4OCXH

Fab complex with methotrexate
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
216
structure length
210
Chain Sequence
DVQLQESGPGLVKPSQSLSLTCTVTGFSITSPYAWNWIRQFPGNTLEWMGYISYRGSTTYHPSLKSRISITRDTSKNQFFLQLNSVTTEDTATYFCSSYGNYGAYSGQGTLVTVSAAKTTPPSVYPLAPGSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Fab ADD056 Heavy Chain
publication title Water channel in the binding site of a high affinity anti-methotrexate antibody.
pubmed doi rcsb
source organism Mus musculus
total genus 47
structure length 210
sequence length 216
ec nomenclature
pdb deposition date 2014-01-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ocxH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ocxH01
5HYJA 3CXHK 1QTYT 1KCVH 4JN1H 1BQHB 1MJJB 5L7XH 3CVIL 2FX8H 3RVTD 2V7NB 1LEGB 3KJ6H 3MLTB 4N8VG 2CMRH 2NXZC 5HDBE 4WEUD 3VWKD 2R9HC 1JPSL 1RZ7L 1KGCE 3NCYS 5JW4R 1AC6A 4JGJA 5FCUL 1OLLA 5KSBF 1NJ9B 5FO7B 5INDA 5AUMB 3OJDB 3RHWK 4FQHB 2OSLA 3I3DA 1BQHG 1G0XA 1J86A 4HIHA 1RULH 1KENL 3EIFA 5DRWB 4LL9A 2YXFA 1EFXD 3VXQA 1TIUA 3OHXB 3O0RH 3TV3L 4U1NB 4RGOH 3QQ9D 3EOYG 2XV6B 3WSQL 3HG1D 4NM8L 1DQML 2BNQA 3BH9B 3QPQC 4LLUA 2DWEA 5ERWA 4HZLA 1NGXB 2IH1A 5EN2A 4W4NA 1KLGA 4JO2L 4DQOL 3WUWB 4O2FB 2X9YA 1BIIA 2XWTA 2P5WD 4KZDH 2DWDA 1AGEB 5DSCA 2AJUH 3D2UD 5HDBF 1AKJD 1R0AH 3C2SA 1MHCA 4GAJH 2NR6C 2B1AH 2V2XA 1P84K 2AJ3B 1FJ1A 3P11L 4YHOH 4Y4KD 3N1PC 2XA8H 2BZDA 3ARDB 3FZUD 2DMBA 1FAIH 1ADQA 1BJ1H 3WUWG 2JJSA 2ERJC 4WFED 4UV4L 2FYYA 4X6EB 5I73B 3LHPH 5IM7A 3CFJB 2IBBA 4LIQE 4DKDC 4QHUB 4HKZB 1T22B 5DQJB 1A7QH 1LO0H 1A6ZA 4JHWH 1TVBA 1Q9WA 2OTWB 4JR9H 5C3LD 4MHHI 1AE6H 1BF2A 1WT5C 3JV4A 3VFRA 2MWCA 2VC2H 4JGUA 4MD4B 4RAUB 1G7JA 4NP4H 4X98A 5FUZH 4WI2A 4IOFD 3FO0H 3RTQC 2NTSP 2DAVA 4TSCL 1OP5H 3T4YB 5DRZA 2X9XA 2AV1A 3P4MA 5DTFA 4JRXB 1WICA 4HKBB 4J4PD 1Q9LB 3BKCL 1VPOH 3VXPB 4QKXB 5LJYH 3BKJL 4EN3C 5E6IB 3WO4C 1OGAA 4JM4L 3P4NB 5ADOL 3R8QA 1WF5A 3NCJL 3OR7A 2DLGA 4OF3A 4Y1AE 3IYLW 4N1EA 4YXKH 2OX5A 3VGFA 3WJLC 5JXEA 2UV3A 2QHRH 1I1AC 5D7IE 4U6XA 3CFEB 4U6HA 3K2UL 3NA4A 3C6LC 1J11A 4NJAL 5DD0L 3DYPA 1IGYA 4XCCL 1QKZH 4AK1A 1E6OH 4XWOC 1O7SA 3HNSH 5AZ2L 3NACH 4BQ8A 4AT6A 3SKMB 3EO9L 2ED9A 1BQLL 3TH3T 3WFBH 1T0PB 3QH3A 1UWEH 3VGBA 3ARGB 4RMRA 5C2UB 3U46A 3VDAA 3TA3B 2V5RA 1KN4H 4UIKL 3Q1SH 2VDKH 1NMBH 3O3AB 1QPPA 2CJUH 3O8XC 3H8NA 3OAYH 5DGRA 2JCCE 4PBVC 4Q9CA 2FD6H 2BY3A 5K9KA 4OFYD 1I1RA 1F3JB 3SDAB 4ONFL 3UTTE 4NWTL 4QRUA 3MLVH 1UC6A 2BVPA 4PBXA 4O58L 1ZA3A 1JGEA 5HGAA 4RGND 3VXMA 3LN4A 1F00I 4LHUD 4BFEA 5HHOB 4YFLI 4N0CD 5D7IF 1WFTA 2NZ9C 3ARFC 1JNJA 1T66D 1MFAH 1U8NA 2ZUWA 4IOIB 4OCSL 3QDGB 4ORGB 1NLBL 5B4MD 5DRNA 3DSFL 3U2SA 4XNUH 4JFXB 5F9AC 3HE7C 4ZNEE 2W9EL 4MDJB 5C0IA 1UCBL 4GRMA 1CG9B 5DEZA 4QXUH 4HDIB 2EEAA 1TZIA 4ZD3L 3WN5A 1MJ8L 2F53D 4GKNA 2X4UB 5F1NB 3VD7A 3P9LA 2B7DT 2JCCF 3L7EA 1S9YB 3VFOB 3PIQB 1NFKA 4X7TA 3ZYZA 2HT3D 5IIEA 3GO1H 3RDTA 3EO1A 4UAOC 4AMKL 3FFCB 1S7SA 2OLDA 1DQMH 1WGOA 1K6QH 1RPQA 4IRJB 5E2UH 2FX7L 4LPWA 3EJYD 7CGTA 4ODTL 3HZMA 5ESVB 4C56D 2XIDA 5I1KL 2CH8A 4FNLH 3CDFA 4DVRL 4ERSL 1OP3K 2E9WA 4K3EH 1GJIA 5I1DA 3OKOA 1NGYB 35C8H 3ROLA 4JZJC 3TWCL 3CD4A 3H9ZA 4JDZB 2UWEB 1TCRA 4OZHA 4PGDB 4RAVA 2BVOA 5FYLL 1F4HA 4MA8L 2I60H 3TZVC 2VITB 3S96B 1JPTH 1JK8B 1J10A 1L9NA 3IGAA 4CU7A 1YNLL 4D3CL 1QRNB 5MENE 5E5MA 1NFIA 4P2OD 5CZVH 3ARBB 2GQHA 1IGIH 3VD3A 4AM0A 2OS7A 2PTVA 2YD8A 3BAEL 2EH8L 1P7KA 2XA3A 4Z5RB 1C5DB 5D7LE 2D2OA 5DMKB 4X80L 1WFUA 1ES0A 5CINH 1GVIA 3O45B 3HRZB 1OCWH 1YQ2A 5LWYH 2VDRH 4Y5YC 4Y0GA 3HTLX 1AFVH 3QFJD 3SPVA 3HNTL 2ZG1A 3HLAA 3Q6FB 4NKDA 1NGPH 2CLZB 2NX5A 5GRJH 1LO2H 3CCHA 5EIIB 2J2ZA 1XIWD 3M1BA 2R2EB 1IC5L 5HD8D 2NXZB 4G6FB 2C1PB 1A2YB 3I6KA 4HCRH 5KN5A 3DO7A 5I30H 1DFBH 4XZUB 5T1KB 3MRGA 4KDTA 1S7TA 2HFEA 1KEML 1EHAA 3BKMH 4TYUA 1UM5L 2BHZA 4QXGL 3HI1A 4GG6B 2APXA 3TO2A 1G7MB 2OR7A 1M05A 4ELME 4G6KL 5C07E 4HUWB 4PB0L 4NN6C 4LLDB 5IROC 2LTQB 3ABZA 4WU7A 1FLRL 1U8HB 1CFNA 1U58B 4OZFB 1I75A 4G5ZH 4G8EB 3ULUL 3QUZD 4EIZC 3N9GH 4WU5B 4HWBH 4H1LH 2RGSA 3FN0L 3G04B 3BN3B 3LRSB 3SDCA 3F7VA 4GT7A 2J8UE 3QNYA 4BZ2L 2OK0H 4NQDB 4HUVA 3W0WA 2DM7A 4HIEB 1TJHH 2IG2L 1Z6JT 1CDCA 2HRPL 2R1WB 1CICC 1LWRA 4NWTH 3OXSB 4ZQKB 5DUPL 2HKHL 2YKLL 3PWUA 4FQJL 1BJMA 4L5FH 3H9HB 5FA3B 3U0WL 2HT2D 1M6OA 4OV5B 1SVCP 1XGUA 4OLUH 3KPSA 1UWGL 4ELMF 1FYTB 5LVEA 3BEWA 2ERJB 1IBGL 1XF1A 2X4PA 3LN5B 4UOW1 5B39B 1FNGA 3O6ML 1HOCA 1ZGLB 3QT2A 2F5BL 3DYMA 4N0FA 3CUPA 4AH2A 2JB5L 4N0UE 4JQIH 5FB8B 4GW5B 1S3KL 5I2IB 3DSFH 3EJZC 1S8DA 4K9EC 2D7MA 2P8PA 3LD8C 2FATL 4MWFA 4D8PB 3I6LE 2C3XA 3E6HB 1M7XA 5EO1A 5E9DA 4QRRE 4KHTH 4ZD3H 3DUUB 3BKYL 3LVEA 5KSVA 3SE8H 2BY1A 2MCPH 3EOBB 1SEBA 2J8UF 4XVSL 1G7PB 5B39G 4LOUD 3AMKA 5MP6L 4HCRA 1T4KB 5GGVL 2IPTL 3THML 1T0MB 7FABL 3LKOA 1N0XL 3RTQB 3P2TA 4OGYL 3RI5K 4XCYB 1CGWA 1HZHH 3MV8B 1MLCA 1ED3B 3S3JA 3C08L 3H0TA 5D2NA 5ICZB 1K85A 4AMKH 3CX2A 3CMGA 5ANME 5IJKC 4EN3B 3WO4B 2O93L 1BFOA 2X1OA 3VRLE 1JUFB 1RZKC 1HHHA 3QJHB 4ONOA 4JG0H 5CP7B 1YY8B 3QXAA 4KTDL 4XGZB 3UAJD 4QTHB 4WFHD 1Z9LA 5F6HI 3KLHD 3BUTA 1I1AB 4PJ9D 3WFDH 2SEBA 3QIWC 4Y5XC 5DS8A 1P9MC 2K7PA 4HH9B 3C6LB 5SWQA 4M4RA 1E27B 4HWBA 3TC9A 4H1LA 1CLZH 5TPWH 4P3DA 2F74A 5LGKA 3A67H 3IU3A 1F13A 1YN7B 2OM5A 3VMPA 1FBIL 4L29B 1B6DA 2BCKB 5DVLA 1NSNH 4K2UH 4MJIB 5FYJU 2ESVE 4OLWH 4NDMB 5DHVB 4FMFA 1N5AB 1QRKA 3O8XB 4X5XB 1VKXA 4I13B 2GFBB 4WGWB 4XBPA 4YHML 4LSTL 3VRLF 1U8QB 5LQBH 2OBGA 3LQAH 5I18H 1A6VH 3TYFB 5DMJB 2HT4D 1R3JB 4FXKA 4V2BA 4P99A 4NQVB 2LFGA 3MR9B 4LAQL 5C0FB 5KZCB 3IJSB 1PGRB 1MJ7H 1UVQB 3D18B 4ZTOL 1KELL 3HC4H 3B43A 4EDXB 2VLJD 3VE0B 4GW1A 5E0QA 5EU4A 4PRNA 3RVXD 5ITBH 3OTTA 1VENA 3VD5A 2VMFA 4G8IA 4LU5H 1KIRA 3HE7B 4RZCA 4U3XA 2J5LC 3WFEL 1XGQB 3GI9L 4FZEL 1KBGL 3ZO0A 2FJGA 1F42A 3QUXA 4ZFGH 5E99H 3BQUD 4NJ9L 2Y06L 3V6FA 1A22B 1MHHB 4HMCA 2MTPA 4S1SH 5F7NC 2ITCA 4HF5L 5HYSG 2UYLA 4G6KH 3HG1E 2D31B 1FYHB 3SKNA 5F8RC 1QFWM 5FYJL 3G6DL 1HHIA 1SM3H 1DQDL 4UINH 3ILPA 4XVJH 3NN8B 1DLHB 1HWGB 1KB5B 3U0PA 1BZ7B 1I8KB 2GK2A 5B3JE 1EEYA 3VXTA 4JFQA 4KK9C 2DQJH 2P5WE 1LK3L 5TE7L 4HK0B 4LQ1A 4H8WC 5CEZL 4QRSB 1MJUH 1MQKL 3GSNB 5EOQL 3OJMB 3BP4B 4AG4L 1QHOA 4BZ2H 1FAKT 4I2XB 5HVHC 1CGUA 1RZJH 1H5BA 3KPRA 1FHGA 2IG2H 3DTXB 3RY6A 2GJ6B 4NKOB 3QNXA 4JZJB 2YKLH 4WEBH 4FQJH 4WFEE 4HGKC 1P2CB 3L1OH 1V8HA 4X4MA 4M48L 1IBGH 3PP3K 4Y19B 1JGDA 3LRGA 1HEZB 3MLXL 5T3XH 1ZT4B 4P23C 3PHQB 4KKCD 4IS6A 1NMAL 3QHTC 3MO1A 4A6YL 3P30H 2EDJA 5B3JF 5FF6A 5HSFA 1B4JH 4K23L 2UY6A 2ATKA 4LSRL 4ZAKC 2XTJC 4RX4D 1KACB 4S1QL 4U4BA 4Y5YB 1LP9E 1EIBA 3UZVB 4FFWD 1CIDA 4Q6IC 1PW3A 4XMKH 1EFQA 4Q9RL 3D3VD 1EXUA 3EDDA 4HZAA 5MP6H 3TIEA 4L9LC 3QYCA 3NFPA 1XGYH 2DIBA 3F12A 1NANH 1UQSA 3CNKA 3FN3A 4NO0A 4XNMA 5D70L 2D9CA 3FQXB 2VAAA 3L3OB 1IGCL 3TCLB 4OI8A 1A7PL 1DQQB 3MODL 5EPMB 1HSBB 5SX4H 2CDEA 3HZYB 4RISH 2OTUB 3VXNB 2QKIB 1A1MB 5DLMH 2Y7QA 3L5JA 1NCAL 5C0AA 4Y2DA 3MBXH 5DD3H 4BQBA 4LCIH 3EYFB 4LAJH 2KKQA 4FQXD 4PS4L 4OKVB 4KJYB 4OF5A 3RZCC 1JZ3A 1VFAB 3CFDA 1NANI 1OSZA 3NCYP 3IDYB 4IHOB 4U31A 5HTSA 2AJVL 3FQUB 3DHJA 3S98A 1T7VA 3KYNB 4R4NC 5SX4I 1LP9F 3O4LD 3QZWA 4TTGA 1U36A 1WCBA 2B1HH 1XGRA 3K2MC 4NQEA 3PGCA 1TENA 4YQXH 1RURL 4JKMA 3MOBH 1KTDB 5IVZA 2B0SL 2XZCL 1G7LB 1ZOXA 4NYLA 3CGTA 2ZCKH 3BEVB 3K80A 4QRPB 2DL2A 3NFSL 2I07A 3TBYB 3FB5A 3X11A 4KK8D 4KHXL 4ELKB 5DD5L 3FOLA 2ZNWA 1TETL 4G3YL 4RGNE 3N1FC 1FVCA 4MMXC 1DQJA 4GXVL 1CICB 3MV11 3MBED 2D7PA 3IKKA 5IFHH 3KPOB 5GZOC 1T21A 3OV6A 4NC1C 1I7TA 5GRUL 1MWAL 2A83A 3QBTB 4P5TC 2Y07L 3ALXA 4FN0A 4M7ZC 4LCWB 5CJ5A 5TQ0H 4OSUL 4Z9KB 2P44B 1LDPL 1ZT1A 4K7FA 3ARDD 3M07A 3KHOA 3VU2A 3G9AB 2AV7A 2ADGA 1FFPB 3EYOA 5ESAB 4DN3L 1QLRB 4EBQH 2F53E 4BYHA 5DK2B 3EW3B 4TN9A 3BP5A 1D9KD 5J3HC 4YO0A 2XTLA 1GGCH 3MFFA 2DICA 4JFFD 1UM4H 2CUHA 3U7WL 1RZGA 1PKOA 4U1LA 4JHZA 2AK1H 1CR9L 3BP6A 3CZFA 4FQIH 4AEIH 5HHVH 1M71A 2FL5A 1IM9B 5D9SB 3ZDYE 4ZS7L 3DOSA 4IRSD 4IMLA 3QUKB 4OD3H 1FZOB 2E9BA 4LCYB 5FGCE 4OZIB 3HCVB 3GMPB 1WBXB 1ZA6B 3DETD 4C56E 2PW1B 3TLRA 4MJ5B 3EDJA 4E41D 3F8UB 4LF3B 5F7EL 1MQKH 2EXYC 4LEOA 2Z8VC 2KQNA 3TN0B 3QXTA 3MLRL 1T83C 3F7YB 4PRPD 4X5LA 1CLOL 3T04D 1QBML 3MCG1 2F8VA 5IMKA 3UC0H 5DC9B 1DUZA 3KPLB 3MYZA 3VDBA 4ZOAA 1T03H 3RBGA 1U92B 5K9JH 4N5UA 4KFZC 1F11B 4JFOA 1MFBL 5JOPD 5I75C 1EUTA 3H9SA 1Y6MR 2HA1A 1BD2A 1HI6B 1I1YB 1E6JH 5ADPL 1OAQL 1KPRA 1DBJH 2BRQA 3I9GL 4L8CB 2MPAH 1C5BL 4CVZA 4XNXL 5I16A 1U8LB 1HHGA 5I8KH 1TVHA 4KU1A 4M3JA 4J6RH 3M8OH 4OFDA 3ZDYF 1BECA 4KK8C 2X89D 5GGTH 2OYPA 4XNZC 1JZ7A 3ETBF 1AQDA 3QFJE 1WFNA 3I6GA 3UTSD 2YMXL 1DBBH 3PP4L 4HIJA 2DLTA 1NCWL 4XWGH 3TBTB 3VG0H 2A73A 5D5MB 2NY7L 4X9BA 4PRHB 1RZFL 3GRWL 3SDAD 1QP1A 5SV4A 1CTOA 5TE6H 1CS6A 4TUKH 4PJIE 4JRYD 4L3EA 3UROR 3IFPA 1ZT7A 5J56B 5KSAB 2XXCB 4OM0L 1PQZB 5DA4A 1FNSL 1GZQB 3ZL4L 3BDYH 4P57A 5BOPA 5CGTA 4CVXA 4ZFFA 4XVTL 1JI2A 3MGAA 2OL3L 4BH8B 4ODHL 4LKCA 4Z0BL 5HI5C 4CUCA 3NA9L 5IW6A 5D71L 5BZWA 5BS0E 2J5LB 4X9FA 1SMOA 5L6YH 4PJHE 2CR6A 3WIIH 2Z4QB 5E56A 2PXYA 1D5IH 3BIKB 4YPJA 1CU4H 5CHNB 3U1SH 1MCBA 5C8JB 2VDQL 3GK8L 1V05A 1UXWB 2OXGA 1IAIL 3BH8B 5IQ7L 2DTMH 3O41B 4P5MB 5E2TH 4O51A 1GPOL 4R0LA 3V95A 2JF1A 1ZTXL 4JZNB 5DK3A 3CK0L 1GC1H 4Q7DA 3OB0H 1T3FB 5DO2C 1QD0A 4HC1L 4IRSC 1PAMA 4PJCE 2C3VA 3KNBA 3ULVD 4UILL 3KVQA 1W72L 1QLEH 5BVPL 1JHTA 1KPUA 1WZKA 4MD0B 1I3RB 1IM3A 2EDHA 5D7JD 3DVGB 5FYKH 4FQCH 5HVHB 5T33L 5EZLA 3UTZB 1RJYB 1ZHBA 4PGCB 3RWCA 3R06B 4OLVL 4MAYD 4GXVH 1OT2A 3MLUL 4WUKH 4IDJL 3MSPA 2JELL 2WIIB 3MXWH 5J11C 1EBAA 3GHBL 2P42B 4BFGA 2XQBL 1KIQB 4D9LL 1IT9L 4Y4FD 1F6AB 1TZGH 4DGYL 5GGTA 1X5LA 3ZTNH 6FABH 1FPTH 3G5YA 2R0ZH 5C0DB 4F33B 2NCMA 2FIKB 5HDQH 1WWAX 1VEPA 4P23B 1FL3A 1K2DA 2XN9B 1C5CH 4PJCF 5JNYA 3AREC 3GIVA 3ARBD 2EZ0D 4Q58C 1IFHL 1LO3H 4OV6F 3S6CA 3IVKA 1A3QA 1H3PL 5MEOB 2IANE 2GSIB 3P4LA 1X6LA 4Q6IB 5KVGL 5J6GA 2VXSL 1X4ZA 3BPLC 4L9LB 1R3IH 3CSYB 3LEVL 5MEPA 4XH2A 4BFIB 2A74B 5E2JA 1YYML 2CKBH 2M26A 4I0PA 4GKSB 1PY9A 3QUMH 4IIQC 4U1HB 1B2WH 4LP4A 1UCTA 3V6OA 4Z78B 1TJGH 3MRBB 4JFZH 2ZPKH 5ISZD 5A16A 1FE8H 4JPIA 3REVA 1CFQB 4M1GH 3T8XB 3LS5L 2R2BA 5I19L 1ORSA 2OR8A 4G80A 4YHKL 1QR1B 1A6AA 4LHQB 1J8HB 1YC8A 3PDDA 2NY0C 2XXMB 5AD0A 4JQXA 1QBMH 4X6DB 2LQRA 2BSED 2HJFB 2MQ0A 4JFYB 4WGVB 5HYQA 1JTPA 5IOPA 1JZ6A 1G0DA 2EDNA 3MJ9H 4P4KD 2R4SL 4PJEB 5GIRB 5EUOA 2RR3A 3MRNB 1RMFH 4PJ8A 5FUOL 4YXLL 1EX0A 3GB7B 4CMHC 1DR9A 3RGVB 4RFOH 2XTJE 1LGVA 1N0LA 3KWWB 5F1KC 3BRGC 1HSAA 2DQFB 3RNKA 4X5WB 2GUOA 5F9WB 5EOTA 5KW9L 5FK9A 1RK0A 5C08E 2YMXH 1XCQA 1MAML 1BX2B 4NQDD 4DVBA 2EYRB 2EDTA 1PEZA 4JG1L 5TDPB 3SQOL 2VLJE 4P5TB 4M7ZB 2P45B 1S7WB 5SWZD 4UT7H 1WAAE 2APWA 2G60L 4O02L 1OAUL 4F8TA 1F4WH 2PO6A 3RVVC 3B4NA 4DAGL 2ZZUT 3V4VL 5GS0H 5E8PB 2OL3H 4NIKB 2I26N 2PN5A 3FAWA 3P0YH 1BFSA 4NCC2 3BFOA 4YDJB 3QUMA 2R4RH 3WEXB 3FT4B 4MNGB 4M4PA 1KCLA 4DFHA 2X44D 4GKZB 2MHAA 1AD9A 1GGIH 5E4IA 3UO1H 1Q9OB 4I18B 1JTOA 2CK2A 1L0QA 1QBBA 3BVNB 1S9VB 2HN7A 3IXAB 4Y16B 1L7TH 2NY3B 3QEGH 4KJPD 4HAFA 3WHE0 4PRAB 2Q8BL 3P0GB 5F6IC 1R3HA 1W72H 5JORB 3MCKB 2Z35A 3B5TA 4GH7B 4KXZH 5EBWB 2VH5H 3KG5A 1WAAF 1AR1C 3MJ9A 1NKOA 2A9NL 4GMSL 4F7CA 2P7TA 5I1EL 5FXCH 1K4DB 2ICES 2BNQD 3DUHA 3D39A 3ROOA 3QRGH 4LLVA 2QQLH 1QBAA 4NC1E 2YPLB 1S7VA 2H2PC 3EFFA 1DBML 5F9JA 1YC7A 1B0GA 2GKIA 4TNWK 1CXKA 4ZSOE 5EG6C 1QNZL 3L9RA 4KXZI 1NBVL 3ZZ1A 4YR6B 3UTQA 4EI5D 1HH6B 4HS3B 2EDXA 3MRPA 3INUH 5D7SH 3Q5OA 5JMRA 3CC5B 4M6ML 3QSKB 5T1LD 3NOIA 3MMEB 5I1AB 1OTUD 4W4OA 2R56H 1SY6H 1FRGL 3BYYA 3GBLA 1JZ4A 3D25B 4MJID 2N4IA 4XNZB 4C4KO 5JW5B 3C5SB 3W5MA 3QDMA 1L6XA 4M9PA 1FFNB 3CMOL 3D3VE 4OQTH 3VD9A 4U1MA 4P48A 4PRIB 4G8GA 1KJ3L 1J18A 2MSPA 1A6WL 1IGMH 1CLYH 4AEHL 4OCWH 3FRUA 1DL7L 3VH8A 3JWOC 2XYCA 4N8CL 3O9WD 4D0CA 1J0IA 4QXWA 4PGEB 5ALBL 1I7RA 1FO0B 3L3GA 4LRNL 4MS8C 1R6VA 3CDCA 3DV6B 5EBMB 5KSBA 2V9RA 3L5XL 1R24A 4WEMB 4W6WB 1AI1L 3BWAA 2R0LL 1JWSB 1H3UA 3TNNA 4RFEA 2WBWB 3QG6A 4YHPA 3ZE1E 4DZ8B 2V2TA 2CD0A 5C0BA 3G5ZA 5L9DL 1X9QA 2B4CC 4YHKH 4LIQH 4KPHH 2ATPA 5CKAA 1PD6A 3O4LE 2FX9L 1OVZA 3QI9B 2IADB 4FQLL 3CDGB 5CWSB 4XPHH 5JA9A 2CXKA 12E8H 1CIUA 1X4YA 1R5VB 4NFBA 1QEWB 2Y25A 1NGZA 4NOBA 1FG2A 5I76B 4ETQA 4PTTA 1HINL 1Q9KB 1KCKA 5HYIA 3RL1B 4ZUTA 3KYAA 4KAQH 4XVUD 4UV7L 2VIRB 1HHJA 1F58H 4KGJA 1TJIH 2ZSWB 4LSUH 5L2KB 1NCCL 1F4XL 1IC1A 3X3FH 5D4QA 5ABDE 2XQYK 5JUEL 1S7RB 4XBEH 5IVXB 3FJTA 3KJ4C 2IQAA 2O5YL 2PYEE 4R26H 3A6CH 4R4BA 3G6JE 4PY7A 2GK0B 3MA9H 3GJFK 5HHMD 5J11B 5IKCB 1ZS8A 1SY6A 2HLAB 5DEGA 3C6SB 2EDLA 5F9OH 4HWZA 1YUHA 3EYSL 5DJ0A 3C5JA 4H25A 2ZKHL 4OQTA 1J7VR 4UNTA 5E7BA 2LVEA 4LKXA 4X6BA 2DQCH 3FQRA 4F7TA 1JI1A 5E8EB 1CDIA 4G6JH 3VXMD 5FOBA 2G5BA 3CPLB 4F15B 1MCKA 1LVEA 3AREB 3HPJB 3WE6B 4JFFE 4CBPA 3B8YA 2CGRL 2JJSC 3I2CL 4KKAC 2R1XB 2WLYA 5L88H 4OT1L 5CSZB 3KS0J 5JR1H 1CZ8H 4JY6B 2Z8RA 3BPLB 4Y4HB 4JJ5B 3T08A 1B0WA 1QVOA 4IDLA 2ICCA 3G6JF 1KLFA 2VDLH 3T0BA 1YNTA 2ADIA 4XNYL 3MREB 1FZJB 2H3NB 4IIQB 4E41E 3UJIH 3QDJE 1OARH 1QSEB 2DN7A 2FB4H 1BBJB 1WJ3A 4JFEB 4OCYH 4P5KB 3WFCH 1HDMB 4GS7C 3LQMA 3LPWA 3T65B 4NNYA 4ODWB 4PRPE 1F6FB 3IETB 3PABB 2X41A 2ZJSH 3AAZB 1TTGA 2R0WH 4MVBD 1MLBB 1IC7H 4XMLH 5JW4M 1RUAL 5JOPE 2AJSL 2NY0B 2WK2A 4JVPA 3TVMB 3MGTA 3IXTA 1ODAA 4PJDE 4HFUL 4JPKH 1UYWL 3BDXA 1FVDA 1G6RB 2M2DA 3LH2L 3EYQC 3ZE2E 5JXEC 4F37K 1NEZG 1W0VB 5BV7H 4M6OH 5J1TC 2JIXB 4L3CA 4CMHB 4OI7A 5IESH 3U4EA 4LFHG 3UTSE 5C0JB 1DBAL 2QTEA 5D7IA 4I48A 4U1GC 5EUKB 5INCA 3DYOA 1DQTA 3ULSA 2YWZA 3RX8A 3PWNB 4JRWA 4FQ2L 4JRYE 1LEKA 4H20L 3MRQB 1BFTA 5DJXA 4ZS6C 1YEHL 1KXQE 4ISVA 1YMHB 3RVUD 1V7NH 1IGTA 2EIZA 4PJDF 2GW5A 1KLUB 4WDIA 5DFTA 4DUWA 3TBSB 3IFOB 2ARJB 2YK1L 2XNAB 5A43C 2XWBA 4RMQA 3ZE2F 4MLIA 3CFKB 1HXMB 4ZPTB 3OKMB 2RAMA 2P8LA 2J8HA 3BGMB 2B2XL 3UTTA 1Q8MA 4OZGB 2NX5D 5C9KA 3L6FB 4OJFL 5DVMA 5HHQA 1A6TB 1MIEL 4PD4K 5MEQA 3HMXL 4LSVL 2GY5A 2X4QB 2V5YA 5FEBA 3CSPA 3HA0A 4R9HA 4ZMAT 4N68A 4QO1A 4XBGB 1T1YA 1S7XB 2VKWA 4PREA 3MPCA 3ULVE 2VZ3A 2VE6B 4OCXL 4M62H 3GHEL 3QIBD 3IS1X 3WN5C 3HI6H 3QCVL 3NFNA 4X4YA 1JGLL 2CRIA 1D5XB 5KS9E 2PF6A 5T3ZH 1TZHB 3ME0A 5F6IB 1JPST 2FZ3B 3TNMB 1S7UB 3RUGE 3GMMB 5C7XH 4PRDA 4O2EB 4GRWH 3V8OA 3AFLA 5HGBB 1L0YA 4HS6A 1FN4A 3MV9A 1BQUA 3FKUS 1CD8A 4X99A 3RDTC 3STLA 2MKLC 4MVBC 3OAYK 2EDQA 2Q8AL 2LE9A 2A6IA 4JY5H 1AR2A 4UB0H 4GUPA 3TN0D 5D2LB 4IRZH 2DTSA 1IQDB 4P46A 3FONA 3HR5B 15C8L 4C55A 4F8QA 3JV0A 1FZKA 4WWKA 2CRZA 2FO1A 3UTPD 1I9IH 4S0TD 4U3HA 1T7XA 5DC0A 3V7AG 3ZKMD 4E0RA 5ID1A 3ULVF 4M43L 3EHBC 3V5HB 1N3NB 1JV5A 3KAAA 3PWPA 4HUXB 4RA3A 1CFSA 2NY6D 1C1EH 1UWXH 2F9BT 2Q6WB 5KS9F 1TNMA 1RUML 3IJHA 2YEZB 4BSWB 3RUGF 1U91B 1OTTD 1H8SA 2ZCLL 4HBCL 5FAAA 2P5ED 2R8SH 1T1ZA 3UJTH 4DKEL 1Z0NA 1QFUL 1BOYA 4P2RE 4R4FL 3MJ8A 4YE4H 1U3HA 4PJAB 3SKOA 1S5IL 2BOCB 4OD2A 1IAOA 3MA7B 1UZ6E 5C0EA 4J2XA 2FEEI 5ISZE 3WNPA 2AEQH 3JTTB 4QRTB 2VLLB 5D6DA 1U8IA 5KG9B 2ARWA 1QSFA 3T4AA 3V7AE 3H3PL 1GGTA 1HXYB 1LHZA 4WTWA 5BO1L 3CAFA 1BWMA 4N9GA 2A6DA 5D7LA 1P1ZB 2G9HA 4PG9A 5KSAD 4PP2A 1I9RL 2VLRD 5HYJB 3S36L 1CXFA 5KBNC 1U93B 1FORL 2CDGB 2NNAA 1CI5A 4ZFOA 2Q3AA 2LVCA 1GAFH 3MYJB 2WP3O 3C2AL 4O00A 3GBMH 1YPZE 4N5ED 4FG6C 4NRYA 4JHAH 2D0HA 4KDTC 4JPVH 4HFUH 4MA1C 3Q3GB 2E6JA 3TEUA 5INDB 3OKKA 1X5HA 5H37G 4I4WA 1KB5L 2OSLB 4PIRF 4XB7A 3O2DH 4HIHB 1IKNA 1VGKA 1UZ6F 3VXQB 3BOVA 2Q86A 5LCVH 2GHWB 1OAKH 1ZWIA 1NDMA 5IV2A 4W6XB 3GSNL 1DVFA 5GRZA 1A4JA 3FT2A 3KJ4B 5C07A 4DZBB 4LLUB 4NUJA 2DWEB 5ERWB 3UYOD 3MRFA 3EAKA 2C26A 4UQ2A 2XACC 3BDBA 4YHYC 4FQ2H 4EVNA 5SWZE 1BIIB 3SDCC 3SDDB 4IJ3B 4QOKB 1MI5A 3KYKH 5DSCB 3LMJL 2E27H 1YPZF 2E9IA 4HUNB 1MHCB 3EGSA 3F6IA 1NCDH 1KJVB 2P47B 4N90E 1QQDA 4YDIL 4DW2H 8CGTA 2J8UA 2DQEH 3OKLA 2N56A 4LPVA 1NGWA 4TVPH 3OKDA 4KVCL 3BZEA 1EHLH 1VACA 4CGTA 4YHNA 4QNPF 1N64L 1UH3A 2NXYB 3GSVA 2FYYB 2BRRL 1RVFH 1NC4A 3GJFB 5M7QA 4RDQG 3N1GC 3D48R 2HFGH 1IL1A 3RAJH 2VLKD 3LCYA 1AXTH 2BOBA 4YUEL 1ZLWK 3RHWF 1A6ZB 2WQ8A 1W8OA 5D1XA 1TVBB 3WS3B 3TM6A 1Q9WB 3QUXD 3QCVH 3KDMA 3AC0A 4NWUH 3JV4B 5GS2D 3VFRB 3WNMA 5I1HL 2KQMA 3RWHA 4Z7VA 2HJKA 1EJ6A 3BHBB 4XRCB 2BNQE 4QRRA 1CFTA 2GT9A 3W2DL 3EDFA 2AV1B 1BVLA 5JPMA 4AIZA 5GSVB 5ID0A 5JHLL 1MY7A 1DLFL 1FNLA 5D2NC 2FDBP 3NABL 3MJGX 2DQIL 5ELIA 1D6VL 1MCPH 3O2DA 1OGAB 3QXWA 3IAGC 1P7QA 5BXFB 4ZXBD 1YNKH 3S35X 3EDEA 2Y1VA 4PLJD 4WY7L 5ANMA 1J0ZA 2A6JA 4U6XB 1F8TH 1H0DB 5T1MB 4AL8L 3MJ7A 4M1DH 3ZT7A 1IGYB 1VFBA 2CXGA 5E6YA 2EH7H 4OTXH 1Q0XL 3O4OB 3PDGA 1IZJA 4U1GB 1CD1A 3C5ZD 3S37H 4ZOEA 4TNVK 4HT1H 3RGVD 2JJVA 9CGTA 1N7MH 2MCG1 4MQ7A 1C12A 5JW4Q 1G0YR 3IDXL 4M6NH 3BIAX 3I50H 4DJMA 2F19L 4U33A 3HHRB 5I1CH 5IMOA 4KRPC 3QISA 3HE6A 4H88L 4JDVA 3WXVH 4R7NA 2W0KA 2PETA 4ZTPH 4YDKL 5K9KB 1P7HL 3GI8H 2R29L 3FL7A 3LB6C 5E94A 3PWVB 3S35L 2BVPB 4HJJL 1ZA3B 5HGAB 3LN4B 3PWJB 4HWNA 3H42L 4QY8A 3E1F1 25C8L 4K9EL 1FORH 5CAYB 4Y8AA 3N85L 1R5IA 3MLZH 1Z3GL 3KGRA 1FIGH 1F4YL 5FV2A 1J0JA 3C2AH 1A6UH 2W38A 5EOCJ 2CIKA 2EDKA 3VFMA 1KTLA 1XH3A 2Y23A 5C0AD 1CGVA 3SO3C 4JN2A 4GRMB 3VWKA 4Z95L 3S34L 5CBAB 2X1QA 1TZIB 3WN5B 4OLEA 3UP1A 1TQCC 3P9LB 2OCFD 1C16A 4GSDH 2AXGB 4Y16D 3WJJA 4L8SB 4JCLA 2OXHA 4X7TB 3U36B 2NY3D 3L3JB 1RZKL 3WLWD 1EFXA 2F15A 3RDTB 5IFJA 3MRLB 4ZPVA 4UTBH 5HHME 2E5EA 1PSKL 1S9XB 1UM6H 1SYVA 1S7SB 3GBNL 5E2VH 3HG1A 2DQDL 2IPKB 2FR4A 4NOFA 3LSOA 2W1NA 2CO7B 4X6FB 2PTTA 4Z7WE 3K4ZA 5C1MB 4S1RL 1OM3L 4TSAH 1NBYA 3TH4T 4PJFB 3VXME 5T5NG 3D2UA 2DQUH 3RY6C 1AKJA 3ROLB 5T3XD 1T04A 3EYUL 4RAVB 2BVOB 4LBEB 5C0NC 3O3BB 4KMTL 1K8DA 5IB2A 4QT5A 3F5WA 2A6KA 4Y4KA 3PWLB 3U7YH 3IGAB 1WITA 2VB5A 1HNFA 4XP9L 2WQRA 3LQAC 3TH2T 2Q87A 2V9TA 3FT3A 3K81A 5I8OL 1AHWA 2LAGB 3GM0A 3FQNB 3IDNA 4XCEA 5A1AA 1A1OA 1MOEA 3NCCB 1BAFL 4PRID 4DGIH 5GXBB 2BNUA 4HSQA 4DUVA 2Y9RT 3ZHLA 5DR5L 4RBPK 3O6LL 2H6PA 2AQ1A 4Z7WF 1CBVH 2Y6SC 4RCAA 3C8DA 3HAEA 3DURB 3HLAB 3OAZH 1J9CT 5E8NA 3VWJB 3BP7A 3CCHB 2AJZB 2WW8A 3D85B 1YEKH 3NABH 5EC1A 5LAXA 4WW1A 4J4PA 1X5KA 2V2WB 2EDEA 1D6VH 4NFCA 4CADA 1NUGA 1MVUB 1A7NL 4Y2DC 4JHBA 3K74B 3VXOA 2A1WH 5C2BL 2HFEB 1BWWA 5KVEH 1VDGA 3PDOB 5C0CB 2LV4A 3HI1B 3TJHD 4OZHE 3QEQA 5CEYA 3CDYA 3TO2B 4PGBA 2WV3A 4QCIA 4R2GD 4U2ZA 2DM4A 3FQTA 2AK4D 4TULH 3ZKNC 4G9FD 4H8WL 2AGJL 3WLWC 5DGQA 3O3UN 4WU7B 2OR9L 4ZFZA 1RZJC 4WJ5A 2BHYA 1MPAH 4KGLA 5F70A 1W0WB 3RGHA 3ZLQC 3V5DA 5L2KD 4ZUWB 4YHYB 2EXWC 5FGSA 3L5HA 4GAGH 1BVZA 3MCLH 3AXLA 3F7VB 4PY8J 1HYSC 4QHKJ 4XAWH 4BQCA 4HUVB 2BVEA 3W0WB 4YC2C 2YOCA 4U05A 3VGHA 5HY9A 4XPAL 5DMGD 5CLWA 3C60B 1BEYL 4DN4H 3JUZA 1P4IL 4OFYA 4DK6A 2NX5E 1M6OB 3SCMD 4YFLF 5J13C 2DD8H 1JZ8A 1JPFA 2CQVA 3Q6GL 3WNLA 3MV01 1J1XH 4LHUA 2X4PB 4NKMA 1HOCB 1P4LA 2VDOH 3O3DA 4ALAH 5I15L 4XP1L 1J1OH 5C09B 4N0FB 2H8PA 3CUPB 4AH2B 4TQEH 3U6RA 5LXGL 3VCLB 3EZ8A 4KQ4H 4RSVA 3QB7C 1S8DB 3HC0B 2P8PB 5JW3H 5GGSA 5TE4L 2JE8A 1YMMD 2J88H 3KS0H 4MWFB 3V4PL 5E9DB 4PJ5D 3S34H 1P6AB 3O3EA 3VFPA 2EIDA 4NC0B 2EYSA 1NAKH 4X7EC 4Y4HD 1MH5A 4E5XA 4LSQH 1JTTA 1SEBB 2EO1A 2F53A 2VERN 3QXDA 4WWID 4I5BB 4WI8A 3KYOA 3FMGL 3DUSA 2FECI 4YNYA 1QFWL 5EB9A 4YDVA 3WNKA 5TF1L 1FH5L 1WIUA 3L5WA 2WBJB 2X40A 3H0TB 4HG4J 3A6OA 3NTCL 2DM2A 4S1DD 3BRFA 1BFOB 1GGBH 5I9QB 2YC1A 2O26U 3P0VL 1ZHKA 5EO9A 4L4JA 1HHHB 3NIGE 4RA0C 3QXAB 1I8IA 1JHLH 4FTVB 4MCYB 4U7SA 5IQ9B 2GITA 3TVMD 1EVTC 3EKCA 4F3FA 5CJBA 1HCVA 4C56A 1UEMA 2SEBB 2PCPB 4ODUA 5DS8B 3KPSE 3FO1A 3ZKQD 4YBLC 2GY7B 5E08L 3O11B 4NM4H 4UOJA 1FDLH 3JTSB 1JGUH 4KKBD 3IU3B 1MCQA 2P5EE 2DS4A 2LAAA 2NY2C 1PKQB 1A7RH 3D6GA 3RPIA 2VDPL 3Q5YA 4XCNA 5LGHH 4YBHA 1CFBA 4XCFL 4P2OA 5FA4A 5GISL 4EOWH 5I8OH 5B8CA 4X6CE 2HH0H 4J1UA 4KRPB 3HPLA 1V3KA 1I1FA 4R8WH 3IU4H 4XBPB 5JQHC 4H1LG 1IGJA 2BNRD 2VZSA 5I1JL 4NZUH 3NH7L 2VLRE 32C2A 1R3LA 4LVNC 3RI5F 1K9TA 4FXKB 2P4AB 3LEXA 1WBZA 2VQ1A 4NQCD 5I71C 5D2NE 4CMMB 4LLMA 4KJWC 4X4XB 2F5AL 4Z8FH 1YJDH 3V52L 5TQ2H 3IKCB 2IALB 1CK0L 4GW1B 2X42A 4HKXA 3OX8A 3MUGA 4JM2D 1A3RL 3LIZL 4PRNB 3V0WL 2CDFA 4J8RA 4G8IB 1XIWA 4M7KH 4BA8A 5AZEL 1OD9A 4RZCB 1QG3A 4K3DL 1JYXA 5A3IC 1YECH 2EE3A 3EOAB 4MJ6A 4M7JL 5GGVY 5B38A 2G5RA 2PXYC 5FO8A 1UXSA 4X6CF 3V6FB 1TQCB 2ADJA 1IQWH 3UZEA 4HPOL 1DANU 1MIML 4NZRL 4NQXA 4HXBL 4POUB 3GJEA 4ODSL 1RUKH 4R0LC 5CZXD 1NDGA 4U6VH 4JANA 1J1PH 2AGJH 2RIKA 4NNXA 4OLXH 2ZUQC 3ILPB 1X3DA 4HIIA 4LEXH 4OKDA 5EU6D 1QLFA 3VXTB 4FFYL 4JFQB 4KY1L 2XWJA 3KPMA 2YPVH 4D0DA 3T77A 2J12B 3QUZA 5EU3B 2X4NA 5EU7C 4PJCA 1KFAH 3DGCR 3KPRB 4WHTA 3BSZH 4X7SH 4YX2H 3L3KA 3QNXB 1BEYH 4KKBC 4C4KT 4I3GA 5CCKH 1MRCL 1OW0A 2Z93A 3KLDA 4H26A 4QWWC 4KKLC 2VLKE 4H0HB 4F9PA 1C08A 1A02N 3LQZA 4Z7UA 3SY0A 1NUDA 4ENEC 1JGDB 4AQOA 1NBZB 5IVOA 3U79A 4G7YH 1OL0A 3C8KA 1KEGL 4LVHB 5GZNC 1Q72L 4OCNC 4UOW0 43CAA 4UI2A 1SJVA 2ATKB 5IJVA 5ALCH 1A4KB 2YD2A 2W9DL 3AS3A 3BZ4A 4EDWL 4MYWB 1EXUB 4GBXA 3BPCB 2CLRB 4BSVB 1IC4L 2IPUK 3KXFD 3CVHH 3F12B 4Q2ZA 2YSSA 4I0PC 4XNMB 3L7FA 3FRPA 3V6OC 3QO1A 3MLYH 2IFFH 5AEAA 2NY5H 2CDEB 3PXHA 2ZWLT 3GKWH 4FZ8H 3KR3H 2Y7QB 4Y2DB 4UNUA 4KJQD 5IHUL 3O2WH 5EOCL 1NUFA 2RBLA 5JDJA 1ACYH 1GC1C 1XGPB 3M17A 1Z5LA 1MCWW 3CFDB 1EO8L 3D39D 4C54A 4PJ9A 1ZANH 4M93B 4TUOB 4JFDB 5ACLA 2VSDA 4X4ME 3E6FA 2XT1B 1WCBB 4DOHE 1BBDH 1DE4A 5JZ7D 4OGXL 2AEPH 1F90L 4QGYA 3BXNB 3R1GL 3BESR 1E28B 4NFDA 3EOTL 4PJ8C 1RD6A 2F8OA 4NYLB 4U1JA 5L8LB 5FHBH 2JB6A 3VFSA 5CGMA 4PJ7B 3VGGA 1BJ1J 3X11B 3FB5B 3FOLB 5A2LH 4YC2B 1FCGA 5IWLA 3ZTJH 1RIVL 3QZWG 3ARZA 4UBDC 2DQHL 5ITFA 1FVCB 1P4BH 1DQJB 3B3IA 5IT2H 3SDDD 3L3DA 3WIHL 4FABL 4M5YH 3CSBA 3MACL 4JKPL 1MUJA 5J13B 1I7TB 1W0YT 3DIFA 4XX1E 4TRPH 2UZYB 1KPVB 3CH8A 4WI6A 3V52H 2BY2A 4K7FB 3KYMA 5C0AE 4S11A 1GGUA 2WIMA 5HYFA 2PO6C 3D69A 5LBSH 3Q0HA 2AV7B 1PX3A 2ADGB 3EYOB 2NXYD 1INDH 1S7QA 2OJEA 5D1QB 5I1LB 3LS4L 2JK5A 1WAAA 1IEAB 3CVHA 5IW1A 1OAXH 4U0RC 5AYUH 3JWDH 1G7QA 1N59B 3OZ9H 1JRHH 5GS3A 3WXWL 3MFFB 3PQYA 5H8DA 4LPUA 3BQUA 4YHLH 5IF0B 5HDLA 1QFHA 4LPXA 4NQEE 3BP6B 3CZFB 3RIAK 3SGEH 1LO4L 1C7TA 5CD3B 5DJ6A 5D72L 4NUGL 4ZDHA 5F96H 1JNHB 2DQGH 3O6KL 1IMHC 4IMLB 4EUPB 2Z92A 3IJYA 1N4XL 2WZPD 3I3EA 1XF4A 4ZODA 1CD0A 3QCUH 1N26A 2AI0L 2ZCHL 1JRHI 4NRXA 4NSKA 5K9OA 3T0ED 1MREH 4OFVA 2QSCL 4LEOB 4BQ6A 4BSJA 1CDBA 2AVGA 4KDWA 2CK0H 3HZVA 4IOSD 3S4SB 1JF5A 5T3XE 2V5TA 2AXFB 4I77L 4WCYH 3SGEI 3LRHA 1G6RL 1HN1A 4TOYH 4L4VD 5AYQA 3TBWA 2RCSL 5DMIL 3BO8A 1T1WB 1DUZB 5CUSL 4P9MH 1KV3A 4H5SB 4ZUVA 4JFOB 5KJRL 5ECJE 3T2OA 3H9SB 4G8FB 4PJGE 1BD2B 1FNEA 2DMKA 2NY2B 5H35B 1KPRB 5J4MA 3O6FA 3BX7C 3IDIA 1A7OL 5C0RL 4S10A 5I16B 3IDJB 1UJ3A 3K8MA 1N2RA 2R69H 2NW3A 4W4OC 1TVHB 1FLTX 5C6TH 1Q72H 3X17A 2HP4A 1I85A 3SE4C 1AQDB 3J8F7 4XC3L 3EYVA 3I6GB 2A9ML 5T1DH 2X4TB 4HIJB 5DWUL 4RX4A 2XZQH 5J89A 5GS0C 3W39A 5I71B 5E24E 2WSKA 1V7MH 4HMDA 4L3EB 3IFPB 4QHMA 1QSVA 1ZT7B 5EZIL 5I8CB 1GYAA 4P57B 2QR0B 4FQ1L 1U8JA 4ZFFB 5GGQL 2E7BA 4PJGF 2VQUA 2AXJA 5BZWB 3EFDL 4ONGL 1NLDL 3LAFA 1MJJA 4NHCH 2IBZY 3MLWH 4RWYL 3V79C 2QQQA 2AK4E 2PXYB 5L2JA 3MLTA 4ZO9A 4APQD 1KCSH 4OM1L 4G9FE 5HI3D 1XCTA 4LSSL 3QPXL 4FXGA 3CX5K 4KVNL 4MB3A 4O51B 4UU9A 4R0LB 2XPGA 1N8ZB 1U6AL 5GSRA 3W9EA 1NJ9A 1AY1H 1I3GL 1YN6B 1VERA 3OJDA 2GI7A 2C3VB 3KNBB 4KROC 4LGPB 4YEEA 1SJXA 4N8PA 2XKSA 3FB6B 4EEEA 1OPGL 2P46B 4U0QB 3PGDA 1JHTB 2Y5TA 1KPUB 3OHXA 3FB7A 2GJJA 1IM3B 4U1NA 1AP2B 4PG2A 1MEXL 5I1IH 2VZTA 4JZOA 2VXTH 3BH9A 3HMWL 5EZLB 3QWRD 1ZHBB 4Q9BA 4P0DA 1RJZA 2DQHH 5KVDL 4N0RA 3MBEA 2RFXA 4RAHA 2Y36H 4L4TD 4Y89A 2ORBL 4EIGB 3G6JA 1II4E 5F3BA 2HTKD 2LU7A 2AJ3A 3LKNB 5IMMA 5LG1A 3DX8B 1YMME 2X4SB 3MXVH 5CILL 3IFNL 1K2DB 3ARDA 4PJ5E 2FWOA 2X05A 1GOFA 4XAKD 5L8KB 5JNYB 4AY0A 3LKPB 3GIVB 2N7AA 4N0YH 4LARL 4UTAH 3JWOL 3IVKB 4ACPA 3CFJA 3GZKA 5EIVA 1EMTL 1D9KA 1X5FA 5J6GB 1T22A 5GHWL 3B6SB 4JFFA 3HI5L 5MEPB 4XH2B 2OTWA 3ARSA 1G7HB 3VW3H 3X14B 3ILQD 4I0PB 4KTEL 2XRAH 2WP3T 2QQNH 3T3ME 2ZOKA 4WW2B 4WHDA 3S7GA 2HKFL 5DXWA 1JFQL 4MD4A 3GSRB 3BN9D 2B4CL 3QEHA 1N4XH 3VWJD 1DN2A 1PBYA 1QFOA 3D85D 3T4YA 5D1ZB 2NY1B 3VXRD 1K5NB 4JRXA 4XPTH 3MV9D 1RIHH 4HKBA 4G80B 3VXPA 3V6ZA 5E6IA 5AD0B 1E4WL 4FQQB 2NPLX 3DHMA 3P4NA 4XP5L 5CFHA 1FSKB 4PRPA 3ULVH 1AO7D 5HYQB 5C0CD 1MFDL 5E8DL 2QADD 1KIPB 1KG0A 5IGXL 1IKFH 4JO1L 5EUOB 4OFIA 4OI9A 3SO5A 3TT3L 5EIQA 1UFUA 4PJ8B 2H2SC 5I6XC 3QO0A 4MNHA 5LGJA 4PJDA 3S3SA 1HWHB 2GTWB 1RQ5A 1ITBB 4KZEH 2BNRE 4MQXC 5AAMA 1GHFL 3T3MF 5C6PB 4JDTH 3SGJC 4LLQB 4KMQA 3I85A 1HSAB 5D7KD 2GCYA 3RNKB 4XHJC 2X89A 4I8DA 5FK9B 1RK0B 4NQCE 4BH7A 2IAMB 3GMOB 3ZT6A 3UTSA 1OGTA 1MVFA 4DVBB 2W0FA 3HRPA 3C60D 3DROA 1ADQL 3SDAA 1UB6B 1H9VA 2DRUA 4G6AD 4M9OA 3O2VL 2PO6B 2A0LC 4LGRB 1T5XA 1QSFD 8FABB 2O5ZL 4PY8I 5F93C 3EFDH 3ZT5A 2CKBB 2IQ9H 4U0RB 4IOIA 4RWYH 1KCVL 2P1YA 2DQTH 1NEZA 4JN1L 1KIUA 4K3JH 5L7XL 3KJ6L 4JFXA 2MHAB 4MDJA 2CMRL 3CU7A 5FYKE 2XG4A 3UPCA 3L3IB 1CG9A 2VXQH 5EU6E 5ENWB 3K4AA 4LNVA 5MI0C 1UA6H 1J0KA 4V1DB 1V3JA 5JDSA 1FFOA 4RQQA 5F1NA 1X5JA 1D5BA 1PJ9A 4HLJA 1WIOA 5CSGA 3G08B 4JM2F 1OPGH 3VFOA 2WBJD 1LD9B 1RULL 4MSWA 4F9LA 5CKGA 3G5VA 4F7CB 2P7TB 3O0RL 1MEXH 4JREC 3FFCA 5L0QB 4RGOL 3RUGA 3FHQA 3D1MC 3FQWA 5BV7C 5IEKA 1ZLVK 4HJ0D 3EFFB 3FN9A 2MOVA 5F9JB 4FTVD 3DXAB 4P46C 3FO2A 1GL4B 4MAYA 4WWKC 5DMYA 5ICYA 5ESVA 1MF2H 1CE1H 4NQSA 2DYPD 2CO6B 3UTQB 4KZDL 1ZE3C 1B90A 2XKNB 3CFCH 4Y4FA 4YWGH 3MRPB 2AJUL 5CIPH 1R0AL 1XMWA 2YA0A 1DBKH 5GRVL 4PGDA 2XICA 4O9HH 3BW9B 2B1AL 1YY9D 5CJOH 1SYSB 2VITA 2XA8L 3MLSH 3QDMB 1FAIL 1MCWM 5DVKA 4OBSA 3ARBA 4MAUH 5DYOA 1FGNH 1WTLA 4G8GB 3KXFE 1T5WB 2NLJB 3VA2C 2VN4A 4TTDD 1BIHA 2XZAH 3I02B 2OL3B 1C5DA 3FRUB 3S5LB 3VH8B 1U3HC 3LV3B 3D9AH 2NY4C 1A7QL 1I7RB 3O45A 1LO0L 3TFKD 1KB9J 1T7YA 2B39A 3L3GB 4LASH 5DJZB 4JHWL 5KSBB 3KLAA 5D6DC 2DKUA 4JR9L 1ZGLP 1R24B 1AE6L 2MQ3A 4M61B 3BWAB 3TNNB 2B4CH 3QG6B 1C7SA 4P2QB 4YHPB 2VC2L 4UT6H 3Q6FA 4MGXA 2V2TB 4NP4L 5FUZL 1D5MA 1AIFA 3D39E 1BOGA 3CLFH 3FO0L 4XXCA 3MC0A 4WRLA 4TNWF 2ATPB 4FFVC 3PNWA 4M6AA 1VPOL 1W72B 2YPKA 1P7QD 4HKJB 3FB8A 3AVEA 3DSNA 4P4KA 1DDHA 3RFZC 1FG2B 4KROB 1G7MA 4YXKL 4ETQB 3RKPA 1EEUA 1BVKA 5FO9B 2QHRL 4HUWA 1ZLUK 3EUUA 1J87A 4LLDA 3B9AA 4QXTB 3MRCB 3LY6A 1S78D 1U58A 2MFNA 2X9WA 1DVFC 1QKZL 4KH2A 1I7ZA 1E6OL 4AEFA 3HNSL 3NACL 5EZOH 5BCAA 1X7QB 5BW7A 2DJSA 5F1SA 5CIPA 5FYLD 3WFBL 1UWEL 2C4XA 1ZS8B 3FTGB 4XTRD 5EH1A 2VL4A 3B9KD 1QPXA 5DEGB 1RHHB 5IHLB 3DECA 4NQDA 1KN4L 2VDKL 1NMBL 1YUHB 4TVPD 3RQ3A 5ILTH 2CJUL 2FHFA 4HIEA 3ELAT 1HE7A 5DJ0B 4N8VB 4LKXB 2FD6L 2I5YH 1RUPH 3FQRB 3DV4B 3GSXB 3QHFH 4F7TB 5SWZA 4J3VA 2R2HB 4X4ZA 3MLVL 2G5BB 1JPGA 1KJ2H 4OGAD 4UDUB 1EERB 1ZGLA 2BFVH 4E9LA 1MFAL 1GOHA 1KT2A 5F21B 4K8RD 1SJEB 4R7DB 3SOBH 4D8PA 4XNUL 5D1XC 3HMXA 2PW2A 1XGTA 1YNTB 3ES6A 3ISWA 1A0QL 1T7WA 4GXUM 3EOBA 4QXUL 3T0EE 1G7PA 4XB8A 5KTEH 2UVFA 4CU6A 4L4VE 4XCYA 3MV8A 4HBQA 1VGEH 1TTFA 3OR6A 2FSEA 2KZ1B 3GSWB 4KK6D 3GO1L 5FDWB 3BD5A 3PGFH 5HGDA 4KWUA 4U1KA 1SJHB 5D6CA 1JUFA 1HIMH 3MV7D 1MCOH 3RWGA 1K6QL 3QJHA 3IXTB 3MRJA 5E2UL 2ITDB 4XGZA 1VA9A 3UXFA 3QEUB 3OG4B 2ZUUA 2EYTA 3ZSSA 4GRLB 3ULUD 2X1XR 3VXUD 4FNLL 5I6XB 4EI5A 4HH9A 4U3CA 4K3EL 1E27A 4JO3H 4L3CB 5JHDD 1YQVH 5TDNB 4Y1AB 1BZ9B 1NMCC 35C8L 5T1LA 1ZEAH 3WBDA 2W0PA 1H3GA 5D7IB 1E4KA 4I48B 5INCB 4MJIA 3HUJE 2I60L 1JPTL 1PZ5B 2XY1A 3AY4A 3ULSB 4BUHA 4R6UA 1FNFA 4NDMA 5CZVL 4O5LH 1IGIL 4X5XA 4IM8A 3HE6C 2GFBA 4M00A 1KJ2A 4UDTA 1G84A 3QJFA 4X8JA 2O5XL 4HH8A 1IGTB 2EIZB 1EO5A 3O9WA 3TYFA 1JMZA 1LE9A 4P4RB 3W11D 3RY4A 5CINL 1OCWL 4WI7A 4EQ2A 5LWYL 2FJFA 2VDRL 4JPWH 2XWBB 4CDGC 2JCCB 4WI3A 1AFVL 1OP3H 3IJSA 4XPFH 5CEXB 3FCTA 3UTTB 4ZOBA 2IH3B 2WUBH 4NNPH 5HHQB 1OAYL 1NGPL 3IB4A 5MEQB 5GRJL 1LO2L 5J06A 3AU1B 3RVTC 4XP6L 4Q9QH 1T1YB 4K8RC 3HUJF 1GZPA 4M7LH 3DGGB 4HCRL 3I3BA 2DLIA 3VWKC 5I30L 5DC4B 1DFBL 4BJLA 3NFNB 4X4YB 1JZ2A 3BKML 3QEQD 1AJ7H 4K3HA 1CVSC 4PRDB 2D31A 5AWNH 4RWHA 3TT1H 2L7JA 4HS6B 2YD3A 4HLZG 2DLFH 3DX7A 1DLHA 3G9VA 2DMCA 3STLB 4JREB 5F89A 2IGFH 1I8KA 2HVJA 2A6IB 3QQ9C 5BV7B 1MFCH 1ND0B 4GUPB 2DI9A 4G5ZL 1FP5A 5E6ZA 1EDQA 4L4TE 2GAZA 4P46B 3FONB 1NAMH 1MY5A 1NCUA 1FZKB 1WK0A 4M8VA 4WWKB 3X3GH 3N9GL 1WWWX 3BP4A 4HWBL 1EA9C 43C9A 1DCLA 4DTGH 3MLPA 2F58H 2OK0L 1G1YA 3DTXA 4Y7MA 4YPGB 2GIYA 4NKOA 5JOEA 4E0RB 1TJHL 3R8BB 2C3HA 4Z7WA 5ETUB 1P2CA 4KUZH 3ZDZE 4L5FL 1MFEH 4Y4KC 2E3VA 4OLUL 3FZUC 4UQ3A 3LEYH 3CIQA 4Y19A 3MTRA 4KUCD 1YYLH 3GDBA 3PHQA 1T1ZB 1AHWC 4GQ9H 5E03A 4HEPG 2VWEE 1PLGH 1U3HB 4JQIL 4HJGA 5MENB 3SKOB 2NY4B 4A2LA 2AQ2A 4OF0A 1FC2D 3W11C 1U8IB 3RWFA 1A0QH 2Z8WC 4KHTL 4N9OB 1CDGA 3DVIA 1BLNA 5GJTH 3NPZB 3T4AB 3TO4D 3VXRE 1U3ZA 1MCRA 3J7HA 3MV9E 3T0AA 4N9GB 2A6DB 5D7LB 5E5RB 3SE8L 1M7DA 2WWKO 2G9HB 2MCPL 4PP2B 2X4OA 4JB9L 3UPRB 5SWSD 4U1SB 4M7LT 1QBLH 2QSTA 3VFUA 2F54D 4ZFOB 4IOFC 3MRHB 5IR1B 1AO7E 3L3OA 1VSCA 4BK5A 3MGOB 1DQQA 3K7UA 3VGEA 1HZHL 4KI1A 3ZDZF 2HLFD 3EO0A 3HZYA 4J4PC 2QKIA 2CRYA 4NRYB 2PR4H 5EO0B 5FYJD 3T2QA 4N1CA 3U0TB 3LDBC 3IS0X 4P3CH 2Y4SA 4JG0L 1R5WA 3PWPE 1VFAA 1TVDA 2VQTA 2ZOLA 4I4WB 3WL9A 5CEZD 5I17B 4U1IB 1YA5A 3HZKB 3TYGH 2JJTA 3WFDL 3KPQA 5D7KE 3QUYB 2BSRA 3DVFA 5DT1H 4FOMA 2Q86B 1NAMA 1ZWIB 3U30B 1NDMB 5IV2B 4WO4D 1DVFB 1CLZL 3RX5A 5HHNB 5TPWL 3A67L 4ELMB 1A4JB 3FT2B 5C07B 5CP3H 5H2BB 4NUJB 3QDHA 1NSNL 4K2UL 1G7LA 3MRFB 4JY4A 4K55A 3BD4A 2CLVA 4HK3N 4QRPA 3REWB 3TBYA 4OLWL 4ELKA 3LKRA 1AD0B 4YDLC 1QSZA 4HQQL 1QSFE 3OAZK 1X44A 5DEFA 4LK4A 4NPYA 2O5XH 3IAPA 3EGSB 3W82A 5JW4N 1YZZA 5IEHA 2R1YB 4DKFH 3N06B 5LQBL 3LQAL 1Q1JH 5I18L 1A6VL 2J8UB 1O7VA 1NGWB 2YUZA 5E2WH 1J5OH 1VACB 1GH7A 1N6VA 4RGNC 4NKIH 4YHNB 2UZIH 5DUML 5T3ZE 4N0CC 1B4RA 3CLEH 5FDYA 5F7WC 1MJ7L 1EUUA 1OAYH 1T66C 5DD1H 4GRWE 2Z31D 3HC4L 3NCBB 4XP6H 5GS1A 1SHMA 5ITBL 3DBXA 5B4MC 5D1XB 4LU5L 2VABA 5CBEA 4K94H 3STBA 4PUBH 2C1OB 4N0UB 4PJXE 3QIBA 4ZO8A 4ZFGL 1BFVH 5E99L 3GMRB 3RWHB 2HJKB 4S1SL 4BZ1H 4QRRB 4HPYH 1BVLB 1XZ0A 5K59E 4AIZB 5ID0B 3TCXA 4HMEA 2VDNH 1EBPA 2HT3C 1SM3L 4XVJL 4UINL 3HCVA 2J1KA 2PW1A 4OF6A 2ICWJ 2HVKA 5D1ZD 2NY1D 1L4IA 4MJ5A 1ZLSH 1MI5E 4X9IA 1RY7B 2DQJL 3N1MC 1F2XK 1VFOA 4XI5D 3TN0A 4GRWF 1MJUL 3EJYC 3F7YA 5ANMB 2WM0A 4KQ3L 5CP3A 3KPLA 1ZK9A 4L8BA 1RZJL 4KMLB 2MNUA 1EGJH 1VFBB 3N50A 5JIPA 3SJVD 3RWDA 4PJXF 4WEBL 1I1YA 3SKUD 1HK6A 1CD1B 1EJOL 3EDKA 3L1OL 3P4OB 1AXSA 4MQ7B 5K93A 4BFBD 4G7VH 5K59F 4P2OC 3ALWA 5T3XL 1JP5A 5B8CC 2P5EA 1S9KC 5IMOB 5I66A 3HE6B 3VXSD 4R7NB 2IAMD 4F2MA 1S5HB 3P30L 2BMKB 1OTSD 5DD6B 3JWNC 1B4JL 5IBLD 1CTNA 2ESVB 4Z7VE 2CPCA 4X6CA 3IF1B 4KK5D 5D5MA 4GBXD 4XMKL 4JB9H 4JO4H 5KSAA 1RZIB 3WIFB 2VLRA 1XGYL 2QL1A 3NPSC 1R5IB 1GZQA 3RX7A 5DK0A 1F02I 5DJ8A 2E6QA 4MNQD 4BH8A 3VGDA 4NHUB 4YHZH 2X10A 5GS2H 1XIWC 4NZTH 1KTLB 1XH3B 5HD8C 4RISL 4JN2B 3TJEH 5DLML 3VWKB 1WEJH 3OPZH 4URTB 5GGSY 3MBXL 5DD3L 4XPGH 4LCIL 5CHNA 3MX0A 2QV2A 3QCTH 1WZ1L 3BH8A 4P5MA 4QHLB 3T0XA 3K3QA 5DFVD 4TNVF 1VHPA 4V1DD 4JZNA 4Z7VF 4X7CC 1EFXB 5SV3A 5FYLE 4ZPVB 1T3FA 4RMWA 1VB9A 4IBLT 1XF5A 3HB3D 3D5OF 3NCFB 2D3VA 2B1HL 1FV1B 3UYRH 3HG1B 5GRYA 3HKFA 1X6NA 4YQXL 3UJJH 1A9EB 1HKLH 1X5XA 4MX7B 4PRBA 4TVPE 4UUJB 5IHBA 2FR4B 3LSOB 2CR3A 3MOBL 4WTXA 1I3RA 4MA7H 1EGJA 3QUZC 2H45A 2VL5B 2PTTB 4XT1C 2ZCKL 3D0LB 4LLWA 3BZDA 2Z91A 3PHOA 1GRWA 5AG8A 4LGSB 2P5WB 4HQQH 4R90H 4PGCA 2C4FT 3DO3A 1WFOA 1JMXA 3D2UB 1AKJB 4B50A 2WIIA 3VFWB 3QIUD 4CNIA 1MSPA 5I0DA 1JGVH 1KIQA 1G7IA 1K8DB 4RNRA 5IB2B 1F6AA 4QT5B 5IFHL 1OW0C 4Y4KB 2HT2C 4PB9H 4LVOC 3DX6A 5C0DA 2GJZA 5DUMH 5CZKA 4F9PC 2FIKA 4ZUSB 2NW2B 3ARFB 1Z9SA 5TQ0L 3NGBC 3P77A 3TPUA 5HYSB 1AHWB 3RP1A 3IDNB 1Z2KA 4XCEB 3DMMD 1A1OB 2RHEA 2VLKA 1AGFA 4M3KB 4S0SD 4FP8H 3PL6D 3JZ7A 4EBQL 3LOWA 2V5SA 1YJDC 4NQTA 2H6PB 3PQYD 3LPFA 1GGCL 1REIA 4YXHH 1UM4L 2W91A 3C9NB 3I75B 4LOUC 1JNLH 5E8NB 5JQ6H 2AK1L 1XR8B 5HBBA 1LP9B 4FQIL 3BP7B 4AEIL 1J12A 2VZ1A 3MV7E 4U1HA 5HHVL 3RKDD 3CFBA 5EC1B 2B5IC 4WW1B 1FL5A 1KTRL 3EZJB 4UAOB 2R2CA 4OD3L 1T2JA 2WWMD 3MOQA 1CFQA 1SEQH 3IDMA 3VXOB 3VXUE 5EULV 3T8XA 1SBSH 3IDGB 3HAEG 1QR1A 4ZXBA 5JHDE 4WUUD 3MNZB 1AXIB 1S9WA 3UAJC 4MXVE 4PGBB 4PD4J 3QHZH 3RVWD 3KLHC 2E9JA 4KQ3H 4PJ9C 3FQTB 1IAIM 4JFYA 2VTFA 1LNUA 3UC0L 4PJEA 4PJBE 1F45A 5D8JL 1NQBA 1D6EA 5K9JL 1T03L 1PG7H 1KGCD 4HS8H 4ZFZB 1MRDH 1EJOH 4WJ5B 5EC2B 3UBXI 3O6FD 3TZVB 1E6JL 3GB7A 3C5ZA 1DBJL 2MPAL 3RGVA 4GO6B 4NT6A 1ETZB 4CVWA 4YHIA 3NBNA 3RNQA 3AXLB 1LQSR 5I8KL 2I9LA 1HCFX 4YDLB 4J6RL 3M8OL 5GGTL 5HY9B 3BT2H 5BMFH 5JXAH 1OSPH 2ENSA 5IUSA 2X2YA 4OD1H 1BX2A 4ETYA 1DBBL 3OAUH 4XP4L 5BRZD 3OF6A 1A3LH 5F7DA 4XWGL 4LNRA 5FYKU 2HT4C 3VG0L 1JPFB 4MXVF 4B7LA 4RGNB 4LHUB 2FJHA 5EORH 5TE6L 1P4LB 3O3DB 4TUKL 2DBJA 4PJBF 2FBJH 2H8PB 3MUHL 2AW2A 2YBRA 1KC5H 3K0WA 3U6RB 3BDYL 1U41A 4J3WA 5GGSB 3OKEA 3RVXC 1NFDE 1FO0H 1GIGH 3QEQE 4OAWA 5J9PA 1RK1B 5CD5D 2BC4A 3O3EB 2R0KH 5L6YL 1FGVH 3VFPB 3WIIL 1BM3H 2EYSB 4MNGA 1JWMA 4E5XB 4LCUA 4LHUG 3HR6A 1D5IL 2J6EH 4GKZA 3BQUC 1A5FL 1CU4L 2F53B 2D7TH 2NY5C 3QXDB 4CW1A 1WZ1H 2AS5M 1KYOJ 1Q9OA 4I18A 3U1SL 3T2NH 2DTML 1D3CA 5E2TL 4Y16A 2HMID 3UBXA 4NN6B 2E8ZA 3L5WB 3BZFB 4I3SH 4OCLC 1GC1L 3A0OA 5JORA 5EBWA 2YC1B 3UEZA 5E1HB 4Y88A 3WFHA 4DWHA 1QLEL 3NMEA 2K1MA 1I1CA 1GSMA 1K4DA 1CE6B 5FGCB 2GITB 5CLTA 4F3FB 5J0BA 4C56B 4OZ4A 1L7IH 5FYKL 4FQCL 4ODUB 2YPLA 1OQXA 3FO1B 1DQLH 1NFDF 2BHUA 1H15B 2IBZX 4UT9H 3MRRB 2D03H 2H41A 3OKNB 4WUKL 3MXWL 2ZUXA 4QRQB 4HS3A 1Q0YH 1TZGL 5FKAA 4Y1AD 3O6FC 3CC5A 2OZ4H 4X7FC 1WIPA 1DUYA 3VFGH 3ZTNL 6FABL 1FPTL 3ZKXC 1UJ3C 4XCNB 2R0ZL 3VI3E 4Z77B 5FA4B 5B8CB 1G9MH 2EKSA 4ONHA 5HDQL 4HFWA 4PJGA 3D25A 3HPLB 1I1FB 3C5SA 4KKCC 1CXIA 5FGBA 1I85C 1C5CL 1QYGH 2P43B 3LD8B 4PRIA 2W92A 1R3LB 5SWSE 1LO3L 2F54E 4YIQB 4GJTB 1DTUA 1XF3A 2IF7A 3PHSA 2V17H 4FFWC 5GJSH 4LLMB 1H3TA 2HG5A 3QFJB 3MNVA 3GEWB 1R3IL 1FO0A 1EO7A 1U95B 1EVUA 2DLEA 3NPSB 3DV6A 5EBMA 1CQKA 3GMNA 4OIIH 5BQ7A 3JWDC 5FYJE 2CKBL 3D87B 3OX8B 1JWSA 3QUML 2CDFB 2J6EA 2Y5EA 4OLZH 4DCQB 1OB1B 1B2WL 1XIWB 1TJGL 4U6YA 4DZ8A 4PJIB 4JFZL 2ZPKL 3I84A 1A1NB 2BVTA 3M45A 5CEZE 5DJYA 2VXUH 1FE8L 1VEOA 4JRXD 3VI3F 4D94A 4M1GL 1INQB 1JNNH 2J4WH 3SQBA 1MRFH 2ADJB 5DQDH 1KCUH 4FQXC 3IFLH 5E6ID 1CF8H 3QI9A 2IADA 3SHSA 5BS0B 3JSSA 3T1FA 3U48A 1RUQH 4PJHB 1QO3A 3QQ3B 4NQXB 4OFPA 4HX1A 3GJEB 3QIWB 4POZD 4O2CA 4Y5XB 4JANB 2AK4A 3MROB 4NNXB 3DVNA 4O4YH 5D8JH 3MJ9L 4G9FA 4HIIB 2HRLA 2KPNA 1Q9KA 2WINA 3RL1A 1QLFB 3ARQA 2G75B 4D9QD 4YBQD 1MCEA 5B38G 4HULB 1RMFL 2OJZH 1UT9A 2VIRA 4D0DB 1F6LL 3QUZB 4PG2C 4MA3A 5L2KA 2D4FA 3QNZB 4LCCC 4PJCB 4RFOL 5IFAH 4TSBH 4P59H 1ZVSA 2W65A 5IVXA 4WHTB 2OZ4A 3ARGD 3UMTA 2LU4A 3L3KB 3TA3D 1T1XB 2XY2A 5F7MC 4XP4H 3MBEC 4YK4C 3F58H 2HTLD 3SCMA 1ZMYA 2BJMH 1C08B 3WMSA 2Z8SA 3LQZB 5CJQH 2AABH 1D5ZA 3NGBB 4UT7L 2YR3A 3C8KB 3ARDC 5HYEA 4DUXA 1F4WL 5HHOD 4KV5E 5GS0L 3SDYH 2FRGP 3HFML 5IJVB 2R1XA 5J6HA 1YMMA 1CDJA 3P0YL 3QDGD 3BZ4B 4PJ5A 1D9KC 4FA8A 5MEND 2R4RL 1I9JH 1A5FH 4Y4HA 3OWEA 3LKQB 5EWIH 2FEDD 4Q2ZB 1GGIL 3ZHDA 3UO1L 3E8UH 1FZJA 2IANB 2KZWA 3L7FB 2HWZH 5EU5B 3B2UD 1BBJA 3QO1B 4JFEA 2B5IB 1T89A 3V7MA 1HDMA 2DM3A 1L7TL 3T65A 3QEGL 3WUZA 3DETC 3O81A 3PABA 1KNOA 2VH5L 3AAZA 3LZFH 1N6QH 2D7QA 5EA0H 3OB8A 4RMTA 4JGMA 2YS4A 4X0KA 3AS2A 3FFCD 3G6AA 5E6IC 3V2AR 1J8KA 2J8OA 4KV5F 4IRJD 3SJVE 3TVMA 4PJ9B 3V9FA 3WHXB 3QRGL 2QQLL 3FRPG 4NO3A 3E6FB 5IMLB 3WO3B 4Z7UE 4FHBD 1LK2A 4NN5C 4U7KA 3DRTB 1YEIH 1FIEA 3QUYD 1W0VA 1HH9A 3RY5A 2K7QA 3VXSE 4U1JB 3HS0B 2GTZA 3INUL 5D7SL 4POYA 2JB6B 4WHCA 1G9NH 2R56L 4F7MB 1SY6L 3MRMB 4LSPH 2BXZA 4R97C 1QRND 1Z9OA 3NZHH 4MXQD 4GAFB 1NC2B 5ITFB 4F57H 5H94B 2BNRA 3L3DB 4ZAKB 4OQTL 1E4XH 2XTJB 5J1AB 3MRQA 4HUMB 1MUJB 4GMTH 1PYWB 1IGML 1CLYL 4OCWL 4MNQE 4NQCA 5C08B 4PYGA 3SDAC 5IBTH 4GG8A 3TBSA 4Z7UF 1MCDA 1HQRA 2ARJA 2VLJB 4ORZC 1S7QB 3DWTA 3OJ2C 4JM2A 2OJEB 1E4XI 2JK5B 1BMGA 5GPRA 4F58H 4WFHE 3S3PA 2BVUA 5IW1B 1UENA 2X4QA 1ZKAA 2AJYL 4FFZL 3BQUB 4XBGA 1CGSH 2NXZD 3SGDH 4G6FD 4LIQL 4KPHL 3U4BH 1S7XA 4NN7C 3RZCB 1T0NB 3SKJH 5T1KD 2VE6A 1DJSA 1NPUA 1CGYA 1DN0B 4XPHL 12E8L 4LLAA 1A14H 1TZHA 2ZSVA 3IJYB 3TNMA 4WNQA 1Y18B 4O2EA 4EI6B 5EU6A 3ULVC 3CH1B 4NSKB 5K9OB 1UACH 2HYMA 4FMKA 1IZKA 3GNMH 5IG7A 3SGDI 3F7PC 4KAQL 4F9LC 4IEFB 3HZVB 4JKKA 3QP3A 4C57C 1F58L 3SDXE 4YLQT 4KI5D 5M94B 5GRXG 1TJIL 2BXYA 4LSUL 5D7JC 3QPQD 3UTOA 3X3FL 3T0WA 3BO8B 5D2LA 1AGBA 4XBEL 1IQDA 3HR5A 4R26L 3A6CL 3SE9H 4MAYC 3MA9L 3V0VA 4YAQA 1CL7H 3LKSA 1FNEB 2H1PH 4Y4FC 5F9OL 4PV9A 5TJWK 1RU9H 2ICWI 4HGWA 4HHAA 2VSCA 2VR5A 3V5HA 3ZKXB 1UJ3B 2ZG2A 4ZSOB 2DQCL 2X1WL 1PDKA 1MELA 3MNWA 5AAWA 1GCFA 1VCAA 4G6JL 4PTUB 1FYTD 4DGVH 1U91A 3PQYE 1CFVH 3H2WA 3HFMH 3FAXA 1M7IA 3RIAF 3ARBC 3WLBA 1CL7I 2EZ0C 1CXHA 3GFUA 3U83A 1H8NA 3ZTJG 3SDXF 5L88L 4JLRA 4PJAA 2ESVD 5JR1L 1CZ8L 4HG4K 3D3VB 2YRPA 4WTZA 2X4RB 4QHMB 3CU1A 3KXFA 1UZ8A 3GJFH 2VDLL 1ZGLM 1NGQH 2BP3A 1QACA 3UJIL 1P1ZA 1OARL 2FB4L 4OCYL 1U93A 4WUUE 2CDGA 3WFCL 3U9UA 3RTQD 3RU8H 4QTIH 3MV8D 3QFDB 4XXCC 5L2JB 4M8QB 3VFTA 2ZJSL 3MYJA 4G42A 3U9PH 4FQXB 1XCTB 4EN3D 2R0WL 4MCZA 2NMSA 1IC7L 4FXGB 4XMLL 4UU9B 3RL2B 2XPGB 4MXWH 4QEGA 5GSRB 2H9GA 2DL9A 3Q3GA 3W9EB 2ICWA 3B2VH 5FHAH 1ONQB 4E42B 4OUUB 4P4KC 2QQKH 4JPKL 4OGZA 3O4LB 1I1AD 2DBLL 4P2CG 5I75B 5ACZB 4BELD 5T5FH 3C6LD 1MCLA 3PGDB 1I4FA 3V6BR 2Y5TB 3QDAA 4PLKD 4M6OL 5BV7L 3FB7B 2LTQC 1EHXA 2YD4A 4XWOD 5IESL 4LCCB 1UG9A 1NCBH 3PE9A 4JZOB 1SQ2N 4KI5C 5BRZE 4DZBA 1NH6A 3PJSA 1RJZB 5BW7C 2YD6A 5HHXH 3GSQB 1C8PA 4JFHD 2OP4L 1JF1A 3MBEB 1CWVA 3K46A 2RFXB 4YK4B 3SDDA 3O8XD 4QOKA 3RIFK 4OB5H 3SN6N 2ADFH 2PYEB 3G6JB 3QG7H 5F3BB 3MJ6A 1KJVA 2JLLA 5IMMB 1V7NL 3OXRA 2FWOB 3NZ8A 4K7PH 3VFNB 5K9QG 3JVGA 2NZ9D 3ARFD 5KZCD 3ARPA 3GUTB 5HDOA 2ZNXA 4DK3A 3GJFA 1RFDL 1KCRH 1D9KB 2WWKT 2AJYH 4FFZH 4C83B 4OLYL 3VRIA 4JFFB 1T6WA 3HE7D 2CRMA 3F6LA 3NAAH 3ARXA 3WS3A 5FM8A 2K3TA 2VXVH 1E0OB 2A38A 5JTWA 2ZOKB 4ZFOL 4TUJB 4M62L 2VDMH 3B83A 3HI6L 3WD5H 3QEHB 4CJ0A 4IRSB 4KJPC 3BHBA 1NEUA 4XRCA 5T3ZL 4I9WD 4ESKA 5C7XL 4F7PA 2UUDH 4I0KA 4I3RH 5GSVA 4E41B 3QDJB 3T0EA 2KL6A 3S8WA 1MCHA 3V6ZB 4Z7OE 4LQFH 4AQ1B 4L4VA 4PRPB 2D9QB 4JY5L 2BSSB 4UB0L 5BXFA 1EZVY 3V4UH 4IRZL 1KG0B 4FXLA 4NN5B 1ZHLA 5FCSH 4DFIA 4HXAH 5IHZB 1I9IL 5M95B 1H0DA 5T1MA 5C0GA 5E1AA 3QO0B 4EI5C 1V5JA 2GJ6D 4MNHB 5LGJB 4NGHH 4PJDB 4PLKC 2PNDA 1LE5B 3A6BH 1NCTA 3BPOC 5KSUB 4M5ZH 4HIXL 1OTUC 3TZVD 5JO5A 1YEGH 2GCYB 3CZJA 1C1EL 1E4KC 2FEEL 5D93C 4R97B 2XFXA 1K3ZA 2WUCH 1MHPH 3HNVH 4Y19D 4BH7B 1AGDA 3AY4C 4HUUB 3Q5TA 1YEFH 1MNUL 4L8DB 3UTSB 1OGTB 3MFGB 2AJXH 2E7LA 3G5XA 2W0FB 1CGTA 2R8SL 4Z7OF 3UJTL 1PY4A 3HUJA 4UIMB 3DROB 4YE4L 3O9WC 2H32H 3PWVA 4JRYB 4WFGD 4P9HH 4JVWA 4MDIB 1T5XB 1MCIA 2AEQL 4OCRH 3PWJA 4JRXE 3DX9A 1FC1A 4HLZH 1T20B 3CVIH 1NEZB 5JPNA 3VRJB 4CU8A 4APQA 1WVZA 1PG7W 3OMZA 1GAFL 4NN7B 2YD9A 3QULA 1JPSH 3GBML 1RZ7H 5GRVK 1HILB 5CBAA 2Y72A 3MRKA 1UB5A 2CIIA 4D9QE 3D0VA 5FCUH 4JHAL 5JDSB 4BKLB 1FFOB 4JPVL 4RQQB 3RPKA 1D5BB 3CXDL 1J05A 2DBLH 4G43B 1R3KB 2AXGA 5DDHB 1KENH 4L8SA 5EBLB 3O2DL 3U36A 3L3JA 4MSWB 2E7CA 3TV3H 3MRLA 4JKLA 3G5VB 4XVUC 5KS9B 1S9XA 5LCVL 3WSQH 2D0GA 1OAKL 4NM8H 4LLYB 1MCNA 2APVA 5D7JB 3RUGB 2Q76A 3FQWB 5IEKB 2IPKA 3FFDB 3QWRA 3T1WA 4JO2H 4B41A 4DQOH 2DDQL 2BY0A 5EDXA 4QRPD 2OP4H 3FO2B 4L9DA 4MAYB 4B5EA 4X6FA 5ICYB 4NQSB 5DJCA 3OG6B 3RWJA 2EC8A 4PJFA 4Y4FB 3KYKL 3GGWA 5HHOE 2E27L 4KDVA 1CICD 4L4TA 5TH2A 3P11H 4LBEA 1OP5K 1NCDL 3QWOA 3O3BA 1XR9A 3PWLA 4DKAA 4DW2L 3QDGE 4JAMA 1V3MA 1WC7A 2DQEL 5F7LB 1I8MA 4LCWD 4TVPL 4UV4H 5F88A 4ODXB 3V5KA 1EHLL 5DYOB 2VR4A 2H32A 5DVNA 1RFDH 3FQNA 1RVFL 2YA2A 2W60A 3EJZD 3X12A 4OLYH 5HJ3B 2HFGL 3RAJL 1GOGA 2DJ4A 1AXTL 1JL8A 3W9DB 2P24A 1B0RA 3KLAB 4P2RB 4NWUL 3DURA 2V5MA 3FFCE 3W81A 4K8RL 2YWYA 1IAMA 1D5MB 1AIFB 3ECBB 1BOGB 4TSCH 3S37X 3VWJA 5ISZB 4EXPX 1IM9D 2AJZA 3UZQA 3D85A 3KPNB 3VXRA 3BKCH 2BSTB 5F7KC 1FVEA 3BKJH 2V2WA 3PNWB 1X5IA 1MVUA 1IAKA 4JM4H 5A2JH 2YPKB 5ADOH 3NCJH 5F7YC 5HI4D 5C92A 1HHKB 1MCPL 4Z0XB 5IB3B 4L1HA 5FUCC 1AO7A 2WLZA 3PDOA 3FB8B 5C0CA 4P4KB 1DDHB 1YNKL 5BS0D 2UWEE 5TGBA 1YPZB 3K2UH 3QIWD 1BVKB 3IDYC 1ZLWH 3QQ4A 1FFQA 2JJTC 1F8TL 4NJAH 5DD0H 5FKPA 3S36X 4XCCH 4M1DL 1QRNE 2ZUYA 3BUYA 1U8PA 5AZ2H 4HIXH 3QA3A 1I7ZB 2EH7L 3EO9H 4OTXL 1BQLH 1W0WA 4RIRA 3S37L 5CIPB 2R23B 4HT1L 4ZUWA 1MNUH 1N7ML 4UIKH 1I7UA 4M6NL 2Q7NA 2APBA 3I50L 5I1CL 1FG9C 4WVRA 1CGXA 2KH2B 4HUKB 3WXVL 4ONFH 1PFCA 3C60A 1VADA 4ZTPL 4D9RD 3RVUC 5SWZB 3GI8L 4O58H 4OZFG 1EPFA 5E00B 2UWEF 4PR5B 4PRHD 1JPGB 3GSOA 5D96C 1A64A 3OGCB 5DRXB 1XF2A 5C09A 5IB4A 4OCSH 1NLBH 2I9TA 3MLZL 3VCLA 1KT2B 3ZSTA 4CN1A 1FIGL 3HC0A 4J3SA 1TFHA 4M02A 5GS1C 2W9EH 4J3UA 1A6UL 4GG6E 1NL0L 1UCBH 4G6ML 4XPBL 2PW2B 1XGTB 1INEL 3ES6B 1MJ8H 1RIUL 5C70A 3CXDH 3QIBC 4I5BA 4GLRH 1BREA 4XMPL 4KI5E 2IAND 5DHXB 3SE3A 4GSDL 4QNPE 3OR6B 2WBJA 2FSEB 1Z0MA 4PJXA 2FHCA 3MRDA 5I74C 2EIEA 5HGDB 4UTBL 4KK9D 4U1KB 2Q1EA 1UM6L 5D6CB 4X7DC 2FX7H 2BNQB 4NQDE 5E2VL 1A47A 2PKDA 5HI4C 3RWGB 3MRJB 4RGMC 4QF1A 2DDQH 5F1IA 4HZLB 1FL6A 3TN0C 4ODTH 4GLRI 4GQPH 2IH1B 2YN5A 5EN2B 1KLGB 4FTVA 4MCYA 4GFTB 5I1KH 5IQ9A 2EYTB 4R3SA 4DVRH 2VN7A 4ERSH 2ILLA 2XWTB 2PCPA 2DYPA 4TSAL 2PUQT 2XKUA 2DWDB 5E8OA 4EI5B 4GG6F 3O11A 3ZKMC 1FYTE 3TWCH 3JTSA 2DQUL 5EBGA 5FYLH 3BPOB 5T1LB 3CX5J 3BJ91 2V2XB 4MA8H 4MQSB 1FJ1B 2NY6C 3STZA 5D93B 1YNLH 4D3CH 1PKQA 1JWUA 3U7YL 4KI5F 4JCMA 5GGRA 1OTTC 4NZJA 4P23D 3MUZ1 1H8OA 3BAEH 5IM7B 2XN9D 2EH8H 4M1CD 3TGXA 3IAQA 1KJ2B 1NC2D 4UDTB 4CKVX