB 1CXKA 4F33B 3TBVB 1WVZA 2VJXA 3W81A 3D0LA 3RY6A 1JGLL 4AY0A 4M9PA 1MEXH 2OZ4H 5F1IB 4F9PC 1BBJA 3MRDB 3VFSB 1NLBL 3BUTA 3CD4A 3QO1A 3PWUB 3HI1A 3L3DB 3C6SA 1FAIL 1P4BL 1WTGT 2NY0C 1WIPA 2HT2C 1EPFA 1XIWA 3FO9A 2DLGA 4GW5A 4Y4HA 5JA9A 4XCEB 3QDJA 1J10A 3OJDB 1A6WH 4DKEL 1KFAL 1INDL 5IHLB 1XF3B 1I3GL 4KJWC 4RDQF 3ES6B 4YPGA 5AUMA 2Z4QB 5IJVA 4KV5F 4HIJA 4HLZG 3ILPB 2BY3A 4AM0B 1FN4A 1HXMA 4R4NC 2DQEH 3V7MA 2ARJB 4LLMA 3QUXD 2R2EA 4NO5A 1FLTX 2F54D 4ALAH 3MNWB 1PX4A 2OQJB 4X9BA 1MCOH 1DBKL 3AM8A 4L3EE 2A2QT 3MNZB 3UJJL 1KPVB 2MHAA 1GSMA 2GAZA 3MRIB 3TIEB 1EMTL 3QCTL 4ZO9A 3O2DL 3KJ6L 2OYPA 2HVJA 2P5WD 5CUSH 1AP2A 1LEKA 4BZYA 3FQNB 4QOKD 3EIFA 2PO6C 3REWB 4JKPH 5E9DB 2BCKB 2VDOL 3BPLC 3FQWA 3GSVB 5FK9B 3BIAX 2BHUA 3V8CA 1K8IB 4NHCL 5CCKH 1IAMA 5IR1B 4CVXA 5IB2A 1I1AA 1MHPL 2XWJB 4Q9QH 3B8SA 1AD9B 3KAAA 3QDGE 2VKWA 1D9KD 5C08E 3PDOA 4U6HB 4I4WA 4G8IA 3K1KC 4JCMA 4R3SA 4MMXC 4WCYL 4ZFZA 5D1QA 43CAB 3CAFA 1BJMA 1H9VA 3MLXH 4X6BB 3TM6A 2W1NA 1P5VA 2C4XA 1JZ4A 5C0DB 3TJEH 3OAZH 1FFQA 2ZCHH 5KS9A 2GY5A 1T5WA 5DO2D 2YUVA 1J8HD 4IM8A 5D7LE 4KK8D 3IU4L 5HTSA 3UROR 2XTJC 4RAVB 3R06B 4I18A 1G9NC 4HUXB 4PJ5A 5EBWB 1LWRA 3UTPE 1CLOH 4ZPTA 1BGXL 2NY4B 2Y36L 2HFFB 4MMZC 3WJJC 5K9JH 5ISZD 1I8IB 4GT7A 3VFNB 3OKDA 1HKLH 3G6DL 5L6YL 3DSNA 3OR7B 1MVUA 3WXVL 1IGFL 3VXSD 4O2EB 4YHMH 5D7JB 4HPOH 1XR9B 2I9TB 1RI8A 2J3SA 4JFDA 3LN5B 5JIKA 5EN2A 3KPQB 4O2CA 1SM3H 4YGVA 4Q9RH 3ELAT 2FX7L 4JZNB 2H2SD 4G7VL 1D5XA 2ADIB 5F89A 1L7TL 4RGNC 4RA3A 3SDXE 1Z6JT 1ZOXA 1KXQE 3TT1H 5I30H 1Z3GL 1NMCB 3ZT6A 3GMLA 1CFVL 1WICA 3BVNB 3O2WH 4M1DH 4P2RE 3CUPB 3LDBC 5KVGH 4X4ME 3ULVC 1DP0A 5MENB 2A1WH 3I9GL 3PF2A 1NDMB 1H3GA 3FONA 1F97A 3L3JB 5IVNA 1T1XB 3G6JA 3U4BH 5GZND 3OGCB 4GKZA 1BWWA 2XTJE 3I6KB 4LRNH 1AXTL 1EV2E 1NBZA 1Y0LB 5IM7A 4M03A 2VTFA 3IF1B 2FH8A 4P4RB 4Z0XB 5HYJB 12E8H 1LO4L 3SKMA 3BGMA 1B4JH 4TQEH 1M05B 2F58H 2MQCA 4L9LC 3K3QA 3I75A 4Z7NE 1A6AA 4JFPA 1KCRL 1R0AL 1MCJA 4ZFOB 1J11A 3V5KA 4X6DB 3IETA 1T4KA 2V9RA 4OLWL 1L6ZA 4PJDA 3NOIA 4ZFOL 1I7TB 2AP2A 4KI5F 4LFHD 1FLRH 2HT3D 3RP1A 2WUCH 1BBDL 1RIHL 2DLFH 4RGNE 2AI0H 3O81A 3ZMRA 3ARDA 3RZCA 2RHEA 1GIGH 3DTXA 3MV8D 1I7RB 3L3KA 1NJ9B 5I66B 1NUGA 4GXVH 1X5FA 4WY7H 5C09A 3TV3H 1HSAB 4AENA 1DBJH 2AK4A 2QV2A 3KYOB 2DI8A 1GVIA 3EYFB 1BQLL 1CGYA 3MXWL 2HKHH 2OSLB 1KJVB 5DRZB 5HI5C 4LIQH 5D1XA 4IIQA 5DUPH 3LIZH 1MFEL 5D6DC 4UTAL 4UB0H 1FZOA 3G08B 4YEEA 4XPTL 4U31A 4KKBD 1YJDL 3QUYD 4PJIB 5ENWB 4ONGL 4DCQB 4PREA 4YDLB 2PCPB 3IB4A 4IOSD 3VXMB 4CGTA 4YNYB 1A0QH 3EOTH 3RGVD 2DTML 1X5ZA 5E2VH 2MSPA 5F8QC 3VFVA 2H26A 3OQ3B 5IBTH 5HYEA 4KUZL 4FQ2L 4D9LH 4PR5B 2QSCL 5KSVB 4BQCA 4ZFFA 3RUGB 1IAKA 5JOFB 1IT9L 1UA6H 4KK5D 1Z0MA 4LSTH 2BOBB 3H9HB 2BNUA 4DN3H 3T0EB 4HULB 4F2MA 1T1ZA 1K6QL 1K5NB 2VZOA 5IMMB 4IEFB 3U4AA 3RVVD 4G3YH 3VWJC 1MIMH 1OGTA 4Y2DB 1CDBA 2FO4A 2ADGB 1P2CA 2CUIA 3GJEB 4LRIC 4FQIH 1IAIH 1UENA 5T1KD 4BFBD 4LVOB 3F7YB 4Y16B 1DQMH 1G1CA 2FB4L 1IEBA 1K4DA 3PL6D 1UCBL 1CVSC 4YHZH 5EOCH 5C9JB 3EYVA 4ONOA 3I6GB 1B0GB 1RV6X 4X5XB 3FQTB 4PJHA 2GUOB 3CXHK 1GGIH 1C7SA 3FO1B 3ULSA 1FNFA 4NQSA 1YMHB 4BKLA 1U36A 3SE9L 4GXUM 4J4PC 4MDIA 4ZUSB 1KXVC 1LP9F 3BE1H 3BIKB 1JUFB 4Q0XH 1I8MB 5JO5B 4X9HA 3MCLL 5JNYB 2O5XH 2YMXH 4XRCB 5IP4A 3DGGA 2NXZB 4YHLL 4JZJA 5TDOA 3W2DL 2P4AB 2R56L 1R3HA 3BT2H 5E8OA 4MQ7A 3TN0B 1FQ9C 2QSVA 2CH8A 2XG4A 3KJ4B 1GCFA 2GKIA 5HHOD 5SWZB 3QI9D 1Y18A 4FQCL 4POYA 4X8XA 4XNZB 2ZOLB 2CO6B 1GZQB 5E08H 3TT3L 2O93L 3WS6A 2D2OA 1RIUL 5J1SC 4M3JA 1B0RB 4IHOB 4AQOA 3O2VH 1OM3H 1P7QB 1CGVA 4WW2B 2X4PA 3PQYE 5JOPE 3PWPA 4Z7WE 3FFDA 5KZCB 3LKOB 4UNUA 5DURD 1J0ZA 3STLB 4OIIH 2EC9U 5C0NC 1INEH 3HAEA 3C6LC 7FABL 2QQNH 4NZRH 3RDTC 3W82A 3IVKB 1OAUH 2DL9A 2VDKH 5CGYD 3HC0A 4KAQL 2O5YL 4XT1C 4Z6AT 3KPRA 5ID0A 2R0LL 3LH2H 5DJ8B 3NFSL 4TSCH 4JJ5A 1EJOH 4S0SD 4A6YB 5EZJA 3UPAA 1J0JA 1MCFA 4U7MA 3O9WA 5EU4B 5BO1L 4WFFE 4TUKH 4APQB 3QR2A 4TSBH 5ESQA 2PXYB 1I3RB 5F1NA 3VI3E 2BC4B 3MGOB 4QHNB 1IQDA 1XIWD 2ZG2A 1F3JB 4G9DB 2HTKC 1P84J 1WZ1H 1QYGL 4FQJL 1JNNH 5J4MA 4V2BA 1D5MA 4KQ4H 5DZNA 1JZ3A 5CZVH 5CWSB 3UBXB 4AEIL 1LEIB 2GFBB 3V4PL 1NL0H 1KELH 3JXAA 4JGJA 4MNQB 1KT2B 2A6JB 1FIEA 4HJGB 4OLZH 4RIRA 5DRWB 5K93A 2P5EA 3T09A 3EJJX 1JF6A 3QUZC 1T83A 3DX9B 4PRHE 4X7TB 3IFLL 2YN3A 3PWNB 3LHPH 3QIWA 4JVUA 2VLJE 5HBBA 2NY4C 2P7TB 1MRFH 4IBLT 4OI8A 3Q6FB 2DQTH 4QRPB 1G6VK 4KUCD 1VGKB 1CGSL 3UTQA 3QH3B 5L2KA 3FOLA 4JPIB 4N0CC 2BVOB 2V5SA 4POUB 1RUKH 3TFKC 2GTZB 5DMGD 3VFRA 3TZVC 3MXVL 2WINA 1YEFL 1JHTA 2XACC 3UO1L 4PBXA 4PS4L 1MJUH 4E42A 5I1HL 2NZ9D 4ODXA 4HUVA 4I48A 5SX4I 4D94A 4OF6A 1VCAA 2W38A 2CRMA 1N6UA 3IXTA 3ZE2E 2H2PC 5DMKB 2ZUUA 2ZUTA 5I8EB 1NMCC 4O02H 2VQTA 4EQ2A 5C86A 3MRPA 4ZFGL 5C0EB 3RRQA 4ZTPL 4ODSL 2CDGA 5D1QD 2DLHA 1CFQB 1D5ZA 1ZHBA 3MBEA 4X6CA 3X13B 4KJPD 3ZHKA 5CHNB 4NUGH 1A6VL 4XP1H 3FRPG 2RFXA 9CGTA 3S37L 5I0ZA 1KXTB 3ARBA 1ZA3B 1U8NB 3H9YA 2X70B 3BZFA 5DQ9B 3KDMA 5D96C 4K94L 4YXLL 3O6FA 4OSUH 1SJXA 4PJ5D 3UTTE 3CSYB 4MAYA 3WEXB 4TYUA 3HUJF 4KY1L 1G7PB 5CINH 3JV0A 1JGEA 3WIHA 3U0PA 4YDJB 1YN6B 2DQGL 3FQRA 1LE5A 1L9MA 3WSQH 2DQFA 4JRXA 3VFPA 1U8QA 5HD8D 4GSDH 5IV2B 4YQXH 4JFDD 5KVFL 5CJXA 3CFJB 4ZTOL 3RL2A 3OB0H 1F90H 1R5VA 4MS8C 1S3KL 1B6UA 3TGXA 1OAKL 1F2QA 3EO9H 3W11C 1T0PB 5D9SB 2VLKE 5E6IB 1K8DA 1F4HA 1CDCA 2HMIC 3CZFA 1DUYB 3WHE1 1OW0A 4BJLA 3VXUB 4AL8L 5I17A 4PGZA 3WS3A 4F7MA 3RWHB 4Q74A 1U9KA 4YAQA 1JK8B 1QLRB 1TJGH 1G6RB 4J3OC 4X80H 1L0QA 1X5KA 1LO5A 1UJ3B 4UT7H 1X4XA 4QRRE 4RMWA 2OP4H 2ATKB 1WC7B 1UKQA 1YJDC 3BN9C 5CP7B 2DKUA 4LDOB 3F7QA 1MHHA 5EUOF 1XF1A 5JR1H 4WHCA 3SDYH 2CGRL 4GBXB 4GRLC 3RJQB 3VGAB 1Q72H 1B0WA 2DM3A 5L2JA 35C8L 1A1MA 3HZYB 1JFQH 3FB7A 3L5XH 3K7UA 4PD4K 5FO8B 4R4BA 5DD6B 3GI8H 4FABL 3RTQA 1DBAH 3IDIB 4KHXL 1KC5L 2DN7A 3DXAD 4RISL 5FOJA 4HG4K 4U3XA 5GGQH 1Z5LA 3ZT5A 3BP6B 3PDGA 2P8LB 3H0TB 3HAEH 2R8SH 1IC5H 3FTGB 3G9VA 3K8LA 1MHCB 1X6NA 4LVNB 3PWJA 2FX8L 1G0DA 4LMQI 4XZUA 5DHYA 3BQUD 2ZPKH 3CDCA 1T66C 3ZLQC 4L3AA 3ARDD 3RZCD 1ZS8B 2C3GA 4P3DB 3U36B 1G7QA 1QFWH 4NHUA 4LDEB 4Y2DC 4XPBH 4EXPX 4FHBD 2BX5A 4PJ9B 5C09D 4HGWA 4HKJB 5GJTH 4AG4L 2AK4D 4LQ1A 1T03L 3QULA 5D2NE 1QBBA 2V2TA 4JE4B 2G60L 5ICZA 1KJ2L 2DWDB 2VQ1A 4F7CA 2E27H 3HPJA 5BCAA 4XVSL 3FL7A 3VFTA 2WV3A 1UADC 1CE1H 1DQDL 3MZGB 1FBIH 1FC1A 4PY7A 5FYKD 3M45A 4HD9A 2Q3AA 3B2VH 4Y1AE 3QHFH 4FQXA 2Z31B 4P4KD 2VXSH 2I60H 5DVLA 5E5MA 1NBVL 5LGHL 4TVPH 5DVMA 4FXGB 4GMTH 2UZXB 4HIHB 3Q3GA 2EICA 3B5GA 4I13B 2HRPL 2YKLL 1MI5A 4CVWA 3RVWC 2CKBA 4LGPB 4C4KO 4L29A 1EEYA 4ZAKB 1C12A 3QWQB 3T8XB 1DN0A 4YDIH 5JHDA 4JKLA 4OLXL 3SDAC 4WW2C 5IIEB 1C7TA 4P5KA 1OAYL 2FYYA 4QWWD 1G9MH 1VADB 1YYMH 4PV8A 1UH2A 3KG5A 4L4VA 1SY6L 4IOIA 4QXUL 3P77B 2VXQL 4YXHL 3TJHD 3B9KC 4HS8L 1JZ2A 2JIXB 2W60B 4K2UH 4EN3C 4HBQA 3MRQA 3I3BA 3MRKA 1EO7A 3DVIA 4APQC 5FOBB 1FGNH 1A9EA 1YN7B 5CGTA 3HG1E 3BX7C 4KZEL 1NEZA 1OF2B 3H42H 1KJMA 4NNXB 4WIQA 4H25A 4OM1L 5FUOH 4NQDB 4M1GH 4AIZB