1AC0A

Glucoamylase, granular starch-binding domain complex with cyclodextrin, nmr, minimized average structure
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
108
structure length
108
Chain Sequence
CTTPTAVAVTFDLTATTTYGENIYLVGSISQLGDWETSDGIALSADKYTSSDPLWYVTVTLPAGESFEYKFIRIESDDSVEWESDPNREYTVPQACGTSTATVTDTWR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords GLUCOAMYLASE
publication title Solution structure of the granular starch binding domain of Aspergillus niger glucoamylase bound to beta-cyclodextrin.
pubmed doi rcsb
source organism Aspergillus niger
total genus 10
structure length 108
sequence length 108
ec nomenclature ec 3.2.1.3: Glucan 1,4-alpha-glucosidase.
pdb deposition date 1997-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00686 CBM_20 Starch binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ac0A00
3K0WA 4ZSOE 3UX9B 5IB4B 4JO4H 1UQSA 3KYNB 2AI0L 5D1QA 4ZUVA 3BSZL 2BHYA 2EYTA 4NN5C 3SDCA 4MJID 2P49B 1CICA 1NCAL 2H32B 2CLVA 5CWSA 3WXVL 2Z91B 5FYKU 3ZL4L 1TFHA 2ZKHL 3WNPA 4G8GD 3ES6A 4XPTH 2VXUL 2H6PB 4H8WH 1GL4B 2ZPKH 5INDA 2JJTC 2RJMA 4NNXB 1S9XB 3KWWB 3Q3GB 3LHPL 3MX0A 4R8WL 4OLXH 3OBAA 3F12B 4YWGL 4XCCH 4OZHF 3HC3L 5C07D 2VNCA 5DQ9A 1ZVSA 4NKOB 3BP4A 2R2BB 4KTEH 4RDQF 4JKPH 1KTRL 4FQHB 3QAZC 3QIUB 3WJLA 1CXLA 1G7JA 2FX9L 3IDMB 4YBQC 2AEIT 2CIIA 3S88L 4S1RL 4UIKL 1MHHB 5T33L 4FQJH 5C0DA 3SDCC 1CICC 1KB9J 3IFOA 4LLAA 2PETA 1IGIH 3SKUD 5EU4A 4RISL 5CFHA 3GSQA 4Q9QL 1GGIL 3RVTC 2XZZA 1BVKA 1PDKA 4NBYB 1MNUH 3QQ4B 2R0LL 3U30C 1ZLWH 2BNRD 4M1GL 2XRAL 2FSEA 2XG4A 1S7QA 3DTXB 1T89A 5CZKA 3FQWB 1DL7H 4GG6B 2WINA 1BX2A 2EE3A 1EEZB 1MCOL 2X4TA 3B9KB 1EGJA 1MCHA 1NSNL 3N1MC 1T20B 5CP7B 4HXAL 4P46D 1PSKH 4PRPB 1RK1A 1WITA 4J4PA 3V7AG 3TZVB 3QNZA 2R4SH 4OJFH 2LTQC 3CFCH 5F7NC 1KGCE 4JFXB 1JI1A 1I8KA 4NCC1 4M4PA 1LE5B 1OTSC 3ARTA 4XWOD 4LDEB 3D0VB 1ZHNB 4C83A 1LWRA 1NGZB 1S7WA 1T1XA 5DD3L 3EOTL 3FFCA 1NAMH 3ARPA 3GSWB 4KKCC 3S3SA 4NO2B 5DURD 2RCSL 5D7LB 3QDMB 4PJAB 1AGDB 3MCLL 4P4KD 1QFHA 2H2SD 2ZCKL 5DQJA 1CFQA 3IKKA 3CFJA 4HX1B 4EUPH 5E1AA 3L1OL 2AJYH 1HN1A 1TJGH 3UTQB 5F8RC 4X9BA 2DQCH 4GS7B 4XVUD 1RZGB 4PJDB 1NMBH 2HT2C 5CBEA 5HYQB 3P0YH 3M1BB 3QUZB 1EH9A 5JA9A 2FIRT 1TETL 5DLML 4CADA 2EIEA 5HDBF 4XAKD 3ZYZA 4DEPC 2YD1A 4YDIL 2DJSA 4XCNB 2F54D 4ZMAT 2KL6A 4KPHL 3ESVF 1FQ9C 2R23A 4P5MA 5E8PA 2H1PH 1JPSL 2XKNA 2DIBA 2H26B 3O6FC 5E2WH 15C8H 2X4OB 1NUGA 1T2XA 4ONFL 1REIA 4NQEE 4TOYH 1AGFB 2EDLA 4JANA 4ODBD 4X99A 4E41A 4RAUB 1CD0A 4QHMA 4JG0L 4YE4H 3PWVA 4AYFA 4P2QA 3ULSA 4AG4H 2E6JA 3GSXA 5E2VL 1S9VB 1R24B 1F11B 2C26A 4I1NB 3M17A 5DWUH 3VXRA 3HFML 2P8LA 4YQXH 5FYKH 2IF7A 4KDTC 3OAZH 3BJ91 4UQ2A 1T04B 3FRUA 3HC4L 4MCYB 2R1XA 2QKIB 4HUMB 2V2WA 2DWDA 3RA7H 2PW2A 4KDWA 2OCFD 2W0PA 1KCVH 1U8MA 1Q38A 2X4UB 4F37K 1ITBB 1A9BA 3QFJD 2R9HD 3MRRA 4R2GD 5GRVK 4LPVA 3G5VB 3EGSB 4ERSH 2XFXA 2XZCL 4PGEB 1DBBH 4M8QA 3TA3A 3LPFA 1B9ZA 4MQXC 1LHZA 3JVGA 1H8NA 2NY5C 4I3RH 1QSVA 3PWJB 5AZ2L 3TO4C 3K2UH 4R26L 4GH7B 3LAFA 3DXAB 2EDEA 3CX5J 3QYCA 3SDXE 3V0VA 3DSFH 3QNYA 1P7QB 1S9YA 4Q9RH 3ROLA 3ALXA 1CK0H 2MQ0A 4P9ML 4LPUA 5FF6A 4JDZB 1YECH 1EO8L 4KHTL 4MJ2A 1DQJA 2H8PB 2Z31B 1WT5A 5CSGA 5C6WH 1VADB 4L3AA 2GFBA 2WUCL 4LVHC 2BSED 3THMH 4NQED 3UAJC 1NC2D 3R06B 3RY5A 1PQZB 5H8DA 5E5MB 5F7DA 3AMKA 4NT6B 2IQ9L 1IC7H 5FV1L 2X4SA 5KTEH 4M1DH 3B9EA 2BFVH 3U82B 5C09E 3TA3C 1IGML 3AAZA 5DMYA 3TBSB 5FM5O 2CIKA 5B8CC 1KIRB 1RZJC 3AM8A 5T1LD 4HZLB 4M61A 3TIEB 1AGBB 3RL2A 5IHZA 5TH2A 4YH6A 3SE9H 1GVIA 3KLAB 3GRWH 5J1AB 2DTML 3IXAA 1JWSA 2DICA 1OAXH 2QSQA 3ARBB 3CMOH 4F3FA 4F37F 4RFNC 1KXQE 1RULH 1Y6MR 3O4OB 1CWVA 3UJJL 5EO0A 4GRMA 4IRSB 3C8DA 4QRTB 3UTSE 5EH1A 4KJWD 1YNKH 3HPJA 2D03L 5AYUH 2AS5M 4ETQB 4PYGA 4X7TA 1I7RB 1VDGA 2DLIA 1QSEE 1LGVA 1X5IA 4U6XB 4ODUA 5FECB 2YRPA 4OZFG 2R0WL 4J3XA 1N6QH 1Z3GH 3DGCR 3FOMB 5EZOL 1ZA6B 2V5TA 5LJYH 1INQA 3MRBB 3WN5C 3DARA 4O2CB 3HTLX 1QEWA 4P9HH 1WZMA 5KSBE 4HDIA 1DBMH 1WBYB 4FZ8H 1I8LC 1HQ4A 4OUOA 5DJ0B 2W9LA 43C9B 1ZT1A 5JUEL 5DDHB 2RHEA 1YEHH 2HFGH 3QRFM 3P77B 1MSPA 4NJ9H 4ENEC 4S1SL 3QDJB 2KZWA 4BZ2H 2X1XR 1U8PA 5C09D 1AIFA 1YEDA 3SKJH 4R7DA 4O02H 1B4JH 3NIFE 5D6DA 3VGHA 3BQUD 2ZJSL 2HJLA 1GYAA 1MCPL 2DLTA 4NN5B 1QUNA 3NCJH 5K59E 1A21A 2ADIA 4QRRE 5EUKA 2VLJD 5GISL 3PGCB 2YUZA 4PG2C 4OGYL 2RBLA 1ACYL 4HBQA 4YX2L 1J1PL 5I1HL 5ALBL 2XY1A 3EDDA 4XHJC 4CMHB 4KUCD 4U1JB 2VMFA 3MJ8B 3I75A 3G6DH 3QUXD 4Y8AA 3QCTL 5T1KA 3OJVC 3WS6A 5IQ9A 5KSUA 2HLFD 5KG9B 1R5IA 1FRGH 2D7TL 4X0KA 5E0QA 4N0CC 3MACL 2X4QB 1EEYB 1JNLL 5FKPB 1JTOA 3O2WH 4HPYH 5JQ6L 2APTA 2XXCB 5D1QB 1QFWM 4ZUVB 3EBAA 3V6OE 2EYTB 5JA8B 1KC5H 1WWCA 2GCYA 3SDCB 2XT1B 1EEUA 3RVWD 5ADPH 2JB5H 1CICB 1EDQA 1QFPA 4XP5H 5CWSB 3O6ML 6FABL 3CU7A 4NQCD 4XTRD 2WBKA 5EIQA 2CDEA 4ODHL 3ES6B 2HTKC 1A6UH 1BLNA 1QYGH 4WHDA 5I1GL 4RGNE 5INDB 1TZGL 5BRZD 1HI6A 1LE9A 1LP9E 1GGYA 5GJTH 5IMKB 4XNYH 2VXTH 1IGCL 5HD8D 3I6KA 3EJZD 5DQ9B 1ZVSB 3BP4B 1AI1L 3KPSE 4Y4FA 3KYKH 2GJ6A 3SGKC 1U8JA 3VFPA 1G7JB 4QRRD 2LTQB 2CIIB 3W11D 1QBAA 1MI5D 1BFOA 4QNPE 1IGFH 1TMCB 3LS4L 1LDPL 4PJ5D 4NFCA 2YPLE 3IFOB 1ZGLA 3ABZA 1XR8A 2K1MA 2PO6D 4JPVL 4S10A 5MHSD 4WI6A 2CJUH 3BPLC 3JUZA 3GSQB 1X6NA 5I8OL 3RHWK 1BVKB 5I1EL 1ZMYA 2A74A 4NPYA 1XCTB 1QACA 2FSEB 5CAYB 4X7SL 4OCNC 1S7QB 2XWJA 2WINB 1BX2B 3ZDZF 5BV7L 2X4TB 2LU3A 1OPGH 1ES0A 4DOHE 4H1LG 2ICES 1JNNL 5A2FA 2YZ1A 5DZLA 3QNZB 4NNPL 1GH7A 3A67L 5D2LA 5ALCL 3STLA 5BS0E 1T1YA 4PFEA 1NBVH 3WFHA 5ITFA 3SCMA 2V17L 2X4NA 1RVFH 3V2AR 4C83B 5GZOC 4NQSA 3VWKC 2CLZA 1S7WB 2KZ1B 2OP4H 1T1XB 5JLZA 4APQD 3P30H 3FFCB 3HI6H 5TPWH 1FVEA 5J11C 4H1LA 4NC1E 1RD6A 3N85L 5DVLA 3CFJB 3LQAH 5E1AB 1A4KA 1IC4L 3GSRA 3WLWD 1A1NB 43CAA 4JFFA 3LN9A 3VMPA 4U1SA 5CBEB 2CRYA 4MWFA 3CVHH 4F9LC 4I2XE 1YJDC 4KK8D 4BQ8A 2EIDA 3DX6A 3QDME 4CADB 2YSSA 5DC9B 1CQKA 2YPLD 4L3EE 4KY1H 5KJRL 4LCIH 3VI4E 4WW2F 2A38A 3RU8H 3QIUD 5E2TH 3C2SA 4D8PB 1DSFL 2R23B 4P5MB 3TWCL 3V4VL 5E8PB 3MBEA 5JHDA 1KCLA 2XKNB 4NQDE 2X9XA 3VXUA 4ELKA 1BIIA 3QHTC 4BYHA 4JANB 2FL5B 4X99B 4YZFE 4E41B 5KSVB 4QHMB 3PWVB 4P2QB 3ULSB 2DBLH 3GSXB 4PR5A 3O81A 3BWAA 2AK1H 4TTDD 4U0RC 2V7NA 2EEBA 2HP4A 1DEDA 3M17B 1I75A 4QXWA 3FZUD 3VXRB 1CU4H 2DQHL 2P8LB 4YEEA 3EIFA 5IK3A 5BS0D 3T04D 2EZ0C 2P8PB 4NKMA 1QRKA 4PJEA 3UTZA 2BVPA 4UQ2B 4HUUA 2R1XB 5E2UL 2PW2B 5IT2H 1FGVL 5DC4B 1ZA3A 4O2FA 5L2JA 4OIIL 1U8MB 3B9KD 4LVHB 5HHOE 1JTTA 5CIPH 1A9BB 4PRPD 4BQBA 2F58H 2VXSL 3TZVD 1U8HA 2XN9E 4YFLI 3IFPA 5DD6A 3MBEC 3ARFD 2HYMA 1YC7A 2E9BA 2XFXB 3SOBH 1T4KA 4M8QB 2EXYC 3ZE0E 4WWKA 3TA3B 3NABL 4LSSL 5CS7A 5B8CB 1RMFL 5KSAA 3X14A 4OBRA 1NCCH 4K8RD 3HR5A 4PD4J 4QTIL 5D7LD 3VGFA 3GI9L 4BZ1L 3V0VB 1A64A 3CPLB 3QDMD 3MZGB 3QNYB 2BVEA 1S9YB 3ROLB 3UZQA 1L4IA 3BZDA 4RFNB 5FF6B 3VFGL 5GSVB 3E8UH 1Q0YH 2J6EH 1DQJB 1I1AA 3IRZA 3MV8E 1JPTL 1N6UA 2P45B 4PJIA 3H2WA 1NCBH 4H20H 2GFBB 3QUZD 1KCUL 4EEEA 1TJIH 1PW3A 1DZBA 2D7QA 1WEJL 5CILH 5DTFA 2FDBP 5F7DB 5I18L 4JO3L 1U8QB 2B2XL 2WIIA 2X4SB 5I15H 1UCBL 1V7NL 4PP1D 1H3TA 2PN5A 5EWIL 3WN5B 4YHYC 2CIKB 2BMKA 3G6JA 4XB8A 1G1YA 5EU6A 4KUCF 1INDL 4M61B 4Z18A 3RL2B 4KROB 1F4WH 1NGXB 1QBMH 3T0EC 2BVTA 3IXAB 5IWLA 1JWSB 4F3FB 2KH2B 4LRIC 3BXNA 3VDAA 4F9PA 1CF8L 2BXZA 4Y4HC 4XCEA 5EO0B 4GRMB 5DJZA 2VAAA 3HE7C 1CGTA 4XXCA 1RZKL 3STBA 2DS4A 4KK6C 4I48A 5D72L 2F8OA 3HPJB 2FYYA 1NJ9A 5KSBF 3ARDD 3VD3A 3HMXH 3AMLA 2CDFA 2EO9A 1IC1A 1ZVYA 4X7TB 4DVBA 1PKQA 4JJ5A 4LGSB 5I8EA 3PIQA 4KHXL 3RJDA 2AJUH 4ODUB 2N7AA 4GKNA 4DGIL 1FNSH 2H2PD 1ZEAH 1INQB 3QJHA 3WKMH 3NCBB 1YEEH 1FNEB 2MPAH 1QEWB 4G9DA 5CJQL 4PG9A 4HDIB 4I3GA 4FFYH 3EYUH 5C92A 1D5IH 3MV8D 1HQ4B 1VACB 5IWLC 4D0CB 2IH1A 1GC1C 3NIFF 2YPKA 2A9NH 1ZT1B 3VJ6A 3MXVH 3FTGA 2CDGA 3QDGB 4OZFB 4XB7A 1X5ZA 1AXSA 3G5XA 3QEGH 4XP6L 5IVOA 3S36X 5F1KC 1CN4A 5F9OH 4POZD 1NCNA 1U8PB 1AIFB 1YEDB 3NA4A 3QUML 3NTCH 3MRCA 4X80H 3M8OH 2Z31D 1SEQH 3HZVA 4PTTA 2OS7A 5BJTA 5CBAA 4GRLA 2ZNXA 2HJLB 3NIGE 2HT4D 5F96H 1JYWA 4PREA 1AXIB 1OHQA 2ADIB 2NX5A 1PEWA 3MODL 4EXKA 2OTWA 1ADQA 4Y16A 3DMMD 5LBSH 4MLSA 1S7VA 3BGMA 4H25B 4PIRF 3CDGB 5C6TH 4P3DA 3TYGL 1NFDE 5JIPA 5IQ9B 5FK9A 5KSUB 5FOBA 3VFWA 3ARBD 2HJKA 1R5IB 3IS1X 4OD3H 4X0KB 5A1AA 3UPRA 1D5BA 3K4DA 5IF0A 4O58L 1YQVH 2VDLH 3ET9F 4IRSD 1M7XA 4NHUA 4FXGB 3F7YA 4AH2A 3BPOB 2R4RH 4NQXA 4NM4L 4IIQC 3VWJD 4JFZH 2GCYB 1NGPH 5SWSE 4OI7A 4XI5C 1DVFA 2E7HA 1F8TL 5TGBA 2CDEB 4UB0L 1FZJA 3C2AH 2AJXH 3QT2A 1BLNB 3HAEH 4Y16C 4WI7A 3W5NA 3AREC 2A1WH 3IDXH 4JHWH 1HI6B 1LE9B 1GZPA 2H32H 1FH5H 2NY0B 1U3JA 4QNPF 1A6AA 2FHBA 4GXVL 3FT3A 4M7ZC 3A6OA 1VESA 2RR3A 3I6KB 5DC0A 5EZIH 1AO7E 4Y4FB 2FX7H 5JTWA 2GJ6B 4RQQA 2NY1D 1U8JB 5C2BH 3VFPB 4UV7L 3SE8H 3QWRA 1F3RB 3AVEA 2I60H 3QDJD 4V1DE 1BFOB 3O2DH 5KVGL 5D5MA 3B2UD 2WV3A 3D9AH 4JO2H 3OZ9H 5HYFA 1ZGLB 4G80A 3CFKA 1OB1A 1AY1H 4N1EA 1J8HE 3DO3A 4U1LA 1HXYB 1IGYA 5F6HJ 3MLZH 1INEL 3MQIA 4YK4C 1TTUA 1QHOA 1MFCL 4D3CH 1R5WA 2A74B 5HHNA 3QWOA 4NPYB 4QLRA 2E27L 3P4NA 1CL7L 5FAAA 3UBXG 1A7OL 2J88H 5HHQA 1XH3A 1U42A 2XWJB 4N8CH 1FNHA 1LD9A 3DX7A 4WEBH 4XPFH 4DN4H 4GG6F 1KEGL 3DROA 1WTGT 5LGKA 4RMVA 1ES0B 1LO4L 5DUPH 4X6DA 1J05A 2E6QA 1CGSL 1JVKA 2Z35B 3LEYL 4JQXC 4JR9H 1AFVH 3BDYH 3OR7A 5D2LB 3STLB 2NY3C 4RFOL 5IFAL 1P7HL 2WIMA 5HDQL 4A2LA 2JLLA 4M02A 2CKBA 4IBLT 2PR4L 3WFHB 3OAUL 1BM3H 2X4NB 1MAMH 1JGEB 3L5JA 1ORQA 1UZ8A 1FHGA 4NQSB 2CLZB 3QG7H 1FZMA 5JLZB 3BW9A 4GAJH 3KGRA 4OM1L 1FVEB 2NY2C 4H1LB 5D1QD 5JR1H 3C6LC 3O2VH 4KZDH 3V79C 1JMXA 3SDCD 5D8JL 4WHCA 3OB8A 1M71A 1A4KB 2FO4A 3H42L 2F5AH 3S3PA 3GSRB 3VI4F 1FV1A 4K8RH 3BP6B 43CAB 4JFFB 1I85A 4JRXA 4PJDF 5DS8B 4U1SB 4MWFB 5I73C 1QRNA 4LPYA 4NBXB 1BEYL 3S5LG 2Q76A 4K23L 1KEML 5J13C 5H35A 3DX6B 3PWUA 1H3UA 2YSSB 4UT7L 3OV6A 4OQTL 3RIAK 2Q3AA 2YS4A 4XHQA 1G7MA 1JIBA 1GOGA 3MLWH 5LWYH 3MBEB 3WHXA 5JHDB 3VFVA 4YAQA 2J7LA 2XZQH 4ELKB 5J1TC 4M5ZL 1BIIB 3S5LA 1EHNA 3TFKD 2BHZA 2Z93A 3VGAC 4KJQC 4PR5B 3IDUA 3TP4A 1WFTA 1FAIL 5AUMA 2V7NB 5A2JH 1GGBL 2FEEL 3LDBB 2L4OA 3EUUA 2A6IA 1CYGA 3BWUC 2ESVE 5IK3B 1P2CA 2P4AB 4PJCA 3IDJA 3B2VL 4NKMB 3HNVH 1YY9D 2OBGA 2O5YH 2OL3L 2BVPB 4PJEB 3SDYH 3UTZB 4DQOH 4JKKA 4HUUB 3NVQA 1N7ML 4MNHA 4FQLL 1KIPA 1XGTA 8CGTA 1RFDH 2QR0A 4O2FB 5L2JB 4R4BA 1E4WL 3CLEH 4RIRA 2HWZH 3BP5A 4J4PD 1M1SA 1H5BA 2A2QT 1OAUH 1PX4A 1U8HB 2GIYA 1OAKL 3IFPB 4MJ4A 5DD6B 4JFPB 4UOW1 1T4KB 3BKCH 5C0CA 1WQVT 2YUWA 4P3CL 4TNVK 4WWKB 5HTSA 1J7VR 1KACB 2A6KA 2VC2L 5H94B 1FYTA 3VA2C 1VGKA 4ZO8A 5KSAB 1P84J 2LAGB 4HIJA 3S35H 3FFCD 3X14B 3HR5B 4B0MM 5JHLH 3U7AA 5L2KE 2IFFL 1SY6A 2Y6SC 3RIAF 4DW2H 1T80A 2B7DT 1D6EA 2VITA 1VSCA 3U0TA 1YMME 1MHPH 3DETC 5CZXC 1QSFA 2DQTL 1I1AB 3NZHH 3HE7B 1MF2L 1HK6A 5C6PB 2L7UA 4TUKL 1XF2B 1G7PA 4GKSB 1EJOH 5DTFB 1F58L 2AXHA 1A0QL 4JE4B 5F88A 4R4FL 4OSUH 2WIIB 4OF6A 4BUHA 4OLZH 1I1CA 2D7NA 2CH8A 1HSBA 3P2TA 4M62H 2EDDA 1FORH 3S37L 2QQNL 2BMKB 1RIVL 3G6JB 1YPZE 2AJVL 3IRPX 5EU6B 3OR6A 5GGVH 1BQHA 1MCIA 2OMBA 1IQWL 4ORGB 4E41D 2EDJA 4P2QD 4P99A 5C0JB 1C7SA 4IRJA 4QHKJ 3P0VL 5EZJA 1EBAA 2OI9B 3BAEH 4XCEB 4QXTA 1JGDB 5DJZB 2VAAB 1S5IH 3VXRD 3AROA 2QQKL 4F57L 4I48B 2BDNH 3MZTA 2FYYB 1NJ9B 1PKOA 2CDFB 3HI5L 4YHPA 5EC1A 4KKAC 4DVBB 1BQLH 1PKQB 1NMCB 1C5CL 3PIQB 5BCAA 1XGUB 1F00I 3DIFA 5FYJD 3LEVL 4GKNB 2ED7A 3QJHB 3I2CL 4G9DB 4PG9B 2GSGA 3TA3D 1HH9B 3WXWH 4K9EH 5BXFA 1F5WA 4WVRA 2IH1B 5E4EC 1V7ML 2YPKB 3BT2H 4OI9A 2GSIA 3T3PF 1YMHA 2AERT 3FTGB 2CDGB 4IRJC 5CEYA 5BMFL 1K4DA 3G5XB 3NIGF 3OAYK 4GO6B 3IGAA 4YHKH 1UM4H 4F2MA 3QIWC 4U1HA 4LARH 2VR9A 3E3QC 3MRCB 1FNFA 2O5XH 5F3BA 3HZVB 4PTTB 3E0GA 5BJTB 5CBAB 2CUMA 3PUCA 1VFBA 4GRLB 3VFNB 1KSRA 5B4MD 1KPVA 4G7YH 3NFPA 1NFDF 4PREB 4Y5VA 4MAYA 4Q9CA 2W0FA 4K3EH 2NX5B 4CVWA 3PWLA 5FGCB 2EDYA 2VDRL 2OTWB 1EHAA 1P6FA 5I76A 1A3LH 4Y16B 3NCFB 4KMQA 1KLGA 4MXVF 4IJ3C 1S7VB 2APBA 3BGMB 4LU5H 5D6CA 4XAWL 5D70L 1R3HA 2LU7A 4P3DB 3TVMA 5E95B 4KROD 1MVUA 4AEHL 3T2NH 5FK9B 1QKZL 1TQCC 5FOBB 1MEXL 1IZJA 2HJKB 4PBVC 1FE8L 4OFYA 1SVCP 4HAFA 4Y1AA 5MERB 1FIEA 1QLRA 2WWKT 3BI9X 1D5BB 1PX3A 4CU6A 5IF0B 4NHUB 3F7YB 4AH2B 1UEMA 3NCMA 2BY0A 3WE6A 5C7XH 1HE7A 1JHLL 4Y5VC 1DVFB 3RFZC 4ZPVA 2KPNA 4MXQD 5TGBB 4K3HA 3ZTNH 3V95A 1FZJB 3OWEA 2Z92A 1G0DA 1GZPB 2VZUA 2XQYK 5ILTH 3L5XL 4LLQA 1MREH 1W72A 2XWBA 1FLTX 3OAYH 4GMSL 3GKWL 3FT3B 5JW4Q 3ZMRA 5GS0L 4L8SC 5L6YL 3QA3A 4ALAL 4WFHE 5IMOA 3KLHC 1WK0A 4RQQB 5D2NA 3GJEA 3KPRA 2HFFA 4OLWL 2NY3B 5C0ND 4UAOC 2PTTA 4HJ0C 1KFAH 4PJHE 3DVGA 1OTTD 4KUZL 3W2DH 3S4SG 5BQ7B 5I0ZA 2ATKA 1A6VH 4TQEH 3SJVA 4Z76B 4BSJA 3UYRH 4G80B 1OARL 2NY2B 3CFKB 1OB1B 1T03L 4MD0A 2WSKA 3OHXA 4U1LB 2HVJA 1IGYB 3GK8L 4MXWH 2QSTA 1R3JA 2J3SA 1R5WB 3CSPA 3KYOA 5HHNB 1KBGH 1ND0B 3C08H 3QWOB 3ULUC 4QF1A 3P4NB 3RKDC 3TO2A 3MLUL 2J8OA 2IBGA 5HHQB 5JIIA 1XH3B 3DX7B 1LD9B 2BERA 4EOWH 4NWTH 4TVPE 3U7WL 1BREA 3DVIA 5I73B 3DROB 3V0WL 1MQ8A 4X6DB 5IB3B 5J13B 2HTLC 4XP9L 5D93C 2VUOA 1J05B 5T1KD 2B4CH 5C0AE 1PD6A 3D2UA 3MRMA 2KQMA 4UTAL 1UM6L 3IT8D 3OR7B 5ESQA 2E8YA 3WD5H 2IH3A 1F6AA 2JIXA 2X4PA 2CKBB 1EGJH 2D2OA 4OFVA 2AXGA 3QRGL 5I1IH 2EE6A 4UDUA 5HGGS 1UZ8B 1I1FA 3BHBA 3TN0C 1BWWA 1FZMB 1P4IH 3BW9B 5EBWA 4M48H 1A7PH 5FB8A 1YEKH 5EU7C 5LCVL 3WFBH 3SEPA 4OFPA 3VGAB 3QSKB 1X44A 2Y72A 2W9DL 1AR1D 4K07A 1ZOXA 4WFHD 1M71B 3O3AA 3IJYA 4FQXC 2DQJH 4Z7WE 5CCKL 4HT1L 1FV1B 2FCBA 4LSDA 1NFIA 1MY7A 4JQIH 4KKBD 4JRXB 2O5ZH 3VGEA 4N9GA 2FGWH 1QRNB 5I1KH 2NY0D 2GI7A 5I74B 2Q76B 1JHKL 4ZS7H 4Q58C 3B5GA 2P47B 3PWUB 1U2HA 2VXVL 3CNKA 3BP7A 5F7EH 1NQBA 5HGAA 4XMKL 2OZ4L 4Y4FD 1CGXA 5EIVA 4HH8A 4CVXA 2NR6D 1G7MB 3LQMA 3QIBD 3BJLA 1RZIA 3VGDA 1VFAB 3WHXB 4NQVB 4YEFA 4YAQB 3VFVB 2BVOA 3S5LB 1OSPH 4KVCL 2V6HA 4W6XB 1A3QA 2Z93B 4OAWA 4TVPD 1BVZA 5DJ6A 4HXBH 5KZCD 1KJ3H 4G43A 5AUMB 2V2TA 1OLLA 3CSYA 5I1LA 1HHHA 2A6IB 1R0AL 1P2CB 4LFHG 4PJCB 3IDJB 5F7MC 2BNQE 2R2EA 3VXUE 5D9SA 4MNHB 4C58B 1XGTB 4QHLA 2QR0B 5J6HA 4G8EB 4R4BB 3OGCA 3BE1H 4JZNA 4XP4L 1YEFL 1U41A 4RIRB 1QFWL 4WHTA 3BP5B 3LPGA 1H5BB 3TF7C 1AGEA 3MNWA 3WL9A 4MLIA 1RK0A 3H9YA 2GK0A 3MJGX 4KXZI 2EYSA 5FYJH 2WK2A 3PL6A 3SCMD 2A6KB 1X5GA 1FYTB 2IAMA 2BX5A 3HUJE 3NFSH 5F9WC 4N0YH 1VGKB 1ULVA 2FH6A 5IUSA 4HIJB 4QXUL 4N8VG 2EDRA 4WUUA 4KRPB 1L7TL 1PGRB 5IW6A 1D6EB 1GOHA 2VITB 1C1EL 1T7WA 4QRSA 3U0TB 1QSFB 4Y2DC 4FQQA 1WBXA 4JFFD 4MZ3A 1OAZH 4XNUL 3FHAA 4G3YL 2YD8A 4MS8C 4JDTL 1G7PB 5CGMA 4BH7A 1TTGA 1MCRA 3UTPD 5FHAH 4N8VA 1DCLA 1HYSC 4J2XA 4UIMA 5F88B 2AJZA 3H9HB 3VXMA 4JM2A 4WGWB 2YD4A 3C09B 3RRQA 3ARQA 1HSBB 2D4FA 4KI5E 4X7CC 1FDLH 4XVSL 5JHDD 3GSUA 4PJIE 5D1XC 3C5JA 3OR6B 3VXUD 1BQHB 1ZGLP 3HR6A 1T2QL 5E4EB 3ULVE 3SGEH 3NH7L 3TT3H 4OLVH 3GMNA 4IRJB 5EZJB 4QXTB 3RAJL 1KJVB 5KANG 3S7GA 3VG9C 3MGTA 5EIIB 4TSBL 1VPOH 2PXYC 1I7UA 3UXFA 1MIML 4LIQL 3BZFA 4AQ1B 4GMTH 1JWMA 3NAAH 4YHPB 5EC1B 1ORSA 1JFQH 4JM2C 1I3GL 4WY7L 4F15C 5T1DL 3DIFB 4UV4L 2WNGA 3UCRA 3RVXC 3CMGA 3IFLH 1AD0B 2IG2L 2D9CA 4PJBE 1S9KC 2G5BA 2Z4QA 3QCVL 3EJYD 4M6MH 2P24A 1OY3B 5F7FA 1BZ7A 2GSGB 1A7RH 4WWKD 5TQ2L 3WDIA 4NGHL 1AQDA 3ILQD 3QI9C 4NZTH 5BXFB 1NMAH 4FP8L 4ZNEE 1KNOA 4PJGA 2W65A 5KSAD 1CDBA 2GSIB 1A7QH 4UINL 1YMHB 5CEYB 1K4DB 3LQZA 2OLDA 3CVIH 3IGAB 3MUHL 5IR1A 2OM5A 3N1PC 2VDNH 1LEGA 4G5ZH 4F2MB 4U1HB 1A6PA 4Z6AT 1UWEL 3ULUL 1W0WA 1I8MA 1I1AD 5KVDH 3BOVA 2QSCH 3DV6A 4GUPB 5HPMA 1AKJA 1IFHL 5F3BB 1A47A 5EORL 1VFBB 2NTSP 1KPVB 3UTTE 3NFPB 4UT6H 3D39E 2QL1A 4Y5VB 3GBNL 4MAYB 3PWLB 2VLME 2OR9H 4LKCB 3RUGA 1UVQA 3O6LL 2CO7B 5I76B 5KN5A 3NPSB 1KLGB 1NUFA 2N7BA 4K2UL 3O8XA 2DI9A 4KQ3H 1N59A 2OJEA 5F3HB 1RUQL 4NIKB 5GGQL 1R3HB 2B20A 3MTRA 5EU6D 5CSBA 5IMMA 3TVMB 1MVUB 5I30H 3X13A 4LLYA 3AFLA 4FFVD 1RUML 5MI0C 3PGFL 2VDQL 1QLRB 4R90H 3HHRB 3MRNA 1RJCA 32C2A 1CCZA 5LQBL 3MPCA 3DOSA 1FPTL 3WE6B 5EU3B 2VZSA 2FB4H 2NZIA 5JW5B 3FQTA 5A2LH 4N0RA 4PBXA 4ONOA 1O0VA 4ZPVB 2R1YA 4TPRH 4BELD 1UJTA 3UO1L 2YZ8A 4JFEA 2RGSA 3V6FA 1Z6JT 2FLRT 2J12B 2Z92B 5AAMA 4OQ1A 3O8XC 5IVXA 3LKQA 1S5HA 2J1KA 3JWDC 1CDYA 2NQCA 4LLQB 1TCRA 1W72B 2XWBB 2V5YA 5A2KH 2EH8L 1RUKH 1HIMH 3I3BA 1LO0H 3P11H 5FM8A 2X1PA 1MHCA 4JG1L 4Y7MA 4RDQG 3QA3B 2G75A 1N64L 1SJEA 5DUBA 3ZHDA 2IC2A 1H3VA 5GGTL 3SGDH 5IMOB 5GPRA 4GAFB 4MZ2A 4EI5C 5D2NB 5D93B 3GJEB 4PJXE 3CH1A 1KCSH 1C16A 3KPRB 2H41A 2HFFB 4NUJA 4HEPG 2A6JA 5ACZA 1TJHH 2PTTB 1A6TA 4X9HA 1BGXL 3DVGB 2A77L 4BKLA 2ATKB 1OTUD 1HEZA 2VIRB 3SJVB 2EKJA 2CKNA 5E6IA 4XNZC 1RUAH 1IVLA 4GRLD 2D31B 4MAUH 4MD0B 1JRHL 2HVJB 1VGEL 1LO5A 4TVPH 5C0GA 2YN3A 2NX5D 3KYOB 4HUNB 4QF1B 1I9IL 4R96A 1DQMH 5E5UB 5I0DA 2BVUA 3TO2B 5D5ME 5BV7B 1E4XI 2AEPH 4Y16D 3FN0H 3PG2A 5KVMC 1FGNL 3UBXI 4DTGL 3ZDYF 4DFHA 3FQNA 3RWCA 4PS4L 4YGAB 2ARJQ 3SDAA 2L0DA 3MRMB 3D2UB 3U9PH 5D2LF 1I9JH 5ESQB 2IH3B 4U3XA 4FFZL 4DGVH 1F6AB 1HZHH 2JIXB 2X4PB 2AXGB 1YJDH 1P1ZA 2R1WA 4ODSL 4UDUB 3MRPA 2XZAL 4A6YL 1I1FB 1QR4A 3BHBB 1A9EA 5C0EA 4M43H 5CEZD 3BH9A 4LCYA 2J5LB 5FB8B 3ZKMD 4M5YL 4PRHA 2ICCA 2ZUQB 4FNLL 4TNWK 3ROOA 4NO5A 3W9EA 1NDGA 3PHQB 4ZOEA 1DVFD 3MRLA 1DFBL 4YHML 3BFOA 3O3AB 3IJYB 1LO3H 5DMGD 1NFIB 4H1LH 4NZRL 3S8WA 3UZVB 2J4WL 4LQ1A 5GRUH 2Z8SA 2UV3A 1TZIA 4N9GB 1BPVA 3RZCA 2HAZA 3HNSH 1FL6A 4NHCL 2R0KL 4YXLL 4OQTA 4Z7NE 2IBZX 5FYLH 3CX2A 4FQ2H 4OD1L 5DGQA 3INUH 3C8HA 3MLYL 3SDAC 2CMRH 3BP7B 5DJXA 4M7LT 5HYEA 1G84A 4OCLC 1YEGH 5HGAB 1UC6A 2EDTA 4N0FA 4TSCL 4G9FA 4CVXB 4NN7B 5EA0H 5CD5D 3TJHD 3QPQD 1RZIB 3H3PL 4F7CA 5FKAA 3F7QA 2BVOB 2G2RA 4GSDL 2P42B 4OCWH 3TJEL 5GJSL 2XICA 4LVEA 3BN3B 4OAWB 4XPHL 5DJ6B 4IEFB 4G7VL 1YNLH 4HKXA 4G43B 1G9NL 2NY2D 3CSYB 3HS0A 1JN6A 4IDJL 5I1LB 1V3KA 1WBZA 4IM8A 4OCXH 2R0ZH 2OL3A 1I3UA 1PY9A 4U49A 5L9DH 1DDHA 5D9SB 3MYZA 4PJEF 1NLDL 3B4NA 5GS1A 1B0RA 3HUJF 1VEPA 4QHLB 1K9TA 5J6HB 3L3KA 4AK1A 5ICXA 3WNLA 4JZNB 5EOQL 5FUZL 3IDNA 4WHTB 4RGOL 3VFUA 1KPRA 4OIAA 1J0IA 4BSVB 5I66A 3KPQA 1AGEB 2EKSA 3MNWB 1RK0B 2GK0B 2EYSB 5HHXH 2DQIL 2BY1A 3PL6B 1U6AH 4GBXA 2IAMB 1A14H 4YDKL 2XQBH 1J1XH 3OF6A 3OX8A 2YD3A 5JDSA 3MBXH 5T3ZL 4CGTA 1K2DB 2R56L 4LOUC 1ZXQA 4HPOL 3RKPA 5IQ7H 5SX4I 5IGXL 1MFAL 2F74A 4LL9A 4WUUB 4LSTL 5IW6B 2DIAA 4QRSB 3AUVA 1Q0XH 5CKGA 5C0CE 4L4TA 1UA6L 5GQBA 4FQQB 4EQ3A 1CR9L 1WBXB 3EAKA 5GS1C 3BKJH 5ACMA 5L88L 4JRXD 3SGJC 4JHAH 4PJIF 1P5UA 1QRND 4HIXL 4BH7B 3FN9A 5DT1H 5GHWH 4N8VB 4C4KO 4GLRI 4UIMB 5TDPA 4OGAC 2AJZB 3ZE2E 3QXTA 4HS8L 3ARSA 5JW3H 3VXMB 4JM2B 5I6XB 3S97C 2RB8A 4UNVA 3FONA 1H9VA 4GBXC 2F8XC 1U3ZA 2IPTH 3VRLF 3HZYA 1A5FL 4AL8H 3G6JF 1TIUA 3GSUB 3U79A 3MLRH 3C5JB 3S35X 5E5RB 1B2WL 3AS2A 4LAQH 3UJTH 4CVUA 1T22A 1NCDH 4PB9H 5CJ8A 4ZS6C 3GMNB 4JCMA 1RHFA 3ARGC 3MUGA 4QO1A 4S11A 4P57A 4LASL 3MGTB 1JE6A 1YYLH 3BGAA 1LVEA 5K9JL 1I7UB 4PYHA 1FFQA 3JWDL 3BZFB 1BFVL 1JWMB 4LAJH 5TE7L 4XPGH 1QLEL 5JIKA 5TE6L 4HBCL 3MFFA 2JCCE 4DKFL 1EVUA 3D3VA 3VGGA 1FCCA 2G5BB 2Z4QB 5C0IA 1C5BH 1EXUA 2P24B 5C0CD 1BZ7B 4X6CA 4WGVB 5TE4H 1AQDB 4LHJB 1KTDA 3J8F7 1KNOB 2LV4A 3CK0L 4MHHG 4OLEA 5HJ3A 4HCRL 2W65B 4NJAH 3DURA 4TULH 4PB0H 3FQRA 3LQZB 4X7DC 3WYRA 4O4YH 3Q5TA 1JZ2A 4KRPD 2QHLA 1JZ4A 2ZCLH 2JE8A 3ME0A 1IC5L 3EDKA 1I8MB 5DVMA 1QSFD 4ZFFB 1H8SA 4H8WL 2A6DA 3AU1A 3DV6B 5HPMB 1AKJB 1G9MH 2QADC 4U1NA 1CD1A 2ZP0T 7FABH 1TTFA 4OLXL 4PV8A 4XCCL 4L9LA 4G6AC 5ESVA 3B5HA 2RFXA 3HLAB 4JKPL 3RUGB 1UVQB 2Y1VA 4FQCL 4MDJA 5I1CH 2FATL 2F9BT 3REVA 4YDVA 5KN5B 1W8OA 3O8XB 2VDOH 4CNIA 3VXPA 1N59B 4M7JL 4P9HC 2OJEB 2XPGA 4ONGH 4WFEE 5DUML 1MWAH 4GW5A 5IMMB 1M05A 4FQJL 4X7FC 1ADQH 4XPBH 3U6RA 4X4YA 1Y18A 3X13B 3I02A 5JIHA 5DGRA 1HINH 2P5WE 1IGIL 1BJ8A 5HI5D 2M1KA 3MRNB 5FCSH 3MV7E 3AY4C 32C2B 5D7KE 4ZSOA 4DZ8A 5I1JH 1MJJA 1E6JH 2NW3A 1QFUL 3FQTB 1LK2A 1XF5A 3FO0H 5IP4A 2R1YB 3BSZH 5CEZH 3K74B 2VH5H 4JFEB 1RURH 1IT9H 2HKHH 2W1NA 4Y1AE 3V6FB 1EMTH 3ZL4H 2R4SL 4QHNA 5IVXB 5CUSL 3CFCL 1S5HB 3LKQB 4LSPL 35C8L 2VXUH 1TCRB 3DYOA 5I75C 1E27A 3FAWA 3MRKA 2F53A 3VG0H 3BD5A 1FL3A 3BKYH 2C4XA 2XTJB 1MHCB 5JXEA 1S78D 2G75B 4R8WH 5F6HI 5DUBB 1NAML 4RAVA 3HC3H 2Q1EA 4KQ4H 2Q20A 2RQ8A 4YHZL 3CH1B 4UMGA 1C16B 4BQ6A 5FA4A 1FSKC 1UWGL 2W9EL 4OF5A 4NUJB 4JM4L 2Z9TA 5ACZB 1IL1B 4KGLA 1A6TB 4P46C 2AJYL 1TJGL 5D5MF 5SWQA 3S88H 2NTFA 3AS3A 3UYOD 4BKLB 4UIKH 4PJ7E 1HEZB 2UY7A 1NMBL 5E6IB 5T33H 1S7SA 3P0YL 4WFED 4Z95L 4XC3L 5ERWA 4CU7A 4J8RA 4XWOC 4NFDA 3P4LA 1RZ8B 4MAYD 1LO5B 5C0GB 1EBPA 4RBPK 4R96B 4Q9QH 2AJ3A 4NQTA 4WUKL 3OXRA 4P4KC 2H2SC 2R0LH 3MV7D 4M8VA 2GTZA 4FN0A 4M1GH 2XRAH 2UVFA 1NH6A 2EDFA 4RMTA 4N0UE 5E2WL 5T5FL 3RWCB 4XVUC 3TVMD 4HMCA 2X89A 1MCOH 4LEXH 4Q74A 3SDAB 3U9UA 3U4BH 4HXAH 5LXGL 4AG4L 2AK4A 3ZDXE 5B22A 4Y1AD 1P1ZB 2FGZA 1HH6A 3G9VA 3MRPB 5IJKC 3FFDB 1A9EB 5C0EB 1RY7B 3DX8A 3BH9B 4EDWL 3MJ9L 2ICWJ 4LCYB 3U1SL 4HJ0D 1VA9A 4U2YA 4PRHB 4QRPE 2CKBH 5DFTA 5EO9A 5DD3H 3EOTH 4KK9D 3ROOB 1D5XA 4NO5B 3RA7L 1NDGB 2WM0A 1SMAA 3N1GC 2RCSH 1KCVL 4WI9A 3MRLB 2ZCKH 1ZLUK 5AWNL 1J10A 2N4IA 1JRHI 2SEBA 1TZIB 4ERSL 4MQSB 3RZCB 1DBBL 4HWUA 1FL6B 5C70A 1JF1A 2Y9RT 1DR9A 3SO3B 2OZ4A 4Z7VE 5CJXA 4I3RL 5DJXB 4Z5RA 3PNWA 3EFFB 2L7JA 4WV1A 2VZ3A 4N0FB 4G9FB 3KPRD 2CRMA 2IALA 4YDIH 5JXAH 4OLUL 1CK0L 2DD8L 4F7CB 5FKAB 3EZJB 4BH8B 1YECL 1D9KA 2AXFA 2XG5A 2G2RB 3LSOA 4OZIE 2X9WA 4JCLA 4R2GC 4S0SD 1JPSH 1FNGA 4CVZA 4R9HA 2W0KA 4RBPH 3SJVD 4R0LA 4M00A 4HKXB 5H37H 4IMLA 3THML 1YZZA 1JN6B 2R8SL 3SHSA 4F7MA 1WBZB 5E2VH 3SE3C 2OL3B 1BF2A 3LQAC 2BY2A 1IC7L 5IV2A 3C60A 1HWHB 4M1DL 2HA1A 4NRYA 1DDHB 3TH3T 1OW0A 3L3GA 1CGVA 4J6RL 5GS1B 1BVLA 1B0RB 3NMEA 3NZ8B 1OWWA 5CJXC 4H88L 3L3KB 5ICXB 1JGLH 1MCSA 1G1CA 1MPAH 5JDJA 1LNUA 3SE9L 3IDNB 3VFUB 1KPRB 1Q72L 3RIFK 1OAXL 3D2UD 2XNAA 3KPQB 5I66B 2EKSB 2DJUA 2DLFL 1MLCA 2JIXD 5L7XL 2UYLA 3MV9E 4GBXB 2XZCH 1YN7A 1NUDA 2DAVA 4ZQKA 1GHFL 4R0LC 3OX8B 1ZLUH 1O5DT 5JDSB 3WNKA 4WW2C 3SDXA 5JPNA 3VXOA 1PG7L 5AZ2H 2F74B 4R26H 3ZE2F 1IILE 4MB4A 5FIEA 3SKOA 2J8UE 3TBWB 1GOFA 3V0AC 5CLTA 3VDBA 1UEYA 3GGWA 4L4TB 1P4BL 5FOJA 4P9MH 2CUIA 2MMXA 1WFOA 4M6AA 3QO0B 1SY6H 4KHTH 3CZJA 1SHMA 4P9HL 3LH2H 1DBML 4M7LL 5TDPB 3T1WA 4QHKI 3WO3B 2WUCH 4KJWC 3MNVA 4MNQE 4D0DA 5SX4H 5C09A 1BOGB 2IQ9H 2HFGL 4NJ9L 2YUXA 3FONB 4P2OA 1K8DA 4P5KA 3GUTA 1WAAE 1IGMH 3OG6B 2ORBH 3HZYB 4D9QE 4L4VE 4BZ2L 3WNOA 5EPMA 4W4OC 4JQVC 3SKJL 3WCYA 2Y07L 2E9JA 4O02L 3T3ME 4LSUL 1MLBB 2DTMH 3RIFF 5C1MB 5IB2A 4P57B 3NCJL 5C0FA 3UTSA 4LPTA 2HRPH 2JK5A 5KANI 2V5RA 1FVDA 1QSEA 25C8H 2QQLL 2UZYB 2ZUUA 5ADOH 3RDTA 4Q6IC 2QADB 2D03H 4D9RD 1SJHB 1VB9A 1Z9LA 3PP4H 1CFTA 1F02I 3MFFB 4OB5L 4JO1L 1ZANL 3BQUC 3D3VB 2MSPA 4LFHD 1F3JA 4M1CD 1FRGL 2DQFA 2FBJL 5C0IB 4JDVA 1EXUB 1XIWD 3P0GB 4X6CB 4JZJA 3PL6D 1KTDB 2IAMD 1GGCH 5J56B 5HJ3B 3FOLA 3T09A 2DDQL 1RAMA 3FQRB 1T6WA 4JPIA 5C3TA 2GHWB 3L3DA 4WUUD 1E28A 3CCHA 4M03A 3F65A 4KC3B 1KB5L 2IMMA 1LEKA 3QUXC 3DUHA 5DI8A 1A6UL 1F4YL 1QYGL 2HLFC 2A6DB 3AU1B 4JPWH 4U1NB 3CFDA 4PJGE 4WCYH 2ADFH 1CD1B 3FCTB 2M2DA 2X1WL 2VXTL 4PV8B 3DYMA 4L9LB 3MOAH 4YNYA 4X9GA 2ZJSH 5ESVB 5J57B 2RFXB 3VXMD 4JM2D 2ERJC 3OG4B 4MDJB 3OKYA 5C8JA 3H0TA 4ZUUA 5HHMB 3RVWC 5GISH 5DK2B 3SKNB 3VD4A 4K3DL 3VXPB 2XPGB 4OGYH 1ACYH 2ITCB 4GW5B 1M05B 1J1PH 5I1HH 4OCYL 4FMFA 3U6RB 5DMIL 1Y18B 4FQIL 3I02B 2LQRA 1Y0LA 4PJFE 5HD8C 3CXHJ 4I4WB 3EJZC 4XCFH 3DHMA 2D7TH 5DFWH 4ZSOB 2F8VA 4DZ8B 3MACH 5TQ0H 1MJJB 1JNLH 4PRAA 3V6OA 3VE0A 2NW3B 3HAEG 3T4YA 1TENA 2VB5A 2B5IB 3VH8A 5JQ6H 1NCTA 3I6GA 1LK2B 3W11C 1XF5B 5DEGA 5MP6L 2X05A 6FABH 4R97B 1LP9A 4QHNB 4ODHH 2HG5A 5DURB 2YA2A 4J3OC 2PO6C 1E27B 3MRKB 2A0LD 1FL3B 4P4KB 4CBPA 1RVFL 4OFKA 1HYRC 1DLFL 1I7ZB 3KPSA 4CRPA 4LSQL 3H8NA 3P30L 3MMEA 4RAVB 5TPWL 4ZXBA 1IEBA 3W0WE 1W72H 4OUUA 1C12A 1S3KH 5EFIA 1EO5A 3UROR 5FA4B 4W68A 5EO1A 5IVXE 2GTWA 4GXUN 3CFIC 5E9DE 5SWQB 1KIQA 2NTFB 1T83A 3WJJA 1AKJD 1S7SB 1R3LA 1RJLA 3FT2A 2WWMD 1MJ8L 5ERWB 2XYCA 4NN6B 1KLUA 4J8RB 2FLBT 4X98A 2OTUA 3MYJA 1PEZA 3DUUA 5TF1L 4APQC 5C0BE 4BQCA 4KY1L 1A2YA 2JELH 4LCIL 2G5RA 3HB3D 5I1DA 1L9NA 3ZDXF 2AJ3B 3OXRB 3WIIL 4PGZA 2GTZB 4FG6D 5CD3A 3O8XD 3AXLA 4X7SH 1K85A 2NXYD 3W9DB 5C3LD 2ICWA 4NZDA 3O41A 3U9UB 5BS0A 5BV7H 5GRWA 1TZHA 3DVNA 2DBLL 1OP3K 1MCBA 2Y36L 2BCKA 4A6YA 5K9QG 1OAYL 4KK8C 4NNPH 4AQOA 4FQ1L 5ALCH 2I9TA 1HH6B 1HKLL 4JFOA 1DQLH 1EIBA 4PLNC 1G6RL 1ROWA 3DX8B 1T0MA 3TGXA 1DQQA 4UBDD 5AYQA 1U3YA 1X4XA 4EN3A 3QIUC 4Q6YA 1K6QL 4I9WE 5EO9B 5L8KB 5DO2D 3RP1A 1D5XB 3ARFA 1KCRH 3BIKA 5IT2L 3K3QA 1P84K 4WI2A 4JFED 3N85H 5SX5K 2F58L 4ZYKA 3MR9A 3PE9A 5HYSG 1GPOH 4P48A 2SEBB 4I2XA 4TTDC 2WBJA 1OD9A 4OF7A 3D87B 2EDKA 5DQDH 1JF1B 3OKDA 3FZUC 5DRNA 2XTJD 5L0QB 4L3EA 1IMHC 1QHPA 4Z5RB 4WV1B 1FNAA 3U4EA 1NCCL 1WGOA 3EDEA 4JRYE 4BFBD 4XMLL 2G60L 5MEOA 5KJRH 2IALB 1S7UA 4NQDA 5HYSA 5C0BD 3KR3H 3K4ZA 1D9KB 1KELH 3LSOB 3E8UL 4HC1L 2GQHA 1Q0YL 3TWCH 3V4VH 3V5DA 3TZVC 3GBLA 1FNGB 4CVZB 1C5DA 3ARFC 4R0LB 1NCBL 4H20L 5E6ID 3IFNH 4KRLB 4QXGL 4U7MA 4IMLB 1J12A 5CILL 4KJPD 3X3FH 3VCLA 1OAQL 5CLWA 1CXFA 5IV2B 3C60B 5I15L 1A6WL 5GRJH 4K8RC 4NRYB 4L1DA 3X11B 5TDNA 4LKXA 3L3GB 1OP3H 4LRNL 9CGTA 1BVLB 1R3KA 3PQYE 5HHOA 1U2CA 4ZFOA 4X83A 4LLVA 5HYJE 4C57C 5E2UH 5I8CA 1LNUB 4GS7C 4W6WB 2XN9A 4TUOA 2XNAB 2C3VA 1QO3A 3FO1A 3QUZC 2W60A 5CIPB 1LQSR 2VXQH 3EO1A 2VXSH 1Q1JL 2UYLB 1OF2A 1YN7B 5FFLA 3EJJX 2EC9T 5SX5H 1HSAA 4PP1C 3SDXB 5JPNB 4PRHD 3VXOB 1RMFH 5CHNA 4HUXA 5J7CC 3KHQA 4S0TD 2QEJA 5DJ2A 3SKOB 4QTIH 3FB5A 3GI9H 4BZ1H 2BOBA 4JFHD 5F9JA 3MV8A 3GGWB 1FNSL 3IETA 1FFRA 3QCUL 1IKNC 3VFGH 1TPXB 4K3GA 3LN4A 1ZEAL 4MDIA 3WKML 1TNMA 1YEEL 1WAAF 4PGBA 2MPAL 4JVUA 5DFVD 1JPTH 3RZCD 4HWZB 1B4RA 3A6CH 1MY5A 5IVZA 2VLRE 4JY5H 4MQ7A 4X4XA 3JTTA 2IPUK 5F89A 3MNVB 2K7PA 4D0DB 1GAFL 2IJ0C 2A9NL 4IHOA 5C09B 4JM2F 2YA0A 4X6BA 3QBTB 3ARDC 2DMKA 4JO3H 3CIQA 3EO0A 5I71B 4P2OB 4CKVX 1K8DB 4G9FD 1V7NH 4XNXL 4P5KB 4JN2A 3GUTB 3HMWL 5F7KC 1PBYA 5EPMB 5EWIH 4M3JA 2XWTA 3NTCL 2H2PC 2AKRA 2MWCA 4W70A 4HG4J 4JFYA 3M8OL 4Y5XC 3ULVL 1TVBA 1A8JH 5IB2B 1ZHBA 1S7XA 3V4UH 1PG7W 5C0FB 3UTSB 5DYOA 4XC1L 3H6JA 4FFWD 2OJZH 1J0YA 5GRXG 1IGJB 2GY5A 4AY0A 4XWGH 2FBOJ 1DBKH 5D72H 1Q94A 1FVDB 1QSEB 3OJMB 5LBSL 1XGPA 3RDTB 2ZOKB 2E8ZA 4POZC 1R6VA 4HK0A 4KHXH 4X8JA 2Z31C 4OGAD 3D25A 12E8H 1F3JB 3N1QC 5KSBB 1S7TA 2ERJB 2DQFB 4DGIH 1GIGL 4JDVB 3MCG1 2HT4C 3X17A 4R4ND 4HUVA 5BO1L 5BZDA 4GBXD 2VDLL 5GXBB 2FR4A 3C5ZA 3PHOA 3SQOH 4PJGF 2KDGA 3FOLB 3OF6D 3LOWA 5L8LB 2R4RL 1FBIH 2PYEE 3DMMC 1ZVHA 4JPIB 1SEBA 3HNTH 1EZVY 4JFZL 4JFDA 3SBWA 3CCHB 1EX0A 1LEKB 4XP6H 3JXAA 3BD3A 3WSQL 2OR8A 3C2AL 2AJXL 2KBGA 4L4TD 5DI8B 5E8OA 1KPUA 2A1WL 3CFDB 1U92A 1WIPA 1JWUA 4MD4A 3O4OC 1AD9A 5EZIL 4YNYB 5D96B 3JV0A 4HUWA 1UZ6F 3WHE1 2F19L 5IROA 2EDWA 1KN4L 3VWJC 1CI5A 1FFPA 3RUGF 5C8JB 2R2HA 3H0TB 4ZUUB 5K9OA 3Q1SL 3MODH 1QBLL 5C2BL 4BFGA 2DI7A 3GSOA 5F71A 3O2DL 5T3XD 4Z7UE 4HQQH 4YFEA 3X3GH 4MA7H 3SBWC 3QULA 4HLZG 5CGYD 3MCKB 1Y0LB 1DBJL 1AY1L 4EI6A 3A6BL 3QXDA 4L5FL 2YRLA 2VDPL 5DHXB 5FDYA 5IESH 1H3GA 3VW3L 4D3CL 1KJ2L 4S1DD 4PRAB 3T4YB 2NY1C 2J88L 1TNNA 2NXZB 5SWSA 3VH8B 3I6GB 4N8CL 4JKMA 5IMLA 4WEBL 4XPFL 4HK3N 4DN4L 4NM4H 3KYMA 4LVOB 3FO2B 2PYED 2AABL 1OOAA 4RGNB 1KXTB 1LP9B 4HLJA 1AFVL 3BDYL 2VJXA 4UB0H 2HG5B 2WP3T 3D3VD 4WEMB 5IVXF 2UWEE 1QVOA 3HAEB 1IBGL 3QQ3B 1BM3L 4PRIE 1MAML 3MV01 4U1KA 3QG7L 3KPSB 1AO7A 1CXEA 3MMEB 4HIHA 4ZXBB 4LQFL 4DCQB 4OUUB 1C12B 3F7PC 5EFIB 2H3NA 1F45A 3U36A 3O2VL 4KZDL 4V1DA 2V9QA 4EXPX 3HRZA 4LK4A 5EO1B 4CMHC 5HGBA 2GTWB 1VFOA 2F5AL 1YY8A 2R29L 3IDYC 2RAMA 4K8RL 5HGDA 1F2QA 2F53E 3QDHA 1KIQB 1Y6KR 2IBZY 3VD7A 3OJDA 2YPLB 4QT5A 3L3IA 1R3LB 1RJLB 1J8HA 3FT2B 4U6HA 3RVUD 1OL0A 1Y6NR 1KLUB 1S9WA 2UVEA 3BZ4A 4MMXC 2OTUB 3MYJB 4UILL 4X98B 4KAQL 3FB8A 3DUUB 1MJ7H 3CU1A 1OSZA 4NO0A 1A2YB 3OSKA 1KYOJ 5D1QC 1INEH 3EYVA 5EBGA 2X40A 1MFCH 1X5LA 1TQBB 5HHMD 2E27H 1CL7H 5CD3B 5LWYL 2EIBA 2V2XA 3AXLB 4DOHB 1QA9A 1FL5B 3O11A 4EIGB 1KN2H 4ACPA 1IAKA 1NGWB 2MHAA 4JLRA 2QHRH 3MA7A 2JB6A 1J18A 2ITDA 3MRHB 3OGOE 2P7TA 1KEGH 2ICWB 5BS0B 3O41B 4KMTL 1TZHB 3DVNB 1LO4H 5D1ZA 2NCMA 2BCKB 4LCCA 2Q86A 2XQYG 3MJ9A 4RFOH 5IFAH 3BYYA 1QFOA 4JFOB 4HFWA 5ESAA 5HDQH 4S1QH 2VL5A 4WFFD 2PR4H 3F7VA 1T0MB 1DQQB 4IRZL 4GRWE 3HNVL 1OQOA 3SDYL 4EN3B 4DQOL 3WJLC 2YN5A 4NP4H 4PGJA 3OKNB 4OM1H 3ARFB 1Z9OA 3BIKB 5EUOE 2B0SL 3QXUA 5B3NA 2AK4E 3TFKC 5D8JH 4JY6A 4Z7QF 4ZYKB 1F97A 3MR9B 3H42H 4FXKA 3BGFB 4I2XB 3WEXA 5C9JA 2WBJB 2CSPA 5GS0D 3BKCL 3OKDB 2F53D 3QEQE 3RWHA 1GSMA 4L3EB 5JXED 4KH2A 1CDGA 1KEMH 1YY9C 3RQ3A 3U4EB 3GHBH 2HMID 1EK3A 4LCCC 5JHLL 2B4CC 4UT7H 4OCMC 4RMWA 1T89C 1MCNA 4OQTH 5MEOB 4DW2L 3ARZA 1S7UB 4NQDB 3TM6A 5HYSB 2YD7A 3ZE1E 3V8OA 2HN7A 5KAQF 1AJ7L 2V5MA 2AAVA 5E6ZA 4J4PC 3NZHL 3V5DB 4HIIA 1C5DB 3L7FA 3UTOA 4M5ZH 2HJFB 3OKMA 2AVGA 5I9QB 5ISZE 3ZHKA 2X10A 4NUGH 3WV0A 1WZ1L 4BFIB 3WFDH 2ESVA 3VCLB 3WNNA 1FAIH 4OSUL 2ZZUT 4Y88A 5KOVC 3IU4L 2IMNA 1GGBH 1CE6A 5LG1A 5JW4M 4OLZL 4KFZC 1C8PA 5IHUL 5TDNB 4LKXB 2CQVA 4FZEL 1IEAA 1R3KB 2OL3H 3VXSE 2ZSWA 5HHOB 4PGDA 1AXTH 4ZFOB 4LLVB 1ACZA 1N7MH 4FQLH 4P3WA 5I8CB 1H0DA 2XN9B 2O93L 2X89D 4NSKA 5FUCC 1KGCD 2C3VB 1MHEA 1BD2A 3ARDB 2APVA 3EO1B 2AK4D 3BAEL 1BJMA 1OF2B 2DQDL 1YQ2A 3KAAA 5JZ7C 3EYSL 3KXFE 5DJCA 4RGMC 2BDNL 5HVHC 1HSAB 2ZOLA 2VISA 5L2KA 4F33B 2WZPD 5CHNB 3VD5A 4HUXB 1IQDA 4YHIB 4P0DA 4Y5XB 5HBBA 4PY7A 2QV2A 1YMMA 2ENYA 2IFFH 3FB5B 3MROA 3TYFA 2BOBB 5F9JB 3MV8B 1Q8MA 3WBDA 1MUJA 1UB5B 3IETB 1LDSA 2FZ3A 3AC0A 1DJSA 5EOCL 4ZAKA 2PCPA 1WLHA 3LN4B 4MDIB 5GGVY 3G5ZB 3LRSA 4PGBB 2EC8A 4HWEH 4TUKH 5IVZB 4K9EL 4X4XB 3UC0H 4MQ7B 5DR5L 3JTTB 5F89B 3BT2L 4IHOB 5KS9E 4X6BB 5DRXA 3N06B 5DD0L 3EO0B 2KQNA 6CGTA 4MVBD 4XBGB 1YPZA 2NY4B 3DRQA 4YHKL 4JN2B 4D2NA 5GGRA 1MCDA 1T1ZA 4HJJH 1OP5K 5D71H 3HCVA 2VRAA 5DJ8B 1D9KD 3OTTA 3S37H 5ITBH 2AKRB 3LD8B 2AJVH 2O5XL 4JFYB 2EDNA 3VXSD 3U0PB 5LAXA 4DGYH 4MA1B 1TVBB 2X44D 4ZODA 5T3XH 3DMMB 1FC2D 1ZHBB 3DI3B 3UYPA 1MCFA 5TFSH 5B38G 4MSWA 3RWJB 5DYOB 1X5YA 1A6ZA 1NPUA 3JVGC 2DQGL 3P0VH 4OCRL 4OKDA 3C60D 1ZT7A 2YMXL 4F57H 3MLVH 1Q94B 1DEEB 1N0XH 4AIOA 4XP1L 4LU5L 2YD6A 5AZEH 1IKFL 1F90H 4HK0B 1C5CH 3JWOH 1XGRA 3PWPE 1X5AA 5B38A 1WT5C 3FJTA 4LIQE 3D25B 3ZYOA 1YDPA 1S7TB 5B4MC 1N8ZB 3CFEA 4PGCA 3VWJB 1H3PL 4QCIA 1YYML 3I2CH 4HUVB 3DRTA 3V6ZB 4JHBA 4X6CF 5BZDB 4WJ5A 2FR4B 3C5ZB 1YEIH 4XBEH 4XX1E 2EEAA 3OJ2C 1NAKL 5C7XL 2APWA 1SEBB 1V7MH 1OCWL 3I50H 4UOW0 1DUYA 5F1NA 3ZHLA 3MNZA 4DUXA 3AM8C 1FG9C 4KROC 1N5YL 1JHTA 5E8OB 1KPUB 1U92B 1JWUB 4ODWA 4NDMA 3D0LB 1LO2H 2NY1B 2LVEA 1AD9B 4NNYB 1DANT 1BAFL 3UPCA 3ULUE 3TCLA 1C7TA 4HUWB 4L3CA 4J7RA 3CAFA 1ZKAA 2R2HB 3G04A 5K9OB 2VZOA 4P2OD 4MXQC 1SJXA 3GSOB 4ZTOH 2E7BA 1KFAL 1NFDB 4FXLA 4LCUA 5DRZA 3T2QA 4I13B 4NRXA 4LPXA 5DSCA 1V05A 3FT4A 4XAWH 5D70H 3VFMA 3QULB 1UWXK 4P4RA 3TNMA 4J1UA 3UDWA 1FFNA 3V52H 1TDQA 3ZSTA 4FMKA 1KV3A 1QKZH 2QJDA 3NGBC 2CGRL 5BOZG 4EI6B 1FE8H 3OKLA 3QXDB 1J0KA 1X7QA 4PJ9A 3UTSD 3K81A 3V6BR 3RWIA 1L9MA 5EU7E 1KBGL 2Q8BL 3IDYB 2FD6H 1CG9A 3T08A 5SWSB 3V4PH 1RSFA 1CLOL 1QSED 4EOWL 3FO9A 4NWTL 5IMLB 3RDTD 5C0NC 5ACLA 4U1IA 2CUHA 1OTTC 1JHLH 4GJTB 5MEPA 2NY7L 1SYVB 3GNML 5D6DC 2DLEA 5D7IE 1UQSB 4XBPA 1QVOB 2C4FT 4P59H 4F7EA 4U1KB 2NZ9D 1E4JA 3L5XH 4F58L 2CLVB 4GMSH 1P4IL 1AO7B 2LAAA 1F4HA 3GKWH 4HIHB 1YEKL 5GS0H 3UP1A 3U7YL 3O3EA 3U36B 5BZWA 4V1DB 5EOTA 3U48A 4PJHA 1HOCA 1YY8B 1FO0A 4OLWH 5HGDB 2JJSA 3JV5A 3WS6C 1A7NL 4OZGE 3OJDB 4QT5B 4JQIL 4YUEL 3L3IB 4UU9A 3K8LA 2AW2A 4KUZH 3RX5A 4U6HB 2FGWL 1J8HB 5SWZE 2CPCA 2A9MH 3GIZL 4G8FA 1S9WB 3QIBA 4AJ0A 4ZS7L 3BZ4B 3IYLW 3FB8B 5F8QC 3MUZ1 3GI8H 1T03H 1CGWA 5F7EL 2NY6D 2X70A 3BPOC 4DVRL 2HFTA 3GK8H 2X1QA 1JTPA 2P1YA 4U31A 1UXSA 5C0DB 1AR1C 1B0WA 2V2XB 3MLUH 3RTQA 3O11B 3GSNA 3LZFH 2MHAB 1KIUA 5EU4B 2JB6B 2ITDB 5C0AA 2P7TB 4Y4KD 1OSPL 4KKBC 2VKWA 5D1ZB 3CGTA 2NY0C 4XP9H 3HG1E 2NNAA 1G6RA 4LCCB 4UTAH 2VSCA 5BW7A 4K7PY 4FABL 1EJ6A 3B6SA 5ESAB 2FIKA 3F7VB 2NY5L 3EOAA 4Y4FC 2PTUA 1AGCA 3GHEH 1RK1B 4NQUA 2NR6C 3QIBC 1UFUA 2NXZD 5CJOL 3H9ZA 1I8KB 4Z7WA 1MRDL 1NCWH 3BE1L 1MQKL 3DSNA 2FX8H 4JY6B 4RGND 4I0PA 5CCKH 4FXKB 4HT1H 1I8IA 5C9JB 3WEXB 3KPTA 3RTQC 2C3XA 1BZ9A 5FYJL 3RWHB 1ED3A 5DQJB 3NFSL 1CFQB 3BPNC 2Y25A 3KPSD 1RIHH 1JHKH 2HRLA 4ZXBD 4AIXA 3WFEH 3Q5OA 1U8NA 4HC1A 4XMKH 2OZ4H 2R69L 1MCQA 1DN2A 4QGYA 2HN7B 3FL7A 3LB6D 1RZJL 1EUTA 1Q9OA 3T65A 1CFBA 1D7FA 4HIIB 3L7FB 1MCEA 2VN4A 5I16A 4RGMB 3OKMB 5HVHB 1JZ7A 3RHWF 4KVCH 3SCMC 5FHAL 1QPXA 1JYVA 3N50A 2ESVB 4G6ML 4RMSA 4NM8L 1CE6B 2BNQA 2K3TA 5M7QA 4XNMA 4UI2A 4U6VH 4JJHA 5ANME 3U0WH 4N5ED 1MRCL 1ZHKA 3ZYIA 1IEAB 3BO8A 3ZT6A 2ZSWB 1NBZA 4PGDB 4NO3A 1UB6A 2JKXA 1H0DB 3N0PB 4NSKB 3AS0A 1YEFH 2JJVA 1QFWH 4KV5E 4OLVL 1MHEB 3S98A 1BD2B 3FRUB 3HUJA 3BX7C 4OLYH 4UNTA 5J6GA 2V2WB 5LGHL 2DWDB 4PLKD 1KF9B 5DJCB 2ZOLB 2VISB 5L2KB 1IAIH 1D3CA 4EN3D 4GAGH 3MRRB 4GMTL 3MJ7A 3SDXF 1IQDB 4JEGB 5GGRY 2IANA 3ARRA 1JFQL 2VSDA 1YMMB 3MROB 3TYFB 1NEZA 4FTVA 1L7TH 3SE4A 1MIEL 1MUJB 2FZ3B 4ZAKB 3SDDB 1C1EH 2PCPB 5T3ZE 5CINH 3IFLL 2Y5EA 3C6SA 3LRSB 3IAPA 2WBJD 3LDBC 5EOCJ 4WU5A 4G3YH 1KJMA 1MCKA 4NZTL 1NMAL 2YR3A 2IQAA 4L3ED 3WIHA 5HDLA 1A7QL 5GZND 1J8KA 5DRXB 1SM3L 3IDGA 1U95A 1YPZB 2CLRA 1EPFA 4NQDD 2MFNA 5GGRB 1T1ZB 2XKUA 3HCVB 5FA3A 3VMOA 4Y19E 3QZWA 4W81A 2C1OA 4UZGA 4XVSH 2QSCL 1KENH 5LAXB 5FO9A 3EJYC 1NCUA 1T2QH 4WWKC 3AAZB 3ILQC 4UT6L 4ZFGH 1XF4A 3NH7H 4MSWB 4CAGA 4WTZA 5KSAC 4YHLH 4BFEA 2OR9L 5EN2A 1UACH 4OTXH 5IHZB 1FZOA 5TH2B 1IZKA 3QXWA 2YKLH 1MCWM 5M94B 3HE6A 4PJ8A 3QEUA 5JMOC 1H8OA 5HHOD 2HFEA 3F58L 4X4ME 4U6TA 1A3RH 1I1AC 1JBJA 1CLYL 1XGRB 1RU9H 2XN9D 5B38B 3CJJA 1R5VA 4U3CA 4PJBA 5T1DH 4C56A 4UV4H 1YDPB 2MJWA 3CFEB 4PGCB 2ICEA 3UJIL 1BF8A 4ZNEA 3DRTB 2IG2H 1CDCA 4WJ5B 4XMPL 1UG9A 5BVJA 2YK1L 4OF3A 5B3JE 1QLFA 2EEDA 2VQTA 4KK5D 2Z8VC 2E9WA 1XAUA 1GJIA 5F1NB 3B3IA 4LHUG 4TPRL 3S96A 3NGBB 1JHTB 2Y06H 1BECA 3GBML 4FFVC 4G6KH 4GW4A 3EHBD 3UTTA 4F9PC 4I18A 2H6PA 3D39A 3JWNC 1IFHH 1HIML 2OI9C 4MYWB 1LO0L 4JFDE 4XXCC 5K59F 2Q3ZA 4MA8L 4B50A 4LHUA 4U33A 3LIZH 3EYQD 5IEKA 3GBNH 4L3CB 4R7DB 4HK3J 4N68A 2BRQA 3G04B 1KCSL 1PY4A 4R7NA 4CUCA 1NMCC 3O6LH 3T2OA 2NY4D 3CH8A 5MENE 1TJHL 4MD5A 1BBDL 4K2UH 5DRZB 4RA0C 4BA8A 1RUQH 2ZNWA 4M7KL 3OB0K 3FT4B 1NKOA 3VFMB 1NC4A 4IMKA 5EUKB 1JPST 1MWAA 1RZFL 3QB7C 4J1UB 4P4RB 1FFNB 4OZHE 1G7IA 1ZE3C 1KJ2A 3OKLB 1RUMH 1X7QB 3PGFH 2VDQH 2K9UA 4WI8A 3RWIB 3QWQB 3EKCA 3I75B 1CG9B 5LQBH 5T1KB 3QQ4A 1G9MC 2AEPL 3FN0L 2OX5A 1FPTH 2VLKA 5J1SC 1FYHB 3UZEA 4KDVA 4U1IB 3DTXA 3BRGC 2DB8A 5CP3A 1JF5A 1O7VA 5MEPB 1OTUC 4XVTL 5CP7A 2X4RA 1LP9F 4O2EA 4GRLC 4XBPB 2BVYA 1ZAGA 2FECI 1YJDL 4JFXA 2QSVA 4XNQA 4F7EB 3O9WA 4U1MA 4WO4A 4ODVL 2EH8H 3C5ZD 3B83A 3D0VA 5T5NF 4PJXA 1NGZA 3NN8A 4UT9L 1ETZA 1N64H 3O4LA 3P4OA 4JFDD 2UUDK 1WISA 3GSWA 3MRGA 1QQDA 1J5OL 5BZWB 5ID1A 1L0YA 5EOTB 5E03A 4PJHB 1HOCB 4PJAA 3JZ7A 1FO0B 2ZG2A 1LO3L 2HH0L 5DJDA 4D9LL 1JPGA 4UU9B 3LPWA 2P5EE 2A77H 4N90E 4G8FB 3QIBB 5ELIA 5FYLL 3ZT7A 4FQ2L 4LSVH 3INUL 4Z0BH 4BZYA 2CMRL 3ZKMC 2VERN 2X70B 2ILLA 1YEGL 4ISVA 3OB0H 2XACC 2JJUA 4I0CC 2AGJH 1UXSB 4Z78A 5KZCB 1I9IH 1DVFC 4LCWA 4OGXH 3RTQB 1XR8B 3GSNB 4TSAL 5DMGC 3K1KC 5I17A 5C0AB 2EH7H 4OCWL 3EYFA 1FGNH 4P2RE 3BPNB 2EDXA 2VDKH 4RNRA 1HHJA 5FGRA 2D7PA 4AEFA 1CLZL 3F5WA 1CFVL 4PS4H 3ZKXB 3H9SE 2NNAB 4RAUA 3DHJA 1X6LA 5J06A 2FIKB 2JJWA 5C9KA 1F11A 3EOAB 4ODSH 1AGCB 4A6YH 1UKSA 3GEWB 5CD5C 2EDQA 3TJHC 3QPQC 5SWSD 1RPQA 4M5YH 1T1YB 2EXWD 4MCYA 4FNLH 4Z7WB 1NANH 3BRFA 4MNGE 5ITFB 3SCMB 4Z77A 3I6LE 2DF3A 4WI4A 2ZSVA 5HVGB 3CFBA 1AQKL 3WO4C 2UUDH 3DV4A 5E94A 1BZ9B 4LNRA 5DVOA 1ED3B 4P23A 4ZDHA 4ETYA 1YC8A 4PGEA 1A14L 4X5WA 5J12C 4YXKH 5T1MA 5TJWK 2R0KH 1AO7D 4YXLH 4UQ3A 3MBXL 4OD1H 5E08L 3MLYH 4CN1A 5IQ7L 1U8NB 3ZZ1A 1PLGL 5HHVH 1DUZA 1UM5L 3DXAA 4GW1A 4V1DD 5H37G 1NKRA 1W2KT 1Q0XL 4GQ9L 1Q9OB 3H3PH 3T65B 4I5BA 4YZFF 1EHLL 4J3UA 4NZJA 3BKJL 4GSDH 5I16B 4JHAL 1U8IA 4KZEL 4LHQB 5GJSH 1J8HD 5DT1L 4XPHH 5GHWL 1A1MA 1ZTXH 4U4BA 2PNDA 1MJUH 4LDLB 3V8CA 5ICZA 1G9NH 5JW3L 2BNQB 5IW1A 1NEUA 3GO1L 4KV5F 3VXUB 3IVKA 4XNMB 5E5MA 4NO0D 4UTBL 3WUWA 3ARVA 1LK3L 2BSSA 3BZEA 2X5PA 3G5YA 4FQPA 5GSRA 1RIUH 4P23C 1ZHKB 3PHSA 3BO8B 1NBZB 3BWAB 1FVCA 4NO3B 5DVKA 3O3DA 5EZLA 5I1AA 1KTKE 1UB6B 4X7EC 3M45A 1I85C 4LAQL 3UJTL 1P9MA 3D85A 2CK0H 5EOQH 5FUZH 1ZV5A 5D1ZD 3BUYA 2NPLX 3ZE0F 5I74C 3HUJB 5E8DL 2DOCA 5J6GB 1CLCA 1YN6A 1YYLL 1ZA3B 1GC1L 3QG6A 4YHOH 1OM3H 4HF5L 1URLA 1NBYA 4QRTA 1E4KA 3MJ7B 5F6IB 5IHBA 3T1FA 4RX4A 2IANB 5CZVL 4BQ9A 4HPOH 4ETQA 4YDLC 5J3HD 1MFAH 2DYPA 1NEZB 1BD2E 4FTVB 4HJGA 3K1DA 4EBQL 5GGSA 3AB0B 5F7UA 1UA6H 3JV4A 1ZA6A 5IBLD 1J0HA 1MCLA 3MRBA 1K4CA 3N9GL 1NLBL 4WU5B 1KJMB 5TE4L 2B1AL 4LEOA 5L88H 4TRPH 5FDWA 1MVFA 2IQAB 1WBYA 4NJAL 3E6FA 3R1GH 4TULL 4MJIE 4PB0L 2ED9A 2Y23A 3KJ4C 4HS8H 43C9A 3IDGB 5KVEH 1U95B 2CLRB 4PJIB 3S6CA 3QQ9C 4G8GE 3OL2A 3SGEI 1BQHG 2VTFA 1VCAA 3QNXA 3QZWB 1H5BC 1A5FH 2C1OB 4NRZA 5JZ7D 5FO9B 4BJLA 7FABL 2JF1A 5C07E 5HSFA 4BUGA 1XF4B 3EO9L 5E2JA 4KKLD 2ESVD 2ZUVA 4ZOAA 1AE6H 1BFTA 3C8KA 4LASH 1FZOB 5I1CL 3CXHK 3HE6B 4KVNL 4PJ8B 5K9JH 3ZKND 1WCQA 4KRPC 2VDOL 5IBTL 3M07A 3CXDH 2OK0H 3QEUB 3BXNB 2HFEB 1RJZA 2JJTA 2JCCA 3D5OF 3MJ6A 5TE7H 1ADQL 4HFUL 1EFQA 4TNVF 1R5VB 4BK4A 3VXQA 4PJBB 4C56B 1CZ8L 3Q48A 1ZLWK 4K94H 5CJBA 4OCSH 1BD2D 2ICEB 4DKFH 3PXJA 3F62A 1MFDH 4JJ5B 4JN1L 5I8EB 3S37X 2BNRE 2CRIA 1MAJA 3FQUA 4PLJC 5I1JL 1H3XA 3C09C 1C08A 3WMSA 4JPKH 5L2KD 1QLFB 3TESA 3CK0H 2I5YL 4OIBA 3QUYA 4OZ4A 3FO0L 1ZWIA 3B3IB 5CEZL 1HQRA 2VH5L 4RWYL 1YMMD 3S96B 5GIRA 1RURL 2FHFA 1IT9L 2HKHL 4M6NH 1EMTL 3TLRA 3SDDD 4ZAKD 1IC5H 3BISA 4GW4B 3VJ6B 3UTTB 4I18B 4HHAA 1RV6X 3D39B 3SN6N 1R3IL 5HI5C 1AXSB 3VG0L 2GITA 2M26A 3BKYL 1T1WA 2ZWLT 2IGFL 5IMKA 1DBAL 1HHKA 4LHUB 4ORZC 5IEKB 3HI1A 4KQ4L 4R7NB 1X5HA 4FQCH 1KTLA 2FATH 3CSGA 4MD5B 3RWDA 4HWBL 1UJ3A 1E6OH 4M7JH 5B39G 2OR7A 5DUMH 1KOAA 3QUYC 1NC4B 1DE4A 2P5WA 1MWAB 5C08A 3KYAA 1G7IB 2VE6A 3MV7A 1KJ2B 3CLFL 1X5JA 1S78C 2EDHA 4XAKE 3RX8A 1B6DA 1XEDA 2F54E 4ZTPH 1S8DA 2X1OA 5B39A 3VFWB 1XCTA 2VLKB 4HV8A 4GFTB 1QFUH 4HGWA 1T66C 4ESKA 3FHQA 3UPRB 4XPAH 5I19L 3MLXL 1DQDH 4LEXL 2WAHA 3I3EA 3C9NA 3U4BL 4LSRL 5FUOH 2X4RB 4O2EB 3TNNA 4NQXB 3C87A 4HLZH 3OAZK 4AMKH 2VYRE 5CUSH 3SGDI 1UJ3C 4XNQB 5GS3A 4MAYC 4LSPH 35C8H 3O9WB 1JJUA 4U1MB 3Q0HA 4WO4B 1NDMA 5CMAA 1E4XL 2D0GA 4PJXB 3ZDZE 3NN8B 1ETZB 2CKBL 1CTNA 3NPSC 3O4LB 3P4OB 3MRGB 3O6FA 4N1HB 1QQDB 1VFMA 5ID1B 4I0KA 5I8KH 4YHZH 3QFJE 1A6AB 4M93C 1UWGH 2W9EH 5DJDB 3TVMC 3JBG7 4JM4H 4PJ7A 4HIEA 1JPGB 5EB9A 1XGYL 1BJ1H 3B8SA 1A1NA 3OQ3B 4KTDH 2BOCA 3PABA 3T0BA 3QISA 4KDTA 4XZUA 4Z95H 3RGVA 4WWID 4XC3H 3RVVD 3ARXA 4AZ8A 5HGHA 5D5MB 3OPZH 4ISVB 2BP3A 4KK9C 4Z78B 1VENA 4N0UA 4LCWB 4YO0A 5JXAL 1XF3A 4WUKH 5DD5L 3WO4B 3EFDL 5I17B 4D8PA 1IM9A 4PRNA 5GGUA 3EYFB 1X4ZA 2C9AA 3V5KA 5A2IH 4RNRB 5J12B 5T5FH 1HHJB 3RNQA 4EDXA 1VHPA 3F5WB 2FEDD 2FL5A 5KSVA 5LXGH 3KS0J 3TO4A 4NCDA 4PJ9D 4QRPA 2ZUXA 1IM3A 5D2NC 2P8PA 2CO6B 2IBBA 3MJ9H 4J12A 5DF0A 3U1SH 4EDWH 3RGVC 5DA4A 1JGLL 5M95B 1MPAL 2I26N 3P73A 3QFDA 1ORQB 4Z77B 4POUB 4WRLA 3TH4T 2ZSVB 4DAGL 3CFBB 3EW3B 5AWNH 3DV4B 5E94B 5HVWA 2VWEE 4LNRB 5DD1H 4Z7VA 4P23B 4ZDHB 3BEVA 4X5WB 4WTWA 4H0HB 4Q2ZA 4U2ZA 5T1MB 2FO4B 4UQ3B 3RPIA 2I27N 1AP2A 5BV7C 5B8CA 4O9HL 2W92A 1DUZB 2VZ1A 2O61A 3GMQA 4K7PH 4EQ2A 4GW1B 5SV4A 1KT2A 4CMMA 4OZIA 4LLMA 3G6AA 3CPLA 1SMOA 3TT1L 4QOKA 1L6XA 2DD8H 4OLUH 5H35B 4I5BB 1CVSC 1SY6L 3G9AB 3VRJA 5GSVA 3HZKA 1U8IB 4XT1C 4U0QB 5IG7A 3LH2L 4OF0A 1A1MB 4MMZC 3WDHA 5ICZB 4GKZA 4HG4K 1HHGA 4KWUA 1FFOA 2J5LC 1MOEA 5IW1B 1JP5A 4OM0L 4YDLB 2BSTA 1RZ7L 2R8SH 3IVKB 1QTYT 3WUWB 3BZEB 2BSSB 2ZUQC 1U8QA 3G5YB 1YEJL 5GSRB 3T77A 3MLSL 2DL9A 2ORBL 1OLZA 3RTQD 1FVCB 4PUBH 4J6RH 3O3DB 5EZLB 3WN5A 5I1AB 5KVFH 5C0AD 1K5NA 5GGSY 4NWUH 4H88H 2MCPH 1T2JA 2A83A 3D85B 3WUZA 3FRPG 3T8XA 1I8LA 1NGXA 3BUYB 1NL0L 1Q72H 3MV9A 3KJ4B 3VXNA 4C54A 1KIPB 1V3LA 5A3ID 2VLJE 3NACL 1YN6B 2DLFH 2HRPL 4AEIL 3MUJA 3VDCA 3QG6B 5L7XH 3L5IA 1NBYB 2PKDA 1GHFH 4NN7C 2R15A 3T1FB 25C8L 5ADOL 1VEOA 2J8UA 4IOFC 1IE5A 1HCFX 3FRPA 1PG7H 1QP1A 1WTLA 3W5MA 3P9WB 1XIWA 2DYPB 5C0CB 1OD7A 3MFGB 3PP4L 4HJGB 4S2SA 3TV3L 3T2PA 1FC1A 5HPOA 4I0PD 5GGSB 2LABA 1JGUL 4ZO6A 1P4BH 3JV4B 4OT1L 3ZYJA 1K4CB 2UZIL 2IADA 4LEOB 1FNEA 4MNQA 3B9DA 4PG2A 3WFCH 1GGCL 5FDWB 2IANE 4LBEA 4M7LH 3E6FB 1N4XL 1VACA 4FTVE 4D0CA 4L29A 4L9DA 1WAAA 4NQCE 4HS3A 4L4VA 3QDGA 1YPZF 3HZMA 4OZFA 1SBSL 4G6JL 2YPVH 2FO1A 3QNXB 5BRZE 3REWA 4JPWL 4M1CC 4WCYL 4NRZB 2ADFL 5C0RL 4W6YB 1BWMA 2Y07H 1XIWC 4L8BA 2F5BH 3PL6C 3FB7A 3JV6A 4NZUL 3ZKSD 5MEQA 2IAMC 3MOAL 1CS6A 4LSUH 1EFXA 4WI5A 4CN4A 1FLRL 2BNQD 3C8KB 4C55A 3D18A 4YC2C 2X7LA 1XT5A 1GGTA 1MI5E 2HVKA 4JKWA 3W39A 4YXHH 2QQLH 3R4DA 1RJZB 4PJ5E 2JCCB 1NGQL 4H25A 3ZTJG 4NC0B 3CDGA 3VXQB 4TN9A 2DQEL 5MHSE 4AEEA 4JAMA 4M3KB 4OB5H 4JO1H 1OGTA 1ZANH 2HT3D 3C5SA 1JGVH 4XCFL 2FBJH 3FQUB 3QAZB 5TQ0L 3MRIA 5I6XC 3SGKA 2IPUG 1C08B 4OD2A 4FXGA 3QUYB 2DDQH 4OZ4B 5GRZA 2IAND 5HI4D 1ZWIB 2Y5TA 3OKEA 4ZD3L 1HQRB 4C56E 1M6OA 5GIRB 3ZKQD 2AJSL 4FTVD 2COQA 1JYNA 1MCJA 4ODTL 1KB5H 4PP2A 2XA8L 2EE2A 5IKCA 4AM0A 4JHZA 1PAMA 1IAIM 1F4YH 1RZKC 4HHAB 3KHOA 2GITB 4Y8DC 1T1WB 3U30B 3QUMA 3I9GL 1HHKB 3MXWL 4QTHA 1Z5LA 5E8EA 3HA0A 4YR6A 1W72L 3HI1B 1S3KL 4HSQA 4KI5D 3WDJA 4PLOB 1MFEL 1WV7T 3L3HA 1KTLB 3ORJA 4KRMB 3RWDB 2ADJA 1KYOK 4K3DH 1QNZL 1UJ3B 3T0DA 5J0BA 2AEQH 5DZOA 2W0FB 2BNUA 3ULVD 3QHZL 1DE4B 1T6VN 4V2CB 2P5WB 4PJFA 4U1GC 5F7YC 5C08B 3RJQB 4OCYH 2A0LC 3VWKA 1U91A 2VE6B 5DMIH 4FQIH 3CSBA 3MV7B 5D7SH 3KJ6H 2Q87A 3GMLA 1JPFA 1I9RH 3CDCA 4ZFZA 1FIGL 5D6CB 5KW9L 2NW2A 1EAJA 1XF1A 5LGJA 1HXYA 4X9FA 2JELL 4M93B