2G0KA

Solution structure of neocarzinostatin apo-protein
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
113
structure length
113
Chain Sequence
AAPTATVTPSSGLSDGTVVKVAGAGLQAGTAYDVGQCAWVDTGVLACNPADFSSVTADANGSASTSLTVRRSFEGFLFDGTRWGTVDCTTAACQVGLSDAAGNGPEGVAISFN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Neocarzinostatin
publication title Synthetic Ligands for Apo-Neocarzinostatin
pubmed doi rcsb
source organism Streptomyces carzinostaticus
molecule tags Antibiotic
total genus 12
structure length 113
sequence length 113
ec nomenclature
pdb deposition date 2006-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00960 Neocarzinostat Neocarzinostatin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.230 Mainly Beta Sandwich Immunoglobulin-like Neocarzinostatin-like 2g0kA00
2G0LA 1J48A 1HZKA 1ACXA 1NCOA 2CBMA 1AKPA 1O5PA 2CBTA 2G0KA 1J5IA 1HZLA 2CBOA 1J5HA 4JW3A 1NOAA 2CBQA 2MCMA
chains in the Genus database with same CATH superfamily
1EZSA 1BFVL 2HRLA 5IK3A 2F53B 4DIXA 2YWYA 5DQ9A 1U92A 1NL0H 2GUYA 1ZXQA 3RTQB 4PMFA 3SDCC 1KIUB 3M7OA 4WAFA 3I75A 4PJIA 3QUYD 1PF3A 3I6KB 2F9BT 4HIXH 4NC1E 3IVKB 4KHTL 3NJGA 5L2JA 1X5HA 5I1CH 2BVOB 3QDGE 3LIZL 4GG6B 3F8UB 4FQ1H 2PXYA 1A7OH 4EUPG 3KLSA 2R29H 4NQXB 2NQ3A 2OZ4L 5DHYB 3U9UB 1VKXB 5SX5K 2GHZA 2E59A 3KAAA 3SKNA 2R1XB 2WKOF 1CYXA 2BERA 2C9XA 1P6FA 2OI9C 3ML9A 3Q13A 3NTCH 4MNGA 5FYJD 1GZQB 2ORBH 2B0SL 3WNKA 1I4FB 4XO4A 1QEWA 4FFWC 3A6OA 2XPGB 5JPMA 1FNFA 2FD6L 4FQLL 5I0YA 1AH1A 4R7DB 4CVXB 2C3VA 4FABL 3QE5A 1S7QA 4K3HA 5IHWA 3P69A 3MKGA 3W56A 4LPTA 1DEEA 1JPEA 2R4SH 1S7SA 4WKZA 4APQB 5B1JA 3MXVL 5JMOC 2WW8A 2EILB 2YD2A 5KSUA 4UT9H 1PL3A 4Y7MA 1AGBA 1UUSA 2UV3A 5CP3A 3WDJA 3SBWA 4N2EA 1NFDE 2XKUA 3F3HA 3QCUL 5EHFA 5B1CA 5AB1A 4WK0B 1L7IL 5E2UL 2FBJH 3TEYA 3CAFA 2XA8L 1UOVA 4KUCD 4OCWH 4WWKB 5AW9B 3RURA 1W6LA 4LNRB 3MNVA 2VMDA 4WI6A 4ELKB 3NZSA 5HY9B 3WNNA 2DMHA 5SV4A 3HLAB 2HVJB 2AI0L 2IH1B 3DX2A 4MBRA 1I8MA 4YUEL 2NNAA 1GRWA 4FFYH 3RB7A 2Z64C 2DQ6A 2RQ8A 3HI6H 4L8SA 5DD6B 4EO5A 3GMLB 5C0EA 4P3DA 4I9WE 1IM9B 5E56A 5DSCA 3L5XL 1D9KA 5KJ4A 1OAXL 1QZNA 1EO8L 4XPTH 5F9WC 5INCB 2CHXA 3RDTA 5LJYH 1JZ3A 3DXAD 4WZ9A 1U3NA 3MRJB 1OTTD 4N2HA 4QRBA 5D5MA 2Y7OA 3E8VA 4B3EA 3IS1X 3AADB 3DX4A 3UO1L 1R0AH 4OFDA 1INQA 4PRHB 2FX9H 2ZJSH 2ZOOA 3VD4A 2P49B 4M8QA 3FW6A 3VFRB 4H88H 4PJ8C 4M3KB 4RFEA 4JFHD 4Y19D 5GZOA 1N12A 3QPQD 2WSDA 1VGEH 2XBZA 6TAAA 4OZIF 4XHQA 2GT9A 3QRGH 4U2ZA 1J5IA 4LLDB 5AAWC 2Q87A 3VI3E 2R2EA 4F7PB 2V4LA 3L48A 2FAUA 2VLLB 3NRPA 1N8ZB 1T1ZB 4PTTA 1NGWB 3OPUA 4X98A 5I6LA 4JREC 4MFHA 4UT6H 4NB7A 1CT8B 3JYCA 4X5LA 4GAJL 4OCMC 1DUYA 3KCPA 4BKLB 4NZTH 3C8KA 3KJ4B 4WFFE 5D1ZC 4ZMQA 4GG6F 1SN5A 4NNXA 1V3KA 4Y5XA 3K4DA 3LQZB 5IY5B 3DX9B 1VCAA 4URTB 4L8BA 2P43B 4IDJL 1BOGB 3QZBA 3W39A 1HILA 1OF2A 3UTPD 4Q9RH 4E41A 3MNZA 3W38A 4TTDC 1AANA 1T20B 3VG0L 5FPIA 1I3GL 3CFCH 3LNHA 1FFNA 3LRKA 4YBLC 1L9SA 2VDML 3W9DB 2NR6A 3REVB 3TYFB 4L5FL 2QADB 1LO3L 5F6HI 4B0MM 1WBXA 5J11B 1MAMH 2NW2B 3UBHA 2R69L 2FT8A 1JPTL 1LEGA 5E8EB 4ODTL 3SPCA 4Y89A 3FB6A 2JK5A 3PAZA 4UQEA 1UADC 1EUUA 1E8WA 4M5ZH 1FNAA 4N86A 3UJJL 4AEEA 4PLNC 3QH3A 4PJFA 5TTRA 3ZKMD 1OAKL 2F6AA 3EYFA 3QORB 4F57L 5AAMA 5L7XL 1NFDB 2FYVA 3LSOA 3BJLA 3NA4A 2UVFA 2CK2A 2K3TA 4M4RA 5MHSE 1QKZH 3KPMA 5E1HB 4NQEE 1KXTA 1JGEB 4K23H 3U0PA 3HZVA 3N0AA 3BCDA 4X7TA 2BS9A 3O6FD 5F7DA 2P5WA 1NGZB 5EIIG 2ADYA 2I07B 1BM7A 4XO3A 1XF4A 4YSUA 2E56A 2JB6B 3GM0A 4E9WA 1JP5A 1MCCA 2Q8AL 1DUZA 4Z8FH 3STZA 3C5ZA 4NHUA 3DBXA 1KBGL 2HTLD 3NCCB 5DEGA 3TJHD 4QHLA 1JZ7A 1HN1A 5EC2B 4NQSA 3ULUF 1UM5H 3HJEA 2Z34A 3OG4B 4WW1B 4RGMB 5JIQA 3O8XA 2YAFA 2Y69B 3TPUB 3LZFL 2WBJA 2DI9A 1K2DA 3FTGA 2C3WA 2KI6A 1RZIA 3X1BA 1N3NB 3ATAA 4FNUA 4PVNA 4N25A 3B2MA 3TXAA 4DFHA 2BVPA 3GXUB 1GOHA 4MNHB 1ITBB 1UWXH 4NWTL 4QAMB 1LD9B 4LFHG 2FT7A 4HFUH 5DJ8B 1BXXA 2X4UB 2LAGB 1KB9J 5IW6B 1A4CA 1U95A 1V3JA 3CSBA 1MXDA 2J5LC 4PG2C 2CZNA 4X7CC 2HRPH 1NUFA 1QFUH 2DQHL 4PGBA 4LLVB 1URIA 2Y7MA 2JVUA 4HBQA 3APNA 5LAPA 3VI3B 2EIDA 4ENED 4AW4A 4NEHB 4ZJ9A 4JG5A 3TBVA 3L7EB 1ZEAH 1O9ZA 3UAFA 1F3JB 2L7JA 4MQXD 5DD3H 3MBED 4A6YL 1LO4H 2BNRA 2W60A 3CH1B 5DRZB 3BZEA 3JWNG 4HH9B 4QRUB 2IDTA 5K39B 1Q0XH 1BG1A 1JZJA 1NPNA 1D6EB 4F7CA 4HK0B 2XN2A 2O26U 3CVIL 2Z93B 4KH2A 4LEOB 3G5VA 3MMEB 4HJGA 1A9BA 2EC8A 5FEBA 3EZJB 1VJSA 2YGNA 2VZSA 2JKJA 3QDME 3ARBB 2PO6C 3U7YH 4BDVB 4YIQB 2MQ3A 2YQ3A 3SY0B 1K85A 5HXMA 3MREA 4Y1AE 1KB5A 5C0AA 1CD1A 3K6SB 3CN1A 5HI3D 4UINL 1D5ZA 1DJIA 1X7QA 1DSFL 3AM8C 3KPRD 4J3BA 3ZT6A 5DUJA 3BAXA 1A6ZA 5CEYB 5JW4R 1KJVB 1I9RH 1OAYL 2WVTA 4JVPA 3NPSC 3V6ZB 5I5MA 3VWJB 3H3BC 3NK3A 4EBQL 3K6FA 3DI3B 3VXNA 5LWYH 4BINA 3OVUB 5I5JA 1NFDF 5SWQA 1IO4C 1HHKB 3WNMA 4HS6A 2I60H 4UTCA 3GUFA 4AK1A 2HLFC 1CN4A 5E6IB 5ISZE 3T0BA 3F62A 4KK5C 2IMNA 1ASQA 4BA0A 2V33A 4XCNB 2GJ6A 1G9MH 4PJCE 4DK5A 2Y1AA 2WQVA 4GAFB 2BP8B 4C56D 4ETQB 3I6LD 4LSUH 2AEIT 3UYRH 3KDMA 1FJ1A 4ZOCA 3P3RA 4W9FC 3NSFA 1FGNL 1NUNB 2BP0B 4MXWH 1A3LL 5E1AA 3DUUA 1WFMA 1YUHB 3VQ1C 1Q1JL 5A6LA 1I1FA 3ZKXC 5IHUL 5HGAA 1E4WL 1YEWA 1ZHKA 2G5RA 2QGDA 3VGFA 3CMGA 5IWLC 3OAZK 2UYLB 4GKSA 3RVXC 2NY4D 5ES4B 4JK0D 5KWYC 4H26B 3INUL 4RX4A 4Y4FA 2AVFA 2ED9A 4UM9D 4S1RL 2GIXA 4HZLB 4FG6D 2VLKA 1FVDB 2BOBB 4BIKA 3O4LA 3SPHA 3CXHK 2VSCA 4AQ8A 5LAXA 5I1JL 2DTML 3ULVL 5DJDB 1TTFA 2NY3B 4H8QA 2VWEE 3ZKND 3VI3F 1H3PL 3MKKA 5I6PA 3VD3A 2Y1YA 3RWGB 4DEWA 4ERSH 3BPNC 2K4WA 3EYUL 5JW4N 5IMOB 1OSZA 3SCMD 2IH3B 2VQUA 4UI2A 5J9PA 1KCRH 4FZ8L 5F70A 1T66D 4HQQH 3TT1L 1KYFA 1P9MA 4YJZL 2G75B 1TLMA 5DQ9B 3LS5L 1HWGB 4GBXA 4L4JA 3NDZE 3I75B 3MLUH 1X3DA 2DQUH 1JUFA 1NCNA 3WELA 3ZGIA 1UXMA 4KQ3H 2GTZB 5CIPA 4RCAA 5KS9F 3LIZA 4FD0A 1OALA 3CZGA 4P07A 2EXWD 1IGFH 1MCRA 1YY8A 2PMZA 3QIUD 2BO0A 4MMZC 4O02H 5CP3H 4HSAC 4HXBL 2CCVA 4K55A 3N06B 4OZGF 4MNGB 3QDMB 3V7AG 5B39G 3PV6A 4FL4B 1UJ3A 4HLZH 3BQUD 5HHPA 2A7BA 2VLME 2VXVH 2A0LD 3OGOE 4PG9A 1IFHH 4DEPB 4LL4A 1UKSA 2C3VB 5E0FA 1G5GA 4RAVB 1JGVL 3EF7A 3WNPA 3QEQA 2LQRA 3EJYD 4PJ7E 2ZWKA 4YZFE 2X89D 5C09A 3H54A 1IILE 2CKBH 3UZVB 4OF6A 3CPLB 4J27A 5KVDL 5HYQA 5KVGE 5ACLA 3IU3A 1TCMA 1E6OH 4JFXA 3WNJA 1KF9B 1CB4A 1CYGA 4M1CC 25C8L 2ZCLL 3ISRA 4JO5A 3NJIA 1JZIA 3EYQC 3TVMC 3JWOL 4P2RE 5ISZB 2HRGA 2BXYA 1ZMYA 5D1XE 2P8PB 1XDTT 3UTSD 4XVSH 1H15A 3VXSA 4GW1A 5ITFA 2JI2A 1DVXA 3JV4A 1R5IB 3FBKA 4PJCB 5E08H 1BZ7A 3ABLB 4MVBC 5ADPL 3FDWA 3Q6FB 1XSKA 3EFFB 2ZOLB 3SPGA 2X4TB 3A0OA 2FEDC 3GBNL 4XNAA 5BO0D 2AQ1A 2O72A 5DGQA 3LQAC 3OMZA 5ENWB 4P3DB 4WV1C 5DLLA 2KMWA 4G43A 5C07D 1DVTA 4NJ9H 3GZPA 2A1WL 3ROLA 4B53A 1S6NA 3WXVL 4NCC1 3RTLA 4KI1A 2AABL 1XL4A 3CGTA 4LOFA 4Q6KA 3MV7A 5D5MB 43C9B 3JTBA 1S9VA 3WIHA 1J8KA 3RE0A 3CLFL 1CLCA 1INQB 2CJUH 1KIQA 3BRGC 3VFVB 3QJVB 1AHWA 3MQIA 4LOEA 1EFXB 2N7AA 1YHPA 4IRSB 4MKMA 1A3QA 1AZZC 3IAPA 3FFDA 4G8EB 4GW4A 3N55A 3FQXB 1B6DA 1M2VB 1J05B 3CG8A 4U6HB 3V52H 1GS8A 1S78C 1REIA 4QOKD 1MRCH 3MUZ1 3VFTB 3VI4E 5CGMA 4DTGH 2ILLA 5FK9A 3T09A 4MTMA 4YGVA 5GZND 3PXJA 4XVJH 3E3QE 2GITA 2BIOA 2WXMA 5H94A 1TSRA 1HH9B 1FH2A 4ZYKB 3T0VA 3IFPA 4D0BB 5KSAD 3MRPB 4PREA 2WTPA 4YHML 1GGBH 4G80A 4K8RD 4NNXB 3VM5A 4POYA 1JZ5A 3VMNA 4H5SA 2YXFA 3VVVA 1EZLA 2J4WL 4YDMA 4BUHA 5F9DC 1QPKA 4F37F 4HULB 5DDHB 5I73C 4CU6A 1UWEL 5FYJE 1CICA 3V5KA 3FSAA 2JXMB 5HVHC 2CO4A 5AW8B 1MRDL 4O51A 4YO0B 3IFOB 2ZTBA 3KNBA 5BXFA 1FZKB 2JI3A 2Z35A 4S1SH 1I8KB 3OHXA 2BIIA 2D4DA 1M7DA 5F9JA 1FL3B 1N0XL 1P5UC 4ABWA 4N8CL 1YY9D 5I8KH 2EO1A 1MPAL 4TUJA 5DS1A 2XWJA 4X83A 4LSTH 1M57B 1NGXB 4HBCH 2R69A 3ABMB 4AXWA 4PJ7B 1ZPUA 1KJ3H 5J56B 4DP0X 1GTNA 4CN6A 4EKJA 3HIZA 2UXGA 1HXMB 3L3OB 4OIIH 4PP1D 5DT1L 3ESVF 5EU6A 5E2WH 3MRRB 1GHFH 4IW4C 4O2FA 2EEBA 3MRCB 5HYSB 1ZANH 4P2RB 5MEND 3KPMB 3MN8A 4OGYL 3EF4A 5D1XB 2WK2A 4C57C 1LK3L 5BOPA 5KVEE 1IGTA 3ATBA 4X7TB 1SDDB 5E00A 3U6RA 2J25A 1A4BA 1EDHA 3PHQB 2VDLL 5HI4C 4QI3A 3BDYH 3LPWA 1QX1A 2CDFA 2Z7ZA 2EE3A 2YPKB 3L3JA 4IBSA 4P4KA 3S96A 5KW9L 1PD0A 1LNUB 2J72A 4OJAA 5JIKA 3DURA 2B1HL 5D5MF 1KFAH 1MQ8A 3NG5A 5CWSB 3G6AA 5KTEH 3L3IA 2UUDH 4OLZH 2BWQA 4IS6B 3DXAE 2WBJB 2RFXA 4KO9A 5IB3B 3NVQA 1GIGL 4L29A 4HOXA 2N01B 3J07A 3HG0A 2JFCA 4IRZL 2GK0A 3GI8L 4WDIA 3S36L 3B2UD 4X6CE 3WFEL 3BP7B 2A9AA 2FJGB 3IGAA 3IETA 4HSCX 5D7LD 4NN7C 4JFHE 3P3YA 2QQKH 5GPRA 4GAAA 1VFBB 1OSPL 4X6BA 4GSQA 3V95A 4POZC 3MRBA 2ZYIA 5FWQA 3RQ3A 1BLIA 2WZAA 2YAOA 3HZKA 3P0YH 1G5AA 4GKZB 4KMQA 4PGBB 3WE1A 2OMTB 4LKXB 1M1SA 1JWSA 1CU4L 1MFAH 4JW3A 4XC1H 3BC9A 3GDBA 1QBML 1CR9H 5GGSY 2WNXA 4AENB 2JKRM 3BAEL 5CLZA 4YDLC 4Z7NE 3VI4B 4UDTB 2VITA 5TDOA 1KB5H 2YAMA 2XJKA 5CJBA 1KLFB 3CHSA 4YVUA 4LCWE 4ZFGH 4A04A 1OTSC 4GT7A 2W60B 3U6XA 5IM7A 4JO8A 4WEUD 5CEZE 1YC7A 3BD3A 3Q9QA 3RZCA 1DBKH 5HHOD 4NC0B 1FL5B 3LXBA 3RVVC 3QUYB 1UXWB 3BN9C 1I85A 2VDOL 1BFOA 2WXRA 2GEEA 3UTPE 1QYGH 1A9BB 3E80A 5CSZB 1CE1H 4MDJB 4XGZB 5EZIL 1AQKH 1KCLA 4MA8H 2CCWA 1YAIA 2V9TA 4Q0XL 4UQ2A 1NC2A 4K15A 4K7PY 4RQQB 4KV5E 1YMME 2Q0ZX 2WJ7A 3AQYA 5H8DA 1CD1B 1T2JA 3CFTA 3LPFA 3SKOB 4LSQL 1ZLSH 4GMSH 5I26A 4JFPB 4PY8J 1MLBA 2YPLA 3SKJL 5GJSL 5DR5H 5I1AB 1OPGH 4J4PD 1Q94B 1NFAA 4OUUA 1PTZA 5GJTH 3KHOA 2FJHB 4AQZA 1AAJA 2Z6FA 1U4EA 3BYTA 4JDTL 2Q6WB 2NLJB 4Z7VA 2VN4A 3EDEA 1GZPB 4JCWA 4LCIH 5DJ2B 1IGMH 2ICEA 1XH0A 2EVFA 1W72H 2LABA 3VWKB 1I1YA 2QSCH 4M7ZC 1S5IL 1JDAA 1MHHA 1I1AC 3FOLA 5FO2A 1JZ6A 3WFZA 4I77H 2WXIA 2O30A 1QACA 1UOWA 3BGFC 1F3RB 3SDCD 1WC7B 4WUUD 1RUKL 3K1KC 3GMQA 2EABA 4HIIA 3QG7H 2D7NA 3CDZB 1JRHL 2EDWA 1URLA 4K3EH 1L3WA 2R59A 1VDGA 2ITDB 3AREC 5G55A 4XT1C 1K4DA 4AM0A 1IBHA 2AK1L 1JK9B 1QSED 3UYPB 4I0PA 3RKDD 4CA4A 4U1IB 1G7PA 1N18A 1TZIA 3MRMB 2VDPL 5DQDL 2Q10A 1BVZA 4NHCL 2AK4A 1X5IA 3LNIA 3DXAB 4GUQA 1KY7A 2B16A 4IRJB 1A3RH 1SY6L 4FFWD 3HS8A 4FQIH 4JL2A 4K71B 4QF1B 5CFHA 2BY0A 3VDBA 5I2IB 5LAXB 1DZ0A 2EIZB 1OV8A 3KL5A 4F8PA 2DICA 4X6CB 5IMKA 3V0VB 5CIPH 4KHTH 3UTTE 4F2FA 3FN0L 1OAZH 4KGJA 2XCMC 3FB8B 3F7PC 2O6DA 5IMLB 5CSGA 1XMEB 1EA9C 2DIJA 3BVTA 3JTSB 4HGKC 1NIFA 3V6OC 5LKNA 3QFDA 3IMSA 3TFBA 1HDMA 3VI4F 2ADIB 1DN0B 1OGPA 5KBPA 1FAIL 1OSZB 5I74C 2AZAA 4PJDE 4FNQA 4Z7NB 2JKXA 5EN2A 3QQ3A 5I76B 2WN3A 4H20H 1MZZA 3QIWA 4LCWB 5DVNA 4XN5A 4L9LB 1Z9SA 3EIFA 2XYBA 4LF3B 4Y16A 4CMHB 4WI4A 2KHAA 5CMAB 3ZHDA 2EEDA 4FXKA 3GXNA 2VIRB 2CXKA 4NAQA 1OWRM 1W8NA 2OJ1A 2Z8SA 1MCNA 3DIFB 3WJJA 4IIQA 2HYMA 1J0JA 3CVHH 5DK0B 4PGJA 1KYAA 5B8CC 1WZMA 1IBYA 2WP3T 3S5ZA 1YZZA 1SVZA 1Y1DA 1VPOH 3COOA 1NCHA 3FUJA 3ETSA 3HA0A 4G5ZL 3Q1SH 1VESA 1YMMB 2J1ZA 4L5FE 3KPRE 4HFWA 2DPKA 1AI1H 3JT2A 1GW6A 3FXIC 4ORGB 3QEQB 1HQ4A 2BFVH 2ZP8A 2M2DA 4W6WB 3U4EB 1BDYA 2IDCA 3OZ9H 2EDKA 2UY6A 4PEEA 2F8OA 3NJMA 3GO1H 3IU3B 1AE6H 2C9QA 1F18A 2CLRA 4XN1A 3HZMA 5DD5H 2XN9E 1DVQA 1UG9A 2ZKWA 1U8IA 2ZKHH 2YC1B 3BSZA 4OCNC 4X5WA 3M6DA 3HC4L 2RMNA 1UVQB 4LBAA 4ZO6A 3HE7D 5EWIL 1IAII 5FXCH 1RH8A 3VXSB 4JKKA 5ITFB 3ZHLA 3QUML 1LEKB 3WIHH 4C56E 1P7KA 2NDGA 1CE6A 5TFSH 8FABB 5D1ZD 1NFIA 3WD5H 3W9EB 4RGOH 3K8MA 1UWFA 3CXDH 3IBEA 1AY1L 1N19A 1RLBA 3ILDA 1K8DB 4G7VH 2B1OA 4U33A 4U1GC 5C9KA 3T0EC 5GGSA 1M53A 3SE3C 5DHVA 1ZTXE 3D4YA 3CZEA 4TTDD 5ICYB 3FNKA 3QDAA 1RCYA 1XHHA 4N8VA 4R6UA 3UBXI 4CSZA 2J7LA 4H25B 2G9HB 2R0WH 2PWDA 3FTWA 2VM4A 3QQ4A 4X9HA 1DHKA 1NDTA 3PUCA 4MXQC 3TV3H 3VXMD 1HL5A 4CJ1A 1AQDA 4V2BA 1NLDH 4G7YL 4GQPH 3UC0L 4Y2DB 1U3HA 2CIIB 3T77B 4ZX3A 3UTTB 2EDTA 4ILDA 1G9MC 2NYZA 5A2KH 2IADA 3JV6A 3FQWA 1HOCA 3DO7A 1XH3B 1KB3A 2WXGA 4ZS7H 4MCZB 3TX4A 4HKZA 3C5XA 5JIHA 4NBYB 4Z7NF 4NI6A 3IJEB 1GA2A 4F9LC 5D2NB 2NZ9C 3NACL 1KN4H 4YGVB 2LTQC 4TSAH 4W9CC 2AQQA 2F19L 4TQPA 4M8VA 1WRFA 4IYKA 1ZHBB 4MXVE 4PJDB 4AEFA 5HYJD 1XD0A 3ATEA 1ETJA 2OTPA 2DBLL 3I3BA 2OMWA 3QA3A 2WTRB 2IGTA 3I9GH 4QRRD 5DFTA 5TF0A 2XHNA 4PJGA 5TQ2H 2BNQD 4LSVL 2PCFB 5ID1A 4C4KT 3G9AB 3AMKA 2ZX8A 5EU7C 1YNTA 3B9KA 5I18H 1AMYA 1J0ZA 1XAUA 3JWNC 2JB5H 4ODTH 1HAUA 4NUPA 5KUMA 5IW1A 2I32A 3DUSA 3M8OL 3V6FA 4PYGA 1X7TA 2EDJA 4KVNL 4YDKL 4V33A 4KV5F 3KXFE 4JFEA 5B38A 5KYYB 1CL7L 5E2TL 4G5AA 4FI8A 3MO1B 3RVTC 1KWGA 2F1BA 4LPWA 4NUGH 2VDMB 4P23A 2Z35B 3PGCB 1WVZA 4U31A 4BXSV 1M7DB 5F9JB 4ODXA 4LHQB 2OULB 3LV3B 1Q72H 2FZ3B 2WXPA 4KTDH 4X7FC 5E6UB 4PHZA 2XV6B 3RX9A 3WO3B 4YS4A 1AXTH 4ZFFB 4KAQL 1JF1B 4JHVA 4HGMA 1JRHI 2R2HB 4TSBL 3QI9A 2IGFH 3F5WB 1CDJA 3OJDB 4OCRH 4L4VA 2EH8H 1BLNA 2XN9B 5T1KB 1KN2L 3KLLA 3P3TA 4YHNA 4S11A 2XWTB 5I8CB 4ZMPA 1M71A 2P8LA 1RZ8A 3KWXA 4JPVL 5HJ3A 3VMOA 1DQMH 4YH6A 2ZXCA 3GSWA 3HCVB 4GSXA 4LVEA 4JPIB 4R4FH 3TIEA 1UURA 1J8HB 4WF7A 4C56B 3HN8A 3ERXA 2X2HA 2AFNA 5EORH 2YEVB 3CMOH 3P11L 3WN6A 1D5RA 2CDFB 4U6XA 3G9VA 3HUJE 1L5GB 3RWFA 3AS2A 2RTTA 1EEYA 5GGTL 2D7OA 3QDGA 2OXGB 4IBUA 3DURB 5F7NC 4O58L 3MYJB 1CDYA 3PWVB 2Y2YA 3G6AB 4EXKA 3H3KA 5FO7A 4XODA 5HGGS 4ZTEA 3UTOA 4BK4A 2DJSA 1ZY9A 4L29B 1EHAA 3BD5A 1JV5B 3NABH 4YBHA 5D8JH 2XIBA 2X6UA 3VRJB 3EDJA 3ARFC 1AQHA 2HFGL 1T5KA 4DGWC 1HKFA 1MUJA 4DFIA 3HTLX 3IETB 4AGNA 2DYPD 4PB0H 4QUOA 3QUZC 4P4RB 4A7VA 3AAZA 4ZUWB 4OCXL 3F7RA 2M26A 4LARL 1KYDA 4MWFA 3AXLB 1AHKA 5A1AA 4NPJA 4OD3H 4W4OA 4HUKB 4PJDF 1OZTG 4Q58C 4QOKE 3UG4A 2VXSH 2WINB 4A2LA 5KYNA 4RIRB 4ZMNA 2HLFD 1MEXL 2YFOA 1I7RA 2VITB 2Z8WC 4JG1H 4OGQC 5TDOB 5IV2A 4GQ9L 1WA0X 4KK5D 2XN0A 2AJZB 2HT3C 4MNQD 4N68A 3T2QA 3EHBB 4A6YB 2H3NA 3VXRE 3KH4A 4MJ4A 2L04A 4ZFZB 3CLEL 4ZSOA 3IDXH 4WW2C 4AIZB 3NEOA 4Y5YC 4YC2C 2K78A 4OFKA 1JPST 5AOJA 1QBLL 4F80A 2WN2A 2VKXA 3FQUB 3SHSA 4U1HA 2YD1A 1W0VB 4JY5L 2WQAA 3KXFB 3QUXA 2YAEA 3QQ9C 3RVXD 3OPZH 3TO4C 4B5EA 4PS3A 3BEVB 3BXNA 3BQUB 5E4EB 3VSTA 1MLBB 1BQHB 2FATH 3HFML 4ONGH 2EIMB 3FO0H 1SZNA 2XTJC 5IBUB 3WKML 2H0FA 1EEQA 3K46A 5JXAL 5FHBH 5I15L 5ACZB 1A3LH 1UB5A 2Z31A 3P3UA 4QDGA 3QEHA 1FORH 4K3DH 3Q7JA 2J6EH 4BGLA 3GIVA 3QPKA 2EUZA 4CC4A 3GNML 5DVPA 2WLIA 4PY7A 1VFAA 3RIKA 2X3CA 3WENA 4LKCB 1RJCA 4IJ3C 4MHHG 1MCHA 3D85B 3V4PH 3RRQA 4YPJA 8PAZA 4CC1A 3BPOB 5AKSA 2C4XA 2WC7A 3X1NA 2XWZA 1YDPB 2QPEB 1UOKA 4XNUL 4H1LB 2BSTA 4OU3A 2ALAA 2FSEA 4HIIB 4NIYE 1BVLA 1SEQH 4XAWL 4MZRA 1X5JA 1DVFC 1JGDA 1CXEA 1BIHA 2AJXL 5BZDB 2NY1C 4G7RB 4RA3A 4MAYC 3HUJB 4NM8L 4Z78B 1E9PA 3JTTB 1TJMA 4LSDA 4K9JA 3FFCA 1EFQA 5FA4B 5F7AA 3T1FB 1G7MA 4HCIA 2C3GA 3B3IB 1PX8A 2K6ZA 3TT1H 2PKDA 1NCAH 2AAVA 3MFGB 2CHDA 1IAOB 1SY6A 2DH2A 3A6BL 3EGSA 4L8DA 4APXA 4BSWB 1A66A 2WQUA 2DKSA 2ZSWA 5FKAA 3VA6A 5ADOL 4UMSA 5BVPH 2P1YA 3N9GL 5GRUH 1ES0A 5DRWB 3D0VA 5J13B 1CDGA 2R1WA 4LMQI 3UROR 3WY1A 2B1AH 3AY4A 2PYEA 4L48A 3DV6A 4G11A 4KITB 1JXKA 4PJHE 4AK2A 5DUPH 4KKCC 4LLMA 4A2GA 2VZTA 5H4ZA 2BK8A 4M1CD 2BRRL 1FSKC 1CL7I 4NIKB 4QOKB 5AYTA 2R8SL 3EYQD 3CFJA 4FG0A 4Z7WA 3EFDH 3FU0A 2BSRA 4OAWB 1HINH 3FO2A 2JCCA 2X3BA 1ZLEA 1GPOL 3VXRB 2P5EA 4Q4IA 1PBYA 2V6HA 5KSAB 2W0FA 5FECB 5JIIA 1EERB 5F3HA 2ZOWA 2B8OT 4NAMA 3UEZA 5KVDH 2FEDD 4WWPA 2E7MA 1EPFA 5TF1H 1DVZA 4PVMA 3W37A 2YGQA 3P4MB 3V4VB 3FUHA 2TRYA 1BCIA 2CUMA 2UX6A 1U30A 3BSZH 3ARDA 1KDJA 1H8SA 4L3EE 1KNOA 1MDTA 2P8MA 5EBGA 1KCSH 1WA2X 3TN0B 1HC1A 4KNTA 6PCYA 1GH7A 4JG0L 1M9WA 3D9AH 4QRSB 4BD4A 2ZXBA 1RMFH 3MODH 2DQFA 4TNEA 5T3ZH 1GSKA 1X9RA 3O3AA 4TM9A 3O6MH 2UY6B 12E8H 3ZDXE 3T0DA 2FHFA 1T04B 1TU2A 2MKLC 4Z0XB 1EWHA 5SWZA 3I6GB 1FNEB 5EUKB 3TIDB 1S78D 2VL5A 5DMIL 5D7IA 1IZKA 4WTWA 2GY5A 3MOQA 6PAZA 2VLRD 3QUMA 4Y5VB 5IJCC 1A6VL 3CLFH 2QKIC 1R19A 1RIVL 4PGEB 2BWDA 1KIPA 2DD8L 1BOYA 2E7BA 1I7ZA 3HUJF 3TBCA 4NQCE 4NNYA 3EOTH 1F02I 1KGCD 2K45A 4K94H 3HC3H 5E70A 1X7SA 4Q9BA 1QSEE 3CFQA 1PNDA 1VFUA 4KY1L 3JBG7 1TQVA 2WQSA 4K7PH 2NOYA 3L6FA 2XKSA 4X9IA 5FO9B 4A7QA 4DPCX 3WBDA 1YEKH 3NGBC 4N2OA 1UB6B 3QCVH 4X7SL 4XPAL 3STBA 3O6LH 3S37H 3WUWB 3SZKC 4FXGB 4ODSL 4UU9A 3ULVF 3FRUA 1HCZA 5C0GA 1OKEA 1S7UA 3K72A 3OMNB 3V9FA 3KCWA 1PD1A 4A68A 4LOVA 1UTDA 4KXZI 1FH5H 2KZWA 4BK5A 2V7NA 4KO7A 4TF4A 3SYQA 1JNLH 3FQWB 2JJUA 2G3MA 1HOCB 3DO7B 2GFBA 2Q2LA 3UEQA 1VZGA 3G6DH 4ZW3A 5E23A 1LE9A 2C7UB 1YLBB 4GUOA 4J28A 3BUPA 3QQXA 1N10A 4KTEH 3U30B 4ISVB 3U1SL 1FPTH 1GKEA 2AQ2A 3NH7H 4IHBA 1T7YA 1AXSB 2QJDA 1RFDH 2RQEA 1GOGA 3O3EB 4P46B 4LLUA 2OMWB 3HBGA 4PRDB 4DK3A 1N0XH 4N8CH 2VR4A 1A4JB 5F1IA 5T3XL 4ZNEE 2AXGA 1D6VL 3MA7B 3OTTA 5HI4D 4B5ZA 1CF1A 5C7ZA 2JH2A 3B9KB 1MREH 1IC5L 2VERN 3BESR 4A7SA 3V6FB 2ENPA 4Z95H 2EEXA 1QABA 4Z77A 5H37H 3MLSL 1P1ZA 4NKOB 2XOTA 3DX3A 5D93C 4MBOA 4ANWA 1NPJA 5C2UB 3UMTA 1CGYA 2OW6A 5GRVK 3FZUC 4L3EB 5CCKL 3CE1A 4LPVA 3I84A 1X44A 1CLZL 2P80D 2W65B 1F4WL 4M6ML 1U8NB 3CHRA 3TCXA 1WIOA 4HKBA 1XBDA 4H2CA 4Q89A 3GI9L 2A6KA 4PM1A 1TNMA 3PWJA 2EDOA 1VHPA 4JKMA 3KVPA 2WCGA 3FUIA 3KGTA 1UZ8B 5C0BE 5EOCJ 4RMBA 2HH0L 3DX0A 3M17B 4HEPG 4RGNC 3VUAA 4I18C 2E8ZA 2D2CC 3DHUA 4WY7L 3ZDXB 3EH1A 4POZD 3VH8B 2Y36L 1YYMH 1ZK9A 4LB8A 2N1KA 1OD9A 2ISDA 4TLTA 3GM8A 4TVPE 2ITFA 4NPKA 1M71B 4Y4KC 1RZ8B 4PB9H 3DX7A 4D9LH 4IMLB 4PU2A 1QI5A 3OLDA 3DIVA 4LBEA 4BZ2L 5TJWK 43CAA 5D4QA 3P2TA 3AWFA 3BAJA 1OTSD 3EJJX 5IVXE 5L6YL 1IAKB 3ARQA 2FH8A 5GGQH 5D6DA 3U83A 4NO2A 3RVVD 4P5TA 3WIIL 4P06A 3C5JA 4NQCB 3GBML 3RWFB 1HNFA 3BN9D 4HOWA 4XN7A 4JKWA 3B43A 5GGTA 3JYBA 4JZJA 4QRQB 3RL1A 2MTAA 3C5SA 3GZOA 5DRNB 1ANUA 1E7UA 4AE0A 2A4ZA 5FOBB 3MNWA 3F05A 2PP7A 5C0CE 2W0PA 3DMMA 2XRAL 3O3DA 1LK2A 4KGLA 5EBMA 1U8OA 1O9WA 4IEFA 4XPGL 5GRYA 1FNSH 3EH2A 1GC1H 2ZAIA 4KRPD 3BZFA 3VGDA 3QZWA 1I7TA 4MX7A 3VXME 3OMIB 4GUCA 5K9QG 1CIUA 3CWGA 1GGCL 1JWUA 2HSIA 2M8XA 4PD4K 4KK9C 4OV5B 2OMUA 5C9JA 1CXFA 5DWUL 5D4IA 3HE6A 1N6QL 2HX7A 2Y0SA 4AL8L 1KLGB 4P2OB 1Z32X 1XCQB 1CLYL 3KWWB 1TQBB 3T8XA 2FO8A 3C2AH 2PCYA 3HJ0A 3MRHA 2HTKC 4ZPTA 2AXWA 2ZWLT 3OMAB 1HIML 4YHIB 2PP9A 3UBXB 1MIEL 1SXNA 1MHEA 5JHBA 1IE4A 4NP9A 4DQOH 2FDBP 1I1AD 2H1LM 2H2SC 4QRRE 3O0RL 2YBRB 1ZIAA 2HLAB 2YGPA 4W9HC 4WHYG 3SE6A 1RZQA 2VDOB 3QUHA 4WFED 1HYSC 4OLUH 4HUXA 1G7JA 3ARWA 4L3CB 3CH8A 2DLFL 5I8OL 3MRKA 4YPGA 3OQ3B 3ARED 2C1PA 1ZGLB 3WHE0 4U6VL 5J0BA 5D1QA 3MJ6A 2QVFB 3MUGA 1NPUA 2JIXA 5IMMB 4NCDA 4UILL 4XWOC 1OSYA 5G2NA 2LT9A 4WWNA 1S5IH 2HFFA 1XWVA 3HAEA 4QHNB 4LVHC 4V1DA 4F8NA 4XMUA 1E4JA 1JGUL 1ZVNA 2OMYA 4J3SA 1I8LC 1CPUA 2O5YH 4DW2H 2ED8A 2EE6A 3VXUA 2FUTA 3F84A 1KTLB 3AMLA 2KKQA 5EIVA 2ZX7A 1YN6B 5C0BB 1YMHB 2EVGA 1L0QA 1YEEL 3LOWA 3PL6B 4FKKA 4TOYL 2A38A 3F7YA 2Z4TA 4XXWC 5C6PB 2R9HC 3BEWA 4G83A 3TPKA 2HKHH 3EOBA 2HJKA 2JJWA 1SBSH 1T0NA 2XV3A 3G5YA 3NT0A 4JQVA 4OT1L 1TPXC 2D3LA 2VLJA 3FONA 4PJAA 3LZLA 4A7TA 3QZMA 1INDH 3ZTJH 3HE7B 3P4OB 4MB1A 4Y88A 1LQBC 5I6KA 1JCKA 1MIMH 1IBBA 3L3KA 4JG9A 3X3FH 4EDXA 1S7RB 1S5HA 3AB0B 3LEVL 2MCPL 1YQVL 3VFMB 5HDBE 4QT5B 4LSSH 1TJHH 3RAJL 1Z3GL 2AQNA 1FF5A 5C0JA 3BT2L 3P4NA 4NT6A 1FFPA 1DJZA 1C1EH 1NWOA 1Q90A 2VDPB 4ODVL 3M46A 4JPKH 4WI0A 5C0CB 3TURA 2YZ8A 3K7UA 4K9EH 1TTBA 4JVUA 3ZW3A 1L7TH 3FS9A 3K4ZA 4QJ3B 5CKAA 1AKJD 1Z0MA 1HSAA 3PP3H 4YSCA 4APXB 3ZRSA 1AG0A 3WCYA 4AV5A 4J2XA 2F5BL 3C6LD 3DKHA 3HI1A 5AOMA 1EXHA 4KWUA 1W0YT 3BSGA 3CDCA 2UZIL 1ZK5A 3PRZA 1LGVA 3QJZA 5ELIA 2R1WB 3P1VA 3RNKB 2VYRE 3GMMB 3GTVA 3WE6B 4Z3FA 3MR9A 2NY2C 3DV6B 3LRGA 4TUKH 4LU5L 3T1WA 4BUQA 3H7BB 1HJBC 1AFVH 4LLMB 4K2UH 4UB0L 3TBYA 1BQ5A 1XH2A 2YK1L 4PJBE 4HS3B 4HIHB 4PJ5D 3HS0A 1EMTH 3FF7A 1Q0YH 2IOMA 1TKWA 4P9ML 1U2CA 2Y2WA 5DU7A 1KULA 3IWVA 1E4KC 5DJCA 4M5YH 2X2JA 1DSWA 1OGAE 1NAMA 3FO2B 5I82A 2YUZA 4HG4K 2JCCB 1P2CA 2P5EB 3NCXA 3GPSA 2RALA 4BFRA 4YEEA 3LKOB 1T3FB 4RMQA 1OP5K 4N2KA 1II4E 3HC2A 5J12C 1HSBB 1UA7A 2OSLB 3QW9A 1CFNA 1MXGA 2DOCA 3FFOA 1ZJBA 1LTXA 4ICXA 1FV1B 4OFPA 2X05A 4ALAL 1UWXK 4NJAL 4GAYA 3HG1D 5EEZA 1ZT1B 3HNSL 4QTIH 4YHYB 3MVSA 1RD6A 1CXIA 3T0AA 5E24E 1BF8A 3E9TA 1L6PA 3VW3L 4X4XB 1JFHA 4MXQD 4IGBA 4DPRA 2X70A 3WLBB 5IFJA 1G6VK 1DBJL 1DDHA 3NP4A 3ROOB 5BQ7B 2A9NL 3FTZA 2VXUL 4ANVA 4WGVB 4Y19A 3B7UX 3DYOA 4X8JB 4G6FD 3TO2A 2PWHA 3T4YB 4U1JA 2DIAA 3E8UL 1FVCA 2E7LC 3V2AR 4F7EB 3DV4A 1XF5A 1JHLH 5CUSL 5D7IB 1O6SB 1RUAL 2V3FA 1CFTA 3APCA 4CL7A 4OZ4A 3VJ6A 4MJJA 1IUZA 4MA3A 3UOAB 3IMUA 3MGOA 2XTSA 4OCYH 3RG1C 2E74C 4P3WA 4HX1A 1KT2A 1AZUA 3MOBL 4GP8B 1CGWA 5HDBB 4ZZKA 2BOCB 2NY6B 4PBXA 4Q6IA 3RA7H 2QQNH 1OVZA 3P30L 2G9KA 1B4JL 2YD4A 1TTCA 2F15A 4JB9H 2XVGA 3APDA 1G9NL 4N87A 1ZV9A 1JNHA 3FUDA 4OGZA 4LAQL 5EZLA 2BOLA 4ZUTA 4PRBA 3RVTD 4F58H 5C0GB 1RJYA 3V5DA 4CNIB 3K72B 3OL2A 1CBVL 2C1OB 4EMZA 4PJXA 5IREA 1GY1A 1GGIH 4M29A 2WTOA 1OCCB 2QFRA 1TMQA 3R18A 3MA9H 3LS4L 3U4BL 3R0MA 4TL4A 3HMXA 4FQHB 3IDYB 3ZOAA 1TUPA 2O5ZH 4NUQA 4OQTA 5D4JA 3PDOA 2CHWA 5EOCL 5C08A 3D3VD 4LLYB 4Z7WF 4YDKH 3AZUA 2NYKA 4JO4H 2WXKA 4RBPH 5LB1A 4UAHA 1MCEA 4PJBB 4O9HH 1B88A 2JCCF 3BDXA 1ZVHA 1FN4A 3BCFA 3CSTA 5FUCE 3ZSTA 5LVEA 3UERA 4YDJA 5ETUA 1F4YH 1B2WL 1X5XA 5E5LA 2JELL 4WFGD 5HYSG 4JM2D 4JM4L 3NA9L 4PQXA 4W9ZA 4ZQKA 4BGDA 1OGAB 3DTXB 3RUGA 4OZHA 4A7UA 2CD0A 5FKPA 3O6FA 5LGHH 2IDFA 2V2XB 5LQBL 1UYWH 3JT0A 4NZ8A 3WTTA 2WZPD 5E4AA 5IHZB 4UTAL 4Z77B 1HEHC 1YEGL 2AERT 2QMJA 2I27N 3W0WD 1S2EA 1YYCA 5E99H 5KG9A 2D7TH 2YIHA 3F58H 1U8LA 1ZS8A 2L7UA 2Y07H 1T0MB 5HGHB 1CYWA 1WFIA 2YEZA 2BCKA 3QO1B 4WI2A 5T1LD 1NBVH 3D2TA 5CJOL 2PTTA 4OIAA 3U46B 1RQ5A 1IQWL 5BQDA 4HHWA 2E6QA 2O1AA 3ARFD 2PABA 1X5LA 2DQTL 2AJYL 4IU3A 5ESVA 3U6XS 3K74B 3L2LA 3N1PC 3MNDA 2KDYA 4XVUC 1PU0A 1RUMH 2N0MA 3ARZA 3PIQB 4WEMB 4YHPA 5D9SA 1IE5A 2VDRL 1EEZA 5D7IF 1KBPA 2AITA 1UENA 3RILA 5CN2A 4DOHE 1LP9A 5DMKA 1ONQA 1QUPA 1CVRA 4P5KB 4OJDH 1N7ML 3AU1B 1OM3H 2DYSB 4MDIB 1F4XH 2WMPB 4BZ2A 1MCWM 2VLRE 4OFVA 1MAKA 3GK8H 2HT3D 4GI9A 2WAHA 5D7JC 4WUKL 4MCMA 5HDBF 3GHBH 3ZSSA 1E9QA 3MBEA 2J88L 3N85H 4C47A 3STLA 2WUBH 1G1YA 3I9PA 4TQIA 5JHDD 3L1GA 1KGCE 2DM3A 3GT6A 1PYWB 4JFVA 4JZJB 3RTQC 5SWSD 3L5JA 3ARUA 2CUIA 4NFCA 5KVGH 1GYAA 3QCTL 2HVKB 4WWOA 4BXVA 4NO0D 5IKCB 5BUGA 2G5BA 3X12B 4I3RL 5CP7A 2WYTA 5AW2B 3QQ9D 3UGEA 2ICES 1I7TB 1TZHB 3KPSD 4PRPE 3TCLB 2ID5A 3QHZL 3EO0B 4UT7H 3EH5B 1V7NH 4FADA 3P73A 4Y7OC 5AD0B 5F7FA 1K5WA 1EJOH 4OLWL 2XTJD 4LGRB 1Y6KR 4XN2A 2B39A 3ZZ1A 4Q74A 3S34L 4LPXA 4DKFH 4IIZA 3SBRA 3MLPA 1N64L 1FRGH 4PJBF 4AQ1B 1UD6A 1EEUA 2QPSA 4MSWA 3RFZB 5JTWA 5DC0A 3T8XB 1FUNA 2YKLH 4NSKA 2ZOUA 1L0PA 3H2QA 5MEQA 1KJ2B 1M42A 4KFZC 4MCYB 4MA7H 5KSVA 3SQBA 1JVLA 3ZUCA 2X1WL 4APQC 1RZJH 4YDIH 2LU4A 1PSKH 2EC9U 1A25A 3ZY7A 4C55A 3ARVA 1CWVA 3BISA 1P4UA 1NMAL 4AI7A 1HL8A 4WLCA 4BCZA 5LBGA 4BE5A 5K59E 4BK8A 4I9XA 4MS6A 4WWKC 1XGRB 4NKDB 5M7QA 1DVFD 3MRKB 4YPGB 4L18A 1MI5B 3QJFB 5D71H 2L4OA 2X41A 2NY1D 1PZ5B 1OOAA 4MAYD 3CFMA 1SDYA 3D25B 4OM1L 3NFSL 1FA4A 3VGEA 1ODAA 4EDWL 3EJTA 3MCLL 5K33A 3ILEA 3QIBD 1J5OH 4AT6A 4RZKA 1S7TA 4K4KA 1BW8A 4GOSA 4M1DH 4UM9A 3SE9H 3V9CA 4PSPA 1U8HA 2ZF9A 3LKQA 2GKIA 4YFLF 2WIIA 3TNMA 3C08H 2Y6SC 5CAYB 4QR7A 4AITA 1UM4L 1JERA 4YSQA 2WWKO 3ULUC 4JFZL 3LMJL 5EZJA 1T0OA 2BSED 3ENEA 3BEWB 1NEZA 4IMKC 1JD9A 1OE3A 4L1TA 4DOHB 2HJKB 1F1DA 1QEXA 3HMWL 1U93A 4KKCD 2EKSA 5FYJH 4PHXA 3T2LA 1SOKA 1QI3A 4J3TA 3FQRA 2G0KA 1X5AA 4OI8A 4ELMA 1TZGH 3ZU8A 3O0LA 1H9DA 1A7QL 3QC5X 4GRLB 4LLAA 2ZOTA 1E8XA 4L4TE 3FTUA 4NRXB 5JQHC 3IDIB 4PWJA 2CO1A 1KXQE 3ME0A 1P4LB 4RMWA 2Q7YB 1E3ZA 1QFWI 4DVBB 3IGLA 5E5UB 2I5YH 4H8WL 3KJ4C 2DI8A 2YLHA 4D0DB 4PV9A 3WLWC 2EYTA 5EF1A 4XH2A 3FUEA 1VIWA 2AJ3B 2C9RA 3DTUB 4NC1C 1IGCL 3QIUA 4WI0B 1O6TA 5FUZH 5BJTA 3L9YA 1XIWA 3CZSA 4I5BA 4TVUA 1IGYA 3H42L 2FNWA 3WMSA 1HSAB 4A39A 3QYCA 1NAMH 3OKMA 1GGYA 2G0LA 4G59C 1UFUA 4PRPB 4PSRA 5DZAA 3OKOB 4RRPM 1OE1A 4JMXA 2CBTA 4WTZG 5KVEH 1C08B 1A7NH 1MWOA 3NJXA 3IJSB 4EIBA 3TBTB 1QQDA 2F58L 2WIMA 3IF1A 1NCGA 1V5JA 3MR9B 3VX0A 4JKLA 1NCCL 3MCKA 4DO6A 4FJ6A 2X89A 2D3NA 2X53A 4F5CA 4DNLA 2H0JA 3SBPA 2QADC 3WTUA 3C60B 5I1DB 4U6YA 5J11C 1OARL 4FZEL 3GSOB 4MQTB 1EXUA 3ZL4L 5FFLA 5F7BA 1IU1A 3CZNA 4A2MA 4CW1A 4BUGA 3SGKA 4HJ0C 3TWCH 3KPQA 3UTSA 5AOZA 3VTMA 1O5DT 4XO9A 3UDWC 3F83A 3QORC 4WSKA 4WU7A 1WAAE 3I2CH 3VAEA 2VDQL 2NTFB 1MSPA 3T3ME 3V10A 3NIDB 3MJ9L 4WFEE 1IT9H 1C12A 1GC1C 1NDGA 1VGKB 1JPGA 2UUDK 3OAWA 2DM4A 1DO6A 4WSJA 3CC5B 1HKLL 4DZ8A 2Y06H 1CFNB 3KBFA 5GS1A 1OCWH 3BLKA 1F00I 5IESH 2Q7AA 5AZEH 2R0LH 5HHQB 4GAYB 5IUCA 1V27A 1EZUA 1QLEB 5C07A 4HALA 1KJMB 1SJHB 1RSFA 4MLIA 3HHRB 4PTUB 1A9VA 1TFHA 2AAAA 4JEGB 1RZ7L 4IGBB 4LPYA 2BVEA 3GXFA 1GKOA 1Y7VA 1PDKA 2FLRT 5SX4I 4RLDA 3KLAA 1MFCL 5CEZH 1G0DA 5J06A 4RGMC 3MLXL 4LSRL 2B2XL 1FVEA 2AEQL 2AEPH 3K71B 2V5TA 4LEXL 4G8IA 3TO2B 4YHLH 3U0WH 1EQWA 3RGHA 1NTDA 4PJAF 3V6OE 4TTGA 1QAWA 2WSPA 4JFFD 3MV8D 1FVCB 5HDWA 4N0RA 3D39D 3EFOB 5T33L 4JPQA 1MH5A 1D5IL 3APMA 2V7HB 3WN5A 3TA3A 4HJUA 1YRKA 2X4NB 5TQ0H 3VYOA 1EHXA 3QEGH 3FPYA 4X4ME 1JHKL 4G8AC 1TETH 4DO5A 1SMOA 5GZNA 1G9EA 1WTGT 4N3UA 1G94A 3ARTA 4EI6A 2ADJB 1UCBH 3LNGA 1M56B 3SDXA 1SJEA 4NQVB 3LX9A 4HX1B 1ZT4B 3VU1A 4L4TB 5EU3A 1IBFA 2A6IB 3HMXH 5FYKL 3DYMA 4Z3JA 2F7OA 4OQTH 4X7DC 5KVFL 4JAMA 3WKYA 1LVEA 2AS5M 1E5CA 3LZNA 3EO9H 1PVHA 3QXWA 3ZE1F 3BKCH 3O2VH 2EDYA 3H53A 3NRFA 3OKNA 4OF7A 2EEFA 2OR8A 2BVTA 3OC8A 5ILTL 5JIDA 1VEOA 4G7SB 5T1DL 1R46A 3JZYA 2V2WA 5LNGA 3FZUD 4KRPB 1T22B 1TIUA 1ZA6B 2DV6A 3MXWL 1PZCA 3BIKA 3DC0A 4G1MA 4AH2B 3ARBC 3G08A 3D8MA 3PNWB 3R06A 1T7XA 2EH7H 4FP8L 3PNRB 5E03A 2IFFH 1RU9L 3FO1B 1EAOA 3FT0A 1WFOA 2DWEB 3EBHA 5JO5B 3MV01 3UAEA 3BUYA 1IAIM 3MLSH 4RGND 5M94B 4HV8A 1QP1A 1YN7A 1JNJA 4XXDA 1OPOA 3KBHE 1K8IB 2DQIH 3VWJC 1B0RA 4YDJB 1ILUA 5CINH 5FCUH 4AQAA 1ORSB 2Y22A 3FSVA 4H13C 4R7NA 2YWZA 2D3VA 3NIDF 5HDLA 4FTVD 5MENA 1MZYA 4J5VA 1F8TH 1KEMH 1NBQA 4KVPA 5K59F 3GTTA 5EOQH 4ZXBA 5E6IC 2F7RA 1UD3A 4KOCA 1Y6NR 1HS6A 1EJ6A 3T3MB 2CA3A 3US9A 2YD3A 4U0RB 4B60A 1GCYA 5I1EL 3PQYE 1QSFE 4MYWB 3L5IA 1XV8A 2ZOKA 1XGYL 2OJZL 1BD2D 3SJVD 1BF5A 4KC3B 1PD6A 4OZFA 1MELA 3GMNA 3BWSA 3NCYS 1WFJA 4YR6A 2NZIA 1INEL 2YEZB 3L54A 4ODWA 3N50A 3QFJA 2XZCH 3O9WB 2K3HA 3P9MB 2WV3A 3LKNA 1MWAL 1GY2A 1OWWA 4UQAA 2DDQL 5CZVL 4PD4J 4WJKB 3J8F7 5B1BB 2BY2A 4KK9D 2Y3NA 1UQSB 5D7LA 5D9SB 1T83A 4MD4A 5B21A 4FNLL 3KPNA 2COQA 1LP9B 2KZKA 3AT8A 2WLLA 1TOXA 3HR6A 2IAND 4JR9L 2R0KL 5I66B 2HTKD 3IE4A 5IQNA 2WXNA 1EDQA 3OX8A 1NGQH 1WDAA 1IC0A 1NOAA 4IDLA 2H26B 1OGTA 5CILH 1H0DB 3BMWA 3KYAA 3NQKA 2K1MA 3GJFH 1E9QB 2VDNL 5C8JB 5F44A 3U79A 4EQ3A 5HGBB 5AUMA 3UPCA 4EN3A 5HHOA 2HT4C 2IWEA 1UXSB 2YRZA 1HYSD 1HU8A 3NUKA 4XNQA 5EU7E 4FLRA 3CVBA 4PJEE 4Q9QL 1XCTA 4JRYA 3VXPB 5BMFL 2YA2A 3T65A 3RGBA 3VSVA 1KCUH 4LVNB 1OF0A 1M05B 3X3GL 4PJXF 3VRIB 4LCCA 3LH8A 1F11B 4XNXH 2J6WA 4KXDA 1ETZA 1TENA 4XWOD 5AYQA 2DQJH 1RZGA 4FYSA 1S3KL 3GJEB 1FIEA 4M1GH 5CJXC 3MGAA 4X6DA 3TNNB 1N8OE 2H1PH 4JHAH 3C6LB 1R75A 2F54D 1MLCA 1BQHG 5TD4A 3NZ8A 5AVVB 5IBUG 4E5XA 2DW5A 2P48B 4FL4C 1PIGA 3OF6D 4J4PA 2DLFH 1NCIA 2SEBB 2Y6TE 3D3VE 3PP4L 4JUTA 4MSWB 3FT3B 4DEPC 3E6HB 1SF5A 2DMGA 4J3OF 1JZHA 3LZRA 3PU7A 4A7GF 1OW0C 3WI9A 4P59H 3TEXA 2DQCH 5BO1L 1ZTXH 2MRYA 3WAJA 3FSZA 2GJZB 4OZHF 3Q43A 3TWYA 4NRZA 1BGXH 3U48A 5C7XL 1T89C 5DK3A 2CR6A 4I48B 4DVRH 4OFQA 4KX8A 2P24B 3MFFB 1A7PL 4RZCB 5B7FA 2DQDL 3NESA 4LLQA 2AXJA 3MJ7A 3EH4B 3GD1C 2DL2A 1NC4B 4IKLA 5I8EA 1H8OA 2CLZB 2EJ1A 3QGVA 5K9JH 5IB5A 1IKFH 4H1LG 1NLBL 4WUUA 5KYUA 4TRPH 2IXQB 3SDCA 1VACA 1DFBH 3NSDA 2NW3B 2D7QA 4NQDD 5E2JA 4FQXA 4X9YA 1HQRA 1B6UA 1QSFB 3B2PA 3PQYB 4XNYH 4Q9CA 1E8YA 3W0WE 1T1XA 3RWCA 2XPZA 1ORQA 3OKYA 1JS4A 1M7IB 1UACH 5B3SB 1QRNE 4XAKE 5DYOB 3QHFH 5F21B 5JQ6L 2V0AA 3S5YA 2PP8A 3GSRA 3WL9B 4NKMB 4UTBL 3WSQL 1CGTA 2MPAL 5EA0L 3MLRL 1J1OL 2BH0A 2FR4B 1X6LA 2YFNA 3GINA 3I50L 4PBVC 4TULL 5AVRB 5BZXA 1LP9F 2P52A 1RSYA 5IIEA 4MMYA 1DJXA 2P45B 2CRZA 4BSVA 4LHUB 3X11B 2LVEA 2A99A 2NY2D 3ZK0A 4G6FB 3ZZQA 5MERA 1T6VN 4NPYB 1XR8B 2DEWX 4IRSC 1YAZA 2HVBA 1Q9LB 2E7HA 5D2LA 4WQOA 1IIIA 3PXLA 3RWEA 3E6FA 5EUOE 1LO2L 1PEZA 2VWEC 2YPVH 3QZPA 1WBZA 4O4YH 5K1VA 4ELMB 5I1LA 4GAGL 4HG4J 3LTVA 4FHBD 3HEIB 3TBSA 2ICWJ 4Q14A 2HPOA 3THML 2ZCHL 5DC9B 2SODB 4Z0BL 3S2CA 3ME0B 2H2PD 4GXUN 3EJZC 2MMXA 1V7MH 2KT6A 1F6AA 3VD2A 4JDZB 4LASL 5MP6H 5SWSE 5BV7B 4FLQA 1DANU 2XWEA 2BNUA 4PJEB 1SYVA 2G30A 1ZIBA 1KBVA 1RJZA 4NDMB 3FU8A 3OXRB 4KPHL 3LQAL 1WS7A 3J7HA 4XP1L 5ESAA 1F3DH 3OM3B 1QA9A 3Q6GH 4O2EB 5CNHA 4L23A 2X12A 4ZODA 2EZ0C 3DVNB 2P26A 2JLPA 3L9BA 4MJID 2AV1A 4I2XE 4GXFA 5CF3A 4QEGA 4H1LH 3GBEA 2DQGH 2GSIB 1BQLL 2E9IA 1YNLH 1WSST 1YEFH 1DFXA 3NAAH 3C09B 3BI9X 1B3JA 2CG9X 1L6XA 2NR6C 1I3VA 1JYVA 5EBWA 2IBBA 4PJ8A 2IWFA 2FX7H 4QTHA 5DZLA 2X9XA 5I6XB 4JY6A 1CGUA 4WO4D 4X4YA 2AP2A 2J12B 4M02A 4HPYH 1QR4A 3TBWB 2B9BA 4NZUL 4DGIH 5AKVA 2YXMA 2I69A 4Z7AA 1LDSA 4DKTA 5AAWA 2MNJB 3L3OC 2QPFA 3KPQB 3MACL 5EEYA 4X4KA 1BZDA 5ITBL 1KZYA 3D30A 4JM2B 3VW3H 2ATAA 5AVXB 5ID0A 2F8XC 3REWA 1IBGL 3D18A 3VFNB 2BHYA 3MJ9A 1SYSB 1ZRUA 2FX8H 3T04D 4NKIH 4HS8H 5KYWB 2VM9A 5D1XC 5IQ7H 5D1ZA 2F8VA 1J5CA 2K6YA 3ZRCC 4F2ME 2ARJQ 4RRPG 1FL6B 3HRZB 4XP6L 3WTYA 2VNCA 4H0LC 5HDQH 3W0WB 1E6JL 2VAAB 1CFSB 1XX9C 4RSYA 4XCFL 1G7QB 1ADQL 5IT2H 1QRNB 3U36A 3ZX1A 2J1XA 5CHNB 2VSKB 1KELL 1NCWL 1H6TA 4GRWH 4NENB 4DAGH 5GRJL 1ED3B 2JTDA 3DROB 1JZ4A 2YUWA 5GRVL 3GRWH 4XB8A 4UQDA 1N5AA 3WUWG 3LB6C 4FQCH 4BFJA 2A6JB 2EYSB 4K8RH 2WBJC 1G6RL 1CZ8L 1IJ9A 4G71B 1DLFL 5AW5B 1NCTA 2BC4A 4LCUB 4DSYA 1MCOH 3MJGX 3CFEB 1NL0L 1AP2A 4MB5A 4ELMF 1WWAX 2GJRA 3WN5B 1RHHB 1PJ9A 3TA3B 5DRXB 5B4MC 4W6YB 5DI8B 4HIXL 3F85A 5HYFA 2ZG2A 3OGCA 2Q7NA 5I1CL 2CPCA 1I53A 4FFZA 1AIFA 5EUOB 4EI6B 3EOAA 3KMDA 1XZ0B 4FQ1L 1HH6B 5HTSA 5H2BB 1A7OL 5HYJA 2R29L 2HUEA 3NFNA 5FUOH 1HYRC 3K6DA 1SVCP 2A77H 2WO2B 4YN3A 3ZTDC 2NUPA 4PJEF 3LN9A 3H55A 4OVUA 2BNQA 3NTCL 5JNYA 2ORBL 3E3QC 3ILPB 4K7FB 3FU7A 5TDPA 5F0MB 3ZMRA 4XC3H 5SWSB 2PPCA 4XPBL 3OKNB 3QUYC 2J2ZA 1D7DA 4TLKA 1KZQA 3PWUA 2R23A 2ZAGA 4XNMA 1XCXA 3MRGB 1TJXA 4NO0B 3ARPA 2PYFB 5FWRA 2JELH 3I9IA 2R2CA 4J6RH 4U1NA 3WS3B 3PWNA 2HN7A 3FT2A 1VERA 1RY7B 2R4SL 1T7ZA 1ASOA 5TE6L 2A6DA 1S7XB 4UT9L 1JMXA 4PI2A 1A1NB 4FA7B 4HAKA 1J0HA 3DSFH 3NFPB 5DEZA 4X0NA 1NGYB 1A6PA 2BCMA 3K0WA 2FBJL 2K7QA 5C6WH 1NANI 1GOFA 3R4RA 2ATKA 4OCWL 1YN7B 1ZLDA 4QMEA 2ZWZA 3MTRA 2TSBA 3VH8G 1H3XA 1OP3H 1R3JB 2XQBH 5IOPB 4J7RA 2FL5B 4XMLH 3SQOH 4PVBA 5HHXH 3HR5A 1G1KA 1H9VA 3QWOB 4FFYL 2KLRA 4AJ0A 4F33B 4ZXBB 2H32B 3ASOB 3QPXH 3HI6L 5KBMA 1IEBB 4O5LH 5D7JD 4YLBA 4P2QD 3WIFB 1JGLH 3VWKC 3OV6A 3SGJC 1HT6A 1BREA 4XPTL 3QK0A 1H8NA 2EICA 5HGDB 1XGQB 3GSNB 3RTQD 4H40A 4IHOB 4LP5A 5T3ZD 4YSTA 1WHOA 3MBWB 4ZD3H 4QRPE 2ZAHA 1R0AL 4S0SD 2FX9L 2ZJSL 4X5XA 5FO8B 2Z4QB 3MJWA 2QTVA 2UZXA 4H88L 5GHWH 3SE8H 3II1A 5T5FL 2PO6A 1VADA 3EGDA 4GUPB 1T0PB 3W11C 2GTQA 2HAZA 2E8YA 3L7FB 3L81A 2LAAA 3VGGA 1VGEL 2VC2B 3JSSA 5GGRB 3QRGL 1MNUH 3AC0A 3AM8A 1AYOA 4EJ1C 2DYPA 2GHWB 5K9KA 1RK1B 2VDRB 3KYOA 1QBAA 2XZQH 4R0LA 4IRJC 5AEAA 2NXZB 1UT1A 4K71C 4PRIE 4YSAA 2NPLX 4RFNB 3QQNA 1UH2A 3DOSB 3MV8E 4UT6L 1DJHA 3SB3A 3D39E 3BRFA 3RGVB 1AR1D 1BV8A 15C8H 1L0XA 4NZTL 4BQ6A 3UBXG 4KXBA 1OGTB 3MLWH 2OSXA 3S7GA 4APQD 5KAQG 3MUY1 4H0IA 1NCJA 2YMXH 3C12A 1SLUA 2DKMA 1NSNH 4MNQA 5FA3B 5FOJA 3VXTA 4Q9RL 3NIFE 4NO5B 2V5YA 1TZOA 3S34H 1BZ9A 3GSVA 1WD8A 1H6UA 3MAWA 1CTMA 2OQJA 3K4AA 4KMLB 1ZWIA 2VMEA 4WWKD 5ALBL 1XCTB 4JRYB 4J8RA 3CFCL 2PNDA 1ND0B 3RKPA 1CGSH 4L9LC 3IDNA 2VO8A 3CU1A 4CMHC 5IB2A 3O2WH 2Y5TB 1A3ZA 2IDQA 4KI5E 4LCCB 1IEAB 2D9CA 1J5HA 1N59B 1RZGB 5IWLA 4AVKA 4KNQA 4CAGA 1MAML 3PGDB 3RHWK 2BHZA 1MLCB 4QXTB 2EDQA 3D12B 1IM9D 2IC2A 3LKPA 1UD2A 3NZ8B 1S8DB 1K72A 4M5ZL 2DM7A 3PF2A 5DTFA 4UOW1 4ONHB 5AVWB 2F74A 3S4SA 5C70A 1ZA3A 3Q05A 3ULUD 5TE4H 1QKZL 1ZJAA 4JCMA 3X14A 4K23L 3T4AA 4PRHD 1AGCA 3CUPA 4BFIB 3ALPA 2VE6A 5F0LB 2ZKMX 2F7QA 4DESA 2YAPA 3GTNA 2QQQA 1JK8A 5I16A 4RMVA 2VRQA 5T1MB 3VE0A 4YEFA 2CHZA 4N2CA 3BP4A 2DKUA 3OR6A 2RHEA 3MJ7B 4ZUVB 3ARGA 4P05A 5BZWA 5TGBA 2YBGA 3N40P 5D7KD 2AKRB 5JOPD 3VYNA 1EO5A 3BHBA 4ODHH 1UM4H 5JW5B 2VW6A 3C8HA 4H8PA 3MRIB 2AQPA 4FQXB 1UM5L 1Y18B 3OSVA 4JN1H 4N0CC 4R96A 3QAZB 1JG9A 3RIAF 1BD2E 5C0FA 2XWBB 1CDHA 5CEXA 4DZBA 5EC1A 2DQEH 4AV0A 4AE1A 1DE4A 3HB3B 3IWUA 1TVHA 3H9SE 1JFQH 4LESA 2CIKA 3GSRB 3WLWD 2OL3B 4MMZA 4X6FB 1IL1A 4QRPB 4UTBA 4BQBA 4HKXA 3T8MA 3RPIA 1KTDB 4HFUL 1AD9A 2WNGA 5I0WA 5SV3A 1I9IH 1JVKA 2J57A 3TP4A 4B0MB 3VFPB 4YSOA 2HRPL 4A2HA 5D6CA 1QFUL 4OKDA 3TTYA 4PW4A 2VZUA 3DETC 1SEBB 3GLZA 2X6AA 2H41A 2Q8BH 4L2LA 3PHOA 1AOHA 2AMGA 2F8IA 2LE9A 1OHQA 1EIBA 2APBA 3DYPA 3GGWA 3A4EA 1ZEAL 2ZSVB 4PRIB 3MV8B 1JPSL 3NCFB 5DD3L 3QJSB 4Y2DC 3D39B 2QADD 1LO4L 1JWMA 4QHMA 1J9SA 2BS71 3DHJA 2E5EA 3EJRA 1Q0XL 1E27A 5GGVY 2R56H 3ZYZA 2EE0A 2AV7A 3GMRB 1GAFH 2IEPA 4D94A 2WSKA 3CD4A 4HUUA 5GSVB 3TVMA 5CBAA 4NBXB 1JTTA 4JS7A 4JCLA 4Q4EA 4TSCH 1YEDB 2YO3A 4W1TA 5D2NC 4PWGA 1JVOA 2CDEB 3QORD 3FCTA 3OAUH 4NYLA 3DDGA 2VZ3A 5KVFE 4ENEC 3NIFB 3L3GA 2VDKH 3V0GA 3U7YL 2LW3A 3K6IA 1SYVB 2CHNA 4AKQA 2B77A 3NJLA 4AG4H 3BVUA 3HNVH 1BVNP 1TEYA 2XXCB 3MRDA 4X6DF 3QO0A 1WH0A 3LRMA 2GJPA 3OB8A 1KPVA 4WV1A 3FQNB 1I9RL 5LBVA 2XG4A 3IDJA 5J89A 4J3XA 1P7BA 4KX7A 5I28A 5IJKA 5H35B 3WKNA 5ACMA 2AV1B 4J1UB 5LWYL 1ZE3H 1R3IH 4PJ9A 3FUKA 4KJWC 5DJZA 2I60L 4I9WD 5CJ8A 2ZUYA 1YEHH 4Z7UA 4N2FA 1A02N 4PV8A 5TE7H 5HI3C 4JHBA 5BW7C 5FX3A 3MV9E 4MRCA 2G2NA 2R51A 4L9DA 1R34A 1G9ML 1RPUA 1BEYH 4XB7A 3CZFB 1BVKB 4HUWB 2BSSB 1CFQA 2VCOA 1IEHA 3FOMB 3N5AA 4LSUL 3FQ4A 3UYRL 1AGFB 2F2HA 3F12A 4JDEA 4UQCA 4UNIA 3A67H 1DQDH 4MXWL 3NJJA 4ZO9A 3BSHA 4D3CH 5GSRA 3IT8D 2J8UA 5IEKA 3D18B 3SYCA 3CLWA 1PZ3A 3VD0A 4OD2B 2AEQH 3HG5A 1VB9A 4NQDE 4UANA 4N1CA 5C0RL 2CGZA 5CLYA 1MNNA 4B50A 4JY4A 1BD2B 4BHUI 1T1YB 3QAQA 3VCLA 2NY5H 1A4KA 1ADQA 5DVOA 1E5AA 1NKGA 2QPDB 3BVDB 3H9SB 1ZHLA 1BVNT 2NSQA 4IQHA 5L4JA 1NBZA 1NINA 4Y2LA 5CBEB 4QCIB 4FFZH 3RU8H 1N5AB 5F1OB 3FSWA 1EHNA 3ILQC 4ERSL 4FC3E 5GRXG 3ARBD 4L0PB 1MVYA 2GI0A 1P5UA 1WCBA 2VABA 4JANA 3TJPA 4BH7A 2YN5A 2MCG1 1KCRL 5D2LF 2OS7A 2FWLB 4HQQL 7PAZA 3H8NA 5I17A 1WEJL 4EI0A 4XOAA 2ENQA 1K4CA 3L9RA 2AC0A 3MLUL 1FO0A 2DQUL 3QNYB 2UY7B 3VWJD 4KQ3L 2MOQA 4Y1TA 1FYTB 4WKXA 2OYMA 5AW0B 1FZJA 5CM1A 3EOAB 3TZVB 3UL4A 4HUVB 2APFA 1GYVA 3ZQWA 3H2WA 3KD4A 1IGFL 4LO9A 4FP8H 4O02L 5E6ID 2HLEB 4P57A 4AMKH 2VQTA 1HE7A 2V3DA 4NI3A 2ZE0A 4Z5RA 3DGGB 1T66C 5I6NA 3EHBC 2PR4H 4MD5A 1U58A 4UIMA 1UEMA 4KI5F 4JDVB 1U8MB 1U33A 1QO3B 2J2ZB 3VFUB 1HHHA 2VXVL 1Z9NA 2XSKA 3P77B 4KDWA 3SKUD 2GEQA 3ESMA 1IFHL 4EIGB 5F7MC 2DM2A 1U8JB 3JUZA 3O45B 5ABAA 3FULA 4HIEA 3HS9A 3QDJD 4ZOBA 1Q9OA 1L9RA 3QJXA 2JKIS 3PWNB 3VFSA 4AGQA 4LAJH 1HHGA 1NBYA 2DMKA 3FO9B 1JOIA 2CKBL 2EXWC 4MJIE 2P80A 5IFAH 2F1EA 1CK0H 4QYOA 1E6OL 1MVUB 3KM1A 4UT9A 3BO8B 1I1CA 1PW3A 3DSNB 4G6JH 1XGUA 3L13A 2ICWI 1G7LB 2QGBA 4LGSB 5E4EC 3BQUC 3OXSA 4ZW8A 3CDGA 1CXKA 3OKLA 3QBTB 2A0LC 4F7MB 2UZYB 3BFOA 3S5LA 4XVSL 3B8YA 3HNTH 5EIQA 3MV9B 4ZI8A 4DUVA 4NO3A 4RNRB 2Z1PA 1DTUA 3EJYC 5T5NG 5E08L 1DLHA 3GKZA 2V37A 1NH6A 3LQMA 2ZWYA 4GEJA 1UKQA 3U2JA 2NY3D 4QTFA 2DWTA 2OAAA 1S9WA 4HGWA 3WGVB 1W0WB 3PJSA 4TVSa 1RULH 2OMVB 3KYNA 3LYRA 4NWUH 4WNQA 1HEJC 4YSSA 1R5WA 2Y7QB 4M6NH 1HEZB 1A64A 3VA2C 1F56A 3D7PA 4I4WB 2EUWA 4NJ9L 4H8VA 5JHMA 2VXQA 3JV0A 3BPOC 5LN4A 5JA9A 2L3BA 3PP3K 3O3BB 3Q2VA 1SPDA 1KOAA 1Y6MR 5IF0B 4U1LB 4F1SA 5I75B 5INDB 4LSPH 1E90A 2Z7WA 5KSBA 2CJUL 4YQXH 2KZBA 3SOBH 4OF0A 2IPTH 5T5FA 3CX2A 4EUPA 1IMHC 4NXKA 1N0LA 1MWAB 5KN5B 1NCOA 2DBJA 4KRLB 4UQIM 3WKQA 2W9EH 1L9OA 3FF8A 3V52L 2DYRB 4UV7H 2VTFA 2NX5E 1T5XA 3DNKA 3QDMD 4QXVA 2W07A 5ANMB 1CDBA 1MRCL 1R3LB 3KYOB 4R0LB 3F01A 2VJ0A 4DTGL 3RVUC 3NBNA 1HXYB 5BMFH 4BHUA 4XVJL 2O6FA 9CGTA 4UT6A 4FQQB 2EDMA 1R5VA 2X4QA 4M5TA 3MHZA 5A2FA 3K6NA 4WCYH 5J13C 3ULVC 1A7RH 5AW4B 5JORA 3WYRA 1GGBL 2WZ5A 3U0TB 1Q38A 4JJ5B 5DJAA 5CU9A 3RI5K 3FCGA 4R4BA 5TH2A 1Y0LA 5JHLL 2Q5BA 3VX1A 3FMGL 2VDNB 1WPCA 3JWDH 1I1AA 5IG7B 1QVOA 3ZT7A 2H1XA 1ZWIB 4J8RB 4G8GA 2Z92A 3MU3A 3IDNB 3CN4A 3HVNA 3ETBJ 2DRUA 4S1SL 5KSAC 3GSQA 3IK2A 4K8RC 2VH5H 1CQYA 4KROD 1PLGL 4JZNB 4QRTB 1ACYH 4F7TA 5IB4B 2NDFA 3D2UB 3T6WA 3GPEA 4LSTL 3IDGA 4O2CA 1LXMA 4HBCL 3QULB 4F7KA 2E6PA 5A2AA 1U8QA 1KJ3L 1BJ1H 3BVNB 4EIZC 3S9DB 4XZUB 4OIIL 3LKPB 2BZCA 4D0CA 3WHXA 1D9KD 5E2WL 5EU5A 2HKFH 4F37K 1GJUA 3TN0C 1GHFL 2HRHA 2A83A 1U6AH 4WHTA 3S4SB 2FECL 3RNQB 3AY2A 3IMTA 1TEGA 3IXAB 4D8PA 1ZANL 1H5BB 2B59B 3PWPA 2DWDA 4QNPF 3X2QB 1XBRA 4H8HA 4FF9A 2JLLA 3EO1A 3T4AB 4ZUSA 2EDNA 1AGCB 4R3SA 4PRAB 5ERWA 4KFMA 5JQ6H 4A1RA 3V6OA 4WO4B 3QUKA 4DN4H 3DHPA 1EFXD 1JK8B 4A38A 1T4KB 5I16B 2GIYA 3AU0A 3BDYL 3SODB 1F42A 3VE0B 2Z7UA 3BP4B 3IKCB 2Y4SA 2OX5B 4PP1C 3ARGB 1Z0NA 4PBWD 4X2UA 3LRSA 3UAAA 1U8CA 5EZPA 2DJ4A 2O5NA 4ODUA 4P2QE 2DL9A 3B9EA 3O2DA 5CXPA 4AYID 1KFAL 1CG9B 3UBGA 3ZR6A 4JFDE 4OB5H 3CFKA 4Y5VC 5KTEL 8CGTA 4OLZL 1IM3B 5CEXB 4OKVA 4X0KA 1BHGA 2AZUA 3SDAA 4DP7X 2FQDA 2CIKB 2GVYA 5DO8A 5GS0C 3IN2A 3GMPA 1X9QA 2J1KA 1BJMA 3B5HA 1KJ2H 3FYEB 4R90H 4ZO8A 1E28A 3DVGB 4JJOA 3UPAA 1QTYT 3MJ8A 4UNUA 5B8CA 2QQKL 1FGVH 1NJ9A 5BS0A 1AKJA 2EZ0D 1Z5LA 1E9OB 5JLZA 1S7VB 4KXZH 2UZPA 4YL4A 4C83A 1PKQA 1SHWA 2WQ8A 3DRQA 4KO5A 1PZDA 1MFAL 5KYXA 4XC1L 1YCSA 1CR9L 3D34A 4XP9H 2NX5B 4FXGC 5GIRA 1DSYA 1IFRA 2J5WA 1KB5L 2NR6D 4V11A 1RK0A 2VLMD 3NCWA 1UFGA 4IKNA 4ZFGL 2ZXEB 3CFBB 1QD0A 1ZHNB 3L17A 3LQAH 4TUUA 4XCCH 1DBKL 1LM8V 2VOTA 4PJ5A 2DB8A 2XX0A 4HUUB 1OAJA 2QV4A 3AQZA 3KW7A 1CDCA 3ZE2F 4N5UA 1K5NB 1QYGL 1F6LL 5E8DH 5DHDA 4LIQE 1CE1L 4ES8A 2CNZA 4NYLB 2BMKA 3U30C 5I1GH 1CD9B 2OMXA 4MA8L 5F88A 4FLOA 4JLRB 3G5ZB 1U3ZA 4P46C 4QY8B 5D1XD 1MFEH 4OCLC 3DX1A 1ZLSL 2EKJA 3FT4A 4GMSL 4QKXB 4FMVA 4HHAA 4IKKA 5EIIA 4PW3A 5D7EA 5D7SL 1K9TA 1RI8A 2ADGB 3PFQA 5DK2A 2X2UA 5CCHE 3B9KC 4WV1B 5DR5L 5IQ9A 4XPFH 3CZLA 3T0EA 1OPGL 2WCPA 2KQNA 3IDJB 3SE3A 2RCSH 1OLLA 2ITCA 3HG1A 1R3KB 4HWBH 5GJTL 2X4PA 2FYYB 2V2TA 4P0DA 1KLUA 4PJ9B 2BHFA 1SRDA 1ZAGA 4HIJB 4G7QB 3KPPA 2IIJA 3Q8CA 1MCLA 4NGHH 3LB6D 1MCSA 4HJJH 1E40A 4LCIL 3L4WA 3O8XD 4WK4B 1IGML 2WBJD 1W72L 3WJMA 2QSCL 1JBJA 3ULUE 2OK0H 2MIZA 3OKEA 3B9DA 4JL1A 4I77L 32C2A 5FDWB 2ZIDA 2IQ9H 4I89A 2XG5A 1FZOA 3QG7L 2GY7B 4EI5B 4F9LA 4OD1H 4AYFA 4NOFA 1FFTB 1WCQA 4DGUA 1XF2B 1X4ZA 5J6HB 3M07A 4RMUA 3ARXA 1ZVSA 2J3SA 1VRSA 1X9LA 4M43H 5GISH 1KBKA 2R2BA 2WXHA 4QHPA 5DQJB 4BKTC 3C2SA 5E94A 4I13B 2D3JA 1SN0A 1NQBA 3IU4H 3UZQA 4EE2A 4FHJA 4JFDB 4NKQB 3W82A 2FEEI 5TPWH 4A66A 4P5MA 3VFOA 1GVIA 4ZO7A 1J1XL 3IXTB 3FCSB 5LGJA 1A3RL 4FQIL 5TDNA 2V17H 1FO0H 2CRMA 1LYQA 1LEIB 3D09A 3DRTA 4MB3A 4N6RA 5AVUB 2Z91A 5FV1L 1RKRA 4ZMOA 4MB4A 1OAZL 4AM0Q 5F6IB 1E30A 1AZNA 3ZHNA 3SE4C 4N0UE 4ZTOH 2B4CH 5F7EH 3L4TA 2P28B 1FFOA 3H4HA 3RKDC 3TBBA 5CD3A 1GCFA 1E4XH 1AD0A 1G6RB 3UAJC 3L4VA 2XWXA 1MCPH 5C0AD 1XL6A 4MMXB 4FMKA 3D33A 3E2HB 4XPBH 2BVQB 4H20L 2D03H 3HHMA 1I75A 1K4CB 3PPSA 1CLVA 4GW5B 4XI5C 4KZ0A 1NMBH 2FIKA 1RJLB 1AR1B 1QLEH 5HP5A 5HHME 4QXUH 2ZNXA 5CZXC 1URZA 1XF3B 3RWDB 1S46A 1IQDA 1KIRB 3HC0A 3DX8B 4P2OC 1ET7A 3U2SB 1TQBC 4RETB 4Y2OA 5A16A 5TE6H 4R26H 3T2NH 4RAHA 1YJDH 4P57B 4O02A 3T5WA 4G6MH 2AXHA 4OF5A 3D0AA 2JMRA 5PAZA 3T9WA 3CVHL 5CR8A 3VWKD 1BIIA 4TLSA 4W9GC 2GJ6D 4QXGH 1VPOL 2FECI 1I3UA 1LO0H 1BPLB 3Q1SL 1FWXA 4WGKA 3AJ7A 3RDJA 3ZKSD 5KBDA 3BN3B 4JBSA 5AVYB 3LRHA 4YXKH 1YA5A 2XQYG 4U1KA 1AI1L 5K1NA 3AWGA 4G9FA 3BKJH 3QG6A 2BFVL 3UTQB 5JW3H 3OZ9L 4P04A 2CKBA 3PAVA 3GO1L 1R24A 4FKHA 4NQUA 4QYOB 1AE6L 3O41B 5T1LA 3W11D 2XBDA 1E2ZA 5JDSA 3IRPX 3FN9A 5DD5L 3QDHA 4DKAA 3ARFA 4RX4D 2VXQH 3GBLA 3MI6A 2ZKHL 5L2KE 3D87B 3TTSA 4KRMB 3QJUB 3N91A 4G42B 2NQCA 3QUZA 4JFOA 4AQOA 4B9FA 2B14A 1MHCB 2X4OA 3O4LD 4IRJD 1DJGA 1RV6X 3WIHL 3E38A 5F3BB 5GGVH 4BE6A 1C5CH 3B56A 4QIRA 1DLHB 2CDGB 2J8UF 4ZPVA 2MCAA 5TFSL 1WYJA 5T5FH 3WD5L 4EUPH 1IJNA 3PL6C 4RGOL 3QRLA 4N20A 4YXHH 3ZPDA 3CXDL 1J86A 1LWRA 1T2QL 4WNQB 4DP2X 2PW2B 3G6JA 5K9OA 1WE5A 4G7VL 1J88A 1GMEA 2YD5A 3DPBB 1O7DC 2LLGA 2NQDA 1Q9WB 4EIUA 2I9TB 1CQKA 3HE7C 1B0WA 2F61A 1SLWA 2WBXA 1HZLA 1BQUA 3IMRA 4WW2A 4GSRA 4NZRH 5FYLE 5JHDA 1ZE3C 5HDOA 3P40A 1A6TB 3KGSA 2ODHA 2R0WL 4LCWD 1RHFA 4Y5YA 3TV3L 2ZX9A 3M1BA 2OPCA 3AB0C 3IGKA 5CEZD 5I5IA 3RWIA 1LE5A 2NNCA 4WWID 4BQ8A 1NLDL 5JXEC 4HEME 1HNYA 4GXUM 4HJTA 1JZ8A 1QLRB 3OKDB 2XWCA 2XZAH 3KPSA 3TO4A 1S9YA 3KLHC 3T3PB 5KS9E 4IBWA 3N04A 4N0UB 4GKNB 4WJ5B 4ZS7L 3QXDA 1AO7B 2GBUA 2QR0B 2YRBA 5FB8A 5B39A 5GGUB 1AHMA 2CO6B 3QWRD 5ALBH 5FV2A 3WV0A 2IMMA 1KN4L 3CSYB 4OZGE 4Q97A 4TSAL 1XGTB 1YMMD 2BM3A 2EQDA 3LKRA 3Q5YA 4HPOL 3K5SA 2OSYA 5DEJA 3TJEH 1G7HB 3I9GL 5DS8A 3QEQD 3AY4C 1FG2B 4L37A 1O0VA 3FTYA 2WUCL 3SGEI 5C09D 5TQ2L 3INOA 2YN3A 5HHMB 1D7BA 1CMOA 3T8VA 5JHLA 1OB0A 5I18L 2NY5C 2JB5L 2QHRH 4Y4HA 3UABA 1MCQA 5EO1B 4MD0A 1X5YA 1AGDA 4HKJB 3S0PA 4JRLA 3BGFB 2QVMA 2X4RA 4KKRA 2VN6A 4G8GB 2P47B 5E8OB 1A1MB 3VXSD 4Q2ZA 3QXAB 2AJSH 3K0YA 4N0CD 4NUGL 2PW1A 1DVFA 5FF6A 3QEUB 3GSQB 5CN1A 2EIJB 1K6QL 2CRIA 2NUTB 3BPCB 4MAYA 5KOMC 3W3BA 3NSJA 4N5ED 4MQ7A 4QO1B 5C0ND 4KTDL 1Q72L 3QDJE 4K3GA 3X17A 2B20A 1AXTL 2C9AA 4GG8A 5AOLA 4BH8B 4I85A 5KJRH 5B22A 1ZSDB 1HZHH 4G3YH 1QHQA 3DPDA 4IKJA 1LDPH 1QPPA 4LOUC 2JKSA 4XPHH 3CHOA 3PGFH 4N0YH 2IGFL 5BOZG 1TZ8A 3I02A 3VFWA 4OCRL 2XLLA 2EH8L 3O2DH 3ZYJA 1YSOA 3G04A 1ROCA 4YHYC 2QVTA 3D1MC 3LN5A 5DJXA 3DETD 1OP5H 5L2KB 1QLFB 4CN1A 2NXYB 4D2NA 2BJMH 4ZUSB 1DQML 5ERWB 3QQDB 4LHUG 4AQEA 4F8OA 3CFDA 4M56A 4R4FL 4KJYA 1QNIA 3S35H 4AMXA 3HPJA 4K5MA 4Y2DD 3SPVA 4XR8C 2ZUQB 4PP2A 5EORL 3UTTD 1KXVA 4LCYA 1PKOA 4UDUB 3CMOL 1ZGLP 4GQZA 3V0WH 1MDAA 2GQHA 2X1PA 3FRPB 5IR1B 3FU9A 5C0DA 2H9GB 3VXOA 3OAYH 5DUBA 4IU2A 2ICWB 1E43A 1X5ZA 3VQLA 4XVTH 3P9LA 3TF7C 4L1DA 2XV0A 2EDBA 1IVLA 3Q8BA 1RUQH 5LO7A 4BFOA 3C9NA 4NQTA 1AZVA 3SDAB 1B0GA 3IBOA 2AMUA 2IALA 4PJIE 3NABL 2R1YB 1JPSH 5D8JL 3GMPB 4HLJA 1Q1PA 4XMPH 1CF8H 1TTUA 3WY2A 5FGRA