3E1ZA

Crystal structure of the parasite protesase inhibitor chagasin in complex with papain
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
109
structure length
109
Chain Sequence
SHKVTKAHNGATLTVAVGELVEIQLPSNPTTGFAWYFEGGTKESPNESMFTVENKYFPPDSKLLGAGGTEHFHVTVKAAGTHAVNLTYMRPWTGPSHDSERFTVYLKAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chagasin
publication title Crystal structure of the parasite inhibitor chagasin in complex with papain allows identification of structural requirements for broad reactivity and specificity determinants for target proteases.
pubmed doi rcsb
source organism Trypanosoma cruzi
molecule tags Hydrolase inhibitor/hydrolase
total genus 23
structure length 109
sequence length 109
ec nomenclature
pdb deposition date 2008-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09394 Inhibitor_I42 Chagasin family peptidase inhibitor I42
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2020 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3e1zA00
3CBJB 2NQDA 3PNRB 2NNRA 2WGNB 3CBKB 2C34A 2OULB 2H7WA 3M88A 2FO8A 3M86A 3E1ZA
chains in the Genus database with same CATH superfamily
1EPFA 2FJHA 1IC4L 2C9AA 2JIXB 5ICZA 4DPCX 3DPDA 3ULVF 3NSCA 4UF7C 4IKKA 2NQ3A 4J3OD 4HJUA 2CO6A 3PNWB 4KJWC 4FAAB 1IV8A 2QADC 3AXIA 4KROB 4GRLB 2J55A 3OKOB 4BRVA 4LARL 2XN2A 3BOVA 3UROR 3WN5A 1RIHL 4TUOA 3TO4D 2CBTA 3V7AE 1PPIA 2YQBA 4TVPD 4OLEA 4RZKA 1JDDA 1EFQA 4CNIB 3U1PA 2IALA 4OZHF 1JPST 5FGBA 2COVD 3ZKMD 4Y5YA 4JG9A 4DPBX 4LCWB 4IJTA 2NY3B 5DZ9A 3APDA 3DRTB 1AHWC 3T1WA 3BH9B 3U0WL 5ERWB 1DLHB 2ID5A 1OAZL 4K3JL 2AAAA 3VH8A 2EILB 3EH1A 3FTGA 2X2UA 2FX7L 4PGDB 3EBGA 1CFMA 1F6LL 4F7CB 2VDKB 4XAWH 5J11B 2F1EA 4Z0BL 5JR1H 2IFFL 1M56B 4APXB 1I7UB 2MFNA 4Z3FA 1IC7L 4EUPH 2VCOA 4XNZB 3ARZA 3L95A 3RIFK 2DI8A 1UACL 4LEXL 2EC9T 3UJTL 4JRWA 3WN5C 1KBVA 5IB3B 3ABZA 2J1KA 1RIVH 2A6IB 4ZBJA 4CRPA 3OZ9H 2YQ2A 4QT5B 3V5DA 2V3DA 5FGBC 3UDWA 5HVHC 2YGNA 1VSCA 2BMKA 4ENZA 3HB3B 1U91A 2AMUA 1AGBB 3MSPA 5FF6B 1IE5A 4F27A 4BDVB 4R5XA 1J5HA 2EE3A 4G8EB 5L2KD 2X4SB 4FTVD 3EF4A 3MV7B 2Y5QA 5B1KA 3ISWA 4H26A 1MFNA 1SJVA 3ATAA 3MBXL 3MBWA 1ML0A 1UOLA 2AQNA 4PJAA 3KPSB 3MRJA 3OF6A 3V5KB 2FGWH 1GOGA 3WE6B 2WHVA 5HDRA 2XZZA 2FD6H 4I1PA 4JVWA 2XWDA 4H8PA 1XGQA 3WFBH 2O5ZH 1F2XK 1T0MA 3WO4B 3UDWC 2MQ0A 3T2OA 1KJMA 4LASH 4X5RA 2XXCB 2PLTA 3SGKA 1FZOB 2TAAA 4ODSH 3NGBC 1JCKA 3SDAD 1A0QH 2GSGA 1BW8A 2DIBA 1R9FA 5KS9F 3FTZA 5DZJA 3B6SA 3BO8A 4IMLA 4QF1A 9CGTA 3FBQA 3KJ4B 2NNXA 3SYCA 2XVBA 3THMH 1INDH 3QORA 1KNOB 4QOKE 2ZONA 4UT9A 4HYTB 3RWCB 4MS8C 5I1LB 4K5LA 2XY2A 3EJPA 5AW6B 4WGVB 5I6NA 2AKRB 5BJTB 1KACB 1XGPB 3GPSA 4NO3A 2WVSA 1NL0H 3FJTA 4ZXBB 1SLUA 2DMBA 2IFGA 3M1BB 4OD1H 4DKTA 4W9HC 2MMXA 3IJHA 4FYQA 3TT3H 3SGKC 3FRUA 3FU0A 1JWMA 4XWOD 5AQ0A 1ZGLA 3II1A 2P24B 2V9UA 4NHCH 4U3CA 2XWTA 4WO0A 1UH2A 3B9AA 4PP1D 2OSWA 3LD8B 4TTDD 5D7JA 2OJEB 2VQ1B 2R1WB 1OTSC 5BOJA 3OXRA 3QORC 1ZTMA 4WU7A 3B3IA 5I5RA 4NFDA 1R6VA 4Y2DD 2LT9A 4P5TA 1UQSA 3DGCR 2IMMA 1U8JA 1OHQA 2EXSA 3MRNA 4DP9X 1RLWA 4JM2A 3LKNB 2WWNA 1A7NL 5B1BB 1A02N 4UANA 4PV1C 5I8EB 2UWEE 5KSAB 5GZOA 2UX7A 1Z66A 2DYSB 4Y0GA 5HYIA 1ET8A 4U1NA 3ZDYB 1WFOA 3K72B 2WINA 3UTPE 4N0UE 4FQLL 1MRFL 2OMZA 3PGDB 6PAZA 5DC2A 2IGFL 5I28A 4OLWL 3NIFE 4OM0H 4KKNA 5GRUH 5L9DH 4ZMVA 5C0BA 3R7RA 3T3PB 5D7JC 1WCBB 1MWAB 5ADPL 4TLSA 3AS1A 1VFBA 4R7VA 5D2NE 5TPWH 1A6TB 2I27N 1A9EB 4FMVA 4S1RH 5HHOA 3EADA 1KIUB 1MI5D 4PV8B 5CJOL 4MZRA 4HFWA 4MD5B 4GO9A 1ZLSH 4HJEA 3LNGA 4P5TC 2CKBB 3UZVA 5FS5A 4JM2C 3PQYB 1JGVL 1EGJA 3HG5A 2DKMA 2QHRL 4OFKA 5GZOC 3K0WA 4X7TA 4YC2C 5JQ6L 1EERB 5F9JA 3DECA 4RNRB 1WD8A 1S7QB 6FABL 2EDRA 2Q8BL 4AW4A 4U7KA 2BVEA 3AWEA 3VM7A 2GSIA 3N1FC 5I8KL 2ZKXA 5FAAA 4OZIF 5EOCL 1PAZA 1W2KT 1YYCA 2DMKA 4ZPVB 1SXBA 1JGDB 1CR9L 1JHLL 2D7QA 5LJYH 1A9BB 3O9WA 4NZJA 4Q6YA 2P80A 1RUAH 1Z3GL 1NGWA 2EYSA 3ILPA 1SYSA 4PRPE 5IG7A 1KCRL 1RK0A 1DQQB 2CLVB 4XBGA 3U36B 5I1JL 2CIIB 2UVFA 5IQ9A 3D2UA 4N2NA 5K93A 1FG2A 3CDZA 1UZ8A 1YA5A 3JT2A 2YD3A 3UPRB 2AV1B 3RX9A 8PAZA 2YPVL 5T1JA 1EUTA 4D0BB 1PIFA 3BE1L 3T0EB 5CGYD 1A8JH 5IHZB 4FE9A 4KAQL 3CQQA 2BK8A 3GT6A 5E4EB 2ZCKL 3H9SD 2I9TB 4OKDA 1UA3A 2C3GA 3DTXA 3TZVA 5T33L 2AC0A 3KLKA 4W9FC 1MFDH 4LCCB 2G9HB 3MLWL 3H42L 4V33A 1HXYB 3EOBA 3UG3A 3EXLA 3HEIB 5F1OB 4L37B 1VFAB 2BINA 3ZO0A 3T4AA 3FFCB 3ZYJA 3TYGL 1B2YA 3O9WC 4JQIH 2TRYA 5IBUB 4O2EA 3LZLA 4KX9A 4L8CB 3BPOB 2VUOA 4GMSL 2AJVL 3NSYA 2ENYA 2FO1A 3MUZ1 5DMIL 3D9AL 2L7QA 4KHXH 3QZWA 5IEHA 3S3CB 4PGJA 1UA6L 3I6GA 1CFTA 1Q1PA 3T4YB 2I60L 3PJSA 3TZVC 4J2XA 1MJ7H 4APQA 5EIIA 5IJKA 1ZWIB 3RURA 4RA3A 3BKYL 4ODWA 3HNTH 3ARGD 1JHKH 1T1ZB 4XMZA 1RPUA 3KPOA 1KDJA 4P9HC 3T4AC 2DQDL 1GTNA 1THCA 4N2HA 1TQBC 5FGSA 4QHNB 4F8PA 3EDKA 3DSNA 3WTXA 3CHRA 5IMLB 4G6KL 1NZRA 1Z9SB 4K3DL 1O0VA 2IBBA 3TIEB 1F13A 4ANVA 1G84A 1KTLB 2IVFC 4YHOL 3JWDH 3S37X 4LU5H 4AL8C 1X5LA 3BGAA 4RFEA 5C0CD 3WJLC 5AZUA 4DCQA 1PZCA 1OSZA 1K8IB 3B2UD 1Q8MA 3BQVA 5F70A 3O6LL 2WAHA 4MCYB 2O5XL 5ECGA 2C7UA 1U8IB 4E0RA 1ORQA 4APQC 4ETYA 3QHZH 4KVNL 2Y7LA 5IJKC 4NSKA 4KUZL 4LK4A 3K4ZA 3GJFH 4LHJB 7TAAA 1OK8A 5CIPB 4QMEA 5C07B 2AXGB 2L8AA 3L2NA 4KX8A 2YEZB 4X4KA 2GI0A 5CR1A 3UAJD 2B5IC 2D7PA 4XO9A 3W1ZA 5BRZA 3D69A 2GITA 3V6OA 3O2WH 4M03A 1P4LA 2WXFA 4J1UA 1IBBA 1MREH 4C56B 1CN4A 2Z64C 4Y5XA 3R18A 1VFMA 2OFQA 4L9LB 3MNWA 3GF8A 2WXMA 2E5EA 3FPXA 3TA3A 3FOLA 5IMMB 1SY6L 2BDNL 1WQVT 2J71A 5FA4B 3TVMB 2W0LA 2R4RH 4XAWL 4DVBB 1O9WA 1RU9L 4PB0H 5DUPH 4P2RA 2QVKA 2CJSA 3EHBD 2Q7YA 4FXKB 1SBSH 5BS0B 3F7YB 4MA8H 4JL1A 3CXHJ 1RHHA 5A43C 5GGQH 3WXWL 2WC7A 3QFJA 2A74C 4PBXA 3FFDA 4Z7UB 4G5ZH 3CUPB 4EZJA 2X40A 4Q7DA 3O3UN 2RFXA 4UOZA 3QFDA 5DU7A 1EIBA 1S8DA 3D4YA 3GMMB 1I7TB 2XCMC 5E2UH 2NYZA 3V6OC 5EBWB 2KZKA 2QJDA 3GMPB 3GLAA 4M48H 5AVZB 4Y5XC 5IWLA 4PBWD 3K7UA 2VSDA 3M17B 5I16A 3KYKH 4RMBA 1U8NB 3IDGB 4MJIB 1KN4L 4LCYA 4TNFA 2LVCA 1RSFA 2NT0A 3CU7A 4UIKH 3G5VB 5H37A 1VRSA 1ZPUA 2AJSH 1AR1B 1AE6L 3CFBA 4WW2F 2ZTBA 5EF3A 3WOVA 3MV7E 2FGWL 4DKEH 1KELH 1RUQH 2MNWA 1IKFH 4MJ2A 2R4SH 2WLLA 3KPSE 2FD6L 5LNGA 4HJ0D 4MNGA 3A47A 4LLYA 3E1ZA 2WIMA 3WFBL 3EJSA 2O5ZL 4YUEH 4BFKA 5EUOB 3B2VL 1H6UA 4AJ0A 1FH5L 2F7IA 2VN7A 1OT2A 1R3LA 4O58L 2GC4C 1J8KA 3WD5H 4LASL 4XPFH 3KPLB 4PTTB 2WBJB 3QIBD 3RVVC 3Q6FA 1JFQH 2C1PA 1C08B 1A0QL 5F9WC 3C9NA 3BGMA 1UEYA 1ACCA 4I18B 2DYPA 3MV9D 2PP9A 3FRPA 1YYMH 1P5UA 2H3KA 2FWOA 4B9JA 3NSFA 5TDOB 2FLBT 2X4PA 3SDDB 3THML 1INDL 4DGIH 2UV3A 1F97A 3DX4A 3FCTA 1XF1A 1IAOA 1MFBH 5C8JB 2VZTA 1UVQB 1KTRL 4MQXD 4G9FE 1LGVA 3GBNL 3QI9D 4GXVH 3OAZH 3QQ4A 4UTCA 3TC9A 4Y8DC 1KJ3H 2HX8A 4XP1H 3CC5A 3MLUL 4B27A 2D8KA 2ZKHH 4FQHA 3KYAA 1NL0L 2YGQA 4R97C 3WKPA 4F58H 4LOFA 1XSJA 2JQAA 3N3EA 3RDTD 4HKBA 2HMIC 1J9CT 2F53B 5J13C 3C5JB 1I9EA 2Y7MA 1E9QB 5B4MD 4N9OB 2AEIT 3SDXB 2EIEA 1R3IH 2AK1H 3CZUB 1E3ZA 1NC4B 4NHCL 1QBMH 4QYOA 1CLYL 2IXQA 4NN7B 3DYMA 2WGNB 2WTPA 3VXUA 5TK4A 4NQCA 3R8QA 3LPPA 1P5UC 8FABB 2TRHA 2CK0H 4PI2A 4YBLC 1U3NA 2DM2A 4PM1A 2ARJA 2KERA 1N26A 5IMKA 3DYOA 1ZT1A 3ZXAC 3WTSA 1TTRA 4M7ZB 5AVWB 3DHMA 5EEXA 1AR1D 1JZGA 3CVHH 2NTFB 5C0NC 1HEZA 5FUOL 1G0YR 3NDYE 4U1KA 1ROWA 1SDYA 4ZAKD 3I6LD 4Y7MA 4YXKL 4QHUB 1L6ZA 4MCZB 4PW3A 4GQ9H 1OAKH 1RI8A 3CVBA 2EDJA 3QWRD 4HUVB 2DV6A 3L7EA 1G9NH 4LDLB 3OR6B 5A7BA 5JIIA 4OM0L 5L9DL 2WXRA 5BNXD 2DAVA 4NRZA 3SDCA 4ETQB 5HXMA 1JJUA 5TPWL 2AI0L 2JLPA 1HILA 4FC3E 2GTZA 1CICD 2MHAB 3PGCB 1T5XB 3EJUA 1BF8A 3T3PE 3ES6A 3UGUA 5C92A 2J8UA 1ZLSL 4YEFA 3QZOA 1E2ZA 1OPGH 4Z9KB 1KB5B 3NJLA 2W1NA 1CLZH 1PKQA 5HHQA 1GYCA 1R5WA 4I85A 2BSSA 1SJEB 3PQYE 2WCPA 1U8KA 3HUJF 1AXSB 3QJOA 3FT4B 4DN3L 4BD4A 4BIKA 3QW9A 1KY6A 4HD5A 1TQCC 2UY7A 5DC0A 2BLFA 3EJYC 3O3DB 1JMXA 3TONA 1P4IH 1JVOA 4QOKA 3NJGA 4K4KA 4QRTB 2JKXA 1CE6B 1WYJA 4JRFA 2HRHA 1DVFB 2UZYA 1VKXA 2ILLA 4D0CB 2Z7ZA 3I9AA 5AW0B 2FE0A 3D30A 3CFDA 1RUAL 4PHZA 1U92B 3IGUA 4I89A 1WA1X 5DGRA 1R1CA 4HU2A 2EDNA 2YXFA 2YBGA 3C2AH 4FNTA 1IEHA 2WVVB 2YAFA 4OJCA 5F3HB 1F5WA 3VI3F 4IDLA 1U95B 2CPUA 4LIQE 4YGVB 3LB6D 1ORSA 1LDSA 3MOBH 4K23L 4FQXD 2W80C 1CT8A 4KVCH 1U3HD 1OXYA 3T0EE 4Q4EA 1MFDL 5AB1A 3FTYA 4OGXH 2OW7A 3JUZA 4IRZH 5ACZA 4LGPB 4L5FL 3VFOA 3V0JA 3C09C 3F58H 3B9DA 1PDKB 2VXQL 4MBRA 3QEGH 2OZ4A 3LEVH 1T2XA 4XH2B 3O4LD 2K8QA 2UWEA 4O02H 4TUJB 1PU0A 1BIHA 3PWUB 1UFUA 3FFCE 5D71H 4HKJB 2WZ0A 3MFGB 4YGAB 3VRLF 3QWOB 3WHE1 4FXTA 3O8XB 4HS3A 4N0RA 3QNXB 3BP4A 4PW4A 4KHXL 4BWTA 4D3CH 5CD5C 2BVYA 1AS6A 5HYSG 4PY7A 5JW4N 3ARDB 3M8OL 3BFQG 3EUUA 5SX4I 3NP4A 4I87A 4B7IA 4C8XA 1XQ4A 4PUBH 3HG0A 2C9UA 5D9SA 3QZPA 4JFPB 3SQRA 3UO1H 4KKLD 2DZEA 3QRLA 1UWEH 5C3TA 5IM7A 3QO1B 1QTPA 2GT9A 4B6ZA 4PAZA 5KS9B 1KGWA 5F21B 3PWNA 1UUSA 3ARRA 4NZTH 2Y23A 3TGXA 3KBPA 1MFAH 3IYLW 4Q14A 3RLSA 4JPQA 1G7MA 4FZ8H 1I1YA 3AXLB 5B21A 3UJJL 1RCYA 3LIZH 4YK4C 3K6SA 2EE2A 3JWDL 4KKRA 3AB0B 1NFIA 3FU5A 3TCLB 5F7BA 2DMCA 5INCB 1QRNA 1NGYA 3NACH 4P06A 4YDMA 2JCCA 2DBJA 4MD0B 4FNPA 4K7PL 3ESOA 3FCBA 2EO7A 4H1LG 1ADQA 2P8LB 4YDLC 4Z1PA 3B2MA 2BHUA 2I5YL 1U30A 1ZHLA 2BIPA 2E9GA 3LQZA 3P0VL 3VCLB 3G08A 5DVLA 1LNUA 1JZ8A 4F37K 1ETB1 3WUWB 2HLFC 3LPOA 4UILH 4JRYB 4AV0A 1JAEA 4J3OF 4QXVA 4NUMA 3RPKA 1J05A 1FQ9C 4JG5A 3E9TA 4MA3B 5C07E 1FGNL 4IJ3B 4JDZA 4M29A 3O2WL 4LHUD 4PWJA 4UZUA 3MLYH 3BAKA 4OCSL 5F7FA 3H85A 3KR3L 4LOUD 4YR6A 1UM5H 1MHCB 5JYMA 4AVKA 1P1ZB 3RGVA 1EJ6A 3HHSB 2QSQA 1N5YH 4C56E 1E3FA 4QYAA 2VUKA 4UM8B 4XHJD 2R1XA 2OX5B 4XCEA 1M05B 2XXMB 1T5KA 2A3TA 4PB0L 3CSYA 5DUPL 4ZRGA 1NWPA 1EQWA 1AD9A 1SBSL 1MCJA 5J6HA 3UEQA 1HCYA 1XZ0B 3QUZA 5GGQL 5ILTL 1N6UA 3KS0J 4ZNEE 4G5ZL 1ZHBB 4EIBA 2V3EA 3DVGB 3IF1A 1LJMA 4FQ1H 3BEVA 2K4AA 4P2QD 4ABUA 3GUTB 2ZG2A 4WWID 5E2UL 3VU2A 4IBLT 4K8RH 1U58A 4Z7UE 3FQUB 4Y9FA 5BVJB 3AT9A 1NEUA 4ZI8A 4M48L 4U6YB 3ZDXB 5BO0D 4M6MH 2X4TA 3RGVC 3KYKL 1BF2A 4Z77B 2D3VA 3RL1B 4NC2B 4OZGF 5F7MC 5IW3A 4NO2B 2E3VA 1UD6A 3IVKA 2NLJA 4JFVA 3SPGA 4JFYA 1DJGA 4UIKL 5KSUB 2EO9A 43CAB 1M53A 2R83A 3BP7A 2AJSL 4KV5E 4RAUB 4MJIE 3VXRB 3WAKA 3B5HA 5FW7A 4AEIH 2X87A 2WBXA 1XTLA 2EZ0C 4AE0A 4DKEL 2I7SA 3QUZC 1RUQL 2V7HA 4M43L 5JW4M 1IKFL 5K9JH 4XO5A 2VLLA 4J27A 4OZ4B 3O6FD 1LK2A 4L3ED 4NZRH 5K9QG 2BRRH 3ETBF 3FK3A 4HX1B 1QA9B 3G5XA 1FLRH 3VACA 4XNMB 1ET7A 3IRPX 4LDEB 1DN0B 1SHMA 3RZWA 5C3LD 4QTHA 5I8CA 1KLUB 3WD5L 3JTTB 4LSPH 3CLFH 3GD1C 4XPFL 3NYKA 4OCMC 1T22B 4WEBH 5CN1A 5EUOE 3RTQD 1JFQL 2LLNA 4DP5X 1ZLWK 1XAUA 2QGDA 4KFMA 4YPGB 2J7LA 4G7RB 1S7XA 5T1LD 3EO0B 3M6DA 1F6FB 1YYML 3M88A 4PJGA 2QSCH 5JO5B 3U9PH 2E27H 5IJCC 3FQNA 2VR4A 3BKMH 5TE6L 3VG9C 2VAAB 3OKEA 3HG1D 3KLAA 3MRBB 3D18B 2NXZD 1MFBL 3SJVD 3SOBH 3CVDA 1AP2B 4NN6C 4OAWA 1D9KA 1NGQH 3IJ8A 3QUMB 2A4CA 1B4TA 1T66C 5DZNA 1CLOL 1FO0A 1KJ3L 4W4OA 3M45A 4GRLA 3KPNA 5DK2A 3IJ7A 2ZKHL 3OKOA 4E9LA 5C0DB 3NA9L 1A66A 3A3YB 1KGXA 2JJSA 3IJYB 3J27A 3SOTA 1T2JA 1HHHB 2ITCA 4F58L 4QY8B 1CGXA 1F8TH 4IGBA 1E27A 4JK0D 1FFTB 1WAAF 1CIDA 5CLZA 1R3IL 1EEZA 1KEMH 5AD0B 1PLBA 5L0QC 2F53E 3DRTA 3I2CH 4DO5A 3MREA 5E5MA 5AZEH 1A3QA 3K0YA 2XN9A 3LS4H 1CPUA 5FKAA 1JZ2A 1BJMA 4PN6A 5EU5B 4GUPB 1IGMH 3H9YA 4MXVF 4RX4A 2VDPB 4N0CC 5LN4A 3BVWA 1RERA 1EDQA 3NVQA 3S96A 3QO0B 4XTRD 5JNYB 4GFTB 4NXKA 4WJKB 4W4OC 4GRLC 2BM3A 3ROLA 1FNGA 3SCMA 2JJSC 5IFAH 1JDAA 5J3HD 5IB3A 3HMXH 2A6IA 1P69B 1Q9KB 1OM3H 2CHNA 3DX1A 3F84A 2FQGA 2G0LA 1E4JA 5DD3H 2XKSA 5ALCH 4N5ED 5C08A 5DRNA 3U48A 3L3OA 4IRSA 3F62A 5EFIA 5ISZD 3O45A 2NY0B 2H32B 1DVTA 3CZSA 3PFUA 4G8EA 3WV0A 3I6KB 2EECA 2X4SA 4CMMB 4J3OG 3RPBA 1SUHA 1I1AA 5J11C 3M86A 1S9XB 2IPTH 1OSPL 2NY4D 3V5KA 1OPGL 3J07A 4AIZB 4EI5A 4XNZC 4KTEL 1YEDA 3TU6A 2D0HA 4KKCD 2B1HL 3SCMC 3FZUD 2GIXA 2HUEA 4HCGA 5BPPA 4KXDA 1TTAA 3CHXA 3FDWA 1EZLA 2AJ3A 4KNTA 3QNYA 5DD0H 2DF3A 4Z5RB 2VZ3A 4KK6C 2Z9TA 3B2XA 3X1NA 1HH9A 3BT2L 3L3OC 4IRSC 4K5OA 3HB3C 3TJHD 4ONFL 3NABL 4BKSC 1I3UA 3QEHB 1M6UA 4NRXA 1L6XA 2QMJA 1J0ZA 1S7UA 2IADB 3NCFB 3RKPA 3PHSA 5AKRA 2VXVH 3BDXA 4FULA 3G6JB 2MCG1 3X14B 4IOFC 3TN0B 1AGFA 2IANE 2VN4A 4G9FA 4PJXB 5IB5A 2Q5BA 1IB5A 4E9VA 1J5OL 4OLXL 4MQ7A 4M7LT 4L4TB 2XWCA 2W38A 1AZNA 5G2NA 4J3VA 5I1LA 1VACB 3Q1SH 5LBSA 4X98A 1A1OB 3C2AL 3K2MC 1JZDC 4XVUC 4GMTL 1T80A 4G7VH 4PGBB 3BVTA 3M1BA 3WO4C 4A63A 2LLGA 2FH6A 3GJEB 4D0DB 2O6FA 3W0WA 3MR9A 3QIWA 3MOBL 4XVJH 5EEZA 4Y2OB 1AKJA 2CO7A 3QIUD 4KVCL 1BJ1J 2P24A 2VLJB 3HJ0A 3SBWA 4GG8A 4BCZA 2XIBA 4IRZL 1AJ7L 4G72B 4M7KH 3KJ4C 1FNAA 1QUNB 3HCVB 3QAQA 1MIEL 4AYEC 5T3XE 2J88H 4Z95L 5DS8B 4Z7WB 3IS1X 4F24A 3N50A 3AS3A 4O02L 3I3EA 2G5BB 1OSYA 2YR3A 5INDB 3ULUE 1N8OE 1CQKA 1PD1A 1FZKB 1TCMA 5EUKA 2VL5B 5I8EA 4ZXBC 1KYAA 3W57A 5HHMB 5KSAA 1DBBH 4D3CL 1UT1A 1JF1B 3LX9A 3PGFH 3QIWC 3TBTA 4W68A 2KZWA 3VXME 4Z7NE 2EH8H 1QNIA 2BNQD 2M1KA 4PUBL 3SBWC 1HE7A 5G55A 4LSUH 3F04A 3U1QA 3VFUA 4H8HA 2ZNXA 4NBZB 3RHWK 5EC2A 1FNFA 1WCBA 2BXZA 1UWEL 4GS7C 1MNUH 4G80B 2AAVA 4XP6H 1KPRB 4NZTL 2EKJA 3CHOA 1X5HA 1MFAL 3VWKB 1E8ZA 1J11A 4HUCA 5DYOB 2G3MA 2FWUA 4FZ8L 4Q2ZB 4ZTOH 1XTMA 5B39B 4LF3B 5DC9B 5KS9E 3AQXA 4CDHA 2WTRB 1A3ZA 3F64A 4LKCB 3PQYA 1PX8A 1YUKB 4ISVB 3ZRCC 2X2HA 2Y2YA 4QRRD 2YD6A 5KSAC 3D12B 3T6VA 3OQ3B 1BAGA 2XRAL 3NACL 2J21A 1L3NA 4NQEE 3O11A 3T0DA 1NEZB 3ZGHA 4PJ8B 1JZFA 2WIIB 3X13A 5KN5B 5AYUH 2P45B 3CFJB 4U4BA 3RB5A 2OR7A 2Y7QB 3FTXA 2VO5A 3JV4B 3EKCA 3PCYA 4G2AA 4HH9B 4XCFL 1QLEL 4UQ2B 4GRWF 1IQWH 4FCHA 4Y1SA 4AYBA 2VLKD 4TUUA 3RI5K 4Z7OF 4UILL 3ZQWA 1NOAA 2BHZA 2VRAA 4FFZA 5E00B 1B0WA 4TNVK 2BSED 4ZNCD 4B0MB 2D3NA 3TO2B 5C71A 5DZOA 1P6FA 3BCDA 4RSVA 5I1EH 4GH7B 5DHVB 1E28B 4ZUSA 5F44A 1PZBA 3MLYL 1TU2A 4EN3B 4JRYE 3TP4A 3AITA 1TCRA 2EIJB 3AS0A 1UM5L 1IU1A 3O3EA 5C09A 1U2CA 1DL7H 4IK6A 1DVUA 1MLCB 2X70A 5CU5A 3QARA 4QRUB 1QOKA 3KD4A 3PWLB 1RURL 4E41B 3LV3A 7PAZA 4FQCL 4G1MA 4BSVA 1A7RL 1IC0A 3GBDA 4OGAC 2OAAA 3MHZA 3FO2A 3V4PB 4LCCA 5DD6A 3OJDB 2G9HA 3LN5A 3HN8A 3LZOA 1HXYA 3BKCH 4P23B 1BV8A 2A6JA 1BOGA 3B8YA 4L0YA 5SWZE 1A6WH 2EKSA 3FSWA 1T7ZA 2K9UA 5DFWH 5B22A 3DJSA 4K8RL 5H8DA 3T65B 1J0IA 2BP5M 4Z7VF 3VXPA 4TSBL 3ZJAA 4OFPA 4FKKA 1HOCA 4N2DA 1Z5LA 3MV8D 4M6ML 5JUEH 2VDRL 3T0VA 3SKOA 5DLLA 1S7WB 5G4MA 4R96A 3ZDXE 2F8VA 4LBEA 5EBLB 1N7ML 1JWSA 1FVDA 1UH4A 3UYRL 2DJ4A 1DBAL 3HUJB 4AEIL 4G82A 5AB9A 4LCCC 3P3RA 1ZWIA 5BQDA 4LP4A 3O6KH 5DRXA 5JXEA 5EH1A 5KVDE 1KT2B 4JY6B 4QRPB 4HK3J 3MYZA 2VDNB 3L5IA 1RPKA 4QHNA 4R3SB 1FLRL 5F3FA 3IMBA 1IILE 1VCBC 1PLGL 3RG1C 4LSPL 3RUGA 1RZQA 4FLRA 1F45A 4WEBL 4YL4A 4G5AA 3WI9A 5CCHE 3QZMA 5FECB 2ZXBA 4I9WE 5IR1A 3AREA 4GKZB 3U9PL 2QSCL 3BKML 4UQ9A 3VD4A 4MCYA 1VDGA 3GKWH 1U8IA 4WWOA 3SKJH 3FSZA 5JXEC 4K71B 5A2IH 6PCYA 1NJ9A 4GAGH 2QHLA 2OV0A 4XZ4A 2J6EL 3WLBB 5C07A 1OTTC 1UXWB 4HIEA 2HRGA 5AKTA 2DWYA 1SHSA 4KTYA 1GCFA 1OP5H 1XSOA 3T2LA 1UM4H 4E9TA 1E4XI 1S9VA 2QMKA 4I4WB 1CU4L 2W07B 1IT9H 1KEML 5HY9B 1T5WB 1QHQA 2XSKA 4QAMB 2MOQA 1FWXA 3EOTH 2XC8A 4GT0A 3AREC 3I2CL 4Q9CA 3N0AA 4NPYB 4E5XG 2BH0A 1EJOH 4YLBA 2AEQH 3LS4L 2OTPA 3HG2A 5C7ZA 1XGRB 4NNXB 3TVMA 1IGML 2VDLH 1L5GA 5J8OA 4CC4A 1UENA 4J4PD 1F18A 1GJIA 2L7EA 4PG2A 4U6HB 2E46A 3DO7A 4I3RH 1BVZA 5FXCH 4QKXB 3MX0A 3IFOA 4AC2A 4NKMA 5IFAL 5JDSB 1L9PA 3HMXL 4MB3A 1EO5A 5EZOH 5T1KD 1H8LA 5IUSA 4JFHE 2XIIA 3QR2A 3HE7A 5CJQH 1KIRB 4P46B 5J4MA 3IXTA 4PJBF 4J3BA 3UP6A 1H19A 5DD3L 2F7RA 3ZHDA 4PRNB 1CDIA 4L9LC 1DBML 5I1DB 5B1JA 2VERN 4CJ0A 2I9LA 1LK3L 3PL6B 4S1SL 2BVOA 1QASA 1I3VA 3V9FA 4C54A 2E0PA 4KZCA 3TVMC 4M5SA 4QD2E 5E9NA 4WFHD 3OWRA 2IPTL 4CC4C 4F37F 5BUGA 2QEJA 2P46B 3AW5A 4MS8D 4WDIA 5E2VL 4JGUA 4PG2C 3TBCA 1KBGL 5L4IA 4DQOH 1HHGA 5E1AA 3DBSA 2VDKL 3S3PA 1IFGA 4L18A 1NCWL 4GSDH 1WZAA 1PX4A 3VWJD 4MWFB 1H15B 3LZNA 4N6RA 3ARFB 4AV5A 1A6AB 2VZSA 3K4AA 2ZXDA 4LVNC 3ARTA 3FOMB 1ED3B 2F15A 3LMJL 1TSRA 4XN2A 5DSCA 4POYA 4KU1A 2HFFB 2WWKT 4PBVC 4TOYL 4PJEF 2R0KL 35C8H 4IHOA 5I74C 4P3WA 5B1JC 1RV6X 3L5JA 4ZDHA 4GAYA 4EUPA 5TK2A 4IEFB 1UCTA 2OM5A 5D5MF 2VXVL 5E6UB 3VRIA 5C0AB 1OTSD 5TDOA 1PG7H 1ZKAA 5I17A 1U93B 4OV5A 3QJHA 2GJ6B 4U3XA 4BCXA 3IE4A 5D55A 4M61B 4UOJA 5TE7L 3BJLA 3G6JE 2ZF8A 2G75B 1XH2A 1J10A 4PJXE 3WS6C 4M02A 1WE5A 3R8BB 1IZJA 3GMOA 3MO1B 4L4TE 1IGTA 4LSQL 2ZUWA 4XBPA 3GI8H 3IDXH 4JFXA 4JGJA 4B9GA 1BQ5A 1M3JA 4G7VL 4MJ6A 4AGOA 2QLVB 4W6WB 1E5UI 4RWYH 5CILH 4BJLA 4M5ZH 2OULB 3QR1A 5DVMA 1FVCA 4PTUA 3VVVA 4Z7IA 1TVHB 4HAFA 5E8PA 1R17A 4I18C 1H8NA 2BZCA 3AG4B 2AK4E 3EH4B 3MCG1 1LE5B 4OZGB 3SDDC 3VXSA 3PLYA 2VLJE 2YXMA 4N6QA 1MXGA 4JVUA 3KVDD 4PRBB 3EYVB 3QG7L 1NMCB 4ZUTB 2J88L 2EDKA 5J1TC 5CSZA 5HD8C 4F2ME 1YEHL 1SLXA 2YAMA 2ZZUT 3L1GA 2WKOA 3UBGA 1NOLA 2K70A 1HQ4A 3RNQA 1SXAA 2Z7WA 2ZX5A 4GXUN 4Z7WE 2IAMD 1WSST 2NTFA 5ALBH 5J12B 1DBBL 4URTB 5FDYA 4I3SL 4NUJB 4OVUA 2X05A 4EJ1C 5I0DA 3KWWA 4FXGB 3BVNB 2KH2B 3PGFL 1X9LA 1T1WB 4JFEA 2EH8L 3S7GA 3ZN6A 1D3CA 1HTYA 1N5AB 5LB1A 5J6GB 3OR6A 3X1EA 1YUHB 3VI4F 1YNKL 4NN7C 4E9XA 3N1QC 4I1NB 2HSIA 4YFLI 2V2XA 4PLNC 1R3JA 4FEIA 3L6FB 1MNUL 4HHAB 2NXYC 3B9KA 4L2LA 4WI0A 2ARWA 3FU9A 1D5MA 1J8HD 1TZIB 4XP6L 2OTWB 2YC1A 3N91A 3DTDA 1LEGA 4M8VA 5TDPB 1XH0A 3UYPB 1G0XA 2LU3A 1QFUH 3FHQA 4ZTOL 3VAEA 1H3XA 4A7VA 4B9CA 3S8GB 3D09A 5BZWA 5F72S 1ZD6A 5MHSD 3H2QA 1EZUA 5IVXA 3E80A 2NY5H 4J3XA 1D7CA 3D25B 3KM2A 5GGRY 5I9QB 1ZJBA 4QXWA 1WBXA 4ODVH 2H47C 1SJEA 3QEQA 3FMGH 5SWSA 3REVB 2XIDA 4FNLL 4LAQH 5AYUL 5I8OH 1CG9A 1AGEA 1EVTC 1LDPH 3CFTA 5AW2B 5J06A 3S8FB 1R5VB 4YDNA 1VERA 4X50A 3QDMB 2IANA 4ZODA 4JFFB 3ZKND 5LWYH 1JN6B 1XF5A 4IBUA 3CLEL 1CE6A 1GZQB 1BLIA 4X9FA 3VNZA 1GYAA 3W9EB 4JFOB 4MNHA 3S35X 1HCZA 3FQXB 2WSKA 2WYIA 3BLBA 4KXZH 5I1EL 2LU5A 3SKMA 4IRJB 5AZ2H 3Q6GH 3MJ9L 1J8SA 2HTKC 4HIJA 3D0AA 1QHPA 2JSFA 4JKNA 2CKBL 4PJHA 3VUAA 4BZ1A 5FA3B 2ZOOA 4WF7A 3ULVH 3X11B 4WWKB 3ZVVA 4RGNB 2Q8AL 5IGXH 4YGVA 5D96C 3MMEA 4M1DH 3VXOB 1NCAH 1S7SA 2DQJH 4ZOBA 3L08A 5EMYA 4IBWA 3P73A 3Q5YA 2E6JA 4E41E 2H0EA 3DX7B 3BKCL 1E4HA 4WHTA 4XR8C 2YOAA 4L4VB 1YYLL 4V1DD 1Q90A 2H1XA 1DVQA 2BRQA 5D7SL 2XQYA 4GFXA 4ZQTA 4QTIL 5DJ6B 1MCFA 4N22A 4X9YA 4G3YH 4M56A 3BPNB 8CGTA 5JUEL 3QWOA 3CPUA 4NQDD 3VXMA 4IOSD 2FH8A 3EGDB 3QS2A 1I1RA 2IPUK 3VU1A 4DAGH 4GUQA 5SWQA 2GBTA 3N44F 4U1GB 4GXUM 4NQVB 1Y0LB 2G60H 4RBPK 3HZVB 4W6YB 5IF0A 1OQOA 2CDFB 3DDFA 4NENB 3VFTB 1HEJC 3KZ8A 2E9WA 4UDTA 4FABL 4JFZL 1OKEA 2Y3NA 3HUJE 4AOFA 3ULUC 1T4WA 3HNVH 4KUCF 43C9B 5FW6A 2XX0A 5F1NA 1B0GB 4HQQH 4HK0A 4PW9A 4QRPE 4BFFA 3AXLA 1OP3H 3P4MB 5HHPA 4NQEA 5I71B 1T3FA 5E9DA 2TSBA 4HALA 5DVNA 3I9GL 5EZPA 3O8XC 4NT6B 4XT1C 1ZE3C 3A24A 4MNQD 3VGGA 3EGXB 3U4BH 3PXHA 1X9QA 1PW3A 4FQIH 3ARDC 2CDGA 4JQIA 1JPTL 4PEEA 4PY8J 1SQ2N 5CP7A 2P5EA 3SKJL 2BW5A 3ECWA 3S2CA 5BO1H 3OJMB 3Q0HA 3QZLA 5HYJD 3EYOB 3RA7H 4CVXB 2BY0A 4GAGL 1LO5A 3DROA 3FTVA 2LFEA 4L3CA 5AW7B 1BYNA 3MRMA 1QSFA 4RAVA 1FBIH 4H2AA 5K59E 2FX8H 1MHPH 1BVKB 1CI3M 1MUJB 3K8MA 1KWKA 3BFOA 1UM4L 1AOHA 1IEBB 4NBYB 2EIZA 3KNBB 4NJ9L 4R5VA 3WFEH 3AB0C 1IT9L 2UYLA 3CBKB 2ZICA 3BZFA 4UQDA 4FFYH 1MHCA 4KY1H 4LXFA 4XC3H 1D5BA 3EOTL 4NYLB 5D70H 3FH8A 1QYGH 2AEQL 4FA6A 5A16A 4HIIB 1MCNA 1KLGB 3FN0H 1Z9OA 3GSNB 5TH2A 3SGEH 1BLNB 1KBWA 2LTQB 3M7OA 5GGRB 2Y06L 2Z31A 1RPQA 5AVVB 2VUYA 4PG9B 2GTWA 3D4CA 1FVEB 3S9DB 2W88A 4XXCC 1VESA 5SWZA 3GHBL 1N68A 1L6PA 4MMZA 3W9DB 1OARH 3A4DA 5EZOL 3GQFA 1S3KH 1FFPA 4Y9CA 2DEWX 5CJQL 3GUTA 1YN6A 2VO8A 5FUCE 2DI7A 2OYLA 1IGJA 4IJ3C 2CO4A 3FQUA 1AHMA 1BXUA 1KXQE 3GXNA 2BCKB 3ASWA 3BDYH 2K78A 4U6YA 2XG4B 3DV6A 3RVVD 1VGKA 3DX8B 1Y6NR 2V2TB 3V4UH 4OD3H 2A6DB 2WSDA 1R5IB 3QDGB 5KYWB 3EO9L 4P9MH 3GMNA 5E95B 3JWOH 3U6RA 4QWWC 1ADWA 3FQRB 3F7QA 3H9HB 1DVZA 1KTCA 1QAWA 4FI6A 3RI5F 5J9PA 1WZLA 4MRBA 2NY6C 2NX5B 4JG0L 4AH2A 2FWLB 3BIKB 4AYMC 1BYOA 3QXTA 4WTZA 3GSRB 3KPQB 3D3VB 3TPUB 1ZT7B 2H3NB 2J72A 3FT2B 1KXTA 4AV4A 4MMZC 3UTTB 1TZHA 4LHUG 5FYKH 1NUGA 2P4AB 4UQCA 5EEVA 2B4CH 1V05A 4HP5A 4X4MA 4BINA 2HJKB 3BUPA 1Z6JT 3AZUA 4MSWA 4H8WH 1XBRA 3ZSSA 5C3IA 1YAZA 1DN0A 1E2WA 3CSPA 2PMZA 2HMID 3CMGA 2WMPA 1B88A 3DVNB 3HW7A 3WFHB 5E1GA 3WNNA 4AM0A 4NO5A 4D2NA 4JE4B 1T04B 1UD4A 4G8GA 5DQDH 4ZTPH 1MAJA 3V6FA 3LEXA 4G8FB 4K15A 2OQJB 3HOGA 4AUJA 2J1YA 3JWNG 4Y4HA 3ZT7A 5HYQB 2FZ3B 4WHDA 1PG7L 5JO5A 1OLZA 2AQ2A 3N41F 5D7LB 3V4VB 1QABA 3GJFK 3MRBA 1RY7B 5E56A 1LO0L 5H35A 1KCWA 2HJLB 3QH3B 4YS4A 2IQAB 1AP2A 5C0AE 1SUJA 3FSVA 1AGDB 2GJ6E 1FFRA 1YY9C 2DLIA 1AQMA 3QXWA 3KS0H 2AJXL 5C0DA 5C0ND 1EHLH 2Z93B 5IFJA 5ICXB 1EFXA 3IJYA 3T8XA 3BWAB 3ZHNA 1XGYH 4WO4A 2F08A 2N0MA 5CILL 3CN3A 1CUOA 1G6VK 4F8TA 2QKIB 2X89A 1HL5A 3MGOB 2DL9A 4LVHC 4PB9L 4Z7VB 4TQHA 4MD4B 5E6IA 4M4PA 2IOOA 3IFNH 3QHTC 4LOVA 3CFMA 4Y4HC 3QWQB 1M6OB 3IU3B 1WUNT 1GL4B 1QWHA 1PLCA 4GAFB 4GUPA 1LO2H 1SDAB 1HQRA 3SE6A 5KVFE 3MRFA 2DWDA 3L9RA 1LO4H 4MMXB 3U7YL 4F7EB 1M7IB 4OZGE 3DETD 3WJMB 1RVFH 1FFOB 2O6PA 5KZCB 5JIHA 4OCXH 2JXMB 1MDTA 2APSA 4X5WA 3IKKA 3SPIA 3Q05A 1NBZA 2A6KB 2AXFB 5E6SB 1RZIB 3KL0A 4WW1A 4KQ3L 4PLJC 5LAXB 1WJ3A 2ADYA 4WJ5A 4WCYH 4NO0D 4FQQB 3O4OC 5I2IA 3EJYD 4Z3TA 4M3JA 2EIBA 2NT1A 4OU3A 2L04A 2NNCA 4LP8A 4CMMA 4JO3H 3WU1A 4JDTL 1ACXA 2GUYA 1KJ2H 1XIWB 4ANUA 5IBLD 4GG6B 1AO7A 1BG1A 3Q5TA 1QFUL 2ZPKL 5IB1B 1MHHB 5E4AA 3OGCA 3EBIA 1XAKA 3B5TA 4AZ8A 5AWNH 5FOBB 4K7FB 5I1HH 4R8WH 4IKLA 3EH2A 3QG6A 5EZJA 2XTJB 2YPLA 2ZOWA 4ODVL 4H7VA 3W11D 2IDQA 2AVFA 1RZKH 4PR5B 4LAQL 1X5IA 4GBXB 3S5LA 5GZND 4AZUA 5JHLA 1LDPL 4R90H 4JW3A 2UXVA 2IEPA 3CFEB 3U83A 3MRQB 1ZVYA 4O51B 1C8QA 3A67H 4R4BA 2FIKA 4X6BB 3MRIA 1MCBA 1IJ9A 2OYPA 4AYID 4P4RA 3CVHA 5T3ZE 4ICXA 3QDME 3MJGX 2H32H 3KPPA 1TFHA 4PGCA 4JFFE 3R1GL 3HJEA 3OAZK 1NC2B 4QLWA 5L8KB 5LG6A 3WFCL 4KRLB 3D1MC 3L2MA 3Q6GL 5JOFB 2AQTA 3HG3A 1DBJH 5K33A 4ZFOA 2JI1A 2HVKA 3LY6A 1WFTA 2BOBA 1XSIA 2RQ8A 5KSVB 1IBDA 1EZVX 3ULVL 1SYVB 1M71A 2C8NA 3B5GA 4PCKA 5FHAH 3GJEA 1J48A 3VSUA 3UX9B 1D6EB 5C9JA 1NCAL 2DQJL 1KB3A 2WCGA 2AK4A 4BFEA 3TEXA 2PW1B 1HAWA 3KPRA 1JNLH 3ME0B 2WM0A 4L8SA 3Q9PA 4IIQB 3Q06A 1H5BB 4PLOB 1TLMA 4UBDC 4P4KD 4U1SA 5AB2A 1X5YA 1YEWA 1MW3A 3TN0C 4F2MA 2ENPA 3A0OA 3QQXA 4WSJA 4OF6A 1C1EL 4OJFH 4ZMOA 2CUAA 3GHEH 4OF7A 4ANKA 3VNYA 1BVOA 1G9NC 1ZA6A 3FQTA 3R19A 2HKAA 4KJQC 3GDBA 4L4VE 4PJ5D 4G3YL 4AM0Q 1RZJH 2PTVA 3VW3L 3QQ9D 3UTPD 1FZKA 1ZK9A 3K6IA 4MDIB 4I2XA 1FL6B 3GZKA 1XXDC 4JHUA 4DAGL 1PVHA 2XT1B 1HHJB 4K55A 1WGVA 4ZMAT 5I66B 2G60L 1EEQA 4NKDB 4PJ7A 2P5WA 2WN2A 5I1AB 4AT6B 1IM9B 2JJVA 3FUDA 3QUYD 5E8NB 4L8SC 3HE6B 3LDBB 2DQGH 2WXNA 2ADGB 2BP8B 1NCNA 1BF5A 4AKOA 4ALAC 1DQTA 2VC2H 3PWVB 5HDOA 2YUXA 2VERA 5T3XL 3BLKA 5D5MB 1HINL 4BK5A 5ESVB 1ASPA 1WT5A 4HQQL 4HUUA 4MAUL 3RKDD 3NIGF 4Y19A 1YEFH 3JTSB 2W0KA 3PHAA 2HG5B 5ADOH 2GFBB 2WTRA 2DDQH 4LKCA 3RIKA 2BNUA 2OTUB 1UG9A 5FK9A 5IFHH 3H4FA 3DMMA 3RIAK 2GJZA 3I75B 4NUPA 5IV2A 1JV2A 3GS0A 4IRZA 1WICA 5GS0C 4HT1H 1N6QH 2PXYB 4JHWH 1NKGA 3SQOH 4BA0A 3DK2A 4PJ8A 5L6YH 3P30H 1L9OA 1CD0A 1SN2A 5BO1L 5KVEH 2Y1YA 3GSUB 3BWZA 3S3JA 2Y7QA 4AKPA 5KYUA 3ELQA 1BJ1H 3IM1A 4HH9A 3RA7L 1BAFH 4NIYE 2ZXAA 2VIRA 3HLAA 4PRPD 3GB7B 3IDIB 4K8RD 2KI6A 2VZ1A 1UJ3A 1N70A 2A83A 3K1DA 3UTZB 4S0HA 3KL5A 4BK5C 3VWKC 1AQDB 5D4IA 2EO1A 2YLHA 1FBIL 2Y22A 2FX8L 1WT5C 1J5DA 1JVLA 1M2OA 4CN6A 4A2LA 3QQDA 4TPRH 3MBEA 3QCUL 1FSKB 5EOTB 5DHVA 2DD8L 4FGMA 4KGLA 4EN3A 2FIRT 5IJDC 4H8VA 1B4RA 1CE1H 2WZ5A 3N85L 3DMMC 2A9MH 4KY1L 1PMYA 2H2PC 3QUXD 5KBDA 3LZQA 3WIFA 5DJCB 2VXTL 1E67A 1MLCA 4N2GA 3T2NH 2ADJB 4ICWA 4Z3IA 5FYLH 3LKSB 2H7WA 4D8PA 3HMWH 3H53A 5MENB 4IOIB 4PJ8C 4E41A 2FB4H 4CW1A 3V79C 3FN0L 1Q0EA 3NJNA 1PG7W 4I0PB 4BH8B 3E2HC 1QW9A 4LFHG 1UKTA 1GC1C 4Y1TA 3BIBX 1SDDB 3FCGA 4MVBC 2EZ0D 3LN4A 4X99B 4X5QA 5E51A 3RL2A 5KSBB 4LPUA 3LIZA 5FCUH 3TBWB 3VI4B 3NFNA 5AOJA 1QVOB 5HYFA 4P23A 4TNWK 4QJ3B 3CC1A 1OARL 2DQIH 4X7FC 2CJ3A 1M1XA 1K8DA 1SXSA 3EZ8A 1ESOA 1K5NB 5I23A 4JCLA 4ZK8A 2J5LB 4XB8A 4HG4K 2ZWKA 1PNCA 2EQDA 5DO8A 1JNHB 4EN3C 4B9KC 5ACLA 3BDYL 2UX6A 1ID2A 1SNRA 1YNTA 3OKNB 5CEZH 2ZUQC 3D4GA 4P9ML 3C8DA 3MNVB 1IM3A 4PJ9A 1TDQA 4H1LH 5T5NG 5ID0B 1A3LH 1XL6A 2BOCB 4Y1AA 3WHXB 5BMFL 5EBLA 4N4YB 3L3IA 3QDGE 4DUVA 1VADA 3FUFA 2EVFA 2YQGA 1QO3A 2OL3H 2O30A 4P23C 4PJAF 4R0LA 4K94H 1FP5A 4DGWC 1COBA 2IDTA 5A2KH 3H7LA 2X41A 4ONHB 4OIFA 2YN5A 3MRGB 4H8WL 3UO8B 4ZFQA 4RMUA 2P42B 1F4YH 4MJ4A 3Q2WA 3HFFA 4RRPG 4X6DA 1P5VB 2QV2A 1OEZW 3ESUF 5DQDL 1MCPH 2CR6A 1E6OL 4ZTPL 4EN2A 1CF1A 1RJCA 5EU3A 2ZAHA 5DK3A 5MEOB 5KBLA 3ZIYA 2IQ9H 1DO6A 3VJ6A 3BZ4A 2WQRA 3IFPA 3EYFB 3O6MH 2JIXD 4BGLA 4LHQB 4N0CD 3IGFA 3IPBA 1P7QB 1RJLA 4HS8L 4LLWA 2Y5TB 4Z3EA 1B9ZA 1C5CH 2EDWA 3HAEG 4EI6B 4R0LC 3S37L 1INEL 5KVDL 4KROD 3FCSA 3ML9A 2VR6A 4A2DA 4XX1E 1LWJA 1EHLL 1B6DA 1SXCA 2FHCA 1QFWM 3LNHA 1V7NH 1A8ZA 1MVYA 3STBA 1XGYL 3IJSA 4CVZA 3BHBB 3HR6A 2RALA 3QUXA 5FB8B 4KKAD 4K9JA 4LCWD 2CIKB 5EULV 2NY3D 3LTVA 1JPGA 1GZPB 4U49A 2XUWA 4XGZB 2BSRA 1BWMA 4M93B 4EXPX 3RJOA 4HWNA 4DETA 5K9KB 3QJRB 4NB7A 4AIXA 3QYMA 1L7TL 4XMWA 4M1GL 3BWUC 3IDYB 3P9LB 3QDJB 1LO2L 1Y18B 1NPJA 3WEXB 3F00A 1QACA 2OJZH 2KC0A 1LO4L 3IJEB 1BQHB 4NCC2 5AKSA 1A2YB 3MUGB 1RL1A 3V52L 4EDWH 1HL4A 3EFOA 1S46A 1XB8A 5IB4B 4OCXL 3KHOA 3X3FH 4Q9RL 3VFVB 3VXTB 1EZVY 4LZKA 3QUML 1W6WA 5B38A 5FX3A 1O7DE 3C60A 1S9YA 2JCWA 4JM2F 4KC3B 1UT2A 4WEMB 1KIRA 2RACA 4P46A 5CGBA 3NJFA 5KBNC 3O3BB 2C9SA 5FHBL 2CAKA 1XMWA 4PP2B 1U8HB 3DXAD 3HB3D 4WCYL 2H0JA 2WXPA 3WLWC 1YN7A 3FONA 4A7GF 5E08H 5CLTA 4JGNA 1NIAA 2ZOKB 3MV7D 2WZPD 2FWSA 1X9RA 2MEJB 1KJ2L 2X4NB 5EN2B 5GS1A 1YMHB 4TQ8A 1BBDL 2ICWB 3KPSD 3U82B 3NN8A 3NG5A 4RQQA 5AWNL 4GG6E 5FUCC 1YLBB 5I1HL 3BUDA 4NKIL 4R8WL 5DUJA 4P2OA 1YEJH 4XVUD 1H15A 3C60C 4DFIA 2HCZX 4PRIB 1A6AA 4R7NB 1YMMB 5EF0A 4YHIB 1RZKL 1ED3A 4P46C 2H6OA 5LGHH 2VISA 1ZANL 3CDYA 5I15H 4R2GB 1KB9K 2WLZA 2DB8A 4HJGA 3CZEA 5EB9A 5JQHC 2YD1A 1CGYA 2EUXA 1FIGH 1NDTA 3PWPA 2E9BA 2HVJB 2RA1A 3EDJA 3TNMB 1A47A 1TYJA 4LLAA 5JLZA 5C0AA 3VGDA 4K3GA 4YQXL 1U93A 2OMYB 1DEEB 3OAUH 4TVSa 3UADA 4UQEA 5MI0B 4YHYB 2DM7A 1GGIH 1RIUH 2WUCH 5GRZA 1ETZB 4CA4A 1DBJL 4PS7A 1BEYL 1C12A 2DI9A 3LOWA 3ARFC 1J8RA 4ZXBD 2EDBA 1NDMB 3U0TB 5FHAL 5F7KC 2NZ1A 3ZMRA 3ZBMA 3D0VB 4LB8A 3L4VA 5LGYA 1ROCA 4ODUA 1SJHB 3AU1B 2CR3A 3QJQB 1XR8A 3LKOB 4BFRA 4N3TA 4J3OH 5DJDB 3KEHA 3MRKB 3UEZA 5D1XB 2BY1A 1JDCA 3FU8A 5HHNA 4DN4H 4OJFL 4UOW0 5JDJA 1A5FH 2XWEA 2ZUYA 5HGBB 5J1AB 5JW3H 1BQRA 1AC6A 3IMWA 2QZ5A 4UOQA 4F33B 3V0VB 1RZJL 2ATPB 5EO0B 5I0VA 1NGXB 4QXUH 2NW3B 5I1IH 1F0LA 4QHLB 1UXSB 4UT7H 4DZ8A 5E5LA 3A6OA 2EUZA 2XTLA 4L2YA 4HEMA 1JK8B 2BIOA 2QQQA 3F85A 3I02B 2YAHA 2OMNA 3ZSTA 1NAMB 2WBWB 1YUHA 3HR5B 2D0GA 1B0RB 3TBBA 3FT1A 1MLBB 1UH3A 1XCTB 2DQGL 3MRCB 3TJEH 3TV3H 1G7QB 2K0RA 2FT7A 1CXLA 5C0EB 4HS6B 1A7BA 3D48R 4FOMA 2VC2L 3STLA 3QULB 2OR9H 2A2QT 2QSVA 1NMCC 3T77B 1ZIAA 4QRSB 1JTTA 2FL5A 1BZEA 2IPUG 3N41B 3IDUA 5GSVA 3AS2A 4LRIA 1VA9A 5ABZA 2DDQL 2MOVA 4LL1A 3G3LA 5D5ME 1A4KA 3OL2A 5IJVA 5IFHL 2WXIA 5J12C 2P8MB 2EEXA 3F7PC 1WHPA 5IHLB 2J2ZB 2ICCA 2H41A 4KI1A 3IBOA 4HT1L 1T20A 4UM9D 1N6QL 2Z6FA 5DA4A 5KOVC 2QR0B 4NC0B 3OC8A 5L6YL 1A21A 3KDMB 2CMRH 4WUKH 4N2KA 2GG1A 4OGAD 4PJIB 4Z3HA 1IKOP 3EOYG 3SN6N 4OI8A 1UWXK 2JTYA 5DA0B 5FO7B 5LUMA 3H3BC 2FJFB 3HC2A 4HSCX 5FUZH 3IPFA 3PAZA 2Z91B 4DPRA 1TFPA 1X5FA 3W37A 3EW3B 2N4IA 1NEPA 1TENA 4X5LA 4PRDB 12E8H 5TDNB 4PLKC 1LQBC 1RHFA 3W9EA 3Q2VA 4MB4A 4WFGD 1NCIA 1ZSDB 1J88A 2WP3O 3MNDA 3MLSL 4TPRL 4LRIC 1E8YA 4J3TA 4P5KB 5EOCJ 1QEWB 5EEWA 3KCPB 4NM8H 1ZXQA 4YFLF 2HFGH 5F96L 1QR1A 3QNFA 2A9ML 4UMSA 4X0KB 4B5EA 3HI1A 3WEAA 4WJG3 1JZ4A 3T2NL 1Y1UA 3LRSB 3OKKA 3T0ED 5EIQA 5FYLL 4ESKA 1ZTXH 3HMWL 4U7SA 4OB5H 4GKNB 2FB4L 1HIMH 4L3FA 3AAZA 4JPWH 3ZQ9A 3A6CH 3P77A 4IQHA 3VXOA 3WNOA 1KGCE 4XMPH 1BD2B 5MENE 1WEJH 4FQPA 5FCUL 1KTBA 2HT3D 2K6WA 2Y5EA 4F57H 1L0QA 3TFKC 3CN4A 3FFCD 4C4KO 2ITEA 5E94B 2JJTC 1NDGB 3K5SA 1HX0A 4L4VA 5KSBE 5TFSH 1XR9A 4JR9H 4PHXA 4Z76B 5E7BA 4MKMA 1H8SA 1USQA 2ZG3A 4M9PA 3T6QC 1TLKA 3MXVH 3LPWA 3R06B 4IRJC 4PJCA 3V0WL 4POZC 4KOBA 1UC6A 1QKZH 2F54A 5A6MA 4X5XB 5D7KD 2P5PA 3B7TA 1CXFA 3NIDF 4MAYB 4P3DB 1C5DB 3GXUB 4Y89A 3SEPA 5CEZL 3NDZE 1QRKA 4UAOB 3EGDA 4FMFA 4HH8A 2R69L 4PGEB 1OV8A 2OXHB 3TYFA 5KVGH 1BYPA 3HS0B 2NNAA 1ZMYA 3HZVA 3L9YA 1DP0A 4MDJB 1C8PA 2BC4A 1NQBA 2A38A 4HD9A 3RJQB 3RILA 4K94L 4MX7A 1WS7A 2VWEE 5AALA 1OTTD 4JQVA 3WFDH 3SGDI 1CFBA 5CM1A 1J5IA 5JIPA 3PWJB 4JX0A 1I3GH 4DP1X 4L29B 1ASQA 1ZHNA 4K0OA 4GUOA 5D72H 1LL1A 1F4YL 3VGHA 4WI8A 3UAEA 4XNYH 3ZHFA 3GXFA 3RZCA 1MCPL 1B4JH 3CZFA 4YO0A 5FLVA 1GYUA 1Y6KR 4OCYH 4HKZB 1I8MB 1D7FA 3T6ZA 1QG3A 4LLUB 1CCZA 3L7FA 2YBRA 1IEAA 1T6VN 3VYNA 2R27A 2WKGA 1XF3B 1SHWA 5FFGA 5JMRA 5HPOA 5JPNA 2PO6B 2ZXQA 1E9OA 2O72A 4AC4A 5JHDA 2EVHA 4JQVC 3LKQA 5DK0A 4BYHA 5BV7H 1EJ8A 2CBMA 2CZNA 1FPTL 2YWYA 1BVKA 1MUJA 2X4QA 2YQ3A 2VDNL 3LH8A 4KK9C 4BE6A 2B2XH 4C56D 4F7TA 1OCRB 3RZCC 3OV6A 1WIUA 3N42F 3NAAH 4G1EB 3S4SB 1OCWH 2JB5H 3N55A 5D1ZB 3AM8A 2XACC 3CTTA 5EIIG 5DJXA 5JPMA 3FBKA 5IK3B 5GGVL 1CVSC 2YRPA 2AITA 2ZXCA 1KLGA 3C8KA 3FSOA 2OI9B 2FO4A 2DL2A 2OJZL 3MFFA 1F11A 3MACH 5BS0D 5JPNC 5ES4B 5F9OH 3GSVB 4EDWL 4NZFA 2C9QA 2G0KA 2ISDA 3X3FL 3W9DA 2O6CA 4NUQA 1I7RB 4DP7X 2V9TA 5LHDA 1YRKA 2BNRB 3NRPA 1AAJA 4G6JH 5L7XL 3D34A 4FF9A 2DIAA 2QADB 2YD4A 2BCKA 5K1VA 1GS8A 4N3UA 5F2FA 3AM8C 2LE9A 4MJID 5E08L 3TOPA 5JPMC 1BZQK 1ZK5A 5E03A 1GY2A 2FHBA 1AQKL 5H94A 1HZKA 4NHUB 4H8UA 5EU4B 3KYMA 3H9HA 2ROYA 1CFVH 1N8ZB 4HC1L 2OJ1A 3TLRA 4KXBA 4PREB 3HTLX 3GSRA 1AH1A 3WELA 3POCA 4J8QA 5HHVH 5BVPH 2PUQT 4H13C 4K9EC 3V2AR 5CBAA 1ONQA 2FJHB 3SIKA 1YEJL 1KXHA 2I85A 4U31A 4TYUA 2DKSA 1WAPA 1XGTA 1HWHB 1YJDH 1H3TA 4RGOH 1JERA 2CO6B 2YSSA 5LGHL 3ARBB 2XZQH 2WBJD 4PRIE 5I15L 1YMME 1CI5A 1MVUA 2PW2A 3WN5B 2J8HA 4TUOB 2JI2A 3QJXA 4EE2A 1FIGL 5M95B 3KL3A 4AIOA 2IWFA 1A1MA 3KW8A 1ETJA 3SDDD 2FZ3A 2IALB 2BP3A 2DQMA 5HVHB 4Y5YB 4Y4FA 5TD4A 3OAUL 2MNUA 3LPGA 3DJRA 3QUKA 5FEBA 4XOEA 2XX1A 4XP4H 3QH3A 2WUCL 1SMOA 3X2QB 2JFCA 2K1MA 4MLIA 4UQIM 3U0PA 3VH8B 3FTGB 4AUYA 4H4NA 3CXDL 5ICXA 1GSKA 4KKBD 4LL4A 2VDQH 2W81C 2VL4A 5C7XH 4GRWH 1HYRC 3UZEA 4O5LH 2F53D 4YLCA 1R34A 5B7MA 3MV01 5CFAA 3PABA 4BWWA 1NC4D 3STZB 1RJYA 5DMYA 4BBWA 2QKIA 5PCYA 3MGOA 4KDTA 2W60A 1OW0C 5G5DA 4ZMYA 2D7TH 3CFIC 3WY4A 3LRLA 3CFUA 1BFOA 1HZHL 1G6RH 3V5DB 4Y4FC 1U36A 2LVEA 1T89A 1EXHA 4DN4L 2BMKB 2YZ8A 5JA9A 1U91B 1A5FL 2A4ZA 2AZAA 4MMXA 5D1XE 1I8AA 4DWHA 1E5ZA 2XKUA 1KCVL 1CFSA 3DLQR 2WNKA 5AVYB 4JFDA 4H26B 2XDHA 3MBWB 2GKIA 1F90H 2UWEF 4PJAB 3MRJB 5I1IL 4UT7L 4OCRH 2A6KA 3UZEC 3K5RA 1INQA 3GYRA 1DSFH 2AABH 2V5MA 3LN9A 1PJWA 1QBLH 3KPMA 5CCKH 2QKIC 4KDTC 5K9OA 1XGQB 5LQBH 4MMYA 3TJEL 1PZ3A 5DQ9B 3TV3L 3DIFA 1T0MB 3TT1L 3I84A 3SO3B 2PP7A 1F3DH 1KJMB 2OR9L 2J1ZA 4K3EH 1T89C 2PCPA 4AYDC 2YA2A 3GINA 5KVFL 2F18A 4JL2A 2GSGB 4MMXC 3KCWA 4BELD 1MHHA 1O7DC 1DE4B 3B6SB 3BO8B 4RMTA 4QJ5B 2M83A 4IMLB 3ULVD 4KO7A 3C6SA 4KBPA 1SEQH 1NMBH 1UZGA 2X3BA 2HLAB 2JELL 3BSZA 3QORB 2NYKA 1QX1A 4WGWB 3RRQA 2EC9U 3L5WA 2K3HA 3QXAA 4GBXA 5LDSA 1OT1A 5I1KH 1Z0MA 2GUOA 1HYSC 4WUKL 2JCCF 4IMKC 1JGUH 4NO3B 1RFDH 2W0FA 3MRQA 1N59A 2CDEA 5HJBA 3SHSA 1UD2A 4PWHA 3IJHB 4HCRH 1XIWC 1DVFD 4CSPA 4PJIE 4DHLA 1JCVA 1SGKA 1JWMB 1ZGLB 4XX5A 1TEYA 2C4FT 4PFEA 4LDOB 2XWTB 4MKTA 1BA9A 3PRZA 3US1A 5D7JB 1ZDSA 5KBKA 2HFGL 1TZAA 5F7YC 3OXRB 3QCVL 2GJPA 4XP5H 1EO7A 4GAJL 4MBOA 3WNLA 2NZIA 1J5CA 3B3IB 5KSVA 3MJ6A 3F6JA 3IT8D 1E5BA 4GBXC 4GSQA 4P5TB 1HIML 4X6EA 3HIZA 1U8JB 3MRNB 4JPWL 4OZFB 4JM2B 4AGPA 4EF3A 5EPMA 1M4KA 4XMPL 4QXGH 5DJ0A 5T3XD 4OF0A 1M7XA 4U1NB 5T8IA 1NCCH 1OB0A 3DO4A 4F57L 2HTLC 3GRWH 4A68A 1OF0A 4U3SA 1H5BA 4PCTA 5IBTH 1AOZA 2WINB 4KZEH 3ILQD 5F9AC 2OMZB 5JW5B 4XO3A 1BD2E 5TFSL 2D7NA 3UC0L 3FB8A 4ZPTA 1AACA 3PS6A 3MXVL 2X28A 5C0BB 5D93B 4H0LC 4F7MA 1VFBB 2C5DC 1G94A 2DMGA 1FHGA 5HHOB 2CM5A 1A9VA 2YA1A 3O8XD 4HFWB 3I50L 2G3ZA 5KVEE 3ISYA 2UZXB 4NZUL 3UZVB 5KVGL 1HHJA 4AVIA 3ARDD 1BFVH 4LEBA 5I66A 4NKDA 1DDHA 1KXVA 2YS4A 3F7LA 4DVRH 4X7TB 3K2IA 5EV7A 3WTVA 2NY5C 5E8NA 4ONGH 3A4EA 3VMPA 5LNDA 1H5BC 4XNUH 2DWTA 3QT2A 1URZA 3MQIA 3WFDL 2CQVA 4M7LH 2YEQA 2EAEA 1I3GL 3GNMH 3VG0H 5D72L 2HG5A 2ESVA 4XNYL 3VFGH 3MC0A 4Q52A 1DTUA 5DHXB 1B4JL 3UJIH 4HK3N 2ZOTA 3VGEA 1I8IA 1CDYA 1G4MA 1K9TA 4OCYL 1CDJA 2FAUA 1NGWB 2EYSB 4PBDA 1SYSB 4QO1A 4KK8C 4YZFE 5IG7B 3ZTNL 4XBGB 4XVSH 2I69A 1BQLL 2NSQA 1BJ8A 2QQKH 5IQ9B 1KXVC 3D2UB 2A7BA 3H9ZA 1FG2B 5DHYA 3EXJA 1KYFA 1F1AA 3CDZB 1UZ8B 3UL4A 2O6DA 2OSYA 3ZO9A 3HE6C 3LDBC 1XF4A 1VFUA 4N8UA 2EDLA 1A65A 1AZBA 3DURA 3L4UA 3GB7A 1OOWA 1TSHA 2X4OA 1WF5A 3UTZA 3ZL4H 5BV7L 3LQAH 1SHXA 3DTXB 3L3HA 2LHAA 3P4OA 1OAJA 4XB7A 3TZVB 2ZP8A 1WWWX 5BRQA 3T0WA 3EOBB 2B2XL 4ODBD 1ZV9A 1OCWL 1IC5H 2F74A 3T4AB 4OLUH 1TQBB 5EU6A 2ZOLA 3OB0K 4O2EB 2WAQA 2Y2TA 4CAGA 1PGRB 3LKSA 4L8DA 3S35H 3IMSA 4Y4KD 3T8VA 2Z65C 3D33A 1IAKB 1MCWM 2XG5A 3HG4A 2P52A 2FX9H 2A9NL 4X99A 5CLYA 5F9OL 5KG9A 5F89A 2EVJA 3QZWB 4LPYA 5IEHB 2XJLA 4MB1A 1QVOA 4OFIA 3I6GB 5BQ7A 3ZUCA 1O6TA 5D8JH 3PJSB 2BOLA 3DWTA 1BXVA 3C5ZA 1BZOA 1FSKC 2VMCA 4G6JL 4ODWB 5LN8A 3GBMH 5DJZA 2E7BA 3KPOB 1QWNA 5E0FA 3UPAA 1AMXA 1YCSA 4NM4H 4GO6B 2VQTA 2YD7A 2YPKA 3DSNB 3OKNA 2BVQA 4MQTB 5D1QA 4AE1A 2B77A 2DH2A 3CH8A 3TF7C 1GR7A 2LQRA 4I0PC 2CKNA 2WLKA 1L0YA 2DWXA 3VXRD 1WA0X 3RWEA 4PU2A 1ZT4A 2KHAA 4RFEB 3L4CA 1D7BA 4NJAH 4DCQB 4BV1A 5HHVL 1OSZB 3AT0A 1FNLA 4FFYA 2BSDA 3L8QA 4JPSA 2OCCB 2AV7A 4KK5D 4E0RB 2FGZA 4ZOCA 1ORQB 2C34A 3C5ZC 1YPZE 5AW1B 4EPSA 4G7YH 4ONHA 2A1WH 4NSKB 3RVXC 1E4WL 4MDRA 4ELKA 4RGOL 1UJTA 1HU8A 4I9WD 1FNEA 2QVMA 1RZPA 4LSSH 1QSED 1NM4A 4IBTA 4IU2B 1D5IL 5D1QC 1TJHL 5I76A 3DUSA 4EQ2A 3C6LA 2C9PA 2RIKA 1GJWA 3BQUA 2KLRA 2HPTA 2GITB 2W9DL 4GT7A 5E9AA 1P4LB 3HZMA 3ROOA 3OJVC 2VWEC 3FAXA 3MUUA 1QFOA 4Y5XB 5KWYC 1NKOA 3MNWB 1OALA 2VLMD 1P7QA 1X9UA 2Y3AA 3Q8EA 2Y5TA 4XP4L 2YAEA 3TA3B 3FOLB 4EI6A 1VZIA 2BIMA 1QLFA 2Q9OA 3AFLA 4KI5E 3U6XA 3OHXA 4KH9A 1XEDA 2WD0A 4XCYB 4P2RB 3RBSA 1VFOA 2VDQL 2Q7YB 4O5LL 3APNA 4JKKA 2KL6A 3M1CA 1RHHB 3VE0A 1X6LA 5FB8A 3QFJB 4MASA 3Q9QA 3FFDB 1G7LA 1NIEA 1Q94A 1S3RA 2QGBA 3F7RA 4FG2A 1NUDA 3V0HA 4J5VA 4HUWA 1I82A 4YXLL 3FT0A 5BCAA 3P4LA 2ALWA 4HFUH 3QFDB 4YZWA 2WNWA 3BQUC 3LKRA 5E1HB 1G6RL 3NIDB 3WO3B 2VLRA 2F19H 3MJ8A 5L88H 4GKLA 3UBXG 3FQ4A 2HRPL 5I16B 2QQLH 4PVLA 4J6RH 2DM4A 3CFKA 4FJ6A 5CBEA 4JFHD 4LCYB 3TCTA 1U8LA 2PYEE 4YHLH 5MP6H 1CDCA 2HKHH 4UB0H 4KNUA 1W72H 2DQUH 3OHXC 1AI1H 1D5XA 2BWIA 4ZS6D 3JWOC 1EXGA 3VFVA 3CFBB 2NYYD 4OLYH 1D2OA 3CDGA 3F01A 1RZ8B 3NTCL 2ICES 3ECVA 2AABL 1KFGA 3PXJA 3TH3T 2WLLB 3BUYB 1MJUL 1QBLL 3Q2NA 3DVFA 1K4CA 4MNGB 2NY0D 2H8PA 5LQBL 3TWYA 3JWNH 4R97B 2B4CC 1R3LB 3K2KA 5FO8B 4WI4A 1JXKA 1YEIH 4LLDA 2YRBA 5J13B 3T3PF 3Q6FB 1X5JA 2C1PB 3BGMB 2OMXA 2ZJSH 1CL7I 4OZIA 2DYPB 3NZ8B 4L1TA 1M9SA 5DF0A 3FRPB 3NCYP 5AAPA 3ULAB 1SEQL 2MPAH 2X4PB 2Q20A 1JZ5A 5EN3A 2Z8RA 4PRIA 4R7NA 3FCTB 3L1OH 1IAOB 1IL1A 1GKEA 3VFSA 3KLHD 2PPEA 1XF2A 3QQ4B 5I1KL 4WU5A 3BI9X 3NQKA 4WEEA 1RFDL 4G59C 1ES0A 3KW7A 2P9RA 1S78C 4HKBB 1FL5A 2Q86A 4HCRL 2R2BA 2DRUA 4TVPE 5DD1L 3TN0D 1E2VA 1FL3A 2ZWNA 3NJHA 1PD0A 1T1XA 1OCOB 5KJ4A 4L4TD 4XPBH 2ZIDA 4QYOB 5KAQF 2CGZA 2IXQB 4HMCA 1KJVA 4NQSA 3VXUB 5J0BA 4NQCB 2ZX6A 4KJQD 4UZSA 3TX4A 1PY0A 2YRZA 2G3XA 1OAZH 4XP5L 5FDWB 5CSBA 2JJUA 2X1QA 2FX7H 3KJ6H 5JQIB 4PRHA 1XHHA 2ZWLT 2IFFH 1G9MC 1GY1A 3W56A 5IMKB 3NCJH 1ZT1B 1Z5YD 4IDJL 1IC7H 1EK3A 3QISA 4F80A 4UT6H 3DK0A 4YSEA 3H56A 4R2GC 1SJHA 2VLJD 1H6FA 1TMCB 5DZLA 3UJTH 4QXGL 4U1KB 1T21A 3MCKA 4TXVB 1NCCL 3IRZA 3FO1A 3JV6A 3EJZD 3GRWL 5SX4H 3TA4D 3H54A 3SQBA 1J9QA 5D1XA 4DGVH 1O5PA 3L7EB 4OSUH 1TQCB 1K72A 5MI0C 3EFFA 3SDCB 4NRZB 4PS4H 3DSFL 2HVBA 4ZO6A 2XZCL 1BWWA 1HILB 5HDWA 2GTZB 2Y36H 3MBXH 4NC1E 1SXNA 1NGXA 5HHMD 5C0BE 5TE4H 3VX0A 3IMUA 2J8UB 3RWFA 1UXSA 5LXVA 4U6XB 1CFQA 1JK8A 4HG4J 4HWBH 3F6IA 5FKPA 3FUHA 2HG0A 1PKQB 5HHQB 3CXFA 4DVRL 4NI3A 1R5WB 2EDYA 2BSSB 4ONGL 1UD5A 5HGAA 1E30A 4EEEA 2IWKA 3SKUD 4XNUL 5D1XC 1U8KB 2UZIL 1RH8A 1P4UA 1OAYH 4X8JB 5GJSL 5I6KA 2WLJA 2ZCLL 3K6OA 3VWKD 2UY7B 4AQ8A 3GNML 2VN6A 3FAWA 4QOKB 1HSBA 3QP3A 2EXYD 1BVLA 4JM4L 4FFWC 4XNQB 5FYLD 2NSXA 3VFGL 2H2PD 2LFGA 3WY1A 2UZYB 4KITB 1VKXB 3PF2A 2IH8A 4B60A 1GS7A 3QQNA 3RUGF 4CADB 2J2ZA 4RZCA 3CFDB 5IHBA 1A7OH 1F2QA 2QR0A 1BHGA 4IU3A 3OLDA 3EJCA 4MVBD 1BZ7A 3HBPA 4A7UA 3KXFA 2FJFA 2X6BA 2X12A 2PABA 1ORSB 1NAMH 5C2BH 2XTSA 4ADJA 3ENEA 3GBLA 5IEKA 3LQAL 4I0KA 3SDYL 4AQ8C 1CT8B 1QBBA 1WCQA 5DR5H 1R33A 3IDNA 4QIRA 4HCIA 5CEZD 3QPXH 2PTTB 4WEUD 4PV9A 1JYVA 4X80L 5A2CA 5ACZB 2WO3B 4DESA 4JRXA 5DTFA 1NCGA 1IC5L 4RESB 3VFOB 2FR4A 4ELMA 1Z3RA 3EDDA 3PUUA 4X0KA 5GRVL 4OFQA 3DVIA 4B3EA 2XBDA 3GKZA 3ARPA 3LRSA 2UWEB 1K85A 1JK9A 1A6UH 1BMGA 3LNDA 4ZAKB 1KPUA 2CCWA 2NZ9D 4YK4B 4KWUA 1HFUA 2QVFB 1KCKA 4D7PA 1BBJA 4HZLA 1X3DA 2H0PA 1BD2A 4HS3B 2DTSA 5ANMA 3VTTA 2PWHA 2WWMD 4PY7B 3ZQXA 2EXTA 3SY6A 1A4AA 1TETH 3OWEA 3GSQA 5E94A 3KBHE 4FQLH 1NA8A 4WW2A 4CU8A 4F7KA 4WNJA 4JFQA 2IGFH 5D9SB 1TTUA 1YC7A 2VITA 4CSSA 4Z7UF 3H2WA 3RWJB 5IM7B 2WUBL 2K4WA 2P7TA 3BUTA 3B83A 3HN3A 1HK6A 3PWNB 1KLFB 1QBAA 1C5DA 4LT7A 1U2HA 5DYFA 1I1YB 5IIEA 5KAQG 1ULVA 3QXDB 1NFAA 2X0VA 3UGXA 4KV5F 4KZ0A 1NFIB 2FLRT 3Q8FA 5EU7E 2ADFH 1QRNB 1NGYB 1JF5A 2OPCA 3MROB 1SOXA 3LNIA 4UIMA 2N1TE 2JCCB 3AU0A 5JQ6H 3GIZL 4QRPD 4UV7H 2I7OA 1RUML 2XICA 3H1ZA 4R4NC 1GHFL 3QC5X 3ZTEA 9PCYA 3H55A 2Q8BH 5HYSA 1MAML 2Z92B 4G7YL 2A1WL 3WDIA 1ZHLB 3IDMA 1FN4B 3LQZB 3AC0A 3ZYOA 3G08B 3QR0A 4WKZA 1LNUB 1VJSA 1WWCA 1B0IA 4X6FB 5EOCH 1Q4NX 1CGTA 5EUOF 5JHMA 3WUZA 1G9EA 3WTYA 3QK0A 4YHNA 1VZGA 2Z0BA 1FLTX 2ETWA 1JXFA 5EZLA 2ZUSA 4OJEH 4NN5B 1I8MA 4JDZB 1KY7A 3HS0C 1KCRH 4LLUA 1AHKA 4YR6B 3UTQB 4Z7QB 4A6YH 2LU7A 3RGVB 1XF3A 2VR8A 1CGWA 1VZHA 2G2RA 1S7TA 1KB9J 2V2WA 3O3AA 4OFYD 5IBUG 1PZDA 2YPVH 3FU7B 3BE1H 2FEDD 2R1XB 4XXWA 4XCEB 4UYPA 3RNKA 3JUYA 4PWEA 3CSYB 2H9GA 5T33H 4JVPA 1AD9B 4H1LA 5J6HB 3RWGA 1LVEA 1RKRA 3MLWH 3QUZB 4XAKE 2XYBA 2CUIA 3U2SB 1ZY9A 1IRAY 4G1EA 4JANB 6CGTA 3OTTA 5JIKA 5D1ZA 4FA7B 2OL3A 1CC3A 5KJRH 3BEVB 1SLVA 4HFUL 1XD1A 3QFJE 1EHNA 1U58B 2RB8A 2NPLX 4GIOA 4GMSH 5L88L 1T7WA 2RTTA 4LSDA 5JZ7D 2X4TB 3U4KA 2NUTA 4J6RL 1S6NA 2IH9A 2CPCA 1K3ZA 1FYTA 3EOAA 4JDVB 4YHLL 5MP6L 3IVKB 3QZNA 2NLJB 1XH3A 2HKHL 4JFYB 4XXWC 1UA6H 2DQUL 4FJZA 3VG9B 3FQ2A 3BP7B 1PIGA 4RWHA 1JL8A 3WXVH 4AX3A 2WKOF 1CGVA 4GSRA 4OLYL 5HI4D 5HJ3A 2V7HB 2BSBA 4NN6B 3BKYH 2E6QA 4Y9BA 4AENA 2VLLB 5IREA 3VD1A 4GQQA 4ZW7A 1LK2B 5AW9B 5D1ZC 3T2PA 3ECBA 5G4OA 3D85A 3G5XB 1XZWA 3PL6D 4LQFH 4MXQC 4QTHB 5I8CB 4MNGE 3S36X 1PZUB 3GIVA 5E6YA 4YHOH 1UWGH 4UV4L 3HAEH 4YBQC 4G43A 2ZJSL 1S7XB 5F7DA 4PCSA 3DOSB 5L0QB 1YPZA 4PJGB 3FQNB 5DCCA 1TQTA 4UTBA 1PX3A 3OKEB 1JI1A 1S9WA 2Q7AA 3ARFD 3KLAB 4HPOL 4U0RB 1X7QA 2O5XH 4RCAA 3NJKA 4EZMA 4XE0A 3L1OL 5DO2D 5IVXF 4UTAH 4KVNH 5ITBH 4KUZH 1D9KB 4OAWB 3ELAT 3ARBA 1FO0B 1NLBL 1HN1A 5DK2B 3KPNB 3V0GA 3HKZA 5TF1L 1ZXKA 1WG3A 5DC4B 2ITCB 3DJTA 4ADIA 1KYUA 2NR6D 4IGBB 5HDBE 2AJZA 2VSKB 1E27B 2VR5A 4FI7A 5HJGA 4YSTA 2GJ6D 5AW8B 3UTSA 1EEZB 1OTUC 2AHIA 4XPBL 1DQMH 4ODTH 1T7VA 2DLGA 5ITFA 1MELA 2JTDA 4ENEC 4ORZC 4G6AC 4AVJA 3MREB 3P3SA 5E5MB 2XN9B 1SY6H 5FKAB 2BDNH 5KW9L 3KJ6L 3VXUE 1JPFA 4NQCE 4C58B 1RU9H 1UXLA 3NCJL 3S96B 4HUNB 2CJUH 3ARBC 2R39A 4UT6L 3FT9A 3WXWH 3ROLB 1FNGB 2ODHA 3N1MC 3SCMB 3STZA 3OKLA 2BERA 4NRYB 3RWDA 3L81A 1H3WM 2V0AA 3MYJA 5CJ5A 1L9SA 1E43A 4DGVL 1UOKA 3NT0A 4Y5YC 5DRNB 5C08B 2PYEA 3L3OB 5K5YA 3VD7A 4OSUL 2V5YA 4IRSB 2RAMA 1U8CB 1TYEB 4LSRH 5DEZA 4F20A 5EFIB 3O45B 4KI5C 1NM9A 3DOHA 4PS4L 1A4JA 3ULUF 1KN4H 2CXKA 1S7VB 1Z1WA 1ITBB 1I1AB 2Y36L 3NJMA 5TE4L 2WQAA 4I0CC 1HXMA 3AWFA 1AE6H 3PJNA 1IGYA 3HPJB 2F2HA 3O6FB 1YEDB 4EI5B 1XB6A 1LEKB 2WQXA 3ZMNA 3GGWA 3P0GB 4HWBL 4Z7NF 5D4HA 5GIRA 2J8UE 1XT5A 4H8QA 2AJ3B 4IIZA 3QNYB 2D31A 3G6AB 1P7BA 4FNUA 2NY1C 3ZE2F 1IGFH 2VRQA 2ED9A 3B2VH 1MCSA 5DQ9A 2Q6WA 1NGZA 3IS0X 5A40E 1FH5H 4W6XB 3V8CA 1OAYL 1PKQE 4O58H 1HH9B 4X4YB 4JB9L 3VVWA 5CHNB 4NP9A 3BRDA 3L3DA 3RB7A 5AL8A 5E6RB 3IKCA 1RZFL 1OAXH 3D05A 1JD7A 1VHPA 2W65B 4NRXB 2HT4C 5B3JF 5E8OA 1S7UB 1DE4A 4YH6A 4E9SA 1AIFA 3ZTDC 2ZXWB 5I5IA 3SJVB 3UPCA 5IB5B 1T7YA 1AGFB 4G9FB 4FS0A 4KY2A 4A2FA 4WLCA 2J6WA 4N8CH 3WL9B 2HLAA 1M1SA 4MQ7B 1YY8A 1XH1A 4JCMA 1A7OL 1NANI 4A66A 5D7IA 2SEBA 3GBNH 4TQPA 2OP4H 3FUJA 3TO4A 5T3ZD 4YHZH 4X98B 5LCVA 3QDMD 3C08L 3MLUH 1IUZA 4KKQA 5TTRA 4Q4IA 1G87A 5D6CA 5IQLA 4JFFD 2BIQA 4KJYA 3ORJA 1AC0A 1M7DA 4EVNA 3SO3C 4OBRA 3MA7B 1NAML 2R29L 5C2BL 3RFZA 3W0WB 3MR9B 3QIWB 1MOEA 1EX0A 5GS3A 1AKJB 2CO7B 2VABA 1D2PA 2E7CA 1BECA 2JB6A 4M3KB 5DR5L 4GG8B 4IRJD 1CLYH 4POZD 3QPXL 2VMDA 3ATDA 4HEPG 1FAIL 4GS7B 1IBGL 4JZOB 5B8CB 4XBMA 5AOZA 2UXGA 1T83A 2BVTA 1QFHA 1ZLUK 4Z18A 5CJXA 5GXBB 2LAAA 1LM8V 3HC3L 2MKLC 4WWKD 3HZYB 4RGND 2DLFH 5DVOA 3GK8H 3II3A 2WQVA 4GKSA 4AG4H 2X6AA 1A6UL 3TO4C 4OZFA 5EUKB 4HWZA 1ILUA 2J56A 5FUOH 3ZKMC 4FG0A 4YXKH 5B3NA 1JGEB 4AK2A 5DD5H 3RFZC 1CD9B 4PRAA 4EXKA 2DTML 4YHPB 4U1JA 3TBTB 1TETL 5JW5A 1LXMA 1BEXA 5L2KA 4FTVA 2FTAA 3VFUB 1YDPA 3FN9A 2HT2D 1IAII 2Q76B 5EC2B 4RBPH 1U42A 1QHOA 2AI0H 1CVRA 1T83C 3DGGA 5AG8A 2NDGA 2VJ8A 5CJXC 1JMZA 4X0NA 3C75A 4ORGA 2E7HA 3ZDXF 2E56A 2UZXA 1UM6H 5CN3A 1GW0A 5JIMA 4YNYA 4P5SA 5DFVC 2C9RA 2ADFL 1I7ZA 1QFWI 2Q87A 4LVEA 1MFEL 1V3KA 4JJ5A 1XGZA 1E7VA 3O11B 4JO1L 4UV7L 3SDAA 3X13B 2B39A 4DN3H 1QRNE 4Q9BA 1LILA 1DUYA 1BP3B 4M3HA 4CMHC 1J9RA 2IV9A 2JCCE 4NC1C 3TNNB 5ESQA 3OHMB 5D93C 2EE6A 4A2EA 4BFIA 3PV6B 1E4XH 1PYWA 2V5RA 1K4DA 1NBQA 2ZYRA 4PJDB 4UNTA 4F5CA 1UATA 4ZUSB 1TU2B 2LABA 1TCRB 4WVRA 3O3EB 5C09B 3H8NA 2VZVA 4A6YL 2X70B 3DI2B 3V6ZB 2WXJA 2XQYG 4L1LA 4M6OL 3F3HA 3CD4A 3QIUB 1EGJH 1OY3B 3OBAA 3SDAC 3CSFA 4PJ6A 3LV3B 4Z7QE 4G1MB 4BSVB 1KIQA 1F3JA 2ZCZA 3B34A 4K23H