3E1ZA

Crystal structure of the parasite protesase inhibitor chagasin in complex with papain
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
109
structure length
109
Chain Sequence
SHKVTKAHNGATLTVAVGELVEIQLPSNPTTGFAWYFEGGTKESPNESMFTVENKYFPPDSKLLGAGGTEHFHVTVKAAGTHAVNLTYMRPWTGPSHDSERFTVYLKAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chagasin
publication title Crystal structure of the parasite inhibitor chagasin in complex with papain allows identification of structural requirements for broad reactivity and specificity determinants for target proteases.
pubmed doi rcsb
source organism Trypanosoma cruzi
molecule tags Hydrolase inhibitor/hydrolase
total genus 23
structure length 109
sequence length 109
ec nomenclature
pdb deposition date 2008-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09394 Inhibitor_I42 Chagasin family peptidase inhibitor I42
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2020 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3e1zA00
2NNRA 3PNRB 3M86A 3CBJB 3M88A 2WGNB 3CBKB 2OULB 2C34A 2NQDA 2H7WA 2FO8A 3E1ZA
chains in the Genus database with same CATH superfamily
4NZUL 3VX1A 3O3AA 4HJJL 4L29B 4PG9B 4WFGD 2N56A 4WI4A 5FECB 2ZWNA 3QXAA 4I18A 3ETBF 1CFQA 3EDJA 2A9AA 4AM0A 1A7PH 3D25B 2WXNA 1P1VA 3NCXA 4YZFE 1YHPA 5E8EB 1HDMA 2YA1A 3MRCB 3MRNB 4ELME 3ALWA 4KGJA 5CCHE 3HG1A 1OK8A 4PRDB 5FA4A 2FEEL 1O9ZA 3KYMA 4IEFB 1B0IA 2CCWA 4X6CF 3S37X 1AVAA 3EH3B 1PFCA 3F7YA 2NTFB 3MRPA 5L8LB 2G30A 2QPEB 1COBA 1N3NB 3LXUX 5EA0H 5LCVA 5B38A 3BWAA 1KWGA 4MS8C 3WEXA 2EINB 5D7SL 4GXUM 5CD5C 5DJDA 2EO7A 3DSNB 4ZXBC 3DUHA 3ZKMC 4GKZA 3UAJD 4XHJC 3V4UH 4ZMWA 5C0RH 4FFVC 1YEIL 4JZOA 3X3GL 3S8WA 3KWWB 3JUYA 1SOQA 4HIIA 2DWEA 3AWGA 3CQFA 2P5WB 1INQA 4ODUB 4WKXA 4YXLH 1INEL 1SHSA 4BK8A 5IM7A 3DX4A 4ZAKB 4LRNH 1QSVA 4J6RH 1N10A 2P8LB 5MI0B 4EI5C 2WP3T 1D7CA 1NUDA 2JQZA 1F13A 4IK7A 1BSIA 1BMGA 3DROB 3GF8A 1WBXA 3SPVA 2B1OA 2KLTA 4MMYA 4K5PA 4BSVA 4FMFA 1IBZA 2VLKB 3SGJA 1TVBB 4GW5A 4I1PA 2JJVA 3O4OC 3QNXB 4R97C 3LNDA 5C70A 3HFML 3L3HB 5GZOC 5IHZB 2G2NA 1LO5A 3SE3C 3ABMB 1HT6A 1YYML 1RZPA 4DPBX 5AVQB 4GW1A 4IHBA 5CJXA 2APSA 4Y1AA 4G6JH 1AGFA 4LCWA 1NM9A 4OFIA 2QHRH 4PJ8B 1C12B 4NPYA 2YAEA 1DVQA 1MVFA 4O5LH 3NSDA 2FYVA 1PCXA 3LV3B 5F9OH 4FGMA 2IH9A 2OYKA 2H1PL 4KJPC 1GYWA 5I75C 5B7EA 2GJPA 2ESVA 4QTHA 4ZDHB 4ORZC 3WUZA 3DGGB 4L48A 1TU2A 3ROLB 3DSFH 3TPUB 4N5UA 5EC1B 1RIUH 3OJDB 5FA3A 2NSQA 5AL8A 3HHSA 1XZ0B 4X8JA 3VXRE 1SXAA 2YWZA 3X12B 4YXKH 4WNJA 4OF8A 1OK0A 3R4DA 3TIDA 1AJ7H 1CLOH 4FABL 1ETJA 2AGJH 2P5ED 1NOLA 4HJEA 2LE9A 1W2KT 4I4WA 4YEFA 1HOCB 3V6FA 5T3ZH 2DM3A 5T1LA 3I85A 4JM4H 1FN4B 1A6UL 3AT8A 4P9ML 5EUOE 2HH0H 3GHEH 3L3OB 4EQ3A 4QT5A 4XN9A 3IFPA 2O72A 3BP4A 4JFQB 4PJBA 4XMXA 5I1LB 1MRDH 3EXJA 1Z7JA 4PWKA 3RUGA 1D9KC 3CPLB 2PWGA 4YGVA 3ARGD 3CZFB 3JVGC 3ZDYE 1FJ1B 4OI7A 3SDCB 3QG6A 4G80A 3TEUA 1CGXA 1M6OB 1OE3A 1XCTA 3WKYA 4UNIA 1PG7L 3VWJD 3W9EB 1N8ZA 1CJYA 2X4OA 2Y7NA 3IYLW 3QORC 5DUMH 5E9AA 3EW3B 2CD0A 4LPUA 4PJXF 3IPBA 5BRZB 4I85A 3KR3H 4LIQH 4G8AC 1QVOA 3VG0L 4DNLA 2EVHA 1BD2E 4HGWA 1RPKA 3O45A 4RFEB 1VZHA 2ZCLL 3GSNB 4KVPA 5I74B 2EDDA 4BKTC 1TENA 3BKMH 1C7SA 4IRSA 4HEMA 3VMPA 1LQBC 2CG9X 1EGJH 1JZJA 1QEXA 3L5WB 5DT1H 4HUUB 4YE4H 3DIDA 3WJMA 3WLBB 1E3FA 3HNVH 4E41A 3QIBC 1H5BB 3DURA 2JQAA 3OKOB 3SD2A 3R8BB 4M8VA 3V0AC 2BWIA 3KPLB 4MCYB 1EX0A 4FQ2H 1UHVA 3SE4C 3PWVB 4XNDA 1E4WL 5CU5A 3G5XA 4ODVL 2BNQE 2HLAB 2XA8H 4WGWB 1I1AB 4NENB 4ELMB 2VQ1A 2D0FA 1J1XH 2NYYD 4Z0XB 4D0DB 1F58H 3VGHA 3TPKA 3D2UB 3A4AA 3SB3A 1MCJA 4W9JC 4UM8B 5KTEH 5B39B 2ZUQB 1E2ZA 3L3DA 3BUIA 3VFMA 3H9SA 3AY4A 2BZCA 1IIKA 4XNXH 3UJTH 1UWYA 3EDEA 1DVZA 2WYHA 3ERXA 5IFAH 3E8UH 4PJDE 1CD0A 2XN2A 3TBYA 3EZJB 2X4NA 3FQTB 4JVWA 4LPYA 1KELL 1MAML 1XGUB 2OSYA 5KS9F 3RVUC 4K7FA 4PY8J 3S5LA 3CGTA 3QG7H 3ZMNA 2A6IB 3L3KB 5C0BA 3X1EA 4DTGL 5EEYA 1BVLB 1KIRA 1KCRL 3KVQA 4QY8B 3MNMA 1AH1A 4LB8A 1PJWA 4GUPA 4ZTOH 3US9A 3FRUA 4AZ8B 5T3ZE 4JFTA 1FSKC 1ZSDB 4Y16B 3RWFA 4Z76B 1LE9A 4NGHL 2XWTB 5BRPA 3EYVB 4JM2C 4LP8A 4ORGB 4KY1H 4PJ5D 4GKNB 2FIRT 1PLAA 3CN1A 1TITA 4KUCF 2R0LL 1PFOA 3SE6A 2WQAA 1HAWA 2ZTBA 3CJJA 3MGAA 5CIPH 3ATAA 1ZEAL 1SN5A 3CCHA 2WOBA 3MOAL 3SOBL 5JQHC 3RX7A 1JF1A 4P4KA 4F8OA 3L3GB 4RMWA 5SWZA 2UZPA 2P7TB 5DK0B 3CK0L 2JKWA 1QLFB 1KLGB 1OAKL 4HJ1A 1FFPA 1P7KA 2WN2A 43CAB 5IW3A 4LSQH 1JE6A 4ZW8A 3UTQB 4EIUA 2BK8A 3QHZL 3QZWA 4MYWB 3W81A 1JZ4A 1U8JB 4NRXA 1ZY9A 1TPXC 5DEGA 4XPTH 1S7XB 4DP5X 2MPVA 4L4JA 5JW3L 4WWOA 4HUMB 3WIFA 2QR0A 1P7QB 5K9JH 2UZYB 3FUKA 2OP4L 4LGRB 5D1ZA 2XBTA 4XPGH 2DQMA 3VXRB 1LK3H 3NZHL 4GFXA 1YEHL 4FFZL 2APWA 2QQLL 2VMFA 3EJJX 3QR1A 3W11D 1HH9B 1IM9A 3P9MB 4P5TB 3JVFC 5IT2H 1T80A 4XPHL 3S2CA 1CXEA 3VCLA 1U8PA 2YOAA 4ZPVB 3GWJA 3P4NB 4JRYE 3KPRA 1HN1A 1DO5A 1MRFH 3SSGA 4XNQA 5EUOB 1NM4A 1T1YB 2NXYD 3INUL 4EVNB 3BXNB 3WFDH 3LIZL 1TZHA 3FT4B 1DLHA 1N6VA 2YMOA 3E3QC 4TMPA 4WI0B 2V8LA 4Z3EA 4HP5A 2K9UA 2YD4A 3DRQA 1NCBL 3DGCR 5E99L 1Y18A 5I8EB 3RVTD 4BXVA 3ASWA 5HHOA 1HCZA 2D73A 2ZG1A 3LNHA 2LU3A 1E9PA 3BN3B 3ZDYB 2ZIDA 3QWOA 5D1QA 4OW6A 2EUZA 3FMGL 1GZQA 4L9DA 4E0RB 3SDCC 3QT2A 4UF7C 4XVTL 4CMHC 2WXPA 1QUNB 2B39A 4N2NA 5JOPE 1Q94B 4YHNB 3FQRB 4X9HA 4UT9A 3PFQA 5EHFA 1ZWIA 1XWVA 4N85A 3GIVA 4OT1L 5EU4A 3KPMA 2ZCHL 1S7WB 1SLVA 1BD2B 1FC1A 2ZSWB 3CC5B 1BBDL 4Y9BA 3WJLC 3OGCA 5HHXH 4Q4EA 4QRBA 5I74C 1QOKA 2DQJH 1A2YB 1FIGL 2C8NA 4XGZA 5B39G 3V4VH 2ADJB 1G7MB 2OX5B 4HJ0D 3P9WB 4FXGB 2WKOF 1LHZA 3W2DH 2BWDA 4JZJC 4TVUA 1RP8A 4RVBA 2J8UA 4PW4A 2B3IA 2WQXA 4AYID 1E2WA 5GHWH 2GIMA 2I9TA 5K5YA 2B2XL 7PAZA 2BNQB 5GGUB 4X4MA 2R69A 3TC9A 1PVHA 2F7RA 4U1HB 4P9HC 5AW9B 5TDPB 4AG4H 5ESVA 1I1AC 1WIOA 4GRLD 2VLRE 2Z31B 4DZ8B 4N2CA 4QWWD 5D1XA 2J6EA 4YHLH 4ILDA 1NGYA 4BCZA 3ULVH 1EBAA 3NJJA 1KXQE 3OPUA 3C5ZC 4XH2B 2VDLH 5C09A 3JWDH 2HMID 1MCWW 4PB9L 3GGWB 4JL1A 4IS6B 1F97A 4ACTA 4PJDB 2NNCA 3EOBB 1A1OB 3EYUH 3LOWA 3O6MH 2XKUA 3WSQH 4BFOA 3MRKB 5DK2B 1ZHBB 4MJID 3PWLB 1VCAA 1PIFA 2P26A 1A9EA 4P2OC 3BDXA 3H0TA 3ZL1A 1JYWA 4HCRA 5E94B 2H3NA 1JWSB 3ZTDC 2X4QB 4WKZB 3QAQA 3TESA 2IDSA 3P4MA 5ACZB 3NJXA 4E42A 2DQEL 1NL0H 4Y4HC 5I1CL 4ZUTB 1TJXA 3HNTH 1W72A 1JHLH 3LH2H 1S6NA 3HPJA 3STZB 1MI5E 4IKLA 2DQUH 2A38A 2R23B 1WS7A 3V6ZB 1U91B 4HPOH 2ZNXA 4P3CL 5T1KA 2QDVA 2BRRH 1I1YB 3B34A 4GRWH 3IB4A 2VL4A 3GJFK 4GXVL 4R0LC 1BLIA 4LEEA 2VXVL 1HHHA 2W65B 4I3RH 5J11B 1MHPL 2JKSA 1U3ZA 1GH7A 4LBAA 5JQ6L 3HI1A 5CEZD 3DXAE 1CFNA 1G0DA 4YAQA 2F5BH 5I18H 1ND0A 4OUOA 3WFHA 2V37A 3P40A 3FC8A 1J5HA 4Y5VA 4NNPL 4MD4A 3JYCA 4YO0B 4MAYD 5L7XH 1BG1A 1MFEH 1T2QH 3LN5A 1TZOA 4Q6IA 2VLME 2R2BA 1R24B 4I9WD 1I3UA 2JCCE 4ZFGL 1D5MB 1NDTA 2AXGB 4PTTA 1AP2B 2MOGA 2DKMA 4WHDA 3DUUB 3ILPA 5LJYH 1FWXA 2PMZA 5I8OH 3CFDA 1DFXA 1IARB 1DFBL 4K94H 1YNKL 4PS3A 3AG2B 5BZZA 3FB7B 3DX6A 3FB5A 1NEPA 1KBBA 4GSDH 4JRYB 3T2NL 2YRPA 2YEZB 4R7NB 2EVGA 4NO5B 1MFBL 2V2XA 5HGAB 3S4SA 4BZ2H 3RPKA 2PCFB 4OCWL 2GK0B 4ZTPL 3WL9A 3KL5A 3DJ9A 4WNSA 2N3JA 4X9GA 5ISZE 5AALA 5AB0A 1ZLEA 3PWJB 2XWBB 1JHKL 1QLRB 2H3XC 2WNKA 3ULVE 5FHAH 4L8BA 2G2PA 3MUY1 3HE7A 5BUGA 1WTLA 3TA3D 3V7AG 1QFWI 4ZS7H 4OJFH 4TSBL 1FP5A 1KN2H 1I7ZB 2W0FB 1QASA 4KI1A 4WVRA 3FDWA 1ROWA 3G5YB 2E7HA 5MEND 2KH2B 3V5HB 2YUWA 4GW4B 1ERNA 1YYLL 4HC1L 5HHMD 3ZTNH 3K71A 1A1NB 1DEEA 1PNDA 5BO1H 2D03L 4M29A 4PGBA 4TLKA 1JYNA 4R7DB 3EYFA 1DCEA 4S2SA 4P2YA 3MLRH 1AQDB 4JN1H 2NOYA 2OL3H 4AIEA 5DQDH 5I17A 4NO3A 1Q0YL 4J8QA 4JDTL 2E9GA 4BRJA 1WHPA 2D7MA 2EDOA 3K1DA 2ZUUA 3OAYK 3QE5A 4MNHA 4GRWE 4AV0A 2WKLA 1VENA 3WMPA 4ZMYA 3HG1E 2YWYA 3U6RA 3GINA 5CIPB 4XZUA 4MLIA 5GRYA 3RVWD 1BQRA 1OGAA 1X9LA 3IN0A 4LPWA 3FRPA 1DTUA 4ZO8A 4D9LL 5TGBB 1RZ8B 3RX8A 1UACH 4EN2A 4WFED 1WBZB 3KLHD 1IM3D 2BVQB 2VLRB 5ADPH 3MNVA 3MLWH 1JZIA 2G3NA 3TT1L 4HG4J 3L3JB 3VXMD 5EZOL 5E5LA 1E42A 4ZMQA 3BUYB 4G71B 4HLEA 1UEYA 1BVKA 5T1DH 1JGLH 3W0WA 1UM6L 1T21A 5EZLA 1F56A 5H37H 3FFCA 5L88H 3REVA 4NUPA 3ZE0E 4DGIH 5JMOC 3HE6B 4A37A 4Z1PA 1R5IA 35C8L 3MUZ1 1X4YA 1B9KA 2N01B 1T20A 3WDJA 3WIIH 4AQ8C 1JZDC 3HC3H 4HJTA 3O2VH 4JVUA 3UO1H 5JXAH 5EO9B 1JZ2A 4U1LB 1Z6JT 2HFEB 1MI5B 3MLVL 2PUQT 4FQCH 3FHEA 2CRIA 3SO3B 3AU1B 4Z78B 1HCFX 4X8XA 3RWGB 3FO2B 2UX6A 3MBXH 4UQEA 2EDBA 5TE4H 2OYLA 3LEYL 1FBIL 3M88A 1UB5B 4FL4B 3KYNB 1SFHA 4Y1AE 4MWFB 1XF1A 1NDGA 2B8OT 4LCWE 1T5KA 4HV8A 3DXAB 2JKTM 4TYUA 5E8DH 2FJUB 4XX1E 1JK8A 1NEZG 2P80D 4HCIA 2MEJB 1M1XB 3NA9L 1HHJB 4O2EA 3ZHNA 4JHUA 4RGMB 2MFNA 5EB9A 3NCJH 2BLFA 2ESVE 3PXHA 4AUYA 1IGTB 1A6TA 4W68A 3NIGE 2UYLB 1NMBL 2DQHL 4FNLH 2AK1H 4L1BA 2ZOKA 5IW6A 12E8L 1ZVYA 2VABA 4JQIH 4AENB 5JPMA 3S36L 4LLWA 5LVEA 3K74B 2X4SB 3IDGA 1HKFA 3DK0A 2JCCB 4YH6A 1RURL 1J5CA 3V4VB 3MRBB 2VJ0A 4TLUA 1KGWA 1MHCB 1NSNH 2H8PB 1VHPA 5DJYA 4F2FA 5TQ0H 4PJBE 2E4FA 3ZIYA 1OF0A 4I48A 2AJSH 4HFWB 4IJTA 5J7CC 3H55A 3RUGE 3WENA 4QRSB 1RJZA 3FN3A 5DJXA 4MTMA 4L0PB 2WNWA 3GS0A 5E8PA 5J1TC 1MCPL 5D5MF 1DO6A 4IRZH 5IOPB 5TE7H 2OM5A 4B9ZA 1JRHH 4JLRA 5ISZB 4BQBA 4L8SA 2HAZA 3RFZB 4M5SA 1R6VA 1RFDL 1ACYL 4Z7QF 4WGKA 4E9XA 2CLZA 1LEKB 4ODTH 4ZRGA 1CFSA 4TUJB 2WO3B 3TO4B 4HX1A 1XXDC 1AGCA 2P8MB 2NZ9D 4Y1SA 4LPVA 3MC0A 3NCYS 4K3JL 5C2BL 4K2UL 4KHTH 4WLCA 4N2DA 2FK9A 1QLEL 1SEQH 5J1AB 4B27A 4N0YH 3SDYL 5E6YA 2XTLA 4HEME 4LKXB 3FSAA 4MD0B 3MGTA 3SQOL 4NKIH 4FS0A 4Y4KC 25C8H 1S78D 2R7EA 1EXUA 3OJMB 4MVBC 1BZ9B 3O3AB 4E41E 4A6YL 2WTOA 1R75A 3PU7A 5LXGH 1QRNE 3QXAB 4I18B 1CFQB 1N4XH 2BCMA 4AM0B 1HYSC 4LP4A 3MRMA 4EN3D 5LQBH 2DQGH 5AVXB 1G4RA 5F3BB 3QEHB 3U79A 3BVUA 1HDMB 1JHTA 3ZQ9A 4GRWB 4PRPA 2HZHA 2B59B 5C0GB 3HG1B 2ZP8A 4PREA 2AEWA 5FA4B 3NSXA 3BP5A 3KYMB 5AB1A 1H3VA 3RGVA 3CHXA 5IQ9A 2J43A 3F7YB 5HDQL 3CAFA 3VFOA 5E0FA 5LNEA 1PKQA 2OBGA 4FA8A 1L9TA 5B38B 3BWAB 4W9CC 3GXFA 1A9VA 1HZHH 3DJTA 3MODL 5IGXH 5DJDB 3A4FA 3ISYA 1BQ5A 1JD9A 2ZUXA 3BAXA 4GKZB 4PJAA 3TYFA 3COOA 4NQUA 3X2QB 4JZOB 2DTSA 2GCYA 1HE7A 2IGLA 4ZMTA 4HIIB 1N6QH 4OZ4A 1QBML 2JKNA 4LESA 1E7VA 3BE1L 4HIPA 4PY7A 3HIZA 5IM7B 1F11B 3ZE2F 1ZT1A 1S3RA 2ZSVB 4DIXA 2B1HH 1AANA 1HSBB 3H7BA 5DWPA 5AAWA 4U7SA 1S3KH 3RP1A 1WBXB 4HQQL 4I77H 2YXWA 1Z3GL 4MMYB 4PGDA 1OWRM 4XMKH 3CXDH 2JTYA 1YAIA 4JG9A 1VF5C 1XGQA 3K2MC 4GW5B 4GT7A 2R8SL 2WBXA 1CGTA 1MREL 2XLLA 1BFOA 2F1AA 1XF5A 2R69H 3PHSA 2EEDA 4FFWC 5E4OA 4YHMH 1WWAX 3UP1A 5BVPL 5J6HA 5GGVL 1MFAH 3Q05A 1MRCH 4GW1B 3F12A 2EXYC 3VXUD 4Y1AB 3VD1A 3IJ8A 1AGFB 2CNYA 4LCWB 3IWUA 1GGTA 4H44C 2W88A 5IB3A 2N0MA 4EE2A 2O61B 4FLRA 4RMBA 2CALA 2DYSB 5ANHA 2WLJA 4PJFE 2ESVB 3APMA 2E76C 4QTHB 4YBLC 5E2UH 1TU2B 4OKVB 5I16A 5L4JA 3SKNA 3NIGB 3SD5A 3WS6C 4JE4B 4M1CC 4M00A 5FA3B 1U8NA 3HHSB 4X8JB 2DRUA 4G6KL 2NY4D 1BWWA 1TEYA 4GO8A 3R19A 2FWOA 3MACL 3QISA 4QTIH 3HZKB 5KOMC 4I4WB 1XAKA 1THAA 3QK0A 3V6FB 5I1KH 5DGQA 1VESA 4HPHA 2NNFA 1ZDSA 5T1LB 5E6IB 2OL3B 2P1YA 2EEXA 5AW6B 3CN4A 1XB3A 4Q2ZB 3WUWA 4WEUD 5DSCA 1Y6MR 4OH2A 2CBPA 4GUOA 4QT5B 1HU8A 1QUPA 3IFPB 3BP4B 1FLRH 4PJBB 4UNVA 1MW0A 1X6LA 4PM1A 1J88A 4N8VG 4A38A 4Y5XC 1N7MH 3RUGB 4S10A 4YGVB 5HHOE 4KNQA 1RD6A 1WAPA 5B3JF 1N12A 1F41A 2WC7A 5D1QE 4LLQA 3FTWA 1UD6A 3QG6B 1ML0A 4G80B 5BJTA 4Z7OE 1XCTB 3EJRA 1OTUD 3AFLA 3S35H 3KPSA 3I84A 2X4OB 4GMSL 3NGBC 2Y4SA 4F15C 1KIPB 2Y3AA 5EPMA 2X2JA 3LDBC 5C2UB 2XKNA 4HUXA 4D9RE 2AS5M 1SPDA 4FP8L 3ULVC 5H35A 4HGWB 1U8IA 1XVSA 3JWDC 3O45B 4LO9A 1PDKA 3EYQC 2Z9TA 1CFBA 3ZW3A 4JY6B 4R5XA 1N67A 2GABA 4YDIH 3VM7A 1IEBA 1GGCL 3WJMB 3H9YA 2JXMA 2A4ZA 5B38G 4E41B 4IOIA 3DURB 3QRBA 2R0WH 3HBQA 3ZDZE 1MCLA 4F8QA 1QRNB 2NY3D 4EOWL 4LPTA 3N0PB 5SWSA 1X5MA 2F53D 3AREA 5GZNA 5TE6H 4FNQA 4DN3H 4DSYA 3G5XB 3FBQA 3GBMH 4NZJA 2JLPA 2J25A 2AABL 2VQ1B 3VD9A 4UU9A 1UVQB 2XN1A 1T6BX 4LCYA 2GJ6A 5LDSA 3QDMD 1F2XK 1J05A 2CGYA 1BVNP 5D1XE 2XQ0A 3UZEA 5IMMA 4I3GA 3VFMB 4CW1A 1TQBB 4PI2A 5IV2A 3D12B 4OVUA 2IAMC 3LS5L 4GNKB 3SDXF 3VFPA 1RZ7H 4G8IA 5EFIA 2W91A 2WXMA 5CILL 1X5ZA 2R1XA 4TQPA 2G4GA 3TBYB 2X4NB 2GSIA 2Z4TA 5FV1L 4YQXL 2F6AA 4AGOA 2UWEA 1F1GA 4L37A 5CJ8A 3S5LB 2A0LC 2X2IA 3DHJA 2Y07H 5EO0A 5M7QA 1ZV9A 3ML9A 4F58H 3EO1A 4WTQA 1KIRB 5T3XL 5CNHA 4GUPB 2Q8BH 3UC2A 5HVFB 3FZUD 1CGSL 5JDJA 5L4MA 1KDJA 1S7QA 1MFUA 4Q9RL 1NEUA 3OB8A 4KKBC 3EFOB 3W39A 2GSGA 1B2WH 4Z6AT 2W0KA 3LEVL 3EFDL 3NP3A 4K73A 5JNYA 4UTBH 4JBSA 4NP4L 2W8CA 3BIKB 3CCHB 4HH9A 1RIVH 3GBNH 5MHSD 4K94C 1JF1B 4KKNA 3O41B 1ODUA 4Q6YA 2NNRA 3OPZL 3S0PA 5GS0H 1JYXA 4YBQD 1MQKL 1U6AH 2PF6A 3T8VA 1RZFL 1YEJH 5FYKU 1FFPB 4FRWA 1P7KB 5DRZB 3EDKA 4YHOL 5LCVL 2OXHA 2FECL 2NZ1A 2YLHA 2J8UF 2GHZA 1TF4A 4DO5A 2UVEA 3QZWB 2CHXA 3QCTH 4WJ5A 4HF5L 2XYBA 1LLAA 4NRXB 1OP5H 5HVHC 3WIFB 4ABVA 2QR0B 4L3ED 1GGIH 4ZSOA 3L9BA 4PJFB 1TYEB 2ZF8A 5B1AB 4YSRA 2EO9A 1XIWC 2ROXA 2EDQA 4J3BA 3PP4H 3TWCH 2DBLH 4NDMA 1MCKA 1A4JA 4Y7MA 3V0HA 2BCKB 5GJSL 4OBSA 2WD0A 4FYRA 4ZMOA 2WUCH 4N24A 2EP6A 2EYRA 4CU7A 3VCLB 2CJUH 5BQ7A 2FB4H 1U8PB 1XAUA 2FX9H 4MS8D 5AB9A 5FUOH 4ZW7A 2YAMA 4XWOC 3SPIA 4XNQB 4IJ3B 4BXSV 5J9PB 4ZXBD 4WUKL 5E6IC 4JQVC 3SN6N 2WINB 3V5DA 4XHJD 1TZHB 4U1MA 2AEPL 1LO3H 1KCSL 2YAFA 4FNRA 1V54B 4HGMA 4QXVA 2D7NA 5AW2B 3WMQA 4AJWA 3DRQB 4C4BA 1Y18B 3BZ5A 5HHOB 4XNYH 1D5BB 4HFUH 5CINL 2DS4A 5SWQA 1NANI 2RA1A 3QWOB 2F1BA 4RISH 5D1QB 4AIZB 4O2FA 1FH2A 2ICCA 1AD9B 1Z5HA 2ALAA 4Z7OB 3KLAA 3CDCA 4LL9A 4X4YA 3KWXA 4OF0A 4CU6A 4X99B 2BW4A 1PJ9A 3BSZA 1YEEL 1ZWIB 5EU4B 3GIVB 1A65A 3KPMB 5T8IA 3Q8FA 4S1QL 5EU3A 1N64L 3HTLX 5BZDA 5GZOD 2QGDA 4U6HA 4BBWA 1A6AA 3OGCB 1LDPH 3OC5A 4Y4FA 1NCDL 1AGBA 1PKOA 1FO0H 2QT6A 4XGZB 4DGVL 3DVNA 2G5BB 4WY7L 2XETA 2EUWA 1XH3A 4KJWD 5DO8A 4BJLA 1UJ3A 4PWFA 1W0VA 3PPEA 3LS4L 2QVTA 3ZDZB 3QIUA 2WLLA 4AYSA 3QCVL 1JPTL 1TOXA 1T22A 1MF2H 2I9TB 2GBAA 4H8WH 4UT7L 3UTSD 4DVRH 4F7EA 3QJHA 5ESAB 4KJPD 2AKRA 3BFQG 3HVNA 1EAPB 1DBJH 5C6TH 3S5LG 3DPBA 5FF6B 3PABB 1P4IH 1BIIA 5FIEA 2OMZA 2H41A 2RQ8A 3HEIB 3O6KH 4R6UA 3O2DA 4GSUA 3U48A 3I2CH 3MJ9H 4XBEL 1J8HA 3T8XA 1O75A 2RB8A 3DDFA 2NY5L 4N25A 1NGYB 1UGNA 3T6ZA 5CUSH 4ZUUA 3SJVD 4FZ8L 4N0FA 3DIFA 1I9IL 3C5JA 2HUHA 5BS0D 3CFNA 4N2EA 3OKDA 2WZPD 4YFLF 1BQLH 2FT6A 1FAIH 3UO8B 3FFCE 3FTSA 3FBKA 5TF1H 1QPKA 2WBJD 2MNWA 3BPCB 4IOFD 4M7KH 3VFSB 1A9EB 4I2XE 4OIIL 2J4WH 1AIFA 3BQUB 5AAMC 4EIBA 2ICWA 1P84K 2B15A 4PJIA 2ORBL 5FHBL 2PW2A 4IBUA 3D4GA 3P4MB 3MV7A 1UZ6F 1G9NL 1KBGL 3HPJB 2JJSA 1F18A 3FCBA 1NC4A 4NFDA 3QZWG 1Q0EA 3CHOA 3SOTA 2FD6L 1D7DA 1Z66A 2K1MA 4OLVH 3II1A 3PGDA 1KGIA 1AHWA 2BHFA 1RZKL 3ELAT 3KJ6L 4BIKA 3MGOA 1HHHB 3FB6A 2Y1YA 3BPNC 4QYAA 5IW1B 1YEWA 4F7TA 2FH6A 2J88L 4XP4H 2R1WA 3HI1B 4W9EC 15C8H 4IRJC 3IEAA 3KGTA 3MXWL 2UUDK 4XMTA 5JW5A 1U92A 1G4MA 1SM3H 1T04B 1P7BA 4R2GC 4ODWB 2AXWA 1T3FA 3J8F7 5LBSA 2NY1C 2KL6A 4MD4B 4QHMA 1JN6A 4DFHA 3ARWA 2B20A 4CN4A 3LN5B 2R27A 1P5UA 3HB3B 4HIQA 1ID5I 4Q6IB 2R2BB 3RWIB 4A04A 2J3SA 3NCFB 4PJCA 1A4CA 4BINA 3GBDA 4GQ9L 3HN5A 1XGTB 4TQEH 3U9WA 3TURA 4UM9A 3US1A 1IAIL 4MXWL 3NN8A 4N6RA 4YPGA 2NY2B 5E7BA 3KG5A 2WQVA 4OCNC 3DLQR 3ILPB 4GO6B 3E38A 4H88L 4H20H 1T4WA 5T1MA 3D05A 1MUJB 1YC7A 4N1HB 1S7RA 3DX6B 3FB5B 1V7ML 2WQSA 4R7LA 5LUMA 2CMRL 2JI3A 5CLXA 3U46A 3LHAA 3BEWA 2PO6B 3S4SB 5M95B 1WFOA 2RCSL 1F4XH 3RVUD 5AOLA 2BHZA 5EWIL 1JDAA 3WL9B 4NP9A 2VSMB 2FEEI 4NC1C 1YEFH 3I9GL 1ITCA 2MCMA 1G84A 4PV1C 3EIFA 3PJLA 4GLRH 1HNGA 4YSUA 3WJJA 4ZMXA 3IGKA 2P5WD 5AVSB 4L8BB 1TMCB 4UT6H 4ZAKD 1MPAL 1C1EL 3SPJA 4QRPA 3US0A 3SE9H 4APQA 5GGTH 2PPCA 1I8LC 4KNTA 2CQVA 4GINA 4PBXA 5FUZL 4XO5A 5FYJU 1ZJBA 3ZZSA 5CZXD 3NEXA 5HGBB 4FAAB 4H8UA 2VMCA 1DEEB 2VLKD 4WV1A 3ZU8A 3I9PA 2KZKA 1EANA 3MNZA 5DD3H 3EYFB 4S2SB 1DE4B 1BX2A 5C0NC 4EXKA 4JFEA 2D0GA 4TTDD 5I17B 1IC4H 4JPQA 3LRMA 3O81A 2Z8WC 4MNHB 1WEJL 4TQ8A 3ORJA 4MZRA 3VRLF 1JYVA 3U6RB 3W5NA 4PJ8D 4F33A 5FGSA 5DD5H 1CF8L 4AY0A 4XZUB 1PZDA 1HIMH 3RU8L 2JV6A 2E7BA 3OKMB 1CYXA 1QWHA 2FUTA 2GVYA 4FQIH 3FRPB 4HLZG 4FHBD 1PKQE 4L9LC 3V0VA 1J87A 4GT0A 4JM2F 4ZFOB 1EJFA 1YAZA 3MNVB 1JNNL 3DUSA 2VRAA 4OJYA 2APVA 1PZUB 3L3IA 2EE2A 2QPFA 3BPOB 1YMHA 4QF1B 1XSJA 1K2DB 4XMLH 2H32A 1BVKB 4P46B 4AE0A 1T21B 5EZLB 3VA6A 5EZIH 1CDYA 1OAQL 3FFCB 5IVZA 3REVB 4HHGA 5A6MA 1QMUA 4JO3L 1RMFL 1H9VA 5JPNA 4I2XB 4DW2L 1N0XL 3OKKA 4AEFA 5BVJA 4DGYH 2DTMH 1AHKA 4Z7IA 3QWNA 3BQUC 3GZQA 3N85L 4DO4A 2RAMA 2OR7A 5L9DH 2CA4A 4MMXC 2MMXA 2OZ4L 4HJSA 3SDCD 4Z7VA 3RIKA 2D0HA 2FX8H 2NQ3A 2ZF9A 5B8CC 1DUZA 2X41A 3VG9B 4PH8A 5G5DA 3BAKA 3JT2A 4DAGH 2FEDD 4ZOBA 1GGUA 3OAUH 2EDHA 4WFHD 4NT6A 1NIFA 3T2OA 1ZGLA 4HK3N 3FS9A 4PMEA 1Q0XH 5BRZD 4RFNC 1NDGB 2AK4B 2VAJA 1I1FA 1J1OH 2E9IA 4HV8B 3VNYA 2MIZA 2DM7A 3VDCA 2VDRH 1M9WA 2J6EL 2AJ3B 5IMOB 1CYGA 3KDMA 4ONGL 1KDIA 2WJ7A 2WNXA 4O2EB 4OAWA 3PY9A 1SFDA 1O9VA 4IBZA 4HK3J 1A21A 1OPGH 1WV7T 2IOMA 1DP0A 2A9MH 1CCZA 1M42A 1U3HC 2ZOKB 3CLFH 3D69A 4X80L 1ZD6A 3S4SG 5JPMB 4HCRL 4LLWB 3D09A 3U2JA 3QS2A 1NH6A 3WIHL 4OCYL 1EV2E 4YZWA 2XI9A 1FO0B 4CMMA 1I1AD 1KN4H 4MS6A 4PJAF 3AACA 3K6OA 1UKTA 1W72L 4BFGA 2X1OA 1P9MC 2DYRB 3O8XA 1HQRA 4NRYB 5CCGE 2CLVB 2NY2C 3D2UD 3DHPA 3DECA 3LXBA 4QJ5B 5C0IA 1U58B 3TL5A 1A1MA 2X12A 2UY7A 1TJHH 1NCAL 3NP4A 3C87A 1KC5H 2XVGA 1IZJA 1ORQA 3MSPA 3LKNA 4FXKA 2XG5A 2G60L 4PMFA 1YJDH 3BGAA 2UUDH 1Q1JL 4G7SB 3VNZA 4M5ZH 3PE9A 3PV6A 5DJXB 5DUBA 3B2MA 3VFGH 3T9WA 4DPRA 5E8PB 3EUDA 4NUGH 2PO6C 4WW2A 1KB3A 1PZCA 4XRCA 2A1WL 4JW3A 3VFTA 1ZLUH 3P30L 3KPSE 4N0UA 2OI9B 1MZYA 5HDLA 5HGHA 2CLZB 4FKKA 3BO8A 4X9FA 4HX1B 1AGCB 5CAYB 5I6MA 1BFVL 2V2TA 1QEWA 3VD4A 4Y16D 2XPYA 2X1PA 4GI8A 3P2BA 1AGDB 5I5JA 2GIYA 3RIFF 5DD0H 1J48A 4KKLD 5D7LE 1OLLA 5E7FA 4ZX5A 5T5FH 3JSSA 2WLKA 3R06A 5L0QC 1DQDL 1FI8C 1KPRA 3MGTB 3FRPG 4OLXH 3VFRA 2BXZA 3GK8L 4C56A 1F4YL 5EZJA 2E7LA 2YK1L 3IU4H 4YDVB 5IIEA 2FGWH 3GHBL 5SWSE 1Z5YD 5D7JA 2ZCKH 2NR6D 4BFJA 4ZTEA 1CICA 1N70A 3D51A 3QIWA 1LJMA 4N9GA 1JHTB 1IO4C 1WFTA 1Q72H 2RD0A 4KZCA 3SDDB 4PREB 4OCRL 4QRFA 3NAAL 3CSBA 2GJ6E 2QQNH 3BP5B 4FZEH 4D0CA 3UDWC 3ALXA 3RGVB 3OF6A 4LSRL 2YRZA 4Z7UF 2ZNWA 4YSPA 1P7QD 2DW5A 3VFOB 2JKJA 5GS0C 4HUVA 1PKQB 1UFGA 1AYOA 4ICWA 3H53A 2XCMC 3GLAA 3NEEA 5A2KH 1JFQH 1DZ0A 3C8DA 5LG1A 2X53A 3VXRD 3Q44A 4U1SA 4ZUSA 2A74C 2X5PA 2BSED 5HDOA 3TYFB 2ED9A 4MDJA 4XN1A 2CWRA 5HPMA 2UWEE 5KJ7E 2YMTA 4P5TD 5IBTH 2GCYB 4O02A 1F4AA 2WBKA 1BGXL 2Z1PA 3BPOC 4OZ4B 2WTPA 4PY7B 5LGJA 3ARPA 3L4UA 1PZAA 1S2EA 5FO9A 1ZT1B 4P46C 1WICA 1EAJA 3KEHA 1BF8A 5EF0A 3MOBL 3WFEH 4GBXA 2EUXA 5FLUA 1YMMA 2DWDA 3U9PL 2F8VA 3VB9A 5AFAA 3IMSA 1WZ1H 4OJCA 4PGDB 5IBLD 1VZIA 3UYOD 3IVKA 3GSUA 1V3KA 1XGQB 4JPIB 5HYEA 1TQCC 1BVNT 2JMRA 5C0JA 3Q5TA 1BFOB 1DUYA 3KWUA 4AYFB 1ONQA 3FU8A 2AJXL 1EEYB 3MLXL 1EAOA 4YX2H 1WHOA 1IGFL 3F05A 1QRKA 1YYCA 3SBQA 1C9SA 3AY2A 2NRDA 2AERT 1BD2D 3VD2A 2V17L 3FU0A 1GSKA 2Y1VA 5IB3B 3QI9C 3T0EA 4XR8C 3L7FA 4NUJA 3LH9A 1SNRA 4PB0H 4TNWF 3ARFC 1WZMA 1PLGL 5AYTA 3ZDWA 3ECBA 4ZSOE 1RL1A 1W0WA 1GY1A 4NFCA 2MQ0A 3PHAA 4WO4C 5E2WH 3JTTA 5EBMA 5DMGD 3TCXA 1NFDA 5I16B 1BFSA 4LVHB 3SKNB 3DO3A 2K7PA 3WKPA 1U8NB 2ZWLT 2CKNA 3MKGA 2FWOB 3KW8A 2X9ZA 3AG3B 2DB8A 5DHVA 3SBPA 2BNQD 3FT3A 4ZO7A 2CDEA 1UXWA 2V6HA 1R47A 3APDA 2Z31D 3KPTA 1TTCA 4NZ8A 2C4FT 5CSGA 1KGJA 1RU9H 4PD4K 4MNGA 1MJJA 3L4WA 3GJFA 4J3OG 4KVNH 1DJIA 3EJYC 3K2KA 4OCMC 5I24A 1UD2A 1OD7A 1NGQL 1NPJA 4WO0A 4Z95H 4LLQB 5F9DC 4HJIA 5BJTB 3NFSH 1CFVL 2R2HB 3ECQA 4B0MB 4EIGB 1CYWA 4X9YA 3KPSB 1OXYA 3VD7A 3NA4A 4JB9H 1OAUL 5EPMB 4HUXB 4KK9C 4YBHA 5T3ZD 1L6XA 4YHPB 5ACLA 1CU4H 2YKLH 2JB6A 1PDKB 3MV9A 4OM0L 2N7BA 3OG6B 5D7LB 5FKPA 1SBSL 1IC1A 1MNUL 3FKUS 1GKEA 1I3GL 5K59F 4NFBA 4HBCH 3U0TA 1UXLA 2EH7H 1JPSH 1I85C 4XN8A 5HYJA 3FCSA 4YEEA 2Z7YA 4IOIB 3UZQA 1Q9WA 1N2RB 1GC1H 4OCLC 3TO2A 3N6YA 4QGTA 5SWSB 3AREB 3U4BH 1TSRA 5EF1A 5FYKL 1KACB 5LBVA 3L4ZA 2BMKA 2FHBA 3B7SA 3HAEA 3A22A 4O58L 4XVSH 2VERA 1N5YL 3D34A 2P24B 4U31A 4ODSH 1RUQH 3HG4A 4KPHL 4UU9B 3TU6A 1JPGA 1NAMH 4M6NL 4G7VL 3K0YA 1JZHA 2WQ8A 5B21A 1MFDH 2GJ6B 4FOMA 2ZJSH 4A2HA 5B1KA 4JHAH 1IGJA 4JREC 2F74A 4LCCC 3SDDC 1D6VH 1J8HE 3T08A 4BZ1L 3X1BA 4X7TA 1IAIM 4PHZA 3PFUA 3QEGH 5IV2B 2E6QA 1IQWH 2WXLA 4RAUA 5IROA 3UG3A 1DL7H 1ASPA 1T5WB 2JJWA 5EFIB 4G8IB 4JFFA 4PJGA 3MBEA 3DPDA 3VFPB 1CBVL 5IBUG 4Z3HA 5LWYL 2Q2EB 1A7NL 2GSIB 2QV2A 3WKMH 1FRGL 5FFGA 2UWEB 4WCYH 2F19L 4L37B 4Y19E 5I30L 3A24A 2V5YA 5EO0B 2WVVA 4UOW0 1UWXK 3EO1B 4PJIE 3I3BA 4KV5F 1U8MA 3MV7E 4JRYD 4FQLH 2CIIA 2B14A 2C7FA 4L5FE 4F8NA 4PRAA 3STBA 5F7LB 2DJ4A 2AJYL 5INCA 3KPNA 3SY6A 3W39B 4S1DC 3KEDA 4N1CA 5DJAB 1J8KA 2VDQH 5JNYB 1CFMA 2XFGB 4CSTA 1JAEA 1KXVC 1M2OA 1UYWH 3IDYC 2HJFB 4W6WB 3U2SA 1CE6A 5MEPA 3G6JE 3EUUA 4X6DA 4LCIL 2HX8A 5JOPD 2ZUTA 1A7QH 2OXHB 3BZ4A 4LCVA 1QHOA 2OMWB 1BECA 3WUWG 1TXKA 1WE5A 4XP5L 4AYBA 2HFGL 5HI3C 3DX2A 1TJIL 3HS8A 3UGEA 5ANME 5HI4D 4UTAH 1P4BH 4ZSOB 3LZFH 5I1HH 4PJCE 1HZKA 3LYRA 5DJCA 2A6DA 4XE0A 1X5JA 2X28A 2MPAH 5DC2A 5IB1A 1ZT7A 3QP3A 4HU2A 4NDMB 4A39A 4N87A 1SBBA 2GBTA 2P52A 1OV8A 3L6FA 3CSYA 4Z8FH 2EYRB 2W38A 2DLEA 3EKCA 5BQ7B 3EYSH 3EJQA 5D9SA 1DSYA 2VLRD 3FT0A 3V5DB 1MWAH 2EJ1A 1E6OL 2MHAB 4UAOC 1F42A 3IMVA 2E3VA 3RBSA 2Y72A 4FULA 2IANA 3P4OB 1MFVA 4S1SL 3HA0A 2H26A 5C0DA 4MA7H 3T6VA 3EO9H 1J1PH 4WHYH 5SWQB 4KXCA 4BZYA 4KAQL 4O2FB 3CLEL 1SY6H 1YNLL 5AKRA 1A25A 1M53A 4QRPE 5HBBA 3U4KA 1I4FA 3KLAB 3IDNA 1R34A 3CIAA 3HE6D 3OZ9H 4NKOB 4O9HH 4W4OC 4OGXH 4X4YB 6FABL 2XZQH 3VWKA 3TBSA 4GRMA 3WEMA 1IX2A 2KLSA 3JV4B 3GMQB 3EH4B 5BZDB 1M7DA 3Q3GA 1MI5D 5AW1B 3DX3A 4UZUA 3OL2A 1AGBB 4F91B 4HZ1A 3TONA 1Z9SB 1F4WH 3FU5A 3BZEA 3DVNB 2EXYD 4JFEE 5IQMA 5E5UB 3TM6A 3EH1A 3ZY7A 4B5ZA 4HBQA 2CUIA 2VXQA 2CBQA 3LN4A 1NCCH 5C1MB 2RTTA 3QIUB 4KXDA 1XD1A 2H7WA 3JWNG 2A9NL 3OB0H 4LQ1A 3EYOA 2DIJA 1T22B 3S37L 3QUKA 3DXAD 1OQOA 4QLRA 3WXVL 4F7EB 3QJHB 1BMZA 1AI1H 4W9HC 3DPBB 1IBGH 2GC7C 2WZAA 2AXFA 4ADGA 2FO4A 1BIIB 4M1CD 2OMZB 4TSCL 5GJTL 5DUPL 1X5YA 3TP4A 4HISA 3ZT6A 4A2LA 3EHBC 4HSQA 4LSVH 3SCMA 1J8HB 1WUZA 3T8XB 5I26A 4TRPL 3DBSA 2VLMD 1BBJA 2UV3A 1HEHC 3M45A 4L2LA 4TL4A 4ZUUB 4C4KO 3DIFB 3PJSA 1YY9D 3C5JB 4PN6A 3IDIA 3OKDB 4NJ9H 1HHIA 1JTPA 4YHYB 4RFOH 2QMKA 4H0HB 5B3SB 1XGYL 3V55A 3EJUA 4Y19B 2TRHA 4JG0H 2QFRA 1AIFB 1GS7A 5F93C 3JUZA 1CR9L 2ICWB 3WFCH 2HVJA 4PJIB 4ABQA 1PQZA 1J5DA 3CFKA 4V2CB 1BDYA 3MV7B 4MQSB 2XZCH 3Q6GH 4YSCA 4KTGA 2H2SC 1RUAH 3VI3A 5JHMA 3S9DB 2DEXX 3QUMA 1MHHA 1JWMA 3QQ9C 1NC4B 4H1LH 3IS1X 3NRFA 3OMAB 2J7LA 2YA2A 4JG1L 1M7UA 5KYNA 1KGUA 4F92B 5JMRA 3U0WH 1G7HB 5ISZD 1KCUL 1IGMH 3PGDB 5LB1A 4OJDH 1AHWB 4UQ2A 5I5MA 3ULUH 2BFVH 4WK0B 3ULVD 3MGOB 3FB6B 1W80A 3TO4D 2FUQA 4KO9A 3EYQD 3O3BA 2R1WB 5DZLA 3ZXAC 1OP4A 3ILEA 5F8RC 3G6JB 5IQ7H 1HHGA 2VC2H 4PS8A 2PCXA 1YJDC 1GZPA 5FYJL 4OKDA 3EOTL 5JW5B 1U92B 2VQ4A 4YNYA 2IXQA 3LRSB 2Y7MA 1T3FB 1WITA 3H1ZA 3U4EB 1NMCC 4QHMB 1JN6B 1KG0A 2R15A 4NKQB 1JDDA 3WE1A 3CHRA 4J4PC 4MJJA 3Q13A 1M7XA 1D5RA 1P5UB 3C12A 5ANMB 1WAAA 2CXGA 4KTDL 4NN5B 5DK3A 2W9DL 4PJCB 1Q4NX 4PGEA 1LO4L 2A6KB 4I0PA 4UM9B 5CGYC 5KSBE 3NN8B 3VD5A 3T3ME 1GS8A 1I1CA 2FJGA 4YXLL 3HG1D 5C0FA 1BEYH 1RUKL 2C9RA 2DQTH 4J6RL 3FQ2A 1Y7VA 5T1MB 3GNMH 1UWGH 2BJMH 1IJ9A 2HN7A 3ZDXE 1BQKA 3E6HA 4IKIA 3ZZLA 3U46B 3AM8A 4XCYA 4HUWA 4KHXH 2EDKA 3OG4B 2XVLA 1ETA1 2EXSA 1KJ3H 1OKEA 2XIIA 4U6XA 4W9FC 3JTSB 4M9OA 4XNMA 2XWDA 3R0MA 3CVHA 1DANT 5DJ0A 3QPQC 4Z7VF 3RIAK 3K6FA 4QKXB 2X2YA 1C8PA 1ECZA 1Q38A 2H6OA 2LHAA 2Y06H 4QRPB 1IE4A 4IBLT 4KKBD 4BFIA 2IOIA 1L7TL 3Q6FB 4MXVF 2EABA 4YDKH 2DYPB 1PZBA 2X89A 3LZQA 1U95A 1EMTH 2DLIA 4KMQA 2VXSH 1EERB 1YUHA 4JUSA 2BIQA 4C56E 1A3ZA 1CZ8H 1XF4A 3JYBA 4K3GA 3MNZB 4UV4H 1S9VA 3DSFL 2VE6A 3QDGA 3U9UA 4A7VA 4BV1A 3KLLA 3WHE0 1AO7A 1BX2B 1RIUL 2ZX5A 1SGKA 3ZL2A 2XN9E 4MZ3A 5FUCE 3RWEA 1AJ7L 5I6PA 2EEBA 1U2CA 2LV4A 3B37A 1KTBA 2VDQB 4N28A 4Y1AD 1LMIA 3ULUE 4LCWD 2XIBA 1E3XA 4JM4L 4YDLC 4WHCA 5AYUH 2JJTA 2VDNB 3ME0A 3VFVA 1QATA 3CC1A 2GY7B 1ORSA 2HH0L 2P44B 2PWDA 2VXTL 3GHEL 3I74A 3TOPA 2EZ0D 2XTSA 1K85A 1KFAH 1MQ8A 3KYKH 2WV3A 2UY6A 3V0VB 2ESVD 1QFOA 3FYEB 4FN0A 4X5LA 4Q58C 5GPRA 1JCKA 4K9EH 3SIKA 3UTZB 4J3WA 1SF3A 3DUSB 5GRUL 5DJ2A 2WYIA 1SEBA 4IOSA 4L4TE 3CVBA 3L3IB 4M7LL 4MMZC 4P2QA 4PGCA 2IALA 1YMHB 2Y7LA 2H32B 3BSZL 2JFCA 3S88L 1A14H 3C9NA 5T1LD 3VGGA 2G3MA 3EBHA 3Q01A 5E6ID 3ZBMA 1T0MA 4FEIA 3TX4A 5AW7B 4YHYC 2IADA 2HXAA 3KR3L 4LIQL 5JOEA 4GG6F 3OKKB 5BVJB 2VMEA 1YMME 4PJ7F 3ZKND 3FN9A 4FQXB 2D2CC 5HYQA 4MXQC 3R4RA 4UDUA 3ARDA 4L2YA 1S5IL 5K1JA 1EGJL 1PL3A 5DT1L 3BWUC 2R9HC 4QCIA 1DUZB 4KNUA 8FABA 1IC7H 5D8JL 4XN4A 5G5DB 1DEDA 5KBNC 4NT6B 3NIGF 1ZGLB 1RHHA 4ETYA 5FGBC 3VSQA 3N43B 3O2DL 4F2MA 1HVXA 3E1F1 4EI6A 1A3LH 1CXHA 5D4QA 1F58L 1PX3A 2ITFA 3P2TA 2DF3A 4W9KC 4OAWB 5KTEL 4IIQA 4JGMA 3WXWL 1NFDE 5CR8A 1WFJA 3PCYA 1NCWH 4E41D 5FOJA 4GUQA 4K23H 1HCVA 4LAQH 1NGWA 1QRND 2I07A 4OGQC 1AY1H 4OZHA 3R18A 4XI5C 4NZTL 2KDGA 4PS4H 2XWXA 4XNUH 2FIKA 5KSBB 2VMJA 1DVFC 3NPSB 4HMEA 4CMMB 3T3MB 4L5FL 3MYZA 2GI0A 3QG7L 3WDIA 2P45B 1AMXA 2SODB 3GB7A 4H26B 4YLBA 3O8XB 2YAOA 3BCDA 4F9PA 3ETBJ 1IEAA 5C0IB 1VGKA 3RB7A 4TUKH 1JK9A 1A1MB 2X3BA 1DJSA 4JQXC 3ZDXB 3O9WC 4MNGE 5GRVK 1ORQB 1GC1C 4DK3A 3LKNB 4FXKB 2XG5B 3U7WH 2BVPA 1JV5A 1SJEA 4KROC 3NH7L 3ZIMA 4MRBA 4NQCA 1A3RH 3PV6B 5DUBB 4WW2B 4V11A 3OWEA 4XRCB 1E4HA 3LQMA 3VFTB 5AVRB 4PJ9A 4BK5C 1FFRA 5IJKC 2BSDA 3QYCA 9PCYA 3CFUA 4XCCH 5E4EB 5LBSL 3BO8B 3VI4A 3SE8L 1KEMH 3CXHJ 4K71C 1QEWB 5JHDB 3NQKA 3DX8B 4YWGH 3MV9E 3D4CA 4HETA 5IHWA 3H85A 5F2FA 1UH4A 5KZCB 4TQIA 3QFJA 1MXDA 5D2NC 4XPTL 1FORH 2BSSB 3K2IA 2J2ZA 1P2CA 3QHFH 5I28A 2Q3AA 3MFFA 4IW4C 4GAJL 5HYJE 3CIQA 5K9JL 2P43B 4C56B 5EZJB 5IIEB 2MQ3A 4XPGL 1DN0A 4U3SA 4UWQB 5D7JB 1DQKA 1PEZA 4XO4A 5E1HB 2XN9B 4H1LB 3G6AA 2VH5H 1CICB 3QIWB 2O5ZH 4LVOC 2OK0H 1P1ZB 4UQAA 1QI5A 1OM3H 2WPGA 4D0CB 5LN8A 1MRFL 1WLHA 4QI3A 3KWTA 1R46A 2CR3A 2W9EH 1QSFA 5E0QA 4N2OA 4ZODA 4Q56A 2VC2B 4PRHE 4RQQA 1LEGA 2CKBH 4HUVB 4FA7B 2Q76A 1RV6X 1J18A 4JEGB 4JFFE 4PJGE 3U30B 4RX4A 3S5YA 3HHMA 1O7SA 4U1SB 2NQCA 4GO9A 4L4TB 4P23A 5KUKA 4MDJB 2X2HA 5AG8A 1K4DA 2OQJB 3BH9A 4O02B 4IDJH 2K4AA 3ZRCC 5LGJB 4FJYA 5ERWA 1NAKH 4IBYA 4DZBA 4EJ1C 4QHPA 1KLFA 1A3QA 1M56B 1I3RB 5HHPB 4MNQA 1BOYA 2EUVA 3X17A 4G6MH 1YMMB 2DWDB 3DK2A 2VXQH 3E6FA 1PCSA 3QUZC 5HHXL 4G11A 5HHOD 3HMXH 2HLFC 3IVKB 3S3BB 5JW4R 3GSUB 4FQXC 4WEMB 5D1QD 5C0JB 2K6WA 5F7WC 1EO7A 3W2DL 4L1DA 2IFFH 3VDBA 3D39A 3OHXA 4L3CB 4X6DE 3B2UC 3U7AA 2Z91A 1B88A 4NAQA 5GHWL 1NINA 3OTTA 2B08A 3S36X 2GYSA 2NW3A 4D9RD 2Q8AH 4YGAB 2UXFA 2DD8L 5F0MB 2QTVA 4A1RA 2P8PA 3QNYA 2W07A 5C0ND 1IFRA 3QCUH 2LTQB 2XQBL 4LGPB 4HKBA 3ECBB 1OF2B 3HZYA 3BDYH 1A8ZA 3JTTB 1OPOA 1IFGA 1NFDB 1A0QH 3WNIA 1Z2KA 4FCHA 3AWEA 5KVDE 5DFTA 4ZS6D 3CFCL 5CJOH 3G3LA 4RWYL 4QHKJ 2APFA 2WGXA 4V33A 3AWFA 2MTPA 3TJPA 3O6ML 5CN2A 4YS4A 3H4HA 5KYWB 3NDYE 1AG6A 3X14A 1EDQA 3JV0A 3QUMH 2CDEB 3TJEH 3FN0H 3L95A 2AEOA 3L81A 1S9YA 1OAXH 4R5VA 4H8PA 1WVZA 3I9IA 5D1XD 5D71H 3LH2L 2IG2H 4MNGB 3T3PE 3ASOB 1MJJB 3HUJA 3ZKQD 3ZO9A 4P3DA 4NN7C 2IANE 4HAKA 5DZAA 3TA4D 4PJEA 2Y2WA 5C08A 4HPOL 5DC9B 3SGDI 3KYOA 4MA1C 4CN6A 2BRRL 5KW9L 5CZRA 4ZD3H 1BJ1J 2HVKB 3CTTA 4ZOEA 3ZJAA 5E2TL 1NBZA 2IDFA 1INDL 1FH5H 4I3RL 4Y2DA 2ATKA 4UAHA 2B4CL 2EXTA 3L2LA 1WBYA 5F97E 3BQUD 1YPZA 4QJ4B 3LKPA 5IR1A 5HYFA 1X5XA 4HZLB 3B1TA 2F5BL 3MRFB 2OMVA 3HLKA 4Y2LA 3BT2L 3JQOB 2ZOTA 2R29A 3QJXA 2IDUA 1CXKA 3RRQA 2JB6B 3MV9B 3RTQA 5HVWA 5FKPB 4N2FA 1BPLB 4NEHB 4Q0XL 1MFEL 4IGBA 3HCVA 1KT2A 5BMFH 3RKPA 2DI9A 2Z8SA 2JKRM 1FE8H 5HYJB 1W6LA 1DBML 3TV8A 3JWOL 3UZQB 1Q9WB 4DKTA 3LQAH 5B7FA 2VISA 4JHVA 2E7LC 3MLSH 2IWKA 5KVFH 2HTKC 2BMKB 3K91A 3EAKA 1DBAL 1QBBA 2AQRA 2YFNA 3DO4A 3HAEB 4LSPH 1OCWH 1G1OA 1CICC 4BCYA 1JPGB 3IF1A 2VMDA 2MOVA 4X4XA 1VIWA 2CO2A 1HWWA 3ULUC 1IGJB 4S11A 2F74B 3LVTA 2O26U 4X7TB 1GCFA 3HB3D 4ODXA 1E0OB 1YEDA 4PRHB 1JI1A 4RAUB 3QEUA 3TBBA 1CWVA 2YQ3A 1JNJA 4EKJA 3CZKA 4JFFB 4PJGB 2X0VA 3MBEB 1QPXA 3IT8D 3BKYH 2NY2D 3W57A 1A4KA 3CZUB 5FHAL 1E9OA 3D4YA 5C8JA 4KJQD 4BKLB 4XCFL 2X3CA 1WJ3A 4GS7C 5CGTA 3FFDA 3BKCH 2MQGA 4UTCA 2DMKA 3EO0A 4AL8L 1U8MB 2CIIB 2P28B 4LLUB 5F70A 5EMYA 2DN7A 3VI3E 3DV4A 5AZEL 1IAII 2PO6D 4PRAB 1E40A 1F8TL 4IU3A 5INCB 3KPNB 4HAGA 3WOVA 3HI6L 3WFZA 5CD3A 4ZQKA 1E4XH 2IDTA 3B7YA 1H3PH 3CE1A 3ZT7A 3L16A 3MLRL 4JN1L 1T1WB 1OTSC 3HG5A 2W0PA 1TNMA 3GSXA 1FPTH 3HPLA 3UEZA 4F9LC 3O6LH 4A55A 5F7FA 4QGYA 2BX5A 4YSOA 3V0WH 2CR6A 4X6DB 1TQTA 2XZAH 3UAJC 2XY1A 3BZ4B 1I9RL 2FATH 1F3JA 4ETQB 2VGLM 1HE8A 4I13B 4DP4X 3EJZD 3GS4A 4KFZC 1VKXA 5EOQH 1UACL 4OFVA 4ZK8A 5ADPL 3NIFE 5DO2C 2XHNA 2XFXA 1WAAE 2J1XA 3VDAA 3UJJH 1EZSA 3M7FB 1YUKB 2OKMA 5E00A 4I88A 2Q0ZX 5KBKA 1IFHL 4N8UA 5IB1B 5IEHA 3NCBB 1CL7H 4K8RD 1OTTC 5D1ZI 3VTAA 5HP5A 5JHLA 5KVGH 1EA9C 1JGLL 4YSEA 2GFBA 3L6FB 2DI8A 3CSYB 3NSYA 5TQ2L 3I6GA 7TAAA 5GS0D 3BAYA 3RZCA 3R0NA 3L4TA 4RESB 3HG0A 5IVXF 4Z77A 5D9SB 3HMWH 3KXFA 2Q3XA 5E8OA 3HC3L 2WTRA 2JH2A 1ADQH 1QO3A 3T3PB 1NCOA 4UILL 2IANB 3CDZA 3ZO0A 2HT4D 1M71A 5I1GH 3DV6A 1RVFL 5C0DB 1M4KA 2ATPA 4P46D 4D8PB 5TE4L 2CKBB 3FFCD 3VXPA 4ATTA 1RERA 1CO1A 1J0KA 3IDNB 2O5YH 4S1RH 4XAKE 4K9EC 4FI7A 4XBPA 1GPOL 3VWKB 3TBSB 3AB0C 3CVCA 3HAEG 3QEQA 3BHBB 2D3JA 2R4SH 5LHDA 3B3IA 1M7DB 5D70H 3C6LA 3KPQB 4Y8AA 4YHZH 2AVFA 3QDGE 1AO7E 1XSOA 4TNVK 2E9WA 4FNLL 3GKWH 1DDHA 4TVSa 3BZEB 4ONFL 3GSQA 5L6YL 2YD6A 1Y1DA 1TEGA 2OMUA 2NXZB 4XP1L 2EAEA 2Z4QB 2OTPA 3MJGX 3ARGC 2AK4D 4PLJC 3FW6A 4XN5A 3QUXA 3SBRA 2FR4A 1QP1A 1ANUA 3PP3K 4JHBA 1Q9LA 5I6KA 1ZHLB 4DCQA 2DI7A 2FO4B 1X44A 2IGFL 1GIGL 1DBKL 4OZGA 5EU7E 4IMKC 4HW6A 2R0KH 5D4IA 2QKIA 4K55A 4P2QE 5ID0A 1Q9KA 3A5VA 4RGOH 2PLTA 2MSPA 3POHA 2ENSA 4IRZL 2V7NA 2G0KA 3IDIB 4KI5F 4YL9A 2WQUA 3EGSA 1HHIB 1AS7A 1A5FH 4WEBL 4PG2C 3RDTA 1L9OA 2K3TA 3SKOA 3GBEA 4OSUH 5C0EA 1AXTH 1DQML 3WU1A 3F58H 2V9QA 2DQIL 3WNPA 2A6JA 1PQZB 3CFKB 2HX7A 3RE0A 1JUFB 4NSKB 5EBWA 2VZVA 3BVNA 4N0YL 2Q7YA 3VI3B 3E2HC 1M2VA 3QUMB 4HWBA 1MHHB 1HH6A 3Q0HA 5EIQA 1JWMB 2DBJA 4ZG1A 2NYYC 1FL6A 1T83A 1URZA 1B6UA 4KK6C 1EXGA 4FADA 4UQ2B 2QVMA 5LXGL 3B1UA 3MJ7A 1N4XL 2ODIA 5JUEH 1Z32X 2DQGL 2AQ2A 4FXTA 4WWID 1UM4L 5LBGA 4F2ME 2OJZH 3O3BB 1T7VA 1N8OE 2PWHA 2D9CA 1NLBH 1HHGB 4HOMA 2L7QA 4NQSB 2O5NA 3LTVA 4J3OD 2O4EA 2COQA 4AGMA 1ZCRA 2IXQB 1G1KA 3GSRB 4Q9CA 4L0YA 2A2QT 1XH0A 4MJ6A 2CHDA 3FHQA 1KTKE 3OHMB 5A2BA 4WI9A 5JIIA 3TH3T 3L5XL 3NIFB 4JZNA 3RAJL 2FSEA 3X1FA 1YY8A 4PGEB 3QARA 4OZHE 4NIKB 1KCBA 4UCFA 1LQSR 2CBMA 4I0PB 5LDUA 3BVDB 1LO0L 3IJ7A 4OFDA 5AG9A 2P49B 2FJGB 3TH4T 5C0FB 1J5IA 4DF9A 1EBPA 1IKFH 1NIBA 3RGVD 2YD7A 1JZ8A 3LNFA 1BLNA 2HN7B 4J1UA 2OZNA 3QXWA 3E6HB 3QAZB 3H9HA 4XCYB 3MRJB 2IVFC 4D7PA 4HUWB 3D2TA 2JTDA 4OCSL 4N2IA 1V10A 4I77L 4TV3A 4NQCE 1JWUB 1K3ZA 1DVXA 1KB5H 5H4ZA 4XMKL 3ULSA 4YFLI 3PV7A 3HW7A 1B0RA 1FNGB 2JCWA 2XZZA 1P4UA 5DJ0B 1BFTA 2G5RA 2H0EA 2JWYA 4NJAH 5GGQL 3ZYIA 2OSXA 2X7LA 3KGSA 3OMIB 3L7EB 2L7EA 2IWGA 3BIAX 3PHQA 5JXEA 4BFIB 2AV1A 4WDIA 3QDJA 1WWCA 3DVIA 4GP5B 2IQ9H 1LO2H 1OGTA 2Y5EA 3QFJE 1U8CA 1XXFC 3NIDF 5KVDL 3QPXL 1JG9A 4QKTA 3THMH 1MIMH 3DOSA 1GR7A 1F90H 2HRLA 1UA3A 1IBBA 1XF4B 5BW7A 5GXBB 1S9VB 3GDCA 2VE6B 2NXYC 4RMUA 5CLYA 3HRPA 4YXHL 1PLCA 4E5XA 3RWEB 1NCGA 4MA8H 1FNSL 1CDBA 5B1JC 4MBRA 2SEBA 5JZ7D 2VR9A 2NXZC 4IM8A 3C60B 1OCZB 3NACH 4JO8A 4M4PA 2BH0A 3QJUB 2VZSA 3CH8A 4K7PX 4FFZA 4UQBA 3C09B 1QTPA 3ECUA 3MV01 2QGEA 4NZRH 1FLRL 2UY6B 2KQMA 4AJ0A 4XO8A 1DR9A 1GHFL 2HYMA 5HHMB 5JLZA 1N7ML 3EGDA 4ODHH 2C9QA 2CGRH 1TCRA 1SEBB 1EO8L 4P2QB 4NNXA 4PGCB 4MASA 3LIZA 5I9QB 5FW8A 3TBCA 1OAZH 3C9NB 1G6RA 4HJ0C 1BP3B 1T0MB 5SX4I 3WY1A 1G1YA 2IADB 2C7UA 4JFVA 4RRPA 1HINH 4MNQE 3CMGA 3CUPA 3F65A 1S7VA 3MTXA 2YC1A 2R59A 4NX0A 2KS0A 3QJVB 3RLSA 5DLML 5HYQB 2VL5B 2EEFA 1MG2C 3Q8AA 3ARDB 3KCPA 4YDIL 1FHNA 5ITBL 4HKJA 1FYTA 4QCIB 5E08H 3WHXA 8FABB 2E46A 1KJ2A 3DX7A 2ZYSA 3KPSD 1I82A 4QWWC 1SF5A 3MHZA 3O4LE 1L9PA 3VXQA 2FBOJ 3TBVA 5TE6L 1RHHB 5F7EH 2HMIC 4X6CA 2PXYA 1KENH 3WTTA 5KJ4A 4F2MB 5MP6H 3GBML 4YVNA 1SOSA 1KTLA 2APTA 3ROOA 4QXWA 5F1IB 4DP2X 5HDWA 5EC2A 3UACA 2I7OA 1NBCA 2ZG2A 3IJYA 2CM6A 5J6GB 4B3EA 5D7LD 1J9QA 4LQFL 5EG6C 2DAVA 1MCIA 3CFIC 5A2IH 1NCIA 4IIQB 1BM7A 2IF7A 3IETA 3UYPB 1Q8MA 2E86A 1P6FA 4HA1A 2AV7B 1ID2A 4KOCA 5FW7A 3M46A 1FZMA 1NGWB 2P5PA 3K8KA 2I07B 3MCLL 1J8SA 1A6WL 5SWSD 3B2VH 3ARED 4OD3L 3BP6A 4OZHB 3TIEA 3BVVA 5DD1L 1EFXA 3H8NA 2EIJB 2FIKB 2MOQA 1TQWA 1T5XA 3P1VA 3B9KA 3CQPA 1RJCA 3FXIC 3U25A 3DTXA 1XT5A 5HDBE 4Q6KA 2GJ6D 1IEAB 1VGKB 2Q8BL 5IQLA 1AGEA 1JK9B 1SJVA 1XFPA 4ZW3A 1UFUA 1VLXA 1S5HB 1E5AA 2I25N 3WTYA 3TBTA 3LQAC 4PJEE 4NQDE 3BSHA 5C08E 1JV5B 1SJEB 4XMZA 5CLTA 4NZUH 4HJJH 4NQCB 1IAKA 1KYAA 1OEZW 3GXPA 1MDAA 1T03L 3FF7A 3B9VA 4J3SA 4PJ9B 2FJSA 3ECWA 2DICA 3JBG7 4GFTB 4NKMA 3H42L 1E30A 1FV1A 3D7PA 1YPZE 1KY6A 1UA6L 3UGUA 1XH2A 5LAPA 3QQ9D 1L9SA 2AQQA 1W6WA 1Z9PA 3QB7C 1SXSA 1U8HB 5SV4A 3FUEA 4KDTA 2VW4A 3BUBA 2CO7A 4Q14A 1FNHA 3EGXA 4FERA 3QFJB 3AGVA 1AZNA 2BIPA 4FQ1L 2J2ZB 1P2CB 3N1QC 3AT9A 1MJ7H 3QQ4A 2HVBA 3A6CL 3A21A 2ZXGA 3C5SB 5D7SH 4EDXA 5I5RA 1BVOA 5DA0B 5C3IA 5CCKL 3QRGH 1H15A 2PR9A 4LLYA 3LH8A 1DN0B 4KDVA 3TWCL 4ODBD 4U3SB 2A77L 4Z7WF 4M7JH 1YEIH 3NCMA 2NPLX 3BAEH 5ECGA 5FFOA 5A1AA 2XUWA 1INEH 1G7LB 2WUBH 4KITB 1BAFH 3H56A 1XMEB 2G9HB 3O0RL 3GJEA 2B5IC 4TUUA 2FX9L 4J4PD 3KL0A 1TJGH 4G9FE 3C60C 5GGSY 1V27A 3FQ1A 1UWEL 3IPEA 4M5TA 1YG9A 3TA3C 3U7YH 4AM0Q 5IG7A 5IHUL 5LGKA 3CVHL 4RQQB 1LEGB 1F2QA 2Q76B 2IWEA 1FFOB 1PBYA 2PWEA 1VCBC 5D55A 4B9KC 5DU7A 5I0ZA 4XMWA 5HHQB 4P23B 3HUJF 4PJXA 1FFQA 1UG9A 5DR5H 3B3BA 5IFJB 2I7SA 1K4DB 2WO2B 3BH9B 3TTSA 2X6BA 1TTFA 1RZQA 1ZLWH 5ERWB 1CQYA 5E03A 3WNOA 4DZBB 4LAJH 4XTRD 1KLFB 1A6PA 1JIBA 2CIKA 2BNRA 1QWNA 2BOBA 1TZIB 3I3DA 3MNDA 5I5IA 4MNQB 2H47C 4Z9KB 2H1PH 2ZOWA 2C26A 5FFLA 5L4FA 3QPQD 3RVWC 1HSAA 4GKOA 3MKKA 1X7TA 4X9IA 5B3NA 1G7PB 2APXA 3T8MA 1GXEA 4PBDA 4ES8A 2IMMA 2Y9RT 2BZ7A 3PUUA 5D6DC 3KLHC 2CNZA 4HSAC 3UTTA 4UOQA 3HKFA 2W92A 3HZMA 3SBWA 1KB5B 4OF7A 2Q7AA 3OHXB 2P4AB 3O4LB 5JIHA 3UIZA 3VWJA 2Z91B 2ZXDA 4LNRB 5GS3A 4NKDA 1A6UH 1QA9A 2B3RA 4PTUA 5F7AA 4DVRL 4P9MH 5E56A 3T4AA 5H4YA 4PR5A 4OU3A 2Y5TA 3D33A 2P8PB 5IOKA 3AQDA 3QNYB 2W07B 1OSEA 4WW1B 5DEFA 4TTGA 2W59A 1CB4A 3L5HA 3VO0A 3O6KL 4GAGL 3I2CL 1DSFL 3MJ9L 4HKBB 3HZYB 2UZIL 5J0BA 2OJEB 4G5AA 5J56B 2R2EB 3NPZB 5KS9A 2E27L 3O6FA 3K6NA 4UB0H 3NJVA 5CUSL 2ETWA 3IK2A 1CT8A 2VR8A 4LPXA 3QIUD 4QRTA 1PG7H 1BQLL 2CJ3A 3M1BA 3N1FC 5GS1A 1A7OL 1FAIL 3RFRA 4PPTA 5TF1L 2IQAA 5IEKB 4M7KL 3S6CA 3X14B 1BV8A 3MJ8A 1DJXA 2X6UA 1S9YB 2H5UA 2F7QA 4N86A 1R33A 5HDBB 2ZCLH 4BFRA 3IXAA 3WY4A 2ZWYA 2UVFA 3V0EA 2LAAA 4HYTB 4PRIA 1J8HD 1W0YT 3BD3A 1AOZA 1K9TA 3C2AL 3RYMA 4P3DB 2ICEA 4NQDB 4PJEB 5C08B 4IKNA 3MROA 3UP6A 3KYOB 5DTFA 1WCBB 5AD0A 2EE9A 1OP3K 3UJIH 1EO5A 5DHEA 2EE3A 4X98A 1NBZB 5DMJB 4Y2DB 2ATKB 4Y19D 1ASQA 1A22B 4ODVH 1WBYB 4G1EA 2VITA 1YPZB 1SMOA 3LKPB 1LP9F 2XRAL 3RY6C 3SKMA 5IR1B 4URTB 2YZ8A 2OMVB 3LAFA 3MV7D 3OBAA 1CGYA 3QEQE 4L8CA 3F7VB 4R5TA 2XT1B 3G7TA 4JN2A 1NUFA 3UPCA 3IWVA 2DM4A 3SHSA 5KSUA 3OV6A 1NC4D 1A6VL 2Z93A 4FNTA 1NIDA 3ZMEA 4LLAA 5BV7H 1MOEA 3HCVB 1KT2B 3DJZA 4ZW5A 5FK9A 4KO6A 3KD4A 5DMIL 2DH3A 4CU8A 3SZKC 5LLIC 1KELH 1MAMH 3QJTB 3VB8A 1GAFL 1S7TA 1LWHA 2B1AL 2F7IA 2R2CA 1E4KA 3IGAA 2NSMA 1R3HA 4OJAA 4DTGH 3GI8L 3PWUA 4FFYA 2HA1A 5FPIA 3WV0A 3O3DA 2A7BA 1TZ8A 4K5NA 4OZGE 4X4XB 4NGHH 5I82A 3CX5J 4KXBA 4G9FB 4G43A 4OCXL 1CI3M 2NZ9C 3T2LA 2I69A 3PDOB 1NJ9B 3MUGB 2CLRA 4XI5D 1YEDB 2R0LH 4M7LT 1WD9A 2GIXA 3BWUF 1ZEAH 1ZA3A 3TJHD 4UM9D 1XGPA 3MOAH 2XOTA 3SOBH 4A67A 5DI8B 1UZGA 4MJ5A 1A4KB 2H9GA 4I0CC 1S78C 1E9OB 2PW1B 3CK0H 1KY7A 4Z0BL 1OAKH 3VGEA 3DA0A 1Z5LA 3M1OA 3FFDB 2NDGA 3SE9L 5GGTL 4AV4A 2J72A 1JZGA 3EO0B 3EJSA 1SMDA 5FB8A 5I23A 3TF7C 4EN3C 3QHZH 1AZBA 2ZQKA 3NUKA 2CDGA 3LQZA 4IU3B 4DOHE 2WKOA 1MAKA 3WY2A 3T2PA 4KMLB 5CD3B 4KKQA 5AOKA 2OP4H 2J73A 5IFHH 4G8EB 4ECNA 3W9DA 1IAOA 4UQIM 3NZHH 4U2ZA 1TO4A 4EUPG 1IC4L 1YEHH 2QQLH 4NQTA 1SOXA 2X4PA 3GSXB 3HPLB 4QRPD 3ZTCC 4OQTH 2BP8A 4HCGA 5JIMA 3PWPE 1UT2A 1NEZA 3TVMB 4PVBA 4XPHH 5FYLE 1GRWA 3HI5L 3CLWA 2IJ0C 5A2JH 4ICXA 1HIML 1QFWM 1DQJB 2DYPD 3IGUA 1KJMA 1HEJC 2X44D 4HWEL 1YNTA 3OKEB 4FQIL 4AZUA 1GYUA 4PLOB 3QQDA 1VKXB 1MLBA 1TMQA 2OMYA 3GSWA 4OZIF 5MEOA 4PVNA 2XFXB 5E99H 3MRLA 1B6DA 3KPPA 4PW9A 5E00B 3RJOA 4JFED 4DGWC 9CGTA 4ANUA 5IEHB 2G3XA 2VN6A 3FMGH 1WAEA 2LW3A 2BIHA 2PCYA 3KYAA 1LNUA 2GFBB 4N0CC 4JCLA 4TVPE 3V9CA 1E8ZA 3ARTA 4U1IA 2QVKA 1RIHH 1AKJA 3RZCB 4HD5A 4OT1H 4CSPA 2K45A 5T1JA 2ZCHH 1FYHB 4DGYL 3BN9C 5B1BB 3V5KB 4OIAA 2V9UA 3KH3A 3O3EA 3ESMA 4Z77B 2ROYA 4GRLA 2WMPA 5BZWB 3IXTA 2YLKA 5HGDA 1AHMA 1QO3B 3CD4A 4MKMA 1FIGH 3WN5A 2P47B 4XCEB 1FHGA 2M2DA 5F96L 3CDZB 1KYOJ 1M71B 3P4LA 4KFMA 2AEQH 4W9GC 5TPWH 3GYRA 3VXPB 3H6AA 3Q48A 1QR1A 2QSCL 1I3VA 2V7HA 5L2JA 3D30A 2KZ1B 2B2XH 3KS0J 4MJIA 2FLRT 2NY4C 4AW7A 1YO4A 3QDJE 4XBPB 3MA9L 2OMXA 2VDRL 4K5LA 1GTFA 3QEQB 5FC9A 3NCYP 4HZAA 2ZWKA 4FQXD 4RZKA 3C75A 3F3HA 1JPFA 3GTTA 3C6LB 1ZLSH 3C08L 1G1CA 3AQZA 2F54A 3SPHA 1T1XA 4X6FA 4PB9H 4M3KB 4NM8L 2A3TA 4KZDL 4TOYL 3N44B 1NGZA 2VRKA 3GSNH 1A8JH 1KFGA 3V8OA 4XVJL 4LXFA 1WG3A 2XV3A 2B7DT 5J3HD 4MQXD 4DCQB 2DQEH 5I1CH 2PTTA 3ZYZA 5I8CA 4OZGB 1KC5L 4HS6A 4Y7OC 2A83A 2QJDA 2Z35A 4P0DA 4MAYA 3ZE1F 4JO4H 3GTVA 4ERSL 1UXSA 2QKIB 1YJDL 3L5IA 5G4MA 1VFAA 1AIZA 4M5ZL 4BWUA 5ID0B 1Q9KB 1WZKA 3FTUA 3I75A 4GXVH 2RBLA 1ZVHA 2VXVH 2NLJA 3EGSB 3ESVF 4PIRF 1MHPH 32C2B 5E9DE 2R29L 3RDTB 4A2GA 2WP3O 1OOAA 4XZ4A 3SKOB 3F6IA 1D5XA 3H2QA 3O8XD 4X6EA 5C0EB 1KZYA 2QPDB 3OQRA 4U6VL 3N42B 4NYLA 2A6JB 2KYIA 1B4LA 2NY3C 1EDYA 3MUJA 4RAVA 4HWZA 4NNPH 1NWPA 5DRNA 5I0DA 4AQAA 3GO1L 1WIPA 3MRHB 2Q7YB 5T5FL 3KCWA 1M2VB 5EUKA 1HH6B 4DOHB 5CJBA 4CC1A 5I1JH 5IHLB 1FYTE 4BSJA 3MZGB 3IN2A 4G1MA 1FDLH 3C8HA 4AX3A 3BRDA 1KV7A 4F5CA 4NRZA 1X7QA 1I9EA 2A9CA 2JKXA 1OALA 3MJ7B 4ZFGH 1EK3A 3DMMA 2ZCKL 2YPLA 1S9KC 4X6CE 2OLDA 4HULB 4LF3A 3VXSA 5JHDD 3PWPB 4M6ML 1H8NA 2XTJE 1DFBH 1YNKH 5IMKA 2D4FA 4PEEA 4AYDC 4FZEL 3TVMC 5KZCD 4FDWA 2GHWB 2RH0A 5IB4B 1MFBH 4BA8A 1R5VB 4OCWH 3DYOA 2LU7A 4ZTPH 4C56D 1J9TA 3KLSA 4FNUA 5DEJA 3FZUC 3MRIA 3TGXA 2WLYA 3S34L 2GSMB 2FSEB 1VDGA 4R7XA 1YY8B 2A4EA 3MRDA 3L5JA 5D7JD 2IEPA 2XN9D 2NNAA 1LE5B 3NK4A 1SDYA 1CICD 3LZNA 4NERA 5LGHL 3MLZL 3QIWD 3HNSL 4U4BA 1T89C 1EZUA 4XN2A 4JKKA 4WWNA 3ULUD 2FJFA 3K6IA 4WU5B 4TSBH 1TYRA 3A67L 3WNJA 3OF6D 3PL6B 4N8VA 4NUQA 4YBQC 4J1UB 1AZZC 1R0AH 4UV7L 1J0YA 5EU6A 1E7UA 1YYLH 3H9HB 4HC1H 2VM4A 4ZFZA 2BS8A 1U41A 1IM3A 1R19A 1WZ1L 4L4TD 3AXHA 4GMTL 4N3UA 3DYMA 4DKEL 2ITCA 1BJ1H 5EU5A 4YFEA 1Q0YH 4U0RC 4N26A 5HJGA 3C8KA 4JDTH 1CQKA 1MWOA 1YEKL 3NQIA 2BY2A 3ZK0A 1QKZL 2X7LB 3PPSA 4Q89A 5JTWA 4YX2L 1HCYA 1V55B 2YGPA 1WP6A 5D6CB 4ZX3A 2YKKA 4QUOA 2AV1B 5DRWA 4WDIB 2K7QA 3QDJB 2FEJA 2CRYA 1RK0A 2XVBA 3OC8A 3IJ9A 4D9LH 1YMMD 1U8CB 1JOIA 3AW5A 4LLDA 4PB0L 4KKCD 1OTSD 2G0LA 3TT1H 4FYSA 1SHXA 5JHLL 5FWRA 4QEGA 4K7PY 4X7SH 5EZOH 2ADYA 2V5TA 4RNRB 5D93C 1IZKA 5I1AB 1NGPL 4L4VA 4C4UA 3VFUA 3IU3A 3NFPA 4Y2OA 1UM6H 1UKSA 2ADFL 3DI3B 2SEBB 1C7TA 1R3KA 5I73C 3BESR 4GIAA 4ZNCD 1V7NH 2J1WA 4XO9A 1HWGB 4CILA 5DO2D 35C8H 4DPCX 1TO5A 5GIRA 5K9OA 4RH4A 3IGFA 3SODB 5D5MA 3UADA 1EIBA 2HTLD 1OTTD 4HXAH 2ARWA 3MLVH 5JLZB 3EGDB 4D3CH 2F1EA 3UG5A 1NOFA 1DVTA 2QGBA 5EIIG 3LD8B 3N1PC 5AW5B 1HEZA 4PJXE 4NNXB 4WRLA 4Z95L 3SDAB 3LEYH 1LEIB 2EECA 2Q6WA 3UAFA 2C4XA 2W9LA 4DVBB 1A64A 4OGAD 1KF9B 1LYQA 5E9DB 1G6RB 4XXWA 1X5AA 2WCPA 4KJWC 3IGLA 3MYJA 1NFIA 5IHBA 3V95A 2BNRE 2KPNA 1TTUA 2QADB 2NUPA 3V8CA 4AGQA 5AVTB 3BVTA 2LFEA 2XG4B 3CUPB 1S7VB 3NA9H 5ITFA 1CU4L 2YKLL 2X2UA 4LOEA 5F1OB 2ZUVA 4F93B 2Y69B 4AEIL 3ZKSD 2DQHH 4FQQB 4WWKA 1YQ2A 4TF4A 2C9SA 5EEWA 2EH7L 5C0CA 4HKJB 1FYTB 2O5XL 1EUTA 3WHXB 4RGNE 1KJ2B 4DUWA 3UTTE 4TPRL 3BAJA 5EF2A 1BYNA 1GC1L 2YRLA 1RURH 3VXQB 3TBVB 3U4BL 4N9OB 2E0PA 4U1JA 4X6CB 4XVSL 1CG9A 4L1LA 1N0LA 3QJFB 4WI5A 3OSVA 3ROOB 4BQ9A 3IFLH 4BA0A 4NXKA 5EC2B 1L7IL 3FQXA 2XTJB 1NAML 3MV9D 3IJYB 4FTDA 4JFXA 1MFDL 2DL9A 2WBJC 3IPFA 4IOFC 1YEGH 3PXLA 3NZ8A 1D6VL 4IHOB 5JIKA 2DQFA 4F57L 2HT2D 5KS9E 2H4EA 2XPGA 3OX8B 1OCRB 2DJSA 5HYJD 1A7RL 1GGBL 4PLJD 1D6EB 5CM1A 3UYRL 5JHAA 2HRPL 2ZKHL 4B50A 1A47A 1FZMB 3FF8A 4L1HA 1M9SA 4R96B 4WSGA 4Y9FA 1O7VA 2E4TA 2D7PA 3BP6B 5GSVA 1RFDH 3TIEB 3UX9B 2HJKA 3DARA 1X5FA 2XV2A 4W70A 1S46A 4YSTA 5TD4A 3ZTJG 1QPPA 4NN6C 3B7TA 5HHNA 5IB5B 4HWBL 5E8NB 5BV7C 2X6CA 3QWRD 3U1PA 4K3JH 2QPSA 3ZSSA 1G9ML 4JFZL 4K2UH 4LOUC 4MQ7A 4X2UA 2AAAA 2BSRA 5KYXA 4JFPA 4H4NA 4PRIE 5C86A 1E27A 1GZHA 1XL4A 3H3KA 4R84A 4WHYG 4XXCA 5DD6B 1T0NB 3KVPA 2ERJB 4PRHD 3OXRA 5IROD 3PL6C 2GTWA 4HALA 4PVMA 4JFFD 3MBED 3U1QA 2KQNA 1IAKB 4A6YH 4JKNA 1Z9MA 3V7AE 3K6DA 2H2PC 3IM1A 5FYLL 5JR1L 4CSZA 1UYWL 1EWHA 4P2RA 1FV1B 4KXZI 3MZTA 2AW2A 4E5XG 4N2GA 4XMPL 2BDNL 5C0AA 2F61A 2EDLA 3D6GA 3SGKC 2H1XA 3QR0A 2YSSA 4KK6D 2WZ5A 3K46A 3UZVA 3LZLA 3QS3A 3TT3L 4C8XA 3EGXB 1KIQA 4UTAL 1FQ9C 3TN0A 5D2LF 5ILTL 1A66A 1N59B 5I1HL 3C6SA 4B3VA 4Z18A 3D18A 1H15B 2MPAL 2QBWA 4LLYB 4TVPL 4XOAA 1JP5A 3PREA 2X1QA 4BWWA 2YPKB 1QBMH 4N2MA 2OTUA 1EDHA 1DANU 2LLGA 2LLNA 5HTSA 2JNZA 3RWDA 2V2WB 1LWRA 2FTAA 3VXUA 1MEXL 3GJEB 4KRPB 4YFDB 3QFDA 3GMLA 1CE1L 5IJCC 4ZAKC 4MD5A 1K6QL 4NO0B 2XBZA 2VM9A 5MI0C 4HQQH 4RRPG 5HD8D 1Z3GH 5AB2A 2BOCA 4AQ1A 2Z3FA 4Y88A 5H94A 4X5QA 1BOGA 1H19A 2J1KA 1AZVA 5CZXC 1VEMA 2R8SH 1AR1B 4U1NB 1MREH 2F8OA 3DKHA 4G42A 4HIJB 4K0OA 4MA7L 3EO9L 4PJXB 4J6IA 4WTZA 4ZZFA 5FDYA 5GRXG 4LRIA 2CM5A 4E36A 3GSOA 3OZ9L 2ED6A 4NLAA 4O9HL 4X4KA 3SDAC 3GMPA 5FW6A 2F7PA 4N6QA 1H3WM 2NY7L 4JS7A 3B9DA 3N41B 4TTDC 3WAKA 4KKPA 2EDJA 5MERA 4XP9L 2BNRB 3QO0B 4FLSA 2BOBB 4JR9L 4K15A 4PJHF 3WG7B 1BQSA 3HS0B 2YGQA 3LKSA 3ABGA 4ONHA 4PJ8C