4K2UH

Crystal structure of pfeba-175 f1 in complex with r218 antibody fab fragment
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
220
structure length
208
Chain Sequence
EVQLQQSGAELVKPGASVKLSCTASGFNIKDNYMHWVKQRPLEWIGRIDPANGNTKYDPKFQGKATITADTSSNTAYLQLSSLTSEDTAVYYCARHYDGYFLYYFEYWGQGTTLTVSSAKTTPPSVYPLAPVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Erythrocyte binding antigen 175
publication title Structural and Functional Basis for Inhibition of Erythrocyte Invasion by Antibodies that Target Plasmodium falciparum EBA-175.
pubmed doi rcsb
source organism Plasmodium falciparum
total genus 39
structure length 208
sequence length 220
chains with identical sequence I
ec nomenclature
pdb deposition date 2013-04-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4k2uH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4k2uH02
3KDMB 1J10A 5D2NA 3EYUH 4N8CL 3V52H 3C6LB 4LLVB 3QIWD 4WHDA 1KEGH 5B3JE 3O9WC 1MCOH 2K7PA 1RZKC 2FEDD 2UUDH 5E08L 2LTQC 1I1YB 1S9XB 2GSGB 3N1PC 3N85H 4NQVB 2YUXA 2DYPB 4LLUB 4ZG1A 2VDOL 2FEEI 1CTOA 2X4NB 3U30C 2C3GA 2EIBA 2VXQL 4G9DA 2BY1A 2OK0H 3QFJA 1SY6L 1X5FA 3ARRA 1YNKL 2G5RA 1H15A 2OTUA 3OAYK 4W81A 3LAFA 3IJYA 1M6OB 1H8SA 2BNRB 5FO7B 3GSOA 2VQ1A 2DD8L 3ELAT 3HZYB 1HN1A 4M61A 4B7LA 1C5DB 3LEYL 4LHUD 1OW0C 1CD0A 1MCBA 3G5XB 4Q9CA 3EFDL 4PJ8C 4YBHA 3MFGB 5E70A 2R56H 4P5TC 3DROB 3GSRB 2PYEE 3LY6A 4CVZA 4NBYB 1ZT1B 4RNRB 5CMAB 3RIFK 1RJYA 1I9RL 1CU4L 1FVDB 2QQNL 1T03H 4NO3B 1Y18B 2CLVB 5IOPA 5CILH 4HMCA 1FVEA 2AAVA 1R6VA 4OJFL 3LSOA 4KZDH 5FYLL 5E2JA 3VFVB 1CBVH 2N7AA 4CDHA 1GZPA 4P23C 1IGTA 4PJAF 4YQXH 1G84A 4FQ1L 2HAZA 2OL3A 1IEHA 3X13A 3LB6D 4I3SH 4C55A 3QQ9D 4K7FB 3MUGB 3UJTL 3UX9B 4U1JA 4OLWL 1L6ZA 1WQVT 3JTSB 4XCNB 1CICC 4JQXC 3TJEL 1UFUA 2R29H 3U83A 4X5LA 4LKXB 1GGBH 1G9EA 5TE7H 5F7EL 1HEZA 1MCWW 5IFAL 5I8KL 2Q6WB 1XAUA 5EC1A 1QBLL 5IW1A 5KSVA 5E5MB 5DUBA 3VXUE 5D9SA 2COQA 1IKFH 4U7SA 4ZTPL 2LAGB 4NNXA 5C71A 3QCUH 4K94L 1XGPB 2F8VA 4KXZH 1MCNA 1LE5B 1BD2E 1DQLH 4LP5A 4OUUB 5FECB 2H32A 4FHBD 1IVLA 1RUKL 5FYJE 2EZ0C 4X5WA 4DK3A 3AY4A 3U4EB 3RWCA 3KPNA 2CLZA 3BGMA 2BVOB 3RVVC 3BP7A 3QZWG 2AEQH 5FOBA 1HILB 1MI5E 1KPUA 1UCTA 3WUWG 3MACL 4KFZC 4FABH 3BW9A 3UAJD 1J18A 4P3CH 1URLA 3W2DH 2ATKB 3CUPA 3L7EA 3MJ9A 2AK1L 5TDPB 4AENA 4DVBB 3BP4A 3LH2H 4NQED 1NCWL 5HHOD 3L1OH 1K6QL 3I9GH 1LE9A 2YKLL 3WJLA 4PG2C 1JCKA 1F4WH 1ZS8A 4GAJL 3KYKL 3O3EA 5D7JA 3FQUB 1S7QA 3BDYH 2AJ3B 1OAXL 4WJ5B 4QHUB 2R0KH 2ITDA 2OSLA 3GO1L 4NZDA 4F2MB 3D0VB 4OF3A 4JN1L 2UUDK 2OZ4H 4LDEB 4OCXL 1NDGB 1E4KC 4PRIE 4XPTL 1AE6L 4OQTL 3KLAB 4F15B 5I74C 5ETUB 3H9YA 3C60C 5BRZE 1XH3B 2B20A 4JPKH 5JHLH 4L29A 5C0IA 3OTTA 3NZ8B 1FNGA 3RTQC 4JHZA 2QLVB 1RZJL 4WWID 3E3QC 4U4BA 1HHHB 3LN5B 3FFCA 3FQRB 3KXFE 4RZCB 5MEOA 3ULUH 1QFWM 1F8TH 2AXFA 3KPSE 3QJHB 5IMOB 3UYOD 3O4OC 1E0OB 1IM9D 2OJZL 3BEWB 2XTLA 3OMZA 4OZFH 5J57B 4C56E 4KJYA 5J0BA 1JIBA 4ZPVB 4WENB 4GAGL 1QZ1A 4U1HB 3NCJL 2BVQA 3OWEA 3H9SD 5FUZL 2OM5A 5FA3B 3HRZA 2FEEL 3TM6A 3CJJA 4FQHA 1ZLUH 4CL7A 3RWGA 5I1KH 4FQXA 5FUOL 5IHLB 4R0LA 3VXME 3BDXA 2JCCB 1E4JA 4ZFOL 4HJ0C 4L8CB 1IKNC 4NIKB 4ERSL 5C2BL 1ZA3A 2KL6A 5KVEL 3TZVC 3FO9B 2YC1B 4X5XB 4GMSH 5ILTH 4M43H 2NYYD 4FFVD 2YPLE 4XNYH 1AD0A 3ARPA 2Q8AL 3P2TA 2G9HB 2VSDA 2CRZA 3STLA 2AJVH 3HC4H 5ISZB 3OR6B 2UYLA 3GRWA 3O6LH 4PB9L 5EIQA 3AUVA 5BV7C 4Z5RB 1TNNA 4XCYA 4Y4HD 4MJ5B 2AABL 3V79C 2IAMC 2VL4A 4NRYA 5DRXA 5IJKC 1BVZA 1FGNH 1XGTA 3P77A 4Y5VC 5SV3A 1QEWB 4M8QB 1TPXB 4O2EB 4BJLA 1BAFH 1FL5A 1WEJH 1CE6A 1U8JB 3WN5B 2XQBH 2FX7L 4OCWH 5F93C 4QRUA 1ZXQA 4PJEF 5DRNB 1I7UB 1G7QB 4KHXH 4PRAA 4XP6L 1QBMH 2BMKB 4QRRD 3R8BB 1MHPH 2WAHA 2VXSL 3BRGC 3M1BA 4ZSOB 1KXVC 3BP5B 1JWUB 3GKWL 4PJ7F 1A0QL 1G7MB 4MD0B 4WW1A 5DD6A 5I18L 2E7HA 4JDTH 3V4PL 5I1EH 2R1XA 4ISVB 3DOSA 5C6TH 4M3JA 3GDBA 3NPZB 1RMFL 4XHQA 4J6RH 3O2DL 1OL0A 1QKZL 4YHOL 2M1KA 4M62L 2JTDA 2XZAH 4FQIL 1CFNA 4ESKA 3CFEA 5ADOH 1D6EB 3B4NA 3PV7A 3ZLQC 4OGYH 2WNGA 3OKLB 1H3PH 1R3JB 2FH6A 5I16A 2DQUH 4KJWD 2V17H 1G7IB 3EJYD 1G9NL 3S5LA 2BVPB 2I27N 2YA2A 2A77L 1YY9D 2GCYB 1LP9E 4NC0B 1L9MA 2VZUA 5C0GB 4OT1L 4PJIE 1KYOJ 4DW2H 1A5FL 1UZ8A 4G5ZL 4PJAB 3DX7A 5EOTB 4HDIB 1R3IH 4HWUA 5CJXC 5JIHA 2VH5H 3VMNA 4EJ1C 3V0AC 4TPRL 3PQYB 3WXWL 1XR9B 3QH3B 3RVXC 2P24A 1HHJB 5B8CB 3C5SA 5F9DC 3IU4L 3MRRB 3BXNB 4YHZL 5LXGL 3NA9H 5GRYA 3HG1E 3QEQD 1QSZA 5EORL 5C09D 3HNVL 2R4SH 4IOSD 1IQDA 3OAUL 1A3LH 1PZ5B 5T3XL 3VXPA 4O51A 4PR5B 3DECA 4X4YA 2EYRB 4JVPA 5C0CA 1UYWL 2RBLA 1C5CH 2QKIA 3RWFA 3IS0X 4XPGL 2FBJH 1EA9C 2IFGA 1WBXB 1SM3L 1T22A 2NXZC 1MHEB 1RZGA 1BFVL 1JGEB 3Q6FA 5ECJE 4HLZG 3UDWC 4P5MB 4GRLA 5E6YA 3TO2A 1H3TA 5GJSL 3S3JA 5DHYA 1CVSC 4YNYA 1RVFL 1T6VN 1Y0LA 2VITB 1ZLUK 1D6VL 1CF8L 1OWWA 3ALXA 5H94A 1V7NH 2IBGA 4OCYL 4I18C 3MV9B 2GUOB 1INDL 1Q38A 3KHOA 5ALBL 4PP1D 4U1KA 3O45A 3HCVA 5AWNH 4KRNA 3D3VB 4I9WD 1T89A 3SCMC 2B1HL 5E1HB 3P73B 3MREB 1ZA6A 4GUPA 5FA4A 4NWTL 2PYED 4M93B 2MHAA 2MKWA 5GGRA 5F9JA 5TJWK 1F11B 2PR4H 4P2RB 3E3QE 3EOBB 3WFDH 1A7QL 1IQWL 4MNQD 3T0XA 3DMMC 1QUNA 4QCIB 3NAAH 2QQLL 4H25A 4H1LA 2BRRL 3PGDB 4LKCA 1H3WM 4CJ1A 1BEYL 3IU3B 4S1DC 5T5FL 2AW2A 4IMKA 5KSUA 2EEBA 5E2TL 3H3PH 3D5OF 1R3KA 2ZKHL 3MUZ1 2Y07L 5CKGA 5LWYL 4U6YB 1YN6A 5HD8C 4UU9A 2CUIA 1OT2A 5DD5H 4YHPB 4IHOB 1A02N 3HI1A 1NAMH 4FS0A 2DQHH 3GSNA 1OSPH 3VXUD 1E6OH 5ANME 3E2HC 4MJ2A 2FH8A 1NMAH 4UZGA 3IDMA 5D7KE 5FV2A 3IKKA 1UWXH 5JLZB 2VC2L 1EBPA 4YHIA 4WV1B 4ZUWB 2VLLB 1BD2D 3PXJA 1OP3H 3H7LA 1UA6H 5FYJD 3BMVA 3EGSB 3IFLH 3O11A 3RL2B 4WHTB 4F3FB 4Z77B 4OTXH 4XP1L 4LEXL 2YSSB 3MNZB 1MLCA 2FJGA 3S6CA 3H42H 1CG9A 4JDZA 2Z8RA 4M5YH 5T5NF 1WFUA 1FDLH 4HWZB 5L0QB 5C86A 4Q9RH 1MI5D 3PHSA 3CZFA 4K23L 3BH8A 5C8JA 4HQQH 5ACZA 2HT4C 5IQ7H 5D7SL 1U95A 3I85A 1GC1L 1NFIA 4PJ5B 4R26L 3TGXA 3PF2A 5ICXA 2R2EB 1KJ2B 1O7VA 4K2UH 4KKBD 2W0FB 2CDFA 1L7IH 2VWEE 5EWIL 1BLNA 2AV1B 3AM8A 4LAQH 2V2WA 1K8DB 3THMH 3TBVB 1MCSA 5HI3D 4MA1C 5F96L 4OGAD 1OPGH 2MQ0A 1KJ2H 4JEGB 1AGDB 4JQIL 3D1MC 3HI5L 4PRID 4O2FB 4MA3A 4PJEB 5EPMA 2BK8A 5J89A 5GGTL 2HYMA 4KQ4H 4RMUA 1EHNA 1BWMA 2KKQA 4TVPL 5BRZD 1M71A 5KSBE 1GIGL 3B3IB 2IMMA 3U6RB 2ID5A 3EBAA 5DMGC 4Y2DD 3MBEB 1D5IH 3MOAH 4H0IA 3KXFD 3FAXA 4U6TA 3PHQA 1MCCA 4RFEA 1P5UA 4OM0L 1UWGL 2D31B 4PJ7B 5EO0A 3VA2C 2CQVA 3L3JB 1AKJD 2VE6B 3KPSD 3HUJF 2DJUA 3Q48A 1IAKA 4CU8A 1GOHA 1LEGB 2P46B 4ZUUA 2ARJQ 5GRWA 4GG6E 4JFYB 3QNXB 2Q76B 1I8IB 1OM3H 5HYJA 1DBJH 1KYOK 3SKUD 3C08L 1VESA 2EDXA 1PYWA 1FE8H 3F7VB 3CSBA 3U4AA 1P7QA 4JG1H 1MF2H 4WTZA 2BERA 1AJ7L 2VTFA 2YR3A 1ZKAA 4FA8A 2HG5B 2WP3T 4KJPD 5HHMB 3SKJL 1KEGL 5EBWA 2HVKA 4WU5B 3VFRB 1X5JA 2J8UE 1T0MB 5T3ZL 3O9WD 3UTZA 2ICEA 2A38A 2E6JA 4I0PA 5CIPA 3W0WE 4HUWA 3SEPA 4XNQB 4EN3A 2ZPKL 1MJ7H 2FWOA 2R1YB 4N8VG 4YO0B 5LGHL 1OF2A 5HVWA 1F6AB 4P2QA 4P46C 1IFHH 1X44A 3GBLA 4WWKB 1XIWA 2EICA 2NX5A 5DHVA 3AXLA 1Q0XH 1GGIL 4IS6A 1JNLH 5L6YH 5I75B 3BAEH 1A9EA 2ICWB 5DUPL 3OG4B 1KTKE 4PJXA 1KLGB 1UWXK 2ZUSA 2HA1A 4JRXB 4MAUH 1EVUA 4PJ8D 5E8DL 3CVIL 1JPFA 1NPUA 4KPHL 1UQSB 4MZ3A 2IG2L 4F9PC 4N1EA 5BVPH 1JF5A 1T03L 3U7YH 4OBRA 5L2KD 5B39G 3U0PA 1CLYL 5E5UB 4MA7H 2QJDA 4M3KB 1YPZA 3PABA 5IQ9A 4L9LA 4KZDL 2NW3A 4KGLA 1CBVL 4XMPH 2YEZB 4HGWB 2A6IA 3ARXA 1C1EH 4P23D 2Y5TA 4ONFH 1EERB 1A6UH 4P0DA 3GMRA 1VKXA 2AEIT 5DO2C 1CICD 1GGBL 2W38A 1KV3A 5MERB 4D0BA 2NTSP 1NFDE 4LCCC 1HSBB 5HDBE 2FCBA 2DQJH 1S7WA 1JGDA 3C5JA 1ERNA 5DEGA 2IANE 4JHAL 5DTFA 4YXHH 4ELMF 1IKFL 1O0VA 2E7LA 1BBJB 3L3OA 3NIGF 1E6JL 3DWTA 4YHKH 3UTSE 1DFBL 2ZUWA 3ME0A 1DQLL 1D5BA 3IFOB 2DRUA 3M17A 2VZSA 3CDFA 4DVRL 1KG0A 3BZEB 4DZ8B 3HG1D 3RWEB 3MGTA 2JJWA 3KPPB 1JGUH 3O4LB 3MRNA 3CXDH 3V0VB 2KQNA 2VJXA 4JY4B 3NPSC 1AGCB 1T3FA 4X8JB 1TQCC 5E6ZA 4ELKA 2AEQL 3RVVD 4B53A 2ZZUT 4LF3A 1L0YA 4B0MM 2H26B 1CFSA 4XXDB 2HMIC 4IRSA 3ZE2F 5K33A 2PXYB 4ZQKA 1D5ZB 1HHGA 5DC9B 3OKOA 3TBWB 3L1OL 3VWKA 3ARZA 5BS0B 3WLWC 5TE6L 1F4WL 3SJVE 1J1XL 1I7TA 4E5XA 4QHKJ 3QI9A 4PYGA 4HCRH 1WLHA 4Q6IB 4Q97A 4ZNCD 3QPXL 4ZD3L 3KR3H 1ZGLM 5C0BB 1QQDB 4XCEA 4HKJB 1WBYA 1JN6B 2I24N 4TRPL 5SWQB 1CD9B 3VRIB 4Q9QH 3VXNB 1LO0H 1J11A 3C60D 2JIXA 3QDJB 1FAKT 3GI9H 3PUCA 1TZGH 3RTQD 2O5XL 3TIEB 4XP4L 3TF7C 1IGCL 4NHCL 5HVFB 4DUWA 3GK8H 2GW5A 4QXGL 5DS8A 5EZOH 3UBXA 3OHXB 3IDYB 3FKUS 4XHJC 5BO1H 1D5XB 4ZUSB 1JVKA 2WBJB 3C8HA 3ZYIA 2W0LA 1U8NB 4NKOB 4CVXA 5KJRL 2CK0H 5ICYB 5M94B 1J05A 2XY1A 5AYQA 4KV5F 1V05A 1W8OA 3GMNA 1KTDB 4WI8A 3GHEH 3U9PL 2HRPH 4JO2H 3ZHKA 1M7IB 2ARJA 2IC2A 3K8MA 43CAB 3HUJB 5F3HB 5GS1B 5IP4A 4CN6A 4G8EB 5ITBL 3MOQA 4HKZA 4OKVB 4UV7H 4RGNC 5E95B 4JFDE 1I85C 2PTUA 5ILTL 4JFFE 4LARH 3TZVD 3QDMD 5GGQH 3CH1B 4UT7H 5C92A 3O2VH 3MLYL 3DSFL 4M7LH 3QEHB 5A2KH 3HC4L 3ZKNC 1MHHB 1ZT7A 3O6LL 4JO3L 2F74A 3FQTB 4JPIB 5EUOA 5E24E 3S3PA 3SDAC 5FF6B 1N3NA 1JF1A 1IAII 1F90L 3QUXC 2AJYH 2X1XR 4U05A 2IAMD 4Y4FB 4S2SB 1XF2B 1PG7W 1FPTH 35C8L 5JW3L 1CGSL 1ACYL 5CSZB 3I3DA 2QSCH 5IEHB 3S5LG 3SDYL 4BSVB 1A6AA 2GTWA 2ZSWB 4AJ0A 4YH6A 3T8XA 5J7CC 4U6HB 2Z8VC 3T2PA 4LSSL 5I17A 5BZWA 4U6XB 4LHQB 1QBML 2IBZY 4MLSA 1FZOB 2LE9A 1XZ0A 4TN9A 4IOIB 4FTVA 2DKMA 4TNVF 4ZMAT 3CFKA 2CDEA 3B5TA 2P5WB 4W4OA 3G5VA 2OYPA 3T0EE 3RGVB 3T3PE 1XGQA 1QA9B 3VWJB 4J6RL 2X4RB 1NCTA 1VA9A 1J7VR 2Y7QB 4NUGL 2V2XB 2IQ9L 2X4SB 5AYUL 5KZCD 2QSQA 4PJGF 1Y6NR 1IGYA 3DX8B 2F5BH 5IWLC 1FL6B 1KCVH 1B90A 4WUUE 1B0GA 4X6EA 3BWUC 4GBXD 4JFPB 1GGYA 1FVCB 2YZ8A 4GXUN 5DK0A 1WWWX 3D2UA 4RDQF 2HTKC 4L4VD 3U4BH 2B2XH 5IIEB 1K9TA 4JPVH 1FG2B 5I8OH 4HWNA 4PGCB 1K8IB 3RVXD 1DBBH 4Z76B 3KDMA 5ESAA 1NUDA 3C6LA 3RAJL 4LLVA 2R4SL 1UCBH 2HKHH 2Y4SA 1A3LL 1R5IB 1L7TL 4KUZL 2MCPL 2GHWB 3LKNB 3P40A 3C5ZC 1A6WH 4ELMB 1S9XA 1FHGA 4NQVA 5LCVL 4F57H 2DYPA 5TPWH 5CJOH 1H5BB 3S35L 4UOW1 2X4NA 3W0WD 1TCMA 3MXWH 4H1LG 2NXZD 3SGDH 5JDSA 2O61B 2J8OA 4LIQE 5I71C 3WDJA 3ROLB 1M6OA 3N1QC 4UAOB 4AZ8A 1V7NL 3MMEB 5IV2B 3SGJA 1F3RB 1MWAL 2A9MH 5DQDL 3ULVH 5MP6H 1QBBA 3BT2L 1NFKA 1C5DA 4Y7MA 1JHLH 1WC7B 1R3LB 2ZCKL 2FRGP 2ZUXA 2VXTH 3G5XA 4PGBB 5AWNL 4BELD 1MCHA 1NBYB 3ARFA 5I2IB 1GAFL 2CXKA 1U8HB 3RVWD 3QIBB 4GKSB 1QFOA 2MNUA 3DROA 4YX2H 3KPRA 3SCMD 1ZT1A 1IM3B 4RNRA 5CMAA 1QNZH 2VLRD 4GH7B 1FVDA 3WV0A 3BHBB 2AQ3A 4NO3A 1Y18A 3E6HA 2CLVA 5SWZE 3I50H 4QRTB 2X4QB 3VGHA 4WI4A 2QHLA 4Y4KD 3WFDL 3O6MH 5F7WC 3A6CL 3ARED 3W11C 3DO7B 5JR1L 2D0GA 1YUHA 3RWJA 4MQXC 3NAAL 3VFVA 4PIRF 4HKBB 5E4IA 5DVLA 2NY0B 1DUZB 2UWEE 4ETYA 3P11L 1G7JA 4WHYG 5I6XC 2JJUA 2LFGA 2G75B 4K7FA 4HJGB 3MUGA 4S1DD 1V3JA 2CH8A 2VDQH 4XCNA 3QDGB 4E41B 2ED9A 1HDMB 4N90D 1KEML 1NMBL 3H8NA 3MLUH 3ILQD 3VW3H 5D1XA 3EO1B 3NGBC 3KPLB 1HQ4B 2Q6WA 5DD5L 1B2WH 5HD8D 1NAML 1IAIL 2DQHL 3FOLB 2IAND 3UTTE 3WFHB 1IL1B 1XGPA 2ZCLL 1TVHA 1KULA 2BC4A 4OUUA 1P4LB 5FECA 3K3QA 5JOPE 1UH2A 4WEMB 1KCUH 3FT3B 3HMWH 3P4MB 3B2VH 4WW2F 4DK6A 2BVOA 1CFQB 1HILA 3KYAA 3WNMA 1NC2B 1T2JA 1FDLL 3RZCB 1QD0A 2LAAA 3G6DH 4ONOA 3P30L 2ATKA 4Z0BH 4LCWA 4QXTB 5FGBA 4IIQC 5TDPA 4DVBA 4GMTH 1EDQA 2BDNL 2Q1EA 1A8JH 2YA1A 2OZ4A 3PGCA 1NLDH 1X5AA 3BPOB 4MHHI 5HGAB 3FQUA 4K2UL 4MB5A 4WJ5A 4J1UA 4F2MA 3D0VA 3O3BB 2F54D 4XVTH 4NC1C 1A4KB 2KPNA 5FDWB 5DJ8A 5F1IB 1T66C 1PEWA 2XACC 3CFBB 5I1HH 4WTZG 3KLAA 1OPGL 4E42A 1YEGH 5ETUA 3SOBL 4WEUD 1XH3A 5IKCB 4J3UA 4KQ4L 4HT1H 4ZFZB 5C07B 5KVFL 1HHHA 3LN5A 5EU7C 3FQRA 4JHWL 4NRXB 4RZCA 4WI2A 3O6FC 3CXHJ 2GJZB 3SN6N 4BZ1H 3MOAL 5DMGD 1I3GL 2H6PB 3BEWA 4X6BA 1F5WA 2VLKD 1N64H 3GJFH 1JYXA 5D7LE 3QIWB 4ZPVA 3LZFH 3PWPD 1V5JA 3QQ3B 4U1HA 2EDQA 1DN0B 2WMPA 2FO1A 2Y23A 1DBKH 1OM3L 1G7LB 1LMKA 1DDHA 4PJGB 4C57C 1QSEA 4NO0D 1A7NL 3G04B 1FO0H 2JCCA 1BQHA 1DR9A 4AL8L 2IPKB 2YC1A 4X5XA 4QKXB 2FBOJ 2GFBB 4Z9KB 3GNMH 1ETZB 4JFDD 1BJ8A 4JFFD 4NZRL 3ZTJG 4OLYH 5I8EB 2VDRH 2HJLA 2G9HA 4LHUB 1CDYA 4HIXH 1UADC 1MJ7L 5IR1B 1TJIL 4Z5RA 2XICA 2DTML 5L7XH 3WS6A 3FMGH 4MJ5A 2XT1B 4CW1B 1FLRH 3CX2A 3VRLF 4HJJL 4HZLB 3JV0A 2DL2A 1QEWA 4O2EA 5DURD 3MJGX 3PWVB 4XBPB 4JM2C 1U8JA 5JNYB 1JFQL 5E1AB 2FGZA 3P9WB 3WN5A 1KN4L 1MFCH 2A0LC 4G8GE 2DWDA 1KBGH 3BAEL 3NMEA 3QUYC 4DGIL 1JBJA 5DRNA 1I7UA 1RZKL 1AQDB 5FO9B 5CEZD 1RZ7H 4LMQI 3WD5H 4HUKB 1XGYL 2BMKA 5KVDL 2WUBL 3PWLA 4G6FD 3DUHA 2HLFD 3KAAA 4DUXA 3GI8H 1VGKA 4OFIA 5AD0B 4ZSOA 5JW4N 3TA3A 3BP5A 3FB6B 1JWUA 3MBXL 1FNFA 4YJZL 1G7MA 4MD0A 3GIZH 1G0DA 1T20A 5HVHC 5FM8A 4ISVA 5HHVH 3WHXB 1JGLH 1S7TB 4HWEL 4K9EH 4IDLA 4LPWA 4XMPL 4PTTB 5B3JF 1CDHA 1Y6MR 1D6EA 3BUTA 3VFUB 4ONFL 2VOTA 2R39A 3OKLA 1R3JA 4JO1L 5CBAB 3E8UL 2PNDA 3TN0C 1G7IA 3F6IA 2BVPA 3IDJB 2CO6B 5MHSE 3MLZH 5CEXB 4PD4J 5DO2D 5C0GA 3AAZB 3HAEH 4G43B 2V7NA 1NL0H 3D6GA 4PJAA 5MENE 4HDIA 2X09A 4WUUD 4JCLA 4Z7NE 5BOPA 1LEKB 3I02B 3EUUA 4P4RB 4KY1L 4NKMB 3EKCA 4YXHL 3D39B 3PQYA 1XR9A 3QH3A 3JWDH 5B8CA 3P4NA 3DRQB 4YHKL 4P59L 4AEEA 1VGEH 3MRRA 3BXNA 3V0WL 3LQZB 1MCRA 4V1DE 4Z7VE 4MMXC 3RL1B 3NTCL 1PZ5A 5DGRA 2NZIA 5A16B 4PR5A 2IWGA 4U1SA 5HHOB 2EYRA 2BCKA 5D2NC 4XMLL 2I9TB 4R4NC 1MRFL 4JE4B 4ALAL 3GJFK 1WBXA 5E8PB 4MJIA 1MHEA 1JGEA 4TNVK 2AJSH 3WIIH 3UBXG 1OTSD 3S36H 1N2RB 4P5MA 1OOAA 1Z5LB 4PJDF 1GRWA 4S10A 4WW2B 4CU7A 3ZKQD 1U8KB 4H8WC 1PGRB 4XP9L 3ZL4L 3JUZA 3TIDB 2VITA 3VGAC 4UI2A 3MV9A 2EYTB 2V9QA 5F6IB 1XFPA 4FQJH 4HCRL 1NCBL 1INEL 1WFTA 3FTGB 5EU6D 3WIFB 5C9JB 4KTDL 3EYSL 3P73A 4U7KA 3ZKXB 1IM9B 1BJMA 5ID1B 4DAGH 3WFEL 5GHWH 4Z8FH 3QXTA 2Z92B 4R96B 1NANH 2DDQL 4P2RA 5TH2B 3EOBA 4NOBA 3DTXB 3H9SB 4TSBH 3GI9L 5J12C 4AH2B 4OFDA 4AK1A 1YYLH 4JPWH 4QCIA 1F58H 3ZDZE 4PRBB 3CXHK 1UH4A 2IEPA 3PGDA 1EXUA 1OAQH 4XHJD 1HHIB 5A43C 1P2CB 1QYGH 2BNRE 1IGJB 3HE7A 3JWOC 2C3WA 4MWFB 2X4UB 1S5HB 4PRNB 2EDBA 4EOWL 5DRWB 2HVJB 2FL5B 1DEEB 1F4YH 4U6YA 5H8DA 2PO6D 4GRWE 2IBBA 3HPLA 3QWRA 1AC6A 3GHEL 2ERJC 1NMCC 2WV3A 4JFEE 2HRPL 4YHPA 3NFSH 5JW5B 4IHOA 1U3HB 4QOKA 4J2XA 4Y4HB 1NGWB 2F58H 5H35A 3QXVA 3BSZH 1S7UA 3OJMB 3UTTD 4QRPD 1U8IB 4RGND 4WV1A 1T1YB 4GKOA 4ZUWA 2VLLA 5GGQL 1BQUA 1M7DB 3EGSA 3QFDB 4WHTA 2YSSA 3OPZL 3MNZA 5TDOB 3ZYJA 3DXAA 3ZKND 1KLUB 2XA8L 4YEEA 4F8TA 3AY4C 3PJSB 4HWZA 3QDHA 5E4EB 1CGVA 3MRBB 1XF5B 4NKIL 4QRRB 4W4NA 2AJYL 4GSDL 3JSSA 4XVJL 5DD3H 4BZ2H 3QUXD 4NJAH 1RIUH 2BNUA 4S1QL 1CDCA 2WWMC 2BNQB 4PJ5A 4U0RB 2MJWA 3EYVB 3S8WA 4HXBH 5JXAL 3QHZH 1EEQA 1KJ2A 3PL6B 2NXYC 2W0FA 1FYTD 2X5PA 2OR9L 1YMMB 1K8DA 3T4AB 3WJLC 1D5MB 2YWYA 3TBVA 4S1SH 1A3RL 3KS0H 2Z93B 1ORQB 4JAMB 4U1MA 5JMRA 5BV7L 1QSFD 4O2FA 3RY4A 4LLWB 4PJEA 5D5MF 5DEZA 2P45B 5GZNC 5KSAB 4XGZB 1KELH 2PW2B 3B3IA 1VFOA 1HOCB 1YEJH 3GMPA 4HFUH 3FT2B 3U6RA 2X9YA 3TBSB 3ARBA 3VD5A 3MBEA 3WO3B 2VLJD 1OD9A 5HGGS 1HZHL 2D31A 32C2B 4HUMB 4PJ7A 2EIDA 4WI6A 3L3JA 4AIXA 1UACL 2J5LC 2VE6A 3Q3GB 4DN3H 3QEQB 5C09B 5GS2D 4OIAA 4RA0C 4D9LH 3CDYA 1D9KD 5D2LE 2A1WL 1S7VB 4FQ2H 5D7LD 1JRHH 3VFGL 3T3ME 3HNTL 2Q76A 1I8IA 4F7EB 3IDXL 1EHLL 2R8SH 1EAPA 2OI9C 3EO9H 4G6AC 3DYMA 3BKYL 2ZWLT 3HE6D 1JK8A 2B2XL 3GBNL 2HTKD 3F7VA 4JPVL 4WFGE 1G6RB 1YNLL 2X70A 1BJ1J 3WIHL 1DBBL 3S3SA 1LQSR 5IMKB 3AS2A 4FQXC 1AP2B 4R0LC 5EBGA 5DHXB 1JGVH 2I60H 5IT2L 4WU5A 3VFRA 1T0MA 1OAZH 3LHPH 1G6RH 1J5OH 2ZUUA 5F9OH 3S35X 1DLFL 4QY8A 2X44D 3QA3B 4XNQA 4FQLH 5HDQH 1CDJA 2R1YA 4ODWB 4YO0A 4G7YH 2FIKB 1RY7B 4M1DH 2VIRB 2NY2C 5J1AA 2XWJB 4OCSH 2PYEB 5GGSY 3UO1H 4C4KO 1QFWL 3RWIB 2PKDA 4KROC 3VGFA 2X1OA 3BESR 4UQ2B 1ZWIB 1JHLL 2JJSA 1SJXA 4MNQB 1KPRB 2ICWA 1KC5L 2P47B 3V6FB 3EJJX 5GQBA 4PJDB 4JRXA 1WWCA 3TPUB 4YX2L 3WBDA 2AEPL 1X7QB 3FO2A 2JB6B 1LP9F 1UQSA 2MQ3A 2B5IC 2VR4A 5A1AA 1AGBB 4IRZL 1WAAE 1VEOA 1BJ1H 1KTRL 1DBML 2UZIL 2QSVA 1FFQA 2H2SD 4R2GB 3WUZA 3FRPG 1FLTX 3W11D 2CRYA 5AZ2H 4DKEH 4LCIH 4F7PB 1FG9C 2VABB 2YEZA 5KW9L 4G3YH 3TYGH 5I76B 1FV1B 3VXUB 5AG9A 1LK3H 4QGTA 3RPIA 2VDQL 4ZO7A 1MHCA 1QTYT 5J56B 2AQ2A 1BD2B 1J0JA 3GBMH 4K3GA 4PS4L 5EC2B 1HSBA 4Q74A 4JR9H 4YXLL 1CR9H 2VDKL 4LVHC 1FIGH 1PX4A 3JV4B 1LVEA 1H3VA 1LNUB 4YXKH 1S7RB 4PV9B 4JVUA 3I2CH 3QRGL 3JXAA 1BBJA 2J2ZA 2KZ1B 5DRZA 4YGVB 5FYJH 2BFVL 1MI5B 5DZLA 3O3DB 2M8XA 2P48B 1KCUL 3IF1A 1XCQB 3QEUA 3TO4A 3HMWL 3BZEA 4O02H 4DZ8A 3RWEA 2BJMH 1PSKH 3O4LA 4KK5C 2XA3A 4JY4A 5ALCH 1AGCA 2XWTA 4TULH 3BUYB 4X8JA 4LRNL 5HDLA 1U3ZA 1X4YA 1PKQE 4UILL 5KVMC 2H26A 3G6DL 2WQRA 3EYOB 2BSTA 3FFDB 4OV5B 4XAWL 4DEPB 1Z9SA 1D5ZA 2WINA 1MFDL 4I3RH 4PRIB 2XG5A 3TBWA 5MEQB 5IBLD 3BQUD 5BS0A 1AIFB 5CJ5A 4GRLC 1H8OA 5HVGB 3R1GH 5BRZB 4OLVL 2O5ZH 2XOTA 1A1MB 4Q6IA 5JXED 3DX6A 3RKDC 4Y2DB 2CGRL 4YPGB 3OZ9H 2X7LA 2RFXB 3KXFB 1FZKB 5C0BA 1QQDA 4HIIB 4HKJA 3RWDB 1AKJB 5F70A 4LSUL 1JN6A 1RUPH 1YEGL 3KPSB 2EDNA 1T89C 2MPAH 5SWQA 3VXNA 1I7ZB 1UB5B 1UM6L 2ADJB 2AK4E 1TCRB 3RX8A 4LPCA 5C7XL 1RZFH 4AEFA 2NY5H 4YZFE 1DQQB 3DHJA 3TIEA 2YZ1A 4HHAB 1GGCH 1OT1A 3O6FD 1JZ2A 3OHXA 1HSAB 2QADB 5DC4B 1D5XA 2EYSB 4ZUSA 5D72L 4M03A 4G9FD 3Q5YA 5D5MB 1H9VA 3VXMB 1GSMA 3RY6A 1U8NA 4NKOA 3RKPA 1SMAA 5ICYA 3TBYB 1AD9B 1QHOA 4I77H 3FN0L 1DBKL 2AJXL 1NANI 4IMKC 1KTDA 1TENA 3D3VE 1M7IA 2AI0H 4ODVL 1FGVL 3HS0B 43CAA 3HUJA 5GS1A 1FO0L 4V2CB 3MA9H 1VERA 4JFED 4QRQA 5DMKB 3QCTH 1JMZA 3O3AB 3TNMA 1U92B 4PJ9B 2Q86B 4NN7C 3FHAA 1F00I 4RX4A 1FBIL 3SQOL 4MJ4A 4EI5A 4GJTB 3O2DA 3BN3B 5DGQA 2DWEB 1OCWH 2VDRL 3QEHA 4R90H 3D9AL 1MHHA 5HHQB 2K9UA 1I9IL 3FQTA 3FN9A 3IDIB 3RHWF 5C08E 2SEBB 4JPIA 4IRJD 5FKPB 1RPQA 5FF6A 2AV7A 4Z7WE 1EGJL 2XI9A 5KSBF 4QHLB 4Y4FA 3VCLA 1A6ZB 4S2SA 1XF2A 3ARVA 2CUMA 1B3JA 4Y8DC 1P4BL 5CSZA 3QEGH 1J86A 3LRSB 5IEHA 3P9MB 1FNEA 1QPXA 4LLYB 1MFCL 4GXVL 4JM2D 4BSVA 3A6BH 3BH9B 1KBGL 3X11B 1DE4B 1Q9LB 4U6HA 2A0LD 5FK9B 3CZJA 4MA8L 5CP7B 4TUOB 3WD5L 1CXLA 4U6XA 4U2ZA 1FZOA 2DJSA 3AB0C 2YUWA 4MQSB 4GG6F 1TFHA 2J88H 3AM8C 4HW6A 4XVSH 2P5WA 3CFCH 1YECL 3BZ4B 4J3XA 3RGVA 1CICB 3GIZL 2FGWH 5HHVL 3MTRA 4P9HC 3RI5K 5J11B 3VWJA 4NJ9H 2X4RA 1LP9B 3LOWA 4HF5H 4G6JH 2J8UF 2X4SA 4OIBA 4L3EE 1MIEL 3MXVH 5D96B 4OF5A 5CEZL 5I73C 2PF6A 4XPFH 4EKXA 2HJKB 4U33A 2B8OT 1MY7A 4RGOL 1FL6A 2VN4A 3KJ6H 4MAYA 3HG1B 3WNNA 3H7BA 3GMMB 1TVBB 4JFPA 1FVCA 4HH8A 5ELIA 2YPVH 1FJ1A 4K7PH 2E9IA 2A74B 1EJOL 5GZOD 1AO7E 4TUKL 1FG2A 4FZ8H 4PGCA 1K8IA 3K4ZA 4ZNEA 2XTJC 4Z76A 4OF7A 2CKBH 4M9PA 4AEIL 1CT8A 1MCPH 3FT4B 3RWHB 1T4KB 2IFFL 1KT2A 3CK0H 8CGTA 1L0XA 3LKNA 2W60B 3P0YH 3HZMB 4HBCL 5EO1B 3WFBH 4ELMA 2DQCL 5BQ7B 5F8QC 1WGOA 1ZLSH 1TJHH 2YS4A 1G7HB 4R4ND 1L0QA 1JRHI 1H5BA 2W0PA 4PTUB 1FQ9C 1MAML 3L5HA 4KC3B 5BCAA 4NFBA 4Y19E 4I0PC 3S36L 4XP5L 4EN3C 1D3CA 3CVHH 5I74B 3QWQB 4FZEH 1BVLB 3MMEA 5IV2A 4DKFL 5EDXA 1XIWC 3QFJD 3QQNA 4K55A 1WC7A 1R3LA 4Y1AA 4FQJL 4PGBA 2V2TB 5ACMA 5DQ9B 1NBYA 2ZCHH 1B4JH 4MZ2A 1U8HA 4P99A 4LSRL 5J13C 3QIBA 4MDIB 4GQ9L 5FHBH 1UKTA 5J6GB 3LRGA 1IM3A 3CDCA 1NFDF 2D3VA 5HDBF 5JZ7D 5E6IB 3BHBA 4P4KD 1NCCL 4Z8FL 5C0RL 2V5TA 4OLUL 2HLAA 1QLEL 4QRTA 5EBLB 4E0RB 3DO7A 1Z3GH 2DM4A 4H8WH 3HLAB 1JYVA 4HKBA 2E7CA 2X42A 3MLWH 3L9RB 4JO4H 1DUZA 5E9DE 3HA0A 2OQJB 4PGDB 4L9LC 1JUFB 1YEIL 2G75A 3GJEA 3PWNA 4F37F 4HJGA 5EFIB 3LV3B 1F3DJ 5H37G 5JPMB 3QDGA 5F88A 3TZVB 1HDMA 4N0FB 1UB6A 3QDMB 2CDGB 3VE0B 3EO1A 1HQ4A 4JM4H 4UB0L 4XC1L 5BW7A 3KJ4C 4RGMC 2VKXA 5FCUL 3FOLA 3WFHA 1IL1A 2F58L 3QWOB 3MLXL 1BQLL 3BSZL 3TP4A 1FN4B 3MX0A 2ADGB 4H20H 2IAMB 3W9DB 4BQ9A 1NEUA 2H45A 2E7LC 3V7AE 3FT3A 3P4MA 4R97C 1UEMA 3MRKB 5LGJB 5I1CH 2DIAA 4YWGH 4Y0GA 1CFQA 1C7TA 4KI5E 4HGMA 1NC2A 4M6OH 4OAWB 5TQ0L 1GPOL 2F53E 2H2PC 1U93A 4XTRC 3FL7A 2X4TB 5DD3L 15C8H 4QXTA 2DLTA 4XNZB 1KIUA 5HDOA 1ED3B 2VB5A 1NSNH 2WWMD 3HB3D 2BSED 1T0PB 4IRSC 5HGAA 5B21A 4XCCL 4TSCL 3CFJB 2D03L 3HZKB 2NXYD 3O3BA 3VWKC 1E4WH 5KSBB 1GHFH 3OL2A 4F7CB 5HGDB 2VZTA 5FDWA 2H32H 5F1IA 3CFBA 4MXWH 3QI9C 5D6DA 5KZCB 3QRFM 5E5RB 5L2JB 2DLIA 1ODAA 5IW6A 1J0KA 1MQ8A 2MWCA 2DQEH 4X6CE 3ULSB 4OKDA 5IKCA 3IFNH 4IDJH 3DV4B 1DL7H 3VXQA 1KELL 5C07A 2YOCA 4GBXB 4YE4H 2AK4D 1NCUA 3GJFA 4NRXA 1BZ9B 2GJZA 5EUKA 4JREC 4GG6B 4L4VB 4GAYB 2H6PA 5D93B 5JMOC 3MJ9H 3FFCD 3O41B 1PW3A 5B38B 3T65B 3QQ3A 3FQXA 1OAUL 2ADIA 1DN0A 1JRHL 2IH3A 2B4CH 2J8UB 1G7LA 2EC9U 5KVGL 4PJGA 4J8RB 4UTBH 5JW4R 4G6AD 3G04A 5I66B 3DV6B 4KAQH 2ZP0T 2V5SA 3LIZH 1CDIA 4DCQB 3W0WB 3NVQA 1UVQA 2NXZB 4LQFH 3X3GL 2P8LB 1C5BL 2I60L 4UOJA 3FB7B 3QDJE 2NTFB 2GFBA 3PP4L 5F9OL 3QSKB 1J1PL 5F21B 5I8EA 4LLMA 4LHUA 4NNPH 1S8DB 1A9BA 1VACB 2IPTH 4FQLL 1MOEA 1I8KB 4G7YL 2G2RB 4M1DL 4TUJA 1T80A 4OB5L 3T3PF 3SCMB 1TQBC 5DUMH 2VLRB 4HZLA 2DLFH 2NY2D 3TVMA 3BMWA 2D7PA 3N1GC 3PWVA 4F80A 4XBPA 5JNYA 5E1AA 1F4AA 4Y4KB 4BUGA 4P48A 2ESVE 3AREB 3C09C 4FG6C 4XT1C 3O8XA 1IGFH 1KN2H 1AQDA 5FO9A 3BKMH 4M7LT 3X3FH 1OLLA 3OKNB 2RB8A 4NQCE 3TT1L 5DZNA 3QIUA 4F7MB 5AD0A 4HG4J 3FB6A 2YD4A 1QRNE 4OLXL 2Z31D 5GS0H 5BXFB 5F9WB 1WUNT 1JPSL 1NDMB 5T33L 3WHXA 1S7TA 1MEXH 4W4OC 1FAIL 2Y06H 5AUMB 4DKEL 5DR5H 4UIKH 3INUH 1OGAA 3JUYA 1NFDB 4IJ3C 4PTTA 3MUY1 3ZMRA 4PRHE 4W6XB 4G3YL 2IANB 3VFUA 1Z9MA 4L4TE 4XNUH 4PY8J 4UT9H 4NP4H 4HIHB 5CBAA 4OLEA 3UYPA 4RRPA 3T2NH 5EH1A 2VLMD 3IDJA 1H3GA 2XG4A 5CEXA 1X5IA 1VPOH 3M45A 3AAZA 1QHPA 1F4XH 3JV6B 1RSFA 1CR9L 4ODTL 4LFHG 4XCFH 5T5NG 1LEKA 2DJ4A 5LQBH 4NKMA 4R4FH 1M1SA 1CFTB 3D39A 3LD8B 3MV8E 3U9UB 3BKJH 4YK4B 2AGJH 5T3XE 2RQ8A 3P0VH 5A2JH 3LQZA 1UT9A 3LQAH 3T1FB 1AO7D 5DSCB 1A47A 4NPYA 3RL1A 3GB7B 4ZUTA 4ZFFB 5F97E 5A16A 4LGPB 1GZQA 1X6LA 5HHOA 2XZZA 5GSRB 2I9TA 3OXRB 3D69B 4KK5D 5I30L 2HFGL 4FXGB 4PB0L 2W65B 1R0AH 2MFNA 2ZG1A 5J6HB 3VDAA 3SJVB 2LVCA 3GGWA 5E8PA 2F54B 1ZSDB 1MRCL 1U58B 5C0CD 1V3LA 3FO0H 3ZDXF 1PX3A 1YEKH 1N2RA 1XF3B 4PJHE 5IBTH 4WW2A 3MODH 3QPQC 1U8KA 2X89D 4JB9H 1WZ1L 4Y19D 3TIDA 3T04D 1WFOA 4U1IA 4I3RL 3NH7H 3SY0B 1FNSL 5JO5B 2EYTA 3ILPB 5KS9E 4ZTOH 5GRUL 3R1GL 2V5RA 3UZVB 5DF0A 5E00B 3FTGA 1LEIB 1MNUH 4N9GB 1DCLA 3SGJC 2W9EL 3OZ9L 3RKDD 2YUZA 1LDPH 4DKDC 5ID1A 1IM9A 3CSPA 4UT6H 3ARFC 4J12A 2F15A 2MPAL 2R9HC 2Z92A 3CSGA 3PWPB 4U1NB 1KTLB 5TH2A 3DTXA 3H9SA 4M8VA 4TSAL 1U8LB 4QXWA 4AH2A 4N0UE 5I8CB 5TF1L 1Q0YH 4PRBA 4TQEH 2WIIB 4NN5C 4PJBA 5FAAA 3O0RH 4W6WB 2R2BB 4L1HA 2F8OA 1QLFB 3KYMB 1HHIA 1HQRB 1P2CA 1XF4B 1IGJA 4Q0XH 5E9DD 3QYCA 5HJ3B 1P6AB 3WNOA 3BE1H 4KQ3H 1PJ9A 1S5HA 4PRNA 3ARTA 5DRWA 2HVJA 4I77L 2FL5A 3G9AB 2GY7B 1DEEA 1QO3B 1W8NA 5KG9B 4JFDB 3AROA 2C4FT 4JFFB 3IAGC 3LEVH 2AJUL 4BUHA 5I1DB 1ADQA 2AI0L 1U3HA 2O5YL 4KMQA 2VO5A 1EO8H 1VFBA 1DEDA 4Y4HA 1PG7H 1Q9OB 5D1XC 4GRMB 1CE1L 1CLZH 1NGWA 3L3GA 5IB1A 3T77A 5FGCB 4EUPB 5TGBA 3V6OE 4LBEA 4D9RE 4MXQD 5F7UA 1U8IA 4KVNH 1T1YA 5DURB 3F12B 2R0LH 3OF6D 3PWJB 5DJYB 4HPYL 2XYCA 4LOUC 4MX7A 1DQML 5FHAH 2GK0B 1A7PH 4CN4A 2P5EE 3QFDA 4WY7H 4R90L 4EUPH 3SQBA 4LVNC 3EOTL 1B4RA 5TDOA 1A7RH 1JHTB 1QFUH 1KLUA 1MIML 4NQDA 3PJSA 2P1YA 1KJVB 4O5LH 4KI5D 4XRCB 1VHPA 1XF5A 4YDVB 1U42A 3F7PC 4OCNC 4DGVL 3MCG1 4QRRA 2ZOLB 4O58H 1TTUA 4ZS7L 4E41E 1ZV5A 4WGVB 3QEGL 2BNQA 3EYVA 3PNWA 1JF6A 4WFFD 1FZJB 4XWGL 4ODBD 3KLDA 2Q3ZA 4XPHH 4JKPL 3PL6A 5FGBC 2K1MA 3KPQB 5TDNA 1KB5L 4A6YL 2VYRE 5C0DB 5K59E 2NY6C 1YMMA 5EOQH 3T4AA 2XZCL 3S34L 3KLHD 2Z93A 1ORQA 4JAMA 3MLRH 4DN4H 4XVSL 4TVPE 3R4DA 3RPKA 1QFHA 1TMCB 2C9AA 4HG4K 4OZHA 3HC0B 5DJ2A 5KSAA 4LPUA 1EFXA 1FORH 4HULB 4XGZA 4F15C 2PW2A 1HOCA 4NJ9L 3ESVF 3ULUC 3BI9X 4WUUB 2Q8BL 4GS7B 1PZUB 1N5YL 3UJIL 4NCC1 3T0AA 5BVJB 1Z9LA 32C2A 3IFPB 3ZZ1A 4G6ML 3Q3GA 2XFXB 3OBAA 2FX9L 3QEQA 2XZQL 3RX5A 2J6EH 4R7NB 3KJ6L 4KK8C 1S7VA 3WSQH 5AAWA 2ORBL 4YBLB 5SX5H 1JPTL 3EYFA 1KXTB 5CWSB 4XNMA 4KUCD 4UIMB 4M7JH 5CSGA 3C2SA 1G6RA 4PY7B 1T5XB 1LWRA 1U8QB 1IC7L 1S7SA 1GCFA 1SQ2N 2CKBL 5T3ZE 5JIKA 2J4WH 2XN9E 1AP2A 3RA7L 4CADB 4ZO8A 5EA0L 1ZHBB 2CMRH 1EBAA 1SYVA 2GJ6E 4XPAH 4KRLB 5T1DL 5A2IH 1NGQH 3S36X 4ODWA 3S4SB 5EU6B 3KWWA 1HYSC 4LIQH 2X6MA 2VIRA 3BGAA 5CHNB 3MV01 4JJHA 3UPAA 4I0PD 3B9KD 4NGHL 1U8PB 3EDEA 2XWJA 2PYEA 4EN3D 2NY7H 4FZEL 5E8EB 5IFHL 3WS6C 3RWIA 2EXWD 4X98B 4UQ2A 1IGMH 1HH9B 3ARSA 3EYQC 5T1KA 2N7BA 1ZWIA 3W5NA 4S11A 3ES6B 1KPRA 1TPXC 1TTGA 3H0TB 5CKAA 5IB5A 1X5HA 5DK3A 3TPUA 1CXKA 1X7QA 2JB6A 4WNQA 2VQUA 3QG7H 3QO1B 1AQKH 1AGBA 3PHOA 4Z7NF 4G7VL 1LO4L 1HINL 2NY4C 5JUEH 3EFFB 3Q5OA 1I1AC 5EZIH 1QRND 2C7UB 5CJ8A 1J0IA 4H8WL 1IAIM 2PO6B 3DVIA 3TA3C 4P2CG 1MJ8L 2VABA 5T1MB 5DHVH 3TYFB 4I5BB 5I76A 3BGFC 1FV1A 2Q87A 3BP6A 3VXUA 1G1CA 2J1KA 5I15H 4PRHD 2EDLA 3UTTB 1CTNA 3OGCB 1CS6A 4L4TD 1BGXL 4RGNB 1WJ3A 1BD2A 1PBYA 2JJTA 1RJZB 5EC2A 4X80L 4ODSL 4QO1A 2BVUA 5IVOA 5H2BB 3JV4A 4MS8C 4Z0XA 5LBSL 3VXTA 2QSTA 4R3SB 1LNUA 5FM5M 1S7RA 3U0TA 4AIZB 4FN0A 1MPAH 4QWWC 1TJGL 3VD4A 4YGVA 3IT8D 1UC6A 4LASH 4IMLA 1MI5A 4H20L 3N9GH 3QJFA 3DHMA 3STZB 3ARUA 3QUXB 1XCQA 2Z4QB 3LPFA 5B8CC 2OTWB 2VDPH 3SHSA 3D25B 4EDWL 3JWOL 2VXVL 3RU8L 2OL3L 3PXHA 2HKFH 4AEHH 1YQVH 4HC1A 4I48A 7CGTA 5C0AE 4DQOL 3EYOA 2H2PD 2B0SL 3FFDA 4XTRD 1H3UA 5SX5K 4LGSB 4PRIA 1SEQL 2ZNXA 3ZDZF 5MEQA 4NYLB 3MRJB 4IM8A 4C59B 1DZBA 3MRMA 1CK0L 2CRIA 2OLDA 4IRSD 5DYOB 4MDJB 4PJFF 5J06A 1E4WL 4Y2DA 1RURL 5FV1L 2VLJB 4X4ME 4YPGA 5T1LD 3OAZH 4F7TB 3KXFA 2RFXA 1FZKA 1J0YA 4MXWL 3S96A 1SMOA 4HIIA 3QUZD 3MOBL 2NR6D 1AKJA 1WITA 3QI9D 4KHTH 5D71L 4GRWF 3KPSA 5BZDA 1ZGLB 1UB5A 4Z7UE 1EUUA 1L9NA 4NQEE 2ADJA 1TCRA 4C56A 4Z78B 1D9KB 3NFNB 1I9JH 5D7LB 1DQQA 4RDQG 1BP3B 3LS5H 1HNFA 1LD9B 4HHAA 5DQJB 1CI5A 4HUVB 4KMTL 4WHCA 2ZJSH 3HNSL 4M6NH 4LGRB 2HT3C 4LHUG 5TE4H 5DEFA 1P7KB 3HE6B 4KKLC 2GTZB 2JIXD 3IDUA 2EYSA 4RMRA 3MJ9L 2FJHB 2F19L 2JE8A 3I6KB 3VXMA 4KDVA 2A6JA 3X12B 5F8RC 4AM0B 3TBYA 1AD9A 2WIMA 3FQWB 5DK2A 1L6XA 3IAQA 2DQTL 3HE7C 2YPLA 2X1PA 3NACH 3HS0A 4JM2F 4PV8B 1MCQA 4KAQL 3AGVA 2NMSA 3I6GB 2ZG2A 1KIQB 5L8JB 5GRVL 2A2QT 5DMKA 5F7DB 5D4QA 4EIGB 1NBVL 3RDTA 4PJ9A 2CLRB 3KPMB 3OJVC 1TETL 3D85A 5HGHB 2FJFB 1E4XH 3ZT7A 4N1CA 4W68A 1MCIA 1II4E 3GMQB 2EE6A 1MVUB 3ISWA 4S0SD 2RGSA 1NCDH 1AGEB 2DWEA 4XC3H 1CZ8H 4G8FB 3WCYA 3S9DB 4M6ML 2W9DH 5KTEL 2UV3A 3RBSA 3BKCL 3K8LA 4WV1C 5HHQA 4OIIL 1U2HA 3K1KC 4XX1G 3OKMB 4OGXH 1G9MH 3RUGE 2IADB 5DJZB 4FFYH 4G8GB 1HIMH 2DBLL 3IDIA 2SEBA 5FKPA 2EXYD 2FB4H 1UJ3B 4RQQB 2E27H 1RK1B 4JCMA 4XWOC 4L8BA 1MJJB 1W72B 5L0QC 1F42A 3HFML 4RRPG 5KOMC 4O4YH 4LLYA 4AY0A 2PYFB 4HFWA 1S9YB 2GITB 3BH9A 1DE4A 2IH1A 5E7FA 4OD3L 5CP7A 4TUOA 4FG6D 2YD5A 3RIAF 1MFAH 1I8LA 1W72H 4WI3A 5TFSH 5DD1L 2HFFB 5D2LF 3F58L 3T3MF 3UYRH 3JVGA 4M7KH 4LNRB 4M7ZC 3BZ4A 3WMSA 4LSVH 1LILA 1N6QL 4LQ1A 4QTIH 3GRWL 1YEFH 5DJCB 3O2WH 1MEXL 1N4XH 3LKOB 5DR5L 1LP9A 2KDGA 3NGBB 1CQKA 4X9BA 4PJIA 2P7TB 1ZVYA 4GLRH 1NJ9A 5HSFA 3GSVA 4G6KH 4BH7B 4NZTH 4BSWB 1BMGA 3S7GA 4WCYH 3DSNA 1JWSB 4NP4L 2HJKA 4Q6YA 3ARBC 3VFMB 1JYNA 1JNHB 3T2NL 4FFZL 5AZEL 1CDGA 2X4OB 4R8WL 3VFNB 1ZHKB 4HK3J 3TT3H 1RU9H 3HG1A 4LPVA 2DQIL 3GMMA 1TVBA 3OAZK 4V1DB 1UH3A 4RISL 1KENL 1KLFA 2RJMA 3MNWB 5FGSA 1K5NB 2OR8A 4Z95L 4R4FL 5E2VH 3WFCL 3BKJL 1VDGA 3MRDA 1O7SA 1WCBB 5DMIH 5I1JL 1LO2H 1MCJA 3FT4A 5C70A 1KGCE 4JFOB 1Q9WB 2ICES 5EU4B 3RWHA 3DURA 4CNIA 3U36A 5HI4C 1G0YR 2W60A 3BQUB 3GZKA 3HZMA 3V95A 3REWB 3IGAA 5CJQL 4LSQH 1BM3L 5HHPB 4MGXA 4AQOA 3CVHA 2GJ6D 5F7NC 5EO9B 3ALWA 3BEVB 4C58B 3LKPB 4QGYA 5EIIB 3CMOL 1WAAF 2ZG3A 2NPLX 1INQB 1YEKL 2QV2A 3WYRA 3FB8B 1UKSA 2X4PB 4MNGE 5J3HC 5C09E 2C26A 2R0ZH 4XMKH 1YDPA 1K4DB 1VFAB 1DBAL 5JORB 1BVLA 3SDCB 2W59A 4X0KB 3C8KB 3A67L 1OAYL 4ZTOL 2CPCA 4K8RC 1D7FA 3BYTA 1NH6A 5E2WH 2V2TA 3E0GA 5DQ9A 1XR8B 4RAUB 4D3CL 1MNUL 2EH7L 4I8DA 4UOW0 2FNBA 1ULVA 4MDIA 1LDPL 2JJSC 5J6GA 2KBGA 1A4JB 1PKOA 5E6IA 4WEBL 3ARFD 1EV2E 5ID0B 5C0NC 3D18B 1MFEH 3EIFA 5EBLA 4GXUM 1UWEH 3KPRD 1RIHH 5KBNC 4E0RA 2NY3D 2ADFH 1TXKA 4MVBC 4EBQH 3HLAA 4Y8AA 5EBMB 5D8JH 3DVGA 4I9WE 3L9RA 3GSUB 4GRWB 3BPCB 1C8PA 4I0CC 4F58L 4JFEB 2OQJA 1ZLWH 4BFEA 4PGDA 2R15A 1JUFA 3LCYA 2N4IA 3HC3H 4Q0XL 5KN5B 5FYKH 2P43B 1H0DB 3LV3A 5JPMA 4OI8A 5ANMA 4N0FA 3QULB 2CDGA 3PDDA 5CEYA 3VE0A 4MNQE 4YPJA 1MH5B 3MRPB 4YFEA 1K4CB 5HYQB 4WDIB 1JNJA 3U2SA 2G60H 3MRIB 4PJDE 2QHRL 2VDMH 1WVZA 3NIDE 3WXVH 4N8VA 2OJEB 4IRJB 5I1GH 4TNWF 3QWOA 3PWUB 1JPGA 4QOKE 2YMXH 4P2OD 5D1XD 1FN4A 1NAKH 5E2UL 2IAMA 3W9DA 1NKRA 1QOKA 3VXOB 4FNLH 2B1AH 4CRPA 4YC2B 4RFOH 5LGJA 4JM2B 1FIEA 1KCSH 4JZNA 4K3EH 2Z91B 4WY7L 3CMGA 4GO6B 3WL9A 3TO4C 1RUMH 3MO1B 3I3BA 5I1IH 1FNAA 2H8PA 1TZHB 4URTB 4OAWA 1CXFA 3FZUC 3TJHC 2JF1A 1RFDH 4YZFF 1A7BA 3BIKB 2GY5A 2D7NA 1RUAH 4X6DE 4O58L 5C0AD 3FQNB 5EZJB 1I7RB 1OTTC 5EN2B 4ZOEA 1ED3A 2PW1B 3U7WH 5B39A 4QXUH 3K0WA 2D7TL 5HVHB 5F3BB 4LCWD 3ETBF 3GSNL 3CFJA 5C0EB 2EH8H 4RFNB 2APVA 2BSRA 3HZKA 4HK3N 5EOQL 1UM5L 5KSBA 2NY6D 3VGGA 4F7CA 5HGDA 3IAPA 4YHLH 2JLLA 4L8SA 1F02I 5DD0L 1SVCP 1EHXA 5CCKL 3REVB 5IESL 5L2JA 4Q6IC 1I3UA 1AHWB 2C1OB 1I1FB 1P1ZB 1V7ML 2EDDA 4PGEB 3ULSA 1RZIB 4YDKH 3DV4A 4L5FL 1DVFD 4FOMA 12E8H 1FORL 2F8XC 3ZHDA 4CN1A 3MUHL 1HYRC 4GBXA 1T04B 1PAMA 5EZLA 4KK6C 1BZ9A 3B9DA 5D2LB 2YRLA 3ULUD 1RIVH 2BX5A 4GG6A 4LVOB 3SE9H 3EZJB 2P8PA 4GAYA 3CLEH 4J3OC 4OGZA 3MCLH 1MSPA 3CFIC 3MV7E 3ESUF 5B38A 1BZ7B 4PLJD 5HHNB 3T65A 3IDYC 3MGOB 4X7TB 4AMKH 4HIJB 5E99H 1ZT4B 3WSQL 5DJ0B 3RY6C 2J8UA 4ODHH 4QTHB 1U8MB 4Z7WF 4J8RA 2YA0A 2V9TA 5C9KA 3RQ3A 5I66A 3DV6A 2ILLA 3WNKA 2H1PL 4P9HL 4DCQA 2APFA 4RMSA 4YUEH 3W0WA 1U8OB 5IHUH 1MJUH 4UTAH 4HXAL 2P8LA 1QSED 2OMNA 1AXSB 4MD5B 5GS1C 3FB7A 1T1ZA 5GIRA 3MLSL 5GRZA 5F7KC 2RHEA 3N50A 1YEEL 1ZLWK 3OB0H 4XPAL 1H15B 2OTUB 1VACA 1NGQL 3ARGA 5IB4A 2UZYB 5C3TA 2R2CA 5IK3B 4M48H 4EI5C 1I8KA 4YR6B 2G2RA 2Y9RT 4LLAA 1CGXA 1J8HE 1CXEA 1AC0A 1HYSD 3SCMA 5D5ME 3RGHA 3PGFH 2EIEA 1A1OB 3BO8B 4P4KB 2NY7L 3DJ9A 2GQHA 5KANG 1ZANH 1NBQA 4LU5H 1IGML 4ZXBD 4Y4KA 4X6FA 1E4XI 4Y4FC 2M2DA 2R69H 3AREA 2YD7A 1RJYB 3UPRA 4ZAKD 3UBXI 3OKNA 4HPOH 1G0XA 5LGKA 1ES0B 3S37L 1FVEB 3DX9B 5FDYA 4FMKA 4KTEH 3LSOB 4NCDA 3O6KH 3AC0A 3N1FC 5BXFA 3VI3E 1QBAA 3QUMB 3TESA 1NDMA 2NY4D 3VA6A 5CD5D 2WUCL 2Y36L 3PG2A 2WANA 1I1AD 1CFBA 3ZT5A 1KFAH 4YDIH 5GGVL 4U6VH 3TA3D 5AUMA 2LU4A 3RGVC 1VADB 1NFDA 4U1JB 1FFPB 4H26B 2HRLA 3QUMH 3T0DA 2IANA 2DN7A 3VWJC 5I15L 1T6WA 4HIHA 1HEZB 1IC4H 2UZXB 2ED8A 2BOCB 3UTSA 2R4RH 5L2KE 2QQKH 3SE8H 5DJXB 3GIVB 1U36A 3JV6A 4MSWA 1LO3L 5K9JL 2GI7A 1VSCA 3RNQB 1KCRH 4MS8D 4MAYC 4L3CB 4X7SL 5CUSL 3U9UA 3WHE0 3DETC 1IGIH 5EOCJ 4N0CC 4KJQD 3HI6H 3KPNB 3T1FA 5DSCA 3BGMB 1PKQB 4ZFFA 3GB7A 3NCYS 2FD6H 3UCRA 3EDJA 4GAFB 4HGKC 2Y1VA 2R23A 3QAZB 1N7ML 2XWBB 5GSRA 3SDDD 3OXRA 1KGCD 4BFBD 5J1TC 2FHCA 4APQC 3RIAK 1PDKA 3CUPB 4FXGA 4BFGA 2W65A 5J6HA 3SJVA 5FKAB 2HKFL 4AENB 2CXGA 1MUJA 4ZOBA 2A6DB 2X2YA 4NQUA 1U58A 5GISH 5JW4M 2A9NL 3NCBB 1XF3A 5D70L 2FR4A 4KKCC 2QEJA 1S7QB 4CMMA 1H5BC 3LKRB 4JG0H 3ULVC 4MJID 1NGPH 1KJ3H 3ILPA 1HKLL 1U6AL 4QT5A 2FX8H 1AXTL 3CLFH 4UAOC 2AK4B 5E00A 3IDGB 4N9GA 3Q6GH 4LSPH 4U31A 3MV9D 4YIQB 4JFQB 1T1XB 1FNGB 3IRZA 5DFVC 4NQXA 1EO7A 5C0JA 3OB0K 3QIBC 4N0YH 2W07A 4U1NA 1KTLA 3U82B 4HEME 4POYA 1U8LA 5CS7A 5EOCH 4FFWC 5HBBA 5I8CA 5DWUL 3RNKB 2KQMA 4QF1A 4CBPA 1JNNH 2VSCA 4M6NL 4BQ8A 2GT9B 2OI9B 2VDLL 1OQXA 2WIIA 2HT3D 4JGUA 4P2RD 4KKLD 4PUBL 3QQ4A 2R2BA 1QLFA 2BSSB 3KYMA 1HQRA 2FZ3B 1XF4A 3KYNA 5CZXC 5HJ3A 3TV3L 3MNVB 2NY0C 4KI5F 4D94A 1QO3A 5KG9A 4JFDA 5D1ZB 4JFFA 4OSUH 2YD3A 5I1DA 1XGUA 3IETB 3MV11 3HE7D 1BECA 2DOCA 3NACL 4NBXB 3NIFE 2E9BA 4HIEB 4ONGH 2NCMA 2OP4L 3V6ZB 3ARDC 3QNYB 2V7HB 1A3QA 4EUPA 3CIQA 3QWRD 2V5YA 3R06A 5BW7C 4NM8H 5C08B 4ZFGH 1E4XL 4LMQE 2EDOA 1UENA 4D8PB 3F12A 3MRHB 4QOKD 3PWJA 5DJYA 4C4KT 4DGYH 2L7UA 4Z7WB 4XCYB 2JELL 2GK0A 3WDIA 2W9DL 4NRYB 1AR1D 4P3DB 3L5XL 1XGTB 3P77B 1A6PA 5DLML 2Q3AA 3VD3A 1PQZB 1HXYB 1RAMA 1FL5B 1KJVA 4X6CF 1BBDL 4XVUC 4XRCA 3Q1SH 4YDVA 1A7OL 2FB4L 1AFVH 1B88A 5D1QD 4XNXH 2E27L 4JKKA 4P57B 4QRUB 4OM1L 4JZOA 4I13B 2ZOLA 3QO0B 3DXAD 4WU7B 2B5IB 2Z31B 3QDME 4XWOD 4Y5YA 3S88H 3ZTNL 4H88H 4M5ZL 3MJ6A 3T0EA 2B7DT 3KPQA 4O9HH 3IJHB 3WKMH 3MLPA 3BPOC 4WW1B 2ZSVB 4K3DH 4KUCF 4ORGB 4M02A 1YMHB 4N8PA 4L3EB 3V4UL 2APBA 1IT9H 1MELA 4LSVL 3HPJB 5GJTH 5JQ6H 3HC0A 1RUQL 5D6DC 1SJHA 3SE3A 4KXZI 3MROA 3O2WL 4XZUA 1Q1JH 3AS0A 1LGVA 4WUUA 5IGXH 2J6EA 3WJJA 1FSKC 1MFBL 3KNBB 5H37H 4G6KL 3K2UL 5BVJA 3C9NA 3IFPA 4WVRA 4L4JA 2JB5L 1ZOXA 1AO7B 4OCRL 1AXIB 5J9PB 5L9DH 4DOHE 3ARBD 1S78D 1WV7T 5I19L 4R7NA 2RCSH 3TT3L 4HZAA 3MV7D 1LK2B 7FABL 3S97C 4OD1L 1I1CA 4OF6A 3QXUA 4N8CH 5JHDE 3AMKA 2R2HB 5CWSA 4PJCE 4UIMA 4NZUH 5TQ2H 4PY7A 2DKUA 4O51B 5E08H 4X4YB 1BQSA 2HWZL 3B8YA 3NABH 5C0CB 3RJQB 4JGMA 5IBUB 1ZVHA 2QKIB 4TTDD 5HYFA 4ZNEE 1MRDH 4Y19B 1OGTB 4CADA 4NHUB 3WE6A 4K3JL 1ZHBA 4XBEL 4LK4A 1RZGB 3UMTA 3Q6FB 1C7SA 2VXQH 2CJUH 4Y16A 5HI4D 1SY6H 2P4AB 1YNKH 4GW5B 5DHYB 5HHMD 4YNYB 3L7FA 4L4VE 1A6VL 4ONHA 3ZE0E 1YZZA 4OZIE 1T2QH 2ICWJ 1ZHNB 2DD8H 5CHNA 4JFHD 3SO3C 3LEYH 1SYSB 3HR5B 1J8HD 3HCVB 6CGTA 1U8PA 3EFDH 4JFZL 5E8EA 2ZUTA 3EYUL 1S9KC 3V52L 4X98A 3OKKA 1HH9A 4OQ1A 1MCOL 5MEPA 5E2WL 3ES6A 5SWZA 2A73B 3TVMC 1CU4H 4I2XE 4X9HA 3H0TA 5DA0B 2C1PB 3NFPA 2C3VA 3N85L 5GGRB 4OLZH 4L8DB 5BJTB 3L95B 1J0HA 3O8XC 1N0LA 3VMOA 4EZMA 4OJFH 4Z18A 2UWEA 5E9DB 1P9MA 2OK0L 5FYLH 3DARA 3OV6A 1YEDB 1O5DT 3W9EA 1MFEL 5IFJB 1BOYA 3EFFA 5C0ND 1UWEL 1X5XA 1WZMA 4LLQA 3QIUC 3GHBH 1ITBB 2C7UA 4LKCB 2ADFL 4FQ1H 4K9EC 2PO6A 3QQ9C 4MVBD 3B9AA 3GSXB 2NW2B 5FM4A 4OLWH 5KSUB 4WO4B 3TJEH 4K8RH 3TYFA 4X9FA 5FO8A 4AG4H 2VLRE 2R56L 3HC3L 4O00A 5F7EH 3VFWB 5FYKL 5IFAH 1MCLA 2YPKB 3UTTA 4P5TD 3MA7B 1OP3K 4CKVX 3CU7A 1GYAA 1RK0B 1KOAA 1N6UA 1PD6A 1RJZA 4ZTPH 1NLBH 3SPVB 4K94H 4D0DA 4PJHF 4TTGA 5CILL 2G60L 3JWDC 1RUKH 4YHIB 2APTA 5FYJU 5KS9F 3N06B 4YQXL 3STZA 4I3SL 2F53B 1MLCB 2Z4QA 3OKYA 1TNMA 2APXA 5HY9A 2CIIB 4N90E 2OTWA 4MD4B 3D25A 3MACH 4K3EL 4P3WA 2R29L 4GOSA 1RUML 2E9JA 5I1IL 1REIA 3TO4D 5TE7L 5F1KC 2AK1H 3NCCB 1NCWH 5CGTA 2EDTA 4RWYH 1K6QH 4WFHE 2YKLH 4GAJH 1FRGH 3KYKH 5D6CB 3VXSE 1OAXH 3QCUL 3WFZA 1IARB 2EDJA 3UZQA 4AYFA 1BLNB 2PCPB 5B38G 4UNTA 1OTTD 3CD4A 3V5DB 1ZAGA 3U7WL 4JN1H 2VR9A 4OCXH 4X6CB 4XPTH 2FLRT 1AE6H 3AS3A 5DYOA 4OQTH 3U46B 2EZ0D 4MDJA 1X4XA 1FZMB 5A3IC 5ITFB 4MA3B 5F6IC 4X7FC 4F7TA 1JL8A 1M71B 1RZJH 5JPNB 5FB8B 1ZGLA 1U2CA 4UQ3B 4FABL 4BYHA 4YDKL 4P3CL 3H9HB 3W2DL 3ZKXC 12E8L 4Z78A 1D9KA 2A6KB 3NFNA 5DVMA 5D7LA 3FOMA 3HN3A 3LH2L 2OJZH 3I9GL 3CFDA 5DQJA 4HUVA 1RI8A 3F6LA 4KK6D 4OUOA 1P7KA 3HE6A 2F54E 2GTZA 3JV5A 3SE9L 4AIOA 3BDYL 4GAGH 4ZFOB 2R0KL 3NCJH 5FUZH 3TH2T 2FJHA 1TTFA 3EOAB 3I6KA 1KJMB 1G7PB 3X12A 5EB9A 2OZ4L 5FUOH 4AM0A 4AMKL 2R0WH 5E99L 3EJZC 5I0ZA 4JPKL 1I1RA 5IVZB 5JHLL 4ERSH 3QDAA 5C2BH 5KVEH 2HVKB 4FFVC 4PV8A 4HAGA 1NGYB 1Q94B 3I6GA 5F7DA 1E27B 5IHUL 2RAMA 4X4ZA 3ULUL 1CIDA 2VLKE 1F8TL 1MJUL 1IRAY 2Q8AH 3U48A 4I0PB 5CIPB 1U3HC 3KPMA 2VKWA 3KLSA 3B9KB 1EH9A 2FJFA 3PWPE 5K59F 1A22B 1YEHH 4Y4HC 3GMQA 1MVUA 1AGEA 1E28A 1OF2B 4OZ4B 2AABH 4JDVB 2YHGA 3MC0A 4RX4D 3OKMA 1QPPA 2JK5B 2IADA 5FUCC 2ESVB 5DJZA 4G8GA 1B0RB 4NRZB 1DUYB 4EI5D 4X99B 4OCMC 5J13B 5I1KL 4JZJA 2FX7H 3PGFL 1UJ3A 4RQQA 3TH4T 2EDRA 2MQCA 1A9EB 3VG0H 4JRWA 2HT2C 2P8MB 4NQCB 4HJ0D 1HNGA 3DVFA 1GGUA 1W72A 1YY8B 1ZANL 4KWUA 5E4EC 5FGRA 4XP6H 1BFTA 3SKOB 4GMSL 3E6FB 1S9YA 4M43L 1QRNB 4HUNB 4Y4FD 2VXSH 4XNYL 3S37X 1NC4A 4U0RC 1H3XA 3GKWH 1MAJA 2AJVL 1FFNB 1WBZB 2OTPA 5I18H 4LAJH 2HFFA 1IC1A 25C8H 3PL6C 5FGCE 2DQDH 3FB5A 2OBGA 3V4PH 1RMFH 3RP1A 4PRHB 3O2DH 4LNRA 1WWBX 1QKZH 4YHOH 4ZUVB 5IB2B 1EO5A 1VB9A 4L4TB 4M62H 4LCYB 5CBEB 4Q2ZB 2BRQA 4FQIH 1FGNL 3MRFB 1BAFL 4HWBA 2Y5TB 1WEJL 5DJCA 1VENA 4KJWC 5SWSE 4YDIL 2XQBL 4OCWL 5CEZE 3KPOB 5KSAC 2ZNWA 1G9NH 1XGRB 1BF2A 3P9LB 4BH7A 5MENA 2A77H 3KJ4B 4D0BB 1OGAE 4KHXL 4MJ6B 1JWSA 4OT1H 2DMCA 3VWJD 1A5FH 3MV8B 4G5ZH 1IC4L 3VFMA 2WBKA 1JGDB 2FIRT 3GSQB 2X4OA 1MHPL 3VFNA 1ZHKA 4TPRH 1QR4A 1RJLA 4JLRB 3WXWH 3L3OB 1CN4A 1EZVX 4NM4H 3BD5A 4V1DA 1SJEA 4Z7VA 3IU4H 4YHZH 3MNWA 5LXGH 4CDGC 2V9RA 2HTLC 5EORH 4JDTL 3HNVH 5I1EL 5C6TL 2C3XA 3OAUH 4MAYD 5DI8B 5T3XH 1IGIL 3VFSB 5JHDD 3DETD 1UYWH 2XZAL 1WCBA 4MYWB 1T3FB 3WNLA 1ZTXH 2ZOKB 5ADOL 3MLVH 4XPGH 3VXRE 4ELKB 5GRXG 4OGYL 1YQ2A 1H3PL 1Q9WA 5I0DA 5EU4A 4PJHB 2DQUL 3I6LE 5DC0A 1SM3H 1OAKH 2Z8WC 3BQUA 1G1YA 2V17L 3REWA 1GOFA 4K07A 5GJSH 4HMEA 4I3GA 3P4OA 3NCFB 1RVFH 2DS4A 2WQ8A 3BEVA 5EO9A 4APQD 5JXEA 4DW2L 5KS9B 3LKPA 4C54A 4G42A 3OKOB 4M1GH 1R3IL 2Y5EA 5T1LB 2VH5L 5JA9A 1INDH 3G6AB 1I7TB 4PP1C 3TPKA 1NGZA 5ALBH 2X4PA 3QUZB 1K4DA 3BZFB 5KAQG 3UPCA 5JORA 3NA9L 3SDCA 1NGPL 3ARWA 2W1NA 3ULVD 1KJ3L 5ENWB 3C8KA 2B1HH 3FO1B 1WBYB 1HWHB 4RAUA 4NWTH 3VDBA 1EX0A 1I1YA 5ESQB 1C5CL 2GSGA 4JGJA 4N0UB 2GSIB 2JIXB 4S1RH 2FBJL 4LLUA 3DUUB 1A7QH 1IQWH 4Y1AD 2L0DA 1R5VB 4TOYH 5DFVD 4EUPG 5I9QC 2QQLH 3D18A 4P2YA 2ENYA 3UBXB 3T0WA 2BRRH 1OY3B 3I84A 2BNRA 2Z0BA 5FO7A 5EOCL 4JKWA 1WISA 1BEYH 5EBMA 5T5FH 3HZYA 4G8IB 5EU6E 3GSUA 3BPCA 4JFEA 2EE9A 1NEZB 4EXKA 4R2GC 2Y07H 3QBTB 4U2YA 5LWYH 4DZBB 3GMNB 5KN5A 3GSRA 4U7MA 1WZLA 3SBWA 2ARJB 5CZXD 2NY0D 2F9BT 3LN4B 5C6WH 4K71B 2E6PA 1MH5A 3MRPA 2PR4L 3ZDXE 4HKZB 1K4CA 5HYQA 4WDIA 2EO1A 3MRIA 2JJTC 1ORSB 2VC2H 2P5EB 4DFIA 1AI1H 3DMMD 4IRJA 3V4VH 3ARDD 3PWUA 2D4DA 4NN6B 5A2LH 2IF7A 2IALB 4XP1H 4OZGE 2D0HA 2MMXA 1X5YA 5JOFB 3JTSA 3CC5B 3R0NA 3H3PL 5MI0C 4OBSA 1RD6A 1W0VB 2EO9A 4LKXA 4K23H 2ICWI 1QP1A 4ODUB 3MO1A 2Q7YB 1TZHA 2K3TA 5D7SH 4Z7UF 3STBA 1GC1H 5E5MA 2LU7A 1AGFB 4EEEA 3K74B 4XVUD 3BIKA 1U91B 5IVXE 3ULUF 1OSPL 4H0HB 4WFHD 5I17B 2X9WA 3FQNA 4QRPE 4RGNE 1E6OL 5EZJA 1LE5A 5EWIH 5CGYC 1I7RA 5HI3C 5EN2A 1NC2D 4RAVB 1NMAL 3VXSD 3L6FB 2PW1A 3EW3B 1T7WA 5FOJA 5F96H 4O9HL 4MQ7B 4GT7A 3U4EA 1UA6L 3FRPA 2CDEB 3IFLL 4JQIH 3HI5H 2VN7A 5CD3B 4Y5XC 4OTXL 3V5KB 4IJ3B 5GGTH 1T7VA 4LRIC 3VRJB 3H42L 4K3DL 3REVA 4M5YL 4TVPH 1GIGH 4F33B 5AEAA 1AHWA 2MKLC 5GSVB 2WW8A 1P1ZA 4Y2DC 4PGEA 5GXBB 4NKDB 1IT9L 4Q9RL 1RZIA 2NY5C 5GJTL 2ITCB 1T0NB 4HQQL 3MLTB 4NNYB 5IQ7L 4KRPC 4OM0H 1UWGH 3GM0A 2D9CA 1JV5B 4RWHA 3WO4B 2HT4D 1T04A 3BIAX 1P7HL 1FYTE 3I3EA 5D2LA 2AJ3A 1L7IL 4QHUA 3S4SG 1B0GB 5C07D 4LAQL 5JOEA 3THML 2BHYA 3H9ZA 1DP0A 5L9DL 1BZ7A 1NDGA 5HHNA 1QSFE 2QADC 3MGOA 4X7TA 2RCSL 4UDUB 3RUGF 1KJ2L 5BOZG 2XN9B 1ZT4A 3F8UB 5CP3H 1AJ7H 4F8QA 3CNKA 1JHKH 4KJPC 4QTHA 2P42B 5ESAB 1U8MA 3NZ8A 3SKJH 2GJ6B 2OS7A 2VLJE 4NZUL 5TQ2L 9CGTA 2WLZA 5T3ZH 3NABL 1U8OA 1D5IL 2FSEB 3QJHA 5IMOA 43C9B 2W9LA 3T0VA 1MRDL 1AXSA 4MD5A 3AS1A 2BHZA 2ZPKH 3RDTC 5LGHH 4MNHB 4N9OB 4PJ9C 2CJUL 2WZPD 5JDSB 3KG5A 2N1KA 2BY3A 4JVWA 5FA3A 1R24B 5IK3A 2IPUG 1Q72H 1CLOH 4YR6A 1T2QL 4X7DC 4NQSB 1DBJL 4B41A 4QLRA 4C83B 1GGIH 1FE8L 5I1LB 1A1OA 2X10A 4JG1L 1MF2L 2AKRB 5E03A 3ARFB 3BO8A 4P4KA 5DUPH 4L8CA 5DVNA 2XPGB 5HXMA 3FO9A 4JKLA 4F9LA 1JYWA 3KPRB 4FXKB 1DLHB 1ZHLB 3CVIH 3PP3H 4PBVC 4XAKD 5E8DH 2NY3B 4KPHH 5I1AB 4KH2A 1WAAA 2IG2H 2D7OA 4NFDA 4YDJB 3MYJB 3TVMD 3E6HB 4OLZL 5ISZA 3JTTB 3OR6A 1JPST 1ES0A 1KNOB 4NN5B 3DX9A 2DI9A 1CLYH 2Q7NA 3O8XD 1IFHL 1YUHB 3RWJB 1I8LC 4POUB 4P46D 3SE4A 3R0MA 3QUMA 1BVKB 3GHBL 3LKQB 4HLJA 4M8QA 3GFUA 1G7JB 3QIUD 5LG1A 4JANB 1Q0XL 3JVGC 4QHKI 2HFEB 1JNLL 5FM5O 5L6YL 1VADA 2IQAB 2VUYA 5SWSD 1FFPA 1HKFA 4H26A 4K8RL 3VMPA 5J11C 1G7QA 1RZ8B 2D2OA 4AG4L 2D0FA 4MAUL 3AVEA 5D1XB 4P2OB 2BOCA 5E7BA 1OGAD 1F6FB 4JHAH 3V7MA 5BVPL 5D96C 1NLBL 1E6JH 2NLJB 3GIVA 5DJXA 4DWHA 3U7YL 4YBQC 3PIQB 1DFBH 1TVHB 4PRPE 1VEMA 2BC4B 1CD1B 1RHHB 3RNQA 2CSPA 4MA7L 4YHNB 1DANT 4LVNB 4L3CA 4DVRH 1HI6B 3VI4E 4GKNB 1JZ4A 1PKQA 1C1EL 2HJFB 5C0AB 4GG8B 3D39D 1A6UL 2DQFB 4MMZC 1C12B 3VXRD 1CGWA 2XWBA 4NBZB 4H0GA 2LQRA 3I6LD 2GCYA 1N6VA 4LCWB 3HR6A 1X6NA 1U3YA 2DQJL 3DBXB 5FKAA 2NY6B 4YDLC 2A6DA 5EOTA 4RWYL 3PGCB 2E7BA 5TE6H 1FRGL 1J1XH 4I1NB 2AQ1A 4I4WB 1HHJA 2DB8A 2ZUQC 3LKRA 1KCKA 3VJ6B 4J1UB 3QPXH 4OI9A 4ZD3H 1YC8A 3DGGB 1DVFB 5DJ8B 4R9HA 3EDDA 4RAHA 4Z7UB 4NQEB 1EK3A 2FLBT 2AK4A 1JGUL 4E42B 4EXPX 3CXDL 3IDGA 3C87A 4TRPH 3ORJA 2VZVA 8FABB 4JRYE 4YIQA 3ZT6A 4JFQA 4NKQB 5A3ID 1T1XA 1UG9A 5ICZB 2DI7A 3O3UN 4OZFB 3LDBC 2AJZB 2O5XH 4XP4H 1IGCH 4NHCH 2HMID 4QXGH 1M7XA 4EDXB 3NIDF 5E6IC 4MB3A 5E94B 4X6BB 3RNKA 2GUOA 3WLWD 5KJRH 2GT9A 1DSFH 1EHAA 4XPBH 3S98A 4NC1E 3D3VA 2BSSA 3BVNB 2AXJA 3KR3L 3PP3K 2FZ3A 5JIPA 2FYYB 3UTPD 3U9PH 1DDHB 3ZKMC 3HMXA 3MNVA 1QSEB 3MREA 3MGAA 2R0WL 4Q9QL 1LO0L 3SGDI 5D1ZA 1BQHB 3EJZD 5ITBH 1F11A 5EU7E 3IETA 3B83A 1TZGL 4HIEA 4X6DF 1JP5A 3V6ZA 3QNYA 2V7HA 2YD6A 3GK8L 3MLYH 1J1OH 4G9FE 5EZOL 3RUGB 3DSFH 2HJLB 5C08A 5BO1L 1U3HD 1YEHL 4D8PA 3MRHA 4JO3H 3IU3A 4Z7WA 4UINH 4PJFE 1HHKB 1J87A 2CK0L 4ZXBB 1V3KA 5FCSH 4P3DA 1F90H 3KS0J 4OFYA 4ZAKB 35C8H 1IILE 5JW3H 1PQZA 1HXYA 1CGSH 2YRZA 1ACYH 4JO2L 4NUJB 2OX5A 3SDYH 4WTWA 2DWDB 4P57A 3VG0L 3QO0A 4WU7A 2VUOA 4LSSH 5D7IE 4NQDD 2HT2D 2Z31A 4UV7L 2VWEC 3CH8A 2NY4B 4LNVA 4WI5A 5JLZA 2DF3A 4LARL 1ADQH 3PWLB 1I1AB 2NY1C 4UT7L 3O2VL 1VGKB 4XNZC 1PFCA 1J0ZA 3TA3B 3IJHA 4M7LL 3RL2A 2GYSA 4F3FA 2BNQD 4Z77A 25C8L 2ZSVA 1T20B 2DQDL 3OR7B 2LABA 3PL6D 3BGFB 4JY5H 4ORGA 1IC5H 1YMHA 4L3EA 1YMMD 4NZJA 2VXUH 3HPJA 4L8SC 4RMQA 4CUCA 3SDAD 4NUGH 1FPTL 3SDXE 2IQ9H 2FO4B 5AYUH 4GW4B 2QSCL 3OX8B 3IYLW 2R2EA 3KNBA 5KSAD 4CGTA 1EFXD 4GBXC 2AV1A 3H2WA 4FQPA 2V7NB 3SKMB 4UDTB 4KDWA 1AO7A 2HP4A 5D7JC 5J9PA 5HYIA 2RR3A 1XCTB 2F5AH 5D93C 2APWA 2B4CC 1AGDA 2XQYG 4NM4L 3P4NB 1LK2A 4OFKA 3QXDB 3DNKA 3SDDB 2PN5A 2R2HA 3RAJH 3LPWA 2HTLD 4OCLC 4ORZC 1L7TH 2MCPH 4HBQA 4KUZH 5IB3B 4U1SB 2BCKB 2YBRB 1SY6A 1ZTXL 5LCVH 1W0WB 3MLVL 2X89A 1JTTA 3G6JE 4Y19A 5KOVC 1OGTA 3M8OH 4NHUA 2AXHA 1VEPA 3S35H 1OAKL 4MNGB 1MWAB 1HXMB 4MJIB 2Z35B 2F5BL 1LEGA 4NSKB 1G6VK 1KCVL 2LV4A 4GW5A 5M95B 3L5JA 4JFYA 3QNXA 4CMHB 1CGYA 4M1GL 1KPVB 3Q0HA 2EDWA 3VI3F 1ZHNA 1MWAH 5DQDH 1WZKA 3U4BL 3BT2H 1ZVSB 3ARGC 1SYSA 3HR5A 2DLGA 2ZCKH 3DVNB 3RVWC 3GKZA 5I8OL 3IDNB 1XF1A 1GAFH 2HG5A 2FDBP 1EVTC 4U1GB 2HFTA 1UCBL 2HKHL 5D2NE 3CSYB 5J1SC 2A73A