1AC0A

Glucoamylase, granular starch-binding domain complex with cyclodextrin, nmr, minimized average structure
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
108
structure length
108
Chain Sequence
CTTPTAVAVTFDLTATTTYGENIYLVGSISQLGDWETSDGIALSADKYTSSDPLWYVTVTLPAGESFEYKFIRIESDDSVEWESDPNREYTVPQACGTSTATVTDTWR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords GLUCOAMYLASE
publication title Solution structure of the granular starch binding domain of Aspergillus niger glucoamylase bound to beta-cyclodextrin.
pubmed doi rcsb
source organism Aspergillus niger
molecule tags Hydrolase
total genus 10
structure length 108
sequence length 108
ec nomenclature ec 3.2.1.3: Glucan 1,4-alpha-glucosidase.
pdb deposition date 1997-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00686 CBM_20 Starch binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ac0A00
3V6ZA 1NBYA 3EFFB 1A6UL 5AAMA 1AQKL 4U49A 1YDPB 3WIFB 1FIGH 1BFOB 2C5DC 4G8GB 5DO2D 3K8LA 1JGLL 4IRSB 4ZG1A 4L8CA 1E6OH 3O3AA 5JW3H 3CZFB 3QQ9C 4ZO8A 3EFDH 2VL4A 1QBBA 1SY6A 2BERA 2VLRB 5EZLB 4MJ6B 5B21A 2CGRL 3HKFA 2R0ZH 2XZAH 3QXVA 2WWKT 4Z7VE 3FAXA 4I3GA 2FRGP 4F7MB 3C08H 1NC2A 4N8PA 2QSQA 3AS0A 1OB1B 1UZ8A 2OLDA 4FMKA 4HBQA 1CYGA 4M6OL 3X12A 3GHBH 2BXYA 4GG6F 2IMNA 4KK6D 4PJIA 1XF3B 5EC1B 5BRZD 4X98A 1S9WA 4PP2B 1A1MA 4WHYG 3TA3B 2HH0L 4O2CB 1GYAA 4G9DA 1DBMH 2VDNL 3WDIA 1I9RL 3GKZA 4DGIH 3V6OA 4H88L 1V7ML 3X11A 1BF8A 1NDMB 1FNEA 5JOFB 2ZG1A 1S78C 5FYKD 1TQCB 2XA3A 1RFDH 1J8HB 3GMOA 5E94B 1NGXA 3KPLA 4MNQD 5F1NB 2EYTB 3TYFB 4XNMB 4WFFE 5DRNA 1X3DA 4I77L 4X9IA 4N0UB 2AK4D 5GS0D 2IJ0C 3SN6N 4M1CC 4N90D 3RPKA 1OAYH 3X3FL 4M1DL 3LCYA 5MEQB 2IPKB 1OWWA 4KQ4L 3IDJA 5CP3H 3PABB 5MI0C 5JORA 3FQRB 2F74A 3LKSB 1ZLUK 5DD0H 4PJAB 4OLWL 2ICWI 4L8SA 3RY6C 5C0AA 5I1HH 3BDYH 3RIAK 4YHOL 5C08D 2HT3D 4TVPH 4AYFA 5C07D 1U3JA 3F58L 3JZ7A 1VPOL 4G6MH 1II4E 3DUHA 5GGTL 1NCBH 2RIKA 4LKXB 1RUQH 4DZBB 4PJDA 3TVMD 3I2CL 4B7LA 4TRPL 3O41A 1AIFA 4M43L 4YZFF 3MRPB 3O9WC 4ZD3H 5I75B 4OTXL 4GBXA 4XTRD 5B38A 2FBOJ 3OTTA 2P5EA 2EE3A 4GS7B 4HUKB 4ZYKB 3QP3A 1UVQA 2H6PB 4NNPL 1Z9SA 2J3SA 3HI6L 1ZTXH 2D4DA 2AS5M 5T3ZH 1KXTB 5IR1A 1T0NA 4PPTA 1QVOA 3FO9B 4K3DH 5IHUL 5GGSY 3UTPD 4Y2DB 4BFGA 4AT6A 3TNMB 1DBKL 4FQ1H 3G5VB 4GRLA 1QFOA 1TENA 2G60L 2NNAA 4XVUD 5JR1H 1IEAA 1MAJA 3MRKB 4HIJA 2PCPA 2Q6WB 4X6EB 1YY8A 1JHTA 2RFXA 2NY5L 1FZMB 2A9MH 3G08A 1KBGL 3CXHJ 4H0GA 1YYMH 1OAZH 3NCBB 5FKAB 1WLHA 4KKAD 2IQ9L 2C4FT 3WXWL 2H3NA 3C2SA 5DWUH 1CE6B 2DQJH 3BP7A 1HINH 2VE6B 1OGAA 2DQHL 4XNZB 5SX5K 5F7UA 3T0EA 4OI9A 1U58A 3F8UB 4TYUA 5ADOL 4NO3B 4U3XA 3H2WA 1X4YA 4R9HA 1A6TB 4NO0A 5LWYL 1QEWA 5L9DL 3L3KB 5DMGC 3DYMA 5HSFA 2OR9L 3D25A 3L9RA 3QUMB 2CDGB 4GMTL 5ID1B 1L6XA 1KC5H 2XTJC 1FYTB 4LU5H 3SDDD 1R3HA 4E9LA 1FIGL 2V5TA 3QDJD 1QSFD 3X14A 4P2RD 4PRDB 3ALXA 1RPQA 3HFMH 4HW6A 3BN3B 4Y4KC 4Z8FL 2AXGB 2JCCB 4LSRH 1JE6A 2YBRA 2EDTA 5HI3C 1E6OL 4QYOA 2W0KA 5JW3L 3QUYB 1MJJB 1I3GH 3EFDL 1RD6A 5GRZA 1ONQA 2YK1H 3WSQH 3KLAB 3GI8L 4LBEB 4XCFH 2WBJB 5IROC 5ICZA 2VC2H 1T66D 3C08L 4LCWA 2A6DB 5CD5D 1FL3A 3CSYA 3QIUC 1NAKH 3RA7H 5TGBB 5BRZE 1W8NA 1U8QA 1MCKA 4NOFA 4R6UA 5INDA 3MUY1 2X1OA 1S7WA 2FB4H 3HG1D 1U8HB 4NQCA 1NLDH 1XCQA 4M7JH 2H9GB 1EDQA 2IPUG 1K4CA 5FYKE 4ZUUB 2Z4QA 2NPLX 1DBML 4DGIL 2AAVA 1T20A 4YK4B 1X5ZA 1RFDL 4XBPA 5EPMA 1RU9H 4TUOB 2E9IA 3JV6A 3NA4A 3B9KA 3RWIB 5HD8D 2AK4E 1FPTH 1UB5B 3PWVB 4PIRF 5DJ2A 4OCNC 5KN5A 1TVDA 3TO4A 3OSKA 1B0GB 2WWMC 1XF4B 4X5XA 3GZKA 1P2CB 1VGKA 1Z9OA 5IB1A 1P9MA 4EI6A 1IGMH 4AIZB 4WWKC 1A9BA 5A2KH 5C0EB 4D0BA 3VFOB 3MJ7A 5DD0L 1G0YR 4KUCD 4X6BA 1U8NB 5C07E 2O5ZH 4Z6AT 5IWLC 4TUKH 3WS3A 1UEMA 5T1MA 5I1HL 3BDYL 1NUGA 4YEFA 4WY7H 3QNYB 2P43B 4TVPL 1ZLSH 3WUWB 2P49B 1QKZL 1JUFA 4G6ML 3BQUB 4PJXF 3NZ8B 4I1NB 3P3YA 2HG5A 1NCBL 1KJ2H 2QR0A 1A1OB 4DKFL 4ZD3L 4GAGH 2PYEB 1MCJA 2VDOH 1WZKA 3EW3B 4EUPG 2CDFB 3OR6B 3QULA 2VDKL 4FQ2L 4P2YA 5T3ZL 2LTQB 4JVPA 4OZIB 1CLYH 3ARBC 1BQHB 4UU9B 4K3DL 4KI5F 3VGHA 4IRZL 2FJHA 4FQ1L 4UOW0 5JR1L 2W9DL 4Y16A 1T21B 4HIIA 3U4EA 3VRLF 5K59E 3CVHA 3O6FB 4LHUB 3UC0H 1C12B 4JPWL 3P73A 2ESVB 2ZSVA 1F11A 1F90H 4OF6A 5GJSL 3UAJC 4PRBB 1CLOH 2E7LA 3P11H 4F33B 1QLEL 1I1RA 3SDCD 3WXVH 3L3GA 1XGPB 5CKGA 2IH3B 3E0GA 4Y5VA 5BVPL 3DV6B 3JTTB 2BNQB 1KGCD 2DQJL 1J5OH 4J2XA 5DZLA 4Z76A 1CGSH 1HINL 1RJZA 3CFEB 4PRID 3C5ZA 5H35B 2NW3B 4JFXA 1WWAX 2WP3T 5BQ7A 1F8TL 4KK5D 4PS4H 2DMBA 1J1XH 4JHZA 2EC9T 2FO4A 1ZVSA 4LLWA 4HK0B 3ULVL 3AMLA 3LKRB 5LQBL 3QDJE 1QSFE 1DBJH 1KC5L 4P2RE 4LCUB 1LE5B 5K9KB 4LU5L 3VXTB 2HLFC 3HZKB 4DZ8B 4OZGB 1I3UA 3AC0A 3FB8B 4Z77A 3HFML 5EU4A 5I1EH 1P4BL 3KXFE 3O9WA 4UBDC 4LSRL 2J1KA 4I2XE 3SDYL 2VLJD 4KTDH 1DR9A 5HY9B 1I3GL 2MHAA 5EIQA 2YK1L 3QBTB 3CFBA 4OQTA 3W82A 1MFDH 2H2SD 4LLMA 2YWYA 2NY6C 1RJCA 4J3SA 1I3RA 5I1CL 5MEPA 2GJ6A 1Q9KB 3AU1A 4WDIB 3WLWD 2CLRA 1A4JA 5HHMB 1RZ8A 5HJ3A 4OFKA 3TV3H 3RA7L 4IMLB 4PJBB 5E9DD 4KKLD 3K8MA 1NLBL 3VI3F 4MJ5A 1HNGA 2KZ1B 2FB4L 4DAGH 3SDXB 2Q3ZA 4M7JL 1B4JH 2XPGB 4Q9BA 3HPLB 2HWZH 2MKWA 1HWHB 1G6RA 5IESH 5FKPB 1P69B 4GRWE 1H3UA 5JW4N 2I24N 3I3DA 1YNLL 1RURH 3I6GA 2D2OA 2OXHA 1RU9L 1YY9D 3TBVB 2VISA 2UY7A 4BK5A 1P6AB 4UT9H 2X2YA 3PWNA 3PIQB 8FABB 1AGEA 5E8PA 5IBLC 1NFIB 1G9NH 4P57A 1G0XA 1AO7B 4MAYD 4BUHA 2V7HB 3QXWA 1VKXB 5K33A 2UZIL 2KDGA 4M48L 1IGML 4KC3B 4NNYA 1BM3H 4FQXB 1N2RA 4Y19E 1FZKA 4Y4KA 3QQ3A 3EJJX 1MI5B 1M7DA 1XR8A 5A40E 5MENA 4TUKL 4XVSH 4PJGB 2DLGA 1JWMA 4OM1L 3MSPA 3QG6A 15C8H 2ZUUA 3GK8H 3EDFA 3SGKC 4FQCH 2OXGA 3G6JA 3MO1A 4WY7L 1ZLSL 1S7VB 1SEBB 3GDBA 1CT8B 3UO1H 2ICWB 1ZS8A 1W0WA 1BOGB 4JM2C 1KELH 1JF1B 5KSBB 1U95A 3EYSL 2CQVA 3LN4A 5IBTH 2B1AH 2ZKHH 2E7MA 4IJ3B 1MCPH 4GAYA 2VDOL 3TCLA 5GPRA 4YX2H 4P59H 4HUWA 5IMMA 4M6NH 2CK0H 3CDCA 3KPSB 5DUML 1H8SA 4JFOA 3NPZB 1KCRH 1S5IH 5T1DH 1CLYL 1MVUA 2EDEA 1VEMA 5C0DA 1GC1C 3EJYD 3D3VB 5E2TH 4UZGA 5IJVB 1GJIA 1IC4H 5HPOA 5HHVH 5C9KA 1NFDB 1M05B 2HRPL 3IJYB 1ES0A 4Z7VF 3JV5A 3UC0L 4FZEH 1TTUA 2H8PB 5TQ0H 1U8LA 2ZP0T 4HZLA 3LRGA 4HH9B 4Y4FD 3M07A 1KGCE 3P11L 1H5BC 1TPXB 3WXVL 3TIEA 4HBCH 3OJMB 5E6ID 1TZIA 4XAWH 3DBXA 1J5OL 1CGSL 4N8VB 3SDAA 3CFJA 4W68A 1J86A 3KR3H 4MCZA 4UIKH 2EDYA 4MD0A 1KNOA 4ZUSB 1FFNA 3H3PH 1J1XL 1CD8A 1F58L 2FZ3B 5CIPH 2F53D 2R29H 1JJUA 2DIAA 1A7NL 5D7LA 1QZ1A 4I18A 3NGBC 4QWWD 1RUPL 4POUB 3MMEA 2A74B 1WICA 1S7QA 3GUTA 4HDIA 1AP2A 4OB5H 1E4WL 4Q6IB 2VLJE 4HXAH 4O2EA 1RZKH 5D1XA 4NT6A 3RGVA 1OLZA 4UIMB 5IT2H 1X5XA 1G0DA 4NZDA 1RZIA 1UCBL 1JV5B 2FJGA 4L8BA 4KTDL 4MVBD 1NGWA 4O00A 4Z0XB 3DX7B 4AK1A 3BZ4A 4HWNA 4NHUA 1YPZE 3LIZH 4Y7MA 3MTRA 2QQLH 1MFDL 2FECI 4UNUA 2ADJB 4G8EA 1R0AH 3STZA 4D0CB 5E9DE 2EKJA 5AWNL 3RVWD 2GYSA 3TV3L 2GK2A 3QPXH 4HV8A 1B0RA 3SJVA 3CUPB 3DX8A 1F00I 2GITB 5T1LD 2ARJQ 3JUZA 1ZHNB 2AVGA 1HYRC 4DAGL 5L2KD 3AM8C 1MCCA 1O7SA 5GS1C 5C6TH 4XHJC 1WISA 1N3NA 2ED9A 5FGCB 5GGVY 5BVJB 5GGSA 1K3IA 1NH6A 1UGNA 2EC8A 2FEEI 1OP3H 3S35H 4JLRA 3VRJA 4UMGA 1SJEA 5GSVB 4P4KD 1OY3B 2V17L 1TCRB 4GT7A 3IFPB 4NP4H 1NAMH 2Y5EA 4OFYA 4C4KT 2NLJB 1TJHH 3TZVC 4K71C 2ZOLA 1LEKA 4KUZH 5HXMA 2YA1A 5FUZH 5SWQA 5FA4B 2F5AH 1G9NL 2YA2A 2VXQH 3O8XB 2ZPKH 4WFED 3HI5L 4P5TA 3ETBF 4OZHE 2XZQL 3UTTB 1DQQA 3GKWH 4IEFB 4PREB 5ANMB 1IAOB 5GS2D 3WMSA 3OKNB 1BM3L 5JHDB 4TNVF 5F89B 3W2DL 1VSCA 1I8MA 5ILTL 5F7NC 1FVEA 1DVFC 1QRNA 3K0WA 5TDPA 1AI1H 2DRUA 4XVSL 4YHIB 3VFTA 15C8L 3GK8L 3Q5YA 2VXVL 1KLGB 3U7AA 3N1GC 1K6QH 2QBWA 1WWWX 3KPRA 3MRIB 1IGFH 3C60A 3UO1L 1TQBB 2FECL 3KPOB 1KELL 3LN5A 1G84A 2CD0A 3B4NA 3W0WD 3QB7C 3SOBL 5CMAA 1FVCA 5DJ0A 5IBTL 2B1AL 4H0HB 1MCPL 5J13C 3HC3H 3CLEH 4XMLH 1KCUH 4PYGA 3TA3C 4Z7WE 3KYMB 2BVOB 1BAFL 4M6NL 3LHPH 5D7SH 5I76A 1KB5A 1OTSD 3PQYD 5ALBH 5DK0B 1NKOA 3WFDL 5E1AA 4H8WC 3TPUA 4K7PL 1KCRL 3RKDD 3RRQA 5JQ6H 3OKEB 4LLVB 1U91B 3MRNA 3BDBA 1Q9LB 4CVZA 3NFPA 2Z8RA 2WBKA 2FEEL 4L9LA 3PP3K 1RZFH 1IC4L 4IBLT 5CEZD 2O5YH 4XPTH 2DQFB 4QRTA 3VGEA 4XRCB 1C5DB 1JTTA 3IFLL 4OLUL 3IXTB 2F58H 1GHFL 2XFXA 5F7DA 4OSUL 4DK3A 3V4UH 5IF0B 1G7JA 1HXYB 2VLLA 3B3IB 3QDAA 5IVNA 1T83C 4ZSOE 1FGVH 3K7UA 43C9B 4XAWL 3WFHB 2P46B 3ORJA 4RFOH 1DQDH 2NXZB 4G9FA 3FTGA 3KR3L 2X4TB 1J1PL 2F53E 3ARGD 1JPSH 4UIKL 4M8QB 3H3PL 4X6DA 1TFHA 3Q3GA 5HDQH 4PJCE 3A67H 4L4VA 4YIQB 2P24B 3DMMD 1UA6H 2FL5B 5J3HD 2R1YA 4GS7C 1MCNA 1JCKA 4J4PC 4CMHC 5EOCJ 4OB5L 2DL9A 5IJKC 1RZKL 1J1OL 1KTKE 1RAMA 4Z0BH 5IT2L 1LE9B 2J7LA 4PJHE 4HCRL 3BD4A 4JKLA 3KLHD 5F7KC 2XV6B 1CICB 4M5ZL 3UTZA 1GH7A 2DM7A 5T5FH 4OJFH 4MD5B 4KDVA 2HKHL 3RL2B 3TO2A 3LIZL 5GGQH 5ACMA 4WO4B 1BEYH 2QQLL 5TDOA 4Q58C 5EO1B 4LVEA 4BJLA 2X41A 1R0AL 3TBYB 2QSCL 2E7CA 3U9UA 3V0VB 1ZAGA 2VZSA 4MNGA 1E27A 1J0YA 2V7NA 3D0LB 1U8IB 5L2KE 3QPXL 1HSAB 1MCWW 2BOCA 2K1MA 4D9QD 4WW2A 5E2WH 1HDMA 4P3DA 5I2IB 3QNXA 4XP6H 3SKJL 1TLKA 4J6RH 4HUNB 2VKXA 5CFHA 2OTUB 3NIDE 4OCWH 5FAAA 2AXFA 3WFEH 5KVGH 5F72S 5E8OB 1NAML 1O7VA 5EBMA 1W0VA 1QD0A 3RZCB 1I1AB 3EO9H 5JA8B 4WFEE 5F88B 1J8KA 2YPLD 5K59F 1Z3GH 1OTUC 5FUZL 4NZUH 4OUUB 1T0MA 2F5AL 2FYYB 1TVHA 3I6KA 2FEDD 4JZJC 1S9XB 1GGUA 2ZPKL 3V5DB 3KYOB 1F5WA 3VXUA 3LKNB 2E8YA 3GKWL 4LRNH 1CDUA 2IAMB 3CH8A 5TF1H 3V2AR 1Y6NR 4MJIB 4GG6B 4P3WA 3VXSA 2DB8A 1AI1L 4X80H 4KGLA 2X4OB 1JGDB 3S97C 3C6LD 3RWJA 5DUBA 3WE6B 2BNRA 4RQQA 4J3OC 4AL8L 1K6QL 1CQKA 1IGFL 4UV4L 4ISVB 3HE7B 3OJ2C 4G8IB 2J88H 4FQHB 3MUGB 4M8VA 4LF3B 3QQ4A 2BVEA 3PQYE 2WUCH 5ESVB 5ERWA 1KCUL 4N0FA 5L0QC 1T5WB 5IB2A 3LHPL 5D7SL 4ERSH 4APQD 2HN7B 2XYCA 3O0RH 5ALBL 1KPVB 2GUOB 4HUUA 3VFUA 5DDHA 4OLXH 4NKMA 1G7QB 2B2XH 3H3KA 1UH3A 1X5GA 2ARJA 5A2FA 2FX9H 2A73A 3IJSB 5DJAB 4NDMB 5GS1A 1PX3A 3QDHA 5SWZD 5CEZE 4L4JA 3S4SA 2AJSH 2X4SA 4Q2ZA 3OMZA 2DJSA 1RZFL 4K8RH 4XCEB 1XIWD 1GGTA 3MCLH 1FFPB 1MH5B 2ITCB 4NC0B 1ZLVH 4MA1B 4BYHA 1HHJB 2O5YL 3QHFH 2YXFA 1CD0A 2GTZB 3EFFA 5FIEA 4ESKA 3WIFA 1I9JH 4PUBH 2CKBL 4JANB 1BFOA 4G8GA 3VG9B 5DRWB 3RWHB 3BYYA 4QOKE 1A6WH 4IRSA 4OKVB 1FGVL 4QY8B 4LSQH 4X4MA 5DEZA 1N59A 3CZJA 3KWWB 4NKIH 5LGJB 3WNLA 1CVSC 1QFHA 1KJ3H 2VLRA 5EZLA 1JPSL 4MJ6A 4NCDA 3BQUC 1PY9A 4GRWF 3BIKB 5I16B 1FZOB 4QGTA 5HDQL 3RTQB 4YEEA 3A67L 2OI9C 4F7MA 2VDLH 1UA6L 4PLJC 2R23B 4C56D 3WFBL 1OB1A 3KYKH 1QBLL 3UEZA 4Z0BL 2LTQC 3QUZB 1XF3A 2Z91B 4ZUVB 3Q2CA 2HKFL 3BESR 5KSAB 1C5CH 4POYA 4O2CA 4P3CL 5BS0B 4KUCF 5T5FL 4DKDC 4Q6YA 5E8EB 4OJFL 4ZQKB 3TWCH 1RHFA 2QV2A 2EXWD 1NDMA 2XNAB 5JOFA 4TN9A 3CSBA 5GGQL 1VERA 4YH6A 1BEYL 1J8HA 5HYJB 1C5BL 4LNVA 5E5RB 4CADB 5DRZB 5E94A 3V4VH 1YNKH 5GHWH 3TYFA 1JMXA 4D9QE 4IRJB 2DI7A 2EE6A 3M8OH 5KW9H 5JZ7C 4DCQB 2QKIB 5JW5B 2A0LC 2IMMA 5EUKB 5MEQA 2J12B 3ZT5A 5D6DA 4JM4L 1KCKA 2HJLB 2XIDA 2VUOA 1OP3K 3PABA 2AI0H 4J6RL 1HZHH 3FQRA 3LKSA 4TSBL 3GBNH 2I9TA 4PJAA 2AEQH 3QPQD 3SQOH 4JR9L 5KVGL 4R0LC 5EIVA 4QTHA 4JRYB 2GT9A 4NOBA 3WDJA 4LPVA 1OVZA 3RBGA 4N1HB 3EO9L 1QOKA 1ZKAA 4LKXA 4DZBA 5TE7H 4NZUL 1EO8H 2D03H 1A7QH 2GHWB 1FE8H 2X4RB 3MRPA 4ZOEA 3MLUL 4OD2B 3OZ9H 5KS9E 2NQCA 1IC7H 5IV2B 4FABL 5D2LE 1CTNA 5IB5B 4ZYKA 4J4PA 5TF1L 2H6PA 5IJKA 4XP1H 4U3HA 3ARFD 1IFHH 3P0GB 4HWBH 4E5XA 3FO9A 1J11A 4Y2DA 5FYKH 3TNMA 3QEHA 3BAEL 5HYSB 4I48B 4Y88A 3MRKA 3VWKB 1AHWA 3O2VL 3M17B 4X6EA 2Q6WA 3ZHLA 1WZ1L 3QDMD 1QFUL 5HHPB 3MV8B 1FZMA 2XI9A 3HZVB 5GS0H 5DJYB 4BFBD 2BVUA 1WF5A 2QQKH 1J05B 4F7TB 5EBWB 5F7LB 4OLXL 4GKZB 3ARDD 1CE6A 4XNQB 1HXMA 1QSEB 1ITCA 3MZTA 2FX9L 1A2YB 5FUCC 3D85B 3IKKA 4U1KB 1UZ6E 2JJSC 4F9PA 3SPVB 4YFEA 1K9TA 4X6CE 4NO3A 3RVTC 2AJXH 4K8RL 1YPZF 3HRZA 3MCLL 3V7MA 5I0ZA 1WC7B 2CDGA 3QHFL 3QUMA 5ID1A 3JSSA 4TQEH 3QAZB 3MV01 3EDKA 1FYTA 4PP1D 1XF1A 4U1HB 4PJXB 2DJ4A 1B90A 3I75B 4FFWC 2HP4A 4PRDA 3KPNB 1UB6B 2OR7A 1SJVA 4D9LH 4JDTH 1A6WL 3SGJA 2AXGA 4E41A 5F9JB 4LSQL 3ROLB 2NXYB 3B2UC 3QUYA 1MJJA 4PRHB 1KJ3L 3EHBD 2ICEB 1U93B 3KLAA 3TEUA 4LBEA 2WBJA 4C56E 4Y0GA 1YECL 1BECA 2VWEC 4S1RL 1MQKL 1NAMB 5FOBB 1A7BA 1VEOA 2A6DA 1FLRL 1G7HA 5ICYB 3VXOA 3DARA 5TGBA 4RAHA 5KSVB 3GIZH 5CEYB 2MFNA 3GJFK 4DW2H 3LS4H 4OZHF 4R4NC 4ZUUA 3BIBX 1C5CL 1PG7W 4JRXD 4PJ9B 4I0PC 4R7DB 4WI2A 4G3YH 2JJWA 3CDYA 3GSVB 4XCCH 1EIBA 4TUOA 2WV3A 4GAFB 3RIFK 1ROWA 3RWIA 3V4VL 1RUKL 1J12A 1YNKL 1UB5A 5MEOB 1WVZA 5GHWL 3QHZH 4OFIA 3G04B 5FM5O 4EEEA 5KW9L 3ARYA 4U1JB 1MCOH 4RFNB 1B0GA 2PXYA 5I30H 4JO3H 1P2CA 5GRUH 1MJ8H 5T3XE 1T1YB 3QUXC 1I1FB 3I50H 2AI0L 4Z7WF 1HZHL 4AIZA 3MA9L 4L4TE 1JF6A 5C0EA 5FA3B 5GISH 3E8UH 3PXHA 2AEQL 3PWJB 2DMCA 4YUEL 1U8NA 3SQOL 3D2UD 1LO3H 1P1ZA 3OB0K 2QJDA 2HT4D 2X6MA 3QNYA 1BWWA 3WUWA 4L3EB 5FGBC 2AJZB 1FYHB 3JWNC 3NZ8A 4BK4A 5JDSB 1A1OA 4G6KL 1MCQA 4PLKD 5AZ2L 1EO8L 3MV7B 1A7QL 1FE8L 4DVRL 1VB9A 3Q5OA 2P45B 2VLKB 1IMHC 2I5YH 3FHAA 4KQ3H 2PYEA 3VJ6B 3OZ9L 3SBWC 4GAJH 4HK3J 1FG9C 4JPKH 5A1AA 5BOPA 3ZKND 2CDFA 3RWGB 3OR6A 2CKBB 1QLRB 2P5WE 2OZ4L 3C5JA 4PGCB 4XP1L 2R2BB 2BSRB 5BZWB 1IFHL 1DANT 3WV0A 2QLVB 4OZIA 1KT2B 1BQHA 4UU9A 2FHCA 5D1ZA 1WBZB 4FMFA 1WT5C 1CBVH 4YPGB 4AMKH 1T21A 3QDME 3VE0A 1P4LB 4GRWH 5D71H 2RHEA 5JXED 4Y5XB 1NGZB 2OTWB 2QQNL 1NCDL 4PJCF 3S36H 1YUHB 3O6FA 4LHUA 4NC1E 1C12A 3ARED 2ESVA 3SE4C 5DEFB 3O6MH 1Q72H 4RA0C 4PRBA 4LPYA 5EU5B 4LCCC 4F33A 1B4RA 2IANA 2QQKL 3UYOD 2VOTA 4JY6B 4N0YL 1XGPA 2IH3A 4YXLH 3JTTA 4NQDD 2BNQA 2F15A 4PJHF 1XR9B 3CFEA 3CLFH 4QRPD 3HE6C 1P7KB 5H35A 4ODWB 3R06B 4JN2B 5L2JB 4JFYB 1OM3H 3W9EB 5I17B 5E70A 5E99H 5E8NB 1FNHA 4M4PA 4HK0A 3E3QC 2GIYA 3LKRA 4PJ5D 1B6DA 3O8XC 4TQEL 4LCUA 5K9KA 4HZAA 4R8WH 3U2SB 3VH8B 3VXTA 3HZKA 4OZGA 3FB8A 3K8KA 2HTLC 4YDKL 1CVRA 4X0KB 4W70A 4LSSH 4JDTL 1BJ1H 3AY4A 4DN4H 1VA9A 2DQTH 5ICXB 5D96B 3SCMC 5EO9B 5HY9A 4JPIB 2JIXB 2APVA 3LQAH 3FOLB 1HI6B 4TNWK 3NIDF 2VITB 1OGTA 3MFGB 4RNRB 3MV9D 4LKCA 1Q9KA 2OMBA 3ZL4H 4WDIA 1J0IA 3LB6C 4EOWH 1ZA3B 1IJ9A 4PJBA 3MLTB 1AKJD 3QEUA 5FYJD 3V52H 4ZNEE 5TDNA 3GIZL 5IM7A 2FX7H 4ODUB 4Y4HB 3SDXA 1DFBH 3VMNA 3ARXA 4DW2L 2XPGA 4KMLB 4YDLC 1BJMA 5CILH 3QFJD 1QA9B 4LDOB 3H9SD 2HAZA 1E4KA 5DT1L 1AGFB 4JHBA 1WAAA 4G3YL 1ULVA 4XCCL 3V0WH 3DSFH 3TBVA 5IMOB 2JJSA 1FVDB 1CN4A 4IDJH 4M7LT 1OTTC 4PJ7E 3QHZL 4FG6C 3K4AA 4IIQC 3PIQA 5ISZD 2IBZY 8FABA 3HB3D 1QBMH 1MCOL 4KHTH 2KZWA 1NFIA 5D7JB 1HHGB 1FH5H 5I30L 1AO7A 2X70B 2V7HA 4W4OA 5JLZB 5GSRB 1BREA 4G7VH 4ODXA 1AD0B 1FQ9C 3I50L 2IFFH 1U3HC 3QG7L 4FQXA 5GISL 4FXGB 3E8UL 1MWAH 1MI5A 2VABA 3E6FB 1LO3L 1TETL 2DQEL 5JO5B 2VXUH 5EOTB 4JZNB 1FC2D 4FFVC 1WBXB 1IC5H 2DQGH 1SEBA 2EIEA 3SKNB 1BZQK 1CT8A 4ALAH 1NJ9A 1AR1D 4POZC 2ICWA 4HD9A 2ZUWA 1BOGA 4A6YA 4G43B 3NTCH 1JF1A 3QIWB 1BFVL 3BEWA 3H7LA 1CI5A 4RRPA 2NZIA 2I5YL 4KQ3L 4CJ0A 4GAJL 4JPKL 1YMMB 5H94B 1IM3A 1NL0H 5DA4A 1BQLL 4I3SH 2CKNA 3EOTH 3KPSA 3QWQB 4IHOB 1ED3B 3CC5B 4WO4C 1JRHH 5F1IB 5DQDL 3QZWB 4LLYB 2P8MB 4BSVB 1H3XA 3KS0H 4DOHB 5B3JE 3D3VA 5IJVA 1CBVL 4JDVA 2ID5A 5K9JH 4K7PY 2IG2H 3BWUC 5D71L 2X89A 3H9HB 1M05A 3IJYA 3S36L 5SWSB 5EU6A 3ZMRA 3O6ML 1Q72L 4P23B 1MAKA 5HHNB 4HH9A 4NQDE 4P2OB 5CBAB 3TVMA 2VL5A 1DQTA 1ZHLB 4QRPE 3D18B 4DEPC 1HQ4B 4YXLL 5C0AD 2OCFD 1LO0L 4N8VA 3CLFL 5FHAH 3JV4B 2VO5A 1OP5H 5C2BL 1OF2B 3WS6C 3CMGA 1QHOA 4ZS7H 1HQRB 5LBSH 4UTAL 5J0BA 4ZUSA 3MRMB 4XNYH 2KPNA 4PJ5E 3L3DB 2OK0H 4P9MH 1NEZG 2YD2A 3PE9A 2AQ2A 4GBXD 4NQEB 2P5ED 5EU7C 4KJPC 4WRLA 1C7SA 3WJLA 2A74A 2IAMC 1BHGA 4R8WL 4NQVB 5H2BB 2C3WA 4ZFFB 3MRFB 1FFRA 4Q6IA 4UDTA 3K1DA 4UIMA 1QPPA 4L8DB 4DN4L 4X4YA 2Z8WC 2DQTL 2BHUA 1JV5A 4IMKA 5FYLH 4LSDA 4GRLD 3EYUH 2NY2B 1KACB 4N1EA 3DX7A 3LQAL 2VDRH 3OGCB 5EWIH 4PG9B 4U1SB 2B5IB 3HE7C 3VWJA 4LQFH 5K9QI 3VXMB 5HHQB 1JHKL 4D0CA 4HS8H 3W81A 3QI9B 3MRGB 4U1NB 2FCBA 4HPOH 5DD6A 5FYJE 2D4FA 1MPAH 3D1MC 3NAAH 1OWRM 3LV3B 5GGUB 3V52L 4PY8J 4ELMA 2GITA 4G6FD 4J12A 1OGAD 2B8OT 1ZHNA 2C1OB 3H9SE 1JRHI 1DFBL 3TJHC 4NZTH 3T0ED 5D2LF 3NIGF 3BKJH 1NMAH 5CILL 2OJEB 2XA8L 5BVJA 1NUDA 4XI5C 5CSBA 4NRYB 1KIQB 1F6AB 3P0YL 2VDMH 2JJVA 2CJUH 4MA1C 4LFHD 5GSVA 1IE5A 2I07A 3JWOH 1TCRA 3IFPA 1HHKB 1ZHKB 2GFBB 1TTGA 1KPRB 3UYRL 1ACZA 3OL2A 2ATKB 2PF6A 3WJJA 3UBXG 1QBML 4KHTL 5FA4A 3VMOA 5GGRB 1U3YA 2NZ9D 5CUSH 3T0BA 5IBUG 2AK4B 3UTTA 3OPZH 1EFXB 4PREA 4G7VL 5ANMA 1IAOA 2R0KL 2L7JA 2IFFL 5F9OH 3OKNA 1IZJA 5F89A 4U6HA 3TM6A 1ETZB 1T89C 3ALPA 3RTQC 2BK8A 3RI5F 1MWAL 4XXCA 2VXTH 4LCWD 5TE6H 4YHIA 2VXUL 1P6FA 1UZ6F 3MBEB 5IMKB 5JOEA 1TNMA 2ZOKB 4PJIE 4Q97A 3TH2T 4X6CF 1PKQB 3QHTC 3OG6B 3MYJB 3MRIA 3W11D 4ALAL 3B5TA 3KPOA 3NN8A 1ZMYA 1I75A 3VDBA 3NTCL 4NQCD 5DMYA 2B0SH 1G9NC 4FXLA 3V6OE 2YWZA 4QRQB 4F2MB 2G5RA 2W07A 1W72H 2XN9B 1XZ0B 4OGAD 4ZPVB 2P8PB 5T33H 1NL0L 2Q8AL 4I3SL 3ZDXE 4YLQT 4LOUC 1JRHL 4YNYB 3B9KD 3OKEA 1UC6A 4LLVA 1U91A 3TGXA 3GSXB 5LKNA 3FT4B 2CRZA 5J1TC 1Q9OA 4KKBD 4OBRA 1X5FA 25C8H 3TO4D 5K9JL 4H20L 4IRJC 2IG2L 4M7ZB 4MXQC 3QXUA 4WI6A 1KTRL 3V4PH 2DQFA 2VTFA 1JGEB 4Z95L 4XRCA 1IAMA 1C5DA 4AJ0A 3ZTNL 1KN4H 5MHSE 5IK3B 4LHJB 4JGUA 4NFCA 4MHHG 4K3HA 1H8NA 5C0AE 3F5WB 1HXYA 3B3IA 2NY0B 4LPWA 4ZFOL 4TOYH 4U6VL 5GS2H 4S11A 5F70A 3WFHA 5IB4B 2ENSA 1JZ8A 3BPCB 5FHAL 4PJDE 2FO1A 4JG0H 1PVHA 4NYLA 2WWKO 5EBLA 4OIIH 5ACZB 3O3BB 3CVIH 5D5MA 4XNYL 1MFNA 2P5EE 1BGXH 4M4RA 1AGDA 1A7PL 4P9ML 1FHGA 4RAUB 3PWPB 4JRWA 1BQUA 1U8JB 1D5IH 4LVOB 5CJOL 4YIQA 2P24A 5HHXH 4XGZB 2FL5A 3VFMB 3HMXL 4ZS6C 2Y6SC 4JFZH 3QXAB 4YFDB 2AEIT 3V6BR 2P1YA 3MRLA 1SYSB 1LE9A 1D5MB 1F4WH 1R3JB 4N9GB 4P2RB 5FYLL 1CICA 1N7MH 5C7XH 1DQLL 3EYUL 2IH1A 1UACH 4V1DD 5GQBA 2W9EH 2P7TB 4Y16D 5K93A 5C71A 1GL4B 2HVKB 2VDRL 4D3CH 3DHMA 1S78D 4MD5A 3RL2A 1OPGH 3DJ9A 3KXFB 5DVKA 4N0CC 4PRIA 4YDIL 4I2XB 4LQFL 5EO1A 5B8CA 4PD4K 1FJ1B 4I9WD 4J8RB 1I8KB 5ITBL 1EO5A 4HS8L 3V0VA 3VD7A 3WNMA 3GSOB 3WN5B 2Y5TB 4HPOL 1UWGL 3TFKD 1MPAL 1OGAE 3CPLB 3ZO0A 3D0LA 1U8IA 2X9XA 3ILQD 1MCWM 4M1CD 4GRMB 1HSAA 3T0EE 3LS5H 3U9PL 5BO1H 1HNFA 3C5ZD 1PBYA 5I2IA 1U8OB 4XNUH 2YD8A 3WUZA 2BY0A 3BKJL 1NMAL 5F6HJ 5DK2B 1FNLA 1U92B 1RVFH 3N50A 4P9HH 2VDML 2GKIA 2CJUL 4KRPD 5J12C 5E8OA 5HYEA 1B2WH 1HHHB 3QAZC 2AJVH 3RZCA 1I8LA 1WIUA 3MLVH 1JN6A 4DQOH 2G5BB 1KFAH 1I1AA 4XWOD 4WHYH 4GRWB 5F88A 3MR9A 5FCSH 5DHXB 3VXNB 1SVZA 3O9WD 3W9DB 1UM6H 5HPMB 2FYYA 1S9XA 2VZOA 3ZE0E 3V5DA 3KYOA 3ECBB 4I3RH 1T7ZA 2NXYC 1JNNL 1NGQL 2AEPL 4U4BA 5F9OL 2W1NA 5ITFB 5I1IL 3KJ4C 4GG6A 3EOBB 3GMMA 1M4KA 1AGCB 2GJ6D 4MJ4A 5I1AB 3STBA 1XT5A 2VXTL 1CD1B 4KI5C 2X4OA 1JGDA 2A83B 4XC1H 3WE6A 2CRIA 2HYMA 4NQCE 1HEZB 5E00B 2CDEB 4Y19B 4ISVA 1X5KA 3BX7C 4MLSA 5T1KB 1CFVH 4R2GB 1DL7H 3S5LB 4G8IA 3NA9H 4JQVA 2FR4A 4P0DA 4FQHA 3MUGA 2B0SL 1JGVL 1W72L 4KROD 1SBBA 4GSDL 4LF3A 3A6CL 4UI2A 3K46A 4YHYC 5J7CC 3MA7B 4O5LH 4YDJB 1T5WA 1T0PB 4QTIL 1KPVA 2GUOA 4JFFB 1VGEH 3K74B 1G7QA 2JELL 2X05A 3IJSA 4JO4H 3O81A 4NDMA 3C8HA 5DJAA 2YD1A 5IUSA 2SEBB 3LKQB 5JOPD 4WENB 1T3FB 5IEHB 3D5OF 4Z7QE 4LP4A 5KVDH 4XCEA 5I15H 1AY1L 5F3BB 1FFPA 3U79A 4RFNC 3H6JA 1HHJA 1LNUB 1NEUA 2R1XB 1WK0A 3OKYA 1NMCC 5DVLA 2QTEA 5GJTH 4Y4KD 3NCJH 1Q38A 5DRWA 3RWHA 2BX5A 4QXGH 2WINA 5HI3D 1HWGB 5MEND 4TOYL 4U6YB 4DN3H 5KAQG 1BBJB 1KCSL 4QY8A 5D1QC 5LGJA 3KWWA 1GPOH 4JG0L 4DUXA 5LGHL 3PDOB 5GZND 1QTYT 4XP4H 4OIIL 3CVIL 1MCRA 4X7SL 3BIKA 5I16A 1FZOA 4B41A 3QO0B 2VQUA 1JYWA 1D5IL 2D0GA 2YOCA 4W6XB 1XCTB 1LQSR 2R23A 2OSLA 4PJ7F 4JFZL 3MV11 4J3VA 3DX9B 3QUZA 4JQXC 1F4WL 2Z91A 4ZUVA 3OKLB 5FV1L 5EFIB 5C7XL 1N7ML 4Z7NE 5KSAA 1TNNA 3C5SB 1UACL 2W9EL 5BS0A 4GLRI 4D3CL 3L5XL 4ZQKA 5F96H 4I9WE 1QSZA 2XNAA 2C9AA 1OPGL 4Y5XC 1MWAB 4O58L 1BX2A 4O9HH 1GAFH 2YEZB 1K2DB 4CADA 5DRZA 1T7WA 5DC0A 5I8KH 3HUJB 4ENED 1YPZB 1CDIA 4IRJA 2PW2B 5D2NA 3QFDB 2XWBB 2WWMD 2FJFB 2X42A 2QKIA 1AQDB 2BNUB 2HTKC 1AGBB 2YD9A 3SDAD 3QDGD 4BKLB 2J8UF 3ILPB 4XNUL 2HJLA 2H45A 5I19H 4KPHH 3LDBC 1R3KB 5F93C 2VMFA 1YQ2A 3BMVA 4MAUL 2K7PA 2J5LB 4EXPX 5D7LD 4ZPTB 4JHAL 5DD3H 2PTTA 1FAIH 3INUH 3BRFA 2YSSB 3E2HC 5CSZB 5ESQB 3C8KB 1SMOA 3V8CA 3MLVL 5F71A 4DQOL 3U0TB 5D1XD 1EERB 3RGVD 4HFUH 2X4RA 5A16B 1MRFH 3RFZC 2GSIA 1SM3L 4Z7OE 5D96C 4M93B 1INQB 2PO6B 3QIBB 3RHWF 3DTXB 2GJ6E 3F6LA 1ZEAH 1MRDL 1RMFH 3AGVA 1WUNT 5T1LA 3T2OA 3ZYZA 4ZFOB 1H9VA 2O5XL 5LXGH 4UQ3B 2WLYA 1C16B 3ZT7A 4OZHB 4MMZC 4HJ0D 4I4WB 3S98A 3EYOB 3BPOB 1N5YH 3T0XA 5E4EB 4X83A 5HYSA 4I48A 3SJVD 3UZQA 3S35X 2BMKB 4P4KA 4KWUA 3VWKA 1CFVL 1DL7L 2CK2A 1V8HA 3M17A 4ONFH 1JWSB 4M9OA 4MQTB 4W6WB 5HHPA 3QWOB 3BGAA 3HZVA 2ARWA 1NC4D 4PB9L 5DJYA 2Z31B 3LZFH 4O5LL 3B9VA 2CIIB 4M6MH 1J05A 4F7TA 5GGRY 4ZDHB 5EBWA 1BBDH 1D5XB 3CU7A 4ODVH 5IW6B 1VGEL 4GKZA 4XNQA 4B7IA 4HCRA 1GGIL 1QSEA 2WP3O 4OFYD 1A2YA 4JO4L 1P53A 3D85A 1MLCB 4PTTB 4U1KA 5T3XH 3ZKMD 4C55A 1S9VB 3SPVA 4Z7WB 1VFMA 5I15L 4EUPH 3S3SA 3MGTB 1D5BA 1WC7A 5D7JC 4P5TD 5EORH 3A6OA 5EDXA 1KIRB 4RCAA 5MENE 2DWEB 3LEYL 4PJ8B 2ZCKH 3AVEA 4PJXA 4U1HA 3I75A 4HAFA 3KPNA 3NCJL 4QXGL 4UBDD 4GW1B 3I3BA 1JF5A 4Y4FB 4DN3L 1F4XH 2QSTA 5F9JA 5DURB 2YUZA 3ROLA 1FP5A 1KEGH 1QFWH 1GPOL 3KPRD 4PRHA 3RVXD 3C60D 3WHE0 4XP4L 2ICEA 2YC1B 4D0DB 4M02A 2EH7H 2QL1A 3QIWC 1X7QA 4ZSOB 2D7OA 5DTFA 4FP8H 1R5VB 3ALWA 1NAMA 4NFDA 4YXHL 2NY4B 5SX4H 2Y4SA 5FOBA 2FD6H 2ZSWA 5ICYA 2X4PB 1PG7L 1IGCH 2GSGA 5KSVA 4PJCB 3HRPA 5JIPA 4RRPG 4ZUWB 3T65B 4S0TD 3WIHH 1IAII 1VFOA 1Y6KR 2Y7QB 3KYNB 1CDBA 4L5FH 4PJ9A 4R7DA 1AXSB 3KVQA 4JKPH 4XMPH 1G9MH 4DGYL 4YE4H 1LVEA 5CGYC 1GAFL 1NCCH 4PJHB 1MFCH 1BVKB 3KLDA 3L6FB 4LNRB 1PLGH 5B39B 2JF1A 4PJIF 5I8KL 5MEOA 1JFQL 3P4MB 4P2OC 4NQTA 1RY7B 3G04A 4U1JA 2DDQH 2HMIC 1R24B 1LHZA 1RZ7H 1W72B 4PD4J 4G9FD 1T1YA 1UJ3B 1I1FA 4KPHL 5D7LE 1DCLA 1NGYB 5L2KB 2Y06L 3ZDXF 2UWEB 5C0BB 4I13B 4HKZB 3PWJA 4L4VD 5DD3L 3E6HA 5CJQH 3HLAB 4QHNB 1FAIL 1X9QA 3LKPA 4L3EA 3STLB 1GZQB 1MHHB 1Z2KA 4JAMB 4WU5B 4JM2D 5DHVH 3PL6C 5JDSA 3N0PB 2EXYD 1FRGL 2IALB 3VFGH 4HFUL 5C92A 3EYVB 4HIHA 2VLKA 5DO2C 4RWYL 1KENH 3VJ6A 4OI7A 5JNYB 4C83A 3RWGA 2NY2C 1QFWI 1QLRA 2CKBA 1RMFL 3GRWL 3R8QA 4QXUH 4RGND 1SBSL 4PGCA 4F7CB 2GJJA 2R2BA 5BZWA 4JDZB 2K9UA 1NUNB 5LXGL 4Q9QH 3FB5B 3BP4B 2BOBB 4UAOC 3SJVE 5BV7H 1IAIL 4PJDF 2ADIB 1WBZA 2WK2A 4J23A 5EN2B 4A2MA 5FOJA 5SX4I 2ZJSL 1FGNH 1N5YL 5J1SC 4X99B 1BWMA 2LABA 3MODH 4J3XA 1NGZA 2OTWA 4Y5XA 4KTEH 3WFZA 1U8KB 3KDMB 2DYPB 4RGOH 1M7IB 1YUHA 3ARQA 1W2KT 4PRPB 1IAIM 4CN4A 5DEFA 4H1LG 4RFEB 5HYIA 4KK6C 2YPLA 5EU5A 4OT1H 3GSUB 5DZOA 3T8XB 4M6ML 4P5MB 3O4LA 4JY6A 1BBDL 1UXSB 4ODVL 1DN0B 1D6EB 3JVGA 4YDVB 4D2NA 1P7KA 5T3XL 4ODWA 1NBVH 2ED8A 4JN2A 3MLXH 5L2JA 4JFYA 1GSMA 1JZ2A 2JJTC 3IS0X 5I17A 2DLTA 3LVEA 1TMCB 3FFCD 1M6OB 1LO2H 3VXUD 4MNHB 3CMOH 3ULUE 2CO7B 5GS0C 3D69A 1OT1A 1QRNE 4HC1A 2YR3A 3U2SA 1ZANH 2J6EH 4CGTA 1EEYB 1GOFA 1OAUH 3SEPA 3KPRE 1F4XL 5ICXA 4MDIB 5EO9A 3MBEC 2BNRD 3TT3L 1QFWL 2GK0B 4JPIA 2JIXA 1AFVH 5IVXA 5I0DA 1HI6A 2IFGA 6CGTA 4QOKB 2VITA 4LK4A 4LLUB 1UYWH 4L3CA 5I18H 4RNRA 3ARTA 4FP8L 4YAQB 1MF2H 3BE1H 1QFWM 4LEOB 4Z18A 1FL5B 2FD6L 1EHXA 1PDKA 4QHKJ 1ZA3A 4RWHA 5IFHH 1IGCL 3MLTA 4XTRC 4EKXA 2W92A 3IVKA 2XTJB 2AERT 3QXDA 1G6VK 4ODUA 4Y4HA 3ZE0F 1S7SB 4CU6A 4NBYB 3VXRA 4OV6F 2XRAH 4L5FL 1AGFA 4MQXD 3RI5K 4EDWH 4JKPL 4XMPL 5GRVK 4YE4L 1NCCL 4XVUC 1MFCL 4RMTA 3UX9B 2YD3A 5IMOA 3RNQA 2I9LB 1FVDA 2BRRH 3IDMB 3U4BL 4G8GD 2UVFA 4G9FE 4IRSD 2DDQL 4GOSA 2DLEA 5D7JA 1HHGA 1T7VA 3OQ3B 1NKRA 1RZ7L 4JFPB 4X6DE 3QIUB 3C09C 3L5WB 5GSRA 2VLRD 3CFCH 2NX5B 5B22A 1AD0A 4L4VE 5EZJB 2FGWH 1MJ7H 4FXGA 5EZOL 5FK9B 1OSZA 2GTWB 1H3TA 4LVOC 3UDWC 5ADPH 5JO5A 5EOTA 5CJQL 4JZNA 4YHMH 4JN1H 5HGHB 1C7TA 1WBXA 2EDJA 2WW8A 2DTMH 1MCHA 5I66B 4G43A 1MHCA 3HC4L 3VU2A 3VFGL 4ONOA 3GNML 3ARWA 3S3PA 2DICA 4P4RB 2OTPA 3WNKA 4U6XA 1KENL 4RGNE 5FYJH 3TA3D 4RSVA 1YMMA 5H94A 2XQBH 1DEDA 1ACYH 3TBTA 4QXUL 1RIHL 1J8HD 1GIGH 1ED3A 5F1IA 3S6CA 3MYZA 5DJ8B 1T2XA 3GSQB 3QZWA 1LO4H 4LLYA 4WWKB 4KXZH 5F7FA 2P8MA 5BV7L 5AG9A 4BSVA 5CEXB 1RJLB 1OAXH 5D2LB 3WFCL 4BSJA 4XCYB 4LAJH 1PQZB 4GW5B 1ZE3C 3DUSB 1S7XA 3MRCB 1EBAA 4JCLA 4NWTH 3MODL 3H9HA 5CD5C 4RGOL 5SWSA 3EJZD 1UWXK 4AG4L 4OF5A 4P23A 5HHNA 5KZCB 1ZT1B 4P2OA 1L7IH 1CL7H 4HEPG 3D18A 1FCCA 4XPHL 1JZ6A 2V5MA 2WUBL 1NCAH 4OF3A 1NCUA 4YHNB 2YA0A 3JV4A 5DS8B 4Z7NF 5DMKB 5E2VH 1OF2A 4PGJA 1HQRA 5C1MB 4X7DC 1CLCA 1YQVH 3ARBB 3L3DA 1B3JA 1H3PL 1MCLA 2WLZA 4MYWB 4R3SB 4EJ1C 1XIWB 4NQEA 1TJGH 3BKMH 4OZFA 4Z7UE 2YKLL 4NQSB 2KQNA 3CFKA 3MNVB 4J4PD 4X6CB 3VXSE 1I85C 4OLZH 1ZANL 4ZFFA 3MRFA 5FB8B 2HFTA 4OZ4B 2EO1A 4I0KA 1OAUL 2BNRE 2E9WA 1M71B 3SKOB 4TPRH 4JFHE 1S7RB 3MFFB 1UT9A 4QHLA 4Y2DD 1RJYB 3FRUB 4EIGB 1I7ZB 3VA2C 3D0VA 1AFVL 2NY7H 4R97B 5D72H 2PTVA 1YEHH 4PG9A 5EUOA 3R1GH 4R2GC 1UYWL 1AD9B 4AEHH 3VXMA 5HHQA 5J89A 1MF2L 1YN7B 4MXWH 3BE1L 3QI9A 3GO1H 4OGYL 5A2JH 1T4KA 5L88L 5GRXG 4QHUA 1EFQA 3GBMH 3LV3A 5GGUA 2B7DT 4R7NB 3T04D 1A3LH 2R8SH 2C3HA 1FN4B 2C1OA 2GJZB 2NYYC 4H26B 1CDCA 1LDPH 3AS2A 4Z7OF 5J56B 3IKCB 3P4NA 1CIDA 3LQAC 2OJEA 1NBQA 5FV2A 2OZ4A 3MOQA 4H8WL 4DFIA 1EUTA 1MRCH 1Q9WB 4NRYA 1KIQA 4HGWB 1A6AA 1F6AA 2AGJH 2CXGA 5HGAB 2A2QT 3MRHB 4EDWL 1V5JA 3FN3A 1BD2A 1SJHB 2CPCA 1CS6A 4G8GE 1FYTD 3QNZA 3BHBB 2GFBA 1KPRA 1JZ5A 1EVUA 4EIZC 1XFPA 5IKCB 2BRRL 5CSGA 4NM4H 1F3RB 4X4ME 2NY6B 3LN9A 1EEZA 4LPXA 3OXRA 2DD8H 1CL7I 4E41D 2VLRE 4NCC1 5E4IA 3ZKSD 3WCYA 3DETD 5GGRA 1K8IB 3QUYD 3SDCC 1EFXA 1UXWA 3MJ9H 5CS7A 1F42A 3GMNB 3VG0H 2WBJD 1S5HA 3HAEG 1W0YT 3UTQB 5SX5H 5E2UH 4KK5C 4DFHA 4WTZG 3WLBB 2H2PD 4JN1L 5IMKA 2ZOKA 3FL7A 4JRXA 1PKQA 3MYJA 4L4TB 5ENWB 4GXUN 5ID0B 4EUPB 2DTML 2DM4A 4JVWA 5EZIH 2VR5A 5EA0L 4YHZH 2MCG1 4F2MA 2XN9A 4RGMB 1MFBH 1J8HE 5IFAL 3BN9C 4ZPVA 5C0JB 2VQ1B 4QRRA 2P8PA 2XQBL 3RU8H 1ACYL 1MCDA 4X4ZA 2VZTA 3IDNB 1ZA6B 3QJFB 4HH8A 1U42A 3D39E 4YNYA 1CE1H 1LO4L 1DBBH 1MEXH 2R2HA 3LPWA 2UV3A 5FDYA 4X4XB 2H2SC 1BZ9B 2P5WB 3IAQA 4JFQA 4LIQL 5JW4M 4PJFA 2W65B 3U46A 2PXYD 1FFQA 3N9GH 3BPLC 5A3IC 1F3JB 4ODHH 1JGEA 5FXCH 5ACLA 5IB3B 2BY3A 1UM4H 4PLOB 4PJAE 3E1F1 4KKLC 5HI5C 1NGPH 5FM4A 4FQPA 3FFDB 5IK3A 2O93L 2VERN 3O3DB 5FO8B 2OP4H 2OYPA 4LMQE 3F5WA 1EJ6A 2BJML 1L7IL 3WHE1 1CL7L 1A14H 4KY1H 1UENA 3U6RA 1A3QA 4HF5H 1NCAL 3NH7H 5IB4A 5CLWA 3BPCA 3O2WH 4YR6B 4EXKA 3ARVA 4JPVL 5IW3A 3BQUD 5ACZA 3O3BA 1YY9C 4HS6B 2A6IB 1YQVL 4I0CC 5CWSB 1TIUA 2DS4A 4RAUA 5CJBA 3PWPA 4PG2C 1M7XA 2VUYA 1U8JA 2APFA 2VH5L 2PYED 3OKKA 3BT2H 1EMTL 4XGZA 3BKML 4M93C 2V9TA 3MOAH 1X6LA 3QIBC 5DGQA 3LEXB 3QXAA 4OLZL 5JXEA 4BZ2H 5I1DA 4MAYC 1MJUH 3Q6FB 3B2VH 3FKUS 1CFQB 5CP7B 1SYSA 3S36X 1D5MA 3WKMH 4QXWA 3PDDA 4TPRL 4N9GA 3MRQB 4GQ9L 4F15B 1H5BB 4AEIL 2COQA 3GMPA 2F8XC 3BPOC 4Y8AA 1KTDB 2HVKA 2NY7L 5TJWK 5E2JA 5D72L 5E4EC 3JTSB 1UKTA 4BZ1H 4HIEB 5DR5H 3R1GL 3O6FD 4LHUD 3KXFA 2X4QB 3FOMB 2ESVD 4AEHL 1FJ1A 5L8JB 4J8RA 1I8KA 1E4XH 3RUGB 1LEGB 4MXWL 3GO1L 2FWOB 2Y5TA 3GSOA 3WN5A 3TNNB 5EC2B 32C2B 3QXTA 5JZ7D 5DHVB 2IAND 4HJJH 5C0CB 4GRMA 5JMOC 1NQBA 2A0LD 5I8CA 1A3LL 4UUJB 2BNQD 3LPGA 2EICA 3MROB 4XAKE 5IW1B 3SO3C 4KAQH 2VIRB 4NGHL 1LDPL 5F7WC 5I1KH 1U8OA 3RHWK 2IQAB 1D9KB 5BOZG 4YJZL 4XPBL 1XF2A 1U92A 2G75A 2AGJL 1YEDB 4H25A 3EJYC 4LSVH 2MTPA 1TJIH 2VYRE 5I73B 5BV7B 3BJLA 4S1QH 1YC8A 3MBXL 1P5UA 1HHHA 4ZO9A 2D7TL 1QG3A 4E41E 5AUMB 2G5BA 3MJ6A 2NCMA 1PEZA 1T1WB 5HPMA 1Y6MR 2MKLC 1BVLA 4Y4FC 4NN5C 3IYLW 3U0WH 1T80A 3ECBA 3P4OB 5GRWA 5J9PB 3MJ9L 1FIEA 3DECA 5E6IC 1ND0A 1JBJA 1HOCB 1N4XL 3FCTB 3VG0L 5ITFA 2W0PA 3W5MA 3PHOB 1LD9B 3VGGA 5ALCH 3P9WB 1AGCA 1HE7A 4Y89A 5I1AA 3JWOC 5E2UL 3MQIA 5HHMD 3QRFM 2APTA 3QFJA 3CVHH 2VN4A 5EOCH 43CAB 3QJHA 4LSPL 4G5ZH 2EYRB 5E00A 2IWGA 4JQIH 4Y19A 4RZCB 1CXEA 4QWWC 4JO1L 3P0VH 4WV1B 3EYQD 2E7HA 1QR1B 1CFTB 4N5UA 5ABDE 3ZE2E 1CGWA 3TZVB 1DZBA 4K71B 4YHZL 1IBGL 5C0IB 3ULUF 1F13A 4LEXL 1T5XB 4Z78A 1ORQB 3MA7A 2HFFB 4KDTA 3EUUA 4RAVB 5ISZA 1F3DH 3RU8L 4OD1L 4JFFA 1U8PB 4TULH 3BUYB 3VFWB 1NMBL 2J8UB 1CE1L 5K9OA 4HKBB 1JZ7A 2SEBA 3LKQA 1DBBL 1L7TH 4M9PA 1UWEH 1DVFB 4PRNA 2D0FA 3OAUH 5F3BA 2C3XA 2HFGL 2P4AB 3VFPB 5TQ2H 5F9WB 4EN3B 1AO7D 4M6AA 3RVWC 3BZFB 1LNUA 2AV7A 1UM4L 2R1XA 4B50A 3RBSA 1NGPL 2E27L 2AQ3A 4G8FB 1UJ3C 4FQXD 4J3TA 2A9NH 5INCB 2OP4L 1TCMA 5JDJA 4ZXBA 1A14L 1CFNB 4KY1L 1MI5D 1MUJB 4O02H 2PN5A 4LPUA 5J13B 5JUEH 4U6YA 1BBJA 3W5NA 1FG2A 4HF5L 4OQTH 3UJJL 3O2WL 5EOQH 4XHQA 3C87A 3PDOA 3F12B 5C09B 2UZYB 2PYEE 3ARSA 2R56H 2HA1A 3QO0A 1KIPA 4WTXA 1YEGL 5BMFH 4ZTOH 2VSCA 3BT2L 1XCTA 5DJDB 1EHAA 3MOAL 1JVKA 1PSKH 4OZIE 4P46B 3KPSD 4BZ2L 1MJUL 3B2VL 4OD3H 1SEQL 1C08B 2BSSB 1MIEL 2JTDA 5FEBA 3LQMA 3WKML 1NDGB 1G6RH 4X6DF 5DI8A 5KVEH 1T04B 4WUUA 2FNBA 3OKLA 3D3VD 3F7QA 3C5SA 3QWRA 2ESVE 3WO3B 2YPKA 2XACC 2X89D 2A6JB 5IEKB 1MWAA 3CAFA 2EDBA 2CUMA 2YEZA 2NTFB 3BYTA 1TVBB 4LQ1A 5EU6D 1OAKH 2IANE 1OP9A 3HUJA 4I5BA 2BNQE 2PYFB 5LGKA 1YPZA 3HCVB 4WNQB 2YS4A 1YJDH 2PW2A 3QFDA 3U1SH 2FJFA 1OT2A 4U1IA 4ODBD 2BNUA 4KJYB 4BKLA 1QRKA 4KAQL 4OCMC 2MSPA 1OTSC 5I1KL 3ILPA 4CMHB 2MQ3A 2DM2A 2W0FA 3RKDC 3GSWA 4YHLH 5AYUL 1R3KA 3BSZH 4XVJL 1RIVH 4LSVL 5K9OB 3FMGH 3MCKB 3H9SB 5FDWA 4OZGE 1TJIL 1J7VR 4S1QL 4KDWA 1A47A 1FL6B 1S7TB 3NACH 3UTSE 2YSSA 4G6AD 5ESQA 3C8KA 1U2CA 1P7QB 3V6ZB 1GCFA 3BP6A 4AM0B 4FZ8H 5A16A 1KN2H 3GB7B 5DGRA 2B1HL 4PTUA 3T09A 1INQA 4OCRH 2AXHA 2PO6A 3FQWB 3WD5L 3QIBA 5BJTB 3DTXA 2EZ0D 5DJZA 4ZOBA 5HHME 4ZFOA 3VWJD 4P9HC 5ALCL 4UQ3A 1C16A 3ARGC 4PJBE 4OZHA 4TVPD 4I4WA 2JB6B 5C0RL 5EOCL 3EYOA 3FQNA 3JUYA 1NC2B 4FTVB 1DTUA 2BMKA 3DMMC 3P0VL 5J3HC 3ZYJA 4P2QA 4ODSH 4NN7C 3X12B 1WAAE 3CK0H 3QWOA 4Z7UF 4PJIB 4S1SH 3HMXA 2Z31A 1S9WB 4JZJB 1A1MB 5T3ZD 2CIIA 4WHTB 3KLHC 3O2DH 4ZDHA 3V95A 1HSBB 2RCSH 3O45B 1KSRA 3SGEH 3Q0HA 4JJ5B 3TC9A 4PTTA 1A8JH 4AH2A 1CXKA 1L7TL 3LQZA 3IXAA 2R0ZL 2XZAL 4PB0H 1AO7E 1CF8H 5JIKA 1UWEL 2IF7A 3QCUH 3OR7B 1NANH 3OAUL 3MGTA 5TQ2L 3MX0A 2KH2B 3O8XD 3UTTD 4KK9C 2CSPA 5DVOA 1KIRA 4BA8A 5J6GB 1MI5E 2MQCA 1IGJB 2DWEA 3GHBL 4GJTB 2A9NL 4PJ8A 3H9ZA 1QLFB 5IIEB 5JHDD 4K3EH 5ESAB 3SE3A 2G2RB 5JORB 4O02L 4YFLI 5L0QB 3QCVH 2ED7A 1A7RH 5D7IB 1KPUB 5FYJU 2YC1A 1HH6B 4MNQE 3ULVD 4HS3B 4MXVE 5CJ5A 2M8XA 2R56L 1IM9B 3FJTA 3Q1SH 2GCYB 5BMFL 4ZTOL 4N90E 3LB6D 1HKLH 3KPSE 4PJDB 1A5FH 2EDFA 3O41B 2BVQB 1EH9A 4GW4B 2FEDC 5KTEH 2OMNA 1OAYL 2P42B 1H15B 3D3VE 5F97E 1A9EA 1G6RL 4FQLH 4ZUWA 3T65A 5KVEL 3T08A 1T0NB 2PW1B 3CXDH 4FFZH 5DQJB 2Y7QA 3LOWA 5HI4D 2VDQH 5C08E 3KYNA 3HC0B 5EU6E 1U0QA 1J0JA 1AXSA 3ROOA 2VAJA 2N7BA 1Q94B 3I02B 5F1SA 3L6FA 2VR9A 4LNRA 2Q7YB 4HIJB 3RWCB 2PCPB 3R0NA 3K80A 1N6VA 2VSDA 1YY8B 3FB6B 4FG6D 2RFXB 1RUQL 4R96B 5DXWA 4DVBB 2MPAH 2DBJA 1I1YB 2OI9B 3G08B 3P4MA 1YJDL 1R24A 3OKDB 4NNXB 2C1PB 5DMJB 2V9RA 1W72A 3VD3A 4YPJA 4APQC 3ULUH 3SGEI 2NXZD 2H3NB 3MC0A 4G6FB 1ZTXL 3UTPE 1NGYA 4YHLL 3PWUA 4D8PA 2UWEA 3THMH 4X7TB 1RIVL 5C0BA 1NANI 2ENYA 3FMGL 4NO0B 4WIQA 4NHCH 1XIWC 4V1DA 3HLAA 3DO7B 4QHNA 3PP3H 3GJEB 3NACL 3STLA 1GZQA 1MHHA 1HIMH 4WU5A 4P99A 4P48A 4PV9B 2VKWA 2FLBT 2XG4A 2A9ML 2IALA 2F19H 3VW3H 4FZ8L 4TSAH 1KN2L 1YYML 1OAZL 1CICD 1PAMA 4PJAF 4OZFG 4OCRL 5I1LB 4JG1H 4QYOB 4R97C 5DWUL 4WO4D 3L7EB 1D3CA 1ONQB 4RIRB 4JDZA 2AABH 3L3IB 3FB5A 3BP4A 5M94B 4NRXB 4ELME 3BZDA 5EN2A 4HMDA 5ICZB 1MREH 1WQVT 3I84A 2R4RH 1KXVC 1CWVA 4R0LB 3RY6A 1FL3B 3CSYB 2DYPA 3LEVH 2NW2B 1M7IA 4PRPA 1E28B 1J0HA 3CK0L 4WI4A 5T3ZE 4RFEA 3D6GA 4S1SL 3RVVD 4PGDA 4JY5H 1VADB 3GSUA 4ZODA 2WNGA 1K4CB 2DLFH 4O4YH 3T8XA 3O2DL 4P5MA 1UXSA 3IF1B 1D6EA 3MZGB 4NUGH 1WCBB 3OKMB 4YDVA 2EXWC 3FN0H 3RZCD 1EJOH 3WSQL 5I9QC 1FLTX 2X4UB 2Q8BH 1I1AD 4PB0L 4XCFL 5DSCB 3PGFH 4WUKH 3UTTE 5T5NG 5DFWH 3U7YH 5CD3B 4F9LC 5ANME 3GIVB 1M6OA 2VC2L 4QKXB 3MRBB 3UPCA 5KN5B 3IDIB 4YXKH 4MNHA 3HG1E 1NAKL 3P2TA 1PZ5B 3IJHB 5DJXB 1VGKB 2EIZB 1IEBB 3MLZH 4MJID 1EEYA 4K3EL 4KK8D 1NLDL 5TE4H 4M7KH 3QSKB 4D0BB 3MJ7B 4MDIA 3ULVE 2EE2A 2C3VB 2I26N 2GK0A 3C9NB 1A7RL 3QPQC 5LAXB 3OHXB 3VXPB 4QOKA 1CXLA 4ODTH 1PD6A 1A3RH 1XGQB 4EQ3A 1FPTL 1V7NH 1IGIH 4RGMC 1WFNA 4X6FB 1P4IH 3D87B 2W91A 5KTEL 1CXFA 4Q9CA 2R9HD 4PRAB 2X1PA 2LE9A 3TJHD 4FQLL 1S7SA 4FFZL 3CXDL 4HIXH 2AV1B 1QP1A 5BW7C 4XI5D 2VDQL 3ZHKA 4YBQD 2O5ZL 3IU3B 2X5PA 7FABH 4Y16B 4XP5H 3RIFF 4HIIB 1RK0A 1CGVA 2I9LA 3K4DA 4ZTPH 3G5YB 4JO2H 1KJ2L 2ZSVB 5IROA 3G9AB 2MPAL 2VQTA 3NIFE 4GAGL 5HYFA 2X44D 1RUMH 1BVZA 3A0OA 3ZE2F 4NC1C 3NCMA 5D5ME 4JFPA 3QIUA 3IDYC 3ULUL 4HUXB 2GI7A 2NX5A 3ARDC 1PG7X 4OCYH 5F9DC 2DKSA 3C5ZB 4CN6A 4JFXB 3SKMB 1G9MC 5BQ7B 5C8JB 2EIDA 2GTWA 4JFEB 3WKNA 4EI5B 3EBAA 1GVIA 5HGHA 4I0PB 2Y07H 5KAQF 5MP6H 4U2ZA 2EE9A 2DQIH 1I7UB 2FIKA 3BVNA 3QUZD 3UMTA 1OAQH 1F90L 2XT1B 3VW3L 5DYOB 2Q76A 4P4RA 1CLOL 3QH3A 5KSAD 3KPQB 4F15C 5I1JH 5BS0D 4HUVA 4PRIE 4XX1G 3BH8B 1UADC 5C3TA 2MHAB 4N5ED 5HYJD 3I3EA 3QDGA 4Q0XH 2AABL 3QUXB 5DJ8A 2F5BH 1IKNC 3EHBC 3QA3B 4K7FA 3GSQA 1YMHB 4JFDB 4WWKA 1XGUA 4RDQF 3DX6B 1RJLA 4R4FH 5D2LA 4PS4L 4BQ8A 4XCYA 1PQZA 4GW5A 1MREL 3ARZA 4IRJD 1Z6JT 3DUSA 5FGSA 4HULB 3MRCA 5IWLA 3MJ8B 1RZ8B 3VFSA 5HJ3B 1DBJL 4HLZG 4WHCA 3LEVL 1DUZB 4WEBH 5FGRA 3NCEB 3HR5B 4OZIF 3ESUF 1D9KC 1ZT1A 1EO7A 5I1EL 4ZO7A 2DLFL 3L95B 1T22B 4GKOA 4ETQA 1I4FB 5IGXH 1G6RB 4NUGL 5I73C 3BISA 5BV7C 2L4OA 4YHNA 5KOVC 3I6GB 2W60B 3FN0L 1EJOL 5DMKA 4J3WA 3LMJH 4PJEB 1HKFA 3A6BH 3EZ8A 3ARBA 2FX8H 3U7YL 3X17A 3PWLA 1REIA 4U7SA 4R3SA 4AZ8A 5HGDB 4YXKL 5E8PB 4KKNA 3V7AE 4JJHA 4CW1A 4U0RC 4GG6E 4NQSA 1U6AH 3C8DA 3ZDYE 1RZJH 1LMKA 4U3CA 3S88H 3R0MA 3MLZL 4ELKB 4OZ4A 4LRIC 5TE4L 4M7KL 4NNYB 1B4JL 1M71A 1N2RB 3F7YB 2HWZL 1S7RA 3MFFA 1NC4A 1IGYA 4JE4B 1RJYA 3QQ3B 4LCCB 5IESL 1OW0C 1I7ZA 4TNWF 2JKXA 1T1ZB 2CMRH 1JWMB 4S2SB 1RQ5A 1RURL 2IPTH 5A2LH 3VWKD 3MO1B 3JXAA 1E6JH 2HT4C 3HE6B 4WV1C 4X9GA 4OZGF 1ZS8B 1W0WB 3MV8D 1A3RL 4UT9L 1V7NL 1IGIL 4MQSB 1YN7A 2YZ1A 5ECJE 2VZ1A 4CL7A 3VDCA 4KJWD 3REVB 4WEUD 4R7NA 5E1HB 4BSWA 1LWRA 1WJ3A 3ZKNC 1QSED 3WIIH 2E9BA 2GJZA 3D85D 2ADGB 4H26A 1A6ZB 4MQ7B 4Y5YB 3RPIA 4YGVA 3UBXI 3V6FA 4HIXL 1MVUB 3BW9A 4EQ2A 5DD1H 3GRWA 1LP9E 1Q9WA 2YD4A 1ADQH 4HGWA 5HGAA 2BP3A 3SCMB 2LQRA 5F9WC 4EN3C 4XP5L 4FQCL 3PJSA 5J1AA 4YBHA 3BHBA 1B88A 4YBLC 5IKCA 2UUDH 2DN7A 3L3OB 2F54B 2XKUA 4JO2L 1LILA 1RK1A 2ZKHL 4WI7A 4X7FC 1GGCH 4RA3A 3ZTJG 4YX2L 4P59L 1WAAF 2NXYD 1K8IA 4PRHD 2CK0L 3Q48A 3DBXB 4OCYL 3SDAB 4NO5B 2WQRA 3GMNA 1S5IL 5T1DL 2BFVH 5KVFH 3CX5K 1VACB 1OCWH 4ZUTA 4YDLB 3UTQA 3OG4B 4KI5D 4OUOA 2EKSB 5E2TL 2ZCHH 3ZDZE 1KIUA 5IVZB 5HHVL 2Y07L 1H3WM 5D7LB 5SV4A 5DEGB 4P46C 5ID0A 4EUPA 5A43C 4FZEL 1S7QB 2EIBA 1RHHA 4XH2A 5BS0E 1OAQL 5E5UB 5TQ0L 4QLRA 4O2EB 2NR6D 4NT6B 3L7FB 4IIQB 4XP9H 1LEIB 1DEEA 4ONGH 5C0JA 2VQ1A 3QEQA 4NBZB 4PJ9D 4HBCL 1YYLH 3IDNA 1ZA6A 3QJFA 1S9YB 1JNLH 2ZNXA 3BZ4B 4NHUB 4Q0XL 1VFUA 3IGAB 3CD4A 4MHHI 2X9YA 5D2NE 4EDXB 2X40A 1L0XA 1U3HB 3GFUA 4R4FL 4G8EB 3QUMH 1BZ9A 3DIFA 1KXQE 4R90H 4MXVF 2R29L 2W65A 4XPFH 3MRRB 12E8H 3SGKA 3MNWA 1F3JA 2FH8A 3AMKA 1MSPA 4HV8B 3HHRB 5IB3A 1WGOA 1HH9B 5GGVH 4WEBL 3VFNB 4JM2A 3FFDA 4HXAL 1OARH 5FO8A 2N1KA 3T3ME 5JW4Q 1T2JA 3GJFH 1JWUB 4N1CA 5K9QG 1EX0A 2DF3A 5B38G 2ZCLH 1P5VA 5CINH 1F6FB 2LV4A 4YR6A 1HILB 4L3ED 4Y8DC 2B20A 2R0WH 3LMJL 1R6VA 3BI9X 1F3DJ 3L3HB 4HS6A 3DGCR 2A6IA 3A6BL 5E24E 5CWSA 2VLKD 3BEVB 2H1PH 2R2EA 3HB3C 1U6AL 3S96B 1KJ2B 1RZJL 3MOBH 3LEXA 2R2CA 1CFBA 3S88L 3DSNA 3Q6FA 3GSNH 1CFQA 5CP7A 5C6TL 1N0XH 1ZWIB 2C7UB 5D6CB 1H5BA 3IETB 1FVEB 1KLUB 1QRNB 3S35L 2V2TB 1WTLA 5DRXB 4N0RA 1KTDA 4DEPB 2CMRL 4MSWA 3OBAA 2IPTL 3JTSA 4ZFGH 4AY0A 2DJUA 4HIEA 1R5IB 4NP4L 1E6JL 1I7TB 1DLHA 2X4QA 2J8OA 3FOMA 3OB0H 5TFSH 1TJHL 3RUGA 1LEGA 4KUZL 2FWOA 5CMAB 1IL1A 3TNNA 5CZVH 5EC2A 32C2A 1N26A 4N9OB 1QSEE 3VGBA 4LLDB 3FFCA 3M1BB 5C0CA 3O4LD 2VXQL 3T1WA 4LFHG 2XZCH 4GFTB 5I76B 3V6OC 4JB9H 5IW1A 2VIRA 3FRPA 4E0RB 5E1AB 3TPUB 2IQAA 4QRSB 1FSKB 4XWGH 1D9KA 1FO0H 5DD1L 1JHLH 4PY8I 1ADQL 1U36A 1YEDA 4O51B 1XAUA 4PJXE 2HVJB 3DXAA 4U1LB 5FCUH 3GMRB 3N1FC 3W0WE 4ELMF 4WU7B 2YN5A 4BUGA 2XXMB 1A6UH 1FNGB 1AQKH 5C2UB 4PRHE 2BCKB 2XFXB 5D9SB 2YUVA 1T1WA 3JWDH 3HC3L 2EH8H 3CLEL 2VLLB 3HNSH 4XMLL 3TP4A 4ZNCD 2MNUA 3P4OA 4WFHD 5J9PA 2JIXD 3RVUC 1HOCA 3FCTA 4F37K 1GOGA 4G7YH 3BUTA 2BFVL 3AM8A 5JQ6L 3BZEB 3PHOA 1LD9A 1XH3B 2DWDB 2LU4A 2AXJA 2DI9A 2HLAB 1OCWL 1MNUH 2X1WL 1EAJA 1JTOA 3AROA 4Y1AB 43CAA 4LLQB 4KMQA 3PP4H 4GBXC 3B8SA 4XPTL 3BRDA 1DE4A 1QR1A 1CFTA 4Y4HD 1YDPA 3TZVA 2F58L 5DD5H 5C0IA 3V4UL 3VXRD 2PR4H 4XP9L 2Y72A 1ORQA 3WDHA 2HFFA 4ONGL 3IS1X 4RAVA 2IEPA 5GZOC 4AENB 1YYLL 1KB9K 4AIOA 4OCSH 4GRLC 2OBGA 3CZFA 1U8PA 4H88H 4RFOL 1DQDL 1G1YA 3VFWA 2J8UA 4HWZB 2DBLH 3ULVF 5FM8A 4HKBA 3QRGH 2ADFH 4WI8A 4R90L 1DVFA 3VFPA 4XPFL 5D7JD 12E8L 4EN3A 3BZFA 3RAJH 2KUTA 1TZHB 2P48B 1CDGA 4M1DH 4U1GB 3C6SB 3GSRB 2R4SH 1GRWA 5EC1A 4UINH 3T0EC 1CFNA 4PP2A 1MLBB 4L3EE 1MUJA 2NY3B 3TA3A 5J6HB 1NEZB 4OLWH 3L5JA 1HCFX 1I3VA 4K8RD 2VLKE 5C09A 4E42B 3T4AB 5EBMB 1W0VB 5F6IB 3QIWD 2APXA 3GMLB 5F1NA 2EYTA 4XNMA 4MD4B 5DJDA 3I2CH 1BZ7B 1T0MB 1YMMD 4M43H 4N0UA 2V9QA 4KZEH 2NZ9C 1CZ8H 5E2WL 2IPKA 5F9AC 2BSSA 4NNPH 3GSNL 3S37H 1CG9B 5D5MF 1NDGA 3HI6H 2WSKA 1N0XL 2XKNB 4XP6L 3X3GH 1T04A 4Z7UB 5I1GH 3VXSB 1CDHA 1H3GA 5L8KB 1T83A 2ZUVA 5IHUH 2XG5A 4OCWL 3WFEL 1DBKH 4ZFGL 2A6JA 1F2QA 2YRLA 5IEKA 2XWJB 2YPLE 5SWSD 5FFLA 5TFSL 1DUYB 2NTFA 1TVBA 4P23D 3O4LE 2ICES 2WZPD 4FRWA 1Z3GL 2NY5H 3QYCA 1FAKT 2PYFA 4P2OD 4JVUA 2HMID 4NKDB 4W6YB 3TN0B 4O2FB 3RQ3A 2XZCL 3DVFA 4OGAC 4NN6C 4JB9L 2IQ9H 4KJYA 4LRNL 3WXWH 4I8DA 3P77B 2ARJB 4FQJH 3T0AA 1FO0L 3IDXH 1JHLL 9CGTA 5ADOH 4X80L 4WW1B 4KKBC 2NMSA 4NQED 4LPTA 5L9DH 1S3KH 4A6YH 3TO4C 3G5VA 3UBXB 5FCUL 1KJMB 2UUDK 1FL6A 1S7TA 4GMTH 5CIPB 5F6HI 5IBUB 1P7QA 1CR9H 3KPMB 3VFVB 4FN0A 2J88L 2VZVA 1P9MC 3G6DH 3VGFA 4WFHE 4AM0A 2AK1H 3DUUB 5IVXE 3JWDL 2EH8L 3GB7A 2WUCL 3HNSL 5FKAA 3S34H 4Z8FH 2NY2D 3FQWA 4ERSL 5FUOH 5BJTA 3O0RL 5SWZE 1N59B 1PX4A 5EIIB 2B2XL 4G7YL 1EGJA 3JV0A 2VE6A 3GGWB 3VXMD 2NY1B 1ERNA 1MNUL 5F3HB 3GI8H 2AJSL 3QI9D 2YN3A 5DLMH 5DC9B 3REWB 2JB6A 1A6TA 2Y36H 3L3KA 3G6AB 3H9YA 3PP4L 5J12B 3O3UN 4FTVA 4DWHA 3VXRE 2F8VA 5KG9B 3CX5J 3IAPA 1OQOA 3OGOE 3V0AC 5DD5L 1I9JL 4PUBL 2GEEA 3ZDYF 2PR4L 5L6YH 1WFTA 4JZJA 2EYSB 2JCCA 4WHTA 1DQMH 4OCSL 4NKIL 1BD2D 1HSBA 4Y16C 3O45A 4TTDC 3N1MC 4JJ5A 2GQHA 2OL3H 2DBLL 4GKSB 3QRGL 2ADFL 1T7XA 3KJ4B 1YNTB 3OR7A 3F7VB 4U6TA 1QQDB 3D39B 3TFKC 2VDLL 2E7LC 2YUWA 3RAJL 3ILQC 4F8QA 1EFXD 4Y5VC 3KYKL 5J6GA 5HVHC 1IGJA 1ZT4B 1FZJB 1ZHBB 3TT1H 5IIEA 2R4SL 1QLFA 3C5ZC 1U8HA 4QCIB 5ESAA 3OX8B 2G2RA 4UINL 1UH4A 2H9GA 3NCYS 4YHYB 3EZJB 4NZRH 5E7BA 3MBED 3L1OH 2I9TB 4FNLH 4EI5C 4LCIH 3TWCL 4MLIA 4M7LH 2BSTB 3B43A 1URLA 1WWCA 3I6LD 1MCIA 2DL2A 5D7IA 4KRPC 4MB3A 2QSVA 1KPUA 4H1LH 1HH6A 1LP9F 2ZWLT 3HMWH 4QTHB 2GT9B 1G7PB 4HS3A 2HJFB 1QKZH 1T7YA 1YMME 2QQQA 1IM9A 2XN9D 2GCYA 3PWVA 4MWFB 4XWOC 4DKFH 4RMRA 3SY0B 3M8OL 4QRRD 2BVQA 3U82B 4GW4A 2HFEB 1XF4A 4KZEL 1J9CT 1H15A 2D9QB 1CZ8L 3QUKB 4DOHE 4MX7B 2VDKH 1UFUA 3S37L 3ULSB 2ZUXA 1NMCB 4FQ2H 3KHOA 4WJ5B 3X3GL 1VFBB 1A02N 1XGRB 5I1GL 3MJ9A 2PW1A 4N68A 4BELD 3GBNL 3VFOA 4E5XB 5DQJA 1AH1A 3RNKB 5SWSE 1LK3H 1X5YA 1I9EA 3HC0A 4IRZH 5D1QB 3QEHB 1QACA 4TTGA 2W9DH 1KLFA 1Q94A 3I02A 3PNWB 2Q7YA 1AHWB 3FQUB 3ZDZF 1S9KC 3RWCA 4AQOA 3BQUA 3HS0B 4HWUA 3DGGB 4JPWH 3FB6A 2PUQT 4R96A 5TE7L 4DVBA 1ZVHA 1I1YA 2D03L 2NY0D 2Y23A 4LGRB 5GJSH 4KROC 1CGUA 2EO9A 3OKDA 3U83A 4NNXA 1IC7L 1QLEH 1UCTA 2C1PA 3O3EB 5BVPH 3BO8B 4JEGB 1HXMB 1NFKA 4FQJL 4LVNC 4OBSA 4NQEE 3IDXL 4HWBL 4X7TA 5I8EB 3PWPD 3MJGX 3HRZB 1F8TH 5FYKL 1QO3B 1S3KL 3MLSH 1VCAA 4A6YL 3ULVH 3DO7A 3GJEA 2X1XR 5LQBH 4OAWB 1CR9L 1YJDC 4PV9A 2R39A 4RX4A 3G6DL 2AK1L 4ZAKB 5GS0L 4OQ1A 5HGBB 5EUOE 3S34L 1P4BH 5I8OH 5I1LA 2L7UA 4E41B 5FUOL 2VXSH 3SDYH 3VXME 3T3MF 3DV6A 3GJFB 3KXFD 3L7EA 2V5SA 1N0LA 5GS3A 4RIRA 3WEXB 4M1GH 5GZNC 2NW3A 3LDBB 3L3IA 5DLML 3TLRA 4NRXA 2AJXL 3KJ6H 2Y36L 5I1CH 5CAYB 1J88A 2CXKA 1G7HB 4R0LA 3VXOB 2QADD 1LE5A 2NW2A 4X9BA 3E2HB 1NLBH 1E28A 4MZ2A 4DZ8A 4Y5YC 2QEJA 1BD2E 1VADA 5L6YL 4NIKB 4D9LL 2E7BA 1CGXA 1DQML 5HHOB 3GSNB 3DROB 3IF1A 3BOVA 4WVRA 3EDDA 4NM8H 1WCBA 3OKMA 1YNLH 4UV7H 1WIOA 2OL3L 2X4UA 1NSNH 2E6JA 5DSCA 1X5LA 3MLRH 2CUIA 2FLRT 5CD3A 1KB9J 3GIVA 1K8DB 3MRBA 4ENEC 3G5XB 3IDIA 4J1UB 4JHWH 3OKOB 5CJ8A 1WV7T 1PZ5A 3CFDB 5GGTA 2PXYB 4IMLA 3MGOB 5CHNB 5C0NC 3IJHA 5DJXA 1YN6B 3TT1L 2EIZA 4Z7VB 3SDAC 1IEBA 2UZIH 3TBSB 4M48H 5AD0B 3LS4L 4JRXE 5DJCB 1PKQE 3I6LE 1ZGLM 3HPLA 4NZRL 1UJTA 3L1OL 4FNLL 5KOMC 4LCIL 2C3VA 5FKPA 3FONB 4M7LL 1DBAH 3C9NA 1P1ZB 1FO0B 2X7LB 1EEUA 3VD9A 1G7MB 4I18C 4OM1H 5IFJB 4Y19D 1F6LL 4S0SD 1X4ZA 2XN9E 5LAXA 5T1KD 3HMWL 3OHXA 4R2GD 3VXPA 4QRRE 1XGQA 4M3JA 3PHSA 5D1XC 3EYSH 3U48A 3RGVC 4X6FA 4XB8A 4XNXH 1MHEB 1UKSA 2DIJA 5HBBA 3H42H 4JFFD 4JO3L 1IAKB 3EO1B 4PRAA 5D93C 3AB0C 2NYYD 4KRLB 4MS8C 5GRUL 1MJ8L 1VKXA 3C5JB 2OX5A 5DUMH 4PJFE 3DVIA 2AV1A 2O26U 4D94A 1LK3L 5D1ZB 5DVMA 3IU3A 4HJ0C 4PJGA 4HFWB 3VE0B 1ITBB 3U30C 1CQYA 1S7VA 2HRPH 3G5YA 5DFVD 4ZXBD 5KSBA 1N6UA 4FXKB 4KFZC 1MIMH 3OAYK 3TPKA 2O61B 4TVSa 2IANB 4HUXA 3PWPE 2DLIA 1KCLA 3R4DA 3ZKMC 4XX1E 1LK2B 4WGWB 3SKMA 2VAAB 1WIPA 4HMEA 4Q7DA 5C8JA 4JFEA 2IBBA 1F58H 1IT9H 3MLSL 3RDTB 4AMKL 4EI5A 4XCNB 3KNBB 4I0PA 1NFDA 1A7NH 1RUPH 2YPVH 3BKCH 4P5TC 1I7UA 4JY4B 4H5SB 4NFBA 2H8PA 1E4WH 5DYOA 4WUUD 4GMSH 1HHIB 3ULUC 3BN9D 3UTSB 3KPQA 2I27N 3QWRD 5I8OL 1EZVY 1UCBH 4YHPB 2VXSL 3EDJA 3BH8A 1T6VN 3FO2B 4IOIB 1Z0MA 3RVXC 2RAMA 3C60C 3QUXA 4M1GL 3QA3A 1YMHA 4JFDA 1OGTB 3DX6A 3MUZ1 1JI2A 3KJ6L 1OM3L 4S1DC 1A1NB 2FZ3A 4LKCB 5E99L 3ES6B 4UQ2B 3OAZH 1JPTH 5AWNH 2ICCA 3MJ8A 5A3ID 3SQBA 1RSFA 1MFAH 7CGTA 3ZHDA 5FGBA 3QEUB 1DUZA 3L3JB 5HI5D 3HAEH 5TDNB 4HG4K 3PL6B 4P49A 3LD8C 3HR5A 5IM7B 1FSKC 3BXNB 1WCQA 2XWTB 2OJZH 4MA7H 4LSSL 3L95A 1T22A 3SBWA 4LARH 4L9LC 3MLWH 5CP3A 1I4FA 4RMUA 4Z0XA 4NM8L 3T2PA 3FRPG 3TYGH 5I6XC 4UV7L 3MV9E 2W60A 1ZLWH 2V17H 3WHXB 2Z8VC 4PJEA 4URTB 3FQXB 1NSNL 5JQHC 2ADJA 3MLRL 1U3ZA 2D31B 4UAOB 5JTWA