2G0KA

Solution structure of neocarzinostatin apo-protein
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
113
structure length
113
Chain Sequence
AAPTATVTPSSGLSDGTVVKVAGAGLQAGTAYDVGQCAWVDTGVLACNPADFSSVTADANGSASTSLTVRRSFEGFLFDGTRWGTVDCTTAACQVGLSDAAGNGPEGVAISFN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Neocarzinostatin
publication title Synthetic Ligands for Apo-Neocarzinostatin
pubmed doi rcsb
source organism Streptomyces carzinostaticus
molecule tags Antibiotic
total genus 12
structure length 113
sequence length 113
ec nomenclature
pdb deposition date 2006-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00960 Neocarzinostat Neocarzinostatin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.230 Mainly Beta Sandwich Immunoglobulin-like Neocarzinostatin-like 2g0kA00
1ACXA 1O5PA 1J48A 1AKPA 1NOAA 2CBTA 2CBOA 2CBMA 2G0LA 1HZLA 1J5HA 1J5IA 1HZKA 4JW3A 1NCOA 2G0KA 2MCMA 2CBQA
chains in the Genus database with same CATH superfamily
4P9HC 4Z78B 3WUWG 3T3PB 4D8PB 2V7HA 2CBMA 4NO0D 1I4FB 2B39A 5FO9A 5JW3L 2MCPH 5AENA 3ELQA 3IFLH 3GB7B 3GXDA 4X5WA 3S8WA 5LBGA 3T3PF 2PP9A 3CSBA 3F12A 3FU8A 3MNDA 3Q2CA 1PD1A 2B4CC 3Q48A 1TO5A 5CMAB 5CD5C 5JNYB 3MLRH 5JDSA 1P53A 3IJ7A 2CK0L 1JXGA 2L04A 3U2SB 5DUML 5D71L 5JR1H 3DNKA 2DQIH 2F54D 4P9HH 4FKEA 5I1KH 4YIQA 3CZFA 4XCCL 1N64L 1M71B 4FL4C 3MRLA 1INDL 4K07A 1UXWB 3S3JA 5AB0A 4RCAA 5JHMA 1RURH 2C7FA 1E27B 1G1OA 4Z7UE 1HT6A 3MRCB 2BCKA 4NPYB 4NQCD 1JF1B 2D3VA 3ECBB 1EK3A 1FJ1A 4PJ8C 5I5IA 2X4RB 1BVZA 2HTLD 4L1SA 5GJSL 3QXVA 3EYUH 1M05A 1S7WA 1YJDL 2V5TA 3LZOA 2XN9D 4JKKA 5HGGS 2BM3A 4KQ0A 5AOZA 4QRQA 1XF1A 1XTLA 4ZTPH 5TK2A 1MNNA 4JANB 1BAGA 3PXLA 4NKDA 2DKMA 3DROA 3ILQC 1L0PA 4NKMB 1SXAA 2KS0A 4LQFL 1JWSA 4KBPA 3VNZA 5M94B 1IAOA 5AVUB 3JWDL 3O4LB 4A68A 4FXKA 3DOSB 3MCG1 3S35H 4F9LC 2XJLA 1FORH 4Y9EA 1W9XA 1PFOA 3DYMA 2MCG1 1PTZA 1VADB 4UQEA 5AWNH 1RUKH 3PXJA 1A6VL 4QXUH 5FFOA 1MCHA 2GB2A 4FA6A 3LD8B 3ZO9A 3FBQA 1MWAH 1KELL 3IXTA 3UH8A 1J12A 3H1ZA 1CFSB 3MRHA 1N8ZA 2JJTC 4Q9BA 4J23A 1QRNB 3UACA 4LCUB 4A55A 5JZ7C 1ES0B 4XVUD 1W6LA 1QBLL 3MV9D 3QORC 4MD5A 1MHPH 4DP5X 2YA2A 4LF3B 5C0AE 4GRLD 5C0EA 1ADWA 1MFCL 3F7RA 3Q8EA 4Y5YB 4FQXC 1YEWA 3VXQA 2BIQA 3Q6FA 3UXFA 1AD9B 2CA3A 3S4SB 4WY7H 4JGNA 1UD6A 3QXTA 4N2IA 4OM1H 4KX9A 2VDQH 2AANA 2YPVL 3MNWB 4M62L 2DIJA 3GXTA 4LESA 4X6DB 2P5EB 1JS4A 2J8UA 4M5ZH 1JGEB 1WFUA 4LRNH 2X6BA 4X6DF 1XEDA 4G9FA 2F5AH 2CD0A 4BJLA 4L37A 2KPNA 3TBBA 3UIZA 1YEGH 2MNJB 1UXSA 4GUCA 4XO3A 1G0DA 3U9UB 1ZSDA 4YFEA 2XN2A 1R3HA 1FG9C 3HMXA 4YHZL 4J3OD 1YEHL 3LZFL 1WICA 5IQNA 3MRKB 1FH2A 1RK1B 4XRCA 1YUKB 3RGVC 1DQMH 1MI5D 2DQGH 2Y5QA 4ODUB 1TZGL 3JTTB 4MNHA 3KLAB 4L0PB 1EZVX 4P2OC 1Q9WA 4XWGL 4B6ZA 4AE1A 5DC0A 1EZUA 1ZPLA 1CYGA 2CHZA 2BRRH 1KENL 2VXUH 2DWSA 2QADD 4S1QL 1PY4A 4PJFE 1W8NA 2X89A 3N40F 3T3MF 2FX8H 2N7BA 1C16A 2WGXA 4YDZA 3Q01A 4HMEA 3UTSA 2FNBA 4NCDA 5E4EC 2PTUA 4JM4L 2JFCA 2JE8A 1VKXA 1CPUA 2WUBH 2WXNA 1VEMA 3KPSA 3KZ8A 1PSKL 5C07A 3U4EA 2OK0L 5DR5H 1LE5A 3AT8A 1ETA1 3BAJA 3QPQD 4H4NA 3V7AE 3HNSH 4BFNA 1N0XL 4FABL 2QGBA 3MGOB 4BXSV 4YZFE 3OKNA 5FKPB 5K9KB 1QWHA 3HZMA 2H1PL 2ZWZA 4BZ2L 3WXVL 4EQ3A 4CUCA 1LEGB 3FK3A 1AZNA 1LL1A 4UQAA 2PWGA 2P43B 4IRSB 3NACH 3A6BH 4PYHA 3GYRA 2V5YA 1HI6B 2Z4QA 4YDKL 1PVHA 3X1BA 1HAUA 2W38A 1F2QA 1D5MB 4EZMA 1OPGL 2MPVA 4JDTH 4CGUB 4LP4A 4OZHE 5DA4A 3CUPB 2EIMB 4H20L 2W07A 1UKSA 3SE6A 4GAJL 4HS8L 2A74C 3B7SA 4ZOBA 5F0LB 3S3SA 5CD5D 5IVXE 2OMUA 5J13C 5JA8B 1GPOL 3NAAL 4RIRA 5DRNA 4PJBB 4Y9GA 3S5LB 6CGTA 4AI7A 4JHVA 4YSRA 3D18B 4XB7A 3CZJA 4PRPB 2CA4A 4PJBF 4AENA 2CKBA 3A6CL 4FQHA 2Z93A 3MO1B 4XPBL 1XF3A 2ICWI 3ES6B 3II3A 4C4UA 4ERSL 5IB4B 3QZNA 3I6LD 2QKIC 4XNMA 4M7ZB 3IBOA 3CCHA 5I8OH 1FVDB 4QLWA 1LHZA 3IMWA 4XP1H 4F7KA 4NKIH 3WUWB 4BH7A 3V9CA 2C3HA 2KZ1B 3TCXA 4AIXA 4Z77A 2EDKA 2FWSA 3ETSA 3NZHL 4RETB 4JZJC 2BSRA 4PS4L 4Q56A 1WA2X 1Z66A 2EJ1A 4FI7A 4XCYA 3QFJA 3FQ4A 2WXFA 2XLLA 1FZOA 1M3IA 3DDGA 1G7PB 3HC4L 2HFGH 3TVMA 1RHFA 4FZEH 4P4KD 2E56A 3HVDA 2VSKB 3CVHA 4K7FB 3PV6B 3VI3B 4DNLA 2AMGA 4BZ1H 1MF2H 2YEZA 3BVNA 1FLRL 2HT2D 2KLRA 1NGYA 4O58L 3AGVA 3P0VL 3B2VL 1NAKL 1BLIA 1RL1A 4OV5A 3VI3F 3D0LA 3CZUB 3KYNA 5HI4C 5B3JF 3SDDD 4JZNA 5CSBA 4ZNEE 4WI7A 2D8KA 1V7MH 1O7DC 1CUOA 1VFBA 2QGEA 1SJEB 5T5FA 4NERA 3PWJB 4AJVA 2NY5C 4G80B 4DWHA 1VZHA 1JHKL 2C1OA 3TF4A 1AQKL 4AEIH 3L6FA 4XC1H 2VABB 1IRAY 4OLYH 1VZGA 1HEJC 3IAQA 2OZ4A 3OAWA 4JFOB 1ZVSA 4FQXD 2ZCLH 5KYUB 4LFHD 4IIZA 2ZG1A 4Y2NA 5CU5A 3IFLL 2ZPKH 4I1NB 2BC4A 4HS6A 4N6RA 2HN7B 1DQQA 4FERA 3BAYA 3UERA 4QAMB 4OKDA 1TQSA 1M7DB 2EXTA 1I7TA 3MLRL 1ZS8B 3HG0A 1ZRUA 2NY5H 4XWOC 1T03H 1DVFC 1OGAB 2X4QA 3OLDA 1NIBA 5ACMA 2FUQA 2NNFA 5GISH 4N87A 4JRXE 3GS4A 4LPVA 4D0DB 4JX0A 1KFAL 5JR1L 1W6WA 5D8JH 2GK2A 2DQIL 4PWFA 1IMHC 4LLAA 4P9HL 4FFVD 2NRDA 4E9RA 1N3NA 4GUOA 2CE6A 3MGAA 1JPGA 2CMRH 4QR7A 3BWUF 1LEIA 1AGCA 4HOXA 4LEXH 1KWKA 4EI0A 3RGVD 1RURL 1KBPA 3DO4A 3ZSSA 4D9RD 4K4KA 3V6FA 4AV5A 4PCYA 1DANU 1JGVH 2V5MA 2VZOA 2QV2A 3FT4A 4NUMA 3CFQA 4AUYA 5ID0A 4HKJA 1TQWA 1J0IA 1BFOB 2WBJC 2WN3A 4JG0H 2RACA 4MNQA 1W0WB 3EYUL 2X0UA 2B20A 1O7SA 2XTJC 2Z65C 4KI5C 4PGDB 2ERJC 2H2PD 4D0CB 4ZTPL 3FQ1A 3QXAA 2QHRH 1ZKAA 2P5WB 4PRHB 2Q5BA 1JNJA 1FORL 1F6AB 2DOCA 2EE2A 3QI9B 4N0UB 2ALWA 1N19A 4OCMC 1GW6A 4P2QA 5AWNL 5JOFB 3VM7A 1RUKL 4QXUL 3H53A 2WQUA 3D48R 1BD2E 1MWAL 1H8OA 3BZ4B 3QJFB 1CIUA 1S7TB 1TENA 4MWFA 5F8QC 3M8OH 4BFIB 1P7KA 1GRWA 5CEXA 4IBLT 5L7XH 4I18C 3NYKA 1MHPL 2ESVD 3O3EA 4U1LB 1Z9SB 5I1GH 3Q9QA 5DO2C 2A7BA 1KBBA 3SD2A 5IEHA 2KZWA 3O2VH 4HUXA 3WY1A 5MENE 1OAQH 3HZVA 1ZIAA 3H3KA 2PYFB 2Q20A 3TWCL 1URIA 1UJ3B 2VQ1B 2WWKO 2XWDA 4WY7L 3AG4B 2YXVA 1PYWB 1DQDH 4IU3A 4UMGA 5EC2B 3RY6A 4XNYL 3SJVB 3O6FC 3T71A 3GINA 4M5ZL 3KLHC 5KS9A 2BJML 3PJSA 5INCA 1KJ2H 4LRNL 3NFNB 3PWVB 4Y4HB 3ASNB 1V3MA 1ZGLM 2F5AL 4N85A 5IHLB 1X4YA 5D6CA 1YEGL 1K6QH 5E8EA 1FYTA 1B6DA 3QBTB 4LL1A 1ZSHA 1UKTA 4QEGA 2A6JB 2D31A 3NTCL 3R0NA 1FL3B 3GSNB 1G94A 3VE0A 1BVNT 5ABDE 2FEEL 4K7PY 5TH2B 3L9RB 2P8PA 4YOKA 3ESMA 2DQGL 2E6QA 3PIQA 1HZHH 1T04B 3MLPA 3TJHD 2WMPB 2C9SA 3QJOA 4ZTOL 4OCLC 2P9RA 4WI0B 4UQ9A 2DWTA 3BJ91 5HHME 3FQTA 2AJUH 2JV6A 3QA3B 1RLWA 2BRRL 4QYAA 2VXUL 3B8SA 4XPGL 4R2GB 3TEUA 5I19H 4C47A 2FX8L 4FZ8H 8PAZA 3EZJB 3O6MH 4KU1A 3FB7A 3BFQG 3K6IA 3PFUA 3SCMA 2G5RA 3IDNA 1H0DA 5DZNA 3SPVB 4F33A 3KD4A 1NA8A 2WUBL 4U2YA 2DQFA 4FOMA 2YD0A 3NIFB 4MDIA 3ASWA 4A2FA 3GM8A 15C8H 3DX2A 2YQGA 2DI9A 4GBXC 4YPGB 4KDTA 1XH0A 3TBSA 3NIFF 1VSCA 2R2HB 1P6WA 3G08A 7CGTA 1LNUA 2GPZA 1T7WA 3ML8A 4OCNC 4JE0A 1RZGB 5JYLA 4MXVF 4PLNC 3NACL 5AKTA 2FGZA 3A6BL 3ZE1E 1LEKA 5C1MB 3IT8D 1I3RB 5H2BB 1QX1A 3QJTB 5GZOA 5E2VL 1WZLA 4J6RH 4JDTL 3US0A 1JZGA 1XEUA 4O02B 5KSVA 2MOVA 1OHQA 2X2YA 4WV1A 4AQ1A 3TLRA 1LE9B 2YMTA 3BEVA 3ZYOA 2WAHA 3I3EA 5D7IE 3X12B 3LKOB 1KB5H 2FZ3A 1UEMA 5MP6H 4UQ3A 1KPVB 4Z5RA 3RX9A 1FN4A 4N26A 2ZIDA 1EEQA 3QZLA 3RL2B 1SUJA 1HEZB 3AROA 3P0GB 4RESB 3HI5H 4NRZA 4F3FA 3TIEA 5A2LH 2OW6A 2VKWA 5GZNC 4B60A 5HJ3A 1L9NA 3DO7B 4EN3C 4YXLH 1BYPA 1I75A 1FH5H 4E5XA 5I8OL 2MKWA 3QEHB 1TQCC 2GIYA 4FN0A 3TO4C 2JSFA 4IBQA 2WKOA 5I74C 1MFMA 3EYQC 4NN6C 4V1DE 3SO3B 2J20A 5C92A 1ORQB 4OZIA 2HPOA 2P4AB 3LRHA 4PBWD 1IKNC 1ZA6A 1FG2A 5C07E 5EC1A 2AP2A 4FD0A 2XTJD 3X11A 5GGTH 2BY0A 1HSAA 2FEJA 4KI5D 5CWSA 5CFHA 2BDNH 3BUPA 4Y4KB 3LRLA 3H85A 4HWUA 1KNOA 2Q8AH 5CEYA 3PP3K 3WCYA 2HFGL 4FZEL 2XWRA 4L8DA 4G83A 1ECZA 4Z3JA 2OJEB 2VQUA 4BZ1L 1AO7A 1FZMA 3TL5A 3GMPB 4JQVC 5D7SH 2ETWA 4R4ND 4KKCC 4OCYH 4MHHG 3RWDB 4L1HA 1A14H 2R69H 2EKJA 4HIIA 2GC4C 4H25A 1C12A 3I6GA 1CFQA 4DKEH 4EI6A 1V7ML 4F91B 1CCZA 1LQBC 3TFBA 3B56A 4Y16C 4JFZH 4FNLH 4XO4A 3RBGA 4QTFA 1TU2A 1NPNA 3G6AB 4WJ5B 4I9WE 3ZR5A 4AEIL 4XC1L 5DO2D 3K4DA 4OLYL 3GZKA 4Y2DB 1TFHA 1S7UA 5I6NA 1XZ0A 1P2CA 2ZCLL 4KXBA 4U1GC 3D50A 3UBXA 1OSEA 3ORJA 2DMHA 3PFQA 2ZPKL 1T21A 5GGVH 3IMRA 4HJGB 1EHAA 2JI1A 2N01B 2WBWB 3WD5H 3O6FD 1N67A 2G30A 3CTTA 3EO9H 3DV6A 2C7UA 3S35X 2JQZA 2MSPA 4C56B 1T03L 1YEJH 4PG2A 5CEZH 1T22B 2VLLB 3BZFA 5EBWA 5GISL 1ZWIA 1XT5A 4EI5C 5D8JL 1TO4A 1Y0LB 4X4MA 3V6ZB 1YQVH 2FBRA 3QUZD 2WWMC 3RWGA 1RAMA 4OZGA 2DQJL 5E1IA 3SE9H 4IRJD 4AE0A 3B3BA 3WJMA 3SKNB 2CMRL 3N5AA 3X1FA 4F8NA 2WINB 5FYLH 1WUZA 3ZHDA 3R06A 4LEXL 2XYCA 5CJ8A 4JN1L 1Q9LA 3W5NA 3L3DB 4FLOA 2AQTA 1NGWA 3KAAA 4HIHB 3PHQB 3R18A 4F57H 4PVLA 4YLCA 1JPFA 1JGVL 2HZHA 2IO5A 1SBBA 4JKNA 1JZ8A 1G7JA 4YNYB 4JG0L 4QLRA 4WO4C 4UM9A 3ELAT 5L8JB 4GNKB 4X9YA 3KPMB 2KERA 3GJFA 3ULSA 3OR7A 2PPEA 3JBG7 2WTPA 1S9KC 4L8CB 2QHRL 4RA0C 4IW4C 3GS7A 2FJFB 4P5SA 3LPWA 4PRNA 1G84A 1KCBA 1JDAA 2NY3C 4FFZA 3ZTCC 2J8OA 4RGOL 1UWXH 2ROXA 4M02A 4UUJA 4D9QD 4R7DA 5FGSA 1H19A 3EGSA 1XGTB 4NQDA 5FOJA 1KXTA 5E9DD 5CKGA 4IK7A 5IMLA 3ULVE 5F1IA 1YDPB 1IGJA 3K7UA 1OAKL 4MJIA 1BEYH 1I82A 4GBXD 4LBAA 3LRKA 1G5GA 4AMWA 3M8OL 1SXZA 4O00A 3ZYJA 4IJ3B 4PTUA 1OL0A 3UZQA 5L7XL 4JPKH 3ULUH 2X4OB 3NIDB 4EO5A 4PGEB 3CDFA 1HJBC 5DYFA 3FUHA 1BOGA 2D7OA 3NIDF 3VACA 3O2VL 5LGJB 3C6LB 2PR9A 1OAQL 3CDZA 4I89A 5L0QB 1BF8A 2WXIA 3VXOB 4Z6AT 4P5KA 3TNMA 1NC4D 3QQNA 4JB9H 4GO9A 3KVQA 2YOCA 2F7OA 1DQVA 1N70A 2DLFH 2AKRA 3QNFA 3TZVD 3WLWC 4WW2B 2DIAA 1JGUH 2EO9A 2ITDB 1CT8B 1U3YA 2IMNA 4HJ0D 4WFHD 1S7VB 3E9TA 1KJ2L 3T0EA 1CLYH 1CDJA 2VTFA 3SE3C 2V7NB 5GGUA 4ODVH 2VRQA 4WW2F 5T1MB 2H4EA 4F27A 5IQ7H 4PRBA 1F41A 2WGNB 5HD8C 4AZ8A 2KC0A 3ARDA 1K6QL 1VENA 3WS3B 4G70B 4B53A 1JNHB 3NRQA 5GZND 4TF4A 2MRYA 2G2RA 5C0BB 4EN3D 1UWEL 5IMOB 2ZKHH 1D2PA 5ESQB 4PQXA 5IHZA 1CE6B 2R2CA 4FXTA 4O4YL 1ROCA 1HZHL 3EYQD 1TZIA 4AQ8A 3MODH 3OSVA 4JY4B 4WNQA 5DJXB 1ND0A 3PHOB 4PP2A 1BFTA 4QDGA 5AKVA 4Y8AA 1GGBH 1T1ZB 2GW5A 2AJUL 3HR5B 5SX5K 3FMGH 3V4PB 1KEGL 3ZT5A 2BP8A 4PHZA 5G5DB 2F1EA 4KI1A 2UWEA 1MW3A 3QUKA 2F8XC 3FQNA 3QIUB 5I19L 5GXBB 2VXSH 5L2KB 5CLXA 3T8XB 4FZ8L 4BQCA 1OE1A 3O9WC 3ZMRA 2Q8BH 3P3TA 3G6JA 3ML9A 2GJ6B 2OTWA 1AXSA 2BY2A 3M1OA 3MBED 4WHYH 4KKCD 4W68A 4UOJA 3X14A 4Z7VA 5C0DA 1F00I 5B1JC 2EVFA 1E7UA 1S3KH 3DVGB 2ZSWA 3F3HA 3EHBC 4RBPH 4N8UA 3JV4A 3DMMD 1O6SB 3WAJA 2H26A 4F9PC 3C5ZB 4LMQI 1TETH 1U8CA 3G5XB 5KBLA 1I7RB 4NZUH 3UZEA 4QRUA 4BFRA 1AY1H 1JMXA 1IJNA 4AGOA 5FUZL 5CEZD 1CICB 1QLFA 4HCRA 3N1PC 3UO8B 4FLSA 2H1LM 3I85A 7PAZA 3L2LA 3MV8E 2OFQA 4P23B 1KTKE 2JJVA 3TYFB 3KPRA 3HLKA 1G7IA 3D4ZA 2MTAA 4J6RL 3ARVA 3KPTA 4RDQG 1ZT1A 4XP5L 2E75C 1JV5A 4WDIA 5A16B 4PJIB 3BDXA 4WI2A 4BHUI 5I1LB 4ZPTB 5D1QA 4E9WA 3GHPA 3KGSA 3RNKB 5F9JA 1E90A 2I9TA 1KB5L 4PJIF 2B15A 5MP6L 1LO0L 5C0CA 1JIBA 1Z32X 5D7EA 1GL4B 2PYEB 4XB8A 3ARGA 5F7AA 2Y25A 2WXQA 4PD4K 2AXHA 1BZQK 1OGSA 3HI5L 5DJ0B 2YMOA 4K0OA 2IV8A 3FT2B 1X5LA 3P69A 4GP4B 2VJ0A 3CHPA 4YXLL 4DUXA 1S7QB 4QGYA 3WIFA 3WKNA 2QSVA 2AVFA 5CHNA 3DX6B 4CVXA 2CWRA 1ZLUK 3S5YA 2KUTA 1F4XH 4TUUA 3QRBA 4WWOA 3D5OF 3O3DA 2IAND 2O6CA 3PWNA 4RDBA 5KYWB 3WNJA 3KYMB 2X1PA 4WO4D 5FOBA 1N12A 1YEDB 2WLJA 5HGBA 5GGTL 2B1HL 3LRGA 4ELDA 2BDNL 1B3JA 4KXCA 1E5YA 5FK9B 5JA9A 4KHXH 2SEBB 2CCLA 4U05A 2WLIA 3H7BA 2NDGA 4N1EA 5JMRA 4RX4A 1JDDA 2VAAA 4CU8A 2NY3D 1ZHKA 3G5WA 4QRPB 5C0FB 2FB4H 3GSWB 3KM1A 3Q5TA 2IPUK 4LIQE 4XE0A 4XMXA 3V5KB 4OLUH 4Y89A 2MQ0A 1JWUB 1WAAF 2XIBA 4H26B 3H8NA 4NLAA 4NUJB 4CJ1A 1A14L 2R69L 4HLJA 2XPYA 1J5IA 2IFGA 2GTWA 3RIKA 4DKEL 3QXWA 4IBYA 1HOCB 4TVPE 4FLQA 1CLVA 1OM3H 4DK3A 3HKZA 4B96A 3GIVB 2GABA 4LBEB 3D2TA 4JFZL 4FNLL 4R0LB 4KY2A 5TGBA 5C6PB 1HKLH 1KJVA 4TLKA 2YA1A 3NGBC 3HJ0A 3R4RA 2OMTB 3GNMH 4G42A 5T5NG 3T1WA 3WL9B 1DUYB 2W9EH 3W11C 4DN4H 3RFZA 2Q76A 3AGWA 3VDAA 4FQQA 4LQ1A 4Y7MA 4ACTA 4OAWB 4P5MA 3KCWA 5GGVL 3LPOA 5DC4B 3S6CA 2FJUB 2EXWC 2HWZL 2QSCL 3AWGA 4PJ7A 3WLWD 4BWWA 3WD5L 4M93B 4NFDA 3AUWB 3EO9L 4JLRA 5ALCH 3B9KC 2CUMA 1AZCA 2JXMA 4LVEA 1LK2B 1DO6A 5IW1B 2ADIB 5CLWA 1YEJL 4X5LA 4PFEA 5DD6B 5HD8D 2ZCHH 3VI4F 1MJUH 3UTTD 3RUGB 2Z31B 1YQ2A 1YQVL 1KXHA 2H0FA 1IGFH 2NY6B 3AMKA 2K9FB 3QIBB 4P2RA 4XT1C 1GMEA 3L5IA 3LSOA 4JO1L 4MAYC 1D7BA 3SE9L 4OQ1A 3RUGF 2P8MA 2YGNA 1QI4A 4PGJA 5FYLL 3BUYB 1EHNA 3FL7A 3APMA 4ZQKB 3DJTA 5GRJH 3SY0B 2R23A 2J55A 2GAZA 3C5JA 3I2CH 4B7LA 1XGPA 5HDOA 4F57L 1AO7E 2YPLD 2NSQA 2NQDA 3F00A 1RSYA 2PR4H 3BESR 3NCMA 4NJ9H 4W4OA 3TN0A 5T3ZD 4HPHA 3AS2A 3FO1A 3GSOA 5L88H 5JQ6H 2VL4A 1SHWA 1B0RA 2AFNA 3MI6A 1OTTD 2OTUB 4FMKA 3WE1A 5HHPA 3VD1A 1PLAA 3FFCD 2EEFA 2BO0A 3O9WD 2XKUA 3EFOA 5I6MA 2KYIA 5CR8A 4ES9A 2ICEA 4WFFE 4BKTC 1N10A 1XZWA 1VFAB 4IOFC 3WIAA 1QSFE 1AS7A 2NY4B 5EUOB 1BEYL 3OR6A 1R19A 2Z1PA 3ABMB 4NS0A 5K1VA 1CN4A 1UCTA 3O8XD 5FWRA 1FVCB 4KUZH 5EU5A 2OMXB 1JK8A 2WVSA 5EUOF 3ZYIA 3OB0K 1J88A 5D4JA 1HH6A 1T1WA 5K9OB 3ULUL 3ESPA 2O6DA 1KGUA 4DGIH 1NEZA 2CHXA 9PCYA 5D1XA 2UZPA 1UENA 2WIIB 4JFHE 3UTOA 5IESH 3E6FB 2WK2A 4GKSA 1WFTA 2P44B 2VL5B 2Y9RT 4K5LA 1X5GA 2CCVA 2PO6B 5FO7B 1AHWA 5AW8B 3PQYB 4Y19A 2ITFA 5B38G 4N2AA 3NJIA 5BV7B 2E7LC 1KCSH 4JB9L 4OZGE 1RJZB 4P5TC 3U4KA 1KGCD 1A2YB 5HYJB 3UTPE 2VLRB 4YQXH 5TF1L 3L3GA 3C09C 1JGUL 2WZ5A 1BG9A 4QOKA 3NZUA 1CLYL 4K2UH 2FJHB 4LVOB 4ODVL 3L48A 2NY1B 2WYIA 2DF3A 1I7ZB 5F1NB 2W0KA 3FF7A 4QRRB 2OA9A 4CW1B 1P5UC 1H15B 4M7ZC 3SBPA 3UGEA 3V10A 4R4BB 4IOIB 4XOAA 3HNVH 2YGPA 4IGBC 4L1DA 1B4LA 1I1YB 4L5FH 4HGMA 1WCBA 4X0NA 2VXVH 4IOSA 3UO1H 2FX9L 5I8CB 5JW5A 1N18A 3VGEA 1K5WA 3FPYA 4C4BA 1FFNA 2CALA 5CGYD 3MODL 3UADA 3AT0A 2XV6B 3F5WB 3EYOB 2EE0A 5D2NE 3SZKC 2DB8A 2V9UA 4RDQF 1YN7A 1QHPA 2R7EA 3O4LD 1GGBL 4G1EB 4MJIE 3FMGL 4C57C 3PPEA 3OPZH 4Q58C 5DHVA 4QXGH 1FL6A 4UM8A 4YL9A 3TTYA 2VXSL 2K8MA 5D2LA 3TJPA 2O72A 2ARJA 4ZJ9A 1S7RB 2D9QB 4R5XA 5FCUH 1QRND 4CADA 3CQFA 4ODHH 5I1IH 1KXVC 1PAZA 2I32A 3WHE1 4Q4IA 2OXHB 1OD7A 2E9GA 4L2LA 1MQKL 1R34A 1U58A 2UYLB 1HE8A 1IVLA 1Q0EA 4NZUL 3RBSA 4ZMZA 2V3DA 5CCJA 4AYGA 3D85A 4FQCH 1AY1L 3QRGH 2HRHA 4JKLA 1U8MA 5BVJB 2E86A 2F6AA 2GSIA 3JV6A 3VFVA 3C8DA 5BRZB 2IH8A 2B14A 1NWOA 1R5IB 5IJKC 3ARBB 3W11D 4MD0A 4MZRA 4M1CC 5T1JA 3FU6A 5AW3B 1J05A 2GUOA 5F9AC 2R56H 2EXWD 3QJUB 1XVSA 3QQ4A 3S8FB 4H1LG 1XF4B 1CYXA 3EGDB 2XOTA 4AYFB 1YVLA 2A9MH 4FP8H 1A6WL 3AW5A 2X42A 3RZWA 2ZTBA 3QG6A 4Q7DA 4JFEE 4UQCA 4X9IA 3VMPA 2QL1A 1T5KA 1TNNA 4CSPA 4FYQA 4HXBH 4WWKC 5KSAB 1A4CA 4CSZA 2X4UB 1U41A 3IJEB 2EACA 2PCPB 5F6HI 5EEVA 2MFNA 1P6AB 4I5BA 3LN5B 4KFZC 1TYJA 4E36A 3MMEB 2J71A 1OAXH 4QRAA 2YQBA 4NM4H 3HC3H 4G82A 5I1AB 5T5NF 4I0KA 2F7IA 1F4XL 3B3IA 4HUCA 5IWLA 1K4CB 4JJOA 4NENB 4UT9H 3J07A 4FTDA 2GG1A 2R8SH 2W8CA 2AK4B 2IQAA 2NXYC 4K23H 4BUQA 4PJ5E 5IV2A 2JKTM 1NBZA 2VMDA 2NMSA 4KXAA 4ISVB 1K8DB 4KHXL 4HUUB 4AQOA 1UUSA 3TOPA 2IGFH 4IBWA 3KS0H 3WEXA 2G0KA 5A2BA 4G6AC 3ULUF 2FB4L 2VR5A 2Q7NA 3PDOB 2YHGA 1E6JH 3O41B 1UACH 4N8VA 4R3SB 3OGOE 1MNUH 1NLDH 4U0QB 5LVEA 3DC0A 5D5ME 4IOFD 2XPZA 2JKNA 2QEJA 4YFDB 1F11A 5EULV 3TXAA 5KW9H 3TF7C 1U8IA 4JFDE 1AGEA 5D1ZB 4JDVA 5GGSA 2QJDA 3CX2A 1VFUA 3IBEA 3RTQB 1OM3L 2HLFC 4QF1B 5F88B 1BV8A 1PJWA 4F80A 1VESA 4KV5E 1HKLL 5E94B 3LQZA 4BE5A 5FLVA 4XO5A 1JV2A 2Z7UA 4KVCL 3V6OC 2KHAA 4S2SB 3FSWA 2I27N 3GNML 1NBVL 3QJXA 1TJIL 3V4UH 5KWYC 1BX2B 2GT9A 4WHCA 2W9EL 2YC1B 1I1FA 5B1KA 4DN4L 4D7BA 2XXGA 4NBXB 3NBNA 4AYDC 4QT5A 3UGUA 2CO6B 1IILE 1K2DB 1ZHBA 1N6UA 3SKMA 5ALCL 3RNQB 2IFFL 3VQMA 4PRPD 3VX0A 4KNSA 1ZV5A 4BQ9A 5LGKA 2L7UA 2VMCA 5EEUA 3TCLA 1S3RA 2J1ZA 4O2FA 1VIWA 1IGIH 2ZCHL 1MJUL 5LWYH 2HKHH 4KX8A 5F89A 1BF5A 1CXLA 1OCZB 1S9YA 5F7LB 2HB0A 4BSWA 5ALBH 2NPLX 2KMWA 5HYQA 1K9TA 1N5AB 3Q8CA 4A2DA 2KBGA 5HDBF 3DBXA 1CG9A 1HTYA 5GRJL 3M86A 5F7DB 3OXSB 4YBQD 5B38B 4OFDA 3I2CL 3T0VA 3B8YA 1KIRB 4M6MH 3PGDA 3MLTA 1MEXH 5I16B 2A0LC 2Z0UA 4M1GH 2A6KA 4ZO8A 2BXZA 4L3FA 4NJ9L 5IFJB 1J11A 3V4VB 4E0RB 5F93C 3F7YA 5HDQH 5IFAH 2GCYB 3A67H 3KXFA 7TAAA 5DQJB 3BW9B 4ZDHA 5L88L 5JQ6L 3U7WH 3W0WA 1S8DB 3N44B 2J6EH 5CXPA 3DXAA 3TONA 2JB5L 3QFGA 3Q44A 3Q2WA 1UATA 3HG2A 4X6CB 4X99A 5TFSH 1ERNA 2B2XH 1OCWL 3WLBA 3VXUB 2A6DB 4DW2H 4NO5A 1I8KA 1XH3A 5J6GB 3OKMA 2D2OA 4GSDH 3FFDA 2ZP0T 4X6CF 2VISA 1YMMA 2EC9T 4RSYA 4KUZL 2O61B 2V0AA 4APXA 3WJLC 2FH8A 5IB5A 3IE4A 2OQJA 2R1YA 3HG5A 4PJAA 4DGIL 4PV8B 2Y7SA 3KW7A 3OC8A 3PYCA 4TS6A 4DFIA 1BP3B 2D4FA 3CDGB 3O3UN 4JN2A 4P57A 3NH7L 4Y4FB 4ZFOB 1ET5A 4JAMA 3RWFA 5IESL 2JK5A 5DRZA 5CCHE 1F18A 2CDEB 1EPFA 1NGQH 4AIOA 4WRLA 2ZXQA 1MELA 3LN9A 3QFDB 4HKBA 4FQ1H 1HNGA 4HW6A 1KCSL 1RH8A 1LDPH 1OGAD 3QDJB 1BQKA 1ZT4B 2NXZC 5EOQH 4ONFH 4PVBA 5EU3B 1B6UA 2VKXA 3WN5A 4M8QB 3G5YA 4QD2E 3AC0A 1IE5A 3VWJA 1OSZA 3IETB 3V7AG 2NY0C 3FOMA 3PHSA 5JPNB 3CHSA 3QWRD 1DE4B 3FU7A 1PKQE 5A2CA 3Q8AA 3BKYL 2ZXGA 2EICA 4PJ9B 3HNVL 3DARA 2WO2B 1DEEA 1KIUB 3WG7B 1EFXB 5F7KC 1Z7JA 4GUPA 1S7SA 4L5FL 4PN6A 5KSBB 1Y18A 4Z76A 3LNEA 3CX5J 4KROC 3AB0B 3CZKA 2VITA 3UO1L 1J8HA 2BW4A 1OAZL 5EU7E 1RI8A 2J88H 5FUCC 5KSBF 1CD1B 1IKOP 1QR1A 1X4ZA 4YGAB 4E41E 2JTDA 1OGPA 2NXYD 4HKZB 2HJKB 2PCFA 3ALXA 5AKSA 2P48B 2Z91A 4ZUSA 1FO0B 1ETZB 2KZBA 3OPZL 5CP7B 5SWZB 1D9KB 4RGMB 2ARJQ 4QXGL 4BSVB 5MEPA 3DX0A 2DJ4A 5C09E 4FE9A 3QUXB 3MOQA 3ZY7A 3P40A 2NNRA 1UM6H 4ZODA 4DO4A 2VM9A 4PJXE 3ZVVA 3J2PA 3GMNB 2BNRA 4ODHL 3VFMA 5C0GB 3OPUA 4N2KA 1X5ZA 4XPAL 3BHBB 4HCFA 2NX5E 4V11A 4X6BB 5FYKU 4ZFQA 4LHUA 1K5NA 1NCOA 1QEWB 3SODB 1L3NA 1XGUB 5TDOB 1XXFC 1MFDH 5E4AA 5LO7A 2HLFD 3RI5F 1MZYA 4TUJA 5DUJA 3FRPG 3DV4A 4M4PA 4GW5B 4QOKE 4X0KA 1QRKA 4J4PA 3QRGL 1HYSD 1T7XA 4JMXA 5TF0A 3VG9C 2ICWA 3GSVA 2JCCF 2LE9A 5GIRA 3E7JA 3GPSA 3SJVD 2XQYK 1CGSL 3DBSA 2NW2A 4AQZA 3BZEA 1NC2B 3QWQB 5G4MA 3TO2A 2Y6SC 4Y4HD 1A65A 4RMWA 3MROB 1AGFB 4I88A 1KT2A 4PY7B 5F96L 2R56L 1ACCA 3VXPB 3EYSH 2BZ7A 4NQQA 3BX7C 2RFXA 3SE4C 3N6YA 3UAJD 4FP8L 4XP4H 5J1SC 4D8OA 5D55A 3OAZH 4IMKC 3QCVH 1LWHA 1JF6A 3QXDA 1EXUA 3T4AC 1QW8A 1IU1A 3MUGA 4GG6E 4HXBL 4H40A 3DETC 3U1QA 4WIQA 5GQBA 1UA7A 3GMRA 5ABAA 4G8GD 3MZGB 2F53E 1TEYA 4KO6A 4RFNC 2XWBB 1OAXL 4NM4L 4WFGD 3GSRB 4N4YB 3GRBA 3L1EA 1J5HA 3GXPA 5DHDA 4R2GD 4UT9L 3ARSA 4HMDA 1U3HA 3OF6A 3ILPB 3OMZA 4NUQA 5DS2A 5IF0A 1X6NA 3U0PA 3V0GA 3D87B 3FUMA 4GEIA 4K3HA 5DDHB 3ZPDA 2QGCA 1D6EB 1UT1A 1CFNB 1DUZB 2JELH 4NNPH 4TULH 3CFKB 2IGFL 4PG9A 1AR2A 1HHJB 2YUXA 1NPJA 1DJSA 5C0AB 1UACL 3K5SA 2RAMA 1MNUL 1KMGA 4ZO6A 4JUSA 3IDYB 4XB3A 3Q5YA 2FTAA 2AW2A 2Z8RA 3ABGA 3UDWC 4QRTB 4ANUA 3MRNB 3HAEA 4WW1B 5FYJH 1V8HA 4PR5B 1RK0A 4PJEB 3MJ7A 4XXCA 4LCWB 1OV8A 3F7PC 4MQXC 4OIFA 5KW9L 4AYID 4R7VA 5G4NA 2OR7A 3NSDA 4U0RC 4LKXB 4KZEH 2MQ3A 4BM7A 1U91A 4IMLB 4U31A 4PJEF 3C6LC 4HJIA 1PG7W 5L0QC 2VLJA 3LH2H 4JHZA 3HTLX 3CHXA 1QA9A 4NBZB 1JZ4A 4PRIE 1J0KA 3V4UL 4U4BA 3ARPA 5D6DA 3ECVA 1OOWA 2JWYA 1OB0A 3CFDB 5BW7A 1INQB 2HAZA 3L8QA 3H2WA 1M7XA 3FB5B 4KRPC 1QUPA 2EDMA 1TR7A 3SE8L 2XU9A 2CKBH 4N2BA 2X40A 3OKEA 1JXDA 1AZUA 5GGQH 1TVDA 4MDJA 2K3TA 4FKHA 3MGTA 2NY0D 4L4TA 1YSOA 3JXAA 2FT6A 1MN4A 2XG4A 5FIEA 3IGUA 3RJQB 2F8IA 3B9EA 1IGIL 3RWIB 2VDMH 4MMZA 2HKHL 5LWYL 3T6ZA 4H5SA 3APNA 1E8ZA 4FMFA 4OFVA 2EIBA 3VVVA 1JERA 3ZTJH 1E4KA 5ALBL 4NGHH 4FTVD 2NTSP 2RA1A 4Q6IA 1ZV9A 4PJFB 1V3KA 2X41A 2Y1YA 4KJWC 1N6QH 2DJUA 4NNYB 4WU5A 3ZKXB 3PREA 4HX1A 4Y4KD 4M5YH 4M6ML 5DQ9B 4PJFF 1MEXL 5B7EA 2H8PB 4M1GL 1CC3A 1F3RB 1TITA 2C4FT 2GJRA 5HDQL 5IFAL 3A67L 4N0CC 2ATAA 2KI6A 1OB1B 5ILTH 1ICTA 4I1RA 4NKOB 1JXKA 3U7WL 5EORH 2PUQT 2ITCB 2RMNA 4DJMA 1ODAA 5I6LA 3NSCA 1E2VA 1XCQB 2ZXAA 1VB9A 3GRWL 4GLRI 5JHAA 3MUHL 4FCAA 5T5FH 3EO1A 4QRFA 5DD1H 3H2PA 5BO1H 3VD4A 3O0LA 5D7JB 1M1SA 4DW2L 5BS0A 4MZ3A 1Q1JH 2YUWA 1EZSA 1D7CA 1MREH 4MS8D 1CLZL 1XFPA 1SOKA 3KPNB 4OI9A 4OZHB 5C0RL 4ANWA 3RY5A 2BVOB 5DGRA 1JPTL 2VYRE 2Y07L 1M1XB 4WVRA 5A1AA 3I3BA 5IVXB 4U1KA 1DLHA 1DBMH 2CPUA 1C08B 2BSEA 3ZL2A 5DI8B 2DRUA 1TF4A 3DTUB 2NY2B 2OX5A 1WGVA 2I5YH 1NGQL 3IPFA 3BEWB 1GXEA 1CGTA 4JUTA 3TBWA 2FUTA 1QFWI 4C56D 1LDPL 3DRTA 3B9DA 5MEOA 1A25A 2DEYX 2IG2H 4YFLF 4ONFL 3LQAC 5EOQL 1AS8A 4U6TA 1DQTA 1IQDA 2AEOA 3KYOA 5KG9A 2CM5A 4B50A 3CFEA 3B2XA 1CFTA 1GZPB 2MHAA 4EIBA 1ECYA 1EHKB 1UZ6E 2J1KA 1MZZA 3FRPB 1AXIB 2DMGA 3DETD 1FAIH 4H2CA 2H6UA 2CLZB 3TC9A 1SUHA 5BPPA 3FAXA 4WK4B 5EN2A 4Y1AA 1U8OB 1A47A 1LD9A 3LQAH 3NCEB 3IN0A 2Y7QB 3FKUS 1J8KA 3QEQA 5E23A 3ABKB 3VNYA 1CFMA 5DRWA 3TCTA 5GS2H 2XWCA 2CJSA 3DRQA 3HIZA 4WUUA 4XX1G 1ZGLP 3N50A 5DJDB 1PLGH 1FVEB 2XWTA 5E51A 4G8IB 1T0NB 4N20A 3VWKB 3QNZA 3QP3A 1WF5A 5LNEA 2YA0A 3PAUA 1FFPB 1CLOH 4LCCB 5T3XD 1IM3A 1QPPA 3JWNC 4ORZC 4RQQB 1MIEH 4CC4A 3IDMB 1AHKA 1M53A 2XZAL 1WTLA 5AOLA 1UM6L 4K9JA 4FX5A 1WFMA 4FI6A 4EMZA 3HRZB 3E2HC 3MTXA 5C0NC 1G6VK 3DX7A 1A7RH 2AXGB 4PIBA 4PJDE 5D7LA 4F2MA 2QVKA 3HS0C 4HU8A 4LOEA 1MFDL 3QJRB 5ISZE 4CRPA 1BW8A 1P4LA 2XA3A 12E8H 3C6LD 3JWNH 4OFPA 3R4DA 3OB8A 4GRWH 4LKCA 5T33L 1J9SA 4WENB 5I0WA 5H4ZA 3BUTA 5EO1B 3CVCA 3C87A 2O6EA 3I9PA 1U21A 2HFTA 4BV1A 4JRXB 3KPPA 3NPZB 2FJSA 5F6IC 1H6UA 3FO0H 4YDLB 1U8NA 2NT1A 1RK7A 1F4WH 3ARFB 3LNHA 2XFXB 1OP5K 3FTGB 4NXKA 2FEDC 1ITBB 3HMXL 1J8HE 2HRGA 1Q72H 1QACA 1I1AA 4URTB 4XP4L 3CVIH 4AM0A 1EUUA 1NM9A 1J0YA 4FYTA 4LOFA 3QCVL 1HKFA 4IHBA 5C0BD 2IBGA 4U7KA 5JMOC 2XSKA 4CDHA 3V5DB 2YFNA 4HV8B 2VDRH 1JPST 5CZXC 5CCGE 1FZJA 3C6SA 1J0JA 1XIWC 1UZGA 1XB6A 4IHOB 4PB9H 2A83A 4UOZA 4DZBA 2E9BA 5F1SA 1I8MB 5AYUH 1IC0A 4WTXA 1ZHNA 2C3VA 5KYXB 5DEGA 1N2RA 5L2KD 3GI8H 5EH1A 3S34H 4KKBC 1NANH 4NCC1 3QHFH 2F68X 2JKRM 4N0CD 3DSNA 3VXRA 1AKPA 1BD2B 2HT3C 5FO9B 2YAPA 1GZQB 2GJ6D 3UP6A 2OSWA 1CK0H 4FNQA 2NZ9C 4X5WB 1H8NA 2JELL 4NNPL 4TULL 3F12B 3BIKA 2QQNL 4B9IA 3DX8A 4ZFZB 4TVSa 5JDSB 1I85A 3H9YA 5J11C 2QVFB 2VNCA 3C5ZD 4UINH 1NGZB 2PLTA 3UC0H 3RIAF 5HDLA 1HJCA 4ZYKA 5FYJL 4HWBA 4HIEA 5MENB 4JZOB 4QO1A 4Q89A 1CICD 2OV0A 3FQWA 3ZL4H 1YN6A 1U8LA 4YIQB 3VXSA 3CZFB 4NNXA 4F7EA 3BISA 4KZEL 3QIWA 3MRLB 4I0PB 2J72A 2P52A 2DD8H 3ARRA 3U2IA 1EVTC 2BSSB 4LEOA 1TTUA 4QHLB 5BV7C 1HWGB 5IUCA 2UUDH 3VFGH 3IU3A 2VRAA 3V0JA 2DMBA 1S9XA 2B3RA 3BKCL 1FJ1B 2FX7H 4R7XA 2PPDA 4FFTA 1M05B 1S7WB 2K9UA 4PRAB 2NOYA 4QRQB 3VMOA 5LXVA 4NO0A 4H8WC 4NKDB 2CKBL 4NN5B 1JWSB 1IAOB 3VRLE 2AJ3A 2OMZA 1BLNA 4LDOB 5CBAA 3TESA 1JVKA 1E7VA 3G5VA 3Q1SH 2R0LH 2VDML 4U1MA 3K6OA 4B9ZA 2ZYRA 3U0TA 1MRCH 4W9GC 3SGJC 1M9WA 1GTNA 4QKTA 3IXTB 3BE1H 4NGHL 3TV3H 3ZTNH 2F54A 1PD0A 1N8ZB 5C0JA 3ROOA 4XH2A 5A2KH 2RCSH 4YDMA 4H8WH 3ZTDC 2BZDA 3ESVF 5DHMC 3WV0A 5EDXA 1N6QL 4Y9BA 3KPLB 3QH3B 4M5YL 5HJBA 1MHHA 2MIZA 3CVHL 1X9UA 2X7LB 4NQCA 4OCWH 2OCJA 3TA3B 4P49A 5LKNA 2WQSA 1KYDA 3EJYC 2NUTA 1SBSH 4QRPD 5EO0A 1GYAA 5F7BA 5ILTL 5E5UB 3Q6FB 1WV7T 5HPMA 4BCZA 3T77A 5EORL 3VGAB 2XN9A 2N0MA 3ESNA 1FLTX 1KEMH 1I9JH 4JDZB 3KHOA 5T5FL 2EIKB 4RWYH 1JFQL 1MJJA 5B4MC 5DD1L 4J3SA 4DGUA 3PAYA 3A23A 3LEVH 1ZCRA 4L37B 3ZE1B 4PG2C 1Q1JL 1UXSB 1MREL 5TQ0H 1E4HA 5C0ND 3FTSA 2QQQA 1NFDA 3EJZC 1ZSDB 4O2CA 2J1XA 3ZE1F 5FA3A 2DQEH 1SYVB 1T5WB 4J3UA 4XNAA 3T3PE 4JS7A 2BW5A 4N0YL 4U1HA 3ARBC 2EE3A 4LVNB 1GY1A 5FV1L 4KO9A 4XRCB 1XR9B 3MV9A 1XV8A 1PKOA 3O2DA 4U6HA 1HK6A 5I1CH 1E5BA 4HFUH 1SHMA 2APTA 1A3LH 1FPTH 1Q9WB 2I5YL 5FDWA 3DA0A 4YHPA 2G3NA 4U1IA 1N5YH 5CJBA 2Q7YA 2ZXEB 4DETA 4WSKA 4BE6A 3BUDA 2YRZA 4ELME 3U7YH 2IG2L 5CU9A 2XWZA 2O5NA 5ICYA 1OGTB 2Z31D 1C16B 2NY6D 1I8IA 1RZKL 3QO1A 3QIBD 1O5DT 4YSPA 1TSHA 1C5BL 5ESVA 4UNIA 4V1DB 2ZQKA 5ANMA 3FUEA 2G3ZA 2J44A 3KPSB 1DSWA 2WANA 3CDYA 4YBHA 3AU1A 5C07B 3U4EB 1FAIL 2P28B 2W1NA 3SGKA 3W57A 1UC6A 4GQQA 5CZXD 5IY5B 1HDMA 4DPRA 3ILEA 5L2JA 2WCGA 1PGRB 4C58B 1PDKA 5ICXA 3DK2A 1UQSA 1JI1A 1YEKH 4KDVA 3HZMB 3ZHLA 3GJFH 1DCEA 2ZYHA 2LU3A 3LQAL 1GMIA 3D3VE 4JO4H 5EUKA 2DM4A 3O3BA 2A77H 2WQ8A 5KANG 3KWXA 3FO9A 2VUYA 1MI5A 2YD5A 1W0VB 4FFZH 3A3YB 1YECH 1SXCA 2Z4QB 5BS0E 3V7MA 1PLGL 3TJEL 3HHRB 1WAEA 5KVFE 3BSHA 1RU9H 3P9MA 4R8WH 4DEPB 4PIRF 5SWSE 1BZ7A 1MFBH 2NZ9D 4NQVA 2W07B 1YRKA 2NY4D 1J86A 4W93A 1MIEL 3IGAB 1H6FA 2OMUB 3L1FA 2AXFB 4BK5C 3T0EC 5DRNB 1ORSB 3SEPA 5I6XB 3B1UA 1GVIA 5FHBH 4WI4A 3PY9A 1HC1A 1HVXA 3TU6A 4BHUA 2B08A 4JFFD 1A7RL 3P9WB 3DGGA 1E6OL 1X9LA 2B9AA 1CO1A 4FQHB 2Z93B 1HOEA 5PAZA 3WDIA 4R26H 5GSRB 2EIDA 4XNMB 5T1KB 5DJ8A 5FM5M 4BRVA 12E8L 2FD6H 4JVPA 1Z9PA 4X6DE 1DFXA 1ASQA 2P5EE 1QSED 4RNRA 5HVFB 1BZOA 5HYJD 2VLRD 2B0SH 5JXAH 4EUPA 1A9BA 4AQ8C 3TT1H 2BSRB 2KZKA 4PM1A 2WTOA 3CXFA 1F4WL 3UTQB 4XCYB 4QRRD 1FZOB 1MXGA 2APBA 4HFWA 4AM0Q 4YDVB 1OT4A 1A1MA 4AKOA 1Q72L 2WLLA 3CVHB 3QXUA 3H9SE 1IGYA 4GT7A 1WFJA 3CVIL 4GFXA 3NQIA 1XF2A 3LOWA 3GSQB 3BVNB 4RBPK 1NGYB 1JVLA 3D69B 1NQBA 4OV5B 3BO8A 3D0LB 4GP8B 4QTIL 3BZ5A 4I9XA 2VDRL 4JZNB 3MNMA 4L8SB 3KWUA 3P4OA 1GSMA 4PGBA 4Q2ZA 3BVTA 5BCAA 3T3ME 1SNRA 4GI8A 3TPKA 2NR6C 2NW3B 4WNJA 1KLUB 1CF8H 1XF5B 5F9WC 1DSFH 1V05A 2C1OB 5HHOE 5ICZA 3L6FB 2D4DA 1KYOJ 3L5XH 5C0IA 3DPBA 4TNVK 1YNKH 3F8UB 3OWEA 2FYYA 4N86A 3GI8L 5BJTA 1EBPA 1MH5B 3EJYD 4ZAKB 3IKKA 4A66A 1QLEB 4POZC 3WTTA 2EC9U 3NCCB 1XSKA 3L95B 5AVRB 1D5BA 2BC4B 1BAFL 3BSZA 1CK0L 3MACH 4HS6B 4BFJA 1IE4A 2DM2A 5J3HC 5IOPB 4GT0A 3PGCA 2RR3A 5I76A 3TA4D 2AQQA 4AW4A 2DWDA 3CSFA 3RA7H 5FB8B 5D1QC 5B4MD 4F9LA 2X4QB 4HHWA 1RZ8A 3UC0L 4R9HA 5CP3H 1ZPUA 3HI6H 1TZAA 2VZTA 5GPRA 1T20A 1EGJH 1AIZA 5LGHH 3TX4A 4DUWA 3W9EB 1BEXA 4QXWA 1KWGA 5LGYA 3SDDA 2VIRA 5ESAA 1MCFA 1MVFA 1N3NB 3ZL4L 1ESOA 4L1TA 4O51B 1SJVA 2VZ1A 4ZFFB 3ARBD 2DD8L 3MZTA 1LEIB 1IFHH 4WTQA 4TVPL 3OBAA 1QUNA 2PXYC 2Y22A 6FABH 2V9RA 1NBQA 4U1SA 3QDGE 1X5MA 5IVZB 1I53A 5E70A 1ET7A 5L4FA 4PJBE 1VZIA 3L4VA 1EUTA 4PH8A 4UT7H 4JFPA 1KCWA 2MNUA 2L4OA 4FQXA 1HYRC 5DQDL 3QXAB 2A3TA 4I0CC 2FJGB 2X44D 4UI2A 1T0MA 2FLRT 3COOA 2WB1A 3VFSB 43CAA 4PJ9C 1Q0XL 4EQ2A 1OIOA 5FFLA 2L7EA 3L3IB 1SVBA 2EIEA 3UBXG 1FRGH 4K8RC 3RTLA 2R0LL 3UFIA 2YWYA 4YLBA 3S36H 4OI8A 4GQZA 3QO0B 1MRCL 1OP9A 2XQYA 3JZYA 3I9IA 3BE1L 3TV3L 4POYA 4FC3E 3ZTNL 3EOTH 4MWFB 4X5RA 2VZUA 1P7KB 4H8WL 5CEXB 2AK4D 3FXIC 3O3EB 4POUB 2L0DA 4PS8A 2B7DT 4N68A 3RGVA 4GINA 5I18H 3VO0A 5EEWA 2AJVL 1A7QH 4DVBB 2EUWA 3QZMA 4K8RH 3UBFA 1OZTG 4W9HC 1CGWA 1UWYA 4HUXB 4P2OA 4PGCA 1SBSL 1E4WL 5DZJA 1IBFA 3I84A 2WZ6A 1ROWA 4LLYB 4AK1A 1CDBA 3J8F7 4M7LL 1KPRA 4IU3B 5GGVY 1KEML 4A7UA 5KS9B 1I9JL 3PJSB 3VU2A 5INCB 3N1FC 5BVPL 4TL4A 4RWYL 3L1OH 5D1ZD 5AZ2H 3LEVL 1YHPA 1A7BA 1JZHA 4NT6A 5E7BA 4CMHB 3IFOA 3MV8B 5D6CB 1P4IH 5KS9F 3VAEA 1NMCB 2DS4A 4J2QA 5DYOB 3X1GA 1AGDA 2DQEL 2D31B 4JO2H 5CZKA 3DJ9A 4MZ2A 4LAJH 3VE0B 1C5CL 5E99H 3Q0HA 2ESVA 1I8LC 2K70A 4R97C 3PIQB 5I1CL 3UG3A 1RXLA 4HFUL 4I2XA 2PTTA 3V95A 1JTTA 5BZWA 1A3LL 3UZVA 3K46A 4ATTA 4MYPA 2Y7NA 1FPTL 1S9WA 1N5YL 3VDCA 4M4RB 3FQTB 4W4OC 5IMKB 1XR8A 3MQIA 3EYVB 5IB3A 3U7YL 1WWBX 3MRBA 3PL6B 2RGSA 5ACZB 2E0PA 2CDGA 3LX9A 1TQVA 3HHMA 4X5XA 3FB7B 3SCMB 4IDJH 4OFYD 3IS0X 2AJSH 4UWQB 4F33B 1XD0A 3F6JA 2NNAA 4OJFL 2DQFB 3JWOC 4MDIB 2ZT9C 1O5PA 4UU9A 1SZNA 1VFMA 1OT2A 2XRAH 1CXKA 4JVUA 4LLUA 5FA4B 3ZRFC 5LUMA 3BP5A 5DJAA 2XN9E 3TBSB 3U6RA 3OJVC 4TYUA 5BQ7A 1U95A 1YEKL 2ALAA 4JO4L 1LNUB 1JDCA 2NR6D 1CGYA 1RZPA 2XVLA 1EEZA 1UEYA 2A77L 2C3GA 3K5RA 5E00A 4JPIB 4BZ1A 2P5WE 2VR7A 3MCKB 1AMYA 1JGIA 4FFZL 5CINH 1GJWA 2ENSA 4PRHE 3WNPA 1YECL 3ZYZA 3DOHA 3JWOH 4Y2OA 5AQ0A 2VDLH 3BWZA 4POZD 4KJQC 1RU9L 3NIGB 4JZJA 1AHWC 3GFUA 5CM1A 4KO5A 3R7QA 3VXUD 1H8LA 2AHIA 1ZTXH 3NT0A 1AQHA 4XCEA 4F8QA 4WV1B 5AOKA 4AQ1B 3M45A 3NIGF 3BEVB 4ZMQA 2FZ3B 3HPJA 4G3YH 4L4VD 3GLAA 5FHBL 3QUMB 5DURB 4ANXA 4Q9CA 4Z5RB 2E9JA 5BZZA 2GSGA 1KJ3H 1QEXA 2YJQA 4NRZB 1LK3H 4F3FB 1HXYA 3TIEB 4R26L 1GKEA 5TDPA 5HJ3B 2IH1A 2NLJB 3Q2NA 1FV1A 3NK3A 2ZOWA 4QHMA 2FD6L 1P84K 3W56A 2DQCH 1DZBA 3CLEH 4BSJA 3BGAA 3QDJD 3QPKA 3TPUA 5H94A 5JXAL 1NKRA 3PDDA 1XBRA 2A73A 1FG2B 3D34A 3TT1L 2WKOF 3X11B 1S9VA 3GDCA 2HJFA 1VRSA 1HSAB 3SPGA 3ATAA 2Q86A 3NFPA 1W15A 3BWAB 4EZJA 5EBLB 1TOXA 5CEYB 2PF6A 1XMWA 1M57B 4PJ9D 3JTSA 2E8ZA 3NJGA 3FZUD 2OKMA 4ZUWB 1HU8A 3REWA 1EFXD 1AO7B 1FZMB 3W39A 1RZ7L 2Z9TA 3BQUC 1IT9H 2R4RH 3FUJA 1IJ9A 4QHNA 2C4FU 1XB8A 5DK0A 1OAYH 4CBZA 2V2TB 4HEPG 2DIBA 5K9JH 4HIIB 4G5AA 4H25B 2WVVB 3EFFA 4GKNB 4JQXC 4W9ZA 3U46A 1NIAA 4WSGA 4EI6B 4YSUA 4TMPA 1F8TL 1EZLA 3ZQ9A 5A6MA 3RDTC 1AIFA 4MNGE 5DS1A 4MA3A 1KGIA 2XXMB 4XVJH 1R3LB 2JIXB 3NN8B 5DMGC 5JIDA 4TTDC 1HNFA 3EO0A 1TU2B 5DHVH 4U6YB 5IVOA 3PNWA 1UADC 1TQBB 5SWZD 1DSFL 3L5XL 5F0PB 5C9KA 2YD2A 1DVYA 4M6NH 2VR3A 1S7UB 3L5JA 3IDGB 1MKFA 1P2CB 3WNNA 2WBJA 5DK2A 5LLIC 1G7MA 2D7PA 3UBXB 2KT6A 5D7JC 1NGXB 5E5LA 3ZZSA 4G6FB 1EMTH 3DVIA 4AK2A 2UZYA 3DV6B 2C7UB 3EIFA 3CFNA 1B4TA 3RA7L 1CVSC 4L9DA 3BZFB 5EBWB 2D2CC 1ZWIB 3HI6L 5E6RB 3TFKC 2E47A 5LGHL 3UYPA 1QNIA 3LS4H 5FKAA 3HJEA 5AFAA 1FIGL 4CJ0A 5BUPA 5I5MA 3GMOA 4OZGB 4JG1H 4FULA 1JAEA 1NAMB 4X80H 4YO0A 3WJMB 3U30B 4K5NA 3L13A 4G72B 4FCHA 1N0LA 3AWFA 1DJWA 1IFHL 1MHEA 2KKQA 3R06B 4DKDC 4FG4A 4OZGF 4I18A 1Q9LB 5IW3A 2HMIC 1U9KA 3QQXA 4P07A 4NAQA 2VDNL 6FABL 1T1YA 1FNSH 4OGXH 1ZLVK 2XYBA 1JPFB 2V5RA 3G5ZB 5J57B 1QR4A 5E1AA 4KKRA 1GAFH 1KLFA 3D06A 4UT7L 4AY0A 3VRJB 3GJFB 2J43A 4O9HH 2EDQA 4HIJA 5E8PA 4Z7OE 3T2QA 2CO4A 2QV4A 3EADA 3MRDA 4OGQC 1NBYB 4PRNB 3O6FA 4M1DH 1PPIA 3IDJB 2AQ2A 5DVPA 1FRGL 2D7QA 5AUMA 4JHWH 5HY9B 5IMLB 5B8CB 3CN0A 3K4ZA 1KZQA 3QEGH 3S36L 4CVZA 2VERA 1SGKA 1WBZA 2ZCKH 4MJIB 3TIDB 4N9GA 3UOAB 3V0HA 1E5UI 5CJXC 3QUZA 3EOTL 4OGZA 3TBYA 2V5SA 2FECI 3LKRA 2OYMA 2DLTA 4IRJA 4PTUB 4H8PA 3NZ8B 3GZOA 4MHHI 2BY3A 2DLIA 2W65B 2WVTA 4KK8D 4WK2B 4Y5VB 3VWKC 3CSPA 3ZW3A 3GEFA 1EERB 1UVQA 4P9MH 4DKFH 5I18L 2BNUB 2D3NA 1A7QL 3RVUC 1YEEH 1BOGB 3FSVA 4K8RL 5IJVA 4OFIA 1FNFA 2D03H 5I73C 1JCKA 3CDZB 2AGJL 3MRRB 3TEYA 4P5KB 5C0AD 1EEYA 1MRFH 3TNMB 5CUSH 3N06B 4LHJB 4OB5H 2AKRB 2GIXA 4MXWH 1RLBA 1WLHA 1ZK9A 3WEBA 2VE6A 2K1MA 5ADPH 3QDME 2L7QA 1KBKA 4JFTA 2F08A 2YBRA 3FQRA 3BP6A 3L1OL 3MLWH 1DQJA 4ZQTA 5CLZA 4JPQA 4RMVA 2AQNA 5AZ2L 2WNXA 3QCUH 4PRBB 5EU6E 3QHZH 1OM9A 3FT0A 1P4IL 4MVBC 4PUBL 4AZ8B 4GXVH 3CPLB 5I66A 3B2UC 1TIUA 4HOMA 2F58H 3E8VA 3X3GL 3HE7C 4GBXA 2ENYA 3RILA 3L4CA 3ZUNC 2CAKA 3CIAA 2J7LA 2G2RB 3DUSB 5F71A 4JO2L 4RFOH 1SVZA 2A4EA 3B6SB 2QZQA 5E99L 2UXFA 4WKXA 2BOBB 5JIIA 5D7KE 3KHQA 2ILLA 5AW7B 3GXFA 3EDKA 3K6SA 1SMAA 1WS8A 2XBDA 4JFEB 5K5YA 4RZKA 4WNQB 4I85A 4KAQH 4WGKA 2GY5A 1SHXA 1ND0B 1JTOA 1KTDB 2XNAA 1Z0NA 4JPWL 4LP5A 5GGRA 2X38A 3HI1A 1NEZG 2N56A 3MV7A 4QHPA 2NT0A 4OD1H 5DHEA 2V9QA 2CBQA 2BP8B 5JIPA 4LB8A 4JVWA 4YHNA 3LHPH 2UWEB 1NC4A 3PWLB 3QUKB 4B3EA 1FCCA 3D1MC 1F4YH 1IX2A 2Y2TA 3D39E 3BVVA 1QW9A 4AVHA 3R8BB 4LCYA 2ZF9A 2UWEF 3APCA 3PXHA 4IDJL 3SIKA 2AJSL 2H0PA 4L1LA 1OZUA 3EXJA 1AFVL 3G6JB 2OTWB 2M8XA 1AXSB 3MTRA 3BQUD 3P77A 1I9EA 2EDTA 4KXZH 5C0DB 1YLBB 3U48A 2AMUA 2ZSWB 3E80A 3LKSA 2XRAL 4PJ5B 2HG5B 3G6JF 1MFVA 3JV4B 5ITBH 1VGKA 1WD9A 4Z7VF 3CG8A 2H26B 3RX5A 3MRIB 3RDTD 3CN3A 3K2MC 1U8CB 1T3FA 5GZNA 1AHMA 4I3SH 2VN6A 3UG5A 3MX0A 4HK0B 4IS6A 5DMGD 2AS5M 2GJZA 3L17A 2F15A 1UD8A 2DICA 4EN3A 4D3CH 4A38A 2NCEA 3F58L 5MEQA 3TO4A 3P3UA 1QLFB 1GCYA 3KCPA 4N8PA 3NESA 4DVRH 5CINL 4Y1TA 3AZUA 3JWOL 4HZ1A 1IKNA 2CGYA 1G7IB 3ISYA 3SN6N 3EJQA 5C8JB 2J2ZA 4PGZA 1ZT1B 1PY9A 4JFDB 5D7JD 2B5IB 3BGFC 3L3OC 1ZTXL 3SDAB 5DD3H 3SOBH 4WDIB 2F7PA 2VDNB 3DI2B 4LSSH 1NANI 2WXRA 2QR0B 4G43A 3WN5C 4KKZA 2IIJA 3LXCA 5HYSA 3NIDE 4G3YL 1FYHB 4XP6H 1YNTA 3OM3B 4KJPD 4KV5F 1NOLA 5C0CB 2XN1A 4KKLC 3HG1E 4JQVA 3MBXH 5H4YA 5CCKH 3ARGB 4KTYA 4HDIA 4HF5H 4X4KA 1S78D 5EZOH 1KJ3L 4E9QA 1LK3L 2HH0L 4G71B 4HH9A 3SQBA 2OMVA 3DMMA 3EDEA 3AQZA 3HZYA 4J8QA 3WIFB 2DQCL 3CLEL 5CHNB 2V3EA 4MB3A 4CVXB 4HLZG 2D3LA 3BAWA 3DHJA 3PWNB 4OU3A 2LTQB 4JY6A 1PEZA 4PVMA 4TUKL 3AXLB 3VFPB 4QJ5B 1LM8V 2C9RA 1OP3K 4WCYH 3QULB 3H7BB 1Z3GH 4A37A 3SKOA 4KMTH 3U36A 1G6RB 2W0FB 2GITA 4PTTB 1KN4H 1MW1A 3S3CB 2YRLA 4GKLA 3BD4A 2WVUA 1BIIB 4XZUA 5DJ2A 4OT1H 5I15H 1IT9L 2R4RL 3KWTA 5A6LA 4CBPA 5E03A 1TSRA 5JPMC 1WBYB 2FCBA 3RVTC 1QG3A 3INOA 5K9JL 1FL5B 5T1LD 3X3FH 2GTWB 2ZX9A 4P46B 4AV0A 1WS7A 5GS1B 1TVHA 2XV3A 1E8WA 3FULA 3TA3C 4DP2X 4XVJL 2VZSA 4J1UA 2C3WA 4XZ4A 5TGBB 1IGCH 3LRSA 1KJVB 3VWKD 2ICES 2ED8A 2MWCA 3GIZH 5C7ZA 2OPCA 1UFUA 2NYYD 4J4PC 5J89A 3RVUD 2IDCA 1ZE3C 5IK3A 1MCNA 4M6NL 2VXTH 3WENA 2IANA 4JY5H 5ADOH 4FF9A 3RFZB 2XZCH 3C8KA 4UNUA 2EVJA 3OJDB 3W2DH 2PPCA 4WO4A 4UQ2A 3IB4A 4P5MB 2EYRA 4RGNC 2KDYA 3VXTA 4PJ7B 1EMTL 5FGBC 3EDDA 1F3DJ 2EQDA 3TBVA 2R83A 2D7TH 3FQUA 2XBZA 2BLFA 3LNGA 3OAZK 4HSCX 4JLRB 5E7FA 3RVXC 3GUTB 5GJTH 3FC8A 1E9OB 2UVEA 4GSRA 1G87A 4PJ7F 1KN2H 4QHUA 3RHWK 3SKJH 3NJLA 1KIQB 1ZE3H 1F97A 2ATPB 4LVNC 2O5YH 3NEEA 3WNOA 3C5SB 5A2IH 3B2UD 3LS4L 2WB7A 2EDXA 2OBGA 4JRYA 3DHPA 5HP5A 3BPNB 2XKSA 3B37A 4QWWD 4P2RB 3LSOB 3HE7D 4JG1L 5DJYA 3F04A 4G8FB 2WXMA 4X80L 4RWHA 3IJ8A 2WQAA 4ESKA 2Y6TE 5H37A 2R23B 4YBLB 3DHUA 2GAZB 3C5JB 4NQTA 1GS8A 5EN3A 2HX7A 3R1GH 5EEYA 4QXVA 4A2EA 3CV5A 1AXTH 4NZDA 4OGXL 1BBDH 3WE6A 3BXNA 1PKQB 3TN0B 3U82B 3HC0B 4ZSOE 4DAGH 5CJOH 2HT4C 3LKNA 3MRPB 5ICUA 3KYKH 4TLTA 4UB0H 3TBTB 4YHKL 5EWIH 3Q5OA 1N59A 3GSOB 1JHTA 4FNTA 2PYEE 4CSTA 3RQ3A 1MAMH 1B0RB 5B39G 3ZDWA 2GHZA 2OMWA 5HHPB 3L3KA 3V0VB 4M1DL 3DGCR 2JI3A 1NIEA 4XMKL 2O6PA 3GEWB 1XBDA 3SE3A 4XVTH 3QEUB 4JHWL 2NDFA 4UZGA 2ICEB 1G7QA 4PREA 3QEGL 4AMXA 3KH3A 4E41B 1CTMA 3MYZA 5BOJA 2ZCKL 3OR6B 1KTCA 3WJJC 3X1EA 5EU5B 1AACA 3OV6A 3BP7A 2F18A 5DD5L 4M6AA 5EA0H 4N0RA 1HH6B 1T1WB 1YG9A 3LPFA 3RB7A 1ZGLA 2EE9A 4UDUB 1QO3B 1BD2D 1NEZB 1X5YA 2ZUQB 4DEPC 4ODBD 4DKFL 5D1XB 3OMAB 1DJZA 4FG0A 4F8LA 1HS6A 1YEEL 4PJXB 2YPLA 3FN0H 2NX5B 4NRXA 2Z8WC 3JVGA 4DH2A 4PMEA 5D6DC 5IMMA 4PJXF 1MRFL 2HLAA 3CH1A 4K9EH 1AKJB 4OB5L 2HKAA 3N85H 4MXWL 5F0MB 3V0EA 3F7KA 5ADPL 2YR3A 4AJYV 5DVKA 4OD2A 4QOKB 1CXIA 5MEND 3KVDD 4HUVB 3FHAA 1IGMH 1QFHA 4TXVB 5SX5H 5H35A 3MLWL 2AABH 3O9WA 4YHML 4I77L 2I60L 3QJVB 1TZ8A 3FTWA 4I0PD 2ZYSA 4EXPX 3QCUL 2IVFC 3QHZL 4KKLD 1QBMH 4YHIB 4Z9KB 3K72A 4GXVL 4XP1L 5B1JA 4YPJA 4MB5A 4MMZC 3CLFH 2F58L 3VGGA 1L9RA 4I4WA 1E4KC 3O8XA 4PPTA 5DZOA 4OJAA 4RFOL 4WU7A 4Z7WA 5KSUA 4AG4H 4YDIH 3QJHB 1FC2D 4QYOB 4S1RL 3WFDH 5JW5B 1AC0A 4D8PA 2F19H 2GJJA 1PU0A 1FFNB 2ODIA 2VM4A 3VI4E 5LBSH 4KAQL 4MJ2A 1DJHA 4GS7C 3P9LA 4GG6B 2ZKMX 3K6FA 1S7XA 5CMAA 2CLRA 4AGNA 1H6TA 1WVZA 4OD1L 4X7DC 1IZJA 3WO4B 3RUGE 5ENWB 4A2GA 3KLSA 4G9DA 1OARH 5D1ZI 1JCVA 1IC1A 3D7PA 1FL6B 2F53B 4UM8B 2F2HA 5KJRH 3TEWA 5AW9B 3SGDH 3DURB 1F4YL 5D2LB 1A3QA 2BH0A 5HHMD 2ARJB 4HP5A 4NO2A 2XTLA 3DWTA 4G7VL 1HX0A 1WZKA 4UTCA 4DHLA 2YJLA 3SPIA 4JFYB 3D33A 4CADB 3FRUA 5D2LF 1M71A 2WD0A 1UM5H 4GAGH 3RVTD 1RHHB 5ITBL 3NJKA 1MXDA 1U58B 1G0YR 1O75A 2JB6B 4Y7OC 3CHQA 4N2HA 4AC2A 3MRCA 4NPYA 1CTNA 1JF1A 4OW6A 2CJUH 3TA3D 3ULVC 3LDBC 3VQ1C 5IBUG 4FLHA 3APFA 4D3CL 4Z8FH 3D85B 4AYBA 43C9B 4E9XA 4DP6X 5C97A 4HU2A 5DUPH 5JIQA 1U8MB 2GSIB 2DL9A 4MGXA 4N8CH 3VFVB 3B2MA 1A0QH 2QLYA 4JANA 1NBCA 3H2QA 2PMZA 2CNYA 5EFIB 1XCXA 4MD0B 4PVNA 1JGLH 1JNLH 1AH1A 4NRYA 1ZLUH 3O4LA 1AOZA 1J05B 1BHGA 2GUOB 2WYZA 2N4IA 2LU7A 3GWJA 4LLMB 5DD3L 3IK2A 3QQ4B 5JW4N 3O6KH 3ULVH 2QPSA 4ZS7H 4HIXH 1KGWA 3U0WL 3KJ4B 4LSQH 4ETYA 3NRFA 2DJSA 2A1WH 1T1XA 3QG6B 3WEOA 1W8OA 1YAIA 4PRIB 1QRNA 3HN5A 3OKKB 4LCUA 4XP6L 5CCKL 3UYRH 3IF1A 4PYGA 3LTVA 3EOAA 1E8YA 3MV7E 4GXUN 5EZOL 2FR4A 3C2SA 4LNVA 3PQYE 5TJWK 4QI3A 1TQTA 2GIMA 3WSQH 1OCCB 4LHUG 2MNWA 3GTNA 4P2CG 4Y5YA 5DZ9A 5ACLA 2YO3A 2LABA 1JMZA 3VSUA 3B3IB 1AD9A 1QPXA 1SDDA 4NYLA 3S4SA 1HHGA 4XP9H 1W16A 3MNWA 2IQAB 2HT4D 5IV2B 5FECA 1F45A 3QAZB 1GHFH 1NBZB 1F02I 4V1DD 1HCVA 1LWJA 4KZ0A 2WQRA 3VB8A 5IR1A 4WCYL 4H2AA 3O3AB 1Z3GL 4LSVH 1HILA 1J9RA 5C07D 3O2WH 1DVSA 1RV6X 5LDUA 1U8HA 4KMTL 4DQOH 3VD9A 2GHWB 3B9KA 4F15C 1EXHA 1KN4L 3NEXA 3U9UA 4ZXBB 4CC4C 4IU2A 4KKQA 5I15L 4DZ8A 3UPRB 1H6EA 4GI6A 4XNZB 3FB8A 4J3BA 3NJMA 1U6AH 4UIMB 4LPWA 3MRKA 1RK1A 4L18A 3X3FL 1U8IB 3CH8A 4ODUA 4JDVB 5GGSB 4MAYA 1BWMA 3JTTA 4B9JA 1H5BB 4M29A 4AT6A 3IGFA 3ISRA 1IGCL 4XOBA 1TYRA 1LO5B 4ONGH 3LQZB 1JV2B 4TQ8A 2IAMC 5B39B 1D5IH 5HJGA 3IJHB 1PZ3A 2GT9B 2Y2YA 5ADOL 2AEQH 1I1FB 2XZCL 1OD9A 2P8LA 3L5WA 2Y4SA 3W2DL 4I9WD 3O6LL 3PRZA 4DCQA 3PE9A 3ZZQA 4QT5B 1I8UA 3DYPA 5BMFH 3EF7A 4L3CB 1ZHBB 2IOOA 2D7TL 1EAJA 1YPZE 2W9DH 4B7IA 3I6SA 1U30A 4JM2B 1KN2L 3NP4A 4LLQA 3SKJL 4MMYB 4HHAB 5T1KD 5FKPA 2O5YL 5F89B 5F3BB 4HKXB 2H9GA 1A7PH 1Q9OB 1S9YB 5BRZE 4KQ4H 4BSWB 3HPLB 3WFCH 3HN3A 2XQBH 3E9UA 3L3HB 3BAIA 3GBMH 3RWHA 4W1TA 3VSTA 1A6UH 3S37X 5KYNA 1CG9B 2Q6WA 1HI6A 5FYLE 3ARUA 3HAEG 3OX8A 3V0IA 1UXLA 1RZJC 1BPVA 4MRBA 4PW4A 1D5MA 1YYCA 3QR2A 4P0DA 3R1GL 5EDSA 3QCTL 1AXTL 4K15A 2C4XA 1BBDL 1TPXC 1XAKA 1ZDQA 2XPGB 2QPDB 1TJMA 3OB0H 1QZNA 2GC7C 4UV7H 4DAGL 5CJOL 3ETBF 5F9DC 1NM4A 3KXFB 1FQ9C 2FGWL 3KYKL 4UB0L 5E6IB 5EWIL 4AC4A 4ZDHB 4JK0D 3A5VA 2R9HC 4M7KH 4ALAC 1T0PB 4OZFG 1MAML 3W0WB 3VJ6A 4MQ7A 4P5TA 3M46A 4ZPVB 1OAUH 4KGLA 4L29A 2IBZX 5DZVA 5FYKH 1V5JA 3PPSA 3L4XA 3L16A 1OW0C 1RZJH 3D18A 1NCIA 3BUIA 4RAHA 4X99B 4PRPA 5C0IB 1HIMH 4GMSH 3WLBB 5CIPB 4NO5B 1I8KB 5IB4A 2V9TA 3EG9B 4YSEA 3FFDB 1T66D 3T9WA 4F37K 1P5UA 3NA9H 2VISB 4DP1X 1FVDA 4Y8DC 3WUWA 4U4IA 2VJ8A 4ZS6C 1B0GA 3PV7A 4ALAH 1SJHA 1YEFH 5IB5B 3ULVD 5EA0L 1L9QA 4PRDB 2OQJB 1E3XA 4ZAKD 3QIWC 3ULUE 2B16A 3ZE2E 3TM6A 4WNSA 3ZR6A 2K45A 4P57B 1V3JA 4S0HA 4JAMB 2DQUH 3RWFB 2JK5B 5DRZB 5EU4A 3WEMA 2X0WA 2C9PA 4DT2A 1YMHA 2Z35A 4F7TA 2YK1H 1G7PA 4JRYE 1MLCB 4BD4A 3OLGA 1B9ZA 2W92A 4K7FA 3IPBA 4PJDB 3SDCC 3VI3A 4QJ4B 4K9EL 4M56A 3L4UA 3N85L 3RJDA 3T1FA 4U6XB 5HDRA 2VC2B 3HLAA 1IGML 5FDYA 3LVEA 3VWJB 1P5VA 2AABL 2EH8H 2W5PA 3FOMB 5GSVB 4XXWA 4AZUA 4ZX3A 4U1JA 1CXFA 3M17B 2C8NA 1SJEA 2HXAA 5IBUB 2O6FA 3PWJA 2CHWA 4L3EE 1A3RH 1JN6B 1N8OE 3CLFL 4XCFH 2GEEA 5I9QB 1VJSA 1DEEB 1EBAA 4AEEA 2D3JA 3EH2A 3MYJB 4GUPB 1S7SB 4AG4L 4A2MA 5F21B 4Y5XC 4YDIL 2VMJA 3PAVA 3WFDL 1J8HB 1CDGA 3KL3A 2F19L 5KYUA 1M6OA 3VFUB 1CDHA 1L0YA 3DHMA 1QR1B 2LAAA 3NCYP 3S97C 2HN7A 1JUFA 2X28A 1J0ZA 2PCFB 3BN9C 3OG6B 4ONHB 5IJKA 1L0QA 1M7DA 3CQPA 4KGJA 2EEXA 4XODA 1PZ2A 1ZS8A 5BRPA 1JYXA 2HTLC 5HDBE 4PI2A 4UQIM 1OGAA 3OAYK 2NNCA 1EQWA 2FQFA 1AR1C 4BKLA 1K3ZA 1SXSA 1KV3A 1GJUA 1A4KA 4UT6A 4C4KO 3PG2A 4LGRB 1T6WA 3Q13A 2Z7ZA 4WQOA 3VFMB 5DVLA 3M1CA 1XWVA 5FR3A 4LHUB 1K5NB 2M1KA 5JHLH 3ZX1A 25C8L 2X2HA 4WWKA 5I75B 3J27A 2PABA 5EEXA 1UB5B 3LXAA 2EXSA 5CZVL 2DTML 2BWDA 4KRLB 1QWUA 2CJUL 3P54A 4NAJA 3NG5A 4TUJB 5D4QA 4LGPB 1SJXA 3DV4B 2V37A 4X0KB 3MNZA 5JQHC 2CNZA 1R3JA 3BPCA 1A1OA 5DUPL 4ZUUB 4QHKJ 4XVUC 2FIKA 2YN3A 2ICWB 3GSVB 4D0CA 1A0QL 4HWZB 1T80A 4X6CE 3BZEB 2NW2B 2VDPH 4GRLC 4GOSA 1R3IH 1JGLL 1JNLL 5KUKA 2O4EA 2BVQB 1C8PA 3KGTA 1KT2B 4N0UA 3MV8D 4Z7WE 2ZJSH 2FBJH 5KYYB 3O6KL 1C1EL 4ZS7L 3HHSA 2RFXB 5J9PB 4PY8J 1TKWB 4LSQL 2A1WL 3BZ4A 1S7TA 1PNDA 2CU9A 4HC1A 4JFXA 1UA6H 1WITA 5HVHB 3UYRL 4L8BA 1EXUB 2VSDA 3MUGB 1J1PH 2COQA 4BWUA 5EIIG 3FN9A 4YC2B 1JXJA 2P42B 4YK4B 1SPDA 1DBAH 1I9RH 5C3IA 2WSDA 1TVBA 4WF7A 3WMQA 3EOBB 1AOHA 3WSQL 1NZRA 1HAWA 1LTXA 5JTWA 3SQOH 5DF0A 1OLZA 1UJ3A 2WSPA 3PL6D 5CGBA 1UM4H 1PYWA 1DZ0A 1U3HB 5EC2A 3VRLF 1KFGA 3SJVA 2HFEA 3WXWL 2GBTA 4S0SD 4IBZA 1GHFL 5DHYA 5FFGA 4LSTH 2CO3A 4OZ4A 5CLYA 5D2NC 4LSVL 3TASA 3HS8A 4CKVX 4C59B 4ZO7A 1YUHA 5FLUA 2QADC 1KF9B 5KSBE 2J5LB 4KNUA 4MB1A 3UAJA 3QS3A 5K39B 2QLVB 1GYVA 2A6JA 1B2YA 2WV3A 1FL3A 1OT1A 3GSNA 3WYRA 5CNHA 3HAEB 5E1HB 2R29A 4YEFA 4Y5VC 5TH2A 1U6AL 1RK0B 1XGRB 3QUYB 3OQRA 3D6GA 3GS0A 2ISDA 3B2DC 2E3VA 2J6EA 4MCMA 1JHLL 2WMPA 5F8RC 4BELD 1U91B 4G8GA 1B9KA 3KLQA 3O4OC 2CRZA 4DF9A 3DUUA 1KGJA 2ZXDA 1O6VA 4ONGL 5DMIL 5EF2A 3QA3A 5FF6A 1H9DA 5I1JH 4OZFB 4TVPD 3IJSB 1D5IL 3GLDA 3DGDA 3GBLA 4P3WA 3CX5K 4Z3HA 1OK8A 2AEQL 1MVUA 4GJTB 1KCVH 1HHIB 1DR9A 3IWUA 4TNFA 2FWOB 5DURD 4WUKH 5BMFL 4DOHB 3CZLA 2H32B 4NIKB 1D7DA 1LWRA 4MDJB 3W82A 2W9DL 2IXQB 4XXDA 2JCCE 2WZ0A 3FQYA 4F1ZA 1IM9D 4UCFA 1SOXA 2YBGA 2R2HA 5M95B 4P5RA 4APQB 1KPUB 2JJWA 3IWVA 4H5SB 2AK1L 1A7PL 5G4OA 4BYHA 3KYAA 4KQ4L 4TL5A 3WFCL 5KUMA 4ACPA 1U0QA 1UJTA 1ZA3B 4EUPH 4P59L 3GBML 2E5EA 3OGCB 4LCIH 4ELMB 1EHLH 1A6UL 2G75A 4Q6IB 3WJLA 2XJKA 1E40A 1KTJA 4QNPF 3ZK0A 4ELMF 4HX1B 4XBPA 1OTUC 1RPUA 1ETB1 4O02A 2B4CH 4UV7L 3GMQB 3QNYB 2NYKA 3IRCA 3BN9D 2I26N 1LE9A 4BKSC 4RZCB 4M7KL 3KWVA 3ULAB 4Y9CA 1UD2A 4G11A 3X12A 2NTFB 1KLGB 1OAUL 1HQRA 5FYKL 1KPVA 3D3VB 1S2EA 2LLGA 1AR1D 2WBXA 3HBZA 3RL2A 1HEZA 2J1YA 3EO1B 3LKPB 4GMSL 4P4KC 2YMXH 3LQMA 2JIXD 3DO7A 5BS0B 4XOEA 2J4WH 3NA9L 2WKLA 4PI0A 2HT2C 1F3DH 1NSNH 1CBVH 4ALAL 1FSKC 1GGCH 1YEFL 4WFFD 4FTVA 4XMWA 5SWSB 3SDDC 1QSFD 4KXZI 3UPAA 2EYTB 1MCBA 3BSZH 2WSKA 4X8GA 2P80A 4U1KB 2ED6A 1DLHB 3VUAA 3B4NA 4EOWH 3IVKB 5HYFA 1EVUA 2DQUL 4G6FD 3SDAC 2H41A 1RULH 4ODTH 2X6UA 3VFRA 4AUUA 4E2OA 1IEHA 1U8KB 2YK1L 4N5ED 2X6AA 3WELA 6TAAA 4JG9A 1IBBA 3BFWA 4JREB 2CIIA 3TBWB 1AMXA 4JFHD 1NCCL 2OJEA 4HWBL 5MEOB 1JYVA 3PWPE 4PJEE 2MCAA 2DI8A 4LCWE 3I9GL 5SWQA 1IQDB 2KLTA 4ZMTA 1KDJA 3RWDA 2BSDA 2BMKB 5MI0B 2LU4A 1AP2A 4DP0X 3AJ7A 2MHAB 3UTPD 4JFSA 2QQKH 1LO2H 2AJXH 1Z5HA 4N0FB 1JG9A 4U3HA 1NGPH 3VG0L 1A3RL 1AANA 4XCFL 3G6AA 2ZICA 4WJ5A 4JMNA 4BA0A 3M1BA 4PLKC 5DSCA 2UZXB 5JO5B 3D25B 4FFVC 4L5FE 4Y1AB 4XN1A 1LD9B 1W72H 4F20A 3HW7A 5DUBA 1A66A 3QEQB 4UZSA 1FC1A 1U33A 1YNLH 3DX9B 3H9SB 4OSUH 4UZUA 5FW8A 4PWJA 1Y7VA 5AAPA 2WTRA 3VTMA 4HJGA 2X87A 1NFIA 3CVBA 3R0MA 2X2IA 2YS4A 3MSPA 4F5CA 5CGTA 4C56A 4LLDA 2EIZA 1ACZA 1MDAA 1T22A 4OIBA 3T3MB 1IM3B 2H2PC 4A6YB 2VR6A 3UTZA 4MJID 4TQIA 3MFFB 1SYSA 3V6ZA 5EIIB 2EYSA 3FF8A 3I6KA 3D07A 3F01A 4PJGE 3SE4A 3TWYA 5HHOB 1C9SA 4IMKA 1BVKA 1AGBA 4IRZH 3SKNA 4K7PH 2WINA 3ZZLA 4RSVA 3JT2A 2A9DA 3U6XA 3GK8H 3T4AA 5JHLL 1QYGH 1UKQA 2XQ0A 3DX7B 5FAAA 2IDSA 3KG5A 2EDEA 4F2MB 1J5DA 1LXMA 5D9SA 4M00A 3RI5K 3KPOA 1P4LB 1J48A 4BRJA 4F7CA 2VDKH 3DECA 4TRPH 2R2EB 3PWUB 3D9AH 1MWOA 3IMUA 3KPMA 2VDOH 5AOIA