2G0KA

Solution structure of neocarzinostatin apo-protein
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
113
structure length
113
Chain Sequence
AAPTATVTPSSGLSDGTVVKVAGAGLQAGTAYDVGQCAWVDTGVLACNPADFSSVTADANGSASTSLTVRRSFEGFLFDGTRWGTVDCTTAACQVGLSDAAGNGPEGVAISFN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Antibiotic
molecule keywords Neocarzinostatin
publication title Synthetic Ligands for Apo-Neocarzinostatin
pubmed doi rcsb
source organism Streptomyces carzinostaticus
total genus 12
structure length 113
sequence length 113
ec nomenclature
pdb deposition date 2006-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00960 Neocarzinostat Neocarzinostatin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.230 Mainly Beta Sandwich Immunoglobulin-like Neocarzinostatin-like 2g0kA00
2CBTA 1J48A 1ACXA 2CBQA 4JW3A 2MCMA 1AKPA 1HZKA 2G0KA 1NCOA 1O5PA 1J5HA 2CBMA 2CBOA 1J5IA 2G0LA 1NOAA 1HZLA
chains in the Genus database with same CATH superfamily
2BRRH 3KPLA 1K8DB 4U1GB 3T1WA 1S5HA 4ZTEA 4S1QL 4HS8L 3P30H 3Q7JA 1SJMA 4AX3A 4ZNEA 3N04A 3STBA 1QFWL 3T04D 2F18A 3KD4A 2EH8H 3GF8A 1OTUC 3H42L 3E8VA 1CXIA 4HISA 4AVKA 2EINB 3UPCA 3FOMB 5FYLE 2D03H 3SJVE 5FK9A 3TL5A 4B7IA 3ARDD 4LNRB 3VDAA 1UURA 5F7MC 2WQRA 2I9LB 3QQ9D 3ZYJA 1IGFH 1UT2A 3OHXC 4PJ6A 4JK0D 2JKIS 3KDMA 3BVXA 1UOWA 3MRHB 1MNUH 2NW2A 2XC8A 1CXFA 3GSOB 4LT7A 3EZ8A 5IFAL 4DN3L 1GRWA 5EB9A 2B1HH 1J1OH 3VFVB 4KZDH 2XFXA 5E6IA 3OG4B 4QHKI 4NRXA 1XGQB 3GGWA 1CF8H 2CIKB 3IU4H 5C6TH 5KS9F 1RZ8B 4ZAKB 1DVFD 3ABZA 2UY7B 4K9JA 4KX7A 3ZSSA 4F9LA 1YC7A 3C6SB 2EIKB 5MEOA 2GJ6D 3C2SA 3DRQB 5T1JA 4FXTA 1V3LA 4LSUH 4XMKH 4HEME 5CIPB 3ARED 4PHXA 3GSQA 5C0NC 3FHAA 3K5SA 1JGDB 5FIEA 3CVDA 3GSXB 4YL9A 2VDNB 4YDVB 2XNAB 5D2LB 3PQYD 2Y7QB 5GJTH 3UZQA 1CICD 4TSCL 4PLNC 2WVTA 5J57B 1JZ8A 5CF3A 3S5LA 5IT2H 1ZLSH 3NBNA 1AJ7H 1A4JA 2FIKA 4IRJB 3I3BA 5E1AB 2VMFA 3BZ4A 5E1HB 4N1EA 2IVFC 1FFTB 4GQQA 3NJVA 5F9WB 4OJEH 1WV7T 1XSKA 1DJIA 5D7HA 5B1BB 1E0OB 1M3IA 4AGOA 2IG2L 2CO7A 1R3IH 3BQUC 5FYKL 2PNDA 4AITA 5HHVL 3WNMA 4ZMZA 4LVHB 5DTFB 4UNTA 2BK8A 3FCBA 2VXUL 1SVBA 3JVFC 1G6RA 2X3AA 3B1TA 2NNFA 2AZAA 4ZX4A 2HRPH 4QRPE 2GSIB 2WYHA 2PKDA 4X6CB 1E27B 5C0BB 4WW2A 5D70L 1DSFL 4X2UA 4JJOA 3IWUA 3HAEA 1W16A 3NSDA 3W11D 4LASH 2NY3B 2PO6A 4U0RB 2ZXWB 5BV7B 1I1AA 4WHYH 3LZPA 3K8MA 4G7YH 3ZKMD 1FC2D 2A9CA 2NXZC 4PJ8B 1FFPB 2DLHA 2PF6A 3GZPA 1BFSA 4Y9BA 2ZWLT 3AAZB 3OD3A 3IVKA 1BFOA 4MCMA 4OFPA 4HH8A 1PKOA 3LXCA 4JFZL 5C07A 1U8JB 1F42A 3O0RL 1V5JA 4LOVA 3LJ3A 2A2QT 4K7FB 2VLJB 4EIZC 4J3OG 4CBZA 3RZCC 3FF8A 3UTTE 1OSZA 3I6GB 1UFUA 4OF6A 3RDTA 1N10A 1YEKL 4NNXA 4M6MH 2H8PA 2WXGA 1I9RL 1JZDC 3DMMD 4H8WL 3QZOA 5F2FA 4HWUA 4ZOAA 3GRBA 3TN0D 2ICCA 2GW5A 4ZX3A 3DX0A 4XNQB 1K4DA 1JD7A 1LD9A 3MNWB 4UQ3A 2QPFA 5IHUH 5C7ZA 1MAJA 2RFXA 3S3DB 4ZNCD 5MHSD 2A9AA 3BMWA 1HAUA 4D7BA 43CAA 3RGVC 3MV7A 1ZCRA 4R84A 3SO3C 3FO9B 4YHML 5FCUH 3U7AA 3GPSA 1H8NA 1EANA 1GHFH 5ACMA 2ZWSA 2VM4A 3BVTA 4MHHG 3RY5A 3STLA 4Y5VC 5DZNA 4HVBA 2ZCKH 4EO5A 4AG4H 4UDTA 3LYRA 4NKOA 4JFDB 4JQIH 5EZJA 1D6VL 4HJTA 2AVFA 2OI9B 4BFKA 4X83A 2VDKH 1W8EA 3C60B 3U4BL 3BD3A 3US1A 2YJLA 3NT0A 4NXSA 3JTSB 4JG9A 1VFAA 1RZFL 3AT8A 3BP7A 3K91A 4R83A 4ABWA 4RWYL 2ISDA 1YCSA 1YJDH 2Z1KA 5CN1A 3KBHE 4TNWK 1HKFA 2WBJC 1XF5B 1WISA 5DLMH 3CLWA 3WEXA 4E9LA 1KN2H 4NN7C 3GMNB 4OD2B 4U2YA 1EMTH 2PWFA 1F18A 2Q8BL 3FQUB 5E5MA 2EADA 3IF1B 4GW1B 4FFZH 4JM2B 3LQMA 4NP9A 3JT0A 1FL6B 5AW9B 32C2B 3GKWL 4G8GB 2J20A 3X3FH 3WYRA 3BPLC 1H6UA 1TTGA 3VA2C 5CCJA 1CD1B 4MQTB 3K46A 2YEQA 3ULSA 4KC3B 1OP3K 4HOZA 2BSBA 4HBQA 1QI5A 5JO5B 1F11B 1QHOA 1U8MA 4JFEE 3UYPA 4C58B 4NERA 4H1LB 4KVNL 2BZ7A 1P6WA 1BZ9B 1HSBA 4HJGB 4XPBH 5E8OB 4B96A 4M61A 2VW4A 2QV2A 3HI5H 4X6DE 9CGTA 4QRSB 4FQXD 1FYTD 1OW0C 2HG5A 5ESQB 4W4NA 1P1ZB 3WTSA 1F6AB 4QWWC 4M7JH 1NLDL 1Q72H 3BEVA 3RURA 4LARH 4HJJH 4QRTB 3U36A 3CBJB 4PRNA 4K07A 5AEAA 5E56A 2EDQA 5HYJA 1L9SA 1SYVB 3DURA 3WFCH 2ICES 4YDJA 2ODIA 3C5ZA 5DLLA 1Z5YD 3ARPA 4JREB 1DJGA 3HTLX 3V95A 2X89D 5T1MB 4JFFB 4LHQB 2JF1A 4CDHA 5F6HJ 4XP5L 2G75A 5CJOH 3BUTA 4ZS6C 3S6CA 5BUAA 4OZHA 4TNEA 4Z7UB 3ARDA 4GAYA 1BQHG 1SLVA 4AIEA 2VDQL 3SYPA 2YQGA 3C08L 4Z7WA 1HX0A 3QZWA 2F8OA 3AS2A 4X9BA 3UBXG 4WY7L 1IC1A 1I9IL 2AK1H 2O6CA 3H6AA 2XZAL 4FZEH 4A2DA 2EVHA 2EEXA 2CO6A 5F88A 5DD6A 4MSWB 1HZHH 3U46A 4H26A 3U0TA 4M1DL 3KGTA 4LF3B 2MEJB 4KNSA 4P4KB 2JI2A 1J10A 2R1WB 1PZ5A 2YAMA 4KJPC 2AV1A 2QMKA 4NQSA 3ARZA 4M5YL 4N0RA 2XBDA 4PJBE 1OLZA 4M02A 1GJIA 3M1CA 2WXJA 5FUOL 4JY5L 1OD9A 4YHNA 2JFCA 3TH2T 1KOAA 2YA1A 2WW8A 1CFTA 3H2QA 3N3EA 5IBUG 1BLNA 3R06A 2A6DA 1BIIB 2A0LD 3S3BB 1WJ3A 3HE6C 3MOBH 5E9DB 5HDQH 5ILTL 5K69A 1N9PA 2VWEC 4TN9A 5DR5L 3RYMA 1SF3A 3RU8L 3PQYA 4K23H 4Y88A 3BKYH 1CICA 4ACPA 3N42B 4YVUA 3ZTNL 2LTQB 3VXTA 2ITCB 3RY6C 3CC5A 3GDBA 1MKFA 2H6UA 1ILSA 4EIBA 5CR8A 4MJID 3VG0H 1EXUA 4XODA 4OGYH 1S7WA 4ALAL 1BM3H 3MUJA 4WW1B 3IDXH 4X80L 1DQJA 5CFHA 2PTTB 3CFBB 4KY1H 1KWGA 1ZVNA 1QKZH 4U1IB 2OMVA 2EE3A 3TTSA 4X5WA 1IGCH 1KGWA 3VFOB 5C2BH 3BKMH 4GI6A 3B9KC 1GGCH 4L8DB 2FLMA 4JR9H 5DGQA 2IF7A 1MJJB 4JN1L 1RZ7L 4MASA 4OVUA 1OE1A 4KXAA 1TZGH 1ZANH 4K7PX 5DJDB 3L3HB 1NBZA 1T89C 2OMXA 2C3HA 6PAZA 5FO7A 5ITBH 2WAHA 3QUHA 4A6YB 3QIUD 1RUQH 2GTWA 2HFEB 5C3TA 3JYBA 1Y1UA 5DS1A 1YEDA 1A14L 3H2WA 5HHME 1C9SA 1OCWH 3G7TA 4L29A 3PWNB 1FVEA 1LEIA 2G5BB 3N1PC 3HG1A 2A9MH 1ZWIA 1DZBA 1MDTA 1SDAB 1IGFL 1PZCA 5I71C 1XV8A 2GCYB 2IADB 3MUY1 2B3RA 3O8XB 4RSYA 3T0AA 2P5EB 1MFAH 2V4LA 1XH1A 2ESVD 1JRHI 4FI8A 4GXVH 4PY7B 5BXFA 2ADFH 3T3ME 4PB0L 2IAAC 1TVBA 2CUHA 2X12A 3T6VA 4KZDL 2GTZA 4LCWD 2BXYA 1MREH 4KNQA 3L4WA 1BVNP 1HU8A 3NCWA 4TTDD 5ADOH 4JFSA 3NCBB 4NRYB 4OJCA 2EUVA 3IU4L 1X7SA 5EBGA 2XWTB 3O9WC 1A3QA 4V1DD 5DEFB 4NQTA 2NY2C 3II3A 3LN4B 2MQ3A 2E8ZA 3VM7A 3TN0A 4YE4H 4F2MA 2YHGA 2BP8A 3AQYA 3V6ZA 2YD1A 4OZIB 4NS0A 1MH5B 3HZMA 4HZLA 1LEKA 3LIZH 4OZGB 3RY4A 1M2VA 1ZHLB 5EBMB 1JE6A 1OV8A 4C55A 4D3CL 1UYWH 1F00I 1R3LB 5CFAA 4NM4H 2LU4A 1SNRA 2PR4L 3I9AA 5DC2A 4ZFFA 1FG2B 1L7TL 1BOGA 2WZ6A 1KTRL 5TDPA 4TVPD 5DS8A 3DYPA 1AJ7L 3C8KA 4XNMB 4LSDA 3WFEH 1HQ4B 1MCOH 1U92A 1UH2A 4EOWH 2WXKA 4KKQA 3KEDA 5KUMA 4Y16B 2BVQB 4LMQI 3QR0A 1S3KH 2F8VA 1FP5A 2VXQL 3UEQA 3BIKA 3IYLW 3QZPA 3ESNA 3KWVA 3SHSA 1CD8A 4JFVA 5D1XD 1JDCA 2DI7A 1R3IL 3UBFA 5GS1C 2W95A 3VU1A 2NLJA 2VN5A 3F7LA 4QJ5B 3MX0A 2DJ4A 2GEEA 5D5ME 4YNYA 4I1RA 2V0AA 4NBXB 2XZZA 3PGFH 1BX2A 3QPQC 4PS3A 5AW5B 5GGSB 2HRPL 5HYFA 4XVUC 1A8ZA 3G6DH 3CMGA 3VRIB 1RQ5A 4OCLC 3CK0H 1CVSC 2NNAA 4UQBA 1OD7A 2H26A 3G04B 1FZOB 3CC1A 5F9DC 4TUUA 2Y6TE 3HN5A 1HNFA 1I9JL 3CDGB 4LRNH 2HXAA 3ZT5A 3ISRA 3R7QA 1YY8B 3NFPA 3PREA 3CAFA 4CMHC 1PF3A 3QI9D 1E6JH 2YFOA 3JZYA 2VLRB 2L8AA 3FDWA 5IIEA 2KLRA 1XB3A 4OKVB 5F89B 3T0EC 5KVEH 2JKWA 5DGRA 1K4CA 2X2YA 4PUBL 1J88A 2NMSA 4MS8C 4UQIM 1UWFA 3GTNA 5AQ0A 3BUIA 2F1AA 5TH2A 2C9PA 2F1EA 4FQXA 2F74A 3VXUD 2DLFL 3RWDB 3SQRA 2EUZA 4L4VA 3WDIA 4DETA 4HCRH 4KK5D 1MN4A 3L48A 4CJ1A 2C9RA 1HYSC 5ALCL 5GRYA 2AS5M 4XCYA 4M6ML 5H37H 4PJXF 2OZ4H 3V0IA 3B83A 2QPDB 3QUYD 3SE9H 1QSED 5IBTL 2X89A 3VNYA 5DXWA 4C4BA 3VXOA 1DTUA 4X6DF 3QGVA 3BKCH 2XN2A 3GXMA 4OUUB 2YAOA 4H40A 3BSZA 4IRZL 2EUWA 3SOTA 5J0BA 3VYPA 3MRRA 4N22A 2W38A 4TRPL 3FT3A 3OTTA 5HDBB 3GSNA 4MMXA 5FCUL 3G6AA 2NW3B 2J8UE 2O1AA 2FL5A 3S34H 3BUYA 4FNLH 1GHFL 4WV1B 1MWAH 5JORB 1CXKA 1I1FA 4D9LL 5JIHA 4Y4KD 5IROD 4WSKA 3DECA 2Q7YA 2NUTA 4FQIH 2EDJA 2VO5A 3OG6B 5I1AB 2K8QA 3ZXAC 4QEGA 5E6IC 2IV8A 2Q0ZX 3L4YA 4NB7A 2GFBB 5AKRA 5H94B 3Q5YA 4ZO8A 1TPXB 3W5NA 4OCXL 3FT4B 2W9DL 2YEVB 1M71B 1PJ9A 2ZOOA 5DVLA 4M7ZC 1PNDA 5LAXA 3FH5A 5DLML 4F9LC 2O6EA 3O2VH 2BSSA 3ASOB 3V4VL 1EMTL 1TJGH 2AXWA 1AIFA 1PCSA 2UUDH 3ZX1A 3N1QC 4KX9A 5DDHA 1ADQA 3EO0A 2AK4E 2EACA 2BERA 2V5MA 3GLDA 1T1YB 9PCYA 2ENQA 4U1SA 3BEWB 2C3VB 5EUKB 2QZ5A 3ETBF 3GMRA 3S37L 4N0UE 4NO5B 1WCBB 1CPUA 4OIIH 1KYFA 4FKHA 4XBMA 1FQ9C 1ETA1 1U36A 5E9NA 3T2LA 3II2A 2FECI 3K71A 5EN3A 4I85A 3K6IA 1E5ZA 4UQEA 4AYBA 1MSPA 4JO1H 4YSAA 1JCKA 1AGBB 3MRCA 4PJDA 2ICWJ 4EVNA 4ODXB 2QQNH 1KCRH 1IAKA 1EAJA 1F4WH 4NDMA 1Z5HA 2YD3A 3V4UH 3WKNA 1G94A 4LARL 2OL3A 2D3JA 3EO9L 1JTTA 3KLLA 4XMZA 2E46A 4UTBA 3LH8A 5I1HH 1PQZB 5H4YA 3KS0H 3WFCL 2OMZA 2CNZA 4X4XB 4WW2C 3F8UB 5FCSH 2CUMA 3LTVA 1KLFA 5CZRA 5C0CB 2OMWB 4FI6A 3QIUA 4LOFA 3UC0H 1H0DA 1LNUB 2BS71 4OTXL 4Y8DC 3ARFD 1SJHA 2PO6C 2I60H 4X99B 2DJMA 2XWCA 4FLHA 3MJ9L 3VXSE 1I1AC 2AMGA 5DZPA 4KI5E 4DGUA 4DP4X 4PS4H 1LMIA 1EK3A 1U95A 1RZJC 3CTTA 1XR9A 5G5DB 3MJWA 1SJVA 1XGPA 1MZYA 4M48H 4TLSA 1R33A 2DTMH 1X5XA 4RMUA 4U6HB 4N2IA 2AK1L 3CZSA 3B5TA 4DWHA 2VL5A 4J4PD 3WDHA 4H7VA 2BNQD 2ESVA 2EUXA 5GZOD 2XTJE 5CWSB 2F58H 5BRZD 3BGMA 1LQSR 4GIOA 2CO3A 4UI2A 2WVSA 4ZMQA 4X8XA 4IU2B 4LCWA 5I0WA 5FKPA 2DMHA 3GRWA 5GS0H 5DD3L 1B0IA 4WU7A 4OVVA 3LQAH 3RDTC 1ONQA 3LV3B 1VFOA 4NGHL 1NUNB 5EORL 2WZPA 1BMGA 1DBMH 1NLBH 1TMCB 2AKRB 3KPNB 4URTB 2Q8AH 2ZWZA 3UABA 5CGTA 1ILUA 1E28B 1SOSA 2XQYG 4YFLF 3WIFA 2JKNA 4OBRA 4BWTA 4KITB 4RAVB 1ND0B 1G7PA 3PNWA 3VWJB 3CDYA 1WF5A 1CGVA 1I1YA 1MCSA 4NT6A 4PRHD 3BWAA 3HR5B 5AB0A 3T3MF 5GRWA 4G9DB 4YXHL 1URLA 1NGPH 3BKYL 1NGWA 4X4ZA 4F92B 3DGGA 4GFXA 5JPMA 5T1KB 2LAGB 4BWUA 4FTDA 1FG9C 1Q9LB 1A4KA 4GAAA 3VG0L 3LXUX 4OGYL 1BM3L 2AABL 2VITB 1OARH 2AF2A 3W9DB 2UYLB 4S11A 2B2XH 3VD0A 3H85A 2DM3A 2ZCLH 2OK0L 4LLYA 4L4TE 1NPJA 4DTGH 5J6GA 1QKZL 2MTAA 2V7NA 1KG0B 2WLZA 3OKDB 4JHAH 5D1XA 1Z9OA 2EIBA 4HEPG 5EIIA 3QWQB 3QIBA 2VJXA 1J9QA 3M17B 4WFHD 3CHSA 2WLYA 1GGCL 1ZSDB 2X1OA 3EGXB 2ZYHA 3F7VA 4BH8A 5LXVA 1T0MA 3FB5A 5SWSD 1U8NA 3IDIA 2B3IA 2OMYA 2AJZA 2CSPA 1TZGL 1DYZA 1RZPA 1ZANL 2YKKA 4F8LA 3PYCA 4ICXA 4OZFB 1LK2B 1S4IA 5JW3H 2BDNH 3OF6D 3WHE0 4PJCB 4DGVH 4U31A 1BQKA 2X4OA 4XR8C 3T0BA 4JFPB 1QABA 1CDCA 1ECYA 1G4RA 1RUQL 2W65A 4PJ5B 5AW7B 4HC1L 5IQOA 1INQA 5A2JH 2H3NB 2A38A 4A2GA 1X5MA 4XP9H 3QI9A 1JXJA 1CK0H 3VFTA 2AJVH 4OIAA 2CHZA 3V9FA 2VLKB 1CFQA 1Q94A 4OD3H 3UJJL 5JMOC 2FEDD 4EI0A 5D5MF 1IEHA 2XYBA 3IJSA 3SDCD 3B3IB 1XCQB 4G6MH 3UERA 1W72L 4PJGA 4B9YA 5DO8A 1IQWH 4QRRB 1RJCA 3QUGA 3VXUA 4ONHA 4GBXD 3BZ5A 4NAJA 4DVBA 2AGJH 4GXVL 2X4PA 4AYEC 1FL5A 1O7DC 1WWWX 3OHXB 5GGRA 4C4KT 1N2RA 5I82A 2QKIB 3QUZD 3EGSA 1JVLA 2K3TA 2XQBH 4Y2DD 1KYAA 1FE8H 5ADOL 1CLOH 3GS0A 1DFBH 3F04A 4ZFOB 2C8NA 4QOKA 3H3KA 1XGTB 1V8HA 3WY1A 3WIIH 5FB8A 1N67A 1YMHA 5HYSG 1J0JA 3QUYA 3C5ZC 4L3ED 2VM9A 1QSEA 1AR1D 3L1FA 2FX8H 2VIRA 1LE9B 4N2HA 3NP4A 4HV8B 5E5LA 5SV3A 1LK3L 2XKNA 1DBBH 3GSVA 4LLMA 1U3HD 1UYWL 5IOKA 4Q7DA 3HOGA 4GOSA 3ARDC 5E4OA 4AT6A 4NM4L 4KROB 2E27L 2HFFA 3QQ9C 4UANA 4TUKH 3TIEB 3CLEL 3VFMA 1E8ZA 1EVTC 5IROA 3SGDH 4RDQG 2WUCL 3AY4A 4YOKA 3F58L 4LVNC 4D94A 1EFQA 3FU7B 1HKLL 3G6JA 4BZ1H 4MA7H 2DH3A 4RFEA 4WFGD 3D39B 4ZX5A 1WA2X 2C9SA 1NKRA 5HI3D 3H2PA 1S7XA 3C5JA 35C8L 2I32A 1MI5D 2O5ZH 2G2RA 3F5WA 3WE1A 1NGQH 2QPSA 1UWYA 3EDJA 1NDTA 1RVFL 2ZYSA 4J3SA 5AFAA 4HPYL 1G7JB 3ROLB 1UATA 4BFIB 2EDHA 3UBGA 2J8UF 1K8IB 4C83A 1OE3A 2BINA 4PRIA 3KLDA 3QNXB 2WN3A 2GI0A 3HLAB 3PGFL 5IESL 3GJEA 2HUHA 3CHQA 5C0AD 4WHTB 5AVZB 3GO1H 3BWZA 1QR1B 3ZR6A 4CVXB 2WIIA 1KTDB 2HB0A 2FO4B 1OAJA 4ZYKA 2JKXA 4G8FB 3NEOA 4B95C 1CICC 4LRNL 3SKMA 2J1XA 4Z78B 3I9PA 5TE7L 5DJZB 3AG2B 1NIEA 4EI6A 1OF0A 5D2NA 4KVPA 2VDRL 2OSWA 2NDGA 5LGJA 3ULUH 5BV7H 1C5BH 2KERA 2XA8L 2GK0B 2R2BA 5KN5A 1JZJA 3FCUB 4LQFH 3T1FB 4UINH 1PCXA 1P7HL 1QQDA 3VXPB 1SEBA 3V6FB 3QCTH 3VRLE 4DZBB 2DMKA 2WKLA 3CZUB 4HETA 4JPIA 2ZG2A 1QNIA 5ETUB 4UOW0 2NXZB 5IB3A 5A6MA 1XIWD 4P5MA 2N4IA 3Q2NA 3ZE2B 5MEPA 1ECZA 1PAZA 5BQ7A 1H3PL 1KZQA 1KYOJ 3L7EA 4HCRL 5GGVH 4Y5XA 3GC3A 4JZJA 5F0PB 1UKTA 3UZEA 4YSSA 3GTTA 1IL1B 1W15A 5EH1A 1X5FA 1ZT1B 4YLQT 2KHAA 5ISZD 1IV8A 4YR6B 3RZCB 4AEIH 3ETBJ 1G9NH 2ATPA 2IFFL 5KJ4A 4Q9RH 2C9QA 3W11C 4CVUA 3S36X 4KFZC 3ARFA 3FZUD 1HEZA 1ZHKB 2WYIA 2D4FA 3MRFB 1TZHB 4I3RL 3T4YB 4BFOA 4PQXA 1DUZB 3ZKMC 4HKZB 3V9EA 4CGUB 2RQ8A 3D8MA 2XV6B 5KG9A 3CFKA 4PWJA 1OAZH 3QNYB 5D1ZD 4WNSA 1XH3A 4YN3A 2PW2A 2ITDA 4JO2H 4DKDC 1MWAL 1GYAA 2JB6B 2K6YA 2WQVA 1VENA 3RGVB 1QLRA 2BNQA 1I8MA 2EDEA 4LLAA 3O45A 5GGSY 5BRZA 3V6BR 5FOBB 5GZOA 2AXFB 5ERWB 2WOYA 5BUPA 5FFLA 4G72B 3A0OA 4Y5VB 1B2YA 1C16A 3WKPA 1IEBB 3JV5A 1SN2A 4NWUH 4KI5F 4UV7H 3WNPA 4G59C 3E8UH 2EJ1A 4PJHB 4X98B 3U25A 3Q1SH 3GSUB 3TN0C 3HZKA 4AE1A 4G42B 3NIGB 1C08B 1DLFH 3SJVD 5KS9A 1RK1B 2YD0A 1ZTXH 1S9YB 3G5WA 4MVBD 3CZLA 4S2SA 4E2OA 4UT6H 1TJGL 4YHIA 4PRHA 1XSJA 1UH3A 2WBJB 5DI8A 1HINH 3IBEA 2PCPA 3KBEA 2YK1H 1MUJB 2EVFA 1MIML 1AGEA 4FZ8H 4FYSA 3ZRFC 4NN7B 5J1TC 2A4EA 1FVCB 4MJ6A 2XRAH 1WBYA 3NJLA 1JZHA 3FONA 1CYXA 2X1PA 1XDTT 2WQXA 5D7IA 3FN0H 5I1IH 5J6HA 3BPLB 4BK5A 2UZXA 4IW4C 4KMTH 2J1ZA 3HB3D 3P4MB 4AM0A 2ADGB 4LHUG 2CJUH 4UZUA 4RQQB 4MDRA 4XCEA 3TGXA 1AYRA 3W39B 1KCRL 4GRWH 1TMQA 1MCNA 1MVFA 2VDLB 5SWSA 3H7BB 2E76C 4BBWA 2CLZA 2OQJB 1IBGL 4GKSB 1WSST 4PGBB 2ICEA 5K9JH 3VI4E 1A3RL 4A55A 4G70B 1BZEA 3LRLA 1I1RA 2R9HD 4UB0L 3SDAD 4F37K 3OF6A 1J9RA 4H25B 2AI0H 3ZU8A 1D3CA 1RZGA 1R24B 3UC0L 5JA8B 1AXIB 1R5VA 5DRNA 3MGTA 3MLVH 2I60L 3CDCA 3FTXA 5CINL 3B56A 3NCYP 4J3VA 4PS4L 4JRXB 3SDCA 4HP5A 4AEEA 3NTCH 3RVUD 2CUIA 3MYZA 3LNIA 1KYUA 2DTML 3IN0A 2IPTH 2W60B 2ZOKA 4FD0A 1FNAA 1Z3RA 2W9LA 5KW9H 3D48R 2VN4A 2XQ0A 4GBXA 2J3SA 4U1MA 4FQXC 5AVYB 1FAIL 3L2MA 4ZUUA 1K5NB 1HHKB 5JQ6H 2VDOH 1BVKB 2F58L 4WNQA 3V55A 3W0WB 5IMLB 2BNUB 3S37X 5FKAB 1O6SB 4GRMB 4Y2DA 2Z9TA 1M7DB 4P23A 2Z4QA 4K8RH 3GMMA 5LWYH 3BESR 1IEAB 1GYCA 2Z92A 3ZYOA 1OOAA 1DBML 1NLBL 4M5SA 1Z5LB 5I8CA 4GP5B 4R7DA 3SE6A 4CU8A 4BUHA 2QDVA 1SVZA 4Z77B 4JY6A 3S96B 4MA8H 4X5QA 2FWOA 1N0LA 4X6BB 5D7LB 3MLWH 4MNQD 1LM8V 2EYRB 3T8MA 3W56A 3O2DA 4UMSA 3TFKD 2RALA 4PJEB 4B9JA 3KPSE 1NGPL 1UD2A 4LSQL 4S0TD 1T21B 4MMXC 4XX1E 2LT9A 3HE6B 3MJ7A 4L2YA 1OTSD 2FJFB 3MRJA 4WK4B 3O6LL 5AOJA 2OLDA 5GIRA 2VXVH 5GRVL 3O6FD 3D30A 3UTTD 1EJ6A 3WUWA 2XVKA 5DC9B 3RVVD 3C2AH 4L8SA 5J11C 3KL3A 5KBKA 3DROA 4WHYG 1BMZA 1N0XH 4PYGA 2B2XL 4LSRH 1CGTA 2D7TH 2WB1A 3VXQA 5FUZH 1A6TA 5CILH 3CCHA 2VZOA 1RHHB 1SVCP 1I31A 1PY9A 3B2VH 4JHAL 1J0IA 3S4SA 2A1WH 3PY9A 2ZOTA 4HIHB 4QRAA 1DDHA 2B14A 4Q52A 4FHKA 3ZKXC 1YEHH 4AKQA 5BVPH 2NCEA 4Q2ZA 3AMKA 1AD9B 3EFOA 3MUUA 3MJ8B 1O0VA 4B50A 5C0AA 2A0LC 4PI0A 1UB6B 3QXAA 3RP1A 1GC1H 5BS0B 2EIZB 3B9KB 4FXGB 1Z9NA 2C1PB 2VRQA 3E0GA 1V3JA 2BDNL 4DGVL 3NFNB 4OCMC 4PTUA 3WE6B 3WXWH 1ZRUA 2K6ZA 2HLFD 2A6JA 3JV0A 4A6YH 4BE6A 3QXDB 1F3DJ 1FV1A 4XP1H 1DBKH 2AJVL 5DUBB 3UG4A 4ZUVB 1ZLUH 4LDLB 4LSPH 4AW4A 3QHTC 4X0KB 1BLIA 4G6ML 4PJ7B 3WKQA 2MTPA 5GGUA 2CO2A 2CU9A 1WFOA 4QKTA 4ZW5A 2Q10A 3MZGB 4W93A 3Q1EA 2BS8A 2VC2B 4EUPG 1R3HB 3MTRA 4FLOA 4P57A 3PWVA 3VI3E 3RWHA 2LAAA 4PJIE 1IBZA 3GBEA 5SWQB 3HPJA 3EO1B 4P06A 5DEJA 4NRZA 2CDGA 5E2UH 2PPAA 4J3TA 2KZ1B 4Z7OB 2R0KH 5DD1L 3TASA 1CLOL 2W59A 4ONFL 3MKKA 1RPUA 1ZLWK 3L4VA 4BUQA 3MVSA 2OW7A 3SD5A 1JV2A 3VRLF 2A83B 3OX8B 1BD2D 2DN7A 4CNIB 4AWJC 3QIUC 4P2CG 5ES4B 3M88A 3D2UB 4FQJH 1KJMA 2FX8L 4FKEA 3OXSA 4YZFE 5GRUH 4K2UH 5DUPL 3O9WB 3RE0A 1S9KC 4P5TD 2TSAA 2NY2B 4KOCA 5EO1A 4Z7QE 1ZPUA 2VDNL 3LMJH 4PGCB 1MFEL 3LCYA 1O9VA 4TUKL 1QYGH 3A22A 3ARTA 1AQDB 2FB4L 4DGYH 3OZKA 4ABQA 4PCKA 2X3BA 5K5YA 4OGAD 1IARB 3AFLA 4YVNA 3HRPA 3AXLA 1U41A 5FF6B 4AENA 4BZ1L 1FIGL 3PJLA 1JYWA 2ENJA 4ODWA 2ZX8A 4N8VA 2V9TA 1TVHB 3QFJB 1MJUH 3WN5B 1MW3A 2QVMA 4QTHA 5EU3A 1YPZB 4BDVA 2O5ZL 3UPAA 1IAII 3X11B 1RSFA 4GMTL 4IS6B 4N2GA 4Y1SA 4ZPVB 3FPYA 3V0GA 4XNXH 3MGOB 4XRCA 3L7FA 3SODB 2VT0A 3D85A 4K9EC 1YECL 2AQ1A 3HJ0A 2CJTA 5E94B 3BWSA 4UU9B 3GXFA 4UILL 3SJVA 3AQXA 4TL5A 3M1BA 1OWWA 3QQ4B 3S98A 1A64A 3WJJA 1P84J 1S9WA 1RHFA 1NICA 4LLUA 4ZW6A 2ICWA 1X9QA 5E9AA 4KRLB 5BZWA 3PHQB 2EDTA 4PJFE 1ROWA 2XWBA 3L3IB 4FQ2H 4ZQTA 4ZXBA 1VFUA 5JPMC 4NO3A 5I19L 2VKWA 4ISVB 2W94A 5DD0H 4XMLL 4P9HL 1J0YA 5CU5A 1PYWB 5EIQA 1FBIH 2JVUA 4ZW8A 4EPSA 4GAJL 5FHAL 5BV7L 4O2EA 1WC7B 4LQFL 1QSFE 2J2ZA 2G9HB 1SYSA 4XWOC 3AXHA 4LGSB 1CFSA 2G4GA 4ZS7L 4CMHB 5K1NA 4E5XA 1Q4NX 3QO0B 2R1XA 2FD6H 2YAFA 3IETB 2WTPA 5EU5A 2ADIA 4N2MA 3FTVA 5JUEH 5D1XC 3T0EB 4TUJB 4BFGA 3DJTA 3QFDB 3QIBC 4HEMA 3QA3A 1S9XB 2NTSP 1S7QA 2APXA 3E7JA 4GG6E 3NZHH 4U05A 4DKEH 2HZHA 2CXGA 4J3OD 2V2WA 5JOEA 4D0CA 4DH2A 4JJHA 3UGEA 5I8KL 3SDAA 3D25B 3I6SA 3EOTH 4MZIA 5CEZE 4ORGB 2BSRA 2OKMA 4TPRL 2CE6A 3FT2A 1TCRB 3PIQB 4QRQA 5IW6B 1I4FB 1GTNA 1EGJH 3KM1A 3IFLH 3KPLB 1S5HB 3MO1A 4DGWC 1T66D 3QI9C 3EYQD 1TG8A 2Q76A 3QE5A 3N42F 4QF1B 4TSAL 3WY3A 3RI5F 1XSOA 5F1OB 1WTGT 2CBTA 3TX4A 1KCKA 2IPUK 3VI4F 4IIZA 2IBZY 1B88A 4NBZB 3QRBA 4RDQF 1JWSA 2XWJA 1CWVA 4QRPA 2PW1A 3LKSA 4KK5C 1H3XA 1M1XA 4WZ9A 3ZTJG 2GT9A 2SODB 3KDMB 5D93C 3FL7A 1ROCA 3D0VA 4QHPA 1P5UA 1UEMA 2NW2B 2ZX7A 4WUUB 2F0CA 2QELA 4KH2A 4XI5D 1SQ2N 3E8UL 7PAZA 5HVWA 2FJGA 1TQVA 5HHMD 5HJGA 3Q1SL 2XFXB 5E6IB 4ES8A 4LXFA 3QUYC 3CG8A 4XCFH 4XH2A 1DLFL 4NRXB 3GGWB 5IQ7L 2IBBA 1ERNA 1RIVH 2EEDA 1EERB 1CU4H 3BWUF 3P73A 4YSEA 3NP3A 2HX9A 4FZ8L 1MVUA 1AE6H 5B7FA 3VGAC 3HBZA 3GHEL 4MYPA 2XRAL 3QEQD 3GSQB 3UTTA 1R5WA 3VDBA 5IROC 2UZYA 2X4SA 4GSUA 4BFRA 3AY4C 5EU4B 3UZQB 2YA2A 5JHBA 3TOPA 1JXGA 5D71H 4F7KA 4DFIA 3IDMB 2AJ3A 3O6MH 1A4JB 1KJ2A 2FIKB 4LDEB 2CJUL 4MCYA 4HHWA 3BZ4B 2GK2A 5JOFB 5DK2A 4QXTB 3AROA 2G5UA 4YAQA 3U0PA 1LO3L 4UTAA 2Q1EA 2XWZA 2C4FT 1BVNT 4IKIA 4APXA 3BKJH 3M6DA 3WLBA 4RH4A 1E5BA 2CO7B 4GAGH 4KJQD 2J44A 4MAYA 5CHNA 5K9JL 2EDFA 3QRFM 3RNQA 4MJ5A 5I18L 2YGQA 4X9GA 2AI0L 4PVBA 1TOXA 2CHWA 1EAPA 2VQ4A 1WFTA 3N06B 4HWBA 1Z9PA 2VQ1B 3HCVA 4Z3EA 1A1MA 2BW5A 5T3ZD 1UXSA 1GZPA 1KXVA 5D2NC 4LAJH 4WW2B 4AGLA 3VD1A 4Z5RB 4ETQA 4O4YL 1TSHA 4KTDL 1TTAA 1BQUA 1U3ZA 2XZCH 3P0GB 3HAEB 2HVBA 3J27A 5I1JL 1N68A 5HPOA 1EZVY 2WV3A 1I8IA 4P48A 3VXME 1CFVH 2XG4A 1I1AB 2F19H 5AOZA 1PIFA 3CX5K 1QI4A 1JTPA 3N41F 4BJLA 2BP0A 4JB9L 4A67A 1YNTA 2EO7A 1AD0B 1DLHA 4Q14A 4XPHH 4Y5XC 1BFOB 3IVKB 4JZJC 3FSVA 4WRLA 4NOBA 5DZJA 3QJHA 4ODUA 5C07B 3UZEC 5J1AB 3A4AA 2O5YH 5I1EH 5I9QC 5LWYL 4X4ME 4JPQA 4U6YA 4GQRA 2BVTA 4PB9H 3O3DA 1BD2A 3QCUL 4RMSA 2YAQA 3UCRA 1OSZB 3DXAE 4KKLD 3ARFC 3RDTB 4NNXB 2DDQH 2H8PB 3ZKQD 4XNYH 3VI3F 4UT9A 1P7QA 2RA1A 1QBML 2AC0A 1JDAA 1NCCH 1I7RA 4WCYL 2JCCA 4G9FD 4JCLA 4Y9GA 2DIAA 1K4DB 1LD9B 4W9LC 1NCBL 2K6WA 5C0GA 1JSYA 2NQDA 1M6OB 1IX2A 2RFXB 3QUMA 2WGXA 4OSUL 4NUGL 3OLIA 1M6UA 1VCBC 2XBZA 3G5VA 43CAB 4DUXA 2BJMH 2IMNA 1ED3A 1WAEA 2R0LH 4JZOB 3D05A 3A67L 5TF0A 4DP5X 2ALWA 5GZOC 4XB8A 1FO0H 4RGMC 1N0XL 5D7JD 4LSRL 1RUML 2D7TL 2VR5A 4LPTA 3RIFK 2YD9A 5FUZL 1ZE3C 3E3QE 3SN6N 4UDTB 4X9HA 3FCSA 2A1WL 2WLLB 1UD4A 4HKXA 4NKOB 1PZSA 3MNMA 5EZJB 4Z7QF 4GYBA 5FYJH 1RIUL 4OLVL 1YEHL 2YIHA 3R7RA 4UOJA 4I0PD 1N12A 3O3BB 4R4BA 1VFAB 4RZKA 3BP7B 3EAKA 4ZOEA 3DX8A 4BCZA 2MKLC 4OF0A 3CFEA 4J1UA 2FX9L 1PZBA 2OS7A 5AB2A 4PRDA 2CMRL 4ANVA 4OZFH 2B0SL 5BOJA 4WKZB 4PYHA 3OAYH 1KIUA 5J9PA 2HH0L 1X7TA 3AACA 1TYRA 3H9SB 2ZXCA 3GB7A 4A6YL 3OGCA 5JLZA 1UB5B 4R8WH 4XP1L 1B3JA 1B4LA 1UT9A 3B8YA 5E5MB 1NCAL 4BQ9A 2YPLE 4XN9A 3T0WA 5HDBF 4DP7X 5AKVA 1A6PA 3VGBA 2NY6C 3F7QA 3FUNA 3ZR5A 5E95B 3VUAA 4PJBA 2VZSA 2AXGA 3B5GA 2QVKA 3ET9F 5MENE 1Z3GH 1W6LA 4BK5C 1MCJA 3ULSB 5K93A 2P8MB 3X14A 5JXAH 2CBMA 2GJRA 1MCQA 1BFTA 2Y72A 1U8MB 3UYPB 2E7LA 1KB3A 2F8XC 4RSVA 1SM3H 4KNUA 1DQDH 3KPRD 5D6DA 5E2UL 1HSBB 1CUOA 1K5WA 3LY6A 5F6IC 5AZUA 2AK4D 3TA4D 2HYMA 3ML8A 3AADB 4JW3A 1UWXK 1BMWA 4Z3FA 2ICEC 4X7FC 5DJCA 1UKSA 1KNOA 1DQQA 1VHPA 2J72A 1RMFH 3IE9A 1IQDA 4MAZA 3S97C 1KELH 3U36B 1T5KA 4PRNB 3OWRA 3PP4L 1CE6A 2HVJA 2I85A 2JKRM 5GRUL 4K2UL 1FNHA 3BAYA 2YFNA 3DURB 1NJ9B 5F9JA 2FZ3A 2MOVA 2ED7A 3REWA 4N5ED 2WJ5A 3C5ZB 2BNRD 1F4YH 1F58H 2FEDC 1RH8A 4LPWA 5DMYA 4NQED 3SDCC 5MP6L 4GG6F 2O93L 1E9OA 4X7SL 4XPFL 5E8DL 2ARJA 1PZ2A 4HOWA 3VFWB 5I66A 4DGYL 4OJDH 1KGCE 2AEPH 4OZHB 3EGDB 2XACC 2K0RA 2WJ7A 3ARDB 2WVVA 3FQ1A 2PYFA 3IRZA 4GAYB 4GBXC 1X4YA 5GZND 2ZUSA 1PVHA 5HHXL 4M00A 4FI7A 4Z7WB 3CXHJ 3K2KA 3QZWB 2F1BA 3MRBB 2HAZA 4ELKA 3CFJA 3WTYA 2BLFA 1MJUL 4UNVA 1TSRA 1KYDA 1MFDL 4Y2DC 4GRLB 1OY3B 2CO6B 2EE9A 4GEIA 4I2XE 5F88B 4P23C 5DD6B 1YO4A 1X44A 5I5MA 2YZ8A 3U46B 4YHKH 5AYUL 2NY4B 4N1HB 4TM9A 4H26B 1HHGB 5DA4A 5E2VL 3U0TB 1FH5H 1HHHB 5F7KC 1PZ5B 2KBGA 4DERA 1AR1C 1EFXB 3QDJE 2AV1B 2XXCB 4NQSB 3CSBA 5J4MA 3BH9A 3O4LD 3VAEA 4YHNB 4HIIA 3K4DA 4HIPA 5GRZA 1CFTB 1PZ3A 5EEWA 4TUOA 1BLNB 5GRXG 3R06B 4N3TA 2A6DB 1XO8A 3B43A 2LQRA 4FQ2L 3L5WA 3MLZH 2WD0A 1J12A 3W81A 2G2NA 4FYRA 3WIHA 3HG3A 3QHZH 1FBIL 3SGEI 2R23A 1W2KT 3PQYB 1AYOA 4ZW3A 2VR3A 4R7NA 1WFJA 1CICB 3GBNL 1INDH 4L8SC 1NPUA 3LDBC 3PWPE 5HI3C 3VXTB 3CC5B 3VMNA 3QPXH 2DQHH 4X0NA 2ID5A 1E42A 4NC0B 2JKTM 5EZLA 1EXUB 5JUEL 1OAQH 1MHPH 4TNWF 3AQDA 5F1KC 3SQBA 5MEQA 3ZDZE 1DQJB 4LIQL 1EUTA 1PL3A 2EC9T 2QTEA 5TE6L 2AEQL 4DKEL 2OMVB 1K6QH 4CSSA 4GKLA 3FS9A 3FU8A 3MCG1 2NXYD 5F96H 2MMXA 3QQXA 2MCMA 1E67A 3BZFA 4QT5A 2RACA 4YDMA 5G4NA 2NY7H 4BKLA 3IFLL 2C3GA 4N0FA 3FMGL 5A16A 4MMYA 4NQVA 1NBZB 2OMXB 4GSDH 5FO7B 1GGBH 4ODSH 4L4TD 4N90D 2PWGA 3UTSD 4K4KA 2GTWB 1KCLA 1HHJA 4JHWH 5IR1A 1YEDB 3V9CA 3ZDXB 2CJSA 4XWGH 4OF7A 4F7CA 5D5MA 4L29B 3GM8A 1BQHA 1BAFH 1FVEB 2EE2A 4XN8A 3HG1B 1KY6A 3UBXA 4UM8A 5G4MA 1ZWIB 5E6YA 1U8IA 1DEDA 1WS7A 4IBLT 1AY1L 3B8SA 3FQRA 3CFDA 5KYYA 3DIFA 4NC1C 1L6XA 3VU2A 2ZF8A 5BXFB 1U8QB 1KV7A 1TVBB 1NDMA 4OCRH 1AXTL 4UCFA 2GTZB 2ALAA 1AZCA 3FZUC 3Q43A 2BY1A 5I1CH 1RIVL 4UQ9A 1CU4L 4LCUA 3TN0B 3S3PA 4R9HA 4F2MB 2BP8B 4PEEA 3S5YA 3V6ZB 4U1NB 4U6TA 5I1GL 1G4MA 1XR8B 4LSSH 3HZMB 4HZLB 4UIMA 1LEKB 1X4XA 1M2VB 2XG5A 3A4FA 2HMIC 3QRGH 2XXMB 5AALA 2OTPA 2ORBH 1AP2A 2P4AB 1XSIA 3O6KH 4ZFFB 1ORSA 2R59A 1R19A 3FOLA 5D71L 1BOGB 3VWKD 5TDPB 3RBSA 1BVOA 3O6ML 5DS8B 3C8KB 4LL4A 2AJYH 1HWHB 1U92B 2E6PA 4K3EL 5KANI 2CM6A 4P2RD 2R27A 1TZIA 3LZFH 3QZNA 5F8RC 3BIKB 4IRSB 4HCIA 2VDLH 4QTIL 1CBJA 2WXPA 4TULH 1MIEH 3KXFE 4MVBC 3WJJC 2NLJB 3UCQA 2J8UA 1HCVA 3MX0B 4RFOL 4UMGA 4G8IA 4YNYB 3CSPA 3WFHA 3DO4A 3BJ91 1BX2B 2WO4A 5I2IA 3PDDA 4ZXBC 1NCOA 5DEGA 5HHOE 3NJJA 1ZDSA 3CSTA 2NNAB 4AJVA 2H26B 4HXAH 1JRHL 1RUKH 4XGZA 2G60L 5F7LB 1BW8A 4RZCA 3TNNB 5EOCL 1JNHA 5ANME 4JQXA 4E42A 3UADA 1CFVL 3D9AL 3NFPB 3HB3C 4FS0A 2VH5H 3L5HA 2CHXA 4X4YA 1BF2A 3DI2B 5IIEB 5CKAA 4N85A 4D0DA 2M26A 2JI3A 4OLWH 4Q6IA 5CLWA 5C8JB 2BIMA 1K4CB 2EXTA 2VLLB 5I5JA 4AYSA 2DQ6A 4XPHL 3QG7L 3N85H 5TF1H 2DW5A 2AK4A 5TH2B 1QFWI 4Z18A 1KPUA 4R4ND 3I3EA 2F74B 3BP5A 2FYYA 1T1WB 4P3WA 3T6QC 2C5DC 1HDMA 5I1EL 2C3XA 5F9AC 3ZE0B 4L4VB 3SDAC 2R9HC 2YUZA 1GSKA 1PSKH 1UEYA 1R1CA 4PP1C 4JO3H 5LBSH 2Q9OA 1CXEA 4N0UA 4ZTOL 5ECJE 3ZQXA 5KEZA 5IMMA 5CCHE 3UTOA 3DRTA 4XCYB 4H4NA 1DJXA 2FSEA 2FHCA 2VMJA 3DETD 3US9A 2FBRA 5AW0B 5T1DH 4FXKA 3GMLA 2GSMB 2LABA 2YBGA 4QHMA 5FYKD 1H15A 3NH7H 1M05B 3I2CL 4XC1H 1KGIA 3RVUC 3CZEA 3MNVA 3SKNA 3VXOB 2AQSA 1OGPA 4R90H 4G1MB 4Y5YA 3FQ2A 3SGKA 4HSQA 4M7KL 1I3UA 4TSBL 5C09D 2B9BA 2R0LL 5GZNA 3FO0H 1CGWA 4N2LA 3GSNB 4MMXB 3S5LG 3G6AB 1QRKA 4OKDA 2FL5B 3BUYB 2J5LC 1YEFL 1I1FB 2O5NA 3D4CA 3UDWA 1E4KA 2ZUWA 3ARGD 2ZONA 3L3OA 4F93B 1P5UC 2GTQA 4HU2A 2ZKHH 5J11B 3RTQD 4FEMA 1CZ8L 2NUTB 4X7DC 1T6VN 4Y1AD 5FYJL 1ZA3B 2VR9A 3H55A 3INUH 2XVBA 5B7EA 4G3YH 1KT2B 3HZVA 3LH9A 2CIIA 3P4NA 4LK4A 1UT1A 1R34A 3O4LA 4HD5A 1J5OH 4YDKH 4IKNA 4ZODA 2CRYA 4J3BA 3HMXA 5DK0A 5LAXB 3TFKC 4PY8J 3UZVA 2BSSB 1YN7A 1OTSC 7FABL 1KFGA 1AIFB 1P4UA 5I75C 4ODVL 5DDHB 3U7WH 5TPWL 1JPTH 1DE4B 1PLCA 3EO0B 2VW6A 4DF9A 4GUQA 3T4AA 3RVVC 4HF5H 1E5CA 4OV6F 2CGYA 3I84A 4LBEB 4G80A 1NL0L 1Z3GL 2WK2A 4U1SB 5DQ9A 4LFHD 5FYJU 3GMRB 4ZK8A 3CN2A 3DVFA 5F7BA 4RBPH 1NBVH 4EKXA 2VC2H 4DN4H 1Q8MA 3INOA 1AFVL 1YRKA 1KB5A 2GABA 3LKNA 1DQDL 1OF2A 3MRCB 2VABA 4PJDB 5C08E 3ZL1A 4PWFA 4EVNB 2N7AA 3WS6A 3IDGA 3EIFA 3B2UD 4ELDA 1DL7H 5B3SB 1IAKB 2WBKA 4NDMB 4ZFOL 4FX5A 3RFZA 1Z2KA 1KELL 2C7UA 2OL3B 4TQIA 1AC0A 2WVUA 4JRWA 5E5UB 3WMQA 4JX0A 1SJXA 1KXVC 2OMZB 4ANKA 1N8ZA 1MJ7L 4KXZI 3VRJA 1KLFB 4NQDB 4L4TA 3NACH 5LUMA 1F4YL 4OLUL 3UTSA 3QIUB 3ZDZF 4JVWA 1H0DB 3JUZA 2HT4D 3P9LA 1SJHB 4GNKB 1JF1A 2X6MA 1F90L 3GIVA 3SPIA 5AVUB 3X12A 2DICA 4O02A 5A2AA 2MNUA 4GS7C 2AEPL 1U95B 5JYMA 1ASPA 1U8PA 1XR9B 2F7IA 3UO1L 4BH7A 3U9PH 3QJZA 1CTNA 2VM3A 3P0VH 3WFBH 2BOLA 3FCTA 2V2XB 1UM5H 4OLXL 4RGNE 2ESVB 5BZDA 5K9OB 3FC8A 5AZ2H 4PTTA 1A0QH 4HUKB 3GLZA 1FH5L 4LCWB 4Q4EA 4W6XB 3EH3B 5FKPB 5IVZB 2A3TA 2CR0A 4QUOA 5EUOA 4JHZA 1ONQB 3MACH 3CVIH 1JWMA 4LEXL 5CUSL 1EXGA 1WH0A 1JOIA 3FO2A 2FECL 2FWLB 1CLZH 3P4OA 4DP2X 4HBCH 2GJJA 3MLZL 4JG0H 2YLKA 1G7PB 2NNXA 1WFMA 3PNWB 1G84A 3BT2H 3QHZL 1I1YB 4NT6B 3K2MC 2QEJA 1FRGH 1NGWB 3A23A 2RR3A 4WFEE 3ZMNA 5F71A 2XJLA 2EILB 3GS4A 3VWKA 1U8KA 5L4FA 3FU3A 3CN1A 1NSNH 3QPXL 5IKCA 3H4HA 4NPJA 1A4KB 3LRMA 3OMAB 1TENA 3MROA 2Z0UA 1OAQL 1MHPL 4PJAE 2NSMA 3JT2A 4IBYA 3ZTCC 2QLVB 3QDGE 3EHBC 3MLUH 4G6JL 4XOEA 1KIQA 2V5YA 4LLYB 5J6GB 3TEYA 5D1XB 2V7NB 3VQ1C 3KPSD 4DK5A 5EIIB 2P42B 1TT6A 4DPAX 1FGNH 3QIBB 4XXWA 4U6VH 5DJXA 3P1VA 1J7VR 4NBYB 3ZZQA 3RFRA 5JHLA 4PRBA 1SHSA 2J8HA 1GMIA 5F96L 1X5ZA 3ASNB 3ZL4L 2Y0SA 4LEOA 2R2CA 3F7VB 4BH8B 1KTJA 1T0MB 2R29H 3FB5B 4OJYA 5DHVA 2OMYB 2AJZB 3ULUE 4EDXB 2NY7L 3EXJA 5KOMC 2BSDA 2KZKA 3MSPA 1ID2A 5B22A 3GS7A 1GGBL 1TQUA 2HFTA 2X4OB 1EQWA 2I07A 1IGTA 2W65B 4H8QA 4S10A 1INQB 3OV6A 3DOIA 2B4CH 3QI9B 4XWGL 3VFTB 5SWZE 1BYPA 2D3LA 4AVJA 1BAFL 2HJKA 1CFQB 1EDQA 2VZVA 3GBMH 1BJ1J 2WTRA 2XOTA 3IJSB 1NM4A 2N56A 1HNGA 2E7LC 3WAJA 4PJGB 1KACB 5D6DC 2Q7NA 2O6FA 3AU0A 3VXUB 4ONHB 4U4IA 4J3OC 4F5CE 2X4PB 1DQMH 2YRPA 1AO7E 1FL5B 4JFYB 3L1EA 4BZ2H 3RX8A 5GGRB 3RA7L 1N2RB 4OCRL 4AEFA 2EE0A 4OFKA 1QFUH 3NJXA 5B1KA 3EGSB 2Z93A 1OB1A 3R0MA 2N7SA 2VXSH 2ZKXA 4NCC1 5I1CL 4HMEA 5CLYA 2H45A 4QOKB 2DS4A 5KVFH 4IBWA 4KO7A 3EYQC 5FB8B 1YMME 1YMHB 2XQYA 3QUYB 1IGMH 1QSEB 2R4RL 3MBWA 4XZ4A 4F8QA 3HC4L 4S1SL 3BT0A 4A68A 2VIRB 1LXMA 3EJRA 2XKNB 2Z8WC 2XPZA 4LLMB 3QRGL 2AXJA 3TBSA 5C09A 4ABVA 3C12A 1CG9A 2ORBL 5HVHC 4JFHE 1J1PL 2EDDA 3FU5A 4PJ7F 3O6KL 4AT6B 2HFFB 5J12C 2BVYA 2PWHA 3CHXA 3U6RA 4CVWA 2QQLH 2JJTA 3HVNA 2I9TA 1C5DA 3WGUB 1KUMA 2FO1A 3RTQA 3S88H 2B5IC 3G6JB 3KL0A 4RFEB 4XI5C 4Y1AA 1KCVH 3STZA 3ZRSA 5CBAA 2ZKWA 4LHUD 2NYKA 1RFDL 1S7XB 3EH5B 2OYLA 4HEPA 4PWEA 5KBNC 2VDLL 2BY2A 2G2RB 3F5WB 2PYEE 4TULL 1MIEL 3T77A 3MV7E 3KZ8A 4J5VA 1IFHL 2APVA 3BGAA 3ESPA 3TT1H 4A2EA 4C83B 3ZHKA 4PRIB 4GEJA 5AVWB 1RY7B 1OLLA 1Q0YH 3QG6A 2WIIB 1E9PB 3CFTA 2UVFA 4ADGA 4HXAL 2VAAA 4ZYKB 1KJ3L 1BIHA 1OGSA 4J7RA 4OAWA 5C3LD 5JTWA 3SKMB 3HAEH 3CZFA 2Y4SA 3C5XA 1T80A 3CMOL 3KGSA 5D2NB 3RPKA 2NR6D 5LGJB 3BIAX 3O3UN 2EDLA 1IM3D 2CHNA 2VH5L 2R2BB 1BJ8A 4LCIH 4YHLL 4PR5A 4GRWE 1SEBB 4OLWL 5D9SA 3SCMD 3CHPA 4OW6A 1MFVA 4JPIB 5E24E 1DBAH 3NA9H 1LWHA 4OGXL 5FGSA 5I6MA 5IB3B 2JJWA 5AKTA 4P5KA 3Q6FA 5MEPB 2YD8A 5A2BA 4HQQH 5BQ7B 4PV9A 3L7EB 4K3DL 1OGAD 2WZ0A 4Y5XB 4HFUH 4JO3L 1B9KA 4JZJB 1FJ1A 5LBSL 2BM3A 5JIKA 4M3KB 3H56A 2XT1B 1U93A 2QVIA 12E8H 3Q2VA 1QSFD 5I9QB 4XXDA 1GZHA 1QRNE 1SPDA 5HYSA 5FDWB 4P59H 1HN1A 5E2JA 4KZ0A 2HN7A 3DNKA 3NH7L 5TFSL 5LKNA 3S35X 1L3NA 3ARFB 4Q0XL 4XP6L 1X5JA 1ZJAA 1RU9L 2OTUA 1IAIM 1SY6A 2WY3B 4L0ZA 3TYFA 1XEUA 5KG9B 3QXVA 1FCGA 4P9MH 1RJLA 1XH3B 2PW2B 2ITDB 4NQCD 1VEMA 2AQTA 4NKIL 4XVSH 5I6PA 5IVXE 3RWEA 1IE5A 4BFFA 1G7IA 1TFPA 1TQTA 4KTEL 1L6ZA 2BNQB 5DSCA 1IGIH 5ADPH 4K3GA 4G43A 2ZKHL 1R0AH 5BRZB 3FN9A 3O45B 1I8MB 1G0DA 3TP4A 4RGMB 1KCWA 2V5SA 2R0WL 4LOEA 1MAML 4W9EC 1NAKH 4NKQB 4OQTH 1C16B 4WO0A 4Z7AA 4KKLC 4UZGA 5DVNA 4RISH 1TQCC 2EC8A 3BAEH 5EC2A 3UJTH 5EF3A 1COBA 4YDKL 4BD4A 4F1ZA 4Q9QH 1P2CA 4NSKB 5DQDH 3TJHC 3D1MC 1ZKAA 3QJFA 3HZKB 3IFNH 2MH4A 2WB7A 5KS9B 2IH1A 1XF3A 1OAUL 3H8NA 4PRAA 1HL8A 1G43A 4S2SB 4I5BA 1MF2H 4YHIB 4F58H 3VW3H 5T3XH 4PRHB 2Y25A 4FFVD 5DI8B 3LPOA 4FA6A 4HJUA 2PCPB 1VCAA 3CE1A 4W9JC 1AGEB 4P2AA 4RAHA 2ATKA 4HF5L 1P4LA 1JVKA 2NY0D 1OM9A 5B3NA 4MJ6B 2P5WE 3BW9A 3PGDA 1IAOB 1AMYA 1WBYB 5FFOA 3O0LA 3UTPD 1NBVL 1UVQA 3ECQA 5JIQA 2NY6B 4I18A 2B15A 2ICWI 2OYKA 1L5GA 4R5TA 2NY5C 2WQWA 3V4PA 1B2WH 5J6HB 4AUYA 2GJ6E 5E1QA 2UZXB 2YPVH 3LEXA 1TQSA 1I53A 4AM0B 2C4FU 1S7UA 1SOKA 3KPSA 3CZKA 4H88H 1II4E 2Q87A 2CJ3A 4C4KO 1QO3A 4MAUL 4PBXA 4GPVA 3PE9A 1ULVA 1I9EA 4XAWH 5CZKA 1NCWH 1U33A 5F6IB 5SWSB 3V8OA 3LZRA 4KZEH 3IKCB 1RI8A 2Q5BA 2CLZB 2WLIA 1AMXA 3QAZC 3T3PE 2ICEB 4AGMA 4F15C 4Y4HD 1DFXA 1AZUA 2BWDA 4NO0D 1R4XA 2YA0A 4PJAF 3SDXE 3NCJL 5EULV 2XFGB 1RZGB 3MDJA 4HUWB 3HNSH 2X0WA 1R5VB 5DRNB 3ELQA 4JQXC 4AKOA 4HG4J 2BVOA 2X70A 2YD4A 4M7LH 2XTLA 1KYOK 2IC2A 2ZXDA 2EXYC 1QTSA 3FQ4A 2YAHA 1BJMA 1FAKT 4ATTA 3PNRB 4Q6IC 5KJ7E 5LGKA 2KKQA 2ZOKB 3P0VL 3FFDA 3KWXA 3SOBH 4JKMA 4U1MB 1DVUA 4FMKA 4ZUUB 4EZKA 5AZ2L 4XHJC 3EG9A 1A0QL 4X5PA 3GMQB 3L45A 2J6EA 2JIXA 5JNYB 1KBVA 2X9YA 1E4HA 3EOAA 2EH7H 5EWIH 3M7OA 3W2DH 2BOCA 4P23B 2Z4QB 3E6FA 2R4SH 1SJEA 3GMMB 2A6KB 2Y5EA 2E8YA 1AR2A 2OX5A 2Z92B 3JXAA 4RWHA 4FXKC 1JHTB 5I8CB 4YDLC 4N5EC 4R7DB 4XNDA 4NP4L 1AQ8A 1AR1B 1CLZL 3DUSA 3A3YB 4IU3B 4QGTA 5I1LA 1NIFA 3EKCA 4PJIA 4HBCL 2OYMA 4JY6B 4WW2F 2FWOB 1N0LB 3SD2A 4Y5YC 1C1EL 3SGKC 4JY4A 1K9TA 1PLGH 4ZRGA 5GZNC 2E75C 2W9EH 1RCYA 3MJ7B 4P04A 2YKLL 2ZD0A 4DUVA 3MRJB 4JHBA 5GIRB 1DVXA 3NEXA 1NSNL 5KJRH 3UDWC 1E4KC 3LNGA 3NFSH 3L3OC 4N2OA 5D7SH 1MLCA 3V0HA 3VD3A 2QLYA 4YJZL 3DXAD 4WTZG 4OIBA 4L8SB 2DH2A 5I0ZA 3LDBB 3DROB 3MV9D 5I74C 3KH3A 2R8SL 1OGTB 1MCDA 4LHUA 2DYRB 1DCEA 1WWBX 3MLUL 4EBQH 3VXQB 5KYWB 1A6TB 3CCHB 5MHSE 1WFUA 3OSVA 5E1GA 4E9VA 1QHPA 2FK9A 4MTMA 4U2ZA 3S4SB 3N9GL 1D5IL 4U6VL 1DDHB 3N5AA 2WWMD 3KS0J 1ZHBA 2F7RA 3PP3K 4MS6A 1A47A 4EN3D 4PJ9A 3FN3A 2MOGA 4Q2ZB 1YNLL 1YNKL 3BSGA 3ATEA 3EH4B 5KAQF 4O9HH 2YPKA 1CDHA 1WTLA 5C0AB 2I5YH 1JS4A 3QXAB 1XTLA 2CR6A 3IXAA 2XTJC 1CGSL 3EBAA 2OTWA 4KVCH 2BZCA 3HI6H 4Z76A 2YN5A 4PTUB 5K9QI 3REVA 5I0DA 1YQVL 3T4AC 5I6KA 1RK0A 2A6JB 5EEUA 2NR6A 4FF9A 4K7PY 1FV1B 4RETB 3X1EA 4MNHA 3MUGA 2FYVA 2ZXAA 3VFRA 1AHWB 3PV6B 4KXDA 2VNCA 1BF8A 4N2NA 3SCMA 1ZT4A 4F20A 5ESAA 2BH0A 4MX7A 1D9KD 5CAYB 3OR6A 3KLAA 4PJFA 1PGRB 3WGVB 1IKFL 2LU5A 3X1FA 1CLCA 1GIGH 3PWVB 1JZGA 3AY2A 5FC9A 3RWHB 2RCSL 3ATBA 3WS6C 5A6IA 2H2PC 5I17A 1GOHA 2XDHA 2NXYC 4NJ9H 4Z3JA 4NRZB 2CDGB 2J12B 4DPCX 3RFZC 2J56A 3FFCD 5A2LH 1QSFA 1G7HA 1N18A 3PL6D 3KJ4C 4XT1C 3BH8A 3O2WH 5KVFL 5MEND 3ZZ1A 1JV2B 3FTSA 4XVJH 4LLQA 1IGML 1MRCH 1OP4A 3QJQB 3QUXB 5AOIA 4M3HA 3QDMD 4FFTA 1Q9OA 3Q3GA 3OXSB 4J2QA 1FYTE 1PG7H 3HC3H 3MOQA 5AOMA 3TCLB 5B38G 5T33H 3WNOA 4FNSA 1YUHA 4GG6A 2KQMA 1BXUA 2R39A 5EO1B 4AGNA 2IXQA 1OSEA 1JZ3A 1X4ZA 2WNGA 3BVDB 2L7JA 4NQCA 1RZIB 1SUHA 2EECA 2N3JA 1IM9D 4BINA 5BO1H 4N2KA 2OJEA 1B0RA 3HBQA 2X88A 3PXLA 3VFGH 3SQOH 3S88L 4Z0XA 3AXLB 4AENB 5GGQH 4ZMPA 2Y7SA 1DSYA 3KMDA 4ODWB 4N8VB 2CK0H 1M7UA 3IRCA 3AGVA 4G7RB 4QTHB 5EU3B 2D7MA 2FSDA 3D0AA 3V0WL 1EJ8A 3VXRD 2D31A 4XRCB 3L7FB 3TIDA 3D85B 2D2CC 4A2HA 4FFYH 4E41D 5L8KB 1BQLH 1KGCD 3SJVB 1E5UI 5IVXF 1FSKB 2AANA 3M1BB 3UYOD 1G6RL 1S9WB 1CFNA 4RNRA 1A1NA 2IWFA 5J56B 3C75A 4LLUB 2VR8A 1K2DA 2ICWB 1UXLA 2RBLA 3MR9A 4MDIA 1CR9L 2CPCA 4NQXA 2HJFB 1HE8A 3BPNC 5DRXA 4ZXBB 4MKTA 4NO3B 5CZVL 1B4JH 2FLRT 3AC0A 3AITA 3VWKC 1QWUA 4J23A 4PG2A 3V0AC 2EYSA 3D4ZA 4JANA 2P8LA 2VW7A 4OZHF 5GGRY 2BWQA 2A4CA 4N87A 4J27A 1FN4A 4LCIL 1NEZG 4XCNB 4Y7MA 1NGYA 2J2ZB 1RZJL 4Z7WF 1SYSB 3ULVE 4WK2B 4EUPA 2V3EA 3HB3B 1HSAA 4E5XB 2R1XB 5DJ2A 3NA9L 5EU5B 1T6BX 2ADIB 5TK2A 1JUFA 2XVGA 3MODL 5C0RL 4G6FB 2Y1AA 1H6EA 3HMWH 3RX7A 3P11H 4XXWC 1SMOA 4XMXA 5DFTA 2A9DA 1S7QB 4HFUL 3TH3T 4JQIA 1Z7JA 3WNIA 5ICXA 4MJIE 2V2WB 4D0CB 1OXYA 4L1BA 4Y4HA 3SDAB 3X3GH 5FLVA 1WITA 3FT9A 3GD1C 3QYMA 3MRDA 3FT2B 4HLZH 1AGFA 1DJZA 4QRQB 5I5IA 3MBED 4OCSH 3EFFB 2WQ8A 3KBPA 1IO4C 1SQMA 2Q86A 4Z6AT 5C0DB 2ARWA 2W07A 2YWZA 3CLFH 3MO1B 4JRYE 3IS1X 2Q76B 1IAIL 2VDPB 1GAFL 4MXWH 1GR7A 1OSYA 4KGLA 2D7NA 4FFZA 4P9ML 2B7DT 1G1OA 3GSNH 3ZYZA 4GI8A 3NA4A 4APQD 4XVSL 5E8EA 1RUPH 4NLAA 2Z7WA 5FA4A 3SDXF 3VMOA 5J7CC 1IGIL 1JWSB 3FYEB 4QRPB 4G6AD 2PW1B 3LKSB 3WOVA 4PREB 1M1XB 2GT9B 2Y1VA 5F7FA 3ZVVA 5IFJA 1GOFA 3D0VB 2ZUXA 1P5UB 3F64A 4YDZA 2VE6A 5JHDD 3SGEH 1JGUH 2BCKB 3TBTB 2K4WA 3DETC 4L9LA 3VXMA 1NPNA 4LKXA 2FJGB 1FORH 4L5FE 1DQLH 2GBTA 4F80A 1PLAA 4XH2B 5AVSB 2WWNA 1SBSH 4JFOA 4N25A 4B9IA 2AJSL 3RPBA 3V4VB 1MF2L 3VW3L 1GVIA 3Q0HA 3P73B 1IFRA 5GHWL 1ADQH 1QNZH 3ZLQC 1MVUB 2E4FA 5IJVB 4AYMC 4X4MA 4NNPL 2EIDA 3AVEA 5I75B 3DPDA 2P24B 3UTTB 1R5WB 5B4MD 4V1DE 1JGEA 2UZYB 2X4SB 2JJTC 3D07A 2YXVA 3DUUA 3DXAA 3KPQA 2MKWA 2MQGA 3RTQC 1DVTA 1G9MH 1P4BH 4YFLI 4N9GA 4YC2C 5E2TH 2V2TA 1DUYA 4TMPA 3ZRCC 2AJ3B 2GJZB 2ITFA 1P84K 2QVTA 4QAWA 4MCYB 5JW4M 2RJMA 1SZNA 4HLEA 1H9VA 1WICA 4NI3A 4G8EA 4LLVA 3L54A 3VA6A 2CA3A 3GNMH 5DK2B 5AWNL 5MI0C 4XN5A 5ALBL 3U0PB 1EO5A 4JRLA 4XAWL 4EN3A 1OP5K 2EVIA 2H6PA 4ZSOE 2UZIL 3V0FA 1KC5H 4XOAA 4APXB 4KZEL 1XL4A 1KEGL 3WLBB 4MAYB 1NIAA 5CHNB 2VGLM 4UTBH 3PU7A 3MRPB 3RNQB 4MJ5B 5IK3A 2FX7L 4B9GA 1G9HA 1SXZA 1UD6A 2BIQA 5ITFA 3DGCR 3TESA 3KLSA 1EAPB 3ARVA 3HCVB 1X5LA 4FYQA 1A1MB 1UXSB 1ZLEA 3DSFH 4ETQB 4DCQB 5IZ7A 2KYIA 3HUJE 2DQIL 4BYHA 5D6CA 1PY4A 4NI6A 1UA6H 5ICZB 5ECGA 2DQFA 5AW2B 5IQMA 1I82A 1D9KA 4MXVE 2JQMA 2XG4B 5I76B 3Q01A 3HFMH 3ECVA 4GS7B 4YIQA 2J4WH 3SOBL 3X13A 4DJMA 3B9AA 3OWEA 3F84A 3B2UC 3K6NA 1DLHB 4K7PH 5HHOD 1NZRA 1WK0A 5CJQH 3ZSTA 3FFCA 2V9RA 2ZXGA 2ZAGA 3W2DL 3Q9QA 4A2MA 3SYQA 2B39A 1GZHC 3FNKA 4O58L 4OCYL 4ZDHA 4F9PA 5MENA 4U6YB 2Y6SD 2YRZA 3C8HA 3O3DB 3UBXI 5LDSA 4MLIA 2J73A 2ZOLA 3QDMA 2HT4C 2A73A 2BIHA 2H0FA 3TWCL 3GMOA 3RL1A 4JFEB 3ZK0A 3CQPA 1OT1A 3F05A 3KCPA 4NFBA 4HIQA 1P7QB 5C71A 2FQFA 6TAAA 1I7RB 3RUGE 4W9HC 1PLGL 1DVQA 4X6DB 5HXMA 1L0QA 3CDFA 1ZVSA 1O7SA 4IHBA 5C0GB 5DU7A 5KBPA 3QUMB 4ZUSA 3G5VB 1IM9A 3KYOA 1ML0A 4TLKA 5E99L 3V52H 5D7SL 1ED3B 5DMIL 5IEKA 1E65A 4HKBA 5JOPE 2G30A 3D08A 1FDLH 4ZZFA 2AQPA 3MRNA 3CFIC 5E7BA 4AQAA 4YXLH 2MFNA 3TNMA 3G5YA 3FCSB 2DWXA 4PGDA 3ZE0F 2GYSA 3S3SA 3V7AE 2AAVA 3EHBB 2X44D 1EBAA 1BQ5A 2X9XA 3OB0H 3MRIA 4E41A 2XV2A 3BDYH 3LKQA 4BXVA 4O9HL 1T0PB 4NX0A 4TVUA 2JJUA 4MZ3A 4R4BB 4D0BA 2C3WA 1QA9A 3F7YA 1T2XA 3MFFA 3T2QA 3DX8B 1UH4A 5D1QE 5GS0D 3PWUB 3C09C 4J1UB 1NANI 4N6QA 4LU5H 4FMVA 4KVCL 1UD5A 1QSZA 1BZDA 1OANA 3GXNA 4H8VA 5J9PB 1KIUB 3EBHA 3K4ZA 4IBTA 4S1QH 4HS8H 4OUOA 1S7TA 3GB7B 2GHWB 5JLZB 1QFWH 4IJTA 2W91A 1JZ6A 3D3VD 3S3JA 1XL6A 2FBJL 3LIZA 1L6PA 4UAOC 1W0YT 3QDJA 3OKMA 4I18C 3D87B 5L9DL 5C0EA 2WOBA 4PJBB 2AXGB 2XXGA 2D9CA 2YXWA 5FHBH 5DJAA 1FH2A 4NKDA 5L2KE 1VDGA 1V3KA 4HK3J 4KK6C 1WAPA 4P8QA 3K8KA 1AGDA 4NJ9L 1FZKA 4DN3H 3IGLA 2EXWD 3IBOA 4QXGH 5LAPA 4P4RA 2MPAH 1DHKA 1AQMA 1XH0A 3L08A 5KVDE 2YMXL 3PWPA 5DJCB 1KNOB 4Q6KA 1DQQB 2G5RA 4XVJL 4U1LA 1JYXA 3ULVF 3NSFA 1IQDB 2H0PA 4JFXA 3MBEA 5I8OH 2A9NH 3ZQWA 1CE6B 2HVJB 4OM0H 5KBLA 1WUNT 4GIPD 1CMOA 1NAMA 1ZHNA 1JN6A 3HC3L 4I9WD 4AOFA 5F9JB 2FZ3B 3GHBH 4L1TA 1UOLA 1XMWA 1JK9A 4P3CH 4AV0A 1BECA 5C08D 4FQQB 3ECWA 3QIWB 2ZIDA 1WUZA 1E9OB 4APQA 1DN0A 2ARJB 3B7SA 3L81A 5ESVA 3WSQH 3ZUNC 1LP9E 5I66B 5IKCB 1T22A 2WVVB 2PYFB 3ZIMA 4U1KA 2D9QB 3SQOL 4V33A 2VAJA 1X5KA 1XVSA 4NN6C 5GGQL 4N0YH 2R1YA 2CK0L 4Q9BA 3CFJB 1W6WA 1EWHA 4YH6A 2YEZA 3BO8B 1MRFH 3HPLA 3DV4A 2IG2H 3BPCA 3CZJA 3PPSA 3EJUA 5HHMB 2YN3A 3CU7A 4HCRA 1BQLL 2XIIA 2VXUH 2IGFH 1BCIA 4GT7A 4AVIA 5IOPA 3MTXA 3WV0A 1CURA 1OPOA 4E9XA 2DKSA 3BH9B 4U3CA 2P80D 4HIIB 2FVNA 2XKUA 2DQEL 4TUOB 1BQRA 1DSFH 4DP8X 2OZ4A 4RGND 4Z23A 3L5WB 1CDBA 1VGKA 3T3MB 5DZLA 3ZQ9A 2O6PA 3WHE1 2VDRB 1VEOA 3BUQA 1S2EA 1W80A 2XQYK 4NN5C 4R7NB 5HGGS 5DHEA 4JDZA 5EBWA 4S1RL 1MDAA 3OSKA 4EKJA 2Y06H 3Q48A 3V0EA 1T6WA 1T20A 1U8CA 4GI9A 4CC0A 1SEQH 1U2HA 2YGVA 3APDA 3PUUA 3UTQB 4RMRA 2OJZL 4F8NA 3BE1L 4KXZH 1JWUA 3P11L 1ID5I 4GLRI 5HDRA 3VNZA 4U4BA 3O0RH 1EEYB 1NFIA 3OZ9L 3SQBB 5MEQB 5H8DA 4IRJD 4PJ9C 1OZTG 4L3CA 5CD5D 3OKNA 2FT6A 3FQTB 1BBJA 4TQEH 1OTTD 4GIAA 4WFED 2OCCB 5IGXH 1LILA 1I7TA 5D7IE 1MAKA 1MFNA 3BZFB 4C57C 5B39G 4OCSL 4FL4B 1UZGA 1H3VA 2ZG3A 4BKLB 1HC1A 4N0FB 4FNPA 4JQVA 3K81A 3U9UA 4MMYB 3NZSA 2NR6C 3QDGD 2Y3AA 3CLFL 1AZZC 1VFBA 2DV6A 3MA9H 3BSZL 4MXWL 3ES6A 4YSPA 5INCA 3AUWB 3SCMC 2BWIA 1CDYA 3KXFA 4CDGC 2ZX5A 5C0BD 2IAMD 1HHJB 3GSNL 2F54E 1QR4A 4YHMH 3EDKA 1FNLA 2MNWA 1NEUA 4E0RA 3JWOC 1RUPL 5D5MB 1BQHB 3DO7A 5ENWA 1ZD6A 4RGOL 4AK1A 3UBXB 3NPZB 4UM8B 3ULUD 4FABL 3OMZA 5HHOA 1U8IB 3WTTA 4AJ0A 4M4PA 4PJ8D 4HULB 2K1MA 3W57A 2WZ5A 3FQRB 4PH8A 3D6GA 3CFDB 4PCTA 3RILA 5KYYB 3DIFB 3MNZA 3U4BH 5ANMA 1JAEA 1JGUL 3DTDA 4O51A 2I69A 3RBGA 3L9EA 4U49A 1JPSH 1EEZA 1N26A 1NDMB 2ZCZA 3HE7A 4RWYH 5SWZD 4MXVF 2P49B 2RHEA 3TURA 4JO8A 2EZ0D 3TBCA 4ZUTA 2VLJD 2VDMB 1TQCB 4QXUH 3BN3B 4NIKB 3K2UH 4RVBA 4Q97A 5IBUB 2AQNA 4LCUB 3CXHK 4AI7A 1T89A 1ADQL 1QNZL 5DZVA 3HNVH 4UIMB 1AO7D 2XG5B 1T1ZA 3CN4A 3OKOA 3E9UA 3GKWH 1UCTA 5TTRA 2ZF9A 4DVRL 3FTYA 1AP2B 2VL4A 4YUEL 4L3EE 3VGEA 1ORSB 1RUAL 1KBKA 1P4BL 3FOLB 5AZEH 4IOSD 5E2TL 3LKPA 1GH7A 2HLAA 4ADJA 1YMMD 4KVNH 4ODHL 1JZ2A 4XMVA 5F7DB 1YEEH 3PJNA 4HUUA 3TV3L 3GNML 1XFPA 2OZNA 3PGCB 4X5LA 4OLZH 1TZIB 4M1CC 4UOW1 5DD5L 4M6OL 2JWYA 3L4TA 3OJDB 1WT5A 3TVMB 4JFHD 2F53E 4JFDD 2OL3L 1NLDH 3K80A 1MLBA 4UTBL 2J8UB 5KYXB 5CP3H 3WHXA 4WVRA 3C60D 3HNTL 4FFVC 4WFGE 5C0IA 1EEQA 1N8OE 3QAZB 5I2IB 4L1DA 1VPOL 4R5XA 4EI5B 4F15B 3DVNA 1MI5E 2OMNA 4BGDA 3DSFL 1ZMYA 2AW2A 4PG2C 3FTGA 3PUCA 3VFPA 4XGZB 4YX2H 1E4XL 1MCEA 3OM3B 4RZCB 4DO4A 4Z8FH 4LEBA 1JNHB 4M7LT 2NUPA 2PYED 3FT0A 1F02I 4E42B 5JXED 1MFCH 4HDIB 2VDQH 3WD5L 3HFML 4PCSA 3C08H 1B0WA 1C8QA 2J4WL 4X4YB 3FB8A 4WY7H 4D0DB 4G8GD 4Q6IB 2XZAH 5DHXB 5F0LB 1GYVA 4ELME 5EHFA 3WI9A 4K7PL 4JPKL 1KF9B 1HI6B 2DWYA 3APFA 3QS2A 4PV8A 3VVVA 2AK4B 5C2UB 3GWJA 1RSYA 1MCCA 1KPUB 4HPOH 3BP5B 4MB3A 2FYYB 3GRWL 3W5MA 1HDMB 4YPJA 5IMOA 4U6XA 2XN9E 4Y4HC 1A7RH 4M5YH 5ID0A 4N0UB 1WIUA 1YJDC 5IMMB 1FFNA 4JY5H 4K9EL 1M53A 3DRTB 3PS6A 4XAKE 1QW9A 2EYTA 2FSEB 5CP7A 2KQNA 4FXKB 1H8SA 1PX4A 3GMLB 4QHMB 4HUVA 3HC2A 2IWEA 3NIFE 4NJAH 1H15B 4N2AA 4TNVK 5C08A 3PDOA 5F7NC 1X5IA 3RU8H 3MNVB 4JVPA 4Y9EA 3SKNB 1I1CA 3ZUCA 4M43H 4Y5YB 3ZTNH 5ISZE 3BGFC 4TVPL 4BZYA 4R6UA 5GRJL 3HFFA 4B9ZA 3DJRA 5HTSA 2H3XC 4HKJA 5DO2D 2QQKH 2P1YA 4ALAH 1IKNA 3N1GC 4EXKA 5CJBA 1FF5A 5HDWA 3L3OB 4YXLL 1OL0A 4YPGA 3ARWA 5I74B 2YUWA 4JPWL 2HT3C 3TU6A 4AJYV 4HJSA 4L9LC 3KPMA 1H3UA 1NCJA 3VXSB 1U3JA 5DS2A 3QJSB 3BDYL 4HHAA 1N70A 1CE1H 1WRFA 1Q9WB 3HZVB 3H0TA 1LP9F 3P4NB 4WWKB 3DV6A 1QSVA 2ZUUA 3VFVA 2P80A 4LU5L 1QLFB 5DK0B 4K8RD 5FX3A 4C56E 4DGIL 3MJGX 1UQSA 1UZ8B 4U7KA 2B08A 2BP3A 3UZVB 1YN7B 2XTJB 1HXYA 2XY1A 4GUCA 1ACYH 3BUDA 3QP3A 5FGCE 4A2FA 1A14H 4K3JL 3T4AB 3D0LA 4XX5A 3N6YA 1GGIH 5LGYA 1QX1A 4G80B 2VRAA 4MQXC 4YDVA 5D2LA 2XNAA 5DQ9B 3SGJA 2AEOA 2ED9A 2AJXL 2SEBA 5FHBL 1C8PA 1J86A 2XICA 2DQDH 2NNCA 2P5PA 5BMFL 4RMVA 1KB5B 3LKNB 2OA9A 1OF2B 3SKOB 1JYNA 4EN3C 5DWUL 2VABB 1E8YA 2FATH 3APCA 4PB0H 1NGZA 4PWIA 4QXGL 4B0MB 2MPAL 3O3AB 2AMUA 3QNZA 1HWWA 4KDTA 4BHUA 1E30A 4WGKA 2NXYB 1WD9A 2P5WD 1S9VA 1LO5A 1CDIA 3RFZB 4KTYA 3E3QC 5I8OL 5DTFA 2I26N 2A9NL 3KJ4B 4PJAA 5EG6C 4OM0L 1K72A 3QDGA 1MQKH 1N8ZB 3VRJB 3GHBL 5JDSA 4L4TB 1IJNA 1H6FA 4P3CL 4Q4IA 3UTSB 3CUPA 4D3CH 3GSRB 4F24A 4X6CA 5C0BA 2IAMA 3P9LB 4TQ8A 1WWCA 3C9NA 3RVTD 2HA1A 3UXFA 1D9KC 1JF1B 2PR4H 2VZUA 1DN2A 1L9NA 3X12B 4O02B 3WSQL 1L7TH 2DLIA 3W82A 4BQ6A 5D7IF 4BH7B 2VJ8A 3THMH 2Y1YA 4N0YL 4PJ8A 3RZWA 1X6NA 2DM2A 5DQJA 2JK5A 4I77H 3FCTB 1BYNA 3L16A 3B4NA 5J3HC 3A21A 4H2AA 5BZDB 2VXQH 4HYTB 3I9GL 1MRFL 2XZQH 1LWRA 2AAAA 5A6LA 2WQAA 3OPUA 4F9PC 3T8VA 5L2JA 5E51A 5SWZA 1U8JA 2Q6WA 5HYIA 2P5ED 2CWRA 5EU7C 2I24N 2IGFL 2WXFA 5FYLH 2Y23A 1R5IA 1JWMB 2W0PA 2PWEA 4W9ZA 4ZMYA 2V7HA 3FO2B 1XB6A 2N01B 3P4OB 2YQ3A 3K3QA 3LB6D 4F5CA 2W0FA 5FPIA 2LLNA 1AO7A 4AKPA 3B7RL 1I9JH 3AQZA 1Y18A 3QEHB 3WEBA 4XNQA 2WO2B 1Q1PA 3BPNB 4CMMA 2BIIA 2Y06L 4FDWA 2DY2A 4IOSA 3AUVA 3LZOA 3VWKB 1U8KB 4L37A 4MCZA 1YMMA 1SEQL 1N59A 4PUBH 3FO9A 3UH8A 1B6UA 4MNQE 1CGXA 2GAZA 3MROB 4DEWA 2LLGA 1TTBA 5E0QA 4WJ5A 5FO8B 2N59A 2DLFH 5B7MA 2BHZA 1KIQB 3EYSH 3OKEA 3GJFH 3BOVA 1O5DT 4JFDA 1VF5C 4HXBL 4UOQA 4TQEL 4KKCC 5IGXL 1GPOL 4PRBB 5ALCH 5B1JA 5BJTA 2X7LA 1HOEA 4KQ3H 3FO1A 3APNA 5DHVB 4W9KC 3BMVA 5FLUA 5LBVA 2EEBA 2HVKA 5IBTH 1XF5A 4IKLA 3IDJA 5EFIA 3KLHD 3MA9L 3T2NH 4UT6A 1BWWA 2FQDA 2I07B 3KCWA 4IRZH 4ESKA 3FRPB 1MCFA 2VDPH 1U2YA 2PYEA 4R7VA 4TRPH 1UXWA 3IF1A 3F6LA 3M45A 1JNJA 1NFDE 3W3BA 2JKJA 5DC4B 4P2QE 5T5NG 1CDUA 2HJKB 2X9WA 3MXVL 3I6LE 1SF5A 4D9LH 2WTRB 3N1MC 2F5BL 1MNNA 4OLYH 5IB4A 5SX4I 2VLRD 4B41A 3EDDA 1MOEA 1CS6A 1F11A 2B1AH 1YEGL 3GZOA 1BZ9A 1HCYA 3RJOA 3TEZA 5CJXA 1JPSL 4OCXH 4DOHE 3H3PH 2W9DH 2FEEI 5K39B 3TO2A 3MBEC 1R3KA 2CDFA 2Z93B 3GMPA 1YEIL 1OB1B 4QXUL 1F6AA 1DANT 1CL7I 4JM4H 3K2UL 3V4VH 4IHOA 1RAMA 4QRTA 2YXMA 4TL4A 5AW4B 2H0JA 4M3JA 3MBWB 2IANE 1SYVA 2D7QA 3DPBA 1NCDL 1IUZA 3HNVL 2COQA 2UWEE 3UAEA 4APQC 3D5OF 2DMCA 1FLRH 2EDBA 3OAZH 4PBVC 1F3JA 1CG9B 3D7PA 3S37H 5E6SB 1BD2E 2AJUH 4G6AC 1PZAA 3NQIA 1QRNA 5AZEL 5GXBB 2HPTA 5F7HA 5FV1L 4EJ1C 3U6RB 1DVYA 4X8CA 2XA3A 1C5DB 3DLQR 3KHQA 1M4KA 1YEEL 4RMTA 4E9RA 3RTQB 3IJHA 4JG1L 2JCCE 4YC2B 5KWYC 4FJZA 3VD2A 4OLZL 1AAJA 3D34A 2WZAA 4ZPTA 3BP6A 2M1KA 2H1PH 1LO4L 2IGLA 3BZEA 5LLIC 4H2CA 2RTTA 3T77B 4CC1A 4K15A 3EO9H 5MI0B 5ABZA 3V0VA 5IVXA 3LS5L 2CLRA 2IH3A 4B5EA 1MFBL 1JFQH 3L4UA 2FH6A 4HWBH 2NQCA 4D9RE 1Q38A 3QG6B 5KVGL 4L8CA 4G2AA 4OTXH 1IMHC 3ILQD 5B4MC 1GCYA 25C8L 2VAAB 1I7ZB 5TGBA 3TO4D 1ETB1 3MJ9H 4YX2L 4Z8FL 4OAWB 3HW7A 3CZFB 1ACXA 3DX6A