3QI9D

Crystal structure of mouse cd1d-alpha-phosphotidylinositol with mouse valpha14-vbeta6 2a3-d nkt tcr
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
239
structure length
239
Chain Sequence
b'GGIITQTPKFLIGQEGQKLTLKCQQNFNHDTMYWYRQDSGKGLRLIYYSYGAGSTEKGDLSEGYDASREKKSSFSLTVTSAQKNEMAVFLCASGSLLDVREVFFGKGTRLTVVEALKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antigen-presenting glycoprotein CD1d1
molecule tags Immune system
source organism Mus musculus
publication title A molecular basis for NKT cell recognition of CD1d-self-antigen
pubmed doi rcsb
total genus 49
structure length 239
sequence length 239
ec nomenclature
pdb deposition date 2011-01-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3qi9D01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3qi9D02
2EIZA 3D48R 3ZDYF 4IRSC 5B38A 1KELH 5HGHA 1UM6L 4KHXL 4NQSB 3S37H 3AAZB 3LKQA 4MJ6B 3BZDA 1JGEB 5IHZB 1WWAX 2AP2A 5C6TL 4BSVB 5E56A 3LV3B 3SHSA 2D7PA 3NFPA 1KEML 4ZFOA 1KB9J 3MQIA 2NNAA 1X5AA 2QADB 2BVUA 4U0RC 1CFNB 5ADOL 4JFFA 2R0WH 1QFWM 4NUJB 4QHKJ 1PSKL 2HH0H 4OZFB 3T4AA 1JPGA 4APQD 2UV3A 4JDTH 4RQQA 4YDIL 1U8JB 3FO0H 5I8CA 3IDJA 1BOGA 3WLWD 4XPTL 3MRIB 4LSQL 2OK0H 1ZGLA 5ALBL 4W81A 4WV1C 4RAUB 3CH1A 1JZ5A 4X4MA 1U58A 2D4DA 2A0LD 3I9GL 4D2NA 5KSBF 5D2LF 1FE8L 1QFWH 5JW5B 1NUFA 4R7NA 4HIJB 5AUMB 1A7RH 4XPHH 3VWJA 3A6BH 4NQXB 3U83A 1FH5H 5J7CC 3U4EA 4QOKD 3OR7A 3PXJA 3I50L 3WFZA 2YD9A 2J6EL 3IFOB 1XMWA 1OTTD 4OLVH 2NY0C 2NW2B 2UVFA 3KWWB 5E1HB 3SBWC 1LILA 5DSCA 3WSQL 1T6VN 3B2VL 4NBZB 1P84K 1L6ZA 5MENE 4JZOA 12E8L 4LCWE 1M7DA 2AW2A 2V7NB 4ZUWB 1F11A 4ETQA 3OKOA 3F62A 1ORQB 1BVZA 2YPVH 4DZ8A 1VFBB 1LO4L 1PJ9A 3AREA 5ID1B 1CT8B 5F7NC 3RIFK 2OR9L 2Z9TA 4HWEH 5C09E 3TH4T 3QG6A 4QRRB 4OF6A 2ARJB 2JCCB 1A7NH 3L5WA 5DK3A 5FYKL 3CC5B 5HHMB 3HCVB 4YXLH 1ES0B 3CFIC 5TDNA 3QDGB 1JTOA 4ODTL 4PGEB 1B0WA 3SDCC 4O4YL 1V3MA 2FCBA 5I15H 4N0CD 4LFHD 1KN2L 2A1WL 3G6JE 1FVEA 2GY7B 4H0HB 2ENYA 1DBKL 4L9DA 4UDUB 4PJCF 4HF5H 4B53A 4D0BA 1DSFH 4G8GE 3N1FC 1RUMH 2WK2A 1AGFA 2JB5H 3K8LA 5LVEA 1KTKE 4TOYH 4MXWL 1DVFB 1UG9A 3IFLL 1F2XK 3RVUD 1UM4H 1FORH 3CFEB 4TUOA 4LKCA 1INQB 1PVHA 3VXNA 3Q3GA 4OD2B 5EC2B 4F80A 3QWRA 3SDAB 3NTCL 5HHOB 3DNKA 1WIPA 2OJZL 4F7CB 3ARZA 2OCFD 2VLKD 5GSRB 4OJFH 2NXZC 1A5FL 3QQ3A 4RFEB 1Z6JT 2HVJA 2RAMA 1OGTB 3L3KA 1U8IB 2IBBA 3TFKC 2EYTA 4X7SH 2GT9A 5BZDB 5L2KE 1DANU 3JWOC 4LSPL 4U1KB 1F4XL 1KACB 1U2CA 2IAND 4ZTPL 2NY2B 1AQKH 3KYMB 5H8DA 4FQXC 3W9EA 3EJZD 3O6LL 3U30C 3SY0A 3IDMB 3OX8B 3U4AA 1J1OH 2HT3D 1BVKB 2VJXA 5C2BL 1FL6B 3O81A 1ZLUH 4M7JH 4YR6A 2EDRA 5C8JA 2QKIA 4FNLL 1KYOK 3VD7A 2V2TB 4PRDA 4YHIB 2B8OT 4E42B 4K3DH 2X6MA 2BVEA 4P4KA 4ALAH 1XT5A 3TVMD 1KB5L 4XC1L 5T3XD 2ZSVA 1NH6A 4DAGH 1P7HL 5JA9A 5CLWA 5J11C 4LRIA 4JFPA 3IVKB 2Z93B 4X99B 1H8OA 4ELMA 1I3GL 4MJIE 5C7XH 4ORGB 4ESKA 2YD4A 4Q6IC 2V2WA 1CLOH 5DC0A 5FKAA 3HI5L 2FO4A 4S1QL 5D7SL 2CUIA 1SVCP 3HAEB 4LKXA 5JR1L 2MHAA 2CLRA 1ETZB 3MLSH 1XF3A 1J87A 5F8QC 3DWTA 1DLHB 2GITA 3HS0A 5DA4A 4E0RA 5KW9H 4HUUB 1MLCB 2YBRB 3D39E 4E5XB 3QG7H 1NANH 1QRNE 4DUVA 3QXDB 1UGNA 4M48L 4L3ED 4PG9A 5TQ2H 3QUZA 4DZ8B 3CPLA 3GBNH 2F54B 3C60C 3BW9A 3EFDH 3QUXD 5FYLD 5I1KL 5EZJA 3H3BC 3Q2CA 2F74B 3LKSB 3O4LD 4NQDB 1T66D 4YE4L 1KF9B 1ZS8B 1FFOA 1I9JH 3UCRA 4NFBA 2NY2D 1TJIL 5C2BH 1MAKA 1Y0LB 1VERA 3GMQA 4S1SH 4MWFA 4P23C 2AXFB 4F2MA 3C2AL 3EFFA 2YPLB 1MLBB 5F7YC 2XWTB 1QSEA 1D6VL 1QRND 4WUKH 3LH2H 1QVOB 1MHEB 1EUUA 4EI6A 5K9QG 5FUCE 2JLLA 5DURB 1K8DA 2YD7A 4PB0H 3D3VD 1BGXL 5IW3A 1MRFL 1U8MB 4O2FB 2N7BA 4UILL 1FYTD 1MCEA 4HEME 4YDKH 5IV2A 4EOWH 2PR4L 1LEGA 1WT5A 4LARL 4RWYL 3N1QC 3QO0A 4Z5RA 2NY5C 1PW3A 3S6CA 1F6AA 1E27A 4JB9H 3MCKB 3FQTA 3GSNL 2FHBA 2Q76A 4U1GC 5IBLC 1E4KA 4PREA 1HWGB 2QV2A 5HYJD 1V3LA 4FQXB 2R29H 1C1EH 1X5ZA 3WFDL 4M7JL 2X4UA 3HKFA 1PZ5A 3B9KC 4R0LC 2Y06L 5GS1A 1FBIH 3QEUB 3FB8B 1MJJB 5KVGH 2H6PA 1NDGB 2NXZB 4EDXA 1XH3B 1AQDA 2OR7A 1T20B 1HKLH 4CJ0A 3FFCE 4XI5D 5T5NG 4LLYB 1BD2B 5E00B 3O0RL 5T1LA 3B6SB 4H1LH 5JXEC 2X4RA 1RVFL 2VLKE 3IDGB 4KKBC 4X5XB 5L88H 2R4SH 4FZEL 4OCXH 1MHHA 3BP7A 2F58H 5FKAB 3QAZB 4WNQA 5DK2B 3X14B 2CXGA 4ODXB 4PB9H 2E9IA 4JPVH 4K2UH 4MD4B 4Z7QE 1IT9L 3BZEA 5CKGA 4PJIE 1NCBH 2WP3O 3EYUH 2A6JB 1KEGH 3QFDA 1G0DA 2DQFA 3V8OA 4C56D 5D8JL 3W11D 2MOVA 2A74B 3JZ7A 2H1PL 3Q6FB 1BF2A 1GGYA 3O6FC 2GK0A 3MBXH 4JRXE 4Y19B 5HGAB 4IRSA 2GK2A 4JFZH 4N8VA 4ODHL 3SDCB 3MRCB 4P9MH 1XGQB 3MBEB 2YSSA 1T21B 1UWGL 5TQ2L 4U6YB 3NZ8A 4Z78A 4Y5XB 5CWSA 4O5LL 1LHZA 1PGRB 2P8LB 1ACYH 4JZJC 4TUJA 1D5IL 4P5TC 4K7PH 2Y36H 5BRZB 1SM3L 3IJSA 4ODWB 3QYCA 4PJFE 1LGVA 4GAYB 3NIDE 4JDVA 2ZG1A 4OM0L 4Z0XA 1J9CT 1T2QL 2ED7A 4X0KA 1IGFL 5JR1H 4FQXD 2NY1C 2MQ0A 5B3JF 2Y1VA 1MCQA 4MB3A 2WBJC 4OZIF 1YZZA 3U7YL 1WZ1L 4HS6B 2HP4A 1N2RA 3O6ML 3DECA 2XZAL 3BQUD 3CD4A 3BRFA 1G7MB 1FV1A 4RX4A 3O4OB 3ES6B 5E5UB 4LF3B 3WLWC 3MGOB 1FGNL 5C0FA 3BN9C 3ZZ1A 5MERA 3WHXB 2Y6SD 2LTQB 3WS3B 4MXQC 3ARFB 3IFNH 3CC5A 1CK0H 1YNTA 1DQJA 4YE4H 5DQDL 3ROOA 4BUHA 1NDMA 3QUKA 1MCHA 3MRRA 3F6IA 5EZOL 5ALCH 3V4PL 1T4KB 2IAMA 1ADQL 4DGVL 1UQSB 4LEOB 1F90L 1WEJL 2JJWA 2MQ3A 4BZ1L 1MHPL 1DVFD 3FQRB 2XA8H 5CEZL 1MVFA 1OTSC 3PGFH 5HYSB 1V5JA 4KQ4L 2CKBB 5IP4A 5I71B 3F7PC 2X89D 4HKBA 5DQJA 3SJVD 4LVHC 3OJDA 1NFIA 2VQ1B 4HKZB 1ZHNA 5L2KB 4OGYH 1PSKH 1RUPL 3WKML 5D96B 1JNNL 5EU7E 1DZBA 3G6JF 1FBIL 3L3JA 4QRQA 3T08A 5I73C 3KXFD 4HT1H 1FAIH 2IWGA 3UJJL 3RL1A 1ZHBB 3ETBF 3I75B 4DCQB 4XZUA 5EDXA 4FS0A 3FQWB 1AO7B 4QHUB 1JHTB 3DIFB 2PTVA 5DURD 5FCUH 5ILTL 3GRWH 1LK2A 4MJID 5E08L 4M5YL 1INDH 5T5NF 4F7MA 3ULUE 1DBKH 1UB5A 4X5XA 4ONHA 1JWUA 3LQAC 3CMOH 1FVDB 5LQBH 1U8NB 4Q2ZA 1BFTA 3OX8A 1LVEA 3C60D 3H9HB 1EAPB 3UTZB 3I02A 4PTUA 1OSZA 2Z35A 1YEKL 2HT4C 3GIZL 1OAYH 4RIRA 3O9WC 5C8JB 3RVXC 4K55A 4J2XA 1ZTXH 1JNHB 5IMKA 1VFAA 5IFHH 4IRJC 4UDTA 4QCIA 4Y7MA 3TNMA 4I3GA 2XY1A 3TBYB 4IRSB 1GAFH 2LFGA 5KVEH 1IAIL 4Z7VA 2YD1A 4YDLC 3TJEH 1T1WB 4LK4A 5JW4R 1G7JA 1Q0YL 5CZKA 5C0GA 1R0AL 4X99A 1GXEA 4MNQA 1JV5A 1WCQA 5CBAA 4CVXB 2W0KA 4PJCE 4EDWL 3MRQA 3BPLB 2DBLL 4L1DA 2F54E 2LU7A 5IBTL 5IEKB 1J0HA 1GOHA 2J6EA 5IVXB 1RIUH 1XF5A 3EO0B 1F3JB 2DKSA 1YEJH 2BDNL 2E9JA 4U7KA 3W0WB 1C5BL 5ACLA 1EUTA 4KRLB 2AK1H 4OAWA 1ORQA 1PLGH 1JPTH 1P7QD 1V05A 4G8FB 1AC6A 4Q6IA 5IIEA 5HY9A 1CTNA 2B5IB 4PJ9B 5FA3A 3TZVD 4PGDA 1TLKA 3QJHB 3RBSA 1A47A 1OQXA 3RI5K 1PX3A 2DKMA 3L5WB 3ZYIA 5C09A 5BVJA 1INEL 3MJ7A 3QPXH 1NC2D 2DF3A 1CF8L 3PL6A 4YBHA 2ICCA 5GRUL 4DFHA 5I19H 2VLRE 4JM4L 1NBVH 2EE9A 4MNQE 4JQVA 4N1CA 4ZPTB 3P11L 1NUDA 3TN0C 2VZTA 5DMKA 1Q9KA 2DQTL 4HCRH 1RIHL 1JZ7A 4NQCA 4XBEL 1IGYB 3NACL 1P84J 4LLAA 1P7KA 5KSVA 2WUBL 2VLLB 4NIKB 2H2PC 1PKQE 3MTRA 1IC7H 3DGGA 3LRHA 3KJ4B 4IEFB 3QZWA 4P23B 3W39A 3ULSA 3CFDA 3MZTA 5JMOC 1I9EA 3IDMA 3EYOB 1RZGB 3PP3H 1UKSA 4TVPL 2I07A 1NCWH 1A3LH 4JO2L 2IGFL 4MS8D 1QFWL 1HHIA 4KZEL 3ZE2F 2HJKB 1CLZL 1F02I 4KKCD 3ZMRA 4KK6C 4LU5H 4KK8C 3SPVB 3B3IB 3WMSA 5AYUH 1AY1L 4JRXD 4E41D 4ZUUA 3RIAF 1ADQH 2Q76B 4LSQH 5KS9F 1YDPB 3QXAB 3RNKB 4LVHB 3PG2A 2XI9A 4P46C 5D6DA 4Z7OF 1HQ4A 2H32B 1FNEB 4K94H 4ZS6C 2ADGB 3ZKMC 1YQ2A 1QNZH 1YEKH 4PTUB 1FL6A 4NQCE 4PLKC 1UM5H 1A7OH 2HRPH 2NNAB 3KG5A 4JFDD 1RUQL 4MJ2A 4NKOB 4XXDB 2NXYC 5INCB 2GSGA 4M7KL 1NAKH 5F9AC 3VFNB 2C1OA 3H9SD 2CQVA 2V6HA 1TCRA 1YYML 1ZWIA 3RIFF 4PY8I 3KPRE 4TSBL 2I24N 4KUZL 2F15A 5L0QB 5EA0H 3RUGA 3AS1A 5FYJL 2E8ZA 1HSBA 3WD5H 2YK1L 5FKPB 3OTTA 3OBAA 1M6OA 3P4NB 1TNMA 5HHPB 5FIEA 1QSVA 3GSNH 2MHAB 1VACB 4QRSB 4JKKA 4XAKD 2EH7H 2QQKL 4CNIA 1OAYL 4ODTH 5MEPA 1IC1A 5D7JC 4CN1A 2UWEF 3P9LB 3MR9A 1LO0L 3KWWA 5E70A 2F19H 2QHRL 1KJVA 2VQUA 3VFGH 5LWYL 3UC0H 4S1DD 4WTWA 2F54A 1AGCB 3OB0H 4HK0B 3GHBH 4KDWA 2EDBA 2HG5B 3MA9L 4P46B 1FO0B 3VFWA 4F33B 2DOCA 3ZKXC 2X4TB 2C7UB 2I60H 1XR8A 3T8XB 5DD0H 1IKNA 4R2GD 1G6RL 3D3VE 4KV5E 5EUOA 2VLJE 4QXTA 1A21A 4U1HB 2P24A 5HI3C 2NTFB 2DBJA 3SGKA 1G7HB 3VXQA 4HUWB 3PV6B 1JPST 4YH6A 5E6YA 4JANB 5SWSA 3WJJC 5CSZB 3C6LC 4NHCH 3U6RA 5FGCE 5DRZA 3TPUB 1OGAE 1OAKL 3K4ZA 2VOTA 2CLVA 1UQSA 4PRBB 3BHBB 2D7TL 3L3GB 3L3GA 1A4KA 4HV8B 4ERSH 4PJIA 2NY6B 5DJ6A 1LQSR 5JOPD 3TVMB 3SGDI 4O2CA 5C0BB 4ONFL 2I07B 5HYJB 2XPGB 1MFEL 3SE3C 1QLRA 2VLKB 3BUYA 3W0WD 1QLRB 2GY5A 2VLKA 5GS1B 5FOBB 3QEGL 5DJAA 3P77B 1M71B 2ESVE 2RR3A 3FAWA 4LEOA 4XNMB 4ZFGL 5IW6B 4HWNA 5EBWA 5INDA 8FABB 3WS6A 1TPXB 4QOKA 5FGRA 1J05A 3DX9B 4Z0BH 5EIIB 1OT1A 2NXYB 3NAAH 2C4XA 3QXAA 2BSRA 1PAMA 5T1DL 4QRTA 3I6GA 4GKNB 1JYXA 1W72A 5FM8A 1HQ4B 4HC1A 1EAJA 2HFFB 1T1XB 3OB0K 1HKFA 3SCMB 2CIKB 5J12B 2CIKA 4JRYA 1T22B 3MOBH 4RISL 2CIIB 1A1OA 4M7KH 1FFQA 3MFFB 5DT1L 5BO1H 1MRDH 4WTXA 1RUQH 5IJKC 4YR6B 3QFDB 1TJHL 4G7VL 3LZFL 4NC2B 5DJZB 4EBQH 5MP6L 4Z8FH 1T04A 5F88A 4WUUE 2CPCA 1TJGL 4K7PL 1K3ZA 1U8JA 1A9EA 3TNNB 2W1NA 3RP1A 1HOCB 4YHLH 2D7TH 2XOTA 3K0WA 2VDMH 3KPSA 3DVIA 4YIQA 2GJ6D 4JR9H 3E3QE 1JTTA 1JGVH 1NCTA 5J6HA 2DTMH 1NCDH 5LGJB 3MUHL 1F4WH 3FKUS 4JM2D 5KSBA 1O7VA 5E2TH 4GQPH 3RJQB 3MODL 4NQXA 3F58L 1HN1A 1HCVA 3MJ6A 1FNHA 3MYJB 5EOTB 1OAZH 3LEYH 4Y19A 4NWTL 4ZSOB 1R24A 1GOFA 2YPLE 4BH8A 4KQ3H 3ZLQC 1NL0H 4XCEB 5A2KH 2YUVA 3TT3L 4C4KO 3L3OB 3S3JA 4MLIA 4PRHB 3FOLA 3N1MC 4L3EB 4N0YH 1J1PH 4PY7A 2VLJD 2YXMA 3PWPB 4P3CH 5KS9E 2I60L 1GRWA 3RJDA 1CYGA 1T3FA 4ETQB 1AKJD 1F3DH 1WAAE 4NN6B 1E28B 3U2SA 4PJFA 4PRIA 1WTGT 3M45A 4JFQB 4U6TA 1BZ7A 3VFTA 5B4MC 2X41A 1NQBA 1SHMA 5ABDE 1B4JH 3QDGE 4LLWB 2MPAH 4MQ7B 2AEPH 4BH7B 2VKXA 1HYRC 1RK0B 1JYVA 3UXFA 2Y4SA 4Z7NE 4M02A 4HIEB 1NKOA 4YAQA 4H5SB 5KS9B 1WITA 3FCTA 3P40A 2B5IC 4PGZA 3RWHB 4PJGA 3DV4A 4D94A 3NFNB 1RZIA 2XWTA 5F7HA 5HBBA 3RBGA 3VD4A 2Y7QB 1IBGH 3K81A 1XR9A 5EN2B 4GRWH 1A02N 4OZHB 1MCPH 3KR3L 2EDKA 2QJDA 3ARDD 3O3DA 1YPZB 1MJ7L 3HPJA 4RAVB 3LN4A 1FN4B 3LB6C 1WJ3A 3RAJH 2ARWA 3PP4L 3UAJD 3ALXA 3MRNA 1YJDL 2JJSC 2VL5B 5I30H 1U8HA 3VI3E 1Q1JH 1BX2A 2PYEE 3SGEI 3QEGH 3BH8A 1VPOH 2D7QA 4LEXH 4KC3B 3FFCB 4UU9B 3ZSSA 5EO0B 5IBTH 1D9KD 3K80A 4Z7UB 5I8KL 5GSVA 1X5IA 4P2OA 4HPOH 1MWAA 4CMMB 3VMOA 4LPUA 2R9HD 2ZUSA 3VFOA 4FQHA 3JTTA 4I77H 3KPNA 3FT3B 3AC0A 1EJOL 3HR5B 4LPTA 2HFEA 5HDQH 4F7TA 5LBSH 3PNWA 5IHBA 4QT5A 5LCVH 3C2SA 5D1QB 1CXLA 3MREB 4CW1A 5D9SA 1XGUA 2I9LB 3E0GA 1BFVL 1EFXB 1NSNL 3TT1H 1CFVH 1AD9A 3QNZB 4ZMAT 4NM8L 4XZUB 4XNYL 1OT2A 1TQCB 1W0WA 5SWSE 5IMKB 2G75A 1NMBH 2DM3A 1GHFH 2VB5A 1S9YA 2W0FA 2RBLA 5HI4C 1AO7E 1A4JA 3X11B 1IQDA 4QGTA 5DVNA 3OR6A 1SJHA 4QHNB 3C6SA 4F37F 5IFJB 2PCPB 4LOUC 1J8HA 3GSVB 5EFIB 5JXED 1VFUA 2I9TA 4P5TB 1ZLUK 1C5CL 3ZTNH 4P5TA 2XKNB 3U7YH 5LGJA 1KIQA 4KWUA 3UTZA 4U6XB 2BSTA 3JV4A 2K7PA 5A16A 2Z92A 4ZXBA 4L9LC 3DTXB 5AG9A 2WANA 4V1DD 2W9EL 3SE4C 5D7IB 4FMFA 3WIIL 1ZA6B 5FYLH 3MACH 3F5WB 3SDYH 4K2UL 1BMGA 5GGRB 1FZMB 1R3IH 1EXUB 2ITDA 2BRRH 4LCWD 1CICB 1IZKA 2R23B 3DROB 3QCTL 5F7KC 1T1WA 4PV8B 1FYTA 3TH3T 4E5XA 3MRMB 2VNCA 2ED8A 2QQKH 3OXRB 3BX7C 2OMBA 3QZWG 2PO6B 3P9MB 5ISZB 2EDWA 1QA9A 1JWSB 4DAGL 32C2A 3TZVB 1CXEA 4P9ML 2IJ0C 5IVOA 1PQZA 1RJZA 5E9DD 5EZJB 2D31A 3OB8A 5EOCJ 4OTXH 4M93C 2R39A 4S1SL 1FFOB 2HTLD 2GUOA 5BOZG 3MLUH 1S7XB 4AQOA 1EX0A 4G6AD 3KPRA 5EZLB 1QFHA 1MREH 1BFOA 3NPSB 3VXOB 5B22A 4OI9A 3RWGA 1IBGL 3W0WE 3U7WL 4OGYL 3P30L 1KLFA 3TN0D 3SQBA 4QNPE 3HMXH 2DRUA 3U0WH 1AIFA 1Q9KB 5FO8B 2WBJB 3T3PE 2ZJSH 4OCYL 1EH9A 3REWA 1F4YL 3G5ZB 5CEZH 2NY1B 3HC3L 1EZVX 4DKEL 2EECA 3OJVC 4NQVB 3TWCL 2CUMA 4Y4KA 5D70L 3RZCD 4CVWA 5ESAA 1H0DA 1V7ML 1N5YH 1NGYB 5GGVY 3SDYL 1TETL 1ZT1B 4LLQB 4JZJB 5CKAA 4NDMB 1R5IA 3NN8A 4M4PA 1OPGL 4MDIA 1S9VB 2A9NL 1UJ3A 5D72L 2GJ6E 3IFNL 5DLML 3QP3A 1WFOA 1F6AB 4NSKA 1LE5A 2X05A 1KCSH 1QQDA 3GMNB 1MCOH 3NCEB 1H3PL 1AGDB 4WUUD 3X3FL 3JBG7 4OLVL 3LKQB 4FZ8H 1JPTL 1F3DJ 4HGKC 5CGYC 4GKNA 1LWRA 5DQJB 5DZOA 1PKQA 4WHYG 2A73A 2IAMC 4Z7NF 1U3HD 3OKMA 2PN5A 2Q3AA 3CDGA 3DYPA 4XP9L 1QP1A 5CHNA 3MLUL 4R4FH 3VW3L 1T1YA 4JM2A 5TE7L 5DJAB 5GZND 4PUBH 4PLOB 4OFDA 1AXSB 2X7LB 1CDGA 4QHUA 1IM9A 3SQOL 4RQQB 4LHUD 2ITCA 1LDPL 5F7FA 5L88L 1LEIB 2YXFA 4K71B 3MJGX 5ENWB 1R0AH 4ODSL 2VZ1A 2WWKT 1J5OH 3P73B 1EVUA 4ZFFB 4M03A 4MA7H 2Q86A 4WNQB 3T04D 4U7MA 3UTTA 3ULVH 3L95A 1SEQL 5HDLA 3MBXL 4EEEA 1OSZB 4NYLB 2UWEE 3WNKA 4LBEA 4L3CA 43CAA 3VWJB 4Q9QL 2ID5A 2VSDA 1X5HA 5F93C 3O4LE 2FL5B 4TQEH 5DC4B 3EYFB 4L4VA 4TVPD 1W0YT 2V9TA 2VWEC 2BHYA 4BZ2H 1P6AB 1KJVB 2FRGP 4BKLB 1DCLA 2ERJC 5DUBA 5D1ZA 3VXSD 4NO2B 5KBNC 1XZ0A 3L3OA 4PRHA 5I1CL 1M6OB 5GS2D 1O7SA 2IADA 2O26U 5ERWA 1AGEB 4YHPA 5C0EA 4WCYL 4PV9A 5J4MA 4LSDA 4PJGF 1WWCA 3M8OH 1OLZA 1WFTA 1WZ1H 2DN7A 4I2XE 4MQSB 2HKHH 3ARDA 4FXKA 3CXDL 3SE3A 1QEWB 4S1QH 1CGUA 2DJ4A 2FD6H 3BWUC 4LARH 1I8KA 3C09B 4W6YB 2I5YL 5D1XB 4WFFE 3PWPD 3GSWB 2AXFA 3H8NA 2DWDB 4FXGA 1RJLA 2MPAL 2V9QA 1LO4H 4KUCF 1F11B 2FECI 3U2SB 4UOW0 4G8FA 3HI6H 3NABL 3KNBB 3OHXA 1MF2L 1V8HA 3CDYA 1MCCA 3O2VH 3BP5A 1WIUA 4CRPA 3Q6GH 2R56L 1VEOA 5CMAA 5E4IA 5K9KB 3R06A 4NBXB 4AH2A 1DR9A 1NC2B 3KPQB 2PTTA 5D7JD 4F7EA 3OAYH 4H20L 1A22B 4POUB 4ZUTB 2YN5A 3G5YB 4KKAC 1QG3A 2G5RA 3MNZA 5JOPE 5IUSA 2Q20A 4DEPC 4H8WH 3PV6A 4NRYA 1NBYA 3E2HC 1YN6B 4K8RC 4YNYA 1JYWA 2MSPA 2Z31D 2JJSA 3D6GA 4PLJC 5EBMA 1HH9B 2EIZB 4P2RA 1HH9A 4AMKL 1A3RH 5AYUL 3FO2A 4FZEH 4OCXL 3WFBL 3O6KL 3RWJB 4BQ6A 1CXKA 3BKMH 1GCFA 5E99H 1P7KB 5KSVB 4NN7C 3UTPD 1DQQA 4TNVK 4ZUVA 1VPOL 4OFYD 5JOFB 2AEQL 3GSQB 3MLSL 4OCSH 3SDAA 3QG7L 4J3UA 4YFLF 4JQXA 4R4ND 3JXAA 1HXMA 2G9HB 4LCUA 2QQLL 2NX5E 1CQKA 3L9RB 3ZKMD 3S36H 5J11B 3NA4A 1RZ7H 4S2SA 1VSCA 5DJZA 3I75A 2DYPB 2XNAA 2ZNXA 5HGHB 4G43B 4U1NB 3B3IA 4Y1AD 35C8L 1S5IH 4ZUSB 4FA8A 2Y5TB 2FWOA 1AHWB 4XH2A 5ENWA 5IJKA 5D7IF 3WHE1 1IEBB 5LWYH 1XGTB 3BP4A 3AU1B 3E8UL 3H9HA 3BDYL 3QUMA 4UOW1 1KB5H 2A83A 4JY5L 3CJJA 5F7DA 5FA4A 3SKMA 4HJGB 1A6TB 1QFUH 3RGVA 4LBEB 1XAUA 1B88A 4PRDB 3S35H 2VSCA 4PRPB 5BV7H 4CL7A 3WIHL 4GJTB 3THMH 1FAIL 5DD3H 1A6WL 2NR6D 1HHHA 4LP5A 3VG0L 1QFPA 5D1ZB 1FJ1B 3FQXB 5IB1B 2E7CA 2AVGA 2YBRA 1HILA 1UB6A 4EN3B 1DANT 3ZHKA 3HE7A 5DMJB 2Z31B 3BKYH 3B9KD 2VLJB 2V2WB 4WI2A 5JW4M 4KMQA 3IGAB 1B3JA 5ACZB 4PPTA 1EFQA 4OLYH 5LAXA 4PD4J 4Y4KD 2Q6WA 3RZCA 4LPYA 2EDOA 5D1XA 2O93L 4RWHA 5CJBA 1NAML 4DW2H 4JN2B 1I9RL 3KXFE 1Y0LA 4JN1H 3C6LA 2KL6A 3MRMA 5DMGC 5I2IA 4NM4H 1NBZA 5D8JH 5C0AD 4PJGB 1CDYA 1Z9OA 4MAUH 3EYUL 1VFBA 4X98A 1U3JA 4UQ2B 1KELL 4WW2B 1H3VA 4P5KA 4G6KH 4P59H 3WNOA 3WBDA 4XMPL 5GJTH 1FC1A 5E9DA 1YEFL 1P5UA 4JFDA 1SVZA 4UQ3A 1BHGA 4KJQC 3SKNB 4J3OC 1JGUH 3L1OH 2P1YA 2VAJA 5EBLA 5IEHA 4WWID 3ZKXB 1NDMB 3QUKB 4WV1A 2QLVB 5KSAC 1GZQA 1FZKA 3J7HA 4MZ2A 3LVEA 4MQXC 1XCQA 2H9GA 5D71H 2FBJH 3IS0X 1IC7L 3BZ4A 5FCUL 3C5ZD 2AJSL 3VXMB 3QJFB 4X6DE 4XWOC 2L4OA 1DL7L 1EO7A 3LMJL 3W2DL 2DWEA 2VQ1A 3CH8A 1AHWC 3W9EB 3WDHA 3W82A 1YMME 3BP6B 3RVWD 3EYOA 1GHFL 1RZGA 2HLFC 4POZD 5DS8B 3D0VA 2VIRB 3P0GB 5FECB 1BQLH 5J13B 1NFDA 5DJ2A 4LASL 1T0MA 3DRTA 4NO0A 3RL1B 2FJFB 3DRTB 1A7PL 1JPSH 4L8CA 4HS3B 1QHOA 2CDGA 1OOAA 1JF6A 4P4KB 2AQ2A 5I18H 1ZLSL 2PW2A 1SYVB 3PWLB 4U0RB 2GKIA 2OLDA 1XCTA 3C9NB 1MRCH 3VA6A 3VFPA 3EAKA 1P1ZB 3ZHDA 3TEUA 3V7MA 3TIDB 1D3CA 3CGTA 5ID0A 1YEJL 3BP7B 4RGNB 3T4YB 2LE9A 4KK5C 4Y89A 3WFHA 1W0WB 1UFUA 1OAZL 3LEYL 1CFNA 5EU6A 5FYJE 3C5SB 3RAJL 3VFNA 4DOHB 2AGJL 4XVJL 2AERT 3EGSA 4NC0B 2E6QA 2YPKB 5D6CB 4L4VB 4AENB 3GIVB 2NZ9D 4YHYB 2PCPA 1B90A 3CZFA 4PJDA 5IB3B 1DJSA 3ARGB 3VDCA 4QF1A 1JWSA 3FB6A 5KTEL 5IROC 5LXGH 1I85C 3P9WB 5C0AE 2H2SD 3UTTB 1OL0A 3TBVB 4U6HB 1VACA 4KRMB 2W91A 3SKJL 3OGOE 5DUML 1UEMA 3MV8A 3UC0L 3O8XA 2HRPL 5DD5L 3RPKA 4EZMA 3H9YA 3STBA 4HWBH 4XP6H 4ZO7A 5HI5C 4WI5A 2XQBL 3TFKD 4XCNA 4NNXB 5DR5H 5MHSD 3TN0B 2VTFA 5I16A 1AGBA 1PZUB 4HDIB 1HI6B 1SJVA 1G6VK 4KUZH 2VXVL 4Z6AT 1N5YL 1NCAL 2N1KA 1NMCB 4K9EC 1MCBA 2IH3B 1M7IA 2C1PB 4I0PA 4P5MA 4ELME 4F58L 3HHRB 3MXWL 1BZ9B 4P4KC 2YHGA 5CAYB 1IGCL 3GMOB 3HTLX 3GO1L 4YXKL 4D9RE 2BOBA 4GAGH 4M1GH 2BOBB 3R1GL 5JQ6L 1YJDH 4K3EL 3QIWD 1LDSA 5GGSB 3RL2A 4ZO9A 5AWNH 3PXHA 4V2BA 3JWDH 1NBYB 4CU8A 4GBXB 1OWWA 4M6NL 5A40E 4PYHA 3HZVA 1FSKC 3D85A 4NQCB 1K8DB 3D69A 5DVKA 2Y9RT 1HNGA 3I9GH 3CK0H 1RUAL 4PRBA 2QSTA 4GQ9L 4WJ5B 4HIHA 4U2YA 3HG1B 4EIGB 3KYAA 4Y1AE 4XHJC 3H2WA 2ZCKL 4KVCH 4WFGE 1NGYA 3ISWA 5KVDH 4K3JH 1FFNB 1Q72H 4FQXA 4NN5C 3SKOA 5JW4N 3PL6C 5HVFB 5L2KA 4PJ7B 4PJ7A 3MRNB 2VL5A 4YX2L 1DE4A 3PWUB 3CDFA 2UUDK 3QEUA 1PG7L 2QR0B 4UU9A 5TGBA 2ATKB 3WD5L 2VXTH 3IJHB 3NTCH 2XKUA 5BS0A 2XTJE 3ZE0F 2HT2C 4P9HC 4XXCA 3M1BB 3IDNB 1GZPA 5D96C 1FPTL 4OI8A 3P11H 4RGNE 4CN4A 4YEEA 4P4RB 2PYFA 3VXUB 1T83C 4JY4A 5ID0B 1AE6H 4NOFA 5BXFB 2C3VB 4BSJA 3IAGC 4Q97A 2XZCH 3D39D 5D70H 3FB7B 4RIRB 1AJ7L 4G6JH 3GM0A 2A74A 2AJXH 1C8PA 4J4PA 3DHJA 1FNGB 1U92A 1A6VH 3QI9D 5D5MF 1FGVL 2ESVB 2QEJA 5IBLD 1ONQA 1IEAB 2G5BB 1OQOA 1NCDL 1TNNA 2CUHA 3QIWB 1GSMA 4OCMC 4EI5B 1J8HD 1A7BA 1HSBB 5JXEA 1RUAH 4GQ9H 2Q86B 3TCXA 4UTBL 4HH8A 5KSAD 3OL2A 4Z77A 1MJUL 1N6QL 2ICWJ 1KIUA 2BSTB 4BFGA 1C16A 4JVWA 4JJHA 5DI8B 2CXKA 5T3XE 3B2UD 3JV0A 2SEBA 2YC1A 5FEBA 2R2HA 1MCSA 3WO4B 5DSCB 3TIEA 4X4YB 1I8KB 4L8SC 3ZDZF 3EO9L 1RIVL 4JHBA 2X9XA 1PEWA 1TZGH 4HUUA 3Q6GL 1EVTC 5EG6C 4Y5XA 1NPUA 5EBGA 4PRNA 1FYTB 4NKIL 2IADB 3QB7C 1A6PA 5KVFL 4L29B 1KGCE 1KB5A 4M93B 3TZVA 4RRPG 2NW3B 3OJMB 3PWNA 2PXYA 4FABL 2FZ3B 4GG8B 4WI8A 1RUKH 1U9KA 4J3SA 5B39B 4EJ1C 1VESA 2IG2L 3ARFD 5IROA 2BCKB 1C08A 3T65A 1UH4A 1V7NH 3V6BR 2B0SL 2D03H 3CVIL 4H5SA 1A1MA 2DI8A 4HS6A 3E8UH 3ROOB 4R2GC 5GGSA 3RL2B 4EQ3A 3QFJD 4N8VG 1N4XL 4PTTB 5E0QA 1AKJB 1TIUA 4L3EE 3BAEH 3ARBC 3PQYA 2EKSB 4JFEA 3U7WH 4JFEB 3RKDC 3TO4D 2WBJA 5IMMB 3DVGB 3QI9B 1I8LA 2E9BA 4WDIA 1FYHB 5IKCB 1KPVB 1S9WB 2AXGA 1BVLB 4Y4HC 4UAOC 3HR6A 2MJWA 2WUCH 3BMWA 4AEFA 2OM5A 3BGFC 1TTFA 3K8KA 2ZUQB 2YS4A 2GQHA 2XTJB 3GBMH 4IRZL 4ONGH 4UIMA 3M17B 4F7CA 4JZJA 4HT1L 1ULVA 3MLWH 4JDZB 1MRFH 5DQ9A 3E6HB 2A77L 1DQTA 4B5EA 4PJ9C 4IJ3C 2HWZH 2XWJA 1H3WM 3VXMA 3BSZL 1LE5B 1LDPH 4ELKA 3IXAA 4UI2A 1YN7B 2HRLA 3KPMB 4DN3L 2FLBT 1I1AB 4KTDL 3T0EC 4P4RA 1LO2H 1VGEH 4KY1H 1I9IL 1TFHA 3WN5C 1MEXH 2MQCA 3ARSA 3HRZB 4OUUB 1MFNA 3C8KB 1OAKH 2HT3C 3RX5A 3KVQA 3MREA 4CW1B 4MB4A 3A6CL 4XBPB 1YY8A 2XZQH 1ITCA 1JL8A 3LEVL 5DVLA 5DJ2B 3O3BB 4XAWL 1KCRH 5D1XC 1MJJA 4N5UA 2P47B 3FTGB 4QRPA 5J3HD 1IQDB 5T3ZL 2X42A 1R6VA 3OAUH 2QBWA 2R0LL 5I1IL 3B8YA 1NGQL 1U8QA 3FT4B 1OP5K 1IEHA 4JLRA 4M1CC 4M9OA 4M5YH 1KIQB 4NZDA 1X3DA 3KDMB 4D3CH 4ZO8A 3DVFA 4HJJH 2WBKA 1R3IL 1IZJA 1S8DB 4F8TA 5KG9B 4YDVB 2Y07H 4NRZA 3UPCA 3X12A 4UTAH 2NY6C 4OKVA 3BD3A 4L3CB 3VH8G 4AL8L 1AR2A 3MLXH 1FRGL 4GAFB 2QSCL 5GS0H 5INCA 4AEIL 3Q6FA 3MV7D 3S9DB 2VWEE 3BI9X 5HTSA 7FABL 3WN5B 1I8MA 4UB0H 5DDHA 1MNUL 4WRLA 4Y2DB 3V7AG 5HHNA 5AEAA 3H7BA 2V17H 1DQDH 2V5RA 4H0IA 3SKJH 5ISZA 4QY8B 3QIUD 1N0LA 4ZAKC 3VWKC 4HUNB 4X80L 3VD3A 5AG8A 3UBXG 1RSFA 4JFZL 4ODHH 4ZDHA 4RDQF 5I18L 2ICEB 4FMKA 3HI1B 5K93A 4AMKH 3KYOA 4IRSD 4CMHC 1KCRL 3RGHA 2ARJQ 3MJ7B 4ZOAA 2VDOH 2EYSA 4KKLC 1F4WL 3G5XA 3EHBD 4MNHA 2RCSH 5C09D 1OP3K 1J8KA 3BESR 1E6OH 4XPBL 3SDXF 4MWFB 3STLB 3DO3A 5JUEL 4JFEE 5E5MB 5A2LH 5KAQF 2NTFA 1L9MA 4OCSL 2EIDA 4Q9BA 4OF0A 2DMBA 4JPKH 4Y88A 2EKSA 3W2DH 1XGPB 1IAII 4PIRF 3GMLB 5I1DA 4HPYH 3BPOB 3HZVB 1R5WA 4YFLI 4WDIB 1RZKL 2XYCA 4MMXC 3RWDA 3VGEA 5EU3B 1TJHH 5D7JB 4Y5VB 5D7JA 1KT2B 2VDRL 3ESUF 4IOFD 2EIEA 3O8XC 5D5MB 2F53E 2F8OA 1D5ZA 5JTWA 2IG2H 2PKDA 1MPAL 1FFNA 2DLEA 3BP6A 5FFLA 1R3KB 4LGPB 5J13C 1JFQH 5EWIH 1UXSA 1B4JL 3UP1A 3RHWK 4R97C 1YECL 1DEEA 2I25N 1S78C 4R7DB 4PJ9D 5F89B 3LRGA 5CSZA 1G7IB 4K23L 4MNGB 3BDYH 1G7IA 4MNGA 4R96B 3D85B 4N9GA 1C5CH 2GT9B 3RFZC 2QSVA 3QXWA 4HQQH 3CSYB 3HG1A 3FQTB 2EEDA 2NLJA 4R90H 3RWIB 5ANMB 2P7TB 5AZ2L 1T2JA 2PUQT 3QT2A 4NC1E 5MEQB 4OFYA 2AJUL 3LS5L 5I9QC 3CFCH 3C9NA 5TDOA 1JGEA 5IHZA 1PKQB 5HHXH 3OAZH 4Y8DC 5H94A 1NFIB 2XV6B 1P4IL 4NZRL 1N6UA 4PRID 3ULVD 4KAQL 1MFBL 5HSFA 3H3PL 3EYSH 3TIDA 3DI2B 1NGPL 5GHWH 5ICYB 2RIKA 5KSAB 1H8NA 5BXFA 3UAJC 1JHKH 2MMXA 1DP0A 1EO8H 4YUEL 4PGCA 4ODUB 3WKMH 1G7LB 2BNQA 1T20A 4K7PX 5A2JH 1XH3A 1NBQA 4POZC 2VAAB 3HE7C 2COQA 2VN4A 3LQMA 5C0CE 4G6MH 5D4QA 4WUUB 5DD1L 5CZXD 4AG4L 4JHZA 1J5OL 2ZUTA 2ATPB 2O5XH 4HPOL 3LKRA 4EBQL 2D9CA 4U7SA 1KBGH 2A9ML 1JMZA 2IFGA 1J1XL 2OBGA 4OGXH 1LNUB 2OQJB 1MREL 3DX7A 4WGVB 4X6EA 3RZCC 3KHOA 1BJ8A 4PJEE 2BFVL 5ESQA 5EOTA 2Y06H 1K6QH 1NCAH 2BC4B 1BFSA 3S97C 2P5EA 4X80H 1IC5H 3TPKA 1LD9B 4Z7VB 1Q9LB 2VXUL 3PWJB 4P99A 3HE6A 1A2YA 4CMHB 5C0GB 3QFJE 3CVHB 2R1WB 3C5ZA 4WHTA 3MCG1 4OF8A 3L5IA 5K59F 2AV7A 3VMPA 1GPOL 3TGXA 1Q0YH 2P8MA 4JJ5A 3ZKNC 4G8IB 2A9NH 3PABB 3T0AA 5E6IA 1VEPA 5DMIL 5BJTB 4HDIA 1RUKL 3FQNB 2F53D 4XBGB 1KGCD 2NX5D 5JZ7C 1G7MA 3EZ8A 5HI3D 1UT9A 2Y5EA 1I7TB 4FZ8L 4PP1C 4OZIE 4MVBC 1EGJA 2FZ3A 1RZFL 2XRAH 3VFVA 3ARBA 4JREB 5EU3A 5LQBL 4HIIB 2FJHA 2X9YA 3BDXA 4BH7A 1UWXK 1FZJB 2B7DT 4OD1L 1EEYB 1WBXA 1CFVL 2J5LC 4I48B 3IFPB 4BM7A 1CL7I 1CE6B 4JKWA 3VXRE 2AV1A 1RJCA 1YNTB 3I50H 5KOMC 5JNYA 2AJZB 4EXKA 3Q5TA 5SWSB 3ULVC 4M4RA 4WFHE 4P2QB 5E24E 5IB2A 1YMHB 2NY3D 1IE5A 3S3PA 3KR3H 3ARXA 5JIPA 1OAQH 5SWZA 1GGBH 3EDEA 2WAHA 2UWEB 1R3JA 3PL6D 4HPYL 1QSFE 3DRQA 3L6FB 1ED3A 4KU1A 3QWRD 5D7IE 4LNRB 4ZFOL 3IU3B 2AJXL 5AAWA 1U36A 1EO8L 4UIMB 2GCYA 4K9EH 3A6OA 4LGSB 5EUKA 4MB5A 1VHPA 3HAEH 4MSWA 1GC1L 4XBPA 5DRNA 4U3HA 3QQ3B 4RFEA 3W5NA 4P0DA 1W2KT 3DO7A 4R8WH 3DO7B 2QADD 2VAAA 1GZPB 3P4MB 1BD2A 5E00A 4U1NA 2W07A 3EO1B 5EORH 5EO1B 4IOIB 4WCYH 3FT2B 1YN7A 5EC1B 2R2EB 2ZUWA 3PHSA 3BISA 4HD9A 5GGSY 2C3WA 4HK3N 4X4XA 2JF1A 1FNFA 4M3KB 3MO1B 3TC9A 3WEXA 4BFIA 1Q9WB 1RUML 5I73B 4LVEA 2G2RB 3B2VH 3AU1A 1XGTA 4P46D 4L1HA 4HS8L 4LLUB 1K4DA 3ZYJA 3QWOA 1F00I 1K6QL 1RJYB 2E5EA 3ALPA 3QNZA 1OM3H 5E8PA 3RGVD 1OGAB 1P69B 2DI7A 3N85L 1RZ7L 4FTVA 3FL7A 3GHEL 2OR9H 2V5YA 3BWAB 4JQIL 4NKOA 5KANG 4MS8C 1FJ1A 3FQXA 3I85A 5F96H 5B3NA 3QQNA 2I27N 3TWCH 1FIGH 5I74C 5E94B 1ZHLB 3AMKA 3CLFL 2P8LA 2W9LA 3K1KC 4IS6A 5J1SC 1ZGLM 5DD1H 3MJ9L 5DRWB 4AG4H 3VG9C 4GW1B 4EIZC 4JFHD 3Q1SL 2ZSWB 4KI1A 2EXYC 5ID1A 2B2XL 2DLIA 2BHZA 1IGMH 1YNKH 4XGZA 1YMMA 2YC1B 1DFBL 2IQAA 4XX1G 2OTWB 2OP4H 5IVXA 4X6DA 3NFSH 6CGTA 3VXPA 4LIQH 1OTUC 5I0ZA 3P9LA 1NC4D 1I3VA 5DC9B 4NZUH 4GKSA 3UYPA 3MNVB 1QLEL 4N0FA 5FHBH 2HMID 2WWMC 1HI6A 5J6GA 3BQUB 1JZ4A 3CXHK 3LHPL 3GEWB 4ZXBD 4XCYA 5EPMB 5C6PB 5IQ7H 5CJ8A 3MRGB 1MIEL 5IB4B 4F7EB 5C09B 5BVJB 3H9ZA 2LABA 1N26A 4L8BB 4RWYH 4X6FB 4PJ8B 3NCYS 3T0VA 4MMZC 2XZAH 4WHCA 2CJUL 1UJTA 2EDLA 5I1HH 3TESA 3LEXB 1KJ3L 3UTPE 3HC4H 3MROB 1RZ8A 3UO1H 1RZ8B 4ZPTA 3FFCD 5D7SH 4HJ0D 2IAMB 5ISZE 4P2RB 2IF7A 2WUBH 3MBEC 2FX8H 2WIMA 4IHOA 1X4YA 2YK1H 2IBZY 5IMLB 3D39B 4NKIH 3WXWH 1QPXA 3DUSB 1TZGL 1N59A 3UYRH 1TQBB 5E8NA 1FL3B 3F12B 4KK8D 3MOAH 1H3GA 1QSFD 5I6XC 3O3AA 1M1SA 2WLZA 3DOSA 5FK9A 4BZ2L 4F57H 3AB0C 1HHIB 1NKRA 2BNQE 4L8CB 5C08B 1OGTA 3L3KB 3V0WL 3UBXA 4YK4B 3KGRA 3MCKA 1YPZF 2DLTA 3RKDD 3TO4C 3MRBA 2Y5TA 4RFOH 3JTTB 3MRBB 3WYRA 4CBPA 4X6CF 3RWEB 4X7SL 1E4XH 3WO4C 2I9TB 4YZFF 1AXTL 5FO7A 3S34L 3VI4F 1KXTB 2C4FU 3WFCL 1CD0A 3QRGH 1CIUA 3SKMB 4PJEF 3SQOH 3L7EA 4OQ1A 2IBGA 3CSBA 5CJXA 4ZODA 2VKWA 3MACL 4L4TD 1FSKB 3O2DL 2VZVA 3EUUA 4X6EB 1MCLA 4I3SH 1INDL 2XZCL 1DLHA 1AP2A 5DFVD 3GUTA 1MF2H 4PJ8D 5LXGL 1SJXA 3GIVA 4NBYB 5FDWA 3OXRA 4DUXA 4WI7A 3K7UA 3F7YA 3BKJL 3RUGB 2VLRB 3BGMA 4RAUA 3EKCA 3TZVC 1NCCH 4YXHH 2NX5A 5F97E 4P9HL 1RFDL 5DJXB 5C0BE 5DK2A 3DURA 1OLLA 2ZOLB 3IS1X 1G9EA 3PIQB 5DD5H 4PJAB 1MAJA 1KN2H 4ODWA 3O8XB 2NTSP 4HWUA 1PKOA 3B2UC 1CDUA 4C55A 4JY5H 3WN5A 3T0EE 4Z7WE 4EQ2A 3O2WH 2XQYG 1QEWA 1AR1D 4R3SA 1NLDL 5BW7A 4R3SB 3O6KH 1MQKH 4JFYB 1X5KA 2YA1A 2YSSB 5E5MA 3B5HA 3GSNB 4W68A 3SKUD 5IQ7L 4NNPL 3CPLB 1HDMB 2EXWC 5SWQB 3HE6B 3HN3A 2YEZA 3WS6C 1EBAA 2BSSA 2AI0L 1QVOA 2F5BL 1SYSB 1CLCA 3D1MC 4QHLB 4U33A 1J1PL 3BPCA 1R5VB 2OJEB 4K3EH 2ZZUT 3RQ3A 1PFCA 1DUZB 3GO1H 2YOCA 4PB9L 3V5DA 2X5PA 1WFUA 1G7QB 3LKPA 1EHXA 1UWEH 1ZT1A 4LAQL 1MLBA 3VRJA 3O2VL 4JANA 3K3QA 1I1CA 1F6FB 2ZG2A 4JFED 4G3YL 4J3VA 1QSZA 3A6CH 3TPUA 1ZLSH 4MXWH 3LRSB 4WEMB 4AEHH 4IOFC 3DYOA 3WXWL 1A3QA 4JR9L 4OBSA 4LMQE 1KENH 3PDGA 1BM3L 2BZDA 4F7PA 2EC8A 4OV5A 1EPFA 4HUMB 4J4PD 5GGRY 1QPPA 2P8PB 1U8MA 4O2FA 2VR4A 3K2UH 4HKXA 4I2XA 1A6WH 1MCRA 1ED3B 3C5JA 3S35L 1JZ6A 3C09C 4XCCL 3EJZC 3RNQB 1IGIL 2VDLH 1VFMA 4YNYB 2IQ9L 5DQ9B 3QUYA 4YPJA 1HH6A 4OB5H 1AXSA 1J05B 1SQ2N 3DX9A 1N7MH 5E5RB 4UV7H 3AS0A 2FIKA 2FX8L 1OTSD 3I6GB 5EO1A 5CIPA 1YEIL 2OL3L 2H1PH 2X4RB 5JOFA 2FWOB 2AJSH 3CDGB 4RRPA 4B0MM 2OTUA 5FGSA 4G6AC 1PZ5B 4I0KA 2AS5M 5J12C 4UV4L 2IMNA 3VXME 1BBDH 4ALAL 1H3XA 1NDGA 4I3SL 2Z91A 1LO3L 1A6UL 4WI3A 2DKUA 1QACA 4GAJL 1FNGA 1U92B 2C1OB 1SM3H 4PFEA 1YJDC 1S9YB 2W0FB 3ZDYE 2BOCA 4G6KL 4P59L 3LB6D 1BFVH 4IOIA 5I8EA 2O61B 1N8ZB 2P5EB 4KVNL 3SDCA 3MV01 4OM1L 4KDVA 1TCMA 3GRWA 1U8OB 2N4IA 5CWSB 3OMZA 1A6ZB 4DGYL 4WFEE 1KYOJ 1SBSH 4TTGA 4GRWF 4RX4D 2CK0L 5JIIA 2ZCLH 5BVPH 4JQIH 3PQYD 3WIHH 1CGXA 1NAKL 3OAZK 4WW2C 1NANI 5IJVA 4CNIB 5JQ6H 4Z0XB 1J88A 3CFCL 4X8XA 3QCUL 2B2XH 3MGAA 4NJ9L 1F4AA 5F7EL 4RGOH 2JCCF 2VYRE 4N8PA 3BIKA 1VEMA 3Q1SH 4JO3H 4WU5A 4X6CE 3GBNL 4LOUD 3QULA 3KPLB 4LDOB 3GKWL 4RMTA 5D7LB 1YNKL 4ZUWA 4IS6B 1IM3B 4MCYB 4QXUL 5D2NC 1KTDA 4ORZC 5EOCL 2AABL 4DTGL 2VRAA 5DJYB 4PJCB 1CFQB 1R5VA 2OJEA 2FJHB 3MLYL 4TNWK 3V4VL 1J7VR 4ZTOL 2JCCE 2DQHL 3MRGA 5GRWA 3VFGL 3NCYP 3O6FD 4O2EA 2UZIL 4NKDB 4I48A 1ZS8A 4X7DC 4HAFA 4LGRB 1E6JL 4PD4K 2GJJA 2DLFH 5T1MB 3SJVA 4PGEA 1L7TL 2DIJA 4YX2H 4XBGA 3U4BH 1G7HA 2RFXB 4PJHA 4P2QD 1BQUA 2YPLD 5GJTL 1FVEB 1GZQB 3V6OE 1ZTXL 4MD5B 4GRLA 4I18B 3GIZH 1FQ9C 5I1AB 3VXSE 5A2IH 2VABB 1MFCH 4AIZA 4HZAA 2WQ8A 4I9WE 4RA3A 4X9FA 5ICXA 5HPMB 5IESL 4DK3A 4LCCA 1WC7A 3NCCB 4TVPE 4MLSA 2JELH 2JE8A 3G5ZA 1NC2A 3S7GA 1QKZL 4NRXB 1Y6MR 1H15A 4X6FA 1RZJH 3LN4B 4P23A 2DQUH 4O00A 4C54A 5EO9A 1I4FB 4FFZL 1MWAL 1U8HB 2EDDA 4R97B 4YBLB 5C0NC 5DYOA 5C0CB 2PO6D 4NQUA 5GISL 5F7EH 1V7MH 2AAVA 5EO0A 4RBPH 4TNVF 2VISB 2NYYC 4MA3B 1T7XA 4FQIH 1MFEH 2LTQC 4FFVC 3GJFA 3UTQA 1KTLA 3BE1L 1LP9A 4LQFL 4UMGA 3D25B 4JY4B 4NPYB 1NJ9A 5JQHC 4QT5B 3V0WH 2G2RA 2DQEH 2OYPA 3VGBA 3BEWB 4DZBB 4KTEH 3WUWB 5DEZA 2NPLX 4HMDA 3BYTA 4WVRA 3RI5F 2V2TA 3EYSL 4NO5A 1DUYA 4WHYH 5E2UH 3T4AB 4QKXB 4W4OC 3TBYA 3ULUL 3GDBA 4Y0GA 4Y5YA 3WDIA 2GTZA 4K8RL 3U0PB 4ONHB 4Q7DA 4QRUA 1IEBA 1JIBA 3GSVA 5JXAH 5T33H 1BEYL 4XBEH 3NACH 4JLRB 5DMIH 1P1ZA 5E4EC 5DMGD 5I15L 1B0GA 3ORJA 3U36A 2E9WA 2D03L 3CVIH 5I66A 1RJYA 4LKXB 5BZWB 4YLQT 3MLXL 4RGND 2Y6SC 5KN5A 1HHJA 1ND0A 3WNPA 4OZIA 5IEKA 4PJ5B 3V0VA 1AQKL 2ITDB 3A67L 5D1QC 3SE8L 5KJRH 2OTPA 2QHLA 1PY9A 3RGVC 2Y72A 1ACYL 4PP2B 1INEH 2XN9A 3QUZD 4YHZH 1CD1A 5C0ND 1MIEH 2H45A 4OAWB 4OUOA 3PWVA 1DLFL 4NO2A 1OB1B 1KLGA 1WWBX 5HDBF 5IVNA 2PYEB 2WP3T 5L0QC 3BPLC 1RV6X 5IBUG 2NR6C 1AY1H 1UJ3C 1LO5A 4MXVE 4OZFH 4F33A 5JPMA 1CVSC 3IJSB 4PRPD 1E6OL 4XPBH 1OWRM 3CIQA 3VI4E 3MUY1 1QHPA 4EVNA 1K4CA 1MJUH 1N6QH 1A1MB 2IMMA 3LKPB 4LCYA 3VXOA 3H42L 1PD6A 1WZMA 3STLA 3EFFB 4WIQA 1HXYB 4WEUD 3GSUB 4QLRA 3KXFB 4KH2A 4HUWA 4N0CC 5MEOB 2DL9A 2ADIB 3IDXL 4M7ZB 3G04B 4PJGE 4J6RL 3MV8E 3ZO0A 5FO8A 3AM8C 4I3RH 3U6RB 4D9RD 2WWMD 5DZLA 3G6AA 4O02L 3MGOA 3TO2A 5CJOL 3RWFB 5HVWA 1JF1A 3DMMB 1YECH 4WV1B 3VH8A 3ZTJG 3IFPA 4Y4FD 1MIML 4ZTOH 3SEPA 5GXBB 2MKWA 2HKFH 2P48B 4R6UA 1KG0B 5C0CA 4GRLD 1RMFH 4L8DB 4D9QE 4DN4H 4PRIE 3ULVE 1JPSL 1TENA 4TSAL 1WAAA 3B9VA 2P46B 4I9WD 1UM4L 4MNQD 3O2DA 4XPFL 5FXCH 1T5XA 1YEHL 1IAOB 3CNKA 3QJFA 1Q0XH 2NLJB 1KIPA 1KIPB 4JRXB 4Y19E 3UZVB 1LP9B 3L6FA 5FB8A 3EHBC 3FT3A 2P5ED 4GW4A 4KKLD 2BVQA 3C2AH 4UINL 4WO4D 3MMEA 3U46B 4IMKC 2LVCA 1CDJA 1QYGL 3MMEB 3U46A 3BEWA 4DZBA 3P0VL 5E2UL 3O45B 4WW2F 3MRLA 1VADB 5D1QD 1I1RA 4UILH 1HINH 4A6YB 4KMLB 2F8XC 2X4SB 4JVUA 5C07D 3X3GL 4JFXA 4MNGE 3X11A 5JHLL 1SMOA 4POYA 2DB8A 3HZKB 4G43A 4G6ML 1XFPA 5B38B 1SYVA 1DN0A 4I5BA 2B4CL 4UIKH 1U8LA 3ZKND 2ERJB 4WUUA 4MA8L 1RHFA 4MA7L 15C8H 2H2PD 4JRYD 3SDDB 1AJ7H 1RU9L 2DQGH 2F53A 1KIRB 4XMPH 4QWWC 4U05A 2EDNA 1MHHB 3LV3A 3V52L 2N7AA 5B4MD 1M05A 4HC1L 5FA4B 3X12B 1JP5A 1ZSDA 4DFIA 1MAML 4UT7L 2Q8BL 4ONOA 3RIAK 4JG0L 1L6XA 2DQJH 2VZ3A 3OKEB 3K4DA 1YYLL 3LDBB 1EHAA 1P4BH 3GSNA 2JB5L 4TPRL 2HJFA 4XXCC 2UUDH 3EDDA 3N1GC 1M7DB 4KJPC 3QUMH 2VXSH 4EUPH 4FFVD 1S7UA 4JFDE 3VXMD 3V5HA 5DUPL 4JDVB 5I17A 2I5YH 2DYPD 3QDJA 2QQQA 4GSDH 5I6XB 2BCKA 3IDYB 2QQLH 5E2VH 5IFAH 3NA9H 4PJ5E 4NC1C 3KYNA 4UTAL 4UNVA 1Y6NR 5L8LB 3VD5A 5F9OH 1A6AA 4KTDH 4V2CB 3LS5H 4P46A 4PTTA 4O02H 4XNZB 5I1DB 1UZ6F 2W60A 2VH5H 3EDFA 3ES6A 2E27L 3VA2C 5K9QI 2VXQL 12E8H 3R06B 4AH2B 3NVQA 4OZHA 4OD3H 4UT9H 5EUOE 3D3VA 3QR2A 2ZPKL 4LQ1A 3HMXL 3MRFA 3MRKB 1G9MH 2AJ3B 4MX7A 2DDQL 2R15A 4PJ5D 5EIVA 4GOSA 1RMFL 3LS4H 5DHYA 1MAMH 4K3DL 3QIUA 5C0JA 3QIUB 3T0WA 4NRYB 4IRJD 5F1NA 2Q7YB 1PG7X 4ZG1A 1AI1L 3FFDB 4MCZA 1EA9C 2DQDL 2FEDC 5C07A 4R96A 3O9WD 1PDKA 1C7SA 2HT4D 2OZ4A 4PRHE 4QRPE 2F58L 4O51A 2A9MH 2ZUYA 4GLRH 3GKZA 5BS0B 1NLDH 1S7SA 2O5XL 4UBDD 1JGLL 4PJIB 5IQ9A 3WLBA 5AAMA 4I3RL 5M95B 3EOBB 2X4NA 3O4LB 3MV9B 3O4LA 3MUZ1 3KPSD 3QZWB 4JPKL 1SMAA 2R0WL 4F37K 8CGTA 3IRZA 3D25A 5C0CD 5SX5K 3QAZC 3B83A 1ZVSB 2Q7NA 2FX7L 3HR5A 3NA9L 5EUKB 2GCYB 4F7TB 1EEUA 3HPLB 1D9KB 3QISA 3UPRB 3LMJH 5KVEL 2EEBA 4N90E 1CFSA 3DGCR 1FORL 5IW6A 3RUGE 1DBBL 2E6PA 1UZ8B 2FH6A 5DEFA 3MLVL 1KCUL 4M62L 1MWAB 1KB9K 4YBLC 2B1AL 1MH5B 4YHOL 5C08E 1IEAA 1D5IH 3VFOB 4OGAD 4NT6A 2R2EA 1Q0XL 2VE6B 3HE7D 4XCFH 1YUHA 1U8OA 2CDEA 5FGBC 1MQKL 1NL0L 4XAWH 1CGVA 4ORGA 2WINB 2VZOA 3S96A 2F54D 3MUGB 3AM8A 4NYLA 5CJQH 4YWGH 3BPOC 3NCFB 4DK6A 5DI8A 4G8GB 4NO5B 3ZTJH 5F3HB 1FLRL 3OR7B 3EJJX 4P2RE 1JTPA 3L3HB 4PJDF 1CBVL 5BQ7B 4U1GB 4H1LB 4MHHI 2AABH 4AIOA 2C9AA 3AGVA 4FTVD 3ZL4H 4NNYA 5IVXF 1JCKA 5GRZA 1G9MC 4ZOEA 2BNUB 4DQOL 1UACL 4PR5A 2GFBB 2GJ6A 4NO3A 4OFPA 5F9JB 15C8L 4NQEB 3BRDA 4FABH 3CUPA 1VGKA 4JDTL 1JF5A 4XC1H 1T0PB 5IB5A 3VXTA 1HQRB 5TPWL 1XF1A 3RVXD 1B0RB 2IBZX 1YMMB 1RK0A 4XRCB 4RGMC 4X6CB 3TT1L 1KJ2L 4YAQB 3V4PH 1F13A 1F3JA 1P5VA 2DQJL 1BFOB 1UH3A 2YUZA 4R4NC 1T3FB 3H7BB 5FAAA 2K7QA 3PWVB 4JPIA 1AGCA 1IAIH 5FV1L 3VFTB 2CGRH 4JAMA 5GJSH 3LN5A 4LSSL 4GG8A 2ZPKH 1HIMH 4XWGH 4OT1L 5J9PA 4J3WA 3GI9L 2VXQH 3VFWB 3SE4A 4B7LA 5DRXA 4UQ3B 3WHXA 4JFDB 1DBJL 6FABL 3QHZL 4HIXH 5I1GH 2IGFH 1DQJB 2PF6A 5FYKE 3E3QC 3HNTL 4QXTB 5KZCD 4K8RD 1C12B 1NC4B 5SX4I 2R8SL 4L4VE 1F2QA 3MXVL 1A7NL 2C3HA 4RFNB 4UV4H 3BZ4B 5E7FA 5FM4A 3RDTC 1E4KC 3D69B 4M6MH 3GMMA 1DVFA 4IIQC 3UYOD 1CE1L 1IAMA 4PJXA 3DGGB 1YEIH 3U0TB 5DHXB 4LNRA 3TO2B 2DWEB 3OJDB 2P8PA 4YZFE 3VXNB 5J0BA 1GVIA 2ICWI 1RY7B 4BK5A 4HUXA 1F5WA 1YEHH 1HXMB 2G9HA 2P42B 4LCUB 5DO2C 1HZHL 1U91B 1JGDB 1CF8H 4MAYA 1QR1A 1T0MB 2DLFL 1UJ3B 4K71C 2YD2A 4U1IB 4X9BA 1D5XA 2HJKA 5DJCB 3DSFL 2XWJB 2YUXA 1ZKAA 4WFGD 4S1RH 5ADPH 1JHTA 3DIFA 2NY5H 1HH6B 1Z3GL 1E4XL 3RY6C 4LHUG 4OGAC 1F4HA 1BLNB 3CSYA 5DJ0A 4ZUUB 4WO4C 3PJSB 4QXGL 5JDSA 2PW2B 4PJ7E 2VXVH 2XTJC 4FFYL 2YRLA 2NY4B 1S9XA 2VUYA 4Y4HB 5D9SB 1MRDL 2ADGA 4KUCD 2ZJSL 1RIUL 3PV7A 4HEPG 4IRJB 3CSGA 3L7EB 3RU8H 4HBCH 3OKKB 3O9WB 4MD4A 4U1MA 4UDTB 4NHUB 1CIDA 5C08D 1MCDA 5CZVL 3RTQD 3F5WA 4G6FD 4M8QB 1FHGA 4WGWB 1F97A 4M8QA 3U9PL 3C6SB 4WFFD 3WFDH 5EOQH 2G5BA 1NMAH 1B9ZA 3B6SA 4HUKB 2DTML 3IFLH 2VLME 1LEIA 3BGMB 1JI2A 3P9MA 1DSFL 3GI8H 4OM1H 1VGKB 3S3SA 2PYEA 2A6IB 2D7OA 3REVB 3VXRB 3IGAA 3DURB 5ACZA 1PQZB 1RJZB 3CXDH 4JGJA 3WL9A 3K74B 3BGFB 2CLRB 1XEDA 1WFNA 3ULUF 1C5DB 4XNXL 4GS7C 5GGVH 2QL1A 5I1HL 1LE9A 2K3TA 3O2WL 1L7TH 2I26N 2DQCL 3D9AL 3R8BB 3QI9C 4Y16A 3VXSB 1U3ZA 4NNXA 1GC1C 2QSCH 4BKLA 5GS0L 4XMLL 5AZEL 2ADFL 1MHPH 3FHQA 3RWGB 3VGGA 3UJTL 5TJWK 2E8YA 4Q6IB 2LU3A 5IIEB 2XKSA 2NY0B 3I6KA 4YBQC 1TPXC 1CQYA 4UQ2A 4WW2A 3MRDB 2OXGA 4N5ED 2EDQA 1HHGB 1EHNA 1FDLH 1NAMH 2D7MA 1I9RH 4GAGL 4M1GL 4W4NA 3GK8H 3KPRB 5EZLA 4DVRL 4BELD 3T2OA 2AJ3A 5AWNL 4JPWH 5DJ8B 1MWAH 4FFZH 1JZ8A 1N5AB 2V5MA 5DHYB 3QWQB 4JO4L 4HFWB 3OQ3B 1K8IB 2K9UA 4EI6B 1WBYA 5ACMA 4RMQA 5DWUH 5E2WL 4HIHB 1AFVL 4ZXBC 5LBSL 5CGMA 4YO0B 2IALB 4I18C 1BBJB 2LAGB 5F9WB 4KI5C 4XPGL 4HUVB 4XHJD 3BAEL 5ESVA 3EOBA 4LSRL 4MX7B 5ELIA 2DQDH 3G5YA 3C5JB 1J8HE 2AV1B 3H3PH 1UXSB 2EDJA 3HNSL 5KSBE 1VCAA 1EBPA 4L5FH 1G6RB 4GKZB 1T2XA 5IK3B 3D9AH 2YD6A 5L2JA 5C07B 3MLZH 3V6FB 2CRIA 1G7LA 4XNUH 1DQLH 3GMNA 3OG6B 2FSEA 2WIIB 2AKRA 4NCC2 2X4NB 4C83A 1AC0A 1I8LC 4YXHL 2FB4H 2H3NA 3I3BA 5CIPB 4KMTL 1ZHKB 1CE1H 3MLVH 4MHHG 4UT7H 4XVUD 1G0YR 4XPAL 4Y4HA 2EDHA 4R8WL 3O45A 2BK8A 4XX1E 1DBBH 4CVZB 4JRYB 4OSUH 4LIQL 2JIXD 5HGGS 4P57A 5D93B 3SDXE 1II4E 4LLUA 5AD0A 5CZVH 4DGIH 4Z95H 4LDLB 2W65B 3FTGA 3ARPA 4QRPB 4QCIB 3L3HA 1CGSH 3ABZA 3LHPH 2IPTL 3TYFB 1QNZL 2O61A 1SBSL 1X5FA 3OZ9H 4LHUA 1RZKC 3JSSA 1CS6A 3E1F1 3WHE0 1JPFB 4IDJH 4O9HH 5IB1A 1A3RL 5KVGL 3UROR 3WEXB 2BNRA 5C9JA 1YA5A 1SJEB 1LEKB 2DMKA 2FJGB 1P7QB 3NOIA 4U6HA 3FO1A 4G8GD 2VDPL 5E9DE 2AGJH 1IQWH 3U4EB 3RDTD 1Q94B 4LNVA 4OZGB 5CJXC 3KPOA 4L8SA 4LLDB 4XTRD 4YGVA 4LAQH 1ERNA 5D7LE 1NGXA 5HHMD 5HGAA 4HBCL 1FNLA 4E41B 3VWJC 5E6IB 2XACC 3MJ9H 3DROA 1AGBB 4OLZH 1HDMA 4PY7B 4D9QD 4GBXC 1KCLA 4UNUA 2Z31A 3OJ2C 2B4CH 4UIKL 4MD0B 5JW3H 2AV7B 5HY9B 5B8CB 2C7UA 4G42B 2VN7A 1SEBB 1CFTB 3AXLA 4XGZB 2NXYD 4OIIH 2NY3C 2ARJA 3VFUA 1TTUA 4GG6A 1FZOB 4HF5L 2X1OA 1FL5A 1CE6A 3ARGC 1FL5B 5MEND 2FDBP 2FO1A 3GMPB 5IM7A 3P4LA 1RJLB 5JO5A 2JK5B 4MDJB 1S7QB 4BJLA 4YEFA 4HX1A 4L4TA 4KK9C 2CH8A 3D0LA 1DBJH 3PE9A 4JAMB 5DRZB 1DL7H 1QSEB 4ODBD 2VR5A 2Z4QB 1MCWM 2PXYD 1QR4A 4D0BB 1XR9B 5GRXG 2AK1L 4OV5B 1KCVL 2HLAA 4ZSOE 2NXZD 1S7VA 4NQVA 2H26A 3F65A 5SWZD 4HHAA 5C0RL 1W8NA 5I8OL 2AJYL 3JWDL 3WUWG 5C0IB 2C3GA 1MI5D 3F12A 1D5ZB 4K9EL 1KCUH 2R2BA 2GW5A 1ZVSA 4UUJB 5IHLB 1IT9H 4HH9B 3BZFA 3QQ4A 1IFHL 1IC4H 5GRUH 3E6HA 5CJOH 3T1WA 4M1DL 5FECA 1S9VA 4NCC1 4S2SB 3QDHA 3BSZH 4RSVA 4Z7UA 2ZKHH 5GS0C 3ARRA 1MRCL 3IDNA 3N0PB 4Q9RH 3MODH 5EH1A 5L8JB 3N1PC 4PGBA 4LSTH 3FT2A 4ZNCD 4OCWL 3U0TA 4NT6B 3NH7L 3KYMA 4D9LH 5HD8C 2NZ9C 4HMCA 4J7RA 4DGYH 3GSQA 5F9OL 3THML 1J0IA 4GLRI 4MAUL 5E6IC 3VFMA 1Z0MA 1BM3H 3DSFH 4S1RL 5ADPL 4OF3A 2Q8AH 1KJ2B 4MSWB 2RCSL 3FN0H 3MUGA 2CLZB 5DD6B 5DD6A 2Z8SA 5FYJU 4W6WB 2X4SA 5B3JE 1P4IH 4NZRH 1QYGH 5EU4A 1V3JA 1T7YA 1AQDB 5DVOA 5D1XD 2X89A 2ZSVB 4Y5YB 4YC2B 3MOBL 2A6DB 4RISH 1KCKA 4HXAL 1FGNH 3MO1A 4YIQB 2NYYD 4ISVB 1BQHG 2BXZA 1MHCA 5DGRA 4U6VL 2XKNA 3ZDXF 3LKRB 3VFSA 2F53B 3FO1B 1KIRA 2F9BT 2PO6C 3V6OC 2FD6L 3DTXA 5KJRL 2UZIH 1OAUL 1GGTA 2DQEL 4JFFD 1S8DA 4OZGA 3MV9E 5BCAA 1B0RA 4G7YH 4WWKA 2BVOB 4HWZA 4JHAH 2YZ8A 3CFBB 2FBOJ 4QEGA 5IFAL 3WV0A 1QFUL 1CICA 3U30B 4Q9RL 4Z7QF 4HLJA 1NBZB 3QA3B 1ORSB 1ZA3B 4KZDH 3HC3H 3RZWA 3JVGC 4XNXH 1E28A 1UA6L 4U6YA 2HJFB 4HGMA 3DV6A 3GB7B 5HYEA 1JMXA 3AREB 1X4ZA 5HHPA 4ZDHB 5I30L 5F1OB 3LQZA 3QXTA 4PV9B 4Y2OA 2EXWD 2VXUH 1I7ZA 2CR6A 1E4WH 1OW0C 1JJUA 1S3KH 3QIBC 1S7XA 4Y5XC 5CGYD 3U7AA 2ZCHL 2GAZB 4LCWB 3KLHD 3VMNA 3GMQB 4XNZC 4KJQD 4OLYL 3BD5A 4NP4H 2HAZA 2JB6B 4KGLA 4C57C 1CWVA 1ZT4B 1H3PH 4W6XB 3GMLA 4IOSD 3GK8L 4QO1A 4DVRH 4D0CA 1WCBA 3LCYA 1K2DB 1DQDL 4EXPX 3RRQA 2RHEA 2IANA 4P5MB 4WTZA 5IW1B 3G6AB 3UTTE 1ZK9A 1NEZA 1H15B 1FZJA 1FN4A 3GHBL 1IFHH 3MRKA 1E4JA 4PJ8C 3VRLF 5EO9B 3MLYH 3V4VH 4M6AA 4FQCL 2YWZA 4GW5B 5GSRA 3BT2L 1CL7L 1FPTH 4FQQB 4U0QB 3PWUA 4RMRA 2BNQD 2UZXB 4Z7VE 1OTUD 3IKKA 4NQTA 3PP3K 1KTLB 5MEQA 5IQ9B 5GJSL 2P7TA 5DO2D 1UC6A 2FECL 1AD0A 1O0VA 4L9LA 4ZNEA 5CEXA 1ZOXA 4KDTC 2VUOA 4RMSA 2H32A 4OKDA 5H94B 2R0KH 1FCCA 4XB7A 3BXNB 4GMTL 1KXVC 3TA3D 3WUWA 1T83A 4GKZA 4LPWA 2B20A 3G9VA 3OSKA 1BF8A 3OF6A 5LG1A 2OP4L 5BOPA 1OF2A 4JM2B 2FX7H 5TF0A 1JFQL 3BN9D 2ATKA 3C5SA 3QPQC 4AYFA 5FUOH 5ICZA 4Z18A 3F7RA 1T04B 4ELMF 5FOJA 3GJEA 4X6DF 1JRHH 3SDCD 4M6NH 1PG7W 1C7TA 1OARH 5C0DA 4YHYC 3F7QA 3MJ9A 2AK4E 3MRJA 4FQIL 4DGIL 2DQIL 4Z7UF 2BVPB 4M61A 4KK9D 3BD4A 1FFRA 5K9JH 3DX6B 4RFOL 1AH1A 1QRKA 4P49A 4NZJA 4XVSL 5JORA 1X7QB 4JG0H 1JUFA 2H8PA 2HT2D 3MV8B 3VCLA 3VCLB 4ZFZA 3FO9A 1KXQE 3ILPA 5CJQL 4YWGL 2SEBB 4B7IA 4LVNB 1X5GA 1MLCA 5I8EB 2P4AB 4QHMA 4APQB 5GRJH 2IPKB 3JTSB 3SO5A 1LD9A 2E7LA 2JELL 3QIWA 2FHCA 4ZQKB 1G9NL 4PG9B 2YA2A 1RURL 2EDTA 1OHQA 4HK0A 3LPFA 2J7LA 1JNLH 4AQ1B 3BH9B 3PWNB 1C5DA 4AEIH 4NQEE 4I0PB 3O6MH 2V5SA 2PW1B 2EEAA 5HJ3B 4DQOH 3W11C 3VWJD 5MEPB 2P8MB 4JJ5B 4QRRA 1OPGH 3BJLA 3T0XA 5D71L 4AK1A 1RHHB 5HD8D 3BVNB 4DWHA 2R8SH 1FYTE 5FCSH 5BV7L 3S4SG 4BQCA 4CGTA 3S98A 4MJ4A 1M4KA 4ETYA 3SCMC 1OAXL 1AXIB 1K2DA 1L7IL 2X4TA 3LSOA 4BYHA 5I1CH 4PJCA 5CP3H 3OKLA 3QNXA 4RFNC 4NQCD 4U3CA 5JUEH 3AXLB 5C0FB 1OW0A 2YR3A 3OG4B 4JEGB 4OT1H 4KRPD 3MLZL 1IVLA 2AK4B 1I75A 4GMSH 4LLMB 3ULUH 2J8UF 2LU4A 3WIFB 1IGIH 2VDLL 5HYIA 1NMBL 2YWYA 3HLAB 5GS1C 1CLYH 2EC9U 2FATL 2VDPH 4D0DA 4I8DA 3O3EB 1YMHA 4L4TB 4HBQA 1CGYA 3SE9L 1K85A 1EEZA 4KROB 4QTIL 2X40A 3SDXB 3F6LA 3T3PF 5SWZB 5FYLE 2R4SL 1MEXL 1MFDH 3QI9A 3I6LD 3EYQD 5I1KH 2J8UA 4L4VD 3B43A 5F6HJ 4X7CC 4JRXA 4HULB 2IC2A 4ZO6A 4CJ1A 3K4AA 3TVMA 4JKLA 3IXAB 1IILE 1G84A 2QSQA 3ARGD 1UCBL 1A6VL 2R1XB 3ULSB 3OKMB 4KRNA 4OIAA 3GNMH 5CGTA 4GRLC 4OFKA 5CD5C 4BZ1H 3H0TB 4OLUH 3H0TA 2B0SH 1CZ8L 2BRRL 1A1OB 3WKNA 3PHOA 4LSUL 2QR0A 4NWUH 1J0KA 1EFXA 4W70A 3S37X 5CSBA 4LP4A 2XWBA 3RPIB 5BS0D 3HI5H 4OCRH 4QRTB 3QIBD 4D3CL 1M7XA 1AHWA 4XH2B 3UZQA 4UV7L 2A6DA 2OSLA 1N4XH 4OGZA 4AJ0A 1YUHB 4CU6A 4XMLH 5GRYA 1GGUA 4BFBD 1FNEA 3VRIB 4HWBL 2BXYA 3V9FA 2D4FA 5ILTH 2KQNA 25C8L 2CLZA 1JNHA 1Q94A 5F3HA 4EOWL 5EZIL 4LVOC 1JPGB 1V3KA 5FHAH 4OLXL 4WWKC 1ZE3C 1OAUH 5HVHC 3TIEB 4X4YA 1HHHB 4R2GB 3HUJB 1JNJA 4ZQKA 4EUPB 4HK3J 1XIWB 4LSVH 2V7NA 4NOBA 3HE7B 2FYYA 1UCBH 1NMAL 4WHTB 4ZPVA 1JNLL 2ZUXA 4HIJA 5AUMA 3U9PH 1FGVH 5A16B 5IVZB 4M3JA 1SEBA 5D1ZC 1KPRA 2ZOKB 3B9DA 3IFOA 3PIQA 2D31B 3ARFC 2VDQL 2V9RA 2FEEI 5DTFA 2ORBL 4PJ7F 4ZSOA 3FQUA 4S11A 4DKDC 1MOEA 5JIHA 4PJXF 1C08B 3G9AB 3T65B 1ES0A 2ENSA 3LPWA 1AI1H 5KS9A 3QO1A 1KLUA 3G5XB 5BJTA 2EE2A 2VZSA 1SBBA 4LCYB 4MQXD 5C0BD 2GJZB 3MNVA 3F58H 4PGJA 3AS3A 5HHQA 2YPLA 1FV1B 4ZD3H 2R2CA 4PGDB 1TMCB 1CGSL 3QJHA 5J9PB 3QEQB 1O5DT 2JJTA 1AGFB 2ADFH 1QBBA 3T2PA 2MCG1 3VFUB 5CCKH 4GG6B 25C8H 2APFA 1S9WA 2BMKB 2Y23A 3KLSA 5IM7B 3RTQC 2R1YA 1LMKA 2DQHH 4OQTA 3HNSH 5DUMH 4AL8H 3KPSE 1FRGH 5D2NB 5CD3A 4XPAH 4FP8H 1IRAY 1U42A 3C87A 1KG0A 1V7NL 3VRJB 5SV3A 4AIZB 4GW5A 1T03L 5DMKB 3P2TA 3HMWL 4NKMB 1QRNA 5CEZD 4MA3A 3RWJA 2XFXA 3D39A 2J8UB 4NN7B 5T3XH 4JN1L 5CIPH 1T1ZB 3O6FB 4HZLB 5CEYA 4G9DB 2FB4L 4G9DA 5E8NB 1NEZB 4JRYE 4RAVA 5LGKA 1D6VH 4WUKL 1D5MA 4PJAE 1ZHNB 4O5LH 4LIQE 4L9LB 2HFEB 4H25B 5TDPB 1FP5A 1LEGB 5IBUB 4X7TB 3E2HB 5F3BB 3UPRA 3VU2A 1H5BC 1IGCH 1YYLH 2EICA 3FFCA 1G6RH 5T3ZE 4OQTH 3SGKC 4LSRH 3NBNA 4QOKE 2FJFA 4G80B 2WNGA 1UACH 1MFAL 3HRPA 4IM8A 3P4MA 4H1LG 1F42A 2KZWA 3SGDH 2H2SC 2F5BH 3OZ9L 5HYQB 5JOEA 3IDUA 4F7MB 1DN0B 4Y2DC 1UB5B 4RMUA 4YHML 1R3HB 1URLA 4P5TD 2ICWB 1YEEH 1YEGL 5GGTL 1I1FB 4ENED 4MYWB 3MRHA 2HWZL 1YY9D 2A83B 3BPNB 3QUYD 5KW9L 1UWEL 2ILLA 3ELAT 5F70A 3T4YA 5DFTA 3DX8A 5E03A 1T1YB 1HZHH 4LCCC 1S78D 3AFLA 4DVBB 5D2LB 3BEVA 1OGAA 3VRLE 4XB8A 4OKVB 4G5ZL 4JFFB 3V0VB 3U9UA 3Q5YA 2EIBA 3VW3H 3KPPB 1GL4B 3HI6L 3NABH 1MUJA 2BOCB 3QBTB 4ODVL 1NCCL 4KJYB 5ETUA 4F9LA 3FOMA 1NEZG 2JTDA 3N06B 1F58L 5T3XL 4XMKL 3L7FB 2VLJA 3UEZA 1I85A 2EYRA 2ZSWA 2AJUH 1BAFH 3ALWA 5B39G 3T3MF 3L95B 5T3ZH 1FVCA 3F7VA 3CVHL 1NBVL 1NMCC 1NFDF 3HC0B 3HC0A 3HNTH 5AZEH 3HNVH 2YKLH 4JY6A 5I0DA 5IOPA 1R24B 4IMLA 5D6DC 2GTWB 5GIRB 3TN0A 3V0AC 1MCNA 4TN9A 1HXYA 2DWDA 3CK0L 4OFVA 3FQNA 5CILL 3G08A 2OL3H 4PBXA 1PEZA 5TFSL 3E6FB 3G6JA 3VXRD 1FO0A 2NW3A 3GI8L 2IFFH 1UVQA 4QRRE 2X70A 4NQDA 2X70B 5HDBE 4OLZL 4AEEA 5IW1A 1OP5H 3T8XA 2ICES 3MLRL 3KPQA 4U1HA 5HGBA 5DJ8A 5IV2B 4G5ZH 2X09A 3RWCA 2XA3A 3KYKH 3ULUC 1N2RB 4K07A 1A7RL 4NN6C 4XPHL 5E6ZA 2J88L 4N8CL 4WHDA 5HVGB 2M1KA 4WEBH 1AKJA 1UCTA 5C1MB 1IMHC 3GMMB 4HCRA 5C3TA 1IAOA 4NNPH 2HA1A 4HIIA 2IALA 3DVGA 5DR5L 3WJJA 2EO1A 2XQBH 1JF1B 2J2ZA 3DMMA 3G5VA 4RAHA 1KSRA 2H26B 2PTUA 4HHAB 3DRQB 4U49A 4MJIA 4YDIH 5H37G 3GMRB 1MCFA 1MI5A 3CXHJ 3ARTA 2HH0L 2AJZA 3JV5A 3BGAA 4G6JL 5ADOH 3O41A 3V6ZB 2LVEA 1FIEA 1QR1B 3H6JA 4HG4K 2A38A 3O3EA 5I1GL 3V6FA 4HMEA 4JDZA 3A67H 4X4ME 4M8VA 1D6EB 1QBAA 4NSKB 5EBWB 2R4RL 5F6IC 5INDB 1UZ8A 3PJSA 3HG1D 1X9QA 5EOCH 4DTGH 4Y4FB 4JGUA 4QXUH 4JFFE 2DICA 1JWUB 4ZFGH 1NJ9B 2X1PA 1N3NA 3QUXA 4YHNA 3VJ6A 5I19L 1Z5LA 3DX6A 3I2CL 1L0QA 1LO0H 3DX7B 3L3JB 3D85D 3O9WA 4KGJA 1J0YA 1JUFB 2H8PB 4JFOB 1AXTH 3QQ9D 5CBEB 3TO4B 2AEQH 5DEFB 5TF1H 4HSQA 4OCYH 4P2OD 2MCPL 4PJHF 3OKNB 4P2OC 4H1LA 2C3XA 3QHZH 3WFCH 1VB9A 5JHLH 5FYKH 1G1YA 1N6VA 2VLRA 1F8TH 3EDJA 4RZCB 3PWJA 3UMTA 2NY5L 2HFTA 3EYVB 1U58B 4YHMH 3GGWB 1NGWA 1NLBH 3LKNA 1P7QA 1ITBB 4QXGH 2FJGA 3T09A 1TJGH 1CBVH 1WQVT 4GXUM 5KSUA 1OGAD 2E7LC 5DJDB 3ULVF 4G8GA 1J0JA 2L7UA 2ZOKA 1RQ5A 4OCNC 4WWKB 4HC1H 1TZIB 4JO2H 4Y16B 1KEMH 4LVOB 3P0YH 2Q6WB 3BIKB 4WU5B 1WICA 1KCSL 4OD1H 1P9MC 3GSOA 4TUKL 3C6LB 2D3VA 2EDXA 3R4DA 1U0QA 4IBLT 3NIFF 4MNQB 2R1WA 4PLKD 5D7KD 4NQEA 5BRZA 3BUTA 1ZAGA 3BT2H 4NCDA 2VITB 4FHBD 1B2WH 4QHLA 4PJ9A 3L3IA 1HQRA 2P45B 4BUGA 1GGCL 3AREC 4UTBH 3QG6B 1KJ3H 3FONB 4PLJD 5GGUA 3V5DB 2DS4A 3WS3A 4OCLC 4LASH 2VDNL 4LLVB 5E6ID 3K1DA 5MENA 4GKSB 3NMEA 3TM6A 2W0PA 3TJHC 1K8IA 1LK3L 1ZT4A 3ULUD 5FA3B 3EIFA 1AE6L 2KUTA 2FEDD 2V7HA 1UWGH 5CMAB 5K9KA 1XF4A 1C5BH 2GHWB 3V79C 5FYJH 5GPRA 4YHKH 1KC5H 4P4KD 5ESVB 1BQSA 3MV9A 1DQQB 3S36L 2YD3A 4CDHA 1T03H 1B6UA 4PBVC 4AT6B 3GSXB 1R3KA 5H35A 1I7RA 4UUJA 2D7NA 5F3BA 3N50A