4K2UH

Crystal structure of pfeba-175 f1 in complex with r218 antibody fab fragment
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
220
structure length
208
Chain Sequence
EVQLQQSGAELVKPGASVKLSCTASGFNIKDNYMHWVKQRPLEWIGRIDPANGNTKYDPKFQGKATITADTSSNTAYLQLSSLTSEDTAVYYCARHYDGYFLYYFEYWGQGTTLTVSSAKTTPPSVYPLAPVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Erythrocyte binding antigen 175
publication title Structural and Functional Basis for Inhibition of Erythrocyte Invasion by Antibodies that Target Plasmodium falciparum EBA-175.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Immune system
total genus 39
structure length 208
sequence length 220
chains with identical sequence I
ec nomenclature
pdb deposition date 2013-04-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4k2uH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4k2uH02
1DUZB 3ARFA 2G2RB 4QTIH 1W0WA 5EZIL 3ZE0E 3S37L 1KENL 3VXRE 2NX5D 2H41A 4R0LA 4S2SA 5J6GB 1QR4A 1CCZA 4XCEB 4Z7NF 3LOWA 5F7MC 4PB9H 4ZPVB 1DSFL 2PYFA 3QSKB 3VG0L 4BQBA 4LMQI 4CNIA 4NRZB 3WFDH 2C4FU 2HTLD 3GI9L 5CUSL 4RISH 1JWMA 3C08H 2BERA 4F9LC 1IZJA 2FX7L 2CO6B 1IGCL 1KC5L 5GGQH 1XGPB 5DJXB 1BVKB 1MFCL 3LKQA 3OAZH 1ED3B 3QCVH 1RZIA 3QUMA 3EYUL 2EXYD 3ARTA 4LCCC 1CXFA 4K94L 1MQ8A 1IGYB 3T08A 1N4XL 4RFEB 3QUXD 2FGWH 2G75A 3HE6B 4NZTL 4J4PC 1S78D 1P4BH 3SE9L 4U33A 1HKLL 2PYEA 3L3HA 3P4OB 2YKLH 4RNRB 3QHZH 4HMCA 4YGVB 5ENWB 2JJSC 4QY8B 3TNMB 3ZE0F 5D7LB 4FQHB 1MFAH 4OCSL 2H3NB 2JJUA 5ECJE 5KSAB 3S35L 1A6UH 2AI0L 4LHJB 3NFPA 2WNGA 4NNXB 2FX9H 3ULUE 3WL9B 1EEQA 5IV2A 5FCUL 4YIQA 3RWGB 5IHZB 4HUWB 2UVFA 3BP4A 4YHLH 3MRJA 1QRND 2HFGH 1NCCH 3FO2A 4S1SL 1CS6A 1S7SA 4KQ3L 3KYOB 5A43C 1FCGA 1AE6H 3HE6C 5DJZB 2F53E 2ATPB 3MCLL 5SWSD 4JGUA 2JE8A 4PRID 3ELAT 5DRXA 4XAKD 3TO4B 3F7VB 3LDBB 1QFUH 2O5ZL 3MJGX 1UA6H 5IVZB 3UC0H 3LH2L 4QOKD 4R3SA 2B0SH 5TF0A 4NWUL 4HWEL 3OB0K 5TE7H 2YMXL 1I8IA 3QJHA 3L3OB 5TH2A 2MHAA 3P73A 1OTTC 1T04B 3PABA 3U7AA 3S5LA 3HR5B 4G8FA 5KSAC 1V3JA 1WEJH 4M93B 5EUKB 4I13B 1QKZH 3GNML 3ZSSA 4YFDB 3B83A 1FG2B 3I6GB 3VWKC 3EHBC 3VMNA 3VWJD 2A6IB 4F7MB 1DN0B 1HQ4B 3RVUC 2B20A 3C09C 3P0VH 2DQFA 4JQXA 3E6FB 3GO1H 1F58H 4DWHA 2VLKD 2HVKB 3BN3B 3SGDI 3TZVB 5L2JA 1A1NB 2YN3A 1DCLA 1R5WA 3MRRA 1D6EA 4JY6B 1MHEB 2ADGA 2F5AL 4YHIB 1OP5H 3TO4C 3LDBC 4XPGL 5DEGA 3LEYH 5INCB 2YZ1A 3FQNA 5D7SH 2RJMA 5JZ7D 1T1WB 1NBVL 4XP5H 4L4TE 5C6PB 4FS0A 4G3YL 3KPPA 5D5ME 3TJEH 4CJ1A 1XGTA 3BEWB 1PQZA 1X7QA 3EYOA 1QOKA 1KJMA 4Y1AA 4Y16C 3LS4L 2FJGB 3U7YL 1I9JH 1WTLA 5ACZB 2QQLH 5GSVA 3CFBA 1U3JA 5D7JD 5HGGS 1QBMH 1MUJA 4HS8H 1GGBL 4I18B 4NQDD 3O4LD 3SDYH 5M94B 3WIHH 3STLB 4M7ZC 5GSRB 2BRRL 4EN3B 3VI4E 3RI5K 3BSZL 2WBJD 3TZVC 5KSVB 1V3MA 1MPAH 3DXAE 2L7UA 5EUOB 2NX5A 5E8PA 5EU6B 1ZVSA 5GISL 3DMMD 1DBBL 4X9GA 1HYSC 5DWUL 1J88A 3HZMB 3O2DL 4OF6A 2PXYB 2IC2A 4FP8H 4OQTA 4PJFA 4MLIA 3G08A 5DSCB 3LSOA 1I8LA 5EFIA 4N8CL 4WDIA 4HC1H 1GZPB 3C8DA 3PGFL 5J12C 5EOCH 2FL5B 5D5MF 5HYJE 3S34H 3B5GA 3TT3H 3VXSB 3L3JB 3BO8A 3K2UH 3O3AA 3KPRA 1G0YR 1MJ8L 5BXFA 4I18C 3SOBL 3D87B 4G5ZH 4M7JH 1X5AA 1L7IL 3VFMA 1CR9H 2IGFH 5F1NA 5EG6C 1U3ZA 1NC2A 3F58H 2BMKB 5FFLA 4HIJB 3BIKB 2XY2A 2FSEB 4P2OD 4Y5XA 2VISB 4YBLB 8FABA 4NC1C 3VI4F 4PJHA 2A2QT 5DMGC 3GJFK 2IAND 4N0FA 3VXMB 4NQCA 3REVA 3P9WB 3WNMA 3C9NA 4N9OB 3ARGD 4RSVA 1BJ1H 5CHNA 3T0EC 4AJ0A 4N9GB 4Z77B 2Y9RT 4W81A 3ES6B 3ZTJH 1WZ1L 1SJHB 4JKPH 3W11D 3V4UH 3BP6A 1Q94A 1YEEL 5GPRA 4XCCH 1TVBA 1EBAA 3X3GH 1FVDA 1JZ7A 5IBUG 1EAJA 5SWSA 4N0YH 4AENB 4GAFB 4KK5D 3OX8A 4PRIA 3QNYA 3MR9B 4HIEB 1DBMH 1KEML 2EDTA 3G5XA 1SBSH 2CPCA 4KVCH 5AZEL 3ZYZA 5I66B 4QOKA 1VGKA 1NANI 4YBLC 4LLYA 4PGJA 3VFSB 4GRLA 4ZFOB 2PR4L 2IQAB 4F33A 3EO1B 2J1KA 4ZUTA 1OT1A 2EYRA 1ES0B 2Z31A 3FFCD 1GC1L 1NGXB 1RZGB 1WAAE 3IDIA 3RWDB 1F90L 3G6JE 3VWJA 4OIBA 2HG5A 4JJ5B 2OSLA 2Y25A 5MI0B 1W0VA 2V9RA 2B5IB 3WIFB 1ORSA 2FYYA 4XRCA 3KJ4C 2ZCKL 3QDMD 4XNZB 3DX8B 5HGHB 3LMJL 4NKMB 1JI2A 3VRJA 1B0WA 2MFNA 5I1KL 4XZUA 2WANA 2X09A 4PP2B 1DBKH 4D0CA 4DN4H 2NY6B 2KQMA 2MQ0A 3RWFA 3LN9A 3ZSTA 2OCFD 3QA3B 1PG7L 4NO3A 4NZDA 1A14H 4PJBB 4GG8B 1T1YB 1G0DA 2IFFL 1PZUB 5IBLC 3X14A 4NN7B 1T5XB 4XVUD 3TYGL 2F8XC 3WD5L 5BV7L 5C0CD 4ONHB 3CVHB 1RU9H 1DVFD 5F3BB 5JDJA 3PWJA 3MXWH 5D2NA 4OZIB 2CK2A 1UVQA 2A38A 5FHBL 3C60D 1FO0A 5MI0C 3GMQB 4NQDA 1JGVH 2ARJA 4R0LB 2XPGB 2FZ3A 2Z93B 1WAAF 1S7QA 3G6JF 2OQJA 4XNZC 1BGXH 2Z91A 3BQUD 4WY7H 4IDLA 1BFTA 2WP3O 3OKOB 1CLYH 4HJJH 1T2QL 1MFNA 3OKNA 2BY2A 4J8RB 1JWMB 4HXAL 3SDDD 4CJ0A 1IC4L 3GSNB 1U8IB 3H42H 5FKPA 3TESA 2EH8L 1XCQA 4CVZA 1D3CA 3BPCA 1OCWL 5ACMA 3T0BA 1JGEB 1YQVL 3OHXB 4LASL 3QUMB 2VN4A 2PO6A 2FRGP 4M8QB 1Z5LA 1CLZH 4LP4A 2KUTA 5J1SC 1QFWI 2BVQA 4Z7WA 2OZ4H 5EB9A 4R2GD 1HXMA 4NBZB 2CGRL 1KB9J 2I60H 2NW2B 1LK2B 2VH5H 4I0KA 3ARFC 1MRFL 5E4EB 2Y5TB 2PYEB 3L3HB 2UV3A 2NCMA 1F97A 1JNLL 4Z6AT 4IJ3C 3D0VB 4R0LC 3MUHL 2C1PA 2JELH 3PGCB 4QXUH 1E4WH 3GMMB 1NGPH 3BDYL 4X5WA 2IG2H 3GSQA 1GRWA 4AMKH 2ADFL 2JK5B 3WDIA 5L8JB 2KH2B 1IQWL 2AKRA 3U79A 4OF8A 1F3JA 4I3RL 1SVCP 4U1MA 5GGRY 5GS2H 3LRSB 3NFPB 5JOFB 4JRYE 5IV2B 5DUBA 4YIQB 4L3CA 3UTPE 4GW4A 3D3VE 3BP4B 1JHKH 3MRJB 4POUB 1FGNH 4QHUA 3ARGA 3SJVE 4G7YL 3FO2B 3T65A 2DQIH 3VXQA 4FFVD 1A1MA 1S7SB 5FGBA 5I76A 2IBGA 1SM3L 3HLAB 5HHXH 2R69L 1AXSA 1CT8A 5SX5H 2ZG1A 2YXFA 4KROD 1GGIH 1BZ9A 4Q2ZA 5ISZE 3L5XL 4YLQT 5DRXB 5GS1A 3MJ9A 1NC4D 1BFVL 1G7IB 2DIBA 3NZHH 5C3TA 3CD4A 3QWOA 3SEPA 3SO3C 3PJSB 4QCIA 1G7HB 1MCCA 5DEFB 3PWNA 1MJUL 1I8IB 1RFDL 4UINL 2X9YA 3DSFH 43C9A 4XMLH 5TH2B 3NVQA 4LCIH 1IAKA 3P73B 4QWWC 3BAEH 3RVWC 4AT6A 3S5LB 3WS6A 3EFDH 4G8FB 2P47B 1Q0YL 4OCXH 4F7CA 2CJUH 5T3ZE 2Z9TA 4HV8A 2R2EB 4MCZA 1BQLL 2V17L 5CLWA 5BOPA 3W39B 1BX2A 3P4NA 1N3NA 1S7TA 3RL2A 5MP6H 1IC7H 3QIUD 3QUYD 4PRBB 4LPXA 1CGXA 3OAUL 4LVOC 2DQFB 2N7AA 4MXWL 3MBEB 5JOPE 4PY7B 2DQJL 1KGCD 3BUYB 1D5IL 1FSKB 3EFFA 4ZXBD 3PWVA 5L2JB 3QDGD 3NGBB 2VNCA 1HSAB 1AFVH 1VEOA 3X3FH 3FQUB 2ADGB 3CVHH 1U8JB 4KK8D 1LMKA 2Q8AL 3MV7E 3UJIH 1PLGH 4Y5VA 3TLRA 4ZNEE 4L8CA 3OQ3B 1ZKAA 1QNZL 1NLDH 1OWWA 5GIRA 5I71B 3EYVA 5I8OL 1C5CL 1P53A 4KJYB 4MVBC 4HF5H 4JM2A 1PQZB 3DYPA 3EYOB 2DOCA 4WV1A 1JNHA 2R1WA 4OLXH 4WWKD 4OLUL 5ID1A 5DO2D 1OSPL 4HGWA 5E08L 5D2LA 5FA4A 5DUPH 3C2SA 1TIUA 2JJWA 3DGGA 1G7PB 5FV1L 2XY1A 2XKNA 4X6DE 1U9KA 4JAMA 1MUJB 3CPLB 1EIBA 1P5VA 1JPFA 1NFIA 4BZ1H 3U4EA 5CKAA 3MBEC 1OP9A 1JZ8A 5MHSE 3WKML 3RUGA 1N5AB 2AXFA 3C60A 3QUMH 2YUWA 1D5XB 2P5WE 3NGBC 5DJCA 1EHLH 2NX5B 4P5KB 5E8PB 5IKCA 1ITCA 2P48B 4P3DA 3LQAC 4UT9L 3B2UD 4K23L 5HHMB 3TEUA 3CFIC 1FFQA 3KYKL 4HLZG 2WLYA 2ZJSH 4PJFB 4X83A 5LQBH 3EKCA 5I71C 2DWDA 2VC2L 3NCBB 4UV7H 4JPKH 3SKUD 2R56H 1TTUA 3LSOB 5CWSA 2XWTB 4K55A 5SWQA 3K1DA 2XA8H 2H6PB 1RZKC 3CFJA 3C2AH 1JRHH 3MLZL 3P0GB 4O02L 4Z78A 4NRXA 4JPIA 1LK3L 4P2QE 3QUXB 3BO8B 4GSDL 3P4MB 4TTGA 1YMHA 3D2UD 2DJSA 4RWYH 2ENSA 1T0NA 3UTTD 4J3XA 5LGJB 4XTRD 4QO1A 1T1XB 2OXGA 2AEQH 4X6DF 3UTZA 4OLEA 2WINA 1YYLL 5AD0B 1KIPA 5BVPH 4RAVA 5L2KA 3IFOA 2ITCA 1RUQH 4O9HH 4YPGA 2ADJA 4G6KH 1R0AL 1IM3A 2CR3A 5MEPA 2OK0L 3HC4H 4NQCB 3REVB 5B3NA 3SDCA 4LSQH 1XR8A 1NGZB 1OTSC 4PJEE 2AQ1A 3PQYD 4JN1H 2YHGA 1MF2L 2GT9B 4OB5L 5DD0H 4WI9A 3TWCL 1I8LC 5I1CH 5LWYH 4EEEA 2VOTA 4HKBA 1QRNB 3L9RA 3P77A 2FHBA 4LDLB 1QG3A 1IKNA 4LIQE 5ALBL 1NAKH 3BP6B 3QEQD 2AP2A 3RWHB 5F6IB 5HSFA 1DQQA 1LNUB 2JB6A 5C0ND 1A7QL 1AHWB 1CK0L 1FVDB 1R3IH 4RGND 5BMFL 5SWSB 3T4AB 4LSPH 4CVUA 4PRIB 4HMEA 3QNYB 1FLRL 4BFIA 5I73B 4J6RH 5CD5D 2Q87A 3G5XB 4FQ1H 1EFQA 4KTDL 4V1DD 4QOKB 3HZVA 2AGJL 4Y5XC 1ACZA 5FA3A 5E9DD 5CD3A 1GXEA 1QQDA 1FQ9C 4OGYL 3IDMA 4Y4KD 2BVYA 4F33B 1HI6A 1S7UB 3LQAH 4E41E 2EYRB 1SEQH 3IVKA 1JNJA 4G42A 4YHMH 1P4IH 3I2CH 4LLQB 4DKFH 1XAUA 2MWCA 2Y07H 3BE1H 3BXNA 2R4SH 1K8DB 1N0LA 1RJLA 2N4IA 4JDTL 3VWJB 4PJEF 1A6PA 4N0UE 2HG5B 4JQVA 3QIUA 1A7OL 1F11A 4JCLA 1W0VB 2ZCHL 4NKIH 1ORSB 2FYYB 3SQOH 4XRCB 5F6IC 2GSIB 1RZKH 3K3QA 3FB7A 1U93A 2VLKB 2IQ9L 3FTGA 4JFEA 2QTEA 4XZUB 4HUXB 5I9QC 4P59H 4D0CB 3WE6A 4ODHH 5I1DA 4KU1A 2X1QA 1UXWB 1M7IB 1OAZH 1RUAH 3QWRD 3CMOL 3CU1A 4GRLC 2R0LH 3X14B 3B6SB 1WUNT 4RRPA 1T89A 4N0RA 4W68A 2Z31C 1C5BH 4WWKA 3RX5A 4HW6A 1OL0A 2YSSB 3PWJB 5D2NB 1UVQB 4O2FB 3MYZA 2X4QA 4OQTH 5D7JB 5A2FA 4YFLI 3VWJC 4AM0A 3EDKA 3UJTL 1ZT7A 1FO0B 1MFEH 5DZNA 5E8NA 5IFJB 5F96L 2FJHB 3DGCR 4NQDB 3O2DA 1T20B 3RZCA 1I7ZB 1GOGA 4UZGA 3TVMA 1J8HD 2OQJB 5DT1H 1GGCH 3UJJH 2F8VA 2WBJB 1J7VR 5I1JH 2FEDC 5DJYB 1ZE3C 1MJ7L 3WMSA 4PJGB 4ZODA 3CMGA 4WHTA 1QFWL 2DL2A 4R26H 3DMMB 4JKLA 3CK0H 2Q20A 3E1F1 3QDJD 4PJ7A 4WU7A 1FN4B 3LS5L 4GMTL 2V5MA 2A9MH 3MBXL 5FUOH 2QL1A 5T3XL 1TPXB 1XCQB 4CVZB 5JZ7C 1U8HA 4LKXB 5DFWH 3GSUA 4U7SA 5KANI 4G8GA 1Z5LB 1BQUA 3M8OL 4RA0C 3T1FA 1EK3A 4Z7WB 4P2RD 1HXMB 4R90H 4QRRE 4HG4J 5D2NC 4NQXA 4ZSOE 4GOSA 4EDWL 1RULL 4NM4L 2YD5A 2LTQB 4QRPD 5B3JE 1IBGH 4XXDA 2GJJA 4RAUA 1RUMH 1Z0MA 1MCEA 4K7PH 3BKCH 4KK9D 1HZHH 3VFRA 4WRLA 4EVNB 3N85L 1YN6A 2DLEA 2AKRB 2Z8WC 3LHPH 2UZIH 4P2OB 2YWZA 4PG2A 1Q9KA 4M1CD 3BD3A 4TUKH 1FORH 1MH5B 4U1MB 1P6FA 1A6ZA 4J3UA 1I9IL 5FO9A 5DUBB 2IANB 1KXTB 1TPXC 3ZDYE 2E7MA 3GHBL 1NCDL 1GL4B 1EDQA 1M7DB 3ARGB 3PQYA 1RMFL 3TIDA 2PO6C 4NDMA 1PKQE 5FAAA 5F7DB 3KVQA 1G7LB 1CT8B 2ENYA 3SKNA 2ZG2A 4K3HA 4LNRB 4PYHA 2VDLL 2Y6SC 3BPNC 1YY8A 2BNRA 4K7FA 1WCQA 3GSXA 5J56B 3D5OF 2CDFA 4KJQC 4LHUG 3MODL 2RAMA 4PGBB 5F9JA 1DQLH 1M7XA 2VDRL 3I3EA 4CMMA 4Z7QE 5B3JF 5C70A 2CRZA 1NPUA 3PDOA 4HIXL 4J3TA 4FXLA 5FYJH 3CH1A 5IMLB 5D7LE 4HV8B 4XCNA 4LL9A 1T66D 2ZCLH 4MCZB 5E70A 4L29B 3KPSD 3W9EB 1JFQL 4WFHD 1CD9B 3P4NB 1N3NB 4R8WH 1S7TB 1URLA 4JO1L 1UADC 2GTZA 1FVCB 1J8KA 3ARGC 3FFCB 2A9NH 4M48L 2IBZY 5TDPA 4NKQB 3ZDYF 1HIMH 5FGBC 1NDMA 3CSYA 4OSUH 1BBJA 4HK3N 5HJ3A 3VH8A 3N50A 2PF6A 1EFXD 1B0GA 5GS1C 3QDMB 5H94A 4N1HB 2XT1B 2DIJA 4PJ5D 4Y5VB 4L8CB 1T03H 1FO0H 5A2KH 2HJFA 3EYVB 1VGEL 3VFTA 3U9UB 4PTUA 3WS6C 4K8RL 5D1QA 3NBNA 4OFYA 4ZTOH 5L7XH 1IM9A 4XPAL 2R1WB 2DKSA 4Z7QF 4RBPH 5ID1B 1NCWH 4HGWB 5D2LB 1T21B 4H5SB 4PJDA 2D03H 3HR6A 2I9TA 1JV5B 3CFCH 3MRCB 5EBWA 4MHHI 4PJAB 3BP5A 5C0CB 2OTUA 1GVIA 1DVFB 2YPVH 1XGQB 3F7YA 4PB0H 4YBQD 3EO9H 3WFCL 4RQQA 3U4EB 3OG4B 4ZS7L 1PX3A 1ZTXL 2BNQD 3PIQA 4HHAB 4LPCA 4BQCA 3O2VL 5JQHC 3RUGB 3C60B 4PP1C 1JGUL 3AC0A 4NN5B 5INDB 4L1HA 2BJMH 4GAYB 4AEHL 3OKKA 5HI3D 2NYYD 3JXAA 5IKCB 1YNTA 1J12A 1W0YT 1SMAA 1Q0XL 4WIQA 3NIGE 3DNKA 4ODTL 4X7TA 1MRDH 3HCVA 3TBVA 1YECL 4Y5VC 3NCJL 4BZ2L 1VKXB 1E4XL 2DWDB 4A2MA 4PGEA 2VDNL 1HWHB 3SDDB 3VGBA 1Y0LB 4NRYA 5B8CA 4JM2C 1L9MA 3IDUA 4NKDA 4WV1C 5IB3B 5SWQB 3ZKQD 1JPTH 3CFJB 1AGEA 1FL3B 4BH8B 3HNVH 4UIKH 4XP1H 4Z78B 4NRXB 4ETYA 5I15H 4JPIB 4XVUC 3K4ZA 4PPTA 4R2GB 4P2RA 5F6HI 4P0DA 4PJ9A 1VDGA 5HYSA 3UTZB 4X4ME 2E27H 5F88A 4CL7A 3MGOA 3C60C 4QRPA 1ZGLM 4O2CA 1Y6MR 4G9FA 5I8KH 1CWVA 1CXIA 4RAVB 1WISA 1U3YA 5H35A 5EUOE 1U8KB 5IHLB 1Q72H 2XZQL 5EU6E 1ZGLA 2BNUA 3FCTA 2ADJB 3MZTA 4NC1E 4D3CH 1D5MB 1IM3B 3DVNA 4K94C 1J1OH 1MCSA 1INEH 3MJ9H 1RUKL 1XR8B 2YA0A 1I9RH 1WJ3A 4M5ZH 4P3CH 5J1TC 3NIGF 4ONGH 4NHCH 4K3JH 3VXOA 1MY7A 5DD5L 1MCBA 5DF0A 2V2WA 1F4XL 4U6TA 4XWOC 4R4FH 3T0EE 1Z9SA 4HKBB 4KKBC 5TQ0H 3P77B 2OR8A 1MLCA 5DRNB 3TPUA 5L88H 4UDUA 5H37G 1DQQB 4H26A 1MNUH 2JB6B 3QG7L 5F7EL 5IESH 2DQTL 1LHZA 1JGDA 4HXBL 3I3DA 1NC4B 5HVGB 4F7EA 4EUPG 5ITBH 4JG1H 2IPKA 2X4PA 1JTOA 1S9XA 5DQJA 3HZVB 5A2IH 4DTGL 4X5XA 5CD3B 3OGCA 1J1XL 1QQDB 4NGHH 1KB9K 3IDMB 4Y7MA 3MPCA 3SDCC 5EUOF 3QCTL 4HJGB 4G42B 3L1OH 4UAOC 3VXME 5DHXB 4XPHL 4OLYL 1DDHA 3BXNB 2K9UA 2WIIB 4KI1A 1SMOA 3MO1A 4UILH 5IOPB 3MCKA 3QIUB 3K1KC 3QUYB 3CZFB 1NCAL 3DV6B 1BQHA 4PRAA 5DGRA 1PDKA 1IKNC 2GKIA 4FFVC 1TZIA 4U3CA 3GMPB 1GGTA 3ALWA 5EZIH 3S37H 1EBPA 1T6WA 1KENH 2WAHA 5GRVL 2E7BA 4ZXBB 4ELMA 4MJIA 5BOZG 3VGEA 3QDGB 5DC4B 4BH7B 3FTGB 4NNYA 1MCLA 3QO1A 3BH9A 3PP3H 4J3WA 4NQVB 1DSFH 1UCTA 4P4KA 1JYXA 3VG0H 3WE6B 5AWNL 5I1DB 3GM8A 1JCKA 4U1LA 5JW5A 3GI9H 1OARL 4PJ5A 1I3GL 5CUSH 5IMKA 5K9KA 2D31A 1IFHL 2FX7H 2QQNL 4WHCA 1IGCH 2IPTL 2NTFB 3MV8D 1MFCH 4JKWA 3BX7C 5HVWA 4ZFZA 3EYUH 2L4OA 4WWKB 4PLJD 2V2XA 4K94H 4R7NB 3MNVB 1N4XH 1VEMA 5IEKB 3A0OA 2XN9A 3UDWA 4NZTH 3EOTL 5GGUA 3OGOE 4JQVC 3QIUC 4RRPG 1WCBA 1BLNB 3SE9H 1HKLH 1BIHA 1KCUL 4RZCA 5IB1A 1IEHA 4PRHD 2P24B 1U8PB 5FGCB 4LPVA 4YXLL 2X2YA 4B0MM 3SE4A 3TBTA 5KTEL 3BOVA 5IFHL 4U49A 1NMAL 2APFA 2GQHA 4N90E 4PJ7B 4KK8C 4OCSH 3IXAA 3KR3L 4IRSA 2ESVD 3QXDB 5DI8A 2DYPD 3V6BR 3S35H 2AI0H 3WLBA 1EPFA 5FK9A 5J06A 5FCUH 1F3DJ 1H3PH 1NL0H 1OP3H 4FOMA 1J10A 4PJBE 3T1FB 5J57B 4KJPC 5SWZD 3VA6A 3KYNA 1T89C 1GGYA 1NGQL 4JHBA 4WWKC 3VXNA 4IHOA 4S1SH 4PRPD 4PYGA 4KQ3H 2V9QA 3PWUB 3G6DL 5BJTA 1H3UA 4IMLB 1HH6A 3D2UB 2WUBL 1H15A 2FWOA 3RZCC 3UTTB 3KPOA 2B39A 2O5ZH 4WTZA 3TVMC 4LEXL 3LH2H 1FL5B 4HWEH 3L5HA 5CGTA 1DE4A 3K81A 1BFOA 2YMXH 3J8F7 3B2UC 4YDJB 3RNQB 3TPKA 1WIPA 4YHYB 4K7PX 4FN0A 3RX8A 1DZBA 1CDYA 3GJEB 4TNVF 3LQMA 4J1UA 3NFSL 5DK2A 2NY1D 2WP3T 3GNMH 5DHYA 2EEBA 3PQYB 5I1AB 3U1SL 3MLSL 3DTXA 4QTHA 3MLTB 1YJDH 2APTA 4YO0B 4QGTA 2BOBA 4PJBF 4OCMC 2YPLD 2EC8A 3QEQB 2AVGA 2MCG1 3BKML 1QSEA 2BNRB 4K7FB 3GSXB 1TXKA 4RGNB 4FABL 2CDFB 2PYEE 3L7FB 4OAWA 2F5AH 2ICWI 5DD3L 4GKSB 4N8PA 4XPGH 1VERA 4CMMB 4GW1B 2AXHA 4F37F 3PDOB 5E03A 4V1DB 1NBVH 1HHJA 4PG2C 3KLDA 1KJVA 1FNEA 2WIMA 4G3YH 3WSQL 4NSKB 4LP5A 2XZCL 3GZKA 5E9DB 1MCWM 3CFKA 4NZJA 2WZPD 2HVJA 1NEZA 4Y4KB 3LS4H 1I8KB 3QRFM 1BIIA 3U7YH 2GTZB 1OOAA 4LSRL 4X6CA 3RNKA 1UEMA 2LAGB 1X44A 2Z0BA 5AYUL 4M3JA 5CEZD 3TBSB 2I9LB 4U0QB 3CSYB 3LPFA 2IEPA 1GGBH 5HHVL 1S3KL 5E6ID 5HJ3B 3I75A 1LP9A 2BSTA 2BRRH 2ZSWA 1B0GB 4UOW1 3BSZH 4WJ5A 4KKCD 5EO1A 4HUVA 4OIIL 5H94B 5C0NC 4WUUA 4RGNC 5HHOD 2WV3A 2DQGH 5GISH 3BGMB 1DBBH 4DVBA 1JI1A 5FYLD 2BY1A 1JN6B 5DWUH 1SEBA 5CD5C 1GC1C 2HJFB 2JIXA 3O2DH 4HAFA 3VFTB 4PTUB 4GLRI 4RMRA 3I50L 5HI5C 3QT2A 5DMIL 4NJ9L 4P5TA 2JCCB 5BS0D 4PJDB 4P57A 2DWEB 4N8CH 4KZDL 5EBWB 5EOQL 4B50A 5KAQF 3BP5B 4XMKL 4MNQD 1A0QL 3PIQB 1IL1B 4LQFL 4V2BA 1MJ8H 3SOBH 1OVZA 1L7IH 4D9RE 5J3HD 4U1HB 4LKCB 3OKKB 1YNTB 2DQCL 4YXKL 1MI5D 3RFZC 1T83A 2MCPL 2RR3A 3KWWA 1FYTA 4X7TB 2VLME 3FO9A 3TBVB 1WBYB 5BV7C 3QDJB 3RVVC 3TH4T 1FNAA 3WIIL 4LVNB 2DYPA 3X13B 2BXYA 2EXWC 4NRYB 5B8CB 5D1QC 3VXPA 4K2UL 1OGAD 1TNMA 3HG1A 3HTLX 4Y1AE 2HKFL 5KSBA 1ZGLP 1XCTA 3VE0B 3EZ8A 5SWZA 4XGZB 1SJXA 2IAMD 2Y7QA 1WZ1H 4P2RB 1ETZA 1KYOJ 5CJOL 2C7UA 1YEEH 3Q5OA 3ZO0A 5HYSB 4HFWB 4F7TA 5F89B 1UJ3A 2J4WH 3KNBB 4QRPB 4O2CB 1X3DA 3QEHA 3TIEA 4QKXB 1KEMH 1OWRM 25C8L 4NO0D 3B3IA 2NX5E 1CE1H 3N1MC 5AZEH 1ZGLB 2XWJB 2D0HA 5HHME 5FF6B 2OI9B 5GHWL 4DN3L 5IEHA 2X1WL 2ZUXA 4PJFE 5B8CC 2V2WB 5J4MA 2ILLA 3EJYD 2EICA 5TGBA 3U46A 2VSCA 1MLCB 3BESR 3VXRD 2VABB 1F90H 4UDUB 5FUCE 3FKUS 1BPVA 4PJ9C 4LVEA 1AGCB 2D3VA 2O5YL 4JGMA 4X7DC 5FYKH 2VL5B 5MEQA 3KPRE 3NAAL 4KKLC 1JGDB 2ZCKH 4PV8A 3LCYA 3VCLA 2EDWA 4F7EB 3LMJH 2X7LA 3ZE1E 4X9FA 4MA1B 4XNYL 2IPKB 3MRGB 5I1KH 3OKLB 1ACYL 3A6BL 5TF1L 4H20L 1X5ZA 1AJ7L 4X5XB 1QPXA 5EBMA 4KWUA 3OKEA 12E8L 1PG7H 4HG4K 4KHXL 5DZOA 4PJHE 5DTFA 4JFYB 5EA0L 2OI9C 2IFFH 2QR0A 2NLJA 2GK0B 2WW8A 2YPKA 1CTOA 4NQCE 5JOEA 1DDHB 5C7XL 3TYGH 3OAYK 3WD5H 5BV7H 3KPSB 1U2CA 4KUCD 5IW1A 3DETC 3ARPA 2KKQA 2WK2A 4P2YA 4HZLB 4OZ4B 4PJFF 1MAKA 2K7PA 1QRNE 5FHBH 1FJ1A 3MRDA 3V6FB 4LGRB 1P4LB 2VDQL 4NNYB 4X99A 3QO1B 4QRQB 4LRNL 1EFXB 2FIRT 2HT3C 4U3HA 5SWSE 2JF1A 1EX0A 4L8SB 4PRIE 43CAA 3LN4B 4MA1C 4XAKE 3F7RA 5HHOA 1T2QH 1HCFX 5T33H 4PJ5B 4ZTPL 5IMKB 1NMBL 1TQBB 1TDQA 4HXAH 3DI3B 2NY0D 1IC4H 1XIWD 4QOKE 4U4BA 3ZE1F 2BSSA 6CGTA 2J8UA 4G7VL 2IFGA 2ZUVA 2R0KL 5LAXA 3S7GA 4U31A 2VQ1A 4ORGB 1OCWH 5HPOA 4Q0XL 5DVLA 1DBJL 4LASH 4TSBH 5C71A 3CZJA 2V2XB 2YK1L 5HYQA 2JJVA 2IH1B 4PJHF 1W72L 4CUCA 4BKLB 4GQPH 1AP2B 4XNMA 1MCRA 4LGSB 2CGRH 1T2JA 1WCBB 3NFNB 4MNQA 1EGJL 3V6ZB 1MRFH 2BC4A 2VLLA 4JG0L 2BNQB 5KJRH 4RZCB 5C1MB 5IB1B 1JNLH 1ZT1A 5FYJE 4PREA 3WUWA 3BDYH 1V7NL 2VLKE 4U6XA 3VFUB 4TSAL 4P4KC 2ADFH 2OR9L 5C2UB 1IQWH 1QLRB 3GBML 4U05A 5DI8B 5DRZA 2OXHA 3QEUA 4KJWD 1MCPL 3AGVA 4I3RH 2C3HA 2RCSL 5F7FA 3UYPA 3WLBB 5FK9B 2DQUL 2EYSB 4FQQA 4I4WB 2Q1EA 1I1FB 1L9NA 3HRZA 3HHRB 1BEYL 1JK8A 3T4YA 3QQ3A 1KCVL 2CQVA 3KYNB 3W9DA 4G7YH 1X5GA 4U1GB 2DM7A 4IHOB 4JFFA 3O4OB 3T2OA 1SM3H 3NCYS 5BJTB 3UDWC 5D2NE 3R8QA 1H15B 3L5XH 3Q2CA 2FWOB 5J89A 1NFDA 3D85A 2ZP0T 3MRIB 1BFVH 4NQDE 4L4TD 4W70A 1KUMA 3EOBB 3RIFF 3NABL 5KVGL 3SE4C 2NYYC 3NPSC 3ETBF 2FBJL 1BFOB 1MJUH 4UINH 4NO0A 3FOLA 1CGSL 1M6OA 1HKFA 1KPVA 4IRSC 3DVFA 4KQ4L 4UT6L 1Q0YH 4POZC 3HNTH 4J1UB 2LV4A 5BO1H 4NWTL 1YNLL 3GI8L 5F7UA 2XFXA 1IAIM 5CSZA 2V17H 5FUZH 3RVTC 1LEKA 4AEEA 1T6VN 4NFDA 5EBGA 3UYRL 4QTHB 1ZLVK 3K74B 4LLMB 4OZHB 3BGFB 2VZOA 3OAUH 2BOBB 4Z7WE 5JUEL 2GFBA 4MXWH 3WO3B 1MJJB 3O4OC 2DQJH 1D5IH 1SYSA 2H9GA 32C2B 2BHUA 2W1NA 4PJIB 5J1AA 4NIKB 1CL7I 1Z0NA 1U8MB 1VFAB 3KPLA 3K7UA 3V8CA 5C0EA 4HS3A 3RWEB 2Q8AH 4JQIL 4S1QL 1U8LA 1QNZH 4D94A 1FNEB 1UJTA 2SEBB 3ECBA 1EERB 5I8OH 1C5CH 3E3QE 3CFKB 3HC0B 4X4YB 5HYJD 5EBLB 2G5RA 2VXUL 1BIIB 2XZZA 1WZLA 1R3JA 4OLUH 2IANE 1OSPH 5E08H 4HJ0D 2V5YA 4X6CB 1HOCA 4U7MA 5CGYC 5BVJA 3BVNA 1L7TL 4MAYD 2W9LA 4YHOL 5E8DL 1MIML 2P8LA 4R97B 3FN0L 2BSTB 2WWKO 5BZWA 3IKCB 1MRCL 1N59A 3WKMH 3UROR 1ONQA 3CH8A 5EO1B 4HUVB 2XTJC 1G9NL 3P3YA 4Z7WF 3L5IA 3AVEA 3WBDA 2MKLC 5FO8B 4UT9H 5DHVA 1EHAA 4G6MH 1DQDL 4K23H 3KYKH 5DJ8A 5F7KC 2NY4D 5A40E 1G7MA 2QLVB 5FDYA 5J9PB 2OL3L 1S7VA 1RJYA 2VC2H 2ADIB 1FE8H 1D7FA 2NQCA 4BJLA 3MV8B 4DK3A 2VXSL 2F74B 3RPIB 3FJTA 3EJZD 3MLZH 4O02H 2CUHA 1LK3H 5E00A 4JPWH 2DIAA 2K1MA 3MV11 3VW3L 4GSDH 3FFCE 1MLBA 4TTDD 4XBEL 4L4VA 5IBTH 3IDGA 4QXTA 2XI9A 1JMXA 1YYLH 3K0WA 4PRHB 3AXLA 3KWWB 4NT6B 5JDSA 3MRKA 3FO9B 5DVMA 5IVXB 2EDFA 4OZFG 1NCNA 1R0AH 2ESVB 2OK0H 2DYPB 4UOJA 4Y19D 3FT2A 1DQML 4G8EA 3VXPB 1CXEA 3V7AG 2EE6A 1MF2H 3HG1B 4P5TC 4DEPB 4OB5H 5KSBB 4WW1A 4JDVB 3TWCH 5F1IA 3FMGL 5SWZB 4E42A 4FQJL 5D2LE 4XC3L 1E4KA 2Y7QB 3QO0B 1WK0A 4HUUA 3KLAB 2PW1A 5ALBH 5KVEL 3U2SA 1NANH 1S5HA 1K4DB 4PRPB 4PJAE 3X12A 5C0CE 1FP5A 2KDGA 1HXYB 1CICD 1CK0H 4EKXA 3TCLB 1UJ3B 2YKLL 5BMFH 5IGXL 4HGMA 3GUTB 1FLRH 3RUGE 4M4PA 4ZUUA 3P9LB 3B3IB 1X9QA 3S36L 1T83C 5IB5A 1CFBA 4KTDH 1VFMA 3MJ6A 5LBSH 2AGJH 3CUPB 3FQXB 3WHXB 2BVPA 4NKOA 5IEHB 4K9EL 4OGYH 1HINL 2I24N 1F8TH 1ZLUH 2HFGL 1CF8L 4N8VB 2NY1B 3BISA 3TBYB 2CKNA 3H9HA 1B3JA 1MELA 4JDTH 5EPMA 3IDNB 3WJLA 2ZCHH 4HKXA 4MAUL 1KNOB 5MEQB 4PTTA 3OSKA 5EN2B 5DA0B 5D2LF 1QFUL 5JLZA 1P7QA 3VCLB 3KG5A 4AG4H 2IQ9H 1UA6L 1UJ3C 3HUJB 3UXFA 2V5SA 4PJAF 3OKDA 4H1LA 1ZLWK 3VGAC 5IR1B 3VDCA 1CD1A 4GRMA 3OKEB 3RUGF 3CMOH 5DTFB 1WEJL 3BPLC 2QR0B 1F6AA 3L3DA 1E27A 3TO2A 1IC1A 4K07A 2GW5A 2IH3A 3T0AA 2M26A 3X17A 3P0VL 2BVOA 3KXFD 2I26N 3FQWB 4MAYA 1XF5A 1FJ1B 3MRDB 3HMXA 5F96H 1K5NB 1KPRA 5E6IB 4DZBA 3HE7D 3JTSA 4WU5A 1DQJA 4JZJA 2IWGA 2OMBA 5FECA 2CIKA 1MJ7H 1LDPL 43CAB 2AJXL 4JRYD 3PL6D 4XX1G 1QFWH 5HHOB 3A6CL 4NC0B 4B5EA 3LS5H 4GMTH 3MBXH 2BSSB 3QFJD 4MZ2A 5T3XH 1FNLA 1ZT4B 5E1HB 2VQ1B 3ALXA 4WCYL 2P8PA 1GPOL 5JW4N 3M8OH 1UC6A 2X70B 5ISZD 2EO9A 3GDBA 1X4YA 3BGAA 3IAPA 4FQ2L 1V5JA 3GSRA 4MNQB 4EDWH 4EIZC 4OV5A 1RULH 4NM4H 1D9KD 1N8ZB 3DRQA 3MREA 1L0QA 5DUML 1A21A 1ZT1B 4PGDA 1HNGA 1KGCE 4K8RC 1CIDA 3H9SA 1NAML 1WV7T 4U6XB 3QDGE 1TVDA 3N85H 4JFEE 4KKCC 2FBOJ 5T1MA 2FLRT 3VFVA 4J2XA 1I1YA 4FQQB 3U0TA 1ZLSL 3GHBH 2R2HA 2IADB 2VE6A 1JK8B 2YC1B 3T4YB 5GZOD 1OGAB 4KFZC 5EOCL 3GSVA 5CMAA 3I6LD 2H2SC 3N9GL 4TN9A 3S6CA 3KDMB 2IAMB 4WEBL 4QHNB 1P2CB 4QRUA 3U6RA 5JA9A 2VDLH 2R23B 3MUGA 1CR9L 3ULVL 2VIRA 4XNQA 1CICA 4CN4A 2EO1A 4NHUB 1BD2D 3MODH 4QHKJ 5IF0A 3O3DB 4D2NA 4YK4C 5FGCE 3WKNA 2VDRH 4EDXA 4NO0B 4XP4L 2VSDA 3FOLB 4MX7B 1KPVB 5E95B 4PJ7E 1K8IB 1OF2B 2XFXB 1DANT 3S97C 5CSZB 4PJCA 5HYFA 2NY7L 1JFQH 3KHOA 3MRBA 1CL7L 1LEKB 4BK5A 5SX4I 3MJ7A 1G9EA 4JO1H 4HKZA 4HH9A 5MHSD 4G8GE 4L8DA 1I4FB 4M48H 3V4UL 2GFBB 2FEEI 5D9SB 3VDAA 1IJ9A 3QJFA 1F42A 3GSWA 1SYSB 3TN0D 3V0AC 4L3AA 1FAKT 2AQ3A 3NIFE 2FIKA 5C0EB 4CMHB 1HQRA 3UTTE 3AAZB 1B9ZA 3MRLB 1AGBA 2B1HL 1X6LA 1KIQA 3DBXA 4LVHC 1VGEH 4JFDA 5DJ6B 1KYOK 5J11B 5J6HA 3OJDB 3K8KA 3EYFA 4K8RH 2Q76B 3HPLB 4U0RB 5IK3B 4XPAH 3GB7A 5EU3A 3INUH 1D5ZA 4GQ9L 1F13A 4UV4H 4F8QA 1HOCB 3O3BB 5BVJB 4PJ7F 4UNUA 2FCBA 4R9HA 3LKRA 3PQYE 4WFGD 2WUCL 2V9TA 3WFCH 4D0BB 3KXFA 4ZS7H 1ZTXH 2P8LB 3SE8L 5BZWB 3O2VH 4Y4FA 4PV9A 1JGUH 4Y4HA 1HILB 1RK1B 3O6ML 3QEQE 4AEHH 1B88A 1Q8MA 4BSVA 1Q0XH 2BNRE 5TQ2L 4RGNE 3QPXL 5C0BA 1EMTH 3O81A 5DJ8B 2VZTA 5HGBA 1G7MB 1EO5A 1YECH 1T0MA 1W72A 3NCJH 4BZ2H 1S7VB 1E4XH 1Q9LA 3NIFF 2HAZA 4M43L 2VDNH 2NY0B 4FTVD 4V1DE 3Q6FA 4JM4L 3QFJA 1EGJA 3K4AA 2YD6A 4WGVB 3TNNA 3SY0A 3SN6N 4U0RC 5E9DE 3NACL 1RD6A 2VAAB 3JWNC 4PRDA 3THML 1WBXB 1FG9C 1QBLL 3RA7L 2ICEB 1I7UB 2GJ6A 2X1XR 1Q9OA 5KVFL 5K33A 4JCMA 1ZLUK 3CSBA 3WHE0 5IW3A 5CJBA 5JIHA 3IDGB 5LXGH 5KANG 4XVJH 1A7PL 1J18A 3AB0C 4I9WE 3I3BA 5F6HJ 1JPST 5GGRA 1ROWA 3SPVA 1UB5A 5JDSB 1N6VA 3WXVH 3QDHA 1X5JA 3VFPA 1XGRA 2P44B 3SGJA 2QHLA 3ZTNL 1KCRH 2H45A 4RMUA 1U3HA 1ZMYA 1ORQA 3DWTA 4WNQB 2FATL 4ZO8A 1RUKH 5I8CB 3QCUL 3ME0A 2FO4A 5DD5H 3U7WL 1IAOA 5GGSB 1F4XH 1T1ZA 4WW1B 3QI9D 4NO2A 4E42B 2JCCE 4PJDE 5IT2L 4UT7L 4H0HB 1NQBA 5DJ2A 4F2MB 1DR9A 2BFVL 1S5HB 3X12B 4PBVC 3KS0J 3QG7H 1TZHB 3FFDA 3UZVB 2DQTH 4HXBH 4WEUD 2IG2L 4ZUUB 1IE5A 1JF6A 1VFBB 1EEUA 1IQDA 3VMPA 3OKMB 3ARSA 2VLRA 3ZT5A 2MTPA 3KJ6L 3HB3D 5D5MB 4HWZA 4DTGH 3S96B 4JZOB 3V2AR 3OKYA 2D7NA 1MFBL 4P5MB 2W91A 3O3EB 3QCTH 4U3XA 4OLYH 1QACA 3KPTA 3PUCA 5A16A 5DK0A 2X41A 5EPMB 1E4KC 2O61B 1NCAH 1OLZA 4EIGB 2XIDA 1ZAGA 1GGIL 3U9PL 5FM5M 3E6HA 1AY1L 3F12B 1YEHL 4P2RE 4PTTB 4PUBL 5I17B 1C7SA 2DBLL 2JCCF 5E94A 4JB9H 4PJDF 3BT2L 1E6OL 1LEGA 4AEIL 1XF1A 1UKSA 3L95A 1WTGT 1G7JB 1INQB 1NJ9A 2YD4A 4QRPE 4Y2DA 4LK4A 4U1IA 3DSFL 5AWNH 5T1LD 5CINL 4FZ8L 1H3WM 1WF5A 1HSBA 4GRMB 5GRXG 1IFHH 2QQNH 1UYWL 4ALAL 2O93L 4OM0H 1U36A 4NBYB 3DJ9A 5DHVH 3TO2B 3ARXA 5HYJB 4P9ML 4JANA 3LD8C 1MCFA 3GJFA 3ZHLA 1IC7L 3F5WA 3VRIB 2AJUL 4Z76A 1ZVHA 3DECA 1OB1B 3JZ7A 4MAYB 3EOTH 4CVWA 3GGWA 3WJLC 3O3UN 3ULUL 5IB4A 2C3XA 1KCUH 2OL3A 3RHWF 4JZJB 2GSGA 2DAVA 5CFHA 5HYIA 4YXLH 2CIKB 2J6EL 3AS0A 3QULA 4XC1L 2ZPKL 5H8DA 5KTEH 2P8MB 5IFHH 1KTKE 2AXGA 4WO4A 1NUNB 3KR3H 4M00A 3V8OA 3VFWB 2NY4B 3MNZB 1HEZB 4BQ6A 4Q6IB 4U6YA 3DX9A 5B38A 1FPTL 1AKJA 4OLXL 5ELIA 2HJKA 4FTVA 3IYLW 5AZ2L 3HE6D 5HDQL 4JY4A 5CEXA 3V79C 1NGQH 1KJ2B 5B39A 1EEZB 5I30L 1ZHKA 1QLFA 1ND0A 3GSRB 3G6DH 3PXHA 4OV5B 2AV7A 1TQCC 5IIEA 2VDOH 2A6DA 3DRQB 2VZSA 3MREB 4MAYC 5EU7C 4QHLA 3SDXA 2MPAL 4HPYL 2OLDA 1N6QL 4PGDB 1I1RA 3MUY1 4JZJC 5K93A 4ELME 4LEXH 4MJIE 2NMSA 4X5LA 1KTDB 3VD9A 5EU5B 3VFVB 3FT4B 1DTUA 4JPKL 3IFPA 2OJZL 2R56L 1I1YB 4PJ5E 3VWKD 3EHBD 4YX2L 3QISA 1HN1A 4ONOA 3G6AA 5T1DH 4Y19B 5IQ7H 3NFSH 2VE6B 5EIVA 4ODUA 3RVUD 1TTFA 5IMOA 1JRHL 3GSVB 3U1SH 3AUVA 4XHQA 4PRNA 4RGOL 5CMAB 1A7NL 2A73A 2MQ3A 4QF1B 2P1YA 3PWLA 3QEGL 1AO7A 1UXSB 3JV4B 3RTQA 1R3HA 1G6RB 4OF7A 3U6RB 4QYOB 2XN9E 2GITA 2ZSVA 2D0FA 3OXRB 3MUGB 1H8NA 2VIRB 3BKMH 3NIDE 4XNQB 4TTDC 4AK1A 1CICB 2P42B 1FL6A 2DJUA 4FABH 4W4OA 2BNQE 3VGFA 2HRPL 5EC1A 5DD3H 4JRXA 4C56D 3D69A 1G7QA 4EDXB 1RUQL 3ARDA 2D4DA 2AJ3A 3TYFB 4Y16D 3HC4L 1U2HA 2ICWJ 1YQ2A 3WSQH 4ELMF 3QZWB 1AQKL 2XZCH 4URTB 3IXTA 4ELKA 4CKVX 5ID0A 1DANU 5I16B 4H1LH 1TETL 1C5DB 4X4ZA 1VSCA 2G9HA 4HH9B 4LSRH 4L8DB 4X80L 4ZUSA 5JPMA 3DURB 2YXMA 3T1WA 3QJFB 2AV1A 3GSWB 1MVFA 4GKOA 1DLHA 5HHVH 1GJIA 1S3KH 1R3IL 3EYQC 4YDVB 4UOW0 3MUJA 3ROOA 1HYSD 5DLMH 2ITDB 3ZYOA 1J11A 4OIIH 1IT9L 1B0RB 1YEKL 1CICC 2ED9A 4GKNA 4PR5A 5ICYB 4M7LL 4EBQL 1WIUA 3NIDF 3HMXH 4LLUA 5T1LA 4EQ2A 5DJDA 1U8NB 3O6KL 3I50H 1AQDA 1MCDA 2B7DT 5DMIH 3V5HB 4OQ1A 3GB7B 3RL1A 4NJ9H 5EU3B 5HD8C 1A3LL 2Y07L 5JORB 5IJVA 4YEFA 1B4RA 1BJ8A 1FFPA 4KZDH 4TUJA 5EOQH 3LKRB 4XMKH 5JTWA 4ODXB 3EDFA 3SKMB 3S3SA 3KXFB 3SQOL 3CSPA 4PJ8D 4D8PA 4LQFH 2X6MA 3TF7C 3CVIH 4GO6B 5LVEA 3QPQD 3DRTA 2VQTA 5EU6D 1SY6L 5KN5B 1QPPA 1UWEL 2CLRB 2DQCH 3HE7B 2XTJE 4BSVB 1QSEE 4P49A 4YXKH 1WVZA 2C4FT 3DX6A 5DRWB 1JZ5A 4JRYB 3PL6B 2DLGA 1W72B 1RUAL 1Q9LB 3HNSL 2R0LL 4A6YB 1CE6B 3T0ED 1EZVX 1MWAL 2HFEB 3CFEA 3WIIH 1QVOA 3QFJB 1F2XK 3TNNB 4K2UH 4PRDB 3LEXA 1C5BL 2ZKHL 2Y72A 2HKFH 2YUXA 3MROA 3SE3A 4QRSA 1Q9OB 5ISZB 1NAMA 1JVKA 1X5HA 1CZ8L 1WFNA 1XGYL 4X6CE 4MQSB 1ZHNB 4D0DA 2FD6L 4NCC2 1J0IA 1P1ZB 4JY5L 1D9KB 2KZWA 4OUUA 4Y4FC 1LP9E 5GGRB 3UJJL 3SPVB 3G5ZA 3PF2A 4Y4HC 2FECI 5DVOA 3OR6B 5EOTA 1UB5B 1KXVC 3FN9A 3MRFB 1FC1A 2O26U 3HE7C 4F58L 5I0ZA 25C8H 3FQRA 1JWSA 3BJLA 4E0RA 4MDJB 1AXTH 4X9IA 3M17A 4FG6C 2NZIA 4Z7OE 2WWKT 4MJ6A 5IHBA 2PTTB 5GHWH 4UB0L 5HI4D 3T77A 5ICZA 3Q5TA 4DN3H 4YE4L 1A1OB 4RDQF 2ZUUA 1BM3L 1X5IA 3S3JA 4R4BB 2YRZA 1FFNA 1NKRA 4F80A 5ADOL 1JHTA 2GIYA 4AY0A 5LKNA 2GY5A 3PHOB 5GS2D 1I75A 4CRPA 5DK3A 5EORL 5GGTL 3IJSA 2PW2A 1RUML 5AG8A 3BKCL 5CP7A 4D9QE 2NZ9C 1T7YA 4X6CF 2X4OB 4LEOA 2AK4D 5E5MB 5T3XE 4XNYH 1TLKA 1BD2B 2UZIL 3F6LA 1ACYH 3A6BH 4PRHE 5TF1H 7FABH 1FORL 1FYTE 4H20H 4WI5A 3SGJC 1AJ7H 1LP9F 3DUHA 1U3HC 1CFSB 4YXHL 1R24A 5IVXE 5TE4H 3WUZA 1XR9B 5EA0H 4KTYA 3VFGH 5F3HA 4BQ8A 1IGFL 3U0WL 1F45A 2OS7A 3OBAA 3U36A 1YEDA 1QFOA 5C7XH 4Z7OF 1S7XA 5DK0B 3HG1E 2DQDL 5GZOC 5KSBE 1TCRA 2EIBA 4S1RL 5SWZE 2C3VB 3E6HB 1UKQA 3TN0B 2W9DL 5L9DL 4N90D 1BZ7B 1VFOA 2VDQH 1UWGL 5I1LA 4KRPC 4Y5YA 4LRNH 3HRPA 4HDIB 3NZ8A 1CBVL 1N7ML 4U1IB 5FOBA 3G9AB 4ZTPH 1NMBH 2GAZB 4JLRB 4G7VH 3MXVL 4M5YL 3VU2A 2EDRA 3DX7B 4X0KB 3TJHC 2C26A 4AH2B 4JDZA 3DUUA 1NSNL 4Q0XH 2BK8A 3GJFB 5DJAA 4YWGL 1QEWA 3F5WB 1EJ6A 5HDOA 2YK1H 3ARFD 5IVXF 2VXVL 3FL7A 3G5VB 1W72H 1HIML 2ED7A 5I74C 3HAEB 1EGJH 1OLLA 3OB0H 4LDOB 4JG0H 2OL3B 4PJ8A 4IOFD 2GSGB 3B8SA 4HBQA 5KSBF 4ODWB 5J0BA 1KLUA 5FXCH 3O8XD 3QULB 2CIIA 3HUJE 4Y2DC 4TSAH 2OR9H 4J3OC 5F71A 1KV3A 2G5BA 2EIDA 3GBMH 3K8LA 4E5XB 1ZHBA 5KVDL 5F72S 2RCSH 5E8OA 2A0LC 4U6YB 3DX9B 2DQUH 4L9DA 4FTVB 5CLTA 1NH6A 1U91B 3TP4A 4OI7A 4X7SL 1BEYH 1KCVH 5FYJU 3FHAA 5B38G 5IVNA 1G9NC 5TDNA 1LO0L 2PYED 1U8OA 2AV7B 3MYJA 5IIEB 4UIMA 1QBAA 3QHFH 1FV1B 4MLSA 4RX4A 4GUPB 3S9DB 3SDXB 4C4KO 5HXMA 1DP0A 1MREL 3P9MA 2OJEA 3BH8A 4R7DA 4WTWA 3RVWD 1LVEA 3B9KA 3NABH 5IFAL 5KVGH 4Y8AA 3UX9B 2FBJH 1UACL 2A74B 4GXUN 4M6OL 4WO4C 4H25A 5HHOE 3IFPB 4HCRL 2Q8BL 2CRIA 4KQ4H 4UT6H 5FGRA 4QT5A 4UUJA 2HFTA 5FYLE 5KS9A 4JKMA 3G6AB 4NPYA 4OCYL 4X4XA 1A9BB 4NWTH 1YNLH 3GI8H 4LSTL 5CIPA 1JPTL 1LO5A 2XOTA 3P30L 5IMOB 3H8NA 2MOVA 2XXMB 3CDGB 3GSOA 2YD2A 4PRNB 2X44D 4ERSL 3GIZL 3UYRH 3G5YB 3QI9B 3TA3A 3PWLB 5MENA 5JUEH 1R3HB 4XMPL 2X1PA 4N68A 3O45B 4MNQE 1BVLA 3D48R 3N0PB 1FL6B 4XP6L 2EDXA 5C0GB 4LPWA 2LU4A 1GIGL 4MJ5A 3D69B 1G7QB 5M95B 4MVBD 2AJ3B 3CCHA 4JQIH 2W0FA 4S1QH 1PYWB 3LKOA 3QQ4B 4WW2A 4JFQA 1H5BA 4PY8I 1INEL 3AS3A 5CAYB 2DF3A 4K3JL 5ID0B 3CJJA 4NM8L 1QBBA 1A6TA 1XEDA 2AEIT 2D7PA 2DJ4A 2VXUH 3BZ4A 4ACPA 3DVIA 4Q9RL 4NCC1 4I2XB 4F57H 4JFZL 5GXBB 2FNBA 3DI2B 3OF6D 5JPMB 1PEZA 4Z7NE 1L7TH 4HX1A 3T2NL 1HHKB 2AV1B 2J8UF 1MVUA 4YHOH 2YBRA 1DLHB 5CZVH 4WGWB 4S1DD 3RTQC 5E8DH 5M7QA 4MD4A 3REWA 2J5LB 2OMNA 1MIMH 3FN0H 4GLRH 1MRCH 2GTWA 3GJFH 3MGTA 4U2ZA 1CFQB 1G9NH 1KTLA 1AD0A 4RCAA 5CJXA 4UQ3B 2VLJA 3DHMA 4H8WL 2HH0H 4K9EC 4W4OC 1Q1JL 1DQDH 3QXVA 1UQSB 2Q86A 4L3EA 1ZWIA 1PFCA 5ACLA 3ARDC 4LLUB 5T1LB 5JIPA 4Y1AD 1T80A 2OL3H 2VDML 4U1KA 1AQDB 2ZOLB 1JF1B 3RL1B 4LCCB 2OYPA 4U1SA 3UTSA 5JIKA 5IJVB 5IWLA 4I0PD 2VXSH 5CEYB 3IDYB 2ZUYA 2J6EA 3MJ8A 1WC7A 3VW3H 1QO3B 4D8PB 3TM6A 3D0LB 3IS0X 2L7JA 5B4MC 4XBEH 2F53A 3DRTB 2XA3A 1O7SA 3Q5YA 5D71L 2J5LC 4WWID 3S98A 3UPRB 5HHMD 2BZDA 2IALB 2VKXA 1MHPH 3TV3L 3O8XA 2NXZC 1OTSD 3NA9H 5FM8A 1AGDB 1GHFL 1RK0B 1SJEA 3T2PA 1JBJA 4NYLA 1T0PB 4G8IA 1NCTA 1QVOB 1WQVT 4JFXA 3HC3L 1PKQB 1DQMH 5LJYH 5E8EA 5GS0C 2E7CA 2FECL 3IU3B 4PGCA 3LRGA 3FMGH 3MROB 3KPRD 4FQJH 3WNPA 4XC3H 2AJSH 2ATKA 3IDYC 4DVRL 5KVEH 1EO7A 4HK0B 3BRDA 4D0DB 5FB8A 4Z0XA 3P40A 1NC2D 4OUUB 3BYTA 5IGXH 3CAFA 3L5WA 2M2DA 2QBWA 4JREB 1RIVL 2E6JA 1J0JA 3S36H 4UBDD 4OBSA 4HEPG 4U1NB 4E0RB 1SQ2N 4JFPA 3I9GL 4F9PA 1FBIL 4NQCD 3M17B 4PJXA 3IFNL 3SKOA 5DVKA 3T77B 5ICZB 4K9EH 4GKZA 1H3PL 1HINH 1NL0L 4JO4L 2EC9U 3VWKB 2EIZA 1BF2A 4LSUL 4X9HA 1CF8H 3EO0A 1IGJB 3O6FA 3C09B 1JHTB 3GMOA 3MFFB 5L0QC 4TVPH 3PV6A 4PLKD 5C9JA 2NTSP 1FYHB 1J9CT 3S3PA 3V52L 3RQ3A 4YHZL 2QV2A 3LKNA 4MAUH 4LCUA 1CFVL 1TFHA 5CP7B 2A6JA 1TVHA 4N8VG 4PLNC 4LEOB 2J2ZA 3DXAA 3X11B 1IKFL 4JREC 2PKDA 4KUCF 1FNGB 2GCYA 1Y6NR 4GRLD 4C56B 1UM6L 2VWEC 4TUOA 5C08D 1UM5L 1X4XA 4YFLF 5JNYA 4Y16B 2CSPA 4O5LH 2Z31D 5F3HB 1UH4A 5A3IC 1TJIL 3RHWK 3MRQA 3RBGA 1YEDB 3U36B 1TZGL 2BDNL 2DDQL 3IGAA 5GRZA 3V0VA 3ULVC 1YJDL 4XPTL 3HKFA 4M7ZB 5C0DB 5FYJD 3OF6A 3STBA 5AUMA 2EDEA 1KB5L 5GS0H 4QGYA 1RHHB 2FEDD 2Y06L 4BSWA 5I1LB 1EEYB 4Y5YB 4YHNA 3UPCA 3UAJD 2O5XL 3NZ8B 1M71B 1LDPH 4K3EL 4AIZA 5FO7B 5FOBB 2AJXH 4LLWA 2ED8A 4OJFL 3A6CH 4FZEL 1R3LA 3AMLA 4MA7H 2RFXA 4PD4J 3O41A 1FZKB 2C9AA 3U0PA 3GMLA 3AFLA 4ZS6C 4WCYH 3DUUB 1GPOH 3HPJA 3JTTA 5J12B 5F7YC 3KLHC 1SY6A 4U1JA 3DYMA 1IILE 4I0PA 1NDGB 3MMEA 4FQ2H 1WBZA 1JIBA 1GOFA 1QFHA 4LLVB 2UZYB 2NW3A 4PJ8B 4YDLC 5DUMH 3LIZL 4CADB 1MWAA 2BSRA 1R5IA 1RIUH 1KLUB 3CX5J 2DQGL 2AXJA 1CI5A 4Y5YC 1NAMH 1JYNA 1OAKL 3KAAA 2G5BB 2Z4QA 1LGVA 3UBXB 5MERA 2CDGB 4OD3L 5F9DC 4OD1L 1VACA 1RI8A 1HHHA 3FB5A 1F4WL 4JGJA 5I1IL 1A2YA 3BP7A 3ILPA 1WWWX 5IG7A 2PO6D 1I1AA 3T0EB 3JVGA 2B1AL 3KYMB 1ZLSH 4CDGC 1P6AB 2FO1A 1OSZB 2YD1A 1K9TA 3QXAB 1JUFA 3N9GH 1S7WA 2Y6SD 1U8OB 2VO5A 1U42A 3MYJB 4WEBH 4NO5A 2ZOKA 4M62H 4KJQD 4TNWK 2WBKA 3VJ6A 3LKSB 3ULVH 4HEME 4PJ8C 5C6WH 4Y88A 2OJEB 3QPQC 4E9LA 4PG9A 3B9KB 4Z7UA 5E0QA 4FMFA 5DA4A 4XP4H 3JUZA 2YS4A 3MTRA 1HH9B 3QIBA 5CJ5A 4CN6A 5KS9B 4DZ8A 4AL8H 1YN7A 4FHBD 3TBWA 5C09D 3VRLE 2D2OA 1ZSDA 2RIKA 1V7ML 3FN3A 2X4SB 1FZJB 1LO5B 5IQ9A 3D18B 5GGTA 2NY7H 5KSUB 1DUYA 1CL7H 3BHBB 3RWCB 2DQEL 3WFHB 2GEEA 5IBUB 2RB8A 1XZ0A 5JHDA 3KJ4B 3ZDZE 5IP4A 2V7HB 4RMTA 1KSRA 2J4WL 5DJ0A 5C8JB 3EDJA 4N5UA 2W65B 3C8KA 3BEVB 3CXHJ 4MJ5B 5E6YA 3DUSB 1CE1L 4JO2L 5DXWA 4O51A 2AK4B 4JVUA 3B9KC 2W0FB 2B1HH 5D6CA 5T1KD 3L7EB 5C08A 3RIAF 4CN1A 3S4SG 2G60H 3EOAB 1A6TB 3BZ4B 1R3KB 5HI4C 4GQ9H 4Y19E 2PCPA 3L3KA 4MB5A 4GRWB 3VRLF 2Q7YA 4HKJA 2DM2A 2VTFA 2WUCH 4PP1D 4M61A 3TA3C 3QIWA 2AJVL 2NNAB 1B4JL 1CXHA 2DL9A 5FYKL 4MD4B 1A9EA 2W38A 3RKPA 3WCYA 3SE8H 3I6KB 2GTWB 3WFEL 5GGVY 2I27N 4JHAL 4NQEA 3O6MH 5GJSH 4LGPB 3ZDZF 1H8SA 4XBPB 5TQ2H 3QPXH 3FOMA 3QAZC 1II4E 4X6EB 4B53A 5HGAA 3MOAL 4G6JL 4JM2D 4WW2C 3IDJA 1H5BC 5ESQA 3MZGB 1SJVA 2W9EL 4M43H 3QRGH 2VR4A 4JM4H 3JV6A 3UTSB 4OLZL 3BZEA 3NACH 1UWXK 3THMH 5ERWB 1KOAA 5DMKA 5F7WC 1QBLH 3BW9B 4PJCE 2X10A 3PGDA 3RA7H 3ARFB 3MJ8B 4WHYG 1FHGA 1W0WB 5D1ZD 3H3BC 5KVFH 1TTGA 3V0WL 4IJ3B 3MGAA 3QUZD 4S2SB 5EO9A 1A7PH 4NQSA 2OM5A 2W92A 1QR1A 2PYFB 5FDWA 5CJXC 4CNIB 4ZAKA 1XH3A 1EV2E 3TFKC 5T33L 3O8XB 4RFOL 3ZTNH 1SJEB 4NYLB 2FATH 4FA8A 4PIRF 1H3GA 1D5BA 3BPOB 3LKQB 4JFXB 4XWOD 3QCUH 4OGXL 4QNPE 4KKBD 1RZIB 5DC0A 4JFDE 2VDKL 4TSBL 3ULUC 3RVXC 3U7WH 4UTAL 5IWLC 2G75B 3FB6A 2ATKB 5IT2H 5F8QC 1UCBL 4UT7H 2BFVH 2V7NA 3QBTB 2XG5A 3E8UH 5KJRL 3DO7A 4PJCF 5CIPH 1ZXQA 3BWAA 3HS0A 3KXFE 4NN6C 4DCQA 4HCRA 5TJWK 3Q0HA 9CGTA 5I18L 3SO3B 1HCVA 3WEXA 4KHTL 4GH7B 1YPZA 5L2KD 4UNVA 1OM3L 1K2DA 5FIEA 2Q7NA 4K3DL 3H3KA 4IOFC 4Y8DC 3T09A 3KJ6H 4LCWA 4JFPB 3MV7A 3SDCD 3O8XC 4PJXB 3QQNA 1QYGH 1B6UA 4GKZB 1MFBH 4FMKA 4IEFB 3S36X 2EIZB 3BPOC 3WJJA 5C09A 2F54A 4NFBA 4TPRL 3QFJE 2ZNWA 1BP3B 4LVOB 3O0RH 3O11A 1U0QA 5C9JB 1KG0A 4QNPF 5HGDA 3LN5A 4LHUA 4XNXL 3U9PH 2VQUA 1AY1H 1YEHH 2EEDA 4PUBH 4LCUB 2DBLH 5EO0A 5F9WC 4UDTA 1OAYL 3BT2H 1E6OH 1TVHB 1Y18A 3H7LA 4AEIH 2P5WA 1H0DA 4R3SB 3IU4L 4GRWH 4GAGL 3U4AA 4PS4L 2W0KA 3QJHB 3EBAA 4XPFL 4Z18A 2MHAB 2W07A 1H8OA 3PABB 4FZ8H 5CINH 4F9PC 2LVEA 3KPMA 5CBEA 5JNYB 4KKNA 3HNTL 4YUEL 4Q7DA 5FM5O 1UYWH 5BO1L 5D7IA 3SDAA 4ALAH 5MEOA 5F7LB 5T1KA 5K9QI 1OTUC 5E7FA 5FUZL 1CFNA 4P9MH 2XTLA 4IRJA 1ZS8A 2AJUH 3O6FC 2BRQA 3WS3A 4P2QA 4NQTA 2OTPA 2OR7A 3B4NA 1JTPA 3I6LE 3ULUH 1NGYA 4JFED 4WHYH 4BSWB 1R5WB 3MRRB 1D6EB 1H3XA 4FXKA 4YHNB 3GMRA 1X5YA 5DEGB 4K3GA 5HDBE 2YD7A 3FQNB 2J6EH 1FZMA 4LPUA 4YDKL 4NUGL 4XC1H 2ZPKH 1R3LB 1NUGA 4KPHH 2RFXB 2VLRE 1HHGA 1BD2E 3C5JA 3KPPB 4P46A 3U0PB 1REIA 5C0AD 1XGTB 3BUTA 4KJPD 3H7BA 1X7QB 2R9HD 2W60A 2XWBA 5DYOA 1KJMB 3GMLB 3PNWA 3N06B 4Y1AB 3T3PE 3KPNA 1FPTH 5I75C 2A1WL 3HPJB 2A6KA 5GSVB 2GUOA 3CFBB 4U1JB 5AZ2H 5HDQH 1VADA 3MV9D 1AIFA 1E6JL 4I0PB 4I77L 1UZ8A 2Z35A 3MMEB 5I30H 4M03A 1WBZB 3H9ZA 3RZCD 4ZFFA 4JQXC 3TVMD 5C2BL 5D1ZA 4F7PA 3GSNL 4LCYA 2VAJA 3FHQA 3D39A 1MWAB 2MPAH 4HPYH 4S1DC 3QUZA 1R5IB 1N6QH 5EZJA 1ZVSB 4LAQL 2BOCA 2R4RL 3WNLA 3ORJA 4G6ML 4U6HA 4WFFE 4YHPA 4D9LL 5MERB 1MHHA 4HS6A 2UZXB 3ZT7A 1HHHB 2QSTA 3FB5B 3G08B 1A2YB 5I19L 2F8OA 2OJZH 3BP7B 3ILPB 4MD0A 5HDBF 4YX2H 4G8GD 4ZUWA 3T8XA 1FE8L 1RVFL 5EFIB 4E41A 4WDIB 4CBPA 3ABZA 2QHRL 3OXSA 4RGOH 3RI5F 1A7NH 1LE5A 3N1GC 1JUFB 4YAQA 1S7WB 4JPWL 3T3PF 3D1MC 4I0PC 3QEGH 4OKVA 3O3AB 3P0YH 3KPRB 5BXFB 3MLUH 3OV6A 5IBTL 3VFMB 1YY9C 1DLFL 4LHQB 4WFGE 5F1NB 1FNHA 1NC2B 1KIRA 2HRPH 4Y5XB 4Z7UB 8FABB 1AGFA 5SX4H 5HBBA 4OUOA 1ZEAL 3DLQR 4PJHB 3SCMA 1NMCC 4MNGA 3QIBB 4N0FB 4ZG1A 4OCRL 1CDHA 3TBWB 1AQKH 3C9NB 3ILQC 4KMTH 1RJCA 1I1AC 5CHNB 3EIFA 3BZFA 3JVGC 5F8RC 4CGTA 1TETH 1HE7A 1DUYB 4FTVE 1KLGA 1CLCA 5C0FA 4X80H 1Q94B 4FRWA 5CSGA 1TVBB 4R4ND 3MRMA 3IF1A 4EUPA 5EIQA 3QZWG 4OFVA 2BNRD 3UP1A 2IBBA 4IS6A 4RAHA 5L6YL 3OX8B 4ZOBA 2DRUA 5I9QB 3C8KB 2XQYG 1IT9H 3SDXE 1YEKH 2IBZX 1ZHLA 1SVZA 2H8PA 4M7LH 5LBSL 1VGKB 3LV3A 4EBQH 4LPYA 2ORBH 4ESKA 4LLYB 5HI5D 4GRLB 4UBDC 1VESA 2EDHA 1C1EL 3QIBC 5FYKD 5C08B 2WWMD 1DBAL 4C4KT 4ZUTB 1F8TL 4LSVL 3O6KH 2P49B 1KB5A 4LSSL 2Z31B 1A3LH 3C5SA 5TDOA 2LABA 2PCPB 3IDIB 1S9YA 3DIFA 2Q7YB 1JZ2A 1A4KA 4I9WD 3QIWB 1RZ8A 2OSLB 5I8EA 4GXVL 5GJTL 4QRRA 4P23A 3LY6A 1A9EB 4FQPA 1JPSL 4PLKC 1LEIA 3SGEI 4AG4L 1ZOXA 1DUZA 4YNYA 2G2RA 1IAMA 1SY6H 4NQEB 3VRJB 1UWEH 1UT9A 2X89D 4BZYA 3RVVD 5J6GA 4C58B 1G84A 4XCEA 3RWFB 2EXWD 4JRXE 1T7WA 3GM0A 5D1QD 1BZQK 4ZPVA 4NO3B 4OFYD 5IUSA 1IM9D 3HNSH 1YC7A 3SDXF 1MWAH 4NRZA 4HLZH 4KAQL 1MCWW 2HLFC 5C0AA 5EZOL 2ZKHH 3PGDB 3FRPG 1BVKA 3E2HC 5C6TH 1QA9A 4YC2B 1OAQL 4MXQC 3MV9A 2WM0A 1X6NA 4I2XE 1CZ8H 1XGYH 1NBQA 3ARZA 3QIWC 1OQXA 1B6DA 2ARJB 2FD6H 4Z7VA 5EO9B 2FZ3B 1FFOA 1S7QB 4NQSB 4JY5H 3IB4A 3U30C 2Z91B 1EAPA 3GFUA 2PN5A 1WFTA 2Z92A 3K8MA 3EZJB 3K4DA 4F58H 3OKNB 3UAJC 3JV0A 5FKPB 1QSZA 1HNFA 1D5BB 2H2PD 4QY8A 5FHAL 4OKDA 3BPCB 3TNMA 4UB0H 5D7LA 4YE4H 3T0XA 1BM3H 2H3NA 1YUHA 2PO6B 2R8SL 2BVQB 1AR1D 4NNXA 1WITA 5ALCL 4PJ9D 3WL9A 5ADOH 3RWGA 5IHZA 1LQSR 4KKLD 4YC2C 3BPNB 4HZAA 4G9FD 4PD4K 5EORH 3HS0B 5GGTH 3FO0L 3KYOA 2CR6A 2C1PB 3WEXB 5BQ7A 4XVSL 1YPZB 2ATPA 4X5WB 3GSQB 3QQ9D 3V9FA 3G9VA 2W0PA 4ZAKC 4HUNB 3WFBH 4G6FD 1A47A 5HY9A 1OAXL 1F3JB 1ULVA 4KKAC 5C0JA 4TULH 4YXHH 1EHNA 2QJDA 3SQBA 5B21A 4XHJC 4L3CB 3STZA 4GW4B 4F15B 3DETD 5C09B 3L3OA 3PP4H 4QHUB 1T04A 1IGFH 3U0WH 3T65B 2VUOA 1CDCA 3VXQB 3O11B 1A1MB 3CX5K 5I76B 4KGLA 2VXTL 1QHOA 2DQDH 3UZEA 1AXSB 3ZL4L 5T5FL 5T5NF 2X4TA 2W0LA 4S1RH 5DMYA 4Q2ZB 4QHKI 1BZ9B 3ESUF 2A6IA 4LAJH 4AIXA 4F7MA 4YHKL 2HT3D 1DN0A 1HQ4A 5GS1B 2W9DH 5L9DH 1MCOL 4B7IA 1Y18B 4ZO6A 1UWGH 3QWOB 1BMGA 2GK2A 4KVNL 4X8XA 5D93C 3VDBA 4QCIB 3E6FA 2QEJA 4W6WB 3PWNB 1CBVH 2A77L 1A1NA 1N7MH 43C9B 5CZKA 1IAKB 4WFED 4AT6B 1HYRC 2YR3A 5CBEB 4F7CB 2VWEE 2X9WA 5D7IB 5MEOB 3MXVH 4M5YH 5T1KB 3VFNA 1AH1A 4MJ2A 1T1WA 1CD8A 4LU5L 4XB7A 2IPUG 35C8L 1BX2B 1NSNH 2DN7A 4F15C 3WJJC 3RL2B 4YWGH 3GHEL 3BEWA 5GRWA 2VXVH 3ULVE 2FJGA 4OT1L 3DROA 3EFFB 2UVEA 5TPWH 3PWVB 4MJID 4ZMAT 4XXCA 1KACB 4P4KD 2J88L 3WXWL 4WI3A 5I2IA 2JJTA 5GSRA 1FZMB 4DFHA 4N0CC 4EN3A 4OD2A 2X89A 4CU7A 1DEEA 5KSVA 5GIRB 3ZKMD 5E2TL 1PKOA 5DURD 5KVDH 4MXVE 4C56E 2CRYA 3AROA 4JM2B 3BIAX 2W60B 5GRUL 4WV1B 1JNHB 3SDAC 2YD8A 2EDJA 2PXYA 3INUL 5FA4B 2GUOB 4UV4L 1JP5A 4X7SH 1VCAA 3DGGB 2XN9D 2XKNB 4IRJC 3RWJA 5DSCA 5E5UB 4JAMB 1LO0H 4H8WC 1JPFB 1NFIB 3HMWH 3UTOA 3RJDA 4ZFFB 1GZPA 5D1ZB 4CW1A 1UENA 2AXFB 2B4CL 3VXSA 1XT5A 3PHQA 5K59E 1P5UA 3L3JA 5DJCB 3ULVF 1VHPA 3QUZB 4P3DB 3OB8A 1T3FA 1QLEL 1MREH 2UUDK 5I0DA 4IRSD 4U6HB 1EMTL 1PBYA 4YHPB 1BBDL 5GRYA 5IFAH 4POZD 3VD4A 1UACH 3SKJL 4HIJA 4M6OH 2EDDA 3BIKA 2DTMH 4EXKA 4HCRH 4MD0B 2Q8BH 2VISA 4P46C 3RVTD 1RQ5A 4OCYH 5CWSB 1OQOA 4LSTH 2P46B 5EOCJ 3P30H 5FKAA 4MXVF 3ZKND 3BMVA 4LARL 4LF3A 4ERSH 3GIZH 5CCKL 1Y6KR 1YMHB 4N9GA 4JE4B 4XMPH 1T0NB 5LXGL 2JKXA 4XVJL 4PGZA 1A7RL 3ES6A 2CMRL 2CK0L 5D1ZC 1SJHA 4HH8A 2WINB 3EJJX 1KIPB 4GMSL 4XP6H 1ADQL 1U8QA 2LE9A 5F9OL 3QUZC 4EI5D 3WXVL 1AD9A 5L2KB 2IF7A 3IFOB 1AGFB 2E9BA 1GIGH 2ITCB 4AENA 1KCRL 4YPGB 5K59F 4MNGB 4RIRA 3MR9A 5MEPB 4HIEA 3SDCB 4UAOB 1BJ1J 1UZ6E 5I66A 1NFKA 5CGYD 1L6ZA 3Q48A 4NM8H 3OZ9L 3VFSA 4PY8J 2R2CA 1GGUA 1KLGB 1YC8A 4Q9RH 3L9RB 1J0YA 4KRNA 4JFZH 5C0FB 5JXAL 1ES0A 2AQ2A 1QP1A 3V5DA 3T2NH 3QP3A 3MRMB 1NGXA 2XTJD 1QSED 1JWUA 4OV6F 4B41A 4BFIB 4JJ5A 1BF8A 2LVCA 2P5ED 4H8WH 1U41A 1Q1JH 5HGHA 2LAAA 1P7HL 5FA3B 3CDYA 4ONFH 1MEXH 2XQBL 1JMZA 5FEBA 1HI6B 4PP2A 2VDMH 3IVKB 1KB5B 2FX8L 5GZND 4HQQL 3CXDL 5KS9E 3QA3A 5F7HA 2QADC 4M8VA 1RJLB 1T1YA 3DIFB 5J8OA 1UZ6F 1F11B 1T5XA 2GI7A 4WVRA 5DD6A 4IOIA 3WNOA 1T5WA 4MGXA 1LO2L 5MENE 1LEIB 4JB9L 3FB7B 5KG9A 4OZIA 1U93B 4WUUD 1KCKA 4JFEB 5D71H 3CLEL 3GMQA 2JIXD 2XPGA 4DGIH 2Z93A 4LIQH 3TV3H 4M6AA 1GHFH 5JO5A 2AK4E 1YJDC 1PGRB 4P5TD 1FGVL 3OKOA 4OM0L 2GHWB 5C0AB 4J8RA 3HC3H 3V4VL 3GSNA 1U8IA 2XQYK 3ZZ1A 1QA9B 2X4QB 1JGEA 3MV9B 3OHXA 1J5OL 3KHQA 4AM0B 4D9QD 4M8QA 1ZT7B 2X4UA 4ZOCA 5CZXD 4DVRH 5KS9F 4LFHG 4GRWE 5E8NB 5T3XD 4Z7VB 3RZCB 4P23C 3VI3E 1FFOB 3TVMB 1CVRA 1EAPB 1FRGH 1FYTD 2NW2A 1LK2A 1A5FL 2H32A 2Z92B 1RIVH 2Y5TA 1RZ7L 4WHTB 1EXUA 2VLJE 4WU7B 3D0VA 5JA8B 3OAYH 3I9GH 1FBIH 3PGCA 1EO8L 3N1QC 3GMMA 4BYHA 1U8HB 3IFNH 4L3EE 4Y89A 2JK5A 2EIEA 3GSUB 1QSFD 2EDOA 3HG1D 5ADPL 4JO4H 1YUHB 4G8GB 4DKAA 3LRSA 2R9HC 4LSUH 1YEJL 5JOFA 3UTSE 4OZGA 1A3RL 4WW2F 3MRPA 1NUDA 4UU9A 4NQXB 3ZT6A 4JHZA 1UEYA 2VDOL 3V52H 3WFZA 3NOIA 4XXDB 4YHZH 4RAUB 4WUKL 2YD9A 5H37H 3HLAA 4U6VL 4FXGA 5BQ7B 1CFVH 4YPJA 5C9KA 2FB4L 3VFRB 1L4IA 2EYTA 1XF4A 1YN6B 5GGSY 4GRWF 3MLXL 2FDBP 1IKFH 3VI3F 4XI5D 4EI5A 5HY9B 1Q9KB 3ARQA 4YDIL 1G7IA 1OHQA 4EUPH 4Q97A 5C0JB 4ZUVA 1UM6H 5EIIA 1A6ZB 1A6WL 1UM5H 3PJSA 5FO9B 1G7HA 5DEFA 3STZB 2AK1L 5T1DL 5IQ7L 3MV01 1TJIH 5DGQA 3TIDB 4NDMB 3CDFA 1TZGH 5KZCB 2BDNH 2DDQH 3LVEA 2R2EA 4H88L 3T04D 2DTSA 1EA9C 1JZ6A 2HT4C 3ZTJG 3SKNB 4XPTH 3GBLA 3W39A 3ZE2E 2X4TB 2DI9A 1FIGL 1N2RA 1KB5H 4PRBA 3ULUF 2E6QA 1YY8B 2Y06H 3JSSA 4KMQA 3MBEA 4PY7A 4NZUL 5F9JB 1MCNA 3BUYA 3NH7H 1LILA 1IC5L 2DKUA 1I1CA 4IM8A 2O5XH 4BQ9A 2P5EA 3B43A 4K3EH 3OL2A 1HSAA 2H1PL 4OJFH 2BHYA 1W2KT 3FQUA 4FZEH 1U8JA 3CH1B 2I07A 4XCNB 2XKSA 4HSQA 4Z5RA 4R96A 3VFNB 4PJXE 3HFML 4YZFE 4KJYA 3AU1A 2M1KA 5EH1A 3DSNA 5TDPB 3BD4A 4M1DL 4M93C 1NDMB 4I3GA 1ERNA 4YQXL 2YZ8A 1BBJB 3DROB 3ARRA 3VH8B 1G7PA 4K8RD 3TH2T 5CP3A 1BAFL 5DLML 4R4NC 3CPLA 3GKWH 3LIZH 3T0WA 5I2IB 3ZE2F 2K3TA 5JXED 1KLFA 3KYAA 4DK6A 5BV7B 4OD2B 1N5AA 1OAKH 1D5XA 1DEEB 2RQ8A 1OW0A 3HMXL 4P5KA 4OD3H 1ZLVH 4OD1H 5D1QB 2VRAA 1F4WH 5I1IH 1NGWA 1IM9B 5HTSA 1YMMD 1AI1H 2B1AH 2H2SD 2I9TB 1QFWM 5HHQA 2WWMC 4N1EA 3RWJB 2OTUB 1I7RA 3UBXG 5KOVC 5C3LD 4PJXF 3F7YB 2XWTA 4GAJL 4RQQB 4Z95L 2H6PA 2WSKA 3CVIL 3EDDA 4YZFF 4CW1B 1BHGA 4XXCC 3PHQB 5C92A 2IPUK 3QUXA 3P4MA 1T3FB 4OZFA 1F4YL 1UG9A 3MQIA 4MNHA 5KBNC 4KRLB 2JJTC 2E9WA 3HCVB 5LGJA 1T1XA 4EN3C 3OJ2C 5AD0A 2AAVA 3MNWA 4PGEB 2DM4A 3GK8H 4KRMB 4U7KA 4NKDB 1V7MH 2VZVA 1QSFA 1AGEB 3KGRA 5FKAB 2PXYC 3PHSA 5E56A 4JFFD 1NGZA 5TFSL 4LF3B 2DQEH 2IMMA 1MCKA 1RY7B 5LCVL 1IMHC 4PJ9B 2GT9A 4XWGL 5DZLA 3D85D 1QRNA 2OP4L 3L3GA 4DAGL 2N1KA 3HI1A 5F88B 3MGOB 4G9FB 4LSDA 2C5DC 3RWHA 1U8QB 2XKUA 1AD9B 1RV6X 1LNUA 1AHWA 5H35B 3OPZH 3RKDC 4JO2H 4KK6C 3T4AA 4UI2A 2BNUB 3FCTB 1AXTL 2D7QA 4L8BA 4RIRB 3DVNB 2D4FA 4G6FB 3MLYH 4KI5D 1PW3A 1IARB 4MSWA 3VXOB 3R0NA 3RY6A 2H2PC 5E2VL 2YOCA 2HFFA 1S7UA 3TPUB 2QQKL 1F02I 3V5DB 2R15A 4QRTA 4LLQA 1AR1C 1YZZA 1JPGA 4H26B 4Z0BL 2AJVH 1B4JH 1K8DA 4KXZH 1JWUB 2BVUA 2ID5A 4HT1H 3VXTA 3OAZK 3WFEH 1DQTA 4MCYA 4JHAH 4K71B 5GGVL 4NJAL 2ZWLT 2X4PB 2DLFL 2GSIA 1S9XB 5DQJB 4MB3A 1CDGA 1KBGL 4LOUC 7FABL 5L8LB 2VLKA 3HI6H 3QQ9C 3OGCB 4Z7UE 3CLFL 3MOAH 4G6JH 2E6PA 5BRZD 1CQYA 5TE4L 4ODVL 4HUXA 2W9EH 3VFGL 1UXWA 1M7IA 2DICA 4OLZH 1S8DA 3VG9B 1WIOA 1A22B 1F6LL 1H3TA 2HTKD 3MO1B 3CDCA 3MCKB 3B6SA 1BQHB 4PRAB 5DD6B 4IOIB 1TZIB 4HWBL 1T5WB 5JHDE 3ROLA 3V0WH 3C6SA 2YSSA 5KG9B 4ELMB 4MJIB 4NZRH 4O2FA 5D7JA 1KN2L 3BH9B 1BQSA 1FVEA 4P4KB 3SO5A 5IFJA 2FJHA 3O4LA 1T22A 1T20A 3CSGA 2B5IC 4K71C 4ZPTA 1I7ZA 4F3FA 4U1LB 5JXEA 5JW5B 4MMXC 3S37X 5IMMA 5K9KB 1GZQA 2D31B 4RFOH 3IJYA 2WBJA 3MLVH 5JO5B 2P43B 5DJYA 4PJGA 1ZANL 2DQHL 5DURB 1N0XL 4OFKA 3DMMA 4FFWD 1UH3A 2B2XL 1OAUL 4OGXH 2D7TH 3A67L 1FN4A 2NY6C 5C08E 4ZFZB 2VDKH 5J7CC 2HP4A 1YMMA 4Z7UF 4UTAH 3EYSL 4FQIH 4LKXA 3VG9C 3OG6B 1XF2A 1RZJL 2XN9B 1UCBH 4L4VD 5GGUB 3W0WD 1F3DH 2X4UB 4NN7C 1ZLWH 1XFPA 4MZ3A 2E8YA 3H3PH 4NP4L 5I18H 2VDPL 1RZFL 1FH5L 4KHTH 2H32B 3TBTB 5JIIA 3NPSB 1OM3H 4NQEE 4K3DH 1EXUB 5IHUH 1CG9A 3NTCH 2Q3ZA 3B9DA 3R1GH 3IXAB 4IRSB 1GH7A 4EVNA 5DVNA 3RZWA 3WNNA 3ZKMC 2WQ8A 4P2OA 4LLDA 4R6UA 1MH5A 1KT2A 1OP5K 1HWGB 3BD5A 4TPRH 1CXLA 2EE9A 4OZGB 3S35X 3VXNB 3C6LD