3E1ZA

Crystal structure of the parasite protesase inhibitor chagasin in complex with papain
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
109
structure length
109
Chain Sequence
SHKVTKAHNGATLTVAVGELVEIQLPSNPTTGFAWYFEGGTKESPNESMFTVENKYFPPDSKLLGAGGTEHFHVTVKAAGTHAVNLTYMRPWTGPSHDSERFTVYLKAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase inhibitor/hydrolase
molecule keywords Chagasin
publication title Crystal structure of the parasite inhibitor chagasin in complex with papain allows identification of structural requirements for broad reactivity and specificity determinants for target proteases.
pubmed doi rcsb
source organism Trypanosoma cruzi
total genus 23
structure length 109
sequence length 109
ec nomenclature
pdb deposition date 2008-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09394 Inhibitor_I42 Chagasin family peptidase inhibitor I42
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2020 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3e1zA00
2FO8A 2H7WA 2C34A 3E1ZA 3M86A 2OULB 2WGNB 2NNRA 3M88A 2NQDA 3PNRB 3CBKB 3CBJB
chains in the Genus database with same CATH superfamily
1XDTT 2V5MA 2Z6FA 3CSFA 3ES6A 3FONA 4FD0A 5F0LB 1KIQB 1NPUA 1ZGLB 4G6FD 4ZYKB 4RMVA 1X6LA 1D5BA 4PGBA 1J18A 4XMVA 2I7OA 5I1LB 1OGTB 3IPBA 1M9SA 4L3AA 4LIQE 2KLTA 2VAJA 2ZOOA 2E3VA 4J3TA 4NWUH 4PLJC 1X4XA 4IBTA 3VFOA 3DO7B 3FSZA 3L4TA 4N2IA 2MMXA 2GBVA 4Y5YC 1A1NA 4JZNB 4W6XB 4AGNA 3FFCA 2H2PC 5AW5B 2WXGA 3SJVE 3SQOH 4KV5F 4GXUM 1HIML 1TJGL 5DJ0A 4NKQB 3E6HA 2NY5C 3NN8A 4KK6D 1OSPH 2F74B 3ULVC 2VDOL 5AAWA 1ZHKA 3GMPB 5DHEA 3WIAA 3HC3L 1CT8B 5ESQA 2R2HB 4AQZA 4LASL 1MVUB 3ABLB 3N42F 1WZLA 1NZRA 4O5LH 5KYUB 2IXQA 4LSSH 2YD9A 4L3EE 2Q8BL 3X12A 3D05A 3FO1A 3SJVD 5AUMA 5HBBA 2WIIB 1FHNA 4JJOA 3OGCA 4DFHA 2Q20A 1U8JA 3H6AA 4TUJA 3FUIA 4GO8A 5C0JB 4IOFD 4XBMA 4YPJA 3FO0H 3KCPB 5EDSA 3LN9A 2XFGB 3FT3A 4QOKE 1RHHB 1HHHA 1OT4A 4IEFB 4OGZA 4DN4L 2F58H 2OJZL 3D3VE 4FG6C 4J3XA 1S7XA 4P2QE 3PUUA 3AU1B 5AOKA 3V5HB 4FJ6A 3RTQD 1F4WL 2IG2L 4HSQA 1T03H 4LCWA 2JXMA 2DL9A 4YSUA 3QDME 2VDKH 5CXPA 3SKNA 4C56E 5A1AA 5SWZA 5TJWK 4GBXD 2YPVL 4KUCF 5CGTA 1OV8A 2H8PA 4QOKD 3IVKB 1T7XA 1I4FB 2XTJD 2WXNA 1ORSA 4PBVC 1PZ3A 4LBEA 2HG5B 4XX5A 1YEDA 3Q1EA 4P2QD 1MLBA 3CMGA 1B2YA 1IAIH 3RZCB 5CFAA 3NGBB 1X5HA 4DQOH 4LDLB 2PYEE 1JGEB 1PX3A 3LIZA 2QDWA 4L1TA 3ULAB 4Q9QH 5LCVL 1AY1L 1PG7L 3IE9A 3I3EA 2IF7A 3PDOA 4N2GA 4NC0B 5GGVY 3PUCA 4DP0X 5D1XB 2F9BT 4QTIH 3I75B 3V0HA 5J57B 5LWYH 2VDRB 3MV9B 2EDXA 4JEGB 2FZ3B 3OBAA 2BSRB 3F7VA 3QE5A 1GJWA 1SBBA 3SIKA 2JK5B 3P2TA 2JKJA 4PRPE 5JZ7D 5EA0H 2F6AA 4K9EL 4KKRA 1JOIA 1WJ3A 3MLRL 2PYED 3WS3B 4MSWB 1C5BH 2BSEA 1A7QL 4NQCB 2OTUA 4E0RB 2BZ7A 3LH9A 1PD6A 1M42A 3W81A 1KXQA 1O75A 4YHIB 3GMNB 4YXKH 1G6RA 2V2XA 5GS2D 1JYXA 4P3DA 1KBGL 4ODXB 2DQJL 4MAYB 1QSFE 5F3FA 4FGMA 3L3OB 4YE4L 4WWOA 5IF0B 43CAB 4BUHA 1QBLL 2HKHH 3SGEH 1RV6X 4F57L 4R26H 3MN8A 4ZUWB 4NLAA 3W0WA 2O5ZH 2LTQB 3T0EE 3CX5K 3WTYA 3B34A 5SWSA 2OYMA 5I16A 1XGRB 3FT0A 4NPYA 3FH5A 1T2QL 2E27L 3CCHB 4WW1B 1RZFL 3CQQA 5CKGA 2QZ5A 5IQLA 5DFVD 4E9QA 4LQFL 4PG9B 5C1MB 3FHEA 3IWUA 4N8VG 4XP9L 1WGVA 4YUEH 4P9MH 4PJXE 4ZSOB 1AXTL 3DETD 4KY2A 4P9HL 1QRNB 2VUYA 2YK1H 3N41F 3QCTL 5AW8B 5I6PA 4KC3B 3E80A 4I4WA 4WHYG 3TEXA 5IY5B 4WGWB 2AMGA 1XGYL 3T0ED 3FAWA 5JA9A 3INUL 4X0NA 3EUDA 3ARDB 1MNNA 5D1ZC 3S2CA 4Z23A 1NOAA 2XV0A 3VAEA 2R51A 2Q3AA 5C08B 4E68A 1KTKE 4WI8A 1UD2A 1TYJA 1D5RA 2V5RA 4BELD 3VFVA 5FF6B 5C7ZA 4TRPH 2AQRA 5DI8A 2VLKA 1CC3A 1Y0LA 3CDFA 4OFKA 1P4LB 4CSSA 4MJ5B 5E9DA 1EHXA 5T1MA 1OWWA 1USQA 2C1OA 3BLPX 1JWUA 4IKKA 3K2MC 4QRTB 3QJQB 3B2VH 4C54A 5I30H 3ROOA 1TQVA 2HSIA 1T4WA 2GJPA 3L9YA 4H8WC 3H7BB 2GKIA 3RX7A 5GPRA 1MWAB 1E28A 5FO2A 1KGCD 2Y7MA 1U8PA 2FL5A 4RMQA 4WO4A 3MV11 1OCWH 1EDQA 3EBAA 2X4OB 2FDBP 4HMDA 2CDEB 2H0EA 5CLTA 4GS7C 2COVD 4LP5A 2Q10A 2ADGA 4NQVA 4YGAB 1MDAA 3OZ9H 5F1IB 2FO4B 3B2MA 4JFFE 2A99A 4OF8A 3HFML 3K5RA 5F0MB 3UP1A 4Z77A 5JXAL 5F88A 1W8NA 4Z18A 4PCTA 3TV8A 4OIBA 4AQEA 5L0QC 2PF6A 3EKCA 2WBWB 4KGLA 1R1CA 2DL2A 4TQ8A 4XXCC 2O5YL 4FA8A 1U4EA 3VGEA 2EKJA 4E5XG 2DW5A 2X89D 3L7FA 3MLPA 4UOZA 1GAFL 1OTUC 2R9HC 5FM4A 1TZHB 2J1ZA 1B4RA 5CCHE 5ESAB 1YNLL 4FFVD 4H5SA 2VJXA 2UWEF 3L9EA 5FIEA 3UPAA 3QQDB 1DN2A 3HLAA 1BYNA 4ZOAA 4RGMB 4DAGH 1CYWA 4WHTA 2BNRB 3K1DA 1CD0A 4WW2F 4XMLH 3NPSB 3U4EB 4FZ8L 1QFWL 4X6DA 5D7JB 1XH3A 1KNOA 4Z5RA 2HT2C 2BP8B 4J3OC 3SGKA 1J88A 5AZ2H 4CKVX 1JXDA 4MX7B 2AV7A 4WDIA 2NY3B 1NCHA 3GSVB 2PWEA 3PL6B 3ZW3A 1DVFA 3BP4B 4UQ2A 4HKJA 4LSPH 4UQ9A 1S5IH 4JKPH 3FCTB 5JPNB 1V27A 1A7NL 3BP6A 4ZRGA 4ZW7A 4YN3A 4XMTA 4GYBA 4YFLF 4AIZA 1DBJH 4OJEH 2EDRA 4ZAKA 3WUWG 3PLYA 4XMZA 4DGUA 5AL0A 3UJTH 3VWJA 2YQGA 4RNRB 4FCAA 2CKBH 3LCYA 5BUGA 2WZ5A 1RJLB 4AYEC 5FCUL 4I0PD 5EFIB 1AANA 2DQGH 1KT2B 2CQVA 2VERA 3BESR 1JK8B 4P2RA 5DS8A 2YARA 1GGCH 3KPSE 1EZLA 3NA9H 1U8MA 1XCQB 1KYOK 2YAHA 2AK4E 2BFVL 2UUDH 4L2YA 4NRYB 4XBGA 5K1JA 1OL0A 5IEHA 4L0YA 3ATAA 4HEPA 3GINA 1S8DA 5MP6L 3OB0H 4OLWH 5DD0H 5JHDA 2OMYB 1USZA 3MJGX 3B8SA 4M5YL 4OD2A 2V9QA 2YEZA 1E6JL 4QYAA 2LU5A 3C6SA 3U7WH 5HHQB 3QEGL 2FE0A 3VMNA 5JQHC 4G6FB 1FZJA 1NIDA 1BAGA 2OZ4A 3WJLA 3V0FA 5FECB 4HWEL 1UATA 5DZLA 1A7RL 5BS0A 4POZC 1HXMA 4MNGB 2BHUA 5JMRA 3IETB 2AK4D 1HXYA 2WXQA 5IMMB 4P2YA 1HS6A 2X1XR 3Q0HA 3QUGA 5BNXD 2EYSB 2DF3A 1EO8L 4GNKB 4XMKL 3J07A 4FJYA 1NEZG 1HILA 5ACLA 2R29H 3SDDB 4X5PA 5FYLH 3QIBC 5E8PA 3HZKA 1N6UA 4C8XA 3LKQB 2G5RA 1BP3B 3OAUH 2WQRA 4UNUA 4ETQB 4FA6A 3ARSA 1G5AA 1L5GA 2X42A 5AB2A 1CK0H 3ECQA 3DK0A 1BQHA 1B0IA 3TFBA 2MQ0A 2WP3T 4ODUB 4TF4A 1KOAA 2R4SH 5DO8A 2HKFH 4QRQB 2AFNA 3FTXA 4FXGA 5EZIL 3QG7H 4NQED 2YD7A 1LO3H 5E94A 2VRAA 2GUYA 3WUZA 4IIQA 1Z9PA 4XMPL 3SCMC 3STLB 2K0RA 2X4SB 5IV2B 5DC9B 1ASOA 2CUIA 3T4YB 5AB9A 3GSWB 3Q13A 4JX0A 1SYVA 4EBQL 1X4YA 3F2LA 3BDYH 3OAWA 1SHWA 4JM2B 3WEXB 1HINH 1O9VA 2FD6L 1NDMB 1PL3A 4W6YB 1JK9B 1M7IA 3KPTA 3QPXL 1N18A 5D96C 3RWGA 1DBMH 1QZNA 3BVNB 4ACTA 3RTQB 3QRFM 3J7HA 1KJ2A 3NP3A 3VD0A 1LE9B 4Q6IA 4POYA 2H0JA 3G5VB 4ZXBD 3ZDZE 2NXZC 4GBXB 1T4KA 2EDOA 3JTSA 1BWWA 5L7XH 1XAUA 2XTJB 2F08A 1BLNB 3L3JA 5G55A 4HX1B 3V6BR 5AVWB 3LQZB 3WFBL 1A6ZB 3MKGA 1NQBA 2XZQL 4AQ1B 4JZJC 4GG6A 1A6AB 3RDTC 4DKDC 1NCUA 2QQNH 1Q90A 2SODB 3ZDYE 1BIHA 1WITA 2Y5TB 3O8XB 3F65A 4EUPG 3O41A 4R7VA 1WWAX 4OZFG 1U58A 1NBQA 1X7QA 3GKWH 2BZDA 1NAML 2OKMA 2J43A 3MCLL 5CP3H 4Z7VF 1MJ7H 1BFOA 1A9BA 5F6HJ 3U30C 1NBZB 1IQWL 5ECGA 5BV7B 1CLYL 3QNYA 4L1HA 1FYHB 4PP1D 4UOQA 1LMIA 5B8CC 1HH9A 3B5TA 5I9QC 4FQIL 3QNZB 3QYCA 3NIGE 1W0WA 4LEXL 2YRLA 4P2OD 2OTWA 2O6DA 5E5RB 1IO4C 3NZ8B 2DJUA 2NX5E 3INOA 4PYGA 1LWRA 3EH5B 5EO1B 4OGQC 1KIQA 3IS0X 1KN4H 3KR3H 1ZGLA 4ZYKA 5DEZA 4JG5A 3KPMB 2XY1A 1KUMA 1L0QA 1XL6A 2CALA 4YWGL 3K6NA 4M6AA 1PEWA 4GXFA 1OGTA 3LIUA 4P48A 5I1LA 1XD1A 3Q6GH 4CSZA 3DO7A 5AOZA 5DMGD 5KAQG 4WHYH 4HS8L 4KMLB 4H0LC 5TPWL 4YXLL 3PDGA 1JFHA 2NX5D 4JZNA 4BYHA 3KBHE 2H3NB 4GI6A 5H37G 3CQFA 3TIEB 4HP5A 3S2AA 1TF4A 4HQQL 3WO4C 5GZOC 1XSOA 2F74A 1FN4B 2R0WH 3GMPA 5BW7A 5EH1A 4ORGB 1CT8A 3RE0A 2R2HA 4X5WB 1MVUA 5CGYD 2D31B 1E27B 3V7MA 4Z7UE 3IFNH 5KYUA 1JL8A 3DTUB 4G80B 1E5ZA 4PRNB 4L8BB 3QEQB 4FKEA 4Q74A 3T08A 4PRHE 1EXGA 2P5EE 4KTEH 2WIIA 2CLRB 3MLXH 1P4IL 3ZHFA 4XO3A 1NCOA 3F84A 2HYMA 4P46D 5C0JA 1LO2L 4PSRA 1XBRA 4MDJB 4I88A 3NJXA 3KCPA 4Q7DA 1RHHA 2IV8A 1ZLSH 1JZ2A 2E9BA 2X70B 4Y9EA 5HI3D 4Y89A 4IEFA 1BZ9B 1VB9A 4PMEA 3EFOB 1IC4H 4XPFL 3V5HA 5D93B 1CBVH 3AU1A 4LCIL 3IMVA 2J6EH 1RJYB 2P5ED 1AP2B 3FKUS 1NM9A 2KLRA 2X7LB 4L4TE 4PRHD 4R9HA 1S9WB 5F6HI 4QHKJ 1TZ8A 1FE8L 2DZEA 5HJDA 4EQ3A 5GS3A 3QRGH 1DJXA 5B7MA 2ZE0A 2Q3XA 4H8VA 1I4FA 4AQ8A 2NYKA 4P3CH 2OW7A 3X3FH 2TRYA 1YHPA 2CXKA 4GMTL 2MOQA 3SKUD 2HG5A 4WTWA 4AH2B 3RZCA 4L4TD 1BVOA 3VD1A 4LGRB 5AZUA 4F92B 1JGEA 2A73B 2QKSA 3DUHA 1GYWA 4RBPH 3DBXB 5LXGL 2NMSA 3UIZA 1EAJA 1M71B 1KV7A 5D1XA 4YSQA 5DK2B 1KGYE 3I75A 1MREH 4I9XA 3MV9A 3COOA 3H3BC 3P77B 2FZ3A 4F2FA 2BSRA 3MGAA 1XF2B 4GAFB 2JK5A 2XC8A 4HXAL 4RAUB 1NGQL 4EAEA 1Z6JT 2AQ1A 3A4FA 3WS3A 5IOKA 1CIUA 2YFNA 4MSWA 4NQCA 3H4FA 1X9LA 4E0RA 2OI9C 2X4UB 5HGAB 4YHIA 3GMNA 2YAMA 1SHMA 5BXFB 1QLEH 4ODXA 4MAYA 3E9UA 3I50L 3VXUD 3RTLA 1NUNB 3L3OA 3WFZA 2KHAA 43CAA 5IF0A 1X9UA 1ZLWK 2WLYA 3NABL 2ALWA 3NDYE 4ZUWA 5ELIA 3VUAA 2X4TB 1JERA 2OPCA 4G3YH 2VDPB 2WZ6A 1XGRA 2XJKA 1DR9A 3JWOH 3QFJD 4PRIE 5CILL 3CCHA 4WW1A 4Z3JA 3US0A 2LLNA 3CQPA 2WVUA 4FQ2L 3DTDA 4PG9A 4ZSOA 2EACA 2P24B 5I1KL 3JWDC 4FP8L 1QRNA 1U2YA 3V0EA 1UCTA 4R2GC 1Q0EA 1RERA 4XPHH 5DUML 5F7DB 4OFDA 2Q86B 4I0PB 2X2IA 3MZTA 3N3EA 4R7XA 6TAAA 3H0TB 1BWMA 2ZP8A 3BZ4B 1Y6MR 5JOFB 3QULB 1S7TB 3ARDA 4B9JA 1A6VH 1AIZA 1SM3L 5A2JH 3GT6A 2EH7L 3ULVH 4AYGA 4D2NA 5C08A 2E86A 3WE6B 3FN0L 1DANU 3L1OH 4KI5D 3X1NA 5FF6A 2QHRL 3ORJA 4LE8A 5HYSG 1P4LA 4ZTEA 4ES8A 1HHIB 1ZVSB 1FV1B 1ZV5A 2KPWA 3F85A 4MJ5A 4QLRA 4QRRE 3BAIA 5MI0B 3NJNA 3FDWA 1SJXA 4QRTA 5IK3B 2AJXH 4H20H 1XVSA 4XVSH 2V5SA 5DEGB 5T1KD 3FU8A 3UH8A 3G6DH 2R7EB 3H7BA 1MWAA 1WIOA 2YIHA 3CVHL 1Z1WA 1BFVL 3KL0A 1BM3H 3KPPB 4JPKH 1COBA 5F9AC 5A7EA 3H1ZA 2Y9RT 2X4OA 3NH7H 5I1JH 2CDEA 2XBTA 4NM4L 2DTMH 5CSBA 2CUAA 4CSTA 1JZ7A 2KERA 3MBEC 5AVSB 3ZT5A 1BEYH 3O2VH 3UO8B 4N2BA 2ZP9A 5K9JH 3CPLB 5F1IA 2FO4A 3FQUB 1S6NA 1FP5A 4UBDC 4MXVF 1YAZA 2A6KB 4N2FA 5E2UH 2VXVL 1RZ7L 3N9GL 4HIHB 1B0WA 1OSYA 2AERT 2HA1A 2AXGB 2K4WA 4NNPL 4OGAC 4ZOBA 1NBCA 3MXVL 4EOWH 2QPDB 4NQEB 3RUGB 1V10A 3PHSA 5JYMA 1K8DB 4N8CH 2EDJA 2KZKA 2WLIB 3CXHK 5K93A 5D7LB 1KC5H 3MUY1 4XTRD 1TZHA 3MUZ1 5ESAA 2NY1C 4HIJB 4Y2NA 3WLWC 5ESVB 4L8SC 2BX5A 5CCJA 4JPQA 3ZMEA 3QQDA 2GCYB 3OB8A 3QR1A 3BKYL 3BWZA 4N2KA 2WQUA 1QLRB 3CSPA 2BNRA 5KANI 1ZK5A 3MOBH 3BAJA 3U4EA 2BOCB 2C34A 3ESUF 5D7JA 2Y36L 2GQHA 3VG0L 2BP8A 1WICA 4Q4IA 1U6AH 4LHUB 4ZXBB 5I6NA 1I8IB 2R8SH 3J2PA 2F53D 3B2XA 1G5GA 3GSVA 5GISL 3PL6A 4KTGA 4GUQA 3BP4A 1G0DA 3NIFB 3QUMH 4EUPH 1N10A 1G9NL 4Z7OB 1IKFL 1BIIB 4X6DF 3FCTA 4NAJA 4OZFH 4U6HB 3E38A 5D7IB 1I3VA 1CE1H 1F90H 3TV3L 3MCKB 4XPGL 5F70A 2IAAC 1R3HB 4NS0A 2J20A 4RNRA 4P4KC 5AKRA 3RKDC 3ZY7A 1RJLA 1EHNA 4PJAF 1OD7A 5EFIA 1EZVY 1KT2A 1UEMA 2YWYA 4AX3A 3X1BA 3AFLA 1JK8A 3MBXH 5C2UB 2C9UA 1UOKA 4F8PA 4LPTA 3P2DA 1F4YH 2YGVA 4I18C 1XCQA 3QWOB 3BIAX 1JXGA 2ZX8A 4OM1H 3ATDA 4Y5VC 4YL4A 5IUCA 2WXJA 5C0IB 2QR0B 2N7AA 1IB5A 4NRYA 4NI6A 5AVQB 2Y72A 4NWUL 4YSTA 5C09E 2JF1A 4P2OB 1WFTA 3AS0A 4DVBB 2XWZA 4G7SB 2I07B 3LXCA 1EDHA 1DQLH 4DNLA 1KZQA 2YXMA 3Q01A 5EOCJ 3PYCA 3SQOL 5HHQA 3MNVB 2ZIDA 3L3GB 1HL8A 5FECA 4GMSL 5J5EA 3WHE0 4M9OA 1C16A 1OSPL 3BD4A 3KYOB 4MNGA 2A6JB 1HE8A 5AYTA 1L6XA 2DYPD 6CGTA 4TN9A 2Y7NA 4MMZC 5IMMA 2ODIA 2EYSA 5J13B 4Y4FD 1JPTH 2ILLA 4DOHE 2CU9A 4O5LL 4R8WH 5F8QC 2NX5B 1AI1H 4MA1B 4HSCX 1UKTA 2CHDA 3EDEA 3LKQA 4HWNA 3D25B 1T1XB 1OXYA 3BIBX 1XGTB 2WAHA 5C3LD 3FO0L 3L5IA 1JTTA 3MLUH 4ODUA 5FO9B 1ZA6B 2PPEA 3KYMB 2NY0C 4QRQA 1BV8A 4E42B 4JQXC 4N68A 2P26A 2F58L 3BUYB 4LAQH 5D2NB 1IGYB 3LX9A 5IV2A 3STLA 2X4SA 1T03L 3T4YA 4GQQA 2N0KA 3GSWA 1BF8A 3P0YH 2DQMA 4P46B 5IJCC 4N2MA 2OZ4L 3N91A 5IB1B 5TQ2L 4JM2A 5AVXB 1CDBA 1W80A 3WEXA 4Z7UB 4D7PA 1NDMA 3NSXA 1CD1B 4LCCB 1VCAA 3IDGB 1JK9A 4OFPA 3FULA 4KJQC 1IAIL 1DBAH 2H41A 1LVEA 4L2LA 4DQOL 3OKKB 1OP5K 3BVNA 3RTQA 5I18H 3G5YB 4Q9QL 4PJHB 1LE9A 2Z8RA 1EBAA 3G5VA 4QTIL 4G7VH 4ZFOL 5LWYL 3FTSA 4GBXA 4HJ0C 2IQ9H 4B5ZA 3ABGA 2ZWLT 3EJZC 2AZUA 5JIQA 4HX1A 2NSMA 1UH4A 3LQZA 4A66A 3WFHB 1A6ZA 4WIQA 3ZIYA 4AQ1A 2RQEA 5EA0L 3GI9H 1A6AA 3GXTA 3L4CA 2KC0A 1C5BL 3FW6A 1RZ8B 2Y5TA 5E8DH 4UILL 3D33A 3GNMH 4YXKL 4M61B 2OMZB 5IOPB 4FQXC 2YAFA 4WI0B 3N44B 2HKHL 2D73A 4R26L 4A7VA 1NBZA 4L9DA 4CUCA 2O5ZL 1K5NB 1ACCA 2DJSA 2X1QA 1U8QB 1J8SA 2ADJB 3LPPA 4BFJA 4ZG1A 4YSCA 3QNZA 1QASA 2ZKWA 3BLBA 1FHGA 3CLFH 3UCQA 1H5BC 1CR9H 4YUEL 3NZ8A 5KS9E 3VXUB 2ITEA 1CVRA 4UYQA 2YK1L 3QUKB 3ABKB 5EO1A 5FYJL 5TE7H 3GB7B 2MQ3A 4FF9A 4CDHA 4E9RA 1UURA 3KPMA 4LL1A 4WU5B 2ERJC 2ZNXA 3CFCH 5D6CB 3TFKD 2DQFB 3O6ML 1ODAA 3QFJB 3QIWD 4EZJA 4QKTA 2WSKA 2XN2A 4L1LA 3HB3D 3QHZH 1A22B 1RZJC 1G43A 4KKAC 4LEBA 4S0SD 1I7RB 5I1IL 5AYUL 3S9DB 4OSUL 4TRPL 4QRPE 3K91A 2H3NA 2ICWJ 1ZV9A 5T1LD 3TIEA 1IL1B 4W9LC 2IPUG 4ZQTA 2J57A 1UD8A 1FN4A 2OV0A 1GS7A 2PMZA 3B2VL 4PSPA 5I30L 1SXBA 4RH4A 2WVTA 2XTLA 5EN2B 2D31A 4DPBX 5KZCD 1E27A 3OKDB 1AACA 4G80A 4PRNA 4BH8B 5I82A 4L8BA 4QRPD 4BCXA 3V0IA 1OCWL 3QEQA 2CLRA 4Y4KD 4KK5C 3MLZH 2W5PA 5DEJA 2WSDA 4X7TB 1BYPA 3HNTL 4B9KC 4GRWF 4MDJA 3NMEA 1X5KA 3OZ9L 4HJGB 4CN1A 3QZWB 4HOWA 5T1KB 1QKZH 2X70A 3ZU8A 3RNQB 1BZ9A 3EFOA 3P9LB 3DI2B 4KI1A 3BEVB 4TMPA 1RJYA 1NFIB 1AP2A 2X7LA 2NSXA 1WWBX 2CJ3A 2ZD0A 1S9WA 1AGDA 3ESOA 3AY4C 2VMDA 4AQAB 1S7UB 4J6RH 5J06A 4R4ND 2YR3A 3MXWH 1ZV2A 4H25B 1M6UA 2OYLA 2RACA 4MXWH 2EEBA 3TWYA 1OT1A 2FJHB 3SBWC 4AH2A 3RGVD 2XWXA 1I1CA 2GEEA 2CDFB 2WO2B 1GY2A 2A73A 4OD1H 5L2KE 1DLFH 3DBXA 4ZTPH 4XMLL 5DA4A 1P5VB 4XCCH 1M71A 5DK2A 1WT5A 4GLRI 4F3FB 2HCZX 2X89A 3P77A 2BERA 5DEFB 1DQIA 4NX0A 3BUQA 2ADYA 5AZ2L 1XF2A 2VR7A 4LSTH 4WTXA 2K3HA 1PIFA 1W8OA 4RAUA 4YBHA 3GRGA 3BUIA 1M53A 4FMVA 4KXAA 4MJ4A 1M7XA 2ICWI 3BYTA 3MFFB 1S5IL 4JKPL 5KVGE 4UCFA 2XT1B 2X4UA 3S35X 5HGAA 3UBHA 1WG3A 4BUQA 1CVSC 5KSAD 5BXFA 3HG5A 4WUUB 3U36A 4HPOH 3AC0A 1UGNA 2E7CA 2J88H 3VSUA 3CUPB 3BPOB 1FCGA 3UJTL 3BPNB 2VMJA 5CEXB 1YRKA 2ZOKB 3WEOA 2DBJA 4WKZB 2F53B 2Z0BA 2DQGL 2X4TA 4AMXA 4HCIA 4MVBD 3TC9A 4BE6A 5KJRH 3KLHC 1GGCL 2D7MA 5HY9B 3NA9L 4K3GA 1S3RA 4ZJ9A 3T2NH 1BOGB 1NGZB 3ME0B 5JW5B 4HCFA 2P24A 4BWUA 4IRJC 2O72A 3FB7B 3KVDD 4M7KL 5C0CB 1I8UA 4I13B 4OLWL 2HJKB 5DD0L 4AKPA 1E9PB 5F7DA 2Q86A 1ZVYA 4I0PA 1FNGB 5ID1B 5SWQB 1JRHI 3H0TA 3BZ4A 1S7QB 3NJJA 4M29A 2YBRB 3U7WL 5JOFA 2X4RB 2VR6A 1NKOA 1S7TA 1GMEA 3QULA 1R3JB 3NSCA 4K15A 5FDYA 3B9DA 2BVTA 5F96L 1KB5B 3C5ZB 4XZ4A 1SEQH 5I8CB 3S35H 1IT9H 1NJ9B 1T1ZB 5DMJB 1L7TH 4LLYB 3WE6A 3ATBA 5GQBA 4BZ2A 1VLXA 5BCAA 5I6XB 3OLDA 2J8UE 4BQCA 1JD9A 3T8MA 3JTBA 1OEZW 1HHIA 4PV9B 1CL7H 4HMCA 2J7LA 2R29L 2EXYD 5FYLL 5GRUH 1GGYA 3TZVD 1FIEA 4M4PA 4OLVH 2I9LB 4HKBB 4NPJA 5D72H 1EUUA 1IGIH 5HJGA 5IK3A 1R46A 1VHPA 4F7EB 3NEXA 5F72S 2CBOA 3SZKC 4X7CC 2VDKB 5DEGA 5J89A 4C4KO 4AJYV 4W9FC 1J9RA 2OSXA 1CK0L 5FM5O 2DYPB 2R7EA 5MHSE 3BHBB 4N0CD 4BE5A 3QCVH 2MOVA 2R4SL 1ES0B 2NY4D 4S1RH 2HKFL 3HW7A 3KPPA 4Y4FB 5TF1L 4FNUA 4RWHA 2XI9A 4O2FB 4AK1A 3TU6A 1MOEA 4O9HH 4Y2DD 3QHFH 1P5UB 5DS1A 4XB7A 5DHXB 4ZUVB 3CPLA 2WNWA 4FEIA 3LD8C 4PJ9B 4RIRB 4R3SB 4BK8A 3FQUA 2QBWA 2E7HA 2PCFB 2EO7A 5DXWA 3MTRA 4RDQF 3ZKXC 5MHSD 3TCXA 3BDYL 1N0LB 4OIAA 5FM8A 3A21A 1U93B 4XNZB 1HINL 3EYVB 4HIHA 4OJDH 1I1AC 5AWNH 5D6DA 1IU1A 4JDZA 4LHQB 5GGSB 4NQEA 2ATKB 3RUGA 1WGOA 4DFIA 1K8DA 1G1CA 1G9EA 2DWSA 2WLIA 3T0BA 1SF5A 4N22A 5D7LA 5DZJA 1DEEB 5J11C 1KSRA 4HIJA 1XCXA 5ERWB 5L7XL 2C9XA 1AOZA 5ESVA 2GCYA 3BVWA 3HG4A 3AY2A 3Q8EA 2P1YA 3Q2LA 4KTDH 1QLRA 4X9YA 3LZOA 3SD5A 4NN7B 2NNRA 2O6FA 2QQNL 2BOCA 1RIVL 3L5WB 3ZGIA 4PRDB 1E43A 4N0YH 3CK0H 4YZFE 1DLHB 3TJHC 1SY6A 1OP9A 2OP4H 2GTZB 2EEDA 4QAMB 4LHUA 4ZXBA 1I8IA 2HX7A 3CH1B 2C5DC 4WEMB 3TT3H 1TQSA 1U41A 3KWWB 3WTTA 4NZUH 3TBWB 4D9LL 4UMSA 4MQXD 2KQNA 1BIIA 3R19A 1IBFA 1EHLH 4U6HA 1UWGH 5D7IA 3UOAB 2D4DA 3HHRB 3MCKA 3WIHH 1INDH 3LB6C 2OYPA 3HCVB 1R3HA 2F8XC 1FLTX 2VISB 3CZNA 4XXDB 3JZ7A 3EJPA 3VRLF 3HMXH 3JWDH 5CEZD 2CD0A 2YEVB 3WHE1 4L8DB 1AVAA 2YHGA 1YPZB 3KR3L 3U9UB 4CA4A 5IKCB 2PWDA 3L8QA 2A2QT 4N2AA 3QWOA 4IBZA 1KXHA 4DESA 3UBFA 3CTTA 5C0IA 2QR0A 5D55A 3Q6GL 2ADFH 1YJDC 4KXDA 1QX1A 5FA3B 2FEEL 3C5SB 3I6SA 4P2OA 3NFSL 3GRWA 4DVBA 1ZVHA 3ARGD 4L05A 3TM6A 4XBPB 4N86A 1MJJB 3VQLA 4FHBD 3RVUC 3JV4B 2AEWA 3T09A 3MNVA 3QHTC 3L3GA 3Q5YA 2F8VA 4D3CH 5J12B 4QY8B 4CU8A 1TT6A 4LLDB 2G75B 4K5NA 2ZNWA 2A6JA 1F6FB 4MS6A 3AGVA 3OG4B 4YDKH 1DJWA 4QJ3B 4ABWA 1IBDA 4EDXA 4C83B 4HJ1A 3KEHA 3B5GA 4FCHA 3FS9A 3H9HB 1RFDH 2NX5A 1DHKA 3FCUB 3QNFA 4NFBA 1Z66A 4KTEL 1C5CH 5T1LB 3MLXL 4NCC2 3RWDB 3D69B 4LRIA 1MI5D 4EN3C 3D25A 1UZ6F 1T1XA 3LZRA 1RUAH 1RK1B 4DZBB 3C09B 4X9GA 4JCMA 5KVDE 5D7SH 4BV1A 4J27A 1RSFA 1PY0A 1E5UI 2CHXA 5FO9A 3ZQ9A 1ZA6A 5KZCB 3KYMA 4OT1H 4E42A 2JLLA 1O7VA 4GAYA 3R8BB 3T6ZA 2X40A 3VFWB 4TLKA 1IC4L 2VLRD 3BUYA 1D9KD 3EGDB 1CBVL 2GTQA 1CGTA 3WGVB 4LARH 5D2NA 1IGYA 3SDCB 3GUTB 4M7ZC 4KZDH 3B3BA 4XP5H 4Y4KB 4ZW8A 2XQYK 3X11B 3WFEL 4P46A 3QRGL 4A7SA 2QTEA 4WFFD 3FJTA 4LCVA 1KFAL 3CC5B 5IB1A 2R83A 3LRHA 4P3CL 3SKMB 3TYGH 1WUNT 5HYEA 4Z7UA 4PV8B 4NZJA 2WJ7A 1XGQB 2BY1A 1CD1A 1FYTD 1S9VB 2YUVA 3IDGA 2OW6A 4LCCA 3UX9B 1TQTA 4ANUA 4XN7A 3DYPA 2HFGH 2FBJL 3OKKA 1ONQB 2BCMA 3KNBB 3G5YA 4L37B 4PJHA 5E2JA 4DH2A 5AVTB 4AMWA 1HZLA 5IM7B 5AKVA 1MHPH 4JM2F 1MREL 3O45B 1J5HA 1F11B 3IN0A 5B3JE 4U6TA 4TPRH 4W9ZA 5L8JB 4ZOCA 5IBLC 1PKQE 3WFHA 2Y7QB 4G70B 2E9GA 1CF8L 4Y4HC 4LIQL 3RGVB 5D1QE 2MNWA 4G6KH 3KJ4B 4YDVB 3LRKA 1VGKB 1RZ8A 3OKMB 2DQUH 3FCGA 3N0AA 3W5NA 4FC3E 1PZSA 3QZLA 2OMZA 4M61A 5TGBB 2CO4A 4MCNA 5IOPA 4YBLC 2JI2A 1QLEL 5CZRA 4KO9A 3BKCH 2RA1A 2NT1A 2IGFL 2NNAB 4R96B 3A4EA 1BLIA 1PZ5B 1JYNA 1VKXB 3GTTA 1K5NA 5FFLA 2PO6B 4G3YL 1KEGL 2ICCA 4ACPA 4XNDA 1U8QA 3FT9A 3AZUA 4XNXL 2ADJA 3JWOL 5AVRB 4YSDA 1R24B 3MUUA 1B6UA 1SMDA 1HAWA 5KSAB 2W0KA 3CFTA 3CIAA 1U91B 3UTTE 1X7SA 4HH9B 2OL3B 3VXUA 3RU8H 3I6LE 4M7JH 3QUKA 4YEFA 4XPHL 1D7BA 3GB7A 3UFIA 4PEEA 1J5OH 3WIFB 2DQHL 4AYBA 4WU5A 2C9QA 1RLBA 5D6CA 2WINB 2APBA 2XICA 5LBSA 2DQFA 3QFJA 1A6VL 2QV2A 3CN3A 5GGVH 2GIMA 3RL2B 5FK9B 2MQCA 4QEGA 3IRCA 1UM4H 4EI5B 5HVHB 1I7RA 4YR6B 3L1OL 2YD0A 3TLRA 4J8RB 4JGNA 3I6LD 3DX7B 5E1IA 3WTWA 4UNVA 4TSAL 3GBLA 5GZND 1BREA 3VI4B 2WWNA 3SPCA 4CADB 1OP3H 4OZHB 2OMUB 4NHUA 4CVUA 3PS6A 3UZEC 1F2QA 1DP0A 1QATA 1GJUA 4DUWA 4MB3A 2AJXL 2FX8H 3CHQA 4H20L 4NJAH 3WL9B 5SV4A 5MENE 4XVSL 3RY4A 5EN2A 1P7KB 1XF5B 3OMIB 3G6DL 3OKDA 1SLVA 2IPTH 3NCMA 4BH8A 2AK1H 4KOBA 2WQSA 4XZUB 1BM3L 4JPKL 3MI6A 1G0YR 4YFLI 1WQVT 3CFJB 5I1JL 2HRHA 1CLOH 2DTML 1LL1A 2X3AA 4FFTA 4X7TA 3C6LB 3ZYIA 4PI0A 3V6ZB 4AIXA 1BEYL 3O2VL 4OJCA 1QFHA 1MJ8H 4HJGA 5K9JL 3QZWA 2QKIC 1E8YA 4NO2B 5ECJE 1AO7E 5FUOH 5T1KA 3EBIA 3RNQA 2JKSA 3DARA 5E2UL 2Y07L 3P9LA 3F7LA 4JPIB 3WV0A 3BEVA 5K9OB 1NFIA 1QAWA 1KTBA 4CJ0A 3KXFB 4F15B 1FORH 3HA0A 1H9DA 2X6MA 3MA9L 2EQDA 3WIIH 4X50A 4HD9A 4N8CL 1W6WA 1OLZA 5DLMH 4AQAA 1S7UA 4EKJA 5K5YA 4A7GA 4BINA 5EEXA 1I9EA 3D39D 3RAJL 1NCBH 1AO7D 1FO0B 4H25A 3FC8A 3N85H 1P7BA 4WWKC 5A3ID 5JPMB 1TTUA 1J9CT 5EMYA 2FJHA 4MQTB 3VI3B 4PCKA 4G1MB 2CDFA 3U6RB 4RFNB 1BEXA 3MOBL 4UYPA 1P5VA 1HQRB 4U31A 4OBSA 4F3FA 3GEWB 4QGTA 5D4QA 1OCZB 2BSDA 4HUXB 5F7YC 3PHQB 4FA7B 5HPMB 1U6AL 4LLUB 5GS0H 2R8SL 4MAZA 2BOLA 3ECBB 5KJ4A 3IFPB 2ORBH 2YRPA 1E2ZA 4CC1A 3U4BH 2F5BH 1U8KB 3KM1A 3QUML 4N1CA 5LNGA 5L2JB 3MFFA 3KPQB 4UT9A 1MWOA 1CE1L 1F90L 5DGQA 3WE1A 5KWYC 3IDYC 4WUUA 1KCKA 5GRZA 5J6SA 4I3GA 6FABH 2X0VA 2ZX6A 4HETA 3CUPA 4Y19B 4PI2A 1YEJH 3O2DA 2QQLH 5I74C 1E4XH 2Y23A 3D5OF 4PJCE 2ZOKA 5CEXA 3FU0A 1A7BA 3NJMA 3GXFA 4WKZA 2F53A 3JVGC 3K46A 3JV5A 3EYUH 3MBXL 5HY9A 2G30A 1QQDB 1HC1A 1F4YL 1S3KH 3TCLB 1LP9B 2DMGA 3O6FC 4AUUA 4OM1L 4RX4D 5G4NA 5DQDH 4YSAA 3LZPA 1BOGA 1NGZA 1B6DA 1RL1A 3ME0A 5JW5A 4LGSB 1SOSA 1CD8A 3FB7A 5C0CA 2EO1A 4Y1SA 2HJKA 4ZFZB 1BBJB 1E9PA 4N90D 3SGJA 2ZAIA 1FNGA 1DQLL 1MFUA 5ID1A 2UV3A 1UZGA 4H0IA 1S7QA 5T3XE 2YBRA 4F33B 2X4RA 1R3JA 3H42H 1I3GH 3ERXA 1KB5A 1GVIA 5DK0B 5I8CA 1NJ9A 1T1ZA 5KOMC 2N1TE 4LLYA 2WLJA 4PLKD 5IB4B 4OIIH 1IC7L 1OTUD 4FADA 3E1F1 1JPTL 3ARGB 3GZOA 4S1SH 4PV9A 3NRFA 4F7KA 3GXUB 1J1OH 5T3ZE 3HZVB 5T3XD 4HIEA 2A4CA 2A74C 3GEFA 4LQ1A 5TK4A 1GZQB 4ZS6D 1KACB 2I9LA 4HKBA 4F7EA 3HS9A 3RY6C 1ROCA 2QTVA 3C8HA 4JFEB 1RUKH 2DYPA 3R1GH 3BHBA 3QQXA 4JQIH 3MLUL 3U1PA 5HI5C 4HUMB 2HT2D 1ES0A 4RRPG 1U9KA 1UM6H 4J3OD 4Y4FA 5DZOA 1YG9A 4JFVA 2V37A 5GS1C 4O2FA 4LAQL 3LS5H 4TVUA 5T3ZD 5HVWA 2HZHA 1A7OH 4IDJH 4PLNC 4Y1AE 1P5UA 1L0XA 5PAZA 1MI5B 4ZUVA 3P0YL 3T2LA 1FSKB 4PJ9A 3O3EB 3VW3H 4RIRA 4R3SA 2PCFA 5EUOE 1N0LA 3MRMB 3E3QC 5KVGH 1GXEA 5E0QA 2XYCA 3WNNA 3EYVA 4YDLB 1VFBB 5IVOA 5EEWA 3PAYA 5GGSA 2VLRB 1U36A 2ATKA 1DBAL 1TXKA 4MMXC 4WF7A 4NQSB 4XAWH 2EYTB 2X2YA 4L9LC 1CFTB 4DT2A 4G7VL 1DEEA 5ERWA 2DQCL 4HV8B 3UDWA 5AG9A 2GFBB 1ACYL 1EVTC 2YO3A 3DWTA 4ILDA 3RUGF 3MTXA 4YDMA 3QJVB 4Z3HA 1QMUA 1FYTB 3V5KB 4HFUH 3GI9L 1GW6A 1S7WB 2LVCA 4NDMA 2ENYA 4TVPD 3S5LG 2UXVA 3NCYP 4WLCA 3L5WA 3ZZ1A 4PRDA 2EJ1A 4YLBA 4N0UE 5E8DL 5LAXB 5B1BB 3QPQC 1NFDB 1DLHA 3GNML 3V6OE 5DC0A 2WWMC 2GTZA 2JB5H 1R19A 3FK3A 5C7XH 3CH1A 1ZGLM 1TPXC 4Y5XC 1MJUH 1RMFH 4P5KB 1J5IA 3KWWA 3RVTC 2IFFH 3TBWA 2HH0H 2J56A 4UM8B 3IGAB 3QIBD 4G7QB 3P11H 4R0LB 5J8OA 1CGYA 3HCVA 1L9TA 1W9XA 2PR9A 3CLFL 2VISA 2F18A 4W6WB 4XXDA 2JFCA 5KBPA 3AB0C 3NIFF 2YAOA 4Z7OF 3G6JB 2C9VA 1U8LB 3QH3A 1FH5H 4P0DA 5TE7L 4L8DA 4J1UB 3BH4A 1YPZA 5D7IF 1UFGA 3SDXE 3U9UA 5LBVA 1J11A 5IKCA 2PP7A 3FOMB 4I7ZC 2UZYB 1F02I 5FC9A 1JNHB 1CB4A 3QXVA 2YJLA 3QIUC 4J23A 1TZOA 3RWHB 3O3DB 4YC2C 5FA3A 2AJ3B 3C5SA 3QHZL 1NCIA 2NRDA 2FO1A 3D1MC 4TNVK 4XBPA 3KLQA 1MJJA 3JV4A 3KW7A 5IHUH 1EHAA 1WEJH 4QY8A 1H15B 2AEQH 1JXFA 4LLDA 2G75A 1Y6NR 2DMKA 1N7MH 3AS1A 2QGBA 2HT3C 3ASWA 1F4XH 4PJFE 4KUZH 2VSCA 3HFFA 5C0BE 4BM7A 3HNVH 4W1TA 4B50A 3OXSB 3HG1B 4C83A 3PWVB 3SE8H 1A47A 1BZQK 1RIHH 1UT9A 4M93B 5CD3B 3H9HA 1KCWA 3WKNA 4WJKB 4RAHA 3QZNA 1Q1PA 5DHDA 5T1LA 3RWDA 1MRDH 4UT7H 2VQTA 3D69A 3KPLB 3MLZL 2UUDK 2FEDC 5HVGB 2LW3A 1QW9A 5SX5H 5D5ME 4ONGH 1RK1A 1N12A 4DZBA 1B2WH 5B3NA 3OB0K 3CX5J 2YUXA 4Q89A 1GC1C 4PWHA 3C60C 4G42A 1QKZL 5KYWB 1LEIB 2XWRA 1OWRM 3VFWA 4A1RA 1XR9B 4ZK8A 2JJTC 2F5AH 3EGDA 3VO0A 5HDLA 3ILPB 4ALAC 3SDCA 3W9DB 1FF5A 1E5BA 1V54B 4Y4KA 2MWCA 4KJPC 4LLVB 5GGTA 3X11A 2DY2A 1J0IA 3HPJB 1Q0YH 4J6RL 4J4PC 2J71A 4Z3IA 1CDGA 2IV9A 3NACL 4J3WA 4BZ1A 3CC5A 4DTGH 3SKMA 5E6IC 2H2SD 4ZX4A 4PV8A 3BWUC 4AE0A 4MXWL 4CVZB 1E8WA 3OHMB 1S9VA 4HIXL 3CFDB 5I17B 4Z7WE 3R0NA 1U30A 3Q6FB 1QYGH 4DJMA 1PAZA 1ZD6A 2EYRB 1IAKB 1ONQA 3SOBH 3OMZA 3F12B 3KNBA 2QT6A 5I1GH 1DLFL 4L37A 4ZTPL 5C0RH 3BE1H 4XCCL 2HTKC 5IM7A 2FVNA 1QSVA 4GKZB 1ZXKA 1LMKA 3O45A 1F11A 3I6GB 3DKHA 4M1CD 1F42A 3D39B 3NJVA 3J27A 4N2LA 4WI7A 2GW5A 2Y7QA 1JGDA 5HYQB 3O9WC 1Z9LA 1CYGA 3RGVA 1SXAA 3MJ7B 2BWIA 3W11D 2J25A 4YDVA 4K3HA 5DJ2B 1VGKA 3OKMA 5GZOD 4NKDB 1X5GA 5TGBA 3NQKA 4HPOL 5I5IA 1L9QA 2J88L 1A3RH 1BZOA 2NNAA 2J5LC 2WVSA 3QJRB 4R96A 3RB5A 1PZ5A 2VM9A 1VKXA 4E41B 2ZUXA 3HLKA 5JOEA 4J3VA 3LHPL 1KXTA 2PO6A 5JIHA 5KJRL 1BMGA 2B15A 4LRNH 4Y16D 1R24A 1S78C 1T22B 3T2NL 5AW4B 1WO2A 5KSAA 3MCG1 3TF7C 5AW6B 1GGUA 1U91A 4HH9A 1URZA 1F56A 2OL3A 5CHNB 5CSGA 4Z7QB 1JGVL 4IHOB 5JTWA 1IX2A 1MRCL 4JAMB 4X4ME 4GP8B 4V2BA 3WIFA 3T0VA 1QP1A 5BRZB 1H3VA 2WINA 4KH2A 4H13C 5DC4B 5JXEC 3KH4A 4FLSA 3FTVA 2MKWA 4MZIA 4S1DC 3QC6X 5JNYA 4EJ1C 1E2VA 2VXTH 1SEQL 4N4YB 3RL2A 4KQ0A 5FK9A 1IT9L 3S35L 1L7TL 5E6SB 1BXXA 2F7IA 4ZPTB 4YR6A 4EI6B 2DEYX 3S36H 1R33A 4GKOA 2VERN 4BXSV 3DX7A 1AKPA 3ULUF 1CE6B 3GLEA 3G04B 3VI4A 4CADA 1NMAH 4QCIA 3QDAA 1Z7JA 2OMUA 4OZHA 3UP6A 3VXSD 5GRUL 3ZTNH 3B56A 1E7UA 3HI5H 4MGXA 2A0LC 5D72L 3TO4D 5L0QB 1IGIL 1WA1X 2IQAA 3WL9A 3H7LA 1FC2D 5HGDB 4F5CE 1P7KA 3DROB 4HS3B 4ZS7H 5EU5B 4HUKB 4PS7A 3CSYB 3EJQA 3PJNA 3I3BA 3S4SG 3QCVL 4XZUA 3GJEB 2WCPA 4HJJL 2ZPKH 4HGKC 1R34A 4J39A 5DA0B 1WAAF 2YKLH 3CFJA 5DVLA 4O9HL 4ODWB 1RZQA 4XOEA 4DGIH 3C6LA 1N8OE 3QHFL 3V6ZA 2E7DA 3A0OA 3BPCB 4XX1E 4FG2A 2Q76B 2WXLA 3D09A 4KI5F 4NO2A 5HHMB 4ZX5A 3P4MB 3FCBA 3MMEB 1FAIH 1KYOJ 4B9FA 3ZQXA 4JPIA 1FBIH 3NSFA 4F20A 5K9OA 5AWNL 5IB5B 4OV6F 4L1DA 3KXFA 4KK9D 3ZE1E 3FYEB 1IBHA 3QORC 2OMWB 1CD9B 2MJWA 4OKVB 5D7HA 2Z7UA 5DZ9A 2ZTBA 3L1EA 5IROA 5EN3A 4WK4B 4X6CF 1N70A 5JIPA 4KV5E 2VN4A 1FO0A 4KKBD 4MS8C 4XCNB 1CICD 1W0VB 2ZUYA 3BJLA 1T5KA 5JPMA 4KITB 3VI3A 4UNIA 2J6WA 1AQ8A 4G1MA 4R2GD 3U6RA 4K23H 4KTDL 3QJZA 4D9RE 2EDWA 3Q7JA 5KSUB 1F86A 2OLDA 3LKSB 3P2BA 3LJ3A 4XHJC 3RVWC 4UTAA 1HQRA 3ELAT 4NUJB 4WWID 1RP9A 4N0YL 3CK0L 1EVUA 3VMOA 4DKEH 3QWNA 2OP4L 4HUXA 1YNTB 3PHQA 5HPMA 5AZEL 3A22A 4LLUA 2XSKA 3TT3L 3T2QA 3ECBA 1D7DA 2UVEA 4XBEH 3IFPA 2PTUA 4G72B 4KXZH 4NZUL 5EF3A 4N0RA 1Y1UA 1NIFA 1U8KA 4C58B 5L2JA 1K5WA 4KX7A 3KPQA 1EHLL 4ZMVA 1UWGL 4ZO9A 3UG3A 4MZ3A 3NT0A 3N1FC 2BY2A 3U83A 3WIHL 1OM9A 1SRDA 4Y19A 5IJKC 1MCLA 1KDJA 2OFQA 2YUWA 3GZPA 3VD2A 5IJDC 1P6FA 3OMAB 3EOTH 3RI5F 3HE6C 4PMFA 3HMXL 3JWDL 3EGSB 4RBPK 5IB3B 1HZHH 4P9HC 4V11A 4HWBH 3ARBD 3DSFH 2ED9A 2R15A 1QQDA 3TCLA 1LP9A 4AYID 4IMKC 5AVUB 3QIBB 4IGBC 4BFKA 2VJ0A 4LPCA 3U9PL 2HVBA 2ADFL 3MODH 4JJ5B 4NYLB 2WXIA 1ZHBB 3ZMRA 3F7PC 2ENSA 4ZFZA 1BBJA 2HX9A 1OAYL 4FERA 2AQPA 3UG4A 5E2TH 5DD1H 4F33A 1MAML 3CIQA 1S9KC 4D3CL 3W3BA 1HYSC 1O5PA 5I75C 4YSOA 5DK0A 4ENZA 3V4UH 2C7FA 3SCMB 5DHYB 1AHKA 2H32H 1F4AA 4YLQT 3BVTA 3V8OA 5IB4A 3H55A 5IQNA 3V4PB 4G7YH 2AQNA 1JJUA 3ARGA 4P5TD 1J8HB 4G1EB 4CC4C 1RFDL 2J55A 3HZVA 3VH8G 1GZQA 3GMOA 4Z7IA 1EJ8A 1EJ6A 2DRUA 5EU6D 2LU3A 2XQBH 2YPLE 1CFQB 5D96B 1UACH 2NNXA 1RUAL 4K07A 4KY1H 4MMYB 5EIQA 3QDGD 4JFEA 3QCUH 4AKOA 4HAGA 1E30A 4G8EB 5D7SL 5M94B 2ZX5A 5FM5M 2VH5H 1EO5A 1OCRB 2VLJE 1GGBH 1E3XA 4OT1L 3BZDA 3RPIB 1YEWA 1ECYA 4PPTA 1MFEH 5F0PB 4XMXA 3EJTA 1CURA 4LARL 1LILA 4K5LA 5EF0A 4XP5L 3WNJA 3N1MC 4OGXH 2DI8A 3NIDF 1MW0A 3B9KD 5DYOB 1MI5A 2IOMA 2Z93B 4JZJB 4IBLT 4L3CB 4LOEA 1OPOA 3O3EA 3QXUA 4TM9A 3F64A 3JWNC 1U4FA 2UY7B 3MRMA 4KAQH 1QBMH 4F8NA 3TYGL 5E2VH 2RAMA 3BSZA 3KGUA 3L13A 4GRMB 2XLLA 1VFBA 3RKDD 4HIPA 3T6VA 2VLRA 3HC4H 3EDJA 1H8SA 4Z8FH 3U30B 4NQSA 2VC2H 1MCCA 2EYTA 4Y88A 4DW2H 5GGRB 3FSOA 1CFTA 3IMRA 3TA3C 4FE9A 3KGSA 3ML8A 3V9CA 1L9MA 2X3CA 3P4NB 1N2RB 4HV8A 2GFBA 4TPRL 2FGZA 2HLFD 1BMZA 5DMIH 3QYNA 1IFGA 1FYTA 2QJDA 1T89C 3WENA 4TQEH 2R0LL 2W81C 1S7WA 4B41A 1MVYA 3F7YB 4G6KL 3IKCB 1CGVA 2FQEA 2AEPH 2XKSA 3SYQA 5LAXA 2DQUL 1NFDA 1P4BH 1W16A 2YSSB 4IMLB 5B1AB 3FFOA 1R6VA 1WS7A 3QFDB 1SJMA 4NBZB 5T3XH 3BKCL 2IADB 3D06A 3E9TA 4P5KA 3MJ6A 3HAEG 5AW0B 4XVJL 1ZJBA 1HDMB 3V55A 4NGHL 4UM8A 2EP6A 4B27A 2IH9A 2F1AA 1MEXH 3IGAA 4GO6B 4M02A 1JGIA 5I73C 4ABQA 5KYYB 4R0LA 3WO4B 3O2WH 5T3ZH 1X9RA 1PLBA 3EOYG 5BZWB 3RU8L 5JIDA 1WWWX 4IRSC 4M7JL 3VQMA 3G6JA 1A1MB 1U8LA 2BCKB 3ZDXF 4J1UA 1J5OL 1ZDQA 4RRPA 5GRXG 1UXLA 4PJIB 1ZLUK 1LEGB 2VDMB 3FOMA 4XX1G 3GLAA 4HT1L 2ICWB 1GYAA 2UZYA 1JNHA 4XP4H 2UWEE 3HE7C 3BKMH 3RWHA 2WCSA 3O3DA 2AJ3A 5GGVL 2YGPA 3QWQB 3ZLQC 1UM4L 1BBDH 4FZEH 1U3YA 4NCDA 1CXFA 1YPZF 2JVUA 2BS8A 1V8HA 1BXAA 1UG9A 2P80D 3AM8C 4FMFA 3APMA 5HP5A 2UY6B 3DXAE 3LPWA 2AEOA 3ZL2A 2JKNA 1H15A 2X2HA 4NJAL 2FX8L 3EO9H 4MB4A 5K9QI 5H4YA 1RJCA 3N2JA 4GUOA 2GJ6E 3OXSA 1NEUA 3HG1A 3PWVA 1KYUA 5A6MA 2IPTL 3T6WA 2AK1L 5CD3A 1NANI 3AQZA 1WLHA 1WP6A 5C6PB 1T2XA 2UZXB 2WNXA 3OLGA 5GZNA 4PJBB 5IWLC 3DXAD 3AREC 1CGSH 3KPLA 4JO1H 2AQ3A 3VXSB 1CLOL 3ASNB 4HAFA 2XRAH 4K5MA 2CCLA 2DH2A 1QO3B 5HXMA 2VWEC 3Q1SL 2GJ6D 2EE2A 3VGDA 5FUOL 1REIA 1LEIA 1MCEA 2QELA 3JBG7 1XR9A 4AIOA 3ILPA 5I5JA 3S5YA 3W9DA 4HISA 3IBOA 4LT7A 4LLVA 1EEQA 3K6DA 2ZYSA 3Q5OA 3WIIL 5AOJA 3QEUB 3HPJA 4X99B 5EU4B 5DLML 4XH2A 4G5AA 1F6AB 2OI9B 8CGTA 1HCVA 1NCBL 1B4LA 1OAXH 1NA8A 5ALCH 2JV6A 4PR5B 1GHFH 1UASA 3VSQA 4CVZA 1MCDA 3CFDA 1DL7H 2V3FA 1EANA 5I17A 2UXTA 1O5DT 3Q6FA 4UV7H 4XAKD 2EYRA 1IAKA 1RD6A 4AT6B 2VUKA 4RGNC 3F12A 2LLLA 3JTTB 4IDLA 1EXHA 4N6RB 2X1WL 1OOAA 1X4ZA 2B1HH 3Q5TA 1JIBA 3HVNA 1FIGH 4GKZA 4TSBH 3LDBC 4NIKB 2EE6A 1AHWC 1IIIA 1UWEH 5JW4N 3I6GA 3D39A 5HPOA 3FQ1A 1F3JB 3AT8A 2K4AA 5GS0L 4I85A 3MBWB 5HYQA 2ORBL 2FUQA 2PP9A 4XOAA 1DQDH 3MJ7A 2F5BL 2JB6A 1E90A 3GK8L 4R2GB 5DJ2A 5D70H 1ZIAA 3CAFA 1J0JA 3RLSA 3K4DA 4NKDA 1IVLA 4UTBA 2VSDA 1GKEA 1PCXA 3CHSA 1D5IH 4F8OA 1YEJL 4DWHA 1WSST 2B3IA 3BI9X 2ZG3A 4XWOD 4RGNE 1E4XL 1DN0B 3MNDA 4WFGD 1V3LA 2IPKB 3UC0L 3EYUL 3PCYA 3FH8A 2GSMB 25C8H 2QVTA 5I8OH 1S3KL 1ZY9A 4HVBA 3BO8B 1Q9LB 4MJIB 1T22A 4IIZA 3W5MA 4ONFH 4PRAB 5DQDL 1T0NB 2H26B 3P0VH 1TG8A 4F27A 4NOFA 2F61A 4J12A 4JY6B 5CHNA 5ANHA 3WKYA 1Z2KA 1WDAA 4FFYH 4IHOA 5LDSA 5F9JA 4AK2A 4JAMA 4APXB 2A77H 1MIMH 1L9RA 2W8CA 2BNQD 3HTLX 4RMBA 5BRZA 3H42L 4BWTA 2VRQA 3ARBB 1I3GL 4O2EB 3MRBB 4PS8A 2BVUA 4N2HA 3DHPA 4PJ5D 1AR1D 4RX4A 1N5YL 5E1QA 5E7BA 3TH2T 4YSSA 1KCLA 4ZPTA 4GSDH 4EI6A 1AZCA 4GAJH 2X1OA 1DJZA 1B9ZA 4OIIL 5EU7E 1CE6A 1WA0X 3WFDH 4LL4A 3G04A 3QQ9C 2BWDA 5E6UB 2G2PA 1J1OL 3LRGA 3OM3B 1UH3A 1PX4A 1GZHC 3LS4H 5SV3A 3US1A 2ZXQA 2WQWA 1KENH 1CDCA 2ETWA 3LMJH 2GJZB 1MPAH 5AG8A 4Z7VE 5HGDA 1EZUA 2G0KA 2MH4A 3DROA 4HS3A 5L88H 1RUKL 2EIDA 3OGOE 3R1GL 2X88A 3CH8A 3CSYA 4XXCA 1SOQA 4JQIL 3SQRA 4OLZH 4AG4H 1BVLB 3VCLB 1OAJA 2IANE 3VI4F 5IQ7H 4QAWA 1M7UA 1UM6L 2HT4C 3IJ9A 3K6IA 5ID0B 3GJEA 4YO0B 5I66B 3NJFA 3RVXD 5JQ6H 5LLIC 4P5TB 1QTSA 3CFQA 3EAKA 5TQ0H 2HRLA 3B1UA 4L8SB 4ODWA 4GT0A 1A7OL 4IDJL 1CGUA 4H1LG 1SJEB 3BPCA 1EH9A 4FNQA 1BQSA 5EU6B 1GPOH 2Q76A 2VKXA 4X7EC 5I23A 3VW3L 4OZ4B 4XNAA 2DLIA 4DGWC 3A6BH 3QDGB 3P4MA 4DK6A 2ADIA 3MMEA 3VD3A 5KVGL 2IAND 4QHUB 4KXCA 4DETA 2V17H 4JKLA 3MV8D 2ATPB 4KKLD 5IB5A 3UYRH 2FIKB 4LP4A 5AAWC 1HQ4B 4X8XA 1HXKA 2CXGA 2OMWA 3KLHD 3HG3A 4LVNC 4OKVA 4XAWL 3B9KB 4IRZH 4FFZH 3M1OA 2PXYC 1UWYA 2E47A 4XCNA 1TQUA 1W0VA 2FWSA 3M1BB 1HEZB 4PJGB 3EFDH 3QGVA 1OTSC 1WIUA 4TL5A 2Z3FA 4KWUA 1TO4A 1DSFL 3X14B 4DCQB 4ANWA 1L7IH 3PHOB 5KSUA 3VXRD 3BQUC 3FFCE 3LKSA 3MUGB 2YMXL 4NM8H 4NUJA 1JRHH 3UJJH 4I18B 5E7FA 1YNTA 2JB5L 3EBHA 4U1KB 5JIKA 4Y5VB 5C7XL 3VI3F 4UDTB 1WFUA 1MFCH 5C3IA 1MJUL 1RMFL 1EA9C 2EDMA 2YBGA 3D08A 4FYSA 1F4HA 2IFFL 5I0VA 1XGUB 2HH0L 3FQNB 4HU8A 1IKOP 3QJSB 3FFCD 2CZNA 4FYTA 3TJEH 3P11L 4APQD 4D0BB 5C0DB 4UZSA 3HAEH 5C0ND 4MCYB 4EEEA 2GC7C 4MMZB 3EGSA 2GUOB 1CXIA 1MG2C 5IB3A 1FH5L 2BFGA 3VXTB 4HWZB 4NN6B 3P02A 4IKLA 1EZSA 1S7VB 2FUTA 3QIBA 3R4DA 5A2LH 5T1DL 1E8ZA 4O58H 1KLUB 5DYFA 4BSJA 2ISDA 2WANA 4HKZB 3LH8A 3QJFA 4JJ5A 1FFOB 1TJGH 1FVCB 2VDQB 4LCWE 4O00A 2BMKB 4NYLA 4UOW0 3V6OA 1ZHBA 2EXSA 1UENA 4KOCA 1GW0A 1R3LB 5SWZE 3UL4A 3HC3H 3QXDB 3D52A 1BJMA 3DOSB 4PD4K 4P3WA 1W72B 4QXVA 4MJ6B 2E46A 1AGBB 1LP9F 1XH1A 2NY0B 2P43B 3QFGA 4PBWD 3MSPA 5DJCB 1I1AD 2KZ1B 5IHUL 1WEJL 1T20B 5JHLH 2PPDA 2AEQL 1RURH 5DURB 2IDQA 1N7ML 4P59L 3SCMA 3EF4A 4UM9D 3GM0A 3KYKL 4X6BA 5DHYA 1KB9J 1F4XL 4KUZL 1SYSB 4OQ1A 3GJFA 3HNVL 3V4PA 1HL5A 2HPOA 3K71A 5FGBA 3DSNB 4FLQA 1RIHL 5SWZD 2M8XA 1J8HA 4G1EA 4PRBB 1F6LL 1GR7A 3NVQA 4PGCB 3KDMB 5DUJA 4DKFH 5DGRA 4O02B 1MRDL 4UT7L 3RWIB 5DJ6B 4KKCD 2ZKYA 1CFQA 1HK6A 2I69A 2OJZH 1JYWA 5C0EB 2CBPA 4ONGL 4MMYA 2EDNA 1I8KB 5B4MC 1B2WL 4G8EA 4ICWA 1F4WH 4KU1A 4OTXH 4RMRA 2EECA 3NP4A 1EX0A 1KXQE 1IJ9A 3RPIA 2F1BA 4G8AC 4WW2B 1QHOA 4LVOB 4EN2A 2F5AL 3ZYJA 3QUHA 2ZONA 3ZYZA 2CWRA 4IU3B 4J2XA 2O5XH 5DYOA 4L3CA 4JZJA 2Z93A 4I77H 2X9YA 2Q9OA 2JKRM 3OD3A 1QWNA 3H9SB 1HCZA 2JCWA 3N1QC 4JG9A 1OSZB 5FKPB 1PGRB 2GJ6B 2UY7A 3LB6D 4DTGL 3P3TA 7PAZA 2FWOB 1T7VA 2GK0A 3AROA 3KPRB 3LEXB 4HGWB 2IFGA 4GRMA 4L4VB 4FQXB 2G2RB 4KROC 1OGAD 1QYGL 2BO0A 2EIZB 3ZOAA 3K72B 1OSEA 3SOBL 2GBAA 3C9NB 3OSKA 4PQXA 2YXVA 5GGRA 3ARPA 1JE6A 3BE1L 4A6YH 5LG6A 1A6WH 2NYYD 4K5PA 5DVPA 1HNGA 1XEUA 4URTB 4WO4C 5E1AB 2X9ZA 2DQIL 1OVZA 2DD8H 3P4NA 1N2RA 1CS6A 3WFCH 4KZ0A 2EUWA 1LO0H 1QW8A 2DIAA 1H5BB 1F8TH 2F15A 2QFPA 3VE0B 4JL1A 3F7YA 3RVUD 3IKCA 1A64A 1QBLH 4F57H 2EZ0D 1G9NC 3PXHA 5E9DE 2LT9A 2YSSA 4IMLA 5FO8B 1KXVC 1ZS8B 2KLSA 3NCXA 1A3RL 2IADA 2AMUA 2WQ8A 2TAAA 1RZFH 1S7SB 4QO1B 4OVVA 3ZGHA 4XP9H 3LQMA 1AXTH 4O2CB 1XEDA 1NFDF 3QDJD 4AV0A 4MXVE 5KYYA 2RH0A 5TDPB 3GHPA 5GZOA 2G5UA 4D9QE 2WXFA 2VABB 2C9RA 3F7RA 5EU3B 5BZWA 1FRGH 1HCYA 2ZOLB 2YAPA 4KPHL 4OAWB 3T1FB 3PGDB 2WGXA 4ORZC 3IPEA 2W1NA 1A1MA 2BCKA 4JG0H 2DLTA 3T6QC 5CGBA 5KVDL 4YLCA 3G3LA 4EE2A 4I1RA 1LEGA 4JB9H 2WKGA 4FHKA 4U1SB 2ICWA 1BAWA 3HBQA 5AVYB 1GCFA 1XHHA 1GIGH 4A2GA 4HJSA 1BF2A 2BLFA 2OTPA 3ULVF 2VXQH 2VXTL 2JKWA 3VWKD 4ODVH 1VGEH 3NZUA 3G6JF 2X6BA 4FTVB 1YECH 3S36L 1OP5H 2X0WA 2DMCA 1NMAL 2UY6A 3H2PA 5ITBH 2BNQB 5E70A 3ZTNL 4YX2H 1Q9KB 3HI5L 3I2CH 3VWJC 5I19H 2DLFH 1KDIA 3Q2WA 3SDYH 3SEPA 2FHBA 5JYLA 1TVBB 4PJ5B 1YCSA 4ZS7L 3FTUA 1AR1B 2OULB 3WEBA 4F80A 4X6DE 4JQVC 2AI0H 5D4IA 2UZXA 4NKOB 3MUHL 3HFMH 2ZPKL 1J0YA 3UZVB 3EH3B 5IBLD 4JRXD 4PJBA 3P54A 3MYJB 1TQWA 2SEBB 3VXSA 4OI8A 1BGXH 4DGIL 3CVDA 5DF0A 3TO4A 1QO3A 4PJAE 2W60B 1F1DA 3V52H 3WD5H 4BFGA 2LHAA 4R5VA 3EZ8A 3IJ8A 3PGCB 1FAIL 4FFWC 4GH7B 5KTEH 4HCRH 1FBIL 4H1LH 2MCAA 5FXCH 3ZE2B 2E5EA 4Y2OB 1TENA 5BQ7B 1IBYA 1KELH 1KF9B 4UQCA 3QEUA 4X99A 2NY6D 5EU4A 4XOBA 1PF3A 3MACL 3FN3A 3E2HB 4P2RE 2DS4A 2ZUTA 1F6AA 2WTRB 4Z7VB 2IPUK 4ZW6A 4PR5A 4GKLA 2KUTA 2AGJH 1QFWH 2QV4A 3NJKA 4ZAKD 4MA3B 3EHBC 5CD5C 2VJ8A 1O7DE 3MV8B 4PJXF 4AT6A 2AXFB 2PPAA 3UIYA 3VXQB 2W95A 5JHDE 3HZ3A 3JTTA 4NUQA 1MDTA 2OR8A 1T7YA 4N6RA 3SDAC 1JNJA 5AAMC 1XXDC 4DKEL 5BO1H 3AQYA 4FXGC 1F3JA 2R23B 5BS0E 1T80A 1X5FA 3PXLA 2M1KA 3MBWA 4LSQH 4MLSA 4XBEL 4IRJB 5BRQA 4UI2A 2IMNA 1DZBA 3B2UD 1I9IH 5E8NB 4OUUB 3JZYA 3ARWA 4UINH 2O4EA 4FHJA 5FCUH 3VXRB 4X8JB 4OQTH 2JI1A 2X9XA 1CG9B 5AAPA 1YC8A 3LZQA 1QBAA 1NH6A 2HVJB 5BS0D 4PG2A 1PZAA 1DN0A 4QXUL 3EOTL 4RISH 4HJTA 5GRJL 3ROLB 5DDHB 2IPKA 2XWEA 3H9YA 1HZHL 4JO3H 4HWBL 4AM0Q 1GGTA 4NQUA 3DSFL 2C9SA 4BFBD 4A63A 4D7BA 5I0WA 4G6AD 1P0SE 3PXJA 1CIDA 1Q9LA 3BO8A 4MJIA 4PRAA 1T0NA 2H26A 4GSXA 1ZT7B 2FH6A 3CN2A 3HZMB 3QEGH 5J1TC 5T5NF 4APQB 3DDFA 3H85A 5L9DH 4ELDA 2FHCA 1Y07A 4K2UL 2GT9B 1E9QB 2Q1EA 4WHDA 3CSBA 4APXA 4FJZA 3PHAA 1ZLVH 2F2HA 2I5YH 1INQB 5E2TL 1UGKA 4OCLC 4U05A 5DD1L 2CGRH 3DJZA 3QK0A 1OLLA 3RWCB 5KBLA 1K9TA 2YA1A 1EO8H 3ARBA 3DO3A 3T71A 4NO5B 2DMBA 4O2EA 3MRBA 4KZEH 1TQBB 4HD5A 4Z7QF 3V4UL 3W38A 2XKUA 3KZ8A 5HGGS 5F9OL 3VNYA 1BJ1J 3LD8B 2XIDA 3K2UH 4B53A 3IJYA 4M6OH 1QTYT 2OMTB 5HYFA 2CBTA 3PFQA 5F93C 2NZ9C 2B59B 4G43B 4OB5H 4LU5H 1I1AB 2XQBL 2GJZA 3SGDI 4XN9A 4GG6E 1UACL 4KY1L 1SPDA 2CE6A 3BPLC 3P3SA 3FZUC 3LRMA 3S8FB 4IU2B 2VH5L 1BVLA 3VCLA 4OCMC 3VG9C 4N2OA 5ID0A 3CWGA 2FQDA 4YO0A 5I66A 4XC1H 4P5TA 1MFEL 4OCSH 3OJMB 4L8SA 2PWGA 5EO0B 4OGXL 4FQJH 1SJEA 5EU6A 5LGHH 2DQ6A 1JVOA 2Y06H 4K3DL 4BGLA 1JZHA 5FW7A 1WA2X 3QDGA 4G5ZH 2AITA 5HD8C 1BXVA 1QBML 1IGTB 2PW1B 3DDGA 2P8MB 3FAXA 4KAQL 4QHUA 3OTTA 5E2VL 5FV2A 1OP3K 5F7HA 2ZCZA 4HK3J 2ATPA 4CU7A 1JDAA 2FIKA 2YQ3A 3EYFB 1HQ4A 2C3HA 3FT2B 3FU9A 3HC4L 2L7JA 3ZPDA 5BW7C 4TNWF 1QPPA 4XNBA 2VC2L 3L45A 4DW2L 2MSPA 3B9KA 3Q8FA 5I0ZA 2Z7ZA 4NNYA 4ABVA 5JW4Q 2ZUQC 3MA7B 2DM4A 3GSNB 1WBZB 4J3OF 5ISZB 3S7GA 3WMPA 3M1BA 4LEEA 1HEZA 4PJGA 3MO1B 3VFGH 3F01A 5DMIL 3RIAK 2G60L 3X14A 1HZKA 4DCQA 4TQEL 3AT9A 3PHOA 1OGAB 3TBTB 4KHTH 3MUGA 4YNYB 4R83A 1NOFA 4ZDHB 2AEPL 5D2LB 5K1VA 3S0PA 5FYKE 1P4BL 4I18A 3MRKB 5CJXA 1DQJB 4MA8H 4U1KA 1CLYH 5T3XL 4Y5VA 1P7QB 2OA9A 1TTCA 3CNKA 4JFSA 4UDTA 5FX3A 3L4UA 4KQ3L 5AD0B 4MD5B 1V7NL 4FQIH 4LEXH 4GRWE 1JDDA 3B7UX 2M2DA 3SZ6A 1XGUA 1ZXQA 3FQNA 1QSZA 5LO7A 1KN2H 2ITDB 3QR2A 3QO1B 4N28A 1MEXL 3TBCA 2AJVH 3MRRB 4UOW1 1WV7T 1QACA 4NP4H 4D0BA 3O2WL 2EEXA 2WSPA 5C0DA 1T1YB 3RVVC 5T3ZL 4PWFA 4MCYA 4KKPA 3RPBA 3GBNH 1FFNB 2WUBH 3NGBC 4MMZA 1UADC 3WKMH 3O3AB 3H4HA 1ZDSA 2GUOA 1FNEB 3VXTA 4HWZA 5D1XC 4QDGA 4R7DA 1S7VA 1KYAA 3QDJB 4XP4L 1KLUA 2BS71 3FOLB 1GMIA 3BKML 3RX9A 4HKZA 1ADQA 1HNFA 1FFOA 2GJJA 1FVCA 1CXKA 1NLBL 4OCYH 2BMKA 3V9FA 4DQAA 3MRHB 1B0RB 4FQPA 4WK2B 5TD4A 1NM4A 3QQ4B 1BBDL 2O1AA 4FZEL 4MRCA 1R3LA 4NC1E 1H0DB 3ALWA 5HHNB 4GAAA 4JY4B 4ZMXA 4NSKB 3QXDA 3DOSA 1W72A 5D4HA 4MJ6A 1AGBA 5DJCA 1SN0A 3K6FA 4JQXA 1T20A 4MLIA 2A9MH 5EOQL 3DX9B 1L6ZA 3RIFK 1NEPA 4M7ZB 3EO9L 1HKFA 1HH6B 2CBMA 5C86A 3CFMA 4NQTA 1SYSA 4NBYB 2DB8A 4X6FB 5MEPB 3VWKB 4ZODA 1L0PA 3DSNA 5D1XE 5CJ5A 4PRBA 2MHAB 3MV9E 4PGCA 1NUGA 3ZDZF 3KDMA 2VR4A 4W9HC 4DEPC 5D4JA 2H7WA 1DBBH 4O02A 1IC5H 2P80A 5DJ6A 3P3UA 1CGSL 2BVQB 4JO1L 2XRAL 3RZCD 5C0EA 2WWKO 3APDA 1I8KA 4G8FB 2ZJSL 4NQCE 4XCYB 4E36A 4V2CB 3WLBB 4MXQC 1R5WB 1D5MB 3CBKB 4M8VA 3GBMH 1L3NA 1WTGT 1LGVA 2RTTA 4JO2L 5EOCL 2V6HA 4MBOA 4WW2A 3ARDC 2D3NA 3SPIA 1PU0A 2R59A 1PZ2A 1N26A 4JRXB 1G7LB 2JTDA 4IU3A 5I71C 4GMTH 1TTBA 4FULA 4ZO6A 1UHVA 2ENPA 3H9SA 3LXUX 4OFYD 1PX8A 1OSZA 2JNZA 5FKPA 5FW6A 4WFEE 2GJ6A 5AEAA 2WHVA 5FW8A 1OAXL 3BN9C 4WHCA 4ZOEA 1BQHG 1E4WH 2FWOA 2VDLB 2AVFA 3KPRA 3LEXA 1DJYA 2VQ1B 1RJZB 1GHFL 3MJ8B 3NAAH 4L4VA 4FQXA 2G2RA 1NKRA 3DJRA 1Q9WB 4NXSA 5JOPE 1DL7L 4MAYD 3L48A 3P4OB 4ZSOE 2P5WB 1N6QH 2EIZA 3K72A 1QRNE 2CAKA 2CDGB 3C9NA 4B96A 3WXWH 2ICEC 4HXAH 3HZYB 1U3ZA 2B1HL 4JPVL 2NY6B 1FIGL 4TSBL 2L04A 4PJAB 3MX0B 3QIUD 5E1AA 2FRGP 4WFED 1UWEL 5IEKB 2BRQA 4JRFA 2EIKB 2FB4H 1H5BA 5C08E 4HG4J 5JOPD 1JVLA 3UYPB 3QB7C 4ODHH 1DVYA 3I50H 1DQDL 5KN5B 2IGLA 1QRND 1CTNA 3O6LL 3J8F7 5D70L 3LH2H 2DM3A 2ZX7A 4PN6A 3KGRA 2GABA 4A55A 2GK2A 2YOAA 1BFTA 1WTLA 3EIFA 2B8OT 5FO8A 3G9VA 4HHWA 1ZS8A 3WAJA 5F3HB 1D5IL 2HT3D 3BAWA 5CILH 1GL4B 1RK0B 4WNJA 4KKZA 1E4HA 4TLTA 4TTDD 5C08D 1S7SA 3S37X 4QO1A 2BINA 3BFOA 3LIZH 5I1DB 5KVFE 4O2CA 2R0ZH 4PS4L 5E6RB 3FSVA 1QI5A 4FP8H 25C8L 2VITB 5I8OL 4LNRB 5CS7A 5TDPA 1IKNA 1MFDH 1R0AL 4ONFL 4BJLA 4LSDA 3P0VL 1UWFA 2VABA 5EU3A 4AUJA 3RWEB 3KYNB 1CGXA 3T1FA 2ZOLA 4OAWA 5CJ8A 1N67A 2D9QB 2O26U 3PGDA 3I84A 4FFYL 4OZGB 5DHMC 3C60D 4N87A 5E99H 2A77L 1MIML 2ZUSA 3QXWA 3FN0H 3POCA 1G7JB 4U1SA 2W07B 3QAQA 5IQMA 4HZLB 1JG9A 2EIMB 2ZUUA 1G6RH 2NXYC 3Q05A 1S4IA 2EDHA 5CKAA 3UYOD 4J4PD 3PL6C 4FTVA 3ET9F 1JF1B 4GAJL 5E6ID 4PJIF 1DCLA 1BA9A 3QUXC 2BXYA 3CHXA 4X8GA 3ZHNA 4QNPF 3S37H 3LS4L 2BNQA 1IFHH 1GS8A 1BFVH 2GTWB 1KENL 1Q9KA 1ZIBA 3LMJL 3V8CA 1MPAL 2P9RA 2JJSC 2BNRE 4LOUC 4PJ5A 3AY4A 5IJVB 1DVXA 2PWFA 5HHPB 3WNLA 5F6IB 1CDJA 4WEEA 2P45B 4AG4L 4OLZL 2P4AB 1WHPA 2DLHA 5IQ7L 5MERB 3SN6N 4AV5A 3FRPG 4QJ4B 5KW9H 2ZOWA 1CXHA 4NKOA 5JQ6L 3UZVA 1LEKB 5TQ0L 4WWKB 3MYJA 2SEBA 3K4AA 3SBWA 4XI5D 3FU6A 2YSTA 3N9GH 3D4CA 4M8QB 1ZTMA 3WHXB 3VRLE 1GPOL 2NY2C 2W60A 2YFOA 3T6XA 2YA2A 4JM0A 2VIRB 2B39A 3AJ7A 4GW4B 5CP7B 1Q8MA 3A6BL 1SJVA 4G8IB 1IGCH 3PGCA 4EKXA 2X4NA 5M95B 3K3QA 1VFAB 1PPIA 2COQA 3BAYA 4NUMA 4Y2OA 5ANMB 3UYRL 4AC2A 3UTOA 5BQ7A 2NY3D 2F7QA 3FUMA 1NMCC 3MGOB 5AW2B 3OR7B 4EDWH 1U0QA 3ILDA 1FL6B 4R97C 3LNHA 2WTRA 4FFZL 4G8GD 4IRZL 4Z7VA 1CQKA 4W9DC 3HG0A 4WSKA 2ZWSA 4W9IC 1AZBA 3OAZH 3IDYB 1HHKB 1AFVL 1CFMA 2XXFA 5HJBA 2DYRB 4MA3A 1UD6A 2LFGA 5DVKA 5FAAA 4J28A 4QXTB 1JN6B 4NAQA 5I74B 1RIUL 3MV8A 4A7TA 1B4JH 2KDGA 2AXFA 2IBGA 4KK6C 3VXQA 5SX5K 3PAVA 3V79C 1L7IL 4HPHA 2Y25A 3ARTA 2F8OA 4HOMA 3TGXA 4NM8L 3ZDWA 4N3TA 1QFUH 3VYPA 3CD4A 1JRHL 4S1DD 1SVCP 3UJJL 3PWPB 1JGLH 2AAVA 2K7PA 4Z76B 2EDDA 4QMEA 2R23A 2X12A 4KFZC 4MNGE 1QFOA 1MFCL 1UZ6E 1DDTA 4IRJA 5B7FA 2W0FB 1CWVA 3IJEB 4OUUA 4IOFC 2V33A 2C1PB 3VXRA 4X8JA 3GTVA 3M46A 2XA3A 3TJEL 1HWGB 1KJMB 1CG9A 4IM8A 3QRLA 2K9FB 3JWOC 3BYYA 1XV8A 2HVJA 3L4XA 5CU9A 4X83A 4Y9CA 5KEZA 2EXWD 3ROLA 3BCDA 3CX2A 4R7NB 5DDHA 3RTQC 3EW3B 4TKWA 2BM3A 2LLGA 2JJVA 1P1VA 1FH2A 3FRPB 2AC0A 2D0FA 2Y6TE 3TBBA 4GBXC 4XE0A 5J4MA 2A74B 3SDDD 3VXMD 3ZIMA 4O58L 3QUYC 1ZT7A 2JKTM 2DQEH 1ND0B 3HZMA 3MAWA 3FMGH 4APQA 2VDNH 4GMSH 4AQ1C 1VCBC 3T4AB 3U2SB 2GT9A 1E9QA 1OB0A 2EDTA 5KVMC 1MW3A 4JY5L 3KE0A 1INQA 3VTTA 3RWCA 4GRWB 2EEAA 2ZCHH 1TTFA 4IQHA 3FPXA 3BCFA 5GS1B 1FPTL 3FTWA 5JHLL 2LR4A 4NO5A 4K3EH 5TDOB 3OC8A 1RURL 4ZFFB 1CLVA 1MFAH 1KIUB 2Y0SA 5IMLB 2B1OA 3QQ3B 2AHIA 4RMUA 4NNXB 1GYVA 5HYJE 3LPOA 3IB4A 4KO6A 2CUMA 3HOGA 4MS8D 4DVRH 5JZ7C 5CSZB 4DKFL 2XTJE 4JM2D 3ILEA 2B59A 2G9HB 3CDYA 3ARQA 4G43A 3ZZLA 5LGJB 1I1AA 5F0JB 1WCQA 2FLBT 5TH2B 4ADGA 1FGVL 1YA5A 4MMXB 2JTYA 4G11A 4ZT1A 1WF5A 3R8QA 5F8RC 4UM9A 1HNYA 4IU2A 2Y1AA 4L9LB 4JW3A 2GEQA 4OTXL 4KNUA 4F1SA 1FFTB 5HYJD 5GGSY 5HVFB 3JUZA 1L9NA 4HHAB 4U1GC 4NZFA 3CGTA 3G5XB 5F1SA 2OZ4H 2YZ8A 2WP3O 5TQ2H 5EO0A 1URLA 2P49B 3LZNA 2O5XL 3CXDH 2QPEB 5DFVC 3DRTB 3LXAA 4I77L 2QSCL 3P73B 4WTQA 5JW4R 3AGWA 4JKMA 2Q7NA 4A7UA 4LZKA 1J87A 3CFBB 1ACXA 2CH8A 4GI9A 2PW1A 3O8XD 1IGTA 4HF5H 3T65B 2P8MA 4Z7NB 3TJPA 2BIOA 1NGWB 4HBCL 4UZGA 5EBLB 1OM3L 3T0EC 4F37K 1MCQA 2Z31C 1XIWD 1TPXB 1WPCA 3HE6D 3EYFA 4GEIA 2XV3A 1GOHA 3FT2A 1QVOB 4Y5XB 5DJ8B 5AVZB 1UVQB 5JHMA 3R0MA 1JBJA 3DX1A 4M4RB 5A40E 3F6LA 4A6YL 3M17B 3H54A 1A6WL 5E4EB 4IGBD 3MA7A 4QIRA 3GSNA 1WBZA 2HJFB 2FJFB 1ETZB 2DD8L 1T21B 4ODSL 1HU8A 3JT2A 4UILH 3WFCL 1MW1A 1IAOB 1LO0L 4R4BB 5CIPB 3ZE0B 5IBUB 1F8TL 4F8QA 2Z8VC 3AB0B 4NOBA 1OGAA 3TBTA 2H6UA 4LNVA 4X2UA 3SKJL 3X17A 4F2EA 4YNYA 1MHHB 2WBJD 4ZDHA 5D2LA 5E23A 3MRKA 3AAZB 1KGWA 1DQJA 4PJGF 4B9PA 3ARYA 3EFFB 1P7QA 2YUZA 3P0GB 1O9ZA 3QIUB 4ZTOL 1SHSA 5AD0A 4MD5A 1H3TA 1SBSH 3O11B 4RRPM 3TP4A 1CPUA 3EO1B 3S34H 2EH8H 3REVB 1BD2D 1ZA3B 3GHBH 4HBQA 4N9OB 2ITDA 2H3KA 1KJ2H 2IO5A 2AEIT 2FATH 3QO1A 4RGOH 3QEQE 1O6TA 4KMQA 4U6YB 2YGOA 3MRRA 3RL1B 3MNWB 5FYJH 1OF2B 3B83A 1T1YA 3KYAA 1QA9B 2DAVA 3DHUA 4QTFA 2BY3A 1FFNA 1FRGL 4JFOB 3O6MH 2A83B 3SE9H 2HXAA 3WNKA 4EIBA 4OFQA 3O3AA 1YMME 1FNEA 2A4ZA 4JG0L 4Y2LA 2CGZA 4YHOH 3O4OB 4YBQC 1KCSH 4OUOA 1HESA 5I1IH 1NC2B 4JB9L 4I2XB 4MB1A 3ZTJG 5AYUH 1TTGA 1KGCE 2APFA 4OSUH 1HHGB 3QEQD 4ZMOA 3OKOB 1GIGL 3QDJA 4N0FB 3FOLA 1ILSA 4LGPB 2VXQL 2Y6SC 3Q48A 4I9WD 3TH4T 1JV2B 3Q3GB 4ODVL 1VGEL 4FFVC 4QKXB 3MRHA 1B0RA 4F2MB 1U3NA 5DT1H 4M6MH 2Z4QB 1YECL 5HHNA 1H0DA 3RFRA 2P47B 4JY4A 4NSKA 1PBYA 2A4EA 1JUFB 1XWVA 1YMMD 3TESA 3C60B 5BJTB 5TE6H 3LEVH 4NZRH 1D2PA 4JGMA 5ITBL 3C5JB 3DX9A 2Y5QA 3QSKB 4M3HA 4YX2L 3LQAC 3BC9A 3I2CL 4YH6A 1HH6A 5I19L 2DLFL 2ZYRA 3SDYL 4YIQB 5ICUA 4X6FA 5MEPA 1AMYA 3V4VB 4JUTA 3VWKA 3EH4B 2Y7SA 1H3PH 3IWVA 4OVUA 4U1JB 4ICXA 3TA3D 4Q52A 4LKCA 6PCYA 3HNTH 4HUVB 1PLGH 1A66A 2AI0L 2MHAA 1UA6H 5E6IB 2UZIL 1AD0B 3ZHLA 4Y0GA 3H9ZA 1KLGB 1O0VA 2APTA 4PYHA 4YHZH 2BVQA 2WJ5A 1BGXL 4F9PC 3T3PB 2UZPA 2AQSA 5M7QA 4G8FA 2VZSA </