2G0KA

Solution structure of neocarzinostatin apo-protein
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
113
structure length
113
Chain Sequence
AAPTATVTPSSGLSDGTVVKVAGAGLQAGTAYDVGQCAWVDTGVLACNPADFSSVTADANGSASTSLTVRRSFEGFLFDGTRWGTVDCTTAACQVGLSDAAGNGPEGVAISFN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Synthetic Ligands for Apo-Neocarzinostatin
pubmed doi rcsb
source organism Streptomyces carzinostaticus
molecule tags Antibiotic
molecule keywords Neocarzinostatin
total genus 12
structure length 113
sequence length 113
ec nomenclature
pdb deposition date 2006-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00960 Neocarzinostat Neocarzinostatin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.230 Mainly Beta Sandwich Immunoglobulin-like Neocarzinostatin-like 2g0kA00
2CBMA 2CBQA 1NCOA 1HZLA 2G0KA 1AKPA 2CBTA 2G0LA 1J5IA 4JW3A 1O5PA 1ACXA 1HZKA 1J5HA 1J48A 1NOAA 2CBOA 2MCMA
chains in the Genus database with same CATH superfamily
3Q2WA 3MN8A 2OMXB 3CFKB 4LSQL 4AC4A 3I6SA 5LGJA 1M6OB 4IKJA 4XNQB 1JL8A 2HH0H 2DQFA 3OWRA 2VE6A 4UV4L 1IGTB 4UZUA 3QHFH 2BNQD 5FWQA 1QHPA 4Q97A 3DLQR 4QHUA 2FHCA 4FYTA 7FABH 2CUMA 3EJYD 5EN2A 4UQ3B 3NH7L 1AACA 2EICA 2VWEE 5I19L 1BQ5A 3GLDA 2AXJA 4YSRA 1WA2X 1RP9A 2X6UA 3WUZA 5JIKA 2G2PA 4MD4A 3HEIB 5AB2A 2HX7A 1DSFL 5KG9B 2YQGA 2MKWA 3OQRA 4NENB 1U95B 1U8NA 1U8HB 4NJAH 4NUMA 4JRXD 4NOFA 4N26A 4E9TA 2ZE0A 3LS5H 4EUPA 2PO6B 3U9PH 4PGCB 5CD5C 3QS3A 3MRGA 3F7LA 2G5UA 1SDYA 5E9DA 1ZMYA 1RERA 4HF5H 4K55A 3ARDB 1BM3H 1FAIH 4YHKH 1O6TA 3U48A 3WEBA 4JM4H 2K3TA 2QJDA 4PW3A 5D4QA 1JHLH 3RZWA 4NQXB 3WKYA 1IT9H 1GGCL 2IBBA 2NR6A 3DWTA 3F7QA 1IO4C 1BBDH 3VW3H 1VEPA 5ALBL 4N8VA 5D7LA 2Q20A 4POUB 2C7FA 2CXKA 3CFEA 5GS2H 3M1OA 4Y1AD 5H94A 3CFDA 2PPCA 2EDLA 4UOZA 1QW9A 4PJDB 3LXBA 4F7PB 4CILA 1NFIB 1YYML 4HZLB 5LGHH 2N1TE 3HJEA 4PRIB 2JB5L 3WO3B 4EO5A 1A3LH 4AGPA 4R3SB 5F2FA 1SUHA 2GVYA 4P3DB 2V6HA 3F5WA 4WF7A 7PCYA 2J5WA 5GZOC 1I7UB 4JS7A 1NCCH 4Y2DA 3GB7A 1NGXB 5KSAB 3W38A 1SOQA 3TBYA 3STLA 1K5NB 2X2YA 3ATAA 3EJSA 3TNNA 4DPCX 5SWZA 3IRPX 1CGVA 4OLYH 4GI9A 3SKJL 5T3XD 3CDYA 4EI6B 2GTZB 3RFZC 3Q2CA 1RIHL 4FG0A 4TVPE 3RKPA 3Q48A 1FE8L 3T0WA 3SD2A 3S2AA 1J10A 1XBDA 3N85L 1X5FA 2IDUA 2R27A 1E43A 3RY5A 1Z0NA 2LW3A 5ABDE 1XH2A 1K72A 2CHZA 4H1LG 2D03H 1KEMH 3IE4A 3MA7B 4G9FA 3PP4L 3SDAD 4KUZH 4KVNH 4RGMC 1TXKA 4U1SA 2Q7YA 1TTAA 2MQ3A 2ZWYA 1JWMA 1BD2D 1SDAB 4BH7A 3FAXA 5I1JL 1W8OA 2QADB 3EDEA 1S3RA 2FSEA 1B88A 1F4HA 5DJCB 3KNBB 4N1CA 4DVBB 3QYMA 1U3JA 4S10A 1VKXB 3PL6C 1KC5H 4JFQA 4JM2B 2ZYRA 3X1GA 4HSAC 1IGML 3MRPA 4GLRH 1WA0X 1IJNA 3I9AA 5TDPB 1NKRA 3BPLC 5B3NA 4LLMB 1FL6A 5EU5A 4OD1L 4DEUA 2Q10A 2CBTA 4WW2C 3HLKA 1H8OA 3KHOA 4U2ZA 5CS7A 4PD4J 2WZ0A 4YX2H 4M9OA 2YPLE 4GT0A 5E8OA 1N8OE 2WYZA 5DQJB 4F33B 4XVSH 5AVZB 1JP5A 1WZ1L 1F56A 2VISA 3CZGA 1K4DA 2AJZA 4Y2OA 5I5JA 4PJFB 5TFSL 1A6AB 1RZJL 2Q8BL 2F5AH 2BC4A 4DK5A 1FRGH 1LEKB 2HVBA 2PO6C 3PXJA 1X44A 3JTTB 1VZIA 3VE0B 4FQIH 4PPTA 4ZFFA 5CO1A 3JUYA 5EBLB 2VZ1A 4H1LA 3ARDC 1XGPB 2FT8A 4MRBA 3D48R 4W9ZA 2X4PA 1OP3K 1JRHL 3DHPA 1ID2A 2EC9T 1OB1B 5F3HB 3TIDB 4XN2A 1E4WL 4MB1A 3BRGC 3CIAA 4P9HL 3TNNB 3GHBH 4KKRA 4RFOL 3L17A 3MXWL 4Z7QB 1E3XA 1N3NA 1Z5LA 3HG3A 4PP2A 4X9GA 4KQ3L 1FO0A 3DX2A 2GTZA 5GGQL 5I0WA 4X6BA 2JCCE 4UQDA 1MAMH 1BXVA 2P5EB 1AZRA 4QRSB 3OKOA 1E5UI 3U9UB 1VHPA 3S5LA 4YNYA 3SD5A 3QQDA 3Q9PA 4M5YL 4QRQA 3VXQA 2WO2B 5F88A 3FU3A 3MZGB 4WV1C 2PNDA 4DVRH 1CC3A 1LO4L 3J27A 3VNYA 4EDXA 4KROD 3GEWB 4DO6A 3AREC 5HHVH 1EHNA 3KS0H 2AJUL 2BY2A 1KG0A 1NUGA 4BH7B 1E40A 1KCVH 4UM9D 4YLCA 1RUAL 3ARUA 5DYOB 2JI1A 1Q38A 3NAAL 2HRPL 1B90A 4NRXA 1SVCP 1YDPB 4G6AC 2O5YL 4G8GE 4B9PA 1S9WB 3HRPA 2CUIA 5JTWA 3FSWA 3TA3C 2GIXA 1F3JB 1MFCL 1FFRA 4J28A 1ODUA 1HCVA 1MXGA 4FP8L 3P1VA 3WIHL 1OAXH 2VRQA 1OE1A 1R24A 2OMYB 2B1OA 4ZS6D 4BFKA 4KY1H 2C3HA 5E9AA 5C0DA 4WZ9A 3TIEA 3UIZA 3QDHA 4LL4A 1MHCB 3CHRA 1DBKL 1ZLSL 3HS8A 2OKMA 4P46A 1PZ5A 3B7YA 3WNOA 3BVWA 2EIZB 4FQXA 3FZUC 5FYKH 1OCOB 2Q0ZX 4PJFA 1KCUL 2PUQT 4C4UA 1MCDA 5DD1L 2F53E 5EIIA 3CDGA 4NFDA 4MAYD 4LIQE 2EDWA 5GRWA 3A4FA 3VFVB 1GZHA 3DMMA 4WHDA 5D1QE 4YS4A 3PNWB 4PG9A 2KC0A 3SOTA 3FB8A 4HAGA 1G87A 4R97C 2WGNB 1QFWI 3PWVB 4G5AA 1JAEA 4D0DA 2AXGA 2W9DH 4IBYA 3WHXB 2BIQA 4PWGA 1RMFL 1FLRL 4MX7A 1UD6A 5CZKA 1MQKH 4I89A 4ODWB 1XGQA 4TQEH 3ECBA 4AM0Q 1UB5A 4OFQA 3CSBA 3ULVL 4TVPH 1ODAA 3CFCL 1KJ3H 4BFIB 4DFHA 3HAEG 1HL4A 2VDPL 4BUHA 3GBMH 3EH5B 3IPEA 4K5PA 2R8SL 1P1VA 5KVFL 4YHIB 3G9AB 3RJDA 5CU9A 3IWUA 4K3EH 3RPIB 3GBNL 1OTUC 3S5LB 2WQ8A 5ILTL 4U3HA 1PCSA 3CLFH 4GSXA 1OW0C 1RZQA 5DUPH 2O30A 4X5QA 1NEZB 2BS9A 3VGDA 5KYXB 1EHXA 2VQ1B 2H26A 2Q6WA 9PCYA 4OVUA 9CGTA 4JKKA 5AW1B 2HG5A 2K3HA 4KKCC 4PRAA 5AYUL 2CH8A 3D0LB 3IFLL 5IBLD 5L7XL 2ZWKA 1CD1B 2DH3A 4Y1SA 3F7VA 3OB0H 3HE6B 2AXHA 3BFWA 5GISL 3GGWB 4NJ9H 3BGAA 3BPCA 4L8CB 5EO9B 1R3JA 3GSRA 3UGEA 1AZCA 1ZS8A 1GGBH 1PX3A 3GSQB 1CURA 3X12B 3L1FA 4G70B 4HPYL 5FCUL 4GNKB 3SGEH 3WSQL 4MXVF 4FTVB 1W16A 4EN2A 1PG7H 4OT1L 3GMRA 3BKCL 5E6SB 1RSFA 3CVHL 5AZ2L 5J11C 2J57A 5I6OA 2E7CA 5J4MA 1QA9A 2OMZA 4ANUA 2R0WH 43C9A 4FQ2L 2EEDA 5CD3A 5DZJA 3MA9L 4JFPA 2OI9C 4Z7VF 4U7SA 1KT2B 4TLUA 4LSUH 1JZ6A 2HLAB 2JCWA 4R7NB 3BGFC 5IF0A 5INDB 2EE2A 3HE7B 4KO9A 4LK4A 5HYSB 3AS2A 2GITA 4JZNA 3CFMA 5BRQA 1KTKE 3CQQA 3DK2A 4ONFH 3V7MA 5I1KH 3TTYA 5IGXL 2F7QA 2ZSWA 5EIIB 2EDJA 3N06B 4MAYA 1GKOA 4WWKA 3RVWD 4XBMA 1IJ9A 4U0QB 5T5FL 3W82A 1LO2L 1AXTH 1WCBB 4PBWD 1B4JL 3BAEH 1ZANH 4JKLA 2P48B 3J07A 4UT9H 1IARB 2ENQA 2EDBA 4UANA 2WWNA 3OG4B 1NC4B 5DD0H 2VLRA 4I48B 2CQVA 2H32H 1TZHB 1E8WA 2X70A 1KB3A 3B2DC 1TLMA 3DX9B 4AW4A 4JY5L 3F6JA 3OZKA 4JHUA 4CVWA 2F68X 1GPOL 3S4SB 2FECI 1Z3GL 4X9IA 1D9KA 1A65A 3QJFA 2XTJB 2B1HH 4CVXA 3MBXL 1KYFA 4Z7NF 3N43B 3M8OH 4FABH 5IESL 3GLEA 4IIQC 4JRXA 3TC9A 3HE7D 1GGUA 3L8QA 4LU5L 3NJJA 5G2NA 1BPVA 2HTKD 1PKQE 3B9EA 2ROXA 3HZKA 3CVCA 4MGXA 3MUY1 5IMMA 1JD9A 3EHBC 3O3EA 3MBWB 4ZDHA 3WN6A 4YXHL 1KB5L 1V3LA 4OZ4A 3NP3A 3LNEA 1IGJA 1I3GL 3MJ7A 3VUAA 2C1OA 3BHBB 1FLTX 3RBSA 1K5WA 2VMFA 1HIMH 1D6VL 1DUZB 1SJHB 5TQ2L 2TSBA 3POCA 4FZEH 3TBWB 2CLRB 5BOPA 2ROYA 3DSFH 4FQCH 3LRMA 1H5BA 3AAZA 1F4YH 3U25A 2DQGH 4ZSOA 3T77B 1C1EH 1OF2B 1CFTB 2W65A 4Y2LA 5ISZD 3AY4C 1QVOB 3H7BA 4QRTB 1N5AB 3Q8BA 5T1KB 3TBTA 4AJ0A 4OM0L 4M4RB 4RVBA 1UZ6E 2B9BA 4OZFH 4NO3B 4LSQH 5F89A 1WVZA 2YUXA 3DDFA 1R46A 4HGWB 3N40F 4Q9BA 3CBRA 4O58H 3LKSA 43C9B 4BQ6A 4W6WB 1FF5A 2DMGA 3TA3A 3MOAL 4JFPB 3D4GA 3HG5A 1U8QB 4Y5YA 4YAQA 3T3PE 1PAMA 2IPTH 2XZAH 4NBYB 1K85A 2VQUA 3OL2A 4FJZA 5HGDB 3UAJC 5FYJD 1OW0A 1QUPA 5T1LB 4YHYB 2ZSWB 1DJSA 4OIFA 3TJEH 4PJAE 3MBEC 5DGQA 3NZUA 4MAZA 2LE9A 3NQIA 4RGND 5C92A 3GXIA 3BE1L 1NAML 2WVTA 2BHUA 3EYQD 3FNKA 3ZYIA 4CC0A 2CKBB 2FB4L 5GGTH 4LRIA 4K5OA 1WFIA 1MCRA 1CICC 2IWEA 1MLBA 4GIOA 5LG1A 5KVGH 5HHOE 3ZTCC 2NNFA 4OZGA 4LVNB 3NA4A 4HC1A 4N2BA 1GCYA 1IT9L 1UT1A 4FZ8H 4HS3A 2BP3A 1KIQB 1BLNB 5DJ0A 1U0QA 1EO7A 1QLFA 1Q9LA 1YN6A 2HJLB 2ZKWA 2ISDA 1MRCH 2VKXA 4UTBL 3RL2A 1SM3L 3HS0B 3JZ7A 3PDDA 5FW7A 4RFNB 3BLPX 3QUYB 3FSVA 2PW1B 4QRUB 2JB5H 2VAJA 3QRLA 4DQAA 3P0YH 3RGHA 5FYJE 2CWRA 4UQEA 2FH6A 4MD0B 4DKFH 3U46A 4GKZB 3MJ7B 5DZPA 3HJ0A 5KAQG 2YGOA 3T8MA 5DHMC 1PZDA 3T09A 2VQ4A 4LKXA 5H35B 1QSED 4IIQB 3X11A 2G0KA 1MJ8L 2H9GA 3QIUB 3LN5A 3QI9A 5KYNA 1ORSB 4BV1A 1CT8B 4KTGA 1L7TH 4IYKA 4P5TC 1IMHC 3FO0L 4AVKA 2CUAA 3BXNA 4DP6X 1CFTA 2K6ZA 1WD9A 4HMEA 2HT2D 5B1JA 1UADC 5HHPB 2X40A 1HNGA 4NN7C 4ZW7A 3LCYA 2ZXGA 5AW6B 4J27A 2XXFA 4KI5F 2UZPA 4TRPL 5C6WH 2IDTA 3MV9D 5KSBF 1GGTA 4KROB 1MI5E 5J6HA 1ID5I 2P8MB 3B34A 1WHPA 5I15H 5F96H 3PU7A 1AC6A 4F58L 1N5YH 1MWAA 3MLZH 4NNPH 4PP1D 4L8BA 2NW3B 2XC8A 5HI4C 3N2JA 1EZUA 3BWUF 4PEEA 5DUML 4DKEL 4Z76B 3OWEA 3TFKD 1CD8A 3T2PA 3QAQA 1AYOA 1DVFA 1HHHA 3JVGC 4OSUL 5K9QG 1FG9C 5CBEB 3C8DA 3EUDA 3PGDA 3OXRA 4HXAH 3LQAH 3VX0A 2R1WB 2VOTA 1EQWA 1IGMH 1IB5A 4K3GA 2FQDA 3TZVA 4B41A 1JGLH 1CD9B 3ARBD 2XQ0A 3ZX1A 3BAXA 4XN1A 4AITA 1MRFH 2P1YA 4NBXB 4UQ2A 5D8JH 4RGNC 3W5NA 2YXMA 3RI5K 5HYJD 3EO9H 1QSEE 4YK4B 1TTCA 3VA2C 3AM8A 2J1XA 4J23A 1S7QB 1XGTA 1SFHA 1YZZA 3T6ZA 1TTGA 3SCMA 1WZ1H 1B0RB 1U58A 4LSRL 2GTWA 4XWOC 3A23A 5DEFA 4Z95L 4PRHB 5DJ6B 3KPSE 4WFED 5IM7A 5BQ7B 1P7BA 4CL7A 4WNJA 1MCEA 2QPUA 2VABA 1CLCA 1J8HD 2PTUA 1MNNA 5E23A 3MV8A 4HCRH 3OD3A 3FBKA 2AEPH 5DMKB 4OQTL 1ONQB 3W0WE 2HVKB 1INEL 4P57A 5JIMA 2VSMB 1HL8A 3JWDH 5DJXA 2VC2B 3GSNB 5ICUA 3TBVB 4M7KH 2ZP9A 3UBXA 3WGUB 1B2WH 1KJVA 1FZJA 3P40A 4LESA 2FZ3A 4JFZL 5ADOH 3NEXA 2FHFA 5I1HH 4PJDF 4JUTA 3O9WC 3SSGA 4XNUL 2KZBA 1KY6A 3F84A 4GY4A 1JTOA 2FLMA 4LCYA 4R0LA 4AQ1C 1UZ6F 1IVLA 1H15A 2FO8A 3QJXA 5KUMA 2WBWB 2QADD 5FM5O 2QHLA 5F7NC 3EFOA 4FFYH 1UATA 1J0ZA 1ZDSA 3GWJA 1A64A 2DAVA 4PCSA 2XZCL 5D1XC 1BVLA 4H26A 4UT7L 3HMXL 4HALA 3QISA 1INDL 4JFOB 2AQTA 4Y16D 5JOEA 1ZV2A 1IGTA 2OJEA 2HKHH 1OHZA 1HEJC 2D7PA 3F12B 1BG1A 3V79C 3RA7H 5ACZA 2GSIA 3E2HB 1EHLH 4AEEA 1LILA 3ZQ9A 2BSCA 5DGRA 3GSOB 1ZV5A 2KLTA 1M1XB 4HLZH 2R59A 1NMCC 3DX8B 5J89A 1FVCB 5CWSA 1FL5B 3IMWA 3D69A 2ZCHL 2R1WA 5KS9F 1EVTC 4YSEA 4R6UA 4PRPE 5DC2A 1ZLEA 3NP4A 1M7XA 1L9NA 3IDIB 2PPEA 3KPQA 4JGMA 4JPQA 3KYKH 4KZEL 3FRPG 1F18A 3SE6A 2VJ8A 5JXEA 5D2LE 3REVB 1YNLL 4ZXBC 4ETQB 5BZDA 3SKMA 5JLZA 5L2JB 1XGTB 1BXUA 1P0SE 4LKCA 2XHNA 1OAJA 2OR8A 5DEFB 1ND0B 3FSOA 5GGUA 1BHGA 4M00A 4C58B 4AGMA 3FPXA 3O3BB 3PWLA 4RGNB 4YVNA 2UX7A 1E5AA 4M1CC 5FA4A 5ICXA 2ITDB 1GMIA 4HJTA 2FIKA 4G5ZL 1AKJB 5LCVH 1DQLH 2HVKA 4JPIB 1P5UC 3NSDA 4P57B 1BEXA 4AY0A 3Q05A 2XI9A 4AYBA 3GRWL 1KCSL 1CK0H 1RZKL 2VR5A 1QEWA 3ZMEA 4HOMA 5FO8A 2CLVA 5EBMB 1UZ8A 1I7TA 5DI8B 3MJ9A 2I9TB 1XIWB 2X53A 1C5CH 2ADFH 4JJ5B 2ADYA 4XMVA 3IGKA 2MPAL 5BJTA 3QNXB 3QORD 4N5EC 1T6WA 4CVUA 1L6ZA 5IMOB 3VGEA 4Z7WB 2VL5B 1XZ0A 3Q1SH 1T7ZA 1PPIA 4ZT1A 2OX5B 5EU4A 4WIQA 1GMEA 3L5WB 5JPNB 1LO0H 1NCAH 1ZJAA 1HL9A 1F4AA 2QSCH 1NBCA 3ETTA 3SZ6A 2WLLB 3ZT7A 1G9ML 4QKXB 1SHXA 4PG2C 4JQIL 4Y9EA 1Z66A 1L5GA 1IGIH 1TU2A 5E2WH 4LLWA 2HWZH 4BZ2L 5I1EL 1PAZA 2J25A 3HZVA 2X4UB 2O93L 3BKJH 1SEQL 1TCMA 3ZDYF 4I0PA 4R5TA 4WJKB 5D1ZD 2ZWLT 1MHPL 4LPYA 4JPWH 1JVKA 4TUJB 4K3DL 5HPOA 1UEMA 1O9ZA 2AJVH 1DBBL 5DJ2B 3VFSA 5F7FA 3KPQB 3TS8A 4X6EA 1RK0A 3I6LE 2XY2A 3AU0A 3P3YA 1ROCA 1N0LA 4IRZL 1KBPA 3RLSA 2VL4A 4XXCC 1CXLA 4G7VH 4HKBB 3U2JA 5JLZB 2UY6B 5JW3L 2BCKB 4MNQA 4LSVH 1XXFC 5TDNB 4F33A 2ZUWA 3DUUA 4PJHA 1G7JA 2OI9B 3GXMA 4TOYL 5DQ9A 4FRWA 4PV9A 2MNWA 1CDBA 5F7BA 4HMDA 2JJSA 2DQHL 3JTTA 4U1JB 3KCPB 5GS1B 1JWUA 5D93C 3UP6A 2OMXA 1CDGA 2AJYH 3IFPA 1FCGA 3L4ZA 4RDBA 4H2CA 1B4JH 3VDCA 5T3ZL 3BP7A 3CGTA 1S78D 1WA1X 1IKOP 4WU7B 3MV7D 2QADC 1HHJB 5FYKU 4HGMA 4XBPA 4JPIA 5CZRA 4JPKL 4IBLT 1Z9SA 1UXWA 4J3OG 1A66A 4J3OC 2Y72A 3IJ8A 2DMKA 3RB7A 5LBSH 2VDKB 3T65B 5I16A 2OMTA 2WXFA 1G9NH 4ZPTA 4AYFB 2FJFB 4TNVK 1EO5A 5IOPB 8PAZA 1P4IL 4N2DA 5HDWA 5IFAL 4TULH 4AE1A 2OR9H 1U8NB 4ZUVB 4PJBF 4U1GC 4HUWB 3EBAA 3VXUE 2VXSH 1SEBB 4KFZC 3BZEB 1YQVH 3BZFB 3U4EA 4PGCA 4ZTOH 1FSKB 4Z7WA 3VQ2C 3VFMB 5FW6A 2HKFL 1ECYA 1D5IH 3F7YA 4Q14A 1OAUL 2JI2A 5F88B 1OL0A 2MOVA 5DC0A 3T6VA 3FULA 4GRMB 2NQ3A 1KCLA 3R7QA 3D0AA 4GXVL 4P2OA 4WU5B 1BZDA 1YEGH 1KN2H 2JQAA 3X1BA 2CJ3A 1DVFC 4KNSA 3TXAA 2WLLA 5CUSH 1E4KC 4FFZH 4TXVB 4POZD 4FZEL 1TCRB 4JCMA 5MERB 2QHRH 4GAJH 2A3TA 2ESVD 4PV8B 3V6OC 1BOGA 5IVNA 2UZYB 5LCVA 3RZCA 5GS0H 1AD9B 5I1LB 1P4BL 3RNKA 2YRZA 4EDWH 4DUWA 4TUJA 1JF1A 3H2QA 1QFWM 4PRBA 1ET5A 4HWBL 3ALWA 3WJLA 4DPBX 5A3ID 4HYTB 2DD8H 4GAAA 3FSZA 4HS8L 3EYUL 1WICA 5AVQB 5IK3A 1BMGA 3AQZA 3DBXA 3D4YA 4RNRB 4ZQKB 3WL9B 1H0DB 3ULSA 1ZAGA 2F9BT 1UOLA 1UGKA 4TSCL 3CZNA 5BVPH 1V7MH 4F5CE 4Y5VA 2FBJL 5DQ9B 4OGAD 4XNBA 2BW5A 5IHZA 5DHYA 2BRRL 3DMMB 2NW2A 4Y9BA 1S5HA 5AB1A 1UD5A 3QDMB 4P5TA 5LO7A 5I9QC 3EGDA 1CU4L 1CTOA 5C3IA 1RPKA 2FB4H 2BW4A 4PJIE 1Z0MA 4H20L 4XWGH 1RHHA 1JWMB 5BV7H 4HU2A 4JDTL 1BJ1H 1AE6L 3TA3D 2Y22A 5AW4B 3HIZA 4HD9A 4KK6C 4UWQB 4Z7UE 2XIIA 4HFWA 5T3ZE 4PRHE 2GHZA 5HGHA 2UY7B 3QXTA 3FT4A 4FMFA 1ZS2A 2YKKA 1H6EA 3BRDA 4N90D 3MRLA 5EIVA 4N25A 4OUUB 2GK0A 5TDPA 3BGMA 1UT9A 1G9MC 4KK5C 2OMUA 4P2QA 3TN0A 3UBFA 4OIIL 3FOMA 2W80C 4JZJC 5F0MB 3R8BB 2AC0A 3N3EA 3QG7H 3G04A 4KQ4H 3LEVH 1OQXA 1JVLA 3T08A 4TQHA 3MNDA 4JDVB 1KV7A 4NPYA 3APFA 4QHKI 3P4LA 4JHVA 4Y2OB 5I8KL 2WXQA 4FNPA 1NLDH 1U8KA 2HT3C 3NZHL 4X98A 3RHWK 5ISZE 1QOKA 2A4ZA 2X6MA 4FYSA 3AMLA 3GGWA 3GTNA 1ZA3B 3C87A 2KS0A 4X0NA 5DWUH 3BH8A 4P2RD 1TQCC 3E6FB 1BOGB 5CSZB 5F9OL 5AVUB 4BWWA 4OFKA 5D71H 3L1OL 2PW2B 3IBEA 2ZTBA 2Z1PA 4BFJA 2YD9A 1DN2A 1JI2A 1THAA 2P80D 3GUTA 4HA1A 1X5IA 3U0WH 1XH3B 2DF3A 2R4SH 5AW5B 3T0EA 3RJQB 3OKYA 3C6EA 2YBGA 4U6YA 4U3CA 1BM7A 4PS7A 5KSUB 3DJRA 1OP5H 3MTRA 3ULVE 1IBHA 4KQ0A 1HH6B 4MJIB 2ZXAA 2XWBA 4P9ML 4CBPA 5JW3H 4PP2B 3O6LH 3TEXA 1S5IH 3DBXB 3O45A 1VADB 1TVBA 3ME0B 1H0DA 1GGIL 1ET7A 3GPEA 3DROB 5HYSA 4Z18A 4TUKL 1J0HA 1HC1A 5BRZE 1HQ4A 4Y5VB 1NFDB 2X4NA 3QQDB 1JZ3A 4LF3A 3IDXL 4JN1H 1TJIL 1BM3L 4UTAA 3TVMC 3Q6GL 5JNYB 4H40A 3FUHA 1KYUA 2AQNA 4DEWA 3L48A 3SDXB 4PJEF 5F3FA 3AQDA 3HRZA 4JHAH 4XCFL 1KG0B 2NX5D 3IJSB 4S1SH 3IMSA 2C9VA 3UZEC 3CMGA 2DYRB 4JRYB 2A6JB 1S9WA 2O5NA 4N0CC 1WT5C 1J8RA 1UD4A 4M6AA 4E0RA 2GK0B 2AK4D 3DVGA 2FWOB 4N85A 1JGVH 3CFNA 3VFRB 5JOFB 4O00A 2X1QA 1O5DT 4HC1L 1OAQL 2AEPL 2CA4A 5G4MA 2WXKA 4XB3A 2VN5A 4EMZA 4PH8A 3FO1A 2NQDA 1RIHH 3S37L 1WWCA 1CE1L 5HHOB 4D7BA 2P24A 2RB8A 3E9TA 4YR6B 3T2NL 4X5LA 1KBKA 4M6ML 4YSAA 3DV6B 1NH6A 4MMZC 5EULV 3AAZB 4Z7NB 1EZVY 3FU8A 4KVNL 4KUZL 2SODB 4L3CB 2P8PA 1VEOA 5DVKA 2E56A 2MHAB 3E1ZA 1N5AA 3MOQA 3OXSA 4MX7B 4XMLL 1GC1H 1XH3A 3RKDD 4DPAX 2G5BB 4HGWA 1YMMB 3PRZA 5F7YC 3T6QC 1USQA 1KC5L 3SZKC 4AQ8A 5F0LB 3QDJD 4L4TA 4WCYH 1DLFL 5ES4B 4HHGA 4EIGB 2CO6A 1DQIA 2NNAB 4JFEE 1UVQB 1HQ4B 3HOGA 3QWOB 1NFDA 2ZCHH 4ODVH 4YX2L 4G42A 4IU2A 1UJ3A 3SGJA 4OFYA 4AI7A 3OAZK 1AGBA 1KTLA 4ODHL 5DVOA 5J6SA 5IMKA 2NLJB 5ANMB 1PJ9A 2OL3B 2WN2A 1NL0H 5EU3B 4HETA 3D0LA 2CDFA 3VGAB 1MW2A 4ZFOB 3HAEH 4A7TA 1U41A 5EF0A 1OT4A 3O4LB 4QTHB 2IADB 1DQDL 1NCNA 1F11B 4JRYA 3WFBH 1CI5A 4W81A 1WAAE 3RURA 1A02N 5D1XE 1MI5D 1QLFB 2V5YA 3EJYC 3CH8A 1VFMA 3EYVA 5IJVB 3GQFA 2Y6SD 4O5LL 4ZOAA 1N64L 1A1OA 1I1FA 2YGQA 2ZG1A 3JXAA 4M8RA 4MJ4A 4QRUA 3QBTB 2DICA 4Z3IA 5C86A 2CBQA 4MCNA 2FYVA 3SKOA 5HHME 1TYEB 5I82A 4NQDB 3WMQA 4OLUL 5CU5A 1HQRB 4GAYB 5C9JB 5F6IC 1DBJL 5B38G 3QPQD 4WDIA 1RZKH 5F93C 5I0VA 2WP3T 1J9TA 3F00A 3PGFL 1P5UB 4NQSB 3ZE1F 4XXDA 2DBLH 4AYMC 1IAOA 3AREB 1ES0A 3B9VA 3Q8CA 4AGLA 5BVJB 2BNRE 2WKLA 5D7LD 1IBZA 3P9LA 2D2CC 3LQAC 3SPCA 2XZZA 5CMAB 5ERWB 3WJMB 4AYSA 4UOQA 5C0AB 1G6RL 4HU8A 1MCIA 2AHIA 3UPCA 5HHVL 3WIAA 1TZOA 3Q1SL 5CHNB 3U30B 3BDYL 5L4IA 2J6WA 2A6IB 3A6CL 3T6XA 5B3SB 4AZ8A 5E9NA 3HZMA 4H0GA 1B2YA 4NKMB 4OZHF 4WGKA 2J6EA 2YBRB 3VXRD 1CF8H 1EWHA 3P69A 2O5YH 3M1BA 4H1LH 3C2AL 2JLPA 3BIBX 4NB7A 1J9QA 3DO7A 3GBLA 2NW3A 2NX5A 1P9MC 1E6JH 1IGIL 2PYED 3U7WL 2J72A 2YQ3A 3POHA 1P84J 4IMLA 3QIWB 2XQYK 3QEQD 1T1XB 4ZO9A 4ZD3H 4WWPA 5CBEA 4K9EL 3SBRA 1MCWM 4KY1L 1X6NA 1RUML 5ESVA 4EN3C 3HZKB 4FNRA 2W38A 3CWGA 2BSEA 1RP8A 2X09A 2Y7OA 1XB6A 3QCTL 4PJEE 4HG4J 2IVFC 2YQBA 1V3JA 3ZTNL 4IBWA 2AJVL 1DBBH 2W07A 4AL8C 3D30A 4X6FA 2C1OB 1S7RA 3V55A 2ADJB 2XXCB 4YDIH 2YK1H 4X4XB 1DUZA 1SJHA 1O6VA 4JX0A 5EU3A 2CLRA 4S1QL 4G7VL 2MSPA 4ZFOA 1AR1C 2NY0C 4HT1H 3BUQA 4NKQB 3TP4A 1F00I 3MBEA 3SCMC 4R5XA 2WWMC 2DWSA 4ONOA 2JSFA 2Z31D 4NWTH 4WUUB 1CLOL 3ZY7A 4KZ0A 2LAAA 5FYLL 1MQKL 1VFBA 2MTPA 4I9XA 3QPKA 1KIPA 4J7RA 2AJYL 4Q2ZB 1C08A 2EXWC 2BRQA 3OJVC 3D52A 4UNVA 4QO1B 4G2AA 4JL1A 1WT5A 5DJYB 1FPTL 2EE9A 3TA3B 4P23A 2AFNA 3MGAA 5F71A 2FR4A 2P5WE 4S0SD 4Z7OB 3MUGA 1YMHB 5JOPD 1KIUB 3C08L 3PDGA 4R7XA 3TCLA 2VLJA 3OAZH 4B97A 1QSFD 1NOLA 1YEDB 2R23B 3MLTA 3COOA 4WLCA 3NCYS 1MREL 2EILB 3HPLB 4QHMB 7FABL 1IAOB 3A67H 5LQBL 2VT0A 3OAUL 1SOXA 5I19H 3ILPA 3G3LA 1A7BA 4R0LB 2X12A 4Z7QF 1TETH 2VDOB 2NUPA 3BX7C 4LCWD 1UA6L 3RIFF 4IOSD 2HKFH 3QUKB 1OM3L 3U4BL 4M8UA 5HPMB 4PJXB 1U33A 5FIEA 4PJGF 3LS5L 2GPZA 1QTPA 2GBVA 1FWXA 4JG0H 3RHWF 2OJEB 2DL9A 4MZ2A 1PZCA 1AXSA 2M26A 3KM2A 3CLEL 3L7EA 5CUSL 2W91A 3UABA 1GW0A 1H3WM 4N2KA 1JOIA 3D2TA 1HDMA 1PD0A 3E6HB 3LKRB 3PPSA 1JE6A 2WLKA 3RL2B 5IHHA 3HS0A 4NM4L 4X0KB 5EB9A 1T2JA 1RLWA 5EUOF 2CRMA 1B4TA 2NY2D 3EO0B 1TTUA 1D9KC 1OGTB 3C8KB 4JAMB 4E9SA 5EZOL 3GBEA 3OPUA 3BMVA 2WIIA 7TAAA 1HE8A 3D50A 1DDHB 4WI3A 2XXGA 3IDIA 4YHZL 4HWBH 3FB6B 2XA8H 1YYMH 5EC2B 4S2SB 3UZEA 1AHWC 3DDGA 3GD1C 5CSBA 1GL4B 3REVA 3RWFA 2MFNA 3GHPA 5I18H 2ENSA 3FS9A 4UBDC 3QI9B 3UJJH 4EN3B 2BCMA 3RY6A 4P4KD 5IR1A 3PGCA 3F6LA 5C08D 4XAWL 4YSPA 2C9UA 3ARFA 3C5ZD 4CBZA 5BVPL 1M4KA 1XEDA 5HHPA 1NTDA 2WLYA 3VVVA 5K9KA 4OLYL 5D1XB 3TFBA 2CKNA 4UUJA 1I7RA 3T6WA 3ZN6A 1QHQA 1SXAA 2ITCA 1VFBB 1EHAA 1XF4A 4ANXA 4LHUG 4RQQA 1DN0A 5E6YA 5HGBA 3SDXE 5EZJA 1YRKA 2DQTL 2QPDB 4OB5H 2X42A 3ZTJG 1N4XL 1SXNA 1MWAB 4AG4H 3O6FC 2NUTB 4Z3GA 2X2JA 2X05A 3MBXH 5SWZE 3TNMB 5CCGE 2G75B 4A6YL 3BZDA 1G7MB 1SBSL 1OARL 3FW6A 5E4EB 5EU7C 1F6AB 1PIGA 1WP6A 1AQDA 1DQTA 2DLFL 3APDA 4QHMA 2E3VA 5KVDH 3O9WD 3FCSB 3BIKA 3MLYH 3KWUA 3QNXA 1ZLWH 1HHKA 1TZGH 4EZKA 3S97C 1HYRC 4Y5VC 4O2FB 3W39A 5ICYB 3BEVB 4Z23A 2QKSA 4CVZB 5B8CB 4Z6AT 4DP8X 3EGSA 4LCWA 4NN6B 3L5WA 5JPNA 3ZO9A 1MCJA 1OO2A 3PAZA 5GGVL 2WD0A 2H0PA 3IDNB 5DJ6A 3DNKA 3S7GA 1AJ7H 3JWOH 4W6XB 5D96B 4AK1A 3CUPA 4DGVL 2QT6A 3CFDB 5KSBA 5D1QD 4MXWL 2CIKA 4EZLA 4IRSA 2GCYB 1F42A 2NCEA 4PRIA 3SQOH 3VG9B 3X14B 5IEKA 2WXOA 5C0GA 5BW7A 4KX7A 3C8KA 1HI6B 2Z8WC 2G3ZA 5LG6A 1J1OH 4ZUUA 4V1DE 2JKRM 2I7SA 4Y2DB 5MENB 2QKIC 5F9JB 3SBPA 1F6FB 2PWEA 3T5WA 4CMHB 1MDTA 2A6DB 2AW2A 4G7SB 5E4OA 3QQ4B 5CGYC 3G6AA 4BZYA 2NY4D 3GMNB 5DF0A 5E8PB 1B9ZA 1ZHBB 2FEDD 4PV1C 1PD1A 5I71C 3QAZC 4KMLB 3TJEL 2ZUVA 2BDNH 3QJOA 2EE6A 4PRDA 3ZE0F 3O6LL 1OT2A 1VFOA 2DWEB 2K45A 4ISVB 5TDNA 2TSAA 3CFUA 3LY6A 3FO9B 5I6XC 4JK0D 2C4FT 2MCMA 4KAQH 3JV4B 3EFOB 5IROC 4NNYB 1A6TA 3K1DA 3RUGB 4B9ZA 3KLAA 2QVMA 1HHIA 3BP7B 2Q7YB 3HS0C 3RNQB 3UAJA 3UYPA 4Y4KD 3UYOD 3MRQB 3CHQA 3MLXH 4L9LC 5B22A 4MJID 3HHRB 2DJUA 4O51B 4IBVA 1MRCL 3K2IA 5C09B 5LXVA 2X89A 5EEUA 5E2TL 2GJPA 1T22A 2ZIDA 5D7IB 3BSZA 3V5DB 4H44C 2XVGA 2QV2A 1UASA 3J7HA 4UDTB 5IOPA 4JDZA 1ZIBA 4Z7QE 2X9YA 4JM2A 4Q9RL 3D69B 4Z3HA 3TEZA 2NOYA 3VWJD 3APCA 3N1MC 4X5RA 4AJWA 3NSFA 5I1DA 4LLMA 4P06A 3NIFF 5I8OL 5EU5B 3S8GB 1C7TA 1ZA6B 3O6FD 3R06B 4L4TD 1NC2A 4PJGE 4K2UL 3H9ZA 1CFQA 4LQ1A 5GGVY 4OLWH 5IVZA 2WYIA 2FL5A 4JL2A 1KENL 1JZIA 4HEPG 2TAAA 2A99A 4KI5E 3ZHDA 4ETQA 1FNSH 1IEAA 4F37K 1BEYH 1W0WA 3WKMH 5SV4A 3CBKB 4NXKA 3TGXA 3ZZLA 3QUZB 3A6BH 1ZOXA 1HVXA 5CINH 1A6WL 4FQLL 3X1EA 4YXLL 2QLVB 4I3RH 4L48A 2EKSA 4G82A 5MERA 3FOLA 2F18A 3ZK0A 2X4SA 1RLBA 4ALAL 5HDQL 3ZE1E 5KJ7E 2R4RL 3I75A 2Y5TB 3GMOA 4HZ1A 5F1OB 1Q0EA 1NICA 3CDCA 3F3HA 4TUOB 3P3RA 5ESAB 1LP9F 1F90L 1GW6A 4LIQH 4NNPL 2APTA 1LQSR 1CUOA 3JWDC 3OM3B 4EOWH 3TPKA 4KKBC 3GSNH 2OMVB 1LO3L 3RWJB 2F54B 2ZOLA 5EF3A 3TASA 3MLWL 3OPZL 3KPPA 1J48A 2CR0A 5DD3L 4P49A 4I9WE 4DWHA 4PJ6A 4AQEA 1EANA 3LAFA 3PXHA 4IW4C 3RG1C 1MLCB 2V3FA 5K5YA 3DX3A 3UTSA 4MMYB 4N8CH 3ULSB 3GT6A 3OKOB 5DEZA 25C8L 4KK8D 3CFCH 3BQUD 3FONB 4FMVA 4U6XA 2HMID 2VL5A 3O3UN 3O9WA 2QBWA 1J1XL 3F65A 2HTLC 4LEBA 3WEXB 5FDWA 4HWUA 4ABQA 4QOKA 1KPUB 1R4XA 2CGRH 4P8QA 1M9SA 3O3AA 1EEYA 1I9EA 2C9QA 1PF3A 2CG9X 3BPOB 4K3EL 3HC2A 1JHKL 3T1FB 4E42B 5AVYB 2B08A 4JFWA 1SUJA 2ICWB 3WE6B 2KZWA 5IB5B 5GHWL 4UQAA 1KGYE 1PYWA 2H47C 2DM7A 3BW9A 2AJ3B 1IIKA 1LWHA 4ODXA 3NCEB 4K71C 1FYTE 3PWPB 2CO4A 2X4UA 1HNFA 4FLRA 1DQDH 1ZDQA 3VYPA 3WFBL 2B9AA 5ECJE 4M93C 2WKOA 4AYEC 3DV4A 1IVTA 2XWTA 2YIHA 3IFLH 3UEZA 5FECA 1KDIA 3S5LG 5L7XH 6CGTA 3EKCA 4OCXL 5EMYA 4B3VA 4KZDH 1CR9L 4XPHL 2OMUB 3NRQA 1A6ZA 1RIVL 3HUJE 5LAXB 1MH5B 4WY7L 5A6MA 4A2GA 2ESVB 1YECL 3EO1B 1JZ5A 3SDAC 4J5VA 3FCTA 2WHVA 1PY0A 3WD5H 2H45A 4J8QA 1MWOA 4FQXB 2W81C 4WW2A 4H8WH 1GC1C 4JE4B 1NGQL 2XBDA 3PGFH 1T21A 4UM8B 3TO2B 4F80A 3QG6A 4AUYA 5F6IB 4XNXL 2FX9H 3WY1A 2A74C 4ZZKA 4O2CA 3FQYA 4G6FB 3D1MC 1S7TB 2NY0B 3VXMA 1INDH 1OSYA 3CDFA 3GMOB 1ZLDA 3F83A 1YNKH 2PW2A 3CSYB 4HULB 1BYPA 2AXGB 3VXSB 2J1ZA 2MNJB 1H8NA 3VH8G 4XCNA 4YDZA 5H8DA 2ZPKL 4HIPA 4HS6B 1HXMA 3QFJA 3QRFM 1RURH 3T0EB 3WS3B 5MENE 2JJVA 1AXTL 3GNML 4ZNEE 1BZ7A 4C57C 4KKBD 1MY5A 2P8LB 1HS6A 2X87A 4Y9CA 4AQ1A 4ZX6A 4XI5C 2ZXEB 5E7BA 3UO8B 4MJIA 1Q1PA 1L3WA 4K3JL 1XGYL 1PMYA 2L7QA 4DP5X 4ZMWA 2X3CA 3NMEA 1MLCA 4HUUB 4K7PY 1EFXD 1SVBA 3UAEA 1P7KA 3MV8D 4K7PH 3THMH 2AXFA 3O81A 1J8HA 2LOEA 1NGPH 4NQEB 4K9EC 4U6XB 1U93A 4XOBA 4C4KT 3SGKC 2E7LA 4JPSA 4HEME 1AQ8A 3F7RA 4Q4IA 2CA3A 3B5HA 4AQAA 4P2OB 4WU5A 1AFVH 3KYMB 5AQ0A 4OD3H 2ZAIA 1H3GA 3DOSB 5A6LA 4E9VA 2Y06L 1IBYA 5KZCB 4YHOH 2ATKB 1JK9B 2ICWA 4GRWB 1DZBA 3WE6A 1E30A 1PYWB 3O3DA 2B1AH 4OH2A 1CDCA 1UWYA 3V9EA 3EBHA 5SWQB 5HD8D 3BPCB 4HT1L 3P4OA 5E99L 5IHBA 4JRXE 1X5YA 3HR6A 4A7SA 4AMKL 1NDMA 2RIKA 3PHQB 5KSVB 3GI9H 2AK4B 3MSPA 3QNFA 3GI8H 1EXGA 1JV2A 2L7EA 2WKGA 3DSFL 3GXPA 3FCGA 1DBKH 1ZLSH 3O2DA 3GRWH 3VXSE 3QO1A 4YDVA 1OF0A 3UTTB 4LDOB 3VD4A 1H6TA 5LAXA 3OGCA 1SXZA 5DHEA 3EO1A 3T2QA 2GKIA 2PYFB 2EEFA 4M48H 2J21A 4MQXD 3KEDA 4ZFGH 2NXYC 2KBGA 1I1CA 3HTLX 3RDJA 5E6IC 4PVLA 3NJHA 1IQWH 2HT4C 4WI0A 4DIXA 4UZSA 4G72B 4F37F 3VFTB 2FO1A 3IS0X 3QG6B 3MOAH 4OZGF 4AQZA 2Z8SA 1J5IA 1SBBA 2MQ0A 1YSOA 4NHCL 3VXMD 2WMPB 5IVXA 3QDMA 1ANUA 3VFOB 4TVPL 2R2BB 5FCSH 2EXTA 2QSCL 4RZCB 4W93A 5DRZB 2F74B 4QR7A 4L0YA 1QQDB 4WNQA 1PEWA 1G0XA 1XEUA 4IBZA 3GBML 4KDVA 3AADB 2G5BA 4FHBD 3S3JA 3DX9A 5KVFH 2NRDA 1A9BB 1HX0A 3ZIMA 1H3XA 4DGYH 4K23L 3VSQA 3FTXA 1EDHA 4WV1B 2DS4A 4GP5B 3OG6B 3MUJA 2XVBA 1LK2B 3KBHE 4HUUA 4X4MA 4FLOA 2ZAGA 3BCDA 3WN5A 1CFVL 2K4AA 2OQJB 5FV2A 2XRAL 3ABLB 4RAHA 4M29A 4CSTA 2WOBA 1OCRB 5AYUH 5CCJA 4MDJA 1I53A 5MI0C 2DJ4A 2Q2LA 3NJLA 4OZ4B 1YNTF 4A2DA 5LXGH 3W81A 2XA8L 4LSDA 4A7UA 2LT9A 5D93B 1G84A 2BSTA 3B3IB 5IUCA 3ZYZA 3EOBA 2ATKA 1E28B 2YD8A 1VAHA 4PJ7B 4UOW1 3KPSB 3RJOA 4OZHB 5JQIB 1VJSA 2IADA 2C3XA 4NLAA 5K33A 2HFEB 3V4VB 4XAWH 3GSWB 4G8GB 3B6SB 3CN0A 4YDLB 5JHMA 4JCLA 1E4KA 2EVGA 1CICA 2FTAA 3L08A 3UG3A 1ZVNA 2AJXH 3GUTB 1XTMA 4PU2A 1G43A 3L54A 2IPUG 5CCHE 4RMQA 3DX4A 1A4CA 2VDMH 1A6PA 1EXUB 3ZRFC 1IBGH 3T3ME 1MFMA 4IOIB 1QUNB 1GAFH 3LD8C 1HNYA 1NWOA 1OCWH 2FGWH 1SXCA 5F1KC 3ME0A 3MC0A 3V9FA 2Q5BA 2O26U 1BAGA 4NZFA 3BN9D 1XX9C 2AXWA 2IH8A 2WP3O 2YA1A 5JXAH 3C5SB 4Z8FL 4LFHD 4M7LH 3AWGA 2B3RA 4XE0A 2X4NB 4HFUL 5DD0L 3F7KA 3QVAA 4OF8A 1URLA 5DUMH 3ZLQC 4DKEH 3QCUL 3CX5K 1JYXA 2GT9B 3B56A 3IE9A 5I74B 4G6ML 3K74B 4QCIB 1TZGL 1TPXC 5L2KD 1KEGH 3PIQB 1BQKA 1CFNA 3MJ9L 5EO1A 5J5EA 2I27N 2AJSL 3FB7A 1S3KH 3BVUA 1I8UA 4NZUH 4CRPA 2ORBL 3KYOB 2YBRA 5KBLA 4OU3A 1CMOA 3ABGA 4CJ0A 1A9BA 3ARGC 3MRKB 4R90L 2A6JA 3V10A 5DC4B 4PY8J 3ZHLA 5IHUH 1AJ7L 2EZ0D 3JWOL 3EJJX 2Q86A 3CDZA 3O6FA 3FSAA 2YXWA 4FQJH 1WZLA 3B37A 2YRBA 4XMPL 1Q0XL 3EDJA 4WK0B 3W2DL 3WN5B 4EI5B 3NPSC 4IDLA 5C0BE 5C0CA 1Z9LA 4PWKA 5DTFA 5AALA 4JFEB 1UACH 4I7ZC 3CZUB 3ARSA 4JB9H 1U6AH 1T3FB 3T8VA 5KYYA 1J1OL 1TQUA 2P5PA 4OCWH 2OW6A 3BIAX 5HXMA 4LCUA 3HLAA 4HUXB 3V4UL 3IETA 3EW3B 3VRJA 3AB0B 4HCRL 2CRZA 4JFYB 4TTDC 1I8KB 3D25B 2OP4L 2ADJA 3QJHA 4NZ8A 1QYGL 4QAWA 5I6LA 4IIQA 4G9FD 4XBGA 4JFTA 5ADPH 4FFYA 2WXIA 4PJIF 1OTSC 3ESMA 4I4WA 2CJUH 3KPSA 2BIOA 1FFPB 3U6RA 2X3BA 1SYVB 3GXNA 1DJHA 2XV2A 4QTIH 4RSVA 5BZZA 2JB6B 1BAFL 2CDEB 2KH2B 3BLKA 1WFMA 3B6SA 4NIYE 1T5KA 4C55A 4H20H 4XWGL 3WKNA 3K6DA 1LQBC 2XTJE 2F6AA 1WLHA 5I17A 3RB5A 1QSVA 1OCCB 2H1LM 1T89A 1WZKA 4FKEA 5CLYA 1H9VA 3RY4A 1EXUA 2EDTA 3QDJE 3IN0A 1FV1B 5FUCE 3NSJA 2G3XA 2JJWA 3SE8H 2WSDA 2C3WA 2N4IA 3KPOA 3WJJC 2DJMA 2B8OT 1MF2L 1YEDA 2R23A 3ZHFA 4N6QA 2UVEA 3N1GC 4M5ZL 4KK9D 4RAUB 2ATAA 1UVQA 1TZ8A 3RA7L 5HVWA 2NY3D 3BP5B 3OKDB 4QKTA 5DT1H 5BXFA 1OTTC 4WHCA 3V6ZA 4JJOA 1EO8H 1DQML 1MNUH 1ORQB 4ZBJA 35C8L 1I8LA 3LD8B 5T1DL 3SYQA 3T71A 4F7TA 5I8CB 1KCRH 1WHOA 5F9WB 3NSCA 3QUKA 5AKTA 3SOBL 1ZTXE 3HUJF 4AQ8C 1G7LB 3MR9A 2LFGA 1LD9A 2YXFA 4JREB 4OW6A 2AZAA 4XN5A 3SCMB 3A6BL 1QFPA 1S2EA 2HPTA 5FGSA 4ZQTA 5MP6H 5IM7B 5A7BA 4JMXA 2ZOUA 4OM1L 3GM0A 4F3FB 4IDJH 3QUZC 4XOCA 2PETA 4QYOB 5FHAH 3RWDB 5CAYB 5IJVA 5KVDE 5K1NA 5CILH 1A5FH 4OZIF 4WI9A 3E3QC 3NFSL 5DMYA 1ETA1 1OV8A 5L4FA 2XCMC 2XZQH 32C2B 1KZQA 2ZG2A 1M53A 4I0PD 2CRYA 5KYYB 4GRWH 5CEZL 1JHTB 2I69A 5DJXB 1JVOA 2WYTA 3GSNL 1KB5B 1L7TL 3O6KL 4OZFB 4F2ME 1I1AD 2LU4A 4LOFA 3AGVA 1KJ2L 1I8KA 2FZ3B 1CXFA 4TUKH 3ARBC 5DLML 2Y23A 1S9YB 2NXZC 1ASQA 1ES0B 2FK9A 5GRJL 3DGDA 2Z7WA 4OLXL 1KCSH 4N8CL 4LSTL 4U2YA 5JHDB 5EU6B 3VX1A 1DVTA 4AENB 1SRDA 5EUOB 2LHAA 1WS8A 1ED3B 3UBHA 2JMRA 4UDUB 3G08B 1BAWA 1QFWH 3UYRL 5IW1B 4AZ8B 3ATEA 4C4BA 2DWXA 3FRPB 1AMYA 3IYLW 3Q5YA 5D7EA 5DSCB 1KELL 3H3PL 3VAEA 2GJZA 5EZJB 3GJFB 2IGFL 2WVSA 1ZT1A 3LRSA 5AW3B 3C9NA 4X6CF 4XODA 5CLZA 5HYFA 4D9RD 3INUH 1AZNA 2G75A 4M43L 3HB3C 2PR9A 2LGNA 3L3OB 5K9OB 3P30H 4N22A 5DUBB 1UC6A 4PMEA 3OAYH 4PJHF 5ESVB 4JO8A 1S7VB 1L6PA 3NIFB 2Y7QB 2O61B 1U8PB 3QK0A 2LLGA 4FN0A 1HHKB 7CGTA 4P2RB 3Q13A 2BZDA 2L7JA 3SO5A 4F7EA 8FABA 1NJ9A 1NKOA 3WYRA 1NCWH 1JNJA 4DZBA 2FIRT 4JPWL 1JWSB 4PJXE 4LSSH 4G6KL 5C7XH 4NO2A 1BF8A 1BF2A 1VZGA 3D18B 1B6DA 4ODTH 3SO3C 3WENA 1S6NA 2E27H 3A4DA 5GRUL 2WBJD 1X5GA 2H3KA 3CUPB 3VYOA 5HVFB 5I28A 3JWDL 2ZXBA 4BSVA 1BQHG 4IOFD 1H3UA 2L04A 5LHDA 4M7KL 1FBIH 3GMLB 3FMGH 3QEQE 4UB0L 5TK2A 3EOTH 5DMGC 3X14A 5IEKB 3I3EA 5C0GB 4XPTH 1IX2A 5DJYA 1AOHA 3LRGA 3PJNA 4WTZG 2Z9TA 3CX5J 3O2WL 5DHDA 3PJLA 2XWRA 3GMMA 3WG7B 3WI9A 2FR4B 4NFBA 2VJ0A 1U3HC 5F9JA 3PV7A 2IANE 3D34A 5FM5M 3ARPA 4OZFA 3MRDB 3KPRB 5D72L 4Y8DC 4HV8B 3G6AB 3P4MA 2OMBA 3H9HA 3GF8A 4UU9B 2O5XH 2ZKXA 3NFPB 3M07A 5D7KD 3VSVA 2WTOA 2K70A 5CJOH 4D7PA 2VDQL 4P48A 2DWEA 4ISVA 3SBWA 5E6IB 1LEIA 1AHKA 3QDMD 3BWZA 4W9HC 4N28A 3ESPA 5LBSL 4ODHH 5FUZH 3U2SB 4OLZH 2NUPB 1DP0A 5F72S 4Z3FA 1OGSA 3ILEA 5FGCE 1AR2A 5HPMA 4RWHA 1CCZA 1K8IB 5EORL 1HINL 1XSJA 4S1RL 5IHWA 5LVEA 3QIBC 3L5XL 2K9UA 3CZSA 1I8AA 2Y06H 4LPVA 4PJ8D 1U91B 4PUBL 1PL3A 3RNQA 3RWHB 5GJSH 4IIZA 1ZT1B 3QQXA 4BHUI 3D33A 1P5VB 1EXHA 2UWEF 4WEUD 4O51A 3NACL 2R56L 4NQCA 3VMOA 4HUMB 4PREA 1L9PA 4ZUTA 2CSPA 1TJGL 2V7HB 4XHQA 1EFXA 1NGWA 2EIDA 4I0PB 1MCNA 4W4OC 5KW9L 1GKEA 4JAMA 4FFZL 3DECA 1GH7A 3H42L 1VFUA 3QQ9C 4W9CC 2GEEA 2BNRB 1DBJH 3GBDA 5KVFE 2QSQA 2XWZA 3SGDI 4ESKA 2ADGA 3NABH 4ZAKB 1H5BC 4C47A 4QRFA 2F5BH 5EC2A 5A43C 3FTVA 1DVQA 1P4BH 4FG6D 4FXGC 4CN1A 1A3RL 4UT9A 3LZFL 1UXSA 4MD5B 5J1TC 3ATDA 1QNZL 1QRKA 1ZHLB 2AMGA 4YDMA 3T3MF 1XF5B 2EINB 2ITEA 4YHPB 5I6XB 1ZHKB 2EYRB 4ODSL 2PO6D 3KM1A 4U3SA 1V05A 4RFNC 4ZPVB 2DD8L 1I75A 5K9KB 2HRHA 1KTDA 1NOFA 4PGDA 4BFEA 2OCJA 3KCPA 4PB9H 5GS1A 1XF4B 3QIBA 1CK0L 3TTSA 4RZKA 2DEWX 4L4JA 1XMEB 2DEXX 1F1GA 3KWXA 1D5XB 2XG4B 4L5FH 2XQYG 1AHWA 1Z5HA 1YHPA 1UM6L 4D0CB 3WDJA 2VZVA 5IW3A 3PDOA 1KZYA 4QRPA 5BS0A 1KJMB 5HY9A 5DRXA 1EZSA 1ASPA 2GJ6E 4HV8A 4ZPTB 4NNXB 1A1MB 4P5KA 2NQCA 1FZOB 2E59A 2C9SA 5HTSA 1PQZB 3AITA 3NFPA 4LB8A 3FCSA 4YIQB 1X4YA 4HUWA 1IZKA 1CFVH 4KTEH 3FQWB 4XCCL 3U2SA 4JFXA 1KXVA 5GGSY 1U3HB 5FF6B 3BFQG 3GC3A 3GLZA 5DHVA 4GMSL 3I02B 3BN9C 1YEJH 5DDHB 2IV8A 3OKMB 2WQUA 3VRLF 4QOKD 2CUHA 3T1FA 4PG2A 5IOKA 4NWTL 2XNAA 3QXUA 4FA6A 3QXVA 2IQAA 3JV0A 1BQRA 4ELMB 2AJ3A 1SY6H 4QMEA 4APXB 2VDNH 1FFQA 5DA4A 4HKJA 3U82B 3CXHJ 1RZKC 3ARYA 3RZCB 1MHHB 1AD9A 3S5YA 4P2QE 1E6OL 2YUVA 3QXAA 1CTNA 3IEAA 5CZXD 2KPNA 1OT1A 4FJYA 3C08H 1JFQH 3VI3A 4D94A 4GG6F 3NT0A 5GRVK 4ZAKA 5D71L 4L18A 2VDML 1KJ2B 4JFFD 4GFTB 3AMKA 3MX0B 1R5WA 1KY7A 4X6DA 5TE6H 4RMRA 5AWNH 1BW8A 2HLFC 1BZ8A 1YJDH 3FCUB 2HVJB 2D2OA 4QXWA 5FOBA 1IQDA 1RK1A 2WZPA 2OFQA 3IRZA 4WW2B 2HT4D 3MRRA 5E5UB 3VB8A 4HAKA 4OGAC 2WTPA 4GYBA 2H2PD 3JV4A 4E68A 1GCFA 1ZPLA 4P9MH 3TYGH 2XG5B 2PTVA 4JPKH 2NT1A 5FK9B 3WHE1 4ZMVA 3QDGB 1S9VB 4F9PA 1WYJA 3X3FH 2VLLB 2QSTA 3T0EE 3D3VA 1PKOA 2HZHA 4QWWD 4GUQA 3BWAB 4NLHA 2Y3NA 1KEGL 2XG4A 4YSCA 3IM1A 3N5AA 3N40P 2WZ6A 5T1MB 1E9PB 1BZ7B 3UZVA 3LB6C 1TSHA 4Y16A 5HY9B 1EVUA 2FQGA 1QATA 4N8PA 5DD6B 4WUUE 1T5XA 3N1FC 4DN3L 5IHUL 3ZVVA 1S7UB 3E7JA 2JKTM 2D7QA 4S1SL 3QH3A 2IO5A 2V5SA 1MCOL 2SEBB 4GBXD 1YEGL 2KQMA 2YPKA 3AACA 3ML8A 4FFWD 3LHPL 3F85A 2EO1A 3O2VL 2VAAB 2F08A 1LWJA 1KPVB 2LR4A 4JB9L 1DFXA 4MXQC 4WUUD 3RU8H 4F2FA 4FADA 4UTAL 5D70H 3L13A 3OHXB 4ZK8A 1RU9L 1HKLH 5KSAD 2OCCB 4G9DB 4G8IB 4I9WD 4IGBB 5J06A 4TL4A 3BAJA 3DXAB 4LFHG 4ZS6C 2COVD 2OPCA 2A9MH 4L05A 4PWJA 4AT6A 1B3JA 2HT2C 4PRPD 5FKPB 1ADQL 1QSFA 2B39A 3SDCD 2R2EB 4WJ5A 3VFGH 4JO3H 3P4OB 1CE1H 4CC4C 4JN2A 3DX7B 4KOCA 4LEOA 4YGVB 1N68A 3DURB 4OB5L 4B9FA 4PGEA 5EF1A 5CZVH 4HS8H 4ATWA 1GHFL 1LJMA 2Q76A 4N90E 2X4OA 1SLVA 3RKDC 3PQYE 2H2SD 4U6VH 3UGXA 2P46B 3NTCL 4HUNB 1VCAA 2DTML 4PJBE 4XPFL 3UTTA 4HK3J 1Q1JH 4P3WA 4DETA 2WLIA 4UAOB 1V7ML 3HI1B 1K2DA 3ARZA 5EDXA 1X5LA 4BFFA 2BMKB 3ZKXC 3MLYL 1AY1L 4LCCA 4OAWB 4UTBA 4OFIA 1WTGT 4G80B 4OJFH 2AI0L 3EFDL 4W70A 1W0VB 1HXYB 3VD7A 4NN6C 5LN4A 3EBIA 1BZQK 2XQBH 5H37H 3S88H 2WQRA 1GZPA 4WCYL 1Y0LA 1R6VA 2AS5M 4JDTH 4Y4HC 3S3BB 5CJXC 4AVIA 5IZ7A 4ACPA 4DGIH 2UZIL 1FORH 3DTXA 2YGPA 1CD0A 1M3IA 4N0CD 2HN7A 1HESA 4QRRB 5I23A 1ZXQA 1OSZB 3T3PB 1IEHA 5AW2B 1O9WA 3BKYL 1IKFL 4YXKH 4X6DF 1NCIA 1NCHA 1EBPA 3MNWB 4NCDA 4JO4H 4Y2DD 5HJBA 2YSSA 3D85B 4WEMB 4B95C 2BH0A 4E0RB 4OM1H 2XWTB 5FECB 3ZE2F 4PLJD 4BJLA 4YBQD 4PRID 3CSTA 3FN0L 4UINL 1JNLH 5K93A 3L3JB 1JIBA 3I84A 3GEFA 1AD0A 2M1KA 1YPZB 4PHZA 4YDJA 1KFAH 1URIA 1KUMA 4Y1AA 2VAAA 1UM5L 5IJCC 3QZPA 1SPDA 3P0VL 2N7AA 2WNXA 5JA8B 3AG2B 1MFEH 3QPXL 5JHLA 3WOVA 1RULH 1N64H 3DIVA 5LGJB 3D87B 1M6OA 2I9LB 4U4IA 2BNUA 2EIJB 2P7TB 2Z4TA 2P24B 3CFTA 5IMLA 2VM3A 1CFSA 1KULA 5JO5B 2X0WA 2FAUA 4XP5L 3P9MB 3KJ6H 3RWEA 5E4AA 2JIXA 5FKPA 5B8CC 3CFBA 4OZHA 2WBXA 5FYJH 3VXNB 1SJEA 1ZY9A 5FV1L 3K6OA 4AEHL 3ZDXF 4F8PA 1A4KB 4HQQL 4Z7UF 5IFJA 1AYRA 3DKHA 1YEEL 4P46C 1DVSA 1IRAY 1T0NA 4NQED 3WNPA 4UQ9A 3HG1E 1VENA 3BH4A 5E1QA 1HXMB 2Y2TA 1DVYA 5DFTA 4NENA 2VDRB 3FFCA 4I5BA 3B2VH 1E3ZA 1WSST 1YMMA 5A2LH 3RTQA 4Q9CA 3WE1A 1QW8A 1BFVL 1U8IA 5DK2B 2WLIB 3FUNA 3SKNA 4P23D 3IFNH 3FU9A 4Z0BL 4LLUB 4ZYKA 3VG0H 2Z7UA 2WW8A 3JZYA 4GKNA 4CMHC 2WYHA 4H0LC 1F41A 3ET9F 2CO6B 3MV7E 2NNAA 5TTRA 4CUCA 4G1EB 4I77L 5E08H 3ABMB 3C60B 4HLZG 1RJCA 1BWWA 1VGEH 4KJQC 4XCFH 4IU2B 4Q52A 3U7WH 5AKSA 3K8KA 5CJ5A 4NC1C 1CGYA 3GKWH 1ULVA 3B9AA 3KBPA 1HZHH 4PJDA 4F7PA 3DTXB 4WHTA 1TJMA 2MWCA 3LOWA 3O11A 5F7DA 2KPWA 3ZKXB 5CGBA 3LKQA 4K9EH 1JPFA 4LLDB 3K71B 4CSPA 3RWIB 4I3RL 5I76A 2VUYA 1OCZB 4ZFOL 5DRWA 4WFHD 1Q94A 1OB0A 3FXIC 4MS6A 1JGVL 1FN4B 1YAZA 4GIAA 1JGEB 4N8VG 1ZSHA 5TQ0L 4L2YA 3TBYB 2YO3A 4N9GA 3JBG7 4Z7UB 1W15A 2XA3A 2XYCA 1RJYA 3D9AH 2CDGB 4MJJA 4N2HA 1O7DC 5GRUH 1GTNA 5FFGA 2ENJA 1J1PL 1LLAA 1T1WA 4LAQL 2ARJB 5JHLH 2JQMA 1A1OB 5IIEA 1ZLWK 4PJIB 3GJEA 4GRWF 1TTFA 3EOTL 5HSFA 2BSSB 4WHYH 1R17A 3FQTB 5JDJA 1P7QD 1QD0A 2NY3B 4GAYA 4NUPA 5FYLH 3IDYB 4A04A 2YPLA 3EZ8A 3QUXB 4FCHA 3W11D 4DTGH 4RMSA 5D7IE 1T6BX 5HDOA 4B7IA 1VACA 5TD4A 2DDQH 1DTUA 1P5UA 3B2MA 3WFHA 1AGEA 2ALWA 4YFLF 4JGNA 1YY8B 4FA7B 1WPCA 1W91A 3LEXB 3U4AA 4ORZC 4BEIA 4Y5XB 5JO5A 1UM4H 1YEFH 2YZ8A 3UBXG 1FFPA 4HK0A 3U6RB 4OGXH 1F1AA 1M05A 3SGEI 1KGIA 1A7OH 5TE4L 1UH2A 2P26A 3GSUB 3T8XA 1YEWA 3BUYB 1R5VB 2A6IA 2XT1B 1QQDA 4KVPA 4WNQB 5M7QA 5BV7B 3APNA 4LASH 4L1BA 4OCSL 1FL3B 4R26H 2Z31A 4DUVA 5I1IL 3R0NA 2P5WA 3MLVH 5FOJA 1UWXH 4F2MB 1QMUA 4NBZB 4QXUH 2WXPA 1VCBC 2VRKA 2Y0SA 4ZYKB 2CGZA 1I9IL 1WFOA 1MG3C 3LDBB 4R84A 1V3MA 2BHYA 2VSCA 3CIQA 5CKGA 3S34L 1A6AA 1NL0L 1UOKA 2X1OA 5T1JA 3KWWA 3R8QA 3TH3T 2VO5A 4PIBA 1CXHA 1JGUL 1I8MA 4G59C 4ZFFB 1KDJA 1AGCA 4JPVL 5EBLA 5J3HC 1IC1A 4H1LB 2BSTB 3B3IA 5E2VH 1FQ9C 2LLLA 3RWIA 4K07A 2C8NA 2FX9L 4G8FB 2E7LC 4GG6E 1E28A 4PJ7A 1P7QB 1NPNA 1UYWL 1LD9B 4BD4A 5JIDA 5DO2C 3DUSB 3C12A 3GSWA 1L9QA 4G8GA 3L3DB 3S37X 2W9LA 2XKNB 2A5UA 1JV5B 4WO4C 4OLUH 5EZLB 2D8KA 1I7ZB 4HPOL 3ZKSD 2V2TB 3D2UD 3PCYA 4JG9A 4ANKA 2FQEA 1MPAL 1BIIA 5GZNC 2IH3B 2PR4H 3MRIB 3SPHA 4MHHG 4Y5YC 4UT6H 3OX8A 4L5FL 4IOIA 3QNYB 3HCVB 2EAEA 4X8JA 3FN9A 3WBDA 3V9CA 1KB5A 1QR1A 2QPEB 5E1AA 1VACB 3SPVA 3V0GA 1MDAA 5E03A 3SDAB 3KLHD 1WZMA 2BFVH 3LEXA 2OSLA 4LBAA 3VI3F 4JFFA 4A6YH 4NWUL 3H2WA 3DVNB 3WNNA 1QSZA 5JHDA 4JM2F 4NRXB 2F8VA 1YDPA 3LPPA 4UILH 3TCXA 2K7PA 4YHOL 1JGDB 4NDMA 4XB7A 4UDUA 5HYEA 4PB0L 4APQD 5GPRA 2V2XA 4N68A 1W72L 4M5SA 3QARA 2GJZB 2DPKA 2LAGB 2OMYA 4IMKA 5SWSE 4AMKH 3D4CA 4MS8D 5FYLD 4LRNH 4F27A 5CCKL 1AG0A 5D5MF 1L9TA 4OKVA 5DZNA 5KN5A 1FC2D 2W9EL 4S0TD 3LKRA 1CXIA 1RZFL 2EDYA 2HFFA 1MG2C 4HIEA 5ID1A 2IANB 3GLAA 1FO0L 5TK4A 5E0QA 4CNIA 3DXAD 2EIZA 4S11A 4PJ9A 3QSKB 4X5PA 3EO0A 4YDIL 2D3NA 2ALAA 4M48L 3E9UA 1RHFA 2BO0A 1MI5B 4YE4L 4XGZA 5J56B 1D5MA 1U8PA 2N3JA 3FB6A 4MCYA 4N1HB 2G3MA 4ZTPL 3KR3L 1TTRA 3L3KB 5CP3A 3CLWA 2IPKB 4LCIH 1ZLVH 3RWFB 3TWCH 2ZXCA 4Z5RA 2EE3A 1CLOH 3UPRB 3VM5A 1F3RB 1KXHA 4QLRA 4ODWA 4NO2B 2FJHB 4R83A 5A16B 4N3UA 5IR1B 4CDHA 3C5JB 3DUSA 1ACYL 1AAJA 2CDEA 5GSRA 1DLHB 4BFIA 3SEPA 2HJFB 1A4JB 3J2PA 3S48A 3FUEA 2CIIB 3HC4H 4Y9FA 3VFPA 1BZ9A 1NOAA 2GG1A 2O5ZL 5I17B 1I7ZA 1KPRB 1U2CA 4E9XA 3LIZH 1TQBB 4E5XB 3GMLA 3EJTA 5CJQL 3SB3A 5JDSB 4BELD 3UZQA 3OX8B 1MREH 1FV1A 3TEYA 1GXEA 1LO5B 5DMJB 1HAWA 1HILB 4P3CL 4PWHA 1U92A 2QTVA 2VMJA 1NEZA 5KYXA 1HXKA 2BJML 3D39E 3PWJA 5FKAA 2H26B 2Q6WB 2E9JA 3C6LA 2B0SL 4HXBL 2DL2A 1AQDB 4AKPA 4C56B 4RAUA 2IH1B 2APWA 2WNKA 1KV3A 3NCXA 3QO0B 2WSKA 2YZ1A 4O9HH 4RIRA 2CHXA 5JIQA 2F53D 1HCFX 4BA0A 5E6IA 1MCOH 1LEIB 3MV9E 1JYNA 4S1DC 4GAGH 3OZ9H 1NUFA 1Q9WB 2WQWA 1G6RB 1ZS8B 4JW3A 3Q0HA 5TF0A 3OMIB 3FU5A 4LCCC 2X7LA 3W39B 5ICYA 3MLPA 4NQVB 4XNMB 4UTAH 3QUMB 2AVFA 4NC0B 4X83A 2OYPA 2WLJA 3P3SA 1HKLL 2B2XL 1GRWA 1LEGB 2ZQKA 4PBXA 2UXVA 2J8UB 3NCWA 4I18C 3DIDA 4X6CB 2OMZB 4KKLC 3BAKA 4X7FC 2GBTA 3MRFB 2VCOA 3IDJA 5JPMA 2BOBA 5KSBB 3LSOA 4XH2A 4PREB 1KT2A 1BEYL 2BZ7A 2YGVA 1CLYL 2X88A 2DMHA 3TO4A 3MRMA 4QHKJ 2NYYC 3OSVA 1A7RL 5D1ZB 2R0LL 4JO1H 4PI2A 3S96B 5FM8A 2GW5A 4TSBH 5E2UL 5D2NA 3ULAB 1AO7D 4PJGA 5A2CA 4Y4FB 3W1ZA 3PWUA 1OCWL 2JCCB 4OCRH 3W9EA 2YFNA 2DEYX 2Q1EA 1B9KA 3WLBA 1DQVA 1T7WA 3HA0A 2MCG1 1PSKL 1MZYA 4U49A 5DJAA 2OXHA 4Z8FH 1QPKA 4H8UA 2CZNA 4RMWA 4EOWL 5I1JH 5J9PA 3NBNA 1B6UA 1AY1H 1NM9A 3VQMA 3QCUH 1XF5A 4YHPA 4U1HA 4XC3L 4OJFL 5K9QI 1I8IA 4MJ6B 3UCQA 2A4CA 4N0FB 2YMOA 3P11H 5DD3H 4IQHA 5EUOA 5SX5H 4X9BA 3MJ9H 2AK4E 2PCXA 3RUGA 1UD8A 3BVXA 5EBMA 4WFGE 1Y18B 4KPHL 5IV2A 1NPJA 2VLRD 4KJPC 1PFCA 3KDPB 4KITB 1AS7A 1YPZE 1U8MA 2OSYA 3VCLB 3SDDD 4X4YB 5IMMB 5JW4R 5BO1L 3B7TA 2Q7NA 3VGFA 3H8NA 1I82A 2X1PA 4JY4A 4MZIA 4JG1H 4WSGA 3MXVH 5GS2D 3W56A 5GRZA 1TIUA 1PVHA 3WELA 4E41E 2ARWA 5B39B 4E5XG 2F5AL 3TBWA 5CEXB 2VLKE 4L3EA 4U3XA 5DVMA 1NFKA 1KLUB 2FO4A 4O02H 2BIHA 2FEDC 4A6YB 4M7JH 3TV8A 3AFLA 1XQ4A 4F7EB 3BYYA 2AQ1A 2OP4H 1QFOA 4NRYB 1NCBH 4IBTA 1J18A 4M62H 1X5JA 4ZJ9A 1JXKA 4N0UA 5KVGE 4GRWE 4KJWC 4YWGL 3V0VA 3UO1L 4DKAA 4NT6B 4OCXH 4RX4D 3LRKA 2N59A 3RYMA 3MDJA 2HH0L 3IVKB 5HYJA 2NY5C 4P9HH 3QQ3B 3EUUA 3BRFA 1DJIA 5I66B 2EKSB 2CLZA 4F57H 3FUIA 1HZKA 4KRLB 3NH7H 5LBGA 3Q5OA 5JPNC 4ONGH 5HGDA 4A38A 4G3YL 3WEMA 4PLKD 4GKOA 1BBJA 5IT2H 4BM7A 1LM8V 4YPJA 1RI8A 3AVEA 2BDNL 2EYTB 4PJGB 3TH4T 2EDDA 4L37B 2OMVA 3S3CB 3B2VL 2YKLL 3GMQA 4KGLA 2V5RA 2WKOF 3KPRA 3E2HC 1JXDA 2Z93A 3DOHA 4DKTA 4X7DC 4M5ZH 3WTWA 3JV6B 1W8EA 4LGRB 3NCJL 1TVDA 4KK9C 3VG0L 1VA9A 4JVUA 1MFBL 1DCLA 4D8PA 1E8XA 5GGRA 4ALAC 4B6ZA 1JHLL 4WTQA 4DP4X 3B83A 1T4WA 3IAGC 1GGCH 2F53B 4WK4B 4K3JH 4D9QE 3ZHKA 5EBWA 5I5RA 2Q8AL 2IXQB 4P2RE 5HJGA 4C56D 5L4JA 3D2UB 3GJFH 5LGHL 1UGNA 2VO8A 1JXFA 1KCBA 4XCEA 4QF1B 4EAEA 4NYLB 3K1KC 5IQMA 4ODXB 2I07B 3BZ4A 5GS3A 2P49B 2WLNA 5FYKL 2XZQL 4UQIM 1KXQE 1L0QA 1DBMH 1UOWA 2CK0H 2R2HA 3D9AL 3MGTA 3DV4B 3X13A 2NCMA 2OYMA 3DARA 5DZ9A 3NEOA 1RK7A 1WH0A 4UAHA 2B1AL 5FS5A 5CEXA 4OJEH 4G6AD 4UV7L 1KLUA 2FO4B 3K6FA 3O6KH 3WJJA 1DL7L 2XN9D 3OKEA 1DDTA 1FIEA 1GOFA 4ZMTA 3LDBC 1JZHA 3TX4A 3VD2A 4TLKA 3ZOAA 5F21B 2IPUK 4OUOA 3HFML 4PRHD 5EC1A 5L88L 3GI8L 3N0PB 4N0UB 1QBBA 4B0MB 3LHAA 1OALA 1WF5A 2QFPA 4GUPA 2D03L 4DTGL 4YQXL 5J6HB 1AXIB 2R4RH 3ZKMC 4LSTH 2XWXA 1EJ6A 1MRDH 3D5OF 3LMJL 2VM4A 4U3SB 4ZPVA 2AF2A 3IDYC 5I66A 2KLSA 2XU9A 4UQ3A 3PLYA 1MCPH 4XP1H 2MOQA 4Y4KB 5AAWA 4GO6B 1K8DA 1DVFB 1HHHB 4GS7C 4XZUB 3VXRA 5C0EA 3MLWH 3OPZH 3CSYA 3VXSA 1JPST 2FCBA 3PS6A 3QHFL 4MD4B 4HIIA 4AIZB 3AWEA 2QEJA 3NIGF 5HDLA 1AHWB 1MWAH 3VDBA 4WO4B 5ILTH 5FA3B 1LK3H 2O6CA 4N2GA 3WS3A 4CAGA 4NHCH 3HC3L 3H2PA 2ADIB 5B7MA 4FNLH 5CIPA 5GZNA 2WQXA 1K2DB 1D5BB 4R5VA 1DSFH 3STZA 3R4RA 4RH4A 2FEEI 4APQB 3SODB 3MRBB 1TG8A 4WEBL 2YA2A 3UADA 1YYLL 2GC7C 4FQ1L 4IRSD 3ZDZB 1R47A 5D5ME 2XWDA 1E8YA 3AM8C 1E50A 1VGKB 2RQ8A 3KW8A 4K23H 4P59H 2GTWB 4EXPX 2J44A 2A73A 5BUPA 5GHWH 2XWEA 1KFGA 5H4ZA 3CFEB 5LWYH 1YY9D 3AQXA 2NNXA 2ESVE 1Y7VA 2K4WA 3ECQA 1A9EB 3GXFA 4LMQE 3DSNB 1S7WA 2E7HA 4LRIC 4LDEB 3GYRA 3I9GL 4R3SA 5CP3H 2Y1AA 3MA9H 1CPUA 1PIFA 2WWMD 5C0IA 2IQAB 1XR8A 2DMCA 2ZX7A 2CO2A 5IWLC 5GRXG 5JXEC 4O4YH 1V5JA 4U31A 2OZ4A 5JW4Q 3SQBA 4X4ME 1F13A 4LHUB 1E0OB 1E4WH 1NDMB 1F3DJ 3PHQA 5I1KL 2J2ZB 1NCDH 2P80A 4M8VA 4MNGA 2DM2A 1C5BH 1JF6A 3CMOL 3WD5L 4XP6H 3QO1B 1A25A 4YDVB 1OKEA 3RBGA 2I5YH 1MPAH 2RFXB 2W60B 4PQXA 4POYA 2F2HA 3KDMA 1ZANL 2X3AA 1X7QA 4TTDD 2J55A 2HTLD 2EXSA 4BFBD 3C60D 4NAQA 1Q9KB 2X6AA 3WXWL 4M6NH 1BVLB 5GS0D 3BWSA 4DESA 3GDBA 1IQDB 4N0YL 3UC2A 2GY7B 2BNUB 3SJVD 4LNRA 4NUJB 4WI0B 4FHJA 1CFSB 1TFPA 1PY9A 3EGXA 4ZX5A 3BUTA 1Z3GH 3VYNA 4OTXH 2X38A 5LNDA 4G7QB 1G7HA 5AKVA 4GQQA 1SJXA 1P4LB 4FXTA 4KU1A 3MAWA 1UFGA 1IAMA 3VVWA 1UWXK 3A0OA 4MLIA 2A9AA 4HJIA 1ZVYA 3IAPA 5DRZA 2F74A 1H3TA 4P2CG 5AVSB 5E5MB 4WO4A 1MFCH 2H3NA 3NK3A 5EZPA 4JHWL 1KB5H 3FFCB 3MRJA 1OIOA 5I71B 2ZONA 1Y1DA 3B7RL 5F9DC 4IKKA 3MCLH 1SNRA 5E1IA 2FLRT 1P4UA 1NGPL 4WV1A 4HOXA 1NCOA 2A6KA 4BFOA 5BRPA 2ZKHL 3GSXA 2OJZL 1W8NA 4YE0A 1S7UA 3Q7JA 2A9BA 4U6HA 3CSGA 1ZTXH 3QH3B 4D2NA 4FL4C 4JFUA 2DQGL 3PY9A 1KCKA 4JNXA 3LV3B 1XO8A 1E9OB 2NY7L 5DVLA 1DJGA 4PJAB 3LZFH 2RTTA 4OM0H 1MCSA 3ROLB 1EJFA 3AXIA 3CFKA 3FUDA 2ITDA 1F4XH 1OAZL 3SYOA 1XGPA 3CSPA 1BPLB 3OJDA 4AGNA 3GI9L 3RFZA 1PKQB 5HDBB 3H6AA 3VDAA 3LXAA 3VWJC 3ULUC 1RMFH 1XR8B 5JORB 3ZZ1A 4TS6A 1JK8A 2DMBA 5TH2A 3TIDA 1W6LA 1YEHH 3TJHC 2ZOKA 4GQZA 2XKSA 3OF6D 1ACYH 5HVGB 5FO8B 2WVVB 4U1KA 4BDVA 1U42A 3QCVL 3Q8EA 5C09E 3NJIA 3UACA 1JZFA 4H8PA 4C56E 3SDCC 4ZFGL 1Z5LB 4JJ5A 2YAOA 3VQLA 4D9QD 1XT5A 3GJEB 2A74B 3N1PC 5DC9B 3HI1A 1AI1H 1T0PB 5C07E 4D9RE 4F7MB 2J1WA 1FYTB 2YPLB 3PWPE 4KDWA 3RVXD 3DHMA 4PBVC 3GS4A 4EDXB 4AH2B 3WO4C 5E7FA 2YJLA 3JWNG 1A9VA 3E80A 4IKIA 4NKIL 4AIOA 1FFNA 4HK0B 2QQLH 3NCYP 2A83A 1BZEA 3UTZA 1M05B 5L9DL 3TESA 4OFYD 3EOAA 3FUJA 4HIHB 1LO4H 3B43A 3S98A 1NFIA 3BH9A 4HZLA 3U9PL 2W0PA 4FXLA 2H0JA 5FCUH 1CFNB 5EO1B 1X5AA 3F5WB 3A22A 3KXFD 1PG7L 3CV5A 1JNNL 4OT1H 3VO0A 2H3NB 3AG1B 3BKCH 5F7WC 2Z31B 1A14H 1OTTD 4P04A 4QEGA 2Z8RA 1N8ZA 4U1NA 2HRLA 3CHOA 4QGYA 1GYUA 35C8H 2F8XC 1K5NA 2WO3B 1E6OH 3RDTB 4W1TA 2XBTA 2WGXA 1ILSA 1UKQA 2VN6A 2CHWA 3ETBF 4XBEL 3WNIA 3ZUNC 2Z92B 3SDDC 4DP1X 4ECNA 4MDIB 2UY6A 4EI5A 4IMKC 1ZE3C 4YN3A 1DVFD 1OAXL 5DTFB 7PAZA 2Z3FA 4Y1AB 1PLBA 3BDXA 5AL8A 1E9OA 3MCYA 1WG3A 2HLFD 2V37A 4HUXA 4MSWB 3QJRB 3BUDA 3VJ6B 3IK2A 1MW1A 1XF3B 3LIZA 3ALXA 3MA7A 1JCKA 4G9FB 4NQQA 4PJ5A 4OKDA 5CILL 2YAFA 3L1GA 1NIDA 4ZXBA 1H19A 4FL4B 2J73A 1K9TA 1GSKA 2AJXL 3FN3A 3P9MA 3RWEB 4DOHB 5JORA 4R7DA 4KO6A 2J43A 4X99B 2R39A 2ZWSA 3IPBA 3LRLA 3O4LE 4XC3H 2FSEB 4OSUH 4UYPA 5I16B 3JQOB 3TVMB 1EV2E 2NXYB 4DVBA 1A4KA 4NM8H 3LJ3A 4KXCA 3VGAC 3MV01 2AQ2A 1GAFL 2BOCB 1Q72H 5AW8B 3GXUB 4OF6A 4Z77A 4WW1B 1KEML 4FG4A 2V2TA 1OSEA 5AVTB 3UTPE 3KPNA 4HG4K 1MRFL 1JG9A 3OKKB 2I24N 4PCYA 5D8JL 2GC4C 4I3SL 4ES9A 4HX1B 1BMZA 2OK0L 1QFWL 3QNYA 4JHBA 4FD0A 1OAKH 5AZEH 1R0AL 5AG8A 4QRRD 3P3TA 4XPGH 2QFRA 3NYKA 5J1AB 1N67A 5T8IA 2EZ0C 4GIPD 3VTTA 2AEWA 2XYBA 4BSJA 2JJTC 2HG5B 4YDKL 4G1EA 1XSIA 2ITFA 1JZ4A 4XTRD 2EDKA 3C60A 4CC1A 4DQOH 3WV0A 4G83A 3Q43A 4BKLA 1BVKB 3HE6A 4X42A 4JFFB 2C9AA 4X8GA 4YSDA 4EPSA 12E8L 1Y6KR 3GKZA 3V6ZB 1R3JB 5I1CL 4G7RB 5IEHA 5J6GA 2A9ML 5FO9A 4JHZA 1R3IL 3FTSA 4PBDA 1R5IA 3HFFA 2PABA 4GH7B 1E2WA 4YWGH 2QQNL 4QRAA 3RRQA 2X2IA 3W2DH 4K73A 4XVSL 5D4HA 1FYTD 4NZRH 1NCWL 3BSZH 4Z7UA 1UACL 1C16B 1GHFH 2LQRA 1FRGL 4C4KO 4Z7IA 4KKAD 4ZMYA 5C7XL 4XHJC 1IM9B 3FT1A 4ONGL 4X6BB 3SYPA 4I8DA 4MDIA 1Q1JL 3WY4A 4IK6A 4Y16C 3OMZA 32C2A 4PVMA 4C8XA 3U9UA 3ZGIA 2Z31C 4ODBD 3QC6X 3VNZA 5HYQB 3FQNB 4TVSa 4WWKB 2XZCH 3KGTA 4WEEA 3GO1H 4NP4L 4U0RB 4QY8A 1B4LA 3HMXH 2VH5L 4G8EB 4UT7H 1QABA 1NAMH 1QP1A 4HBCH 3TF7C 2ZCKL 4MB5A 1BD2A 3HI6H 3M7FB 4RFOH 3AG3B 3N50A 3RGVD 1QBLH 3H9SE 4YSSA 4Y5XA 5ISZA 1LL1A 3KPMA 3MLRL 1TZHA 2X70B 2FJHA 3EYFB 2J56A 3L7FB 3K72A 3TVMA 1NUDA 3GSUA 3FUKA 2VDOL 4WFGD 1C9SA 5FHBL 3BT0A 1A4JA 3VGGA 1RUQL 2J4WL 5B3JE 4E41D 4OUUA 3H53A 2IMNA 4KKNA 1JMZA 3BKYH 1EGJA 3DYMA 5DS1A 5AAWC 4B9KC 4PJ8C 2VLKD 3QZLA 4MA7H 2R83A 1PG7X 2L7UA 3FK3A 3FOMB 4ENED 1RAMA 4HX1A 3P0GB 5C0DB 5I0XA 3L5JA 4GG8B 1I85A 4K7FA 4NQDE 1WS7A 2B1HL 3HVDA 1KGUA 1NM4A 1RUAH 5BUGA 2ZUQC 5E00B 5EORH 3FN0H 1PZ5B 3W5MA 2VLRE 3NAAH 5SX4I 3V4VH 4DP2X 5J1AA 4HMCA 2K78A 3CVHA 5HHOD 3BHBA 4HIXL 1DBML 2CK0L 3QDGD 4AV5A 5BRZA 5A3IC 1JSYA 4N2AA 5IBTH 4PS3A 5DS8B 1U8KB 4X98B 3ARGB 2R56H 2WINB