5CEZE

Crystal structure of the bg505 sosip gp140 hiv-1 env trimer in complex with an early putative precursor of the pgt121 family at 3.0 angstrom
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
213
structure length
213
Chain Sequence
SVLTQSASVSGSLGQSVTISCTGPNSVCCSHKSISWYQWPPGRAPTLIIYEDNERAPGISPRFSGYKSYWSAYLTISDLRPEDETTYYCCSYTHNSGCVFGTGTKVSVLGQSKANPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Affinity Maturation of a Potent Family of HIV Antibodies Is Primarily Focused on Accommodating or Avoiding Glycans.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein/immune system
molecule keywords Envelope glycoprotein gp160
total genus 42
structure length 213
sequence length 213
ec nomenclature
pdb deposition date 2015-07-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5cezE01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5cezE02
1Q9KB 4F7MA 4I13B 2Z4QB 2E8ZA 1BEYH 5F1NB 1W0WB 4MXVE 4ETYA 5CD3B 4MQSB 3MNVB 3UTSD 5FA4A 5LVEA 3Q0HA 5IB5B 1A9BA 2X70A 5J9PA 4JM4H 1GJIA 3MLUH 4HGWB 1TJGH 3UTSE 3LN5B 2P48B 1A3LH 5EOCH 5IFJB 5C09E 3E6FA 1IM3A 4OFYD 4NBYB 4QHUA 5HGAB 4U4BA 4HBQA 3FQRB 4YDLC 5I8KH 3G6AA 3V7AG 2EYTA 2YZ1A 1YMME 4OV5B 1ZWIA 3KYKL 4PJIA 4G6JL 4FG6C 2E7LA 1MCKA 3WNOA 1JHLL 3MLVL 1ZVSA 3CLEH 3SJVA 5IQ7L 4X4XA 2W65A 4HGWA 2N7AA 4M9OA 3C8DA 2DQDH 1KPVA 1NCCH 1R3IL 5IF0B 4FXGB 3T0EC 4JO2H 3WV0A 4L8CB 2A73B 1C1EH 4O02H 4BSVA 1ZHBA 3RGVA 3PG2A 4TTDC 3TP4A 3M8OL 5D5ME 2B1AL 3UPRA 4OLYL 3R1GH 2CMRL 2ZCLH 4N0RA 1MRFH 3RUGB 4Y2DA 1BHGA 1CU4H 3DYOA 5D1ZA 1CXEA 4ZFOA 3BZDA 3OBAA 3X12B 5C6PB 4HWNA 3EFFA 1RQ5A 2YC1B 3ARGA 4GMSH 4WVRA 5IQ9B 1X7QA 4YHZH 4L29B 4RMSA 3BPLB 4XC1H 3SKNB 4KMLB 3U0WL 1YDPA 3QXAB 5FGSA 1UB6A 1RJZA 2OTWB 5HYQA 4MJID 3GJFB 3JTTA 4YLQT 4D0DA 2DB8A 3BKCL 3VRLF 4OZHF 3P0YH 4X98B 1PKQE 3UTTD 3L7FA 5ESVB 5IOPB 3QDME 2FD6L 1OARL 3WS6A 2Y25A 5CBEA 3SKOB 3MXVH 1C5BH 4UU9B 4LVEA 5KANG 4M43L 3ZDZF 4NZTL 3LN9A 5T5NF 1UZ8B 4JJ5B 3TZVB 2GK0A 4AM0A 1M7DB 4NQDE 5D9SA 2H2PD 3NGBC 4LKCA 3WUWG 1PEZA 4P2RD 4L9LB 4M93B 1H3WM 3L9RA 4UT7L 4RAUA 2G60L 5IK3B 3SDCB 3TNMB 4CBPA 1JWUA 2OYPA 1SYVB 2W0LA 3OB0K 2VLKB 2X4OB 5EU6B 3HNSL 4FQIL 2X6MA 3T3PE 2H2PC 1B0RA 3QUYA 4G7YH 2VDOL 2OCFD 2KUTA 3C9NB 4KK8C 4N0CC 4FQJL 3LKPB 2FJHB 4JPKH 5DMJB 5I75B 3ARFA 2J88L 5C0RH 5GGVY 1PW3A 3IS0X 3CH1B 3WSQH 4D0BB 4S1DD 2VKWA 3Q5YA 4HKXA 1T0NB 1F3RB 2OZ4L 1JWMB 3KPMB 3VFNA 3FFCA 4WFFE 2OTUA 1EEZA 4RGMB 1A6VL 4G6FD 3RVXC 2P5EE 1YN7B 3V2AR 1A8JH 1HDMB 3QA3B 2XZCH 2AXHA 1SM3H 5HVWA 1DR9A 1KB5L 5GIRB 3W0WA 5JMOC 4OGXH 2NW2A 5D7LE 4UUJA 4L5FL 5AUMA 3WJJC 2P8PB 4NRYB 3VD7A 2UZIL 3AUVA 1Q9OA 1Q38A 3AS0A 4D2NA 2P5WD 5EBMB 5F97E 5ITFB 3K7UA 3UO1L 4HUVB 3QEHA 1OHQA 5FYKU 4XVJL 4CKVX 3BUYB 1J87A 3HCVB 4ZFZB 3UBXA 4HK3N 3N06B 3OGCB 1D5BA 4P57B 3CZFB 3O8XC 1T1ZB 1CICC 5D2LA 5AZEL 4K2UH 5BVJB 3O4LB 1AKJD 1IC4L 2IPTH 1DLHB 1VB9A 4L4VE 5E2WH 3V5DA 1NDMA 3JTSA 1UEMA 3KPRB 2Z8VC 3MJ9H 2GJ6E 2AQ3A 4D8PA 1PZUB 4WI4A 3X3FH 1SJXA 3TPUA 4HK3J 5M7QA 1J8KA 1HOCA 5KSAD 4IRJB 1HWHB 2NY4D 3B5TA 3DX6A 1W2KT 2HVJB 5I6XC 4MMZC 5FUCE 3BKYH 5EOQL 4H25B 1CICA 3DXAE 3O3DB 4HV8A 3S5LB 1A5FH 2ADJB 1U0QA 1ND0A 4GSDH 1U8IB 2FBJL 5GZNC 5GGQH 3TA3D 1SJEA 5KAQF 1MFEL 4JB9H 1AI1L 3EO0A 5T3ZL 1TETH 3FT2B 4K7PX 4O51B 3QR2A 2H6PB 2R1YB 4NP4H 3O2WH 4EI5C 3ETBF 4D9RE 2ZNXA 1F2QA 2BNQE 2Q7NA 1W72B 2DWDA 3CUPA 5IUSA 1PDKA 3WN5A 3MRDA 4GQPH 2GSGA 1BF8A 1LO3H 1FJ1A 2B1HL 1A4KA 2HJFA 1HEZB 1NJ9B 1IVLA 2Q3ZA 3LEXB 3RA7H 5JA8B 1IQWL 5C0AB 4Z7VA 4G7VL 5IW1B 4Y89A 2NY7H 4FTVB 4Q6IA 3BZ4B 1NL0H 3BZEB 4JZJC 4X6CA 4PJAE 5D2NE 5E6ID 2I5YH 5IFHH 2OX5A 4NSKB 4MNQD 4UQ3B 7FABH 3BE1L 4F57L 4HEPG 3PIQB 3TBYA 4KTDL 2NCMA 2AXFB 4JVUA 2HJLA 2PO6C 4P23D 3OPZL 3H9HA 5ESQA 1IFHH 3TF7C 1P7HL 2DQUH 2VOTA 4KPHH 3CSYA 1VKXB 2HN7A 4LSPL 2FBJH 5IV2A 3TT3H 3BDYL 3I50L 5L7XH 3PHQA 5I73B 1NFKA 2P24B 1A02N 3LKNA 4DKEL 4XVTH 5IKCB 1L7TL 5IM7B 2X10A 3TJEL 1YQVL 5GGSB 5MEND 1KJ2A 4MAYD 1NLDH 2X4NA 4PPTA 3RIFK 5AG9A 2N1KA 2J4WH 2V17L 5J56B 3K8MA 1F58L 5MI0B 1HQRB 4HS8H 4PR5B 4RQQA 1YEGH 2EYRB 4L4TD 1MI5A 5T1LD 2APXA 2DN7A 4UBDD 1N5AA 3HZYB 4BK4A 5J13C 4KZEL 5GGSA 3JWDL 2DBJA 1A6PA 4ZS6D 5IKCA 1G0DA 2DI9A 1WBZB 4S2SA 2P24A 5EN2B 3P0GB 3NPSC 2E9JA 4Y5XB 5E7FA 4JO2L 5GGTL 1W0YT 3WHXB 5SV4A 1TNMA 4I1NB 4XTRD 1U6AH 5ICYB 4V1DA 2WINA 2NY4C 2VJXA 3N1GC 1A9EA 2B1AH 2GAZA 3CFCH 2W92A 4WW2B 5I71C 4FABL 2HMID 4DKAA 4FZ8L 3UDWA 1K3IA 5LCVH 2DYPA 3PHSA 4P3CL 1T1YA 2ZG2A 5L6YH 1RZGB 2IH1A 2F54B 1NUFA 1MAJA 3DECA 2OS7A 2DQDL 4Y4FD 1A7PH 1X5LA 4OZGB 5T3XD 4AYFA 1QRKA 4M61B 4X4YB 2KQNA 2ZOLB 3F7YA 3VMNA 2FO1A 2RHEA 1X5KA 3HC0A 2PCPB 5J12C 1UXSB 2DL9A 4Q6IB 5BXFA 1YEEH 3E6HB 3BGMB 1Z6JT 5B22A 4D0CA 1RZKC 3PWVB 5AEAA 4WRLA 3REVA 2F8XC 3LEXA 4RGMC 5HHQB 5DC0A 1I8MB 4XPFH 1AGDB 3UTTA 1FFOA 4L3AA 4P9HC 3T0VA 1HEZA 5KOVC 4HQQH 3MLSL 2ADIA 4WHTB 2BNQB 3F12A 1BIIA 2R0WH 1LWRA 2OI9C 3FO2A 4OF5A 1TVHA 3U4EB 4MQ7B 1DQML 3LMJH 5E70A 3DI3B 1VADA 3LDBC 4KGJA 4Y4KD 5IVXA 4PJHF 2LAGB 1KGCD 4OLEA 1KF9B 2IANA 4P9MH 4ETQB 4TPRL 3VG9B 5ID0B 4HH8A 3VJ6B 1NGXB 1T03L 1MCFA 1XIWD 1WIOA 4PLJD 4WJ5B 2EDFA 3G5VB 4G42A 4QXUH 4LSDA 4PBWD 3DX6B 2VB5A 2R1XA 3LEYL 2C3GA 3O9WB 5IB4A 3V5HA 3GSXA 4WEUD 5JOPE 4LSQL 5C0FB 1HI6B 4M48H 3V6BR 2I9LA 3VXPB 4P5TD 1BZQK 4ZOCA 5KTEH 1G1CA 5MEOB 4DQOL 2MOVA 4WI3A 1YPZB 3MR9B 3PQYE 5SX5K 4X7EC 2D31A 1S7XA 1BM3L 3B9KB 6FABH 4Z95L 1S7WA 1XH3B 4YX2L 4HWZB 2AQ2A 3FB7A 2OK0L 4XPFL 4M5ZL 1QQDA 3N1FC 5I17B 5I1CH 4HX1A 5LQBL 2QADB 5EBLA 5F6HJ 4PJEA 5ID1B 4GG6A 4UQ2A 4V2CB 2YD2A 5DRXA 4UUJB 5GHWH 1I3RB 4JO1H 3W0WB 4UT7H 3QA3A 2WWKT 1N3NB 4U6YA 3IFLH 3TO2B 1RV6X 3HTLX 4YDKH 1CF8H 1YECH 2VISA 1EHLL 4I0PB 5D7JD 2DJUA 4JG0L 4DOHE 1MWAL 3Q48A 5I74C 1WICA 3ESVF 5I1DA 1CFQB 4HKXB 3QIWA 4YNYA 3PGDA 1OAQL 5DUPL 3WN5C 1AGEA 2O5ZL 4QRTA 3PWJA 2BRQA 5DQ9B 1NFIA 2EIDA 1OW0A 4NCC2 3RKDC 5HI4C 5L9DH 4CRPA 3QIBB 3CVHB 3NMEA 4RAHA 2DLFL 3MV8E 4LQFL 1JMXA 4PJDE 5AZ2H 1WITA 3DSNA 2UV3A 2APWA 1GIGL 1VFMA 3MFFB 3BEWB 3SDXF 3RWDB 3RGHA 4AT6B 1CFNB 2PO6A 4KKAD 3BW9A 3V4UL 4MJ5A 2ENYA 2YA1A 1Q72H 2E7BA 4HWUA 3P4LA 2R4RH 3KYMA 4P4KD 3EDKA 1WZ1L 2ADGA 2ORBL 4HS6A 5DJAA 3QEQE 1F11A 2QV2A 1QOKA 2GK0B 4OCRH 4AM0B 1H3VA 1MCSA 1WT5A 3S34L 1ONQB 3WL9A 3ZHDA 1YJDL 1NBYB 1I7ZB 1HYSC 1OAYH 5FO7A 4XCNA 3IJYB 5EDXA 1KJVB 1GIGH 1R5WB 3G5YA 1MWAB 4JJHA 3K46A 1FL5B 2IBZY 4XNZB 3FOMA 4R4NC 4QY8A 5GRVK 5GISL 4P2YA 1JNNH 5JNYA 1XCQB 4XWGL 3VRLE 4PJ8C 1XGYL 4Y16D 1F4AA 1U3YA 5C07D 2ZOKA 3W9EB 3VU2A 1CLYL 43C9A 3STZA 1KYOK 4PJHE 4PRHB 3ARGB 1UA6H 1FZKB 4M00A 3SDDD 4WHCA 5DFTA 5E9DD 2PYFB 3JV0A 3P2TA 3I9GL 3D39D 1WWWX 2EDQA 2H26A 3RTQB 3UJJL 4Q9QH 5DF0A 1WFNA 3KPOB 3IXTB 2KL6A 4ZFOL 4CVZB 4K8RD 5E8DL 1P4BL 2ZZUT 4D3CH 3RWIA 2A9NL 1A21A 4X9IA 3HG1D 5DD5H 1JZ7A 4YPJA 3LHPL 4YHOL 3Q6FB 1DVFA 5F8QC 5AAMA 4G6KH 4MCYB 3HB3D 2C4FU 4JG1L 3NTCH 3ARBB 3EUUA 4BYHA 4M03A 3VXMB 2V2XA 3QIUD 2DQGL 1VCAA 1OSZB 3HRZA 4OLUH 4JM2D 4NNYA 4CN1A 4Q6IC 1L7IL 3SCMA 4PRIA 1DQDH 3MROB 1WGOA 5J06A 3HI1B 3X14B 1CIDA 1KENH 2EYTB 3V6OA 3O45A 2BSED 4MGXA 2VLME 4MSWB 4LLQA 1ED3B 4P3CH 5TE4L 1P7QD 1UVQA 2X4SA 4O00A 1QHPA 3C60A 4XP5L 4YUEL 1KYOJ 5K9JL 1GGCH 4PGCB 3T2PA 1A9BB 1PX4A 5J9PB 4YHMH 2Q20A 3I50H 4U1LB 2R2HA 1W0WA 4PJAB 3Q6GL 4WWKD 2P7TA 5KS9A 4L1DA 1AGFA 5FCUH 4ZSOA 5CJXA 3HE7B 2DLTA 3GKWL 5JXEC 1OD7A 3O4OC 3T0XA 2E7LC 5EU3B 1ERNA 1TQBB 4LLYA 5AYUH 4KTEH 2AABH 4K7PH 4LASL 1IRAY 4L4VA 2A2QT 3WDHA 1F4YH 4QT5A 1IGJA 5FYJE 1GGCL 3JVGA 1T5WA 4XMLL 3WXWH 1JPTH 1NANH 1RIVH 1CFTB 2GUOB 4ONGH 1KLFA 1D5XA 3DUHA 4WI7A 3CFKA 3QHTC 1U8PB 1FZJB 1SBSL 3LMJL 2FHCA 4DGVL 4JO3H 4ODSH 5KVFL 3T04D 3QRGL 5FYLD 1LP9B 3WMSA 4C56A 3RL2B 5FM4A 1BZ7A 5DR5H 3EHBC 2CKNA 4FQLH 4KI1A 3B3IB 4ONHA 2YXMA 4L8SB 4WFGD 4EOWL 1PKQB 5KSVB 5DYOB 1A4JA 4YXKH 4KFZC 1Q0YH 4ELKB 2AJXL 5IG7B 2Q7YA 1DBAL 2H8PA 1EO5A 1GHFL 3DI2B 3QFJB 5LGKA 5L88H 2XKSA 1MCCA 3ARXA 3L6FA 2ZP0T 4EI5D 4KJQD 1PGRB 5H35A 4MS8D 3NIFE 4PJ8A 3PWUB 2JJSC 3GSRB 3CXHJ 2JJTC 4MAUH 5A2IH 5AD0B 5FECA 2BHYA 4GRWE 3TA3A 1OGAB 4FOMA 1QZ1A 5LKNA 1MCHA 1RUKL 1CDUA 5E2UH 2YEZB 3O11B 1Y0LB 1ZLVH 3QQ4B 1TENA 1X6NA 2OMNA 4LKXB 4HIXH 5TDPB 4EN3D 3BIAX 1N59B 3SBWA 3HR5A 1YJDC 5JW5A 1T7ZA 4Y1AD 4LLDA 4JEGB 2D4DA 3G6DH 2Z8SA 3RWEA 2BNRA 3CJJA 4NHUB 1FGNL 1MY7A 3RWHA 3ARFD 5D7IB 1C16B 2E9WA 3GK8H 3GJEA 3C6SB 1LO4H 5BS0B 2MFNA 2X89A 3AM8C 3ARGD 3ORJA 1R3LB 3ZKSD 3FL7A 3EOAB 1ORQA 4KDTA 2CSPA 1KEML 1F4XL 3UZVB 1MAML 1J8HD 5DD1H 3IDXL 3VWKB 1ZMYA 1R0AL 1MEXH 3QXTA 4A6YA 1FO0B 4QF1A 4QRSB 1DUZA 1WJ3A 2JIXA 4GMTL 3RAJL 2VL5B 3T0EA 4PJFF 5E94A 3U4BL 4U1HA 4ZTPL 1U3HB 3DETD 5IWLA 2DLFH 4Q2ZA 1R3JA 1P84K 1KTRL 4GG8A 1EPFA 4YXLH 3MRHB 5EBGA 4ZFGH 5DHVA 3T8XB 2B2XL 4C56D 1G7PA 1P6FA 5CINL 1GXEA 4FFWD 2R69L 4XXCA 4CU7A 4O9HL 3RRQA 1I1YB 3KLHD 4M8QB 4XPBL 1JPGB 5FGRA 3FT4B 3QUZC 4QRRB 3INUH 1PG7X 1G7JA 2R2CA 1MHEB 1LO3L 3HE6D 4MB5A 1LE5A 3CCHA 4LAJH 3MLTA 2YBRB 1WBXA 1FIEA 3M17A 2I26N 1ZAGA 1KEGH 1A0QH 3RBGA 1OAYL 1SEQH 4YHNA 3BZFB 4KKBD 5FV1L 1RZIA 2VLJD 2VN7A 3HC3H 1CDBA 1N8ZB 3AU1A 3HE7C 4P2OC 1GGIH 4HKZB 4AEIL 3HLAA 3QUXB 2AV7A 3ARTA 3BPLC 1EBPA 2EIEA 4FRWA 5FHAH 1TZGH 3G5XB 2JJSA 4I9WE 2XA8L 8FABB 1UB5A 3LRSB 2A77L 4OUUA 2BMKB 3EOBB 3RKDD 3RVUC 1CDYA 5F96H 4S1RL 1II4E 1TNNA 4F37K 4UDUB 4N1EA 3MBEA 3C6LD 3S97C 1JGEA 1XGUB 3B2VL 2VR5A 3V4VH 5A16B 1JZ8A 3UAJD 2IWGA 5DDHB 4H1LH 5JQHC 3ZSSA 4JFXB 1A1OA 1J9CT 3MUGA 5GGUB 5I0ZA 3OAZH 5J6HA 5ALBH 1A14L 2IAMC 5FGCB 4PG2A 1E28B 3JWNC 4PJDF 1FVCA 3F6LA 4N8VA 4U2YA 4U6VH 1BD2B 1MVUB 4MS8C 2O5ZH 4KROB 1RHHA 3MOAL 4OI9A 1BFTA 5E03A 3G5ZA 5A2KH 1KIRA 5JXAH 1M05A 1E28A 4LSRL 3V8OA 5L2KE 4L3CB 4K23L 1EAPB 4QTIL 4U1SA 1NBZA 5IQ7H 1JNNL 3MUGB 1ZLSH 3VRIA 3MLPA 2P5WE 3BUTA 3QI9D 4AIZA 4D9QD 1IAKB 1XAUA 4NHCH 2IPKB 3GJFK 1WLHA 3ROOB 3SHSA 1RUAL 1XGUA 3F7QA 5IMLB 3CU7A 2HP4A 5F72S 2DM2A 2R2EB 1IQDA 5DI8B 5SX5H 4F7TA 3FQUA 3AREB 4H8WC 4HF5H 4JQVA 3RWCB 3RY5A 5IP4A 2G2RA 3BH8A 5F9OH 3FZUC 3F58H 3ARQA 3HAEA 4K8RH 5KAQG 1HYRC 4APQA 5CP7A 2FZ3B 3CX5K 3VDCA 1FNAA 1H9VA 2VABB 2X1PA 4OZFB 4R7DA 2DMCA 3CDGA 2W0FA 5CJQL 4QEGA 1U8JA 3UTSA 5I1AB 2DTMH 2XZQL 2OZ4H 4X99A 5F44A 5JHLH 4DGVH 3KNBA 4PGBA 4HBCH 1KJMA 2HLAA 5CHNA 3QZWA 4W70A 4HF5L 4GRLA 3EJYC 1RZIB 5KSUB 4WNQA 4U7MA 1QACA 3OKYA 1PY9A 3TO4A 2CO7B 3M17B 2PXYA 2VO5A 2ZNWA 4J2XA 3RZCB 1JHLH 3MXVL 5F89B 4K3JL 3VD9A 3V0WH 1NDGB 2VXTH 4H8WL 2Z31B 4MA7L 3MODL 4KZEH 1NGYA 4KRLB 2DYPD 4HWBH 4I3RL 4OBSA 2RJMA 1M7XA 5DRZB 1U92B 5D5MA 1Q0XL 1XZ0A 1RK0B 5KW9L 5TJWK 4P5KA 1K4CB 2NY5L 1ZT1A 3CX5J 4KRPC 4BFIB 1MCWW 4YAQA 4P9ML 5BQ7B 1R3JB 3CFIC 3EHBD 1ODAA 3B4NA 3MA7B 4Z7VE 1YN6B 1TQCB 4L9DA 1NCBL 1JI2A 1KENL 3OKOB 4XGZA 2VL5A 5T1LA 3MRIB 3B6SA 3A6CH 3KHOA 4S1QH 5KZCD 4HQQL 3C6LC 3HNVH 3VGEA 1X4XA 2NXZB 4H20L 4LSQH 4P48A 1NGZB 2OXGA 4OZFG 3HMXA 4I5BA 2QBWA 3PWPD 3J8F7 3TWCL 1AGBA 4XPTL 4PUBL 3QPQC 1E6OL 4PJ9C 1DBML 1RZ7L 3KJ6L 2V5RA 1UQSA 2GEEA 3K1DA 1IAIM 4Y4KC 3O3BB 3RWHB 5LJYH 4V1DE 1WWCA 5E2VL 2YK1H 2PTTA 2QADC 4AMKL 5SWQB 1HQ4B 4V1DD 1AE6H 5HHPA 2BCKA 1EIBA 4PJDA 2AI0H 1I1FB 3ALXA 3U0TB 4HXBH 4PJ5A 1KCUL 3MRGB 4LIQH 1H15B 2A6IA 3P73B 4CMHB 3EYSH 4U1IB 4TOYL 1T22B 1HWGB 1J05A 3I6KA 4NC1C 3LKRA 5IMLA 4OM1L 3PV6B 1KUMA 3D85D 2IPKA 4KROD 4OD3L 2BVPA 1GVIA 2CUIA 4YK4B 1LO5A 4KTYA 3BN9C 4YHLH 3VRIB 1JZ2A 1JCKA 2JJTA 1NBZB 1I9EA 4BSWA 2O61B 3FT3B 5BW7A 1U41A 1IILE 3ISWA 2AJXH 2QQLH 3C08L 4O58H 5H35B 1MCDA 2VC2L 5JLZA 3O9WD 4HIEA 3LKQB 3GM0A 3TJHC 3TVMD 4Y5YA 3N0PB 4OF3A 4YDVA 7CGTA 4Q6YA 2NXYB 2Q7YB 4OZIF 2NY6D 5D7KE 1JGVL 3KDMA 4R3SA 4K23H 2GT9B 4K3EH 4FQ1H 4ZTPH 3EJJX 3IF1B 3FB8A 4G9DA 4DZBA 2XIDA 1NBQA 4LHQB 2BY1A 4M7KH 3QUMH 4CN6A 2NY1C 3DTXB 3D25B 5GRUL 1HSAB 2WQRA 4HAGA 3KLAA 4ODBD 1KEMH 1MQKL 4U6TA 3IAQA 3IJHA 4J7RA 3OXRA 3OZ9L 3PHOB 4P2OA 5HJ3A 3DROA 3RVXD 5DMKB 1HNFA 5EG6C 3VFMB 2VITB 2XT1B 3SE3C 1LO0L 4JFQA 1CS6A 1RUMH 5DJYA 4P59L 1JRHI 4PGDA 3AAZB 3SGEH 1BVKA 2XA8H 4J3OC 3QCUL 5F9JB 3C2AH 3GI8L 2VXQH 3GHBH 3P77A 3MV9A 5IEHA 5HGHA 1EO8H 4Z7WA 5D6CA 2JELL 1IQWH 4HKJB 5KSAA 3D85A 4HUXA 3GHEH 4R0LC 4Z0BL 1DLFH 2HFGH 5JPNA 4GUPB 5F7DA 4PJAA 3GSUB 3MCLL 4PRBB 3MRJB 5DWUH 4PJ7F 3RPKA 5D93C 1D6VH 1MHHA 3HI5L 1OSPL 4UOJA 3O2WL 1QR1A 4XHQA 3C60B 5B39A 2ZUWA 1UACL 4W4NA 5MEPB 5SX4H 4FHBD 3O6MH 2X4QA 3CVIL 2V5SA 1X4ZA 1PG7H 3QIBD 3Q5OA 3VFOA 5GRXG 1M7IB 3U1SH 4ZUTA 3VFTB 5MERA 1I4FB 5CSZB 2X4PB 2OR9H 3UYRL 4PJ5D 2FJFB 3BMVA 1DUYB 4JFDB 1PYWA 3FQTA 5B8CB 4G8EA 2BSSB 2D3VA 4UILH 1D5IH 4WFEE 4PBVC 5D7IE 2IH3B 2ITCB 2E7MA 3AXLA 4NP4L 4LSPH 4HCRH 4YO0A 4XVSH 3MRHA 3GMLB 5JOPD 4NHCL 4DKFH 1AHWA 2NX5D 5KZCB 2D03H 2IAMD 4NPYA 2MQ0A 1CQKA 1YMHA 4NFCA 3IU3B 2EKSA 4G80A 3O41B 5E94B 3KWWB 4RFNC 2AJUL 1NEUA 3IRZA 4NM4H 3P4NA 2EDKA 2NY7L 3DPBA 4ELMF 4LVNB 1P9MA 4HFWA 4HJJL 4ZD3H 4OKVB 4LQ1A 4DN3L 4LVOC 5F3BB 5INDB 1WIPA 2F19H 1ZLUK 1ZE3C 4YHIB 3KJ4C 4PG9B 4MZ3A 4E41E 2MTPA 2BSSA 5B8CA 4EN3A 3OB8A 1BX2B 3L3HA 3P11L 4MDJA 4KI5D 4UB0H 2AK1H 3TVMC 1DBAH 4GQ9L 4H88L 1XGTA 4ELMA 3U6RA 2YPLB 1DQDL 2DIAA 4XBGB 4M8VA 4DCQB 3QEGH 2JCCF 4MXQD 1NLDL 4ODVL 5D1QA 4UAOB 2C3VB 5I30H 4QYOA 5MEPA 1ZHNA 4A6YH 5E4EC 4HC1H 1BIHA 4CDHA 1J11A 5CBAA 4LLUB 3UTQB 4RMQA 1QD0A 1MHHB 1C5CH 4LKXA 2CGRL 1P84J 3O3AA 3MRJA 3VW3L 2GCYA 3RWDA 2Y6SD 4FXKB 4WU7B 1D5ZA 1MFBL 4LSUL 3QNYA 2QHRL 4OZGF 2AJ3B 3KS0H 1Q72L 3DUUA 2YSSA 4ZFFB 1LE9A 3O6LL 4V2BA 3MV8A 5DT1H 5HGHB 3C08H 4WU5A 4IIQB 5IHZA 1MJ8H 1W8OA 5F9JA 3CSBA 3GBNH 4KVCH 1BVKB 5CJOH 1T3FB 4GAGH 2WLYA 1DBBH 1LDPH 4AK1A 4KU1A 4OZ4A 5HTSA 2D2OA 5F7HA 1AQDB 4LEOB 5DYOA 1J0YA 4APQC 3D0VA 4OQTL 1JJUA 1NC4D 3CC5B 2VZTA 4X6FA 5DRNB 2H1PL 1XGYH 1NGQH 4Y2DC 3GSNA 3IF1A 3BX7C 3H8NA 4PY8J 2D03L 5DMGC 1L6ZA 1MF2H 3WIHL 2GUOA 1LEGA 2X4UB 1U36A 2XA3A 4OZ4B 4RX4A 2HT3D 5I6XB 2MKWA 1ZHLB 1P7QA 5C0BB 3W0WE 5D1XD 1V3JA 2FNBA 5IVNA 2VXQL 3P9WB 1D7FA 5EZLA 3H42L 1A6WH 2VAAA 5I19L 4UT9H 2IFFH 4F9LC 3MPCA 1K6QH 3ARRA 3MV7E 4O4YH 3RDTB 4U1MB 4TSBL 3WLBB 3TH4T 1U95A 3PV6A 4FQLL 2GCYB 4W68A 5K9KA 4LDOB 4UIKL 3VXPA 3UTQA 1YEHH 2F5BL 4G7YL 1BVLA 5DFVC 4PJ5B 4CU8A 1CN4A 5CKAA 5DVMA 4DAGL 3SPVA 5HD8D 3C8KB 2BCKB 4LLQB 5IFAH 4OLVH 4X4ME 1F4YL 3MRFB 3HUJA 1TCRA 2GYSA 4GG6E 1FZMA 1CU4L 3ULVD 4NNXA 3O4LD 5DURD 3SCMB 1OGAD 3T1WA 4XCCL 1FBIL 4PJAF 5D7JA 3CSPA 5FKAA 1QBBA 2H9GB 2HKFH 3AC0A 2VNCA 5HI3C 1MFBH 3H6JA 1SMOA 4JRXB 4QXGH 2NX5A 2R2BA 3E1F1 5GXBB 1JWSB 4MNGB 3QG6B 2P45B 4XTRC 5LXGH 2P46B 1S7SB 3WJLC 3IDUA 4Y19B 5EOTA 3P4MA 2EE9A 2V5YA 1E27A 1OM3H 1EEUA 5DJ2A 3RPIA 3QHZL 1ZA3B 3P4MB 1YN6A 4P2QB 5DEFB 4Q9RH 1CL7H 4P5TC 1FZKA 3TZVC 5LGJA 1AIFB 5DJZB 2MPAH 1H5BC 5BO1L 5K59F 1JZ4A 3BQUD 5B38A 4NKMA 1EO7A 4KI5C 4N90E 5E1HB 3NACH 1QG3A 4M3KB 4XPHL 4Q58C 1OM3L 4NNXB 3T3ME 5BVPL 3HFMH 1B6DA 2VLLB 2A0LD 4K94H 3WO4B 5DJAB 2AP2A 4Y2DD 2FEEI 5F7FA 1X3DA 5HHOA 1F4WH 3BHBB 1I75A 1KCVL 4HLZH 1EEYB 2W0KA 4JG0H 4NKQB 1NCCL 4ZNEA 3QIWD 3BD3A 2R56L 1Z9LA 2J1KA 3CFBA 1A3LL 2Y36L 2BNRE 2ARJQ 4HUXB 3IXAB 1AO7D 5E8EA 3WLBA 1YA5A 2P8LA 3BI9X 1XR8B 2ICWJ 1UM4L 2GY7B 3CDGB 5GGRY 1HHGA 1IT9L 3P77B 5FYJU 2V7HA 4GAGL 5IMOA 5IT2H 1YYMH 1IE5A 2ID5A 5TE4H 1KCRL 3W39A 2I24N 1YJDH 1E4KA 1MCOH 4YR6A 2OZ4A 2D7PA 5DI8A 3V9FA 4F7TB 4OCXL 4GXUN 4Y0GA 4M5YH 5E99H 1LEIB 1C7TA 3KPNB 4XPGH 2BVTA 3PHOA 4P2OB 1J1OH 1F00I 1QKZH 4K9EL 3TO2A 4XPAH 2JE8A 4I4WB 4OD3H 1EAPA 5DO2D 4G9DB 3DOSA 3SDDC 4DZBB 3TJEH 5ABDE 4S11A 4GW5B 4FABH 1KIRB 1CK0L 1LD9A 2ESVB 1Y18A 4PJ9D 4YDVB 3WIFB 4X0KB 4YHKL 4OLXH 1KIUA 4GW1B 5C6TH 3NZHL 3NBNA 1UCBL 1G7MB 1VGEL 1QBMH 5TPWL 1HCVA 2XI9A 5IMOB 4PJ7E 4GLRH 4DWHA 5J6HB 5DC9B 4X7CC 4MJ6A 2OJZH 4KRNA 4UQ3A 1GAFL 2P1YA 3EO9H 4UV4L 3HNTL 1INDL 1BZ9A 3AB0B 2J8OA 4G5ZL 4KK8D 5BZWB 4RWYH 1GH7A 4ZXBD 4M6MH 2Y7QA 3SE4C 4HMEA 3H7BB 5C0JB 3LB6C 5DJDA 3DV4A 4JHBA 4C55A 5AYQA 2A6IB 3P73A 3HKFA 1JF6A 2WWMD 2ICCA 2XV6B 3IKKA 2HJFB 3U2SA 3OF6A 32C2B 8FABA 4ZXBC 1P9MC 3OR6B 1DANT 3MBED 2VLLA 3OB0H 3MACH 4ODWB 3U6RB 5DUMH 3BRDA 3B8YA 4M5YL 1DTUA 4HKZA 1AQKL 1YQ2A 5IGXH 1SJEB 2IANB 3PUCA 5EZJB 1ND0B 4I5BB 3BZFA 4P2QD 5INCA 5FHAL 4BZ1L 4O2EA 4F80A 2JLLA 4F8QA 3CH8A 1WT5C 4X4MA 4CADA 4WI6A 3BGFB 2BNQA 5IHUL 4FG6D 1AFVL 1KLUA 3P4NB 3MRIA 2FHFA 4M3JA 2HRPH 3ZKND 5HVHC 5DJ2B 4HK0B 1AGDA 2VXTL 3RIAK 1F42A 4DEPB 3S4SG 1YMHB 4ODUA 1YY8B 4UT9L 5DVLA 3V6OC 2JK5A 5EO0A 1KT2A 4Z7WE 1RVFH 4WW2C 3MV9E 3TO4C 4R96B 4TPRH 3MRPB 5IESL 4I3SH 2PW1B 3QJHB 3U7WL 5FKAB 4NUJB 3EYQC 5GGRB 1MNUL 3LQAC 4OZIE 1PYWB 3FQTB 5D70H 4F58H 4RBPH 3IGAB 2H45A 3FO1A 2EZ0D 1T1YB 3VFTA 3MRFA 2E6JA 1I3GH 4A6YB 1I8LA 4WW2A 1JHTB 3IDNA 3WKMH 2PR4H 2BOBA 2X1WL 1AO7B 4WNQB 3KPQA 3EZJB 1H8SA 4TULL 5E2JA 3QEQB 1MQKH 3K0WA 1OAXL 4UIMA 4WO4B 3VFUB 1FAKT 1LHZA 4QXWA 4N0FA 1Q0YL 1BGXL 1AI1H 1TPXB 4JY5H 1GCFA 3C6SA 4DFIA 1ITBB 5L2KD 1I9JH 3UTSB 3T0DA 3BMWA 5D7IA 1P4LB 4E41B 4NQDD 2W0FB 4U1MA 1UM6L 4N8CL 3CNKA 1HIMH 2XKNA 1CD1B 3GMOB 4YZFF 4NQXA 4MA7H 4YEFA 4GBXA 3DMMA 3QXWA 4LCWB 2ILLA 1CIUA 4OM0H 2UY7A 1ZHLA 1HZHH 5EO9A 1B0RB 1FNEB 3MX0A 5DWUL 1QO3B 4U0RB 5GS2D 5LBSH 4UINH 1XR9A 5DMKA 4XCFL 1IL1B 1GOFA 3IJHB 2NYYC 3VFGL 3U46A 1B6UA 4PP1C 4GRMA 3VXUB 2HJKA 3VGGA 4OKDA 3ULUH 4MZ2A 4L9LA 1MFDH 1M05B 2UZIH 2NY3C 2YMXH 4LEOA 1BLNB 5ISZB 2HWZL 1DN2A 1KELL 3QFJA 4KTDH 5MENA 3S36X 4ERSH 3LZFH 5ALCH 4B53A 3BSZL 4ELME 5IG7A 5DJ0A 5ACZA 3P40A 4LNVA 1PKQA 5IHZB 4PRAA 1INQA 4XC1L 4WU5B 4BSWB 2O61A 3UTPE 4U33A 2CK0H 2A83B 2YSSB 3TBSB 1NKOA 1GC1C 3WO3B 3VGHA 5I9QB 3T0EE 1PKOA 1FZJA 3ZYIA 3FZUD 1JGEB 3MBEB 2C1OB 1T22A 4FQCL 1V7NL 1MF2L 3WIHH 1UWEL 4LLUA 4NGHH 4ERSL 3TIDB 5C8JA 5I75C 3L3JA 1EDQA 1P4IH 3GMOA 4L8BA 3VGAC 1I85A 3NA9H 5I1KH 1FJ1B 3QCTL 1G84A 5C0RL 4QHMA 4HPOL 2V5MA 1X5IA 3RZCC 4P46C 1AGFB 4X6DE 3G5XA 3L95A 2G60H 3RGVB 2F53B 4B7LA 4MA3A 4HG4J 3L3HB 5CEYA 5DS8A 3D2UD 3O2DH 1W72H 3HLAB 3QIWC 1N64H 3DJ9A 1K4DB 4G43B 4OZGE 1PLGH 4FFYH 4KQ3L 1JGUL 4WDIA 3DNKA 3KPQB 2X4SB 4HT1H 4IOFC 4GXUM 2GJJA 4M1GH 3I84A 1MREH 3SE3A 4L5FH 5HYSG 4HC1A 1PG7L 2X41A 2P5EA 1LO2L 4ENEC 3NZ8A 3QUZA 4NIKB 2EKSB 3OJ2C 3IU3A 1A7NH 1YNLL 3FB6B 3RX8A 4CMMB 4RFOL 3ZE0E 2Y07L 5IVXF 4P2RE 4TVPH 2FATL 1DVFB 1CG9A 2NY3B 4JHWH 3F65A 4GG8B 4LLVA 2IQ9L 5DD1L 2JK5B 3FN0H 2IH3A 2ITCA 5KVGL 3VH8G 4RMTA 2VDRH 5E1AA 5AYUL 4JQVC 4CVZA 4RA0C 2QQLL 4GW4A 4K9EC 1S9WB 2DD8H 2BDNL 4OT1L 1KELH 3QEHB 2Y4SA 1N4XH 4Z7NF 1I4FA 2P5WB 4QF1B 4NO0D 4ZAKD 2VYRE 4K3EL 4LLMB 4NRYA 2BRRL 4HXAH 5KW9H 3TO4B 5AUMB 3J7HA 5I1HH 2DJ4A 3HUJE 4GLRI 3X3GL 1MCJA 4ORGA 4OI7A 2DM7A 1K4DA 4G43A 3HNSH 4DEPC 3ARSA 5DS8B 2Z92A 3GSUA 3KPRD 4PRBA 3O8XA 5CEXB 1PFCA 5JUEH 1BMGA 3DRTB 1RUML 1T0NA 5GS3A 3UPAA 2B20A 4HKJA 5KSAB 1I9IL 2BERA 1QPPA 4UTAL 3KR3H 3RQ3A 3MRMB 2DKUA 2F58H 1REIA 3UJIH 2FJHA 2XACC 3CLEL 2QQKL 4TQEH 3RIFF 4DW2L 4N8PA 3UCRA 2R2EA 2C1OA 2FLRT 4KK6C 3H7BA 2KZWA 2X42A 4M7LL 3KPTA 1J1OL 3JWOC 2LU4A 4HH9B 4OGZA 3TA3B 1TQBC 1JWUB 4GQ9H 2Q87A 1CWVA 3IDMB 6FABL 4WI8A 2ZCLL 2XTJE 3HB3C 1ES0A 1SMAA 3QIUC 1NAKL 1XF1A 3T65A 2GKIA 4HKBB 3NZHH 4Z7UE 4I2XB 4GOSA 3NOIA 4Y5YB 3MNWB 2FR4A 2J5LC 5E99L 5DZNA 3N85H 4D94A 4FTVD 3NCJL 4I4WA 2DM4A 4WI2A 4XPTH 3U46B 1OTUC 3A6BL 1KTDB 5AZEH 5DDHA 3E0GA 3KPNA 3T77B 3VXOB 1HILA 4NRXA 1ZK9A 2VLRB 2ARWA 1S5IL 2R29H 4NC2B 2LAAA 2FL5B 3H9SB 3T3MF 1LO0H 2MWCA 4GBXB 5ECJE 4D9RD 1LVEA 1A3RH 1RJCA 5EU3A 1HQ4A 1AHWC 1UB5B 1MJ7L 4EZMA 5DQJA 2LVCA 5IROA 5EWIL 3QUML 2CJUH 4E41A 2CLVA 4AEHL 3A6BH 3B9AA 4XBEL 1U8HA 4C57C 4N0FB 4Y1AE 4FXGA 1NSNH 1Q9WB 1WF5A 1N8ZA 3AU1B 3E8UH 3FCTB 1KPVB 3QEQA 3QRFM 5FUOL 5FKPB 1AGBB 3WCYA 43CAA 1DEEB 3U30C 2XZZA 2BOBB 5C0BD 4F9PC 4P4RB 1DVFC 1E4XL 1HKLH 4Y2OA 4F9LA 2ATKB 3ZT7A 4HIJB 2Q86B 4OV5A 2ZCHH 4PV8A 3BP4A 2FIKA 5IIEA 3HI1A 5T1LB 3X14A 1EXUA 1NGWB 4Y8DC 3E6FB 3K2UH 4J8RB 4JRWA 2XTJB 4NUJA 4PRNA 4QGYA 3HRZB 3STLA 2V2XB 3WNLA 5FA4B 4QXTB 2A74B 1NANI 1Z0NA 3E2HB 1GGTA 4KDWA 4R96A 3GMNB 4XNYH 2HLFC 4MCYA 5F1NA 2WK2A 4Z7OF 4PJ5E 2BXZA 1DE4B 4LFHG 1CFSB 4OGAC 1K4CA 3A6OA 4MVBD 2AJSH 3RWIB 3SOBH 1BIIB 4X7SH 1U92A 3B9DA 1WUNT 5LXGL 2V2TA 1LEKB 3VXMD 4FNLH 5HHQA 4RBPK 1T21B 2YD1A 2WBKA 3PWVA 4NQCD 2RFXA 4X7TB 3NA9L 5F89A 2L4OA 3E6HA 1RAMA 5I76A 3DX9A 1MPAH 5BRZB 4YGVB 1A6AA 2OJEA 1A2YA 1UXSA 4IHOB 1AXSB 5INCB 2X9XA 3QULA 3VXQB 5JNYB 1G0XA 2AXGB 3VG0L 2MPAL 3BKCH 3OKEB 3QZWB 4LCIH 5E6IA 5MEQB 1GRWA 1FV1B 1YEEL 4S1SH 3NAAH 1FZOA 1UT9A 1R5VA 3ZL4H 4C58B 2A6JB 1H3GA 3QB7C 1ACYL 4ZS7L 1C16A 1RZGA 4ODWA 3BP5A 5GJSL 2PETA 32C2A 3S5LG 5L9DL 3FRPA 1BBJB 2YRLA 3ECBA 1GPOH 2W59A 4RMRA 1JMZA 3KYMB 5D71H 4UV4H 4TSBH 1S9VA 3FQUB 5IBTH 3G08B 3TT1L 5HDQL 3NFSL 2WLZA 4XX1G 2YEZA 1ACZA 2HAZA 1U91A 1U95B 2DQHL 1E4XI 1QSFB 1I9RL 3MO1A 3QAZC 1A1MB 2EC9U 4FQQB 4MQXC 4X80H 4RQQB 4MJ6B 3G6DL 2I5YL 2ICES 1PY4A 1WC7A 4X7SL 3ZDXF 3RHWK 3CVHA 4PJ8B 1GZQA 1HNGA 2NY2C 3KGRA 4P0DA 4EKXA 3HAEG 2EC9T 3TH2T 2FJGB 1F4WL 4R8WH 3EW3B 4X5WB 2PNDA 1MVUA 1MI5D 5KVDH 1QBML 5TPWH 1C5DB 4P5TB 5DMIL 4MQXD 1RJYB 4PJCA 4QHKI 3TVMA 1GGYA 5DTFB 2H2SD 4PFEA 1A4JB 4KMTH 1XF4B 1FNSH 4I18C 1VKXA 5C7XL 2Y5EA 3ZKXB 3QQ3A 2WIIA 1U8KA 2LQRA 1P69B 2ZSVB 2GFBA 3QZWG 2D0GA 3BVNB 4P4KC 4WIQA 4BKLA 3TFKC 4Z6AT 2EE2A 3VXUE 5EBLB 1K5NB 4JZOB 4NT6B 3OXSA 4QT5B 1IKFH 2YOCA 1S7QB 1GHFH 3IB4A 4YDJA 3GI9H 3W39B 3V4PL 3TJHD 3FB7B 2MKLC 3W11D 3SDYH 4LLYB 3VXTB 4HUKB 4IIQA 2QQQA 1S7WB 4LSRH 1FYHB 4EDXB 3MV8B 4KC3B 5I19H 1F13A 1PEWA 4MVBC 1KJ3H 4M9PA 4JDZA 4ZFFA 1LE9B 2YD4A 1HK6A 4LSVL 4Y16A 1JN6A 4NO0A 1A0QL 2P7TB 4YXLL 3QUMA 4JG1H 3LCYA 2AJYH 3IKCA 3NA4A 3AGVA 2QHRH 1QHOA 1B2WH 1I8KA 5C0AA 2XQBH 3QO0B 5GRZA 5I74B 3FN9A 1G7QA 3INUL 4I0KA 5HHOB 1VESA 4X9HA 3C5JB 4FQJH 4H88H 4I0PC 1JUFB 3LH2L 3GSXB 1RUQH 4JFEA 5FDYA 1ED3A 5KG9A 1KN4L 4PLKD 2C3VA 1QLRA 1S7RA 1A1NA 2GSGB 2OL3L 1RZJL 2VUYA 3MLTB 2AK4A 3ZDZE 5I1KL 4QRRE 4J3WA 1O0VA 1VHPA 2JF1A 1MHEA 2FHBA 5CJQH 1UJ3C 4Y1AA 4S1RH 3VCLB 4XT1C 3MV11 3VXNA 1IGIL 2J6EL 4PG9A 1B2WL 3AS1A 2ZCKH 2ADJA 5L0QB 2YWZA 1U3HD 2YUXA 3SJVE 1AJ7L 1EJOL 2A9MH 5A2FA 2DQJL 4HFWB 4X6DF 4LARH 3UTPD 2EDHA 4N5EC 3KPOA 4U1HB 5LWYH 3QIBC 1U93B 1QFUH 1T80A 5D6DC 5HHME 4JHAH 1DBKL 1XCTB 3JTSB 4O5LH 3SKMA 1DUZB 2JIXB 4RDQF 2IFFL 1OPGH 4PB0H 1CL7L 4U1NB 2COQA 2J8UB 2P44B 3JUZA 3EGSA 2VZUA 1TPXC 3MA9L 5CJ8A 1G6RB 4HUWB 3OGCA 4WUUD 4AY0A 4M6ML 1MFCH 4EDWH 3IYLW 2AJSL 4WUUE 4M93C 2E9BA 5CINH 1RUPL 3GGWB 1OTTD 5K33A 1A7BA 1MCNA 3OMZA 1MJJB 4JFYB 2IH1B 5D7JC 1TXKA 1UWXH 3LPWA 3S3SA 2P43B 4DN4L 1Q9OB 4L4VD 4JRYB 1UCBH 4OLZL 2GAZB 1A7QL 1MUJA 3X17A 5D71L 2ADGB 4NKIL 2FECI 3L5JA 1M6OA 4FQXB 3D9AH 2OTUB 3QQ4A 1CGXA 3V6OE 1WBZA 1A47A 4S2SB 1JZ5A 5JW4M 3ARBD 2UYLB 5FOBB 3QBTB 1CDJA 2YHGA 5IW6B 1H3XA 1ZSDA 2AAVA 1T7VA 4WY7H 3WJLA 3VE0A 2EYSA 5TFSH 4R2GB 3CVIH 2DMBA 2W60A 3CVHL 3T4AB 2X4NB 1NFDE 2N56A 3AAZA 1R5IB 1P7QB 2AK4D 3NCCB 3LZFL 5C0BA 5C08D 4XP5H 4YUEH 3HAEH 1WQVT 3SDAA 5KS9E 1MCIA 2EDBA 1BQHA 2ICEB 3D39A 4UV7H 5F9AC 3ZE0F 3D39E 3LQZB 1E4WL 4R4BA 4I0PA 4ONHB 3MLYH 1IGIH 4MAYC 4CDGC 3ULUD 3CFEA 5EO1B 3TNNA 2MJWA 5T5FH 1N2RB 1T7YA 3FRUB 5HGBA 1JFQH 1S9XA 4QTHB 4MNQE 3DARA 4MXWH 1CGSH 4KK9C 3QNXA 1MY5A 3MSPA 4UT6H 1IC4H 2ZKHH 3SKJH 5DFVD 4RGND 3DWTA 5DJ6A 4JJ5A 3I6LE 1CE1L 1F6AB 4K3JH 3RJDA 2BVOB 2D7TL 4RA3A 4NC1E 4OTXL 4RGNE 3LKQA 3PABB 2FH6A 4FNLL 4WUKL 5FK9B 5HHOE 5D7KD 5CZXC 5E8DH 4BM7A 4LCUA 4LSSL 2VZSA 5I8CA 1GPOL 2DQTH 5EIIA 4LRNH 5TE6L 1YPZE 5I2IB 1S7XB 2AJ3A 3TC9A 1XEDA 3THMH 4HJ0C 2VZ1A 2YS4A 4NN5C 1KCSH 1HXYB 1ZV5A 4M02A 1J05B 2NXYC 2QTEA 5MEOA 1V5JA 4JM4L 4KK6D 5E95B 5ADOL 1HHKB 1MELA 1CQYA 4PGCA 5ALCL 5E6ZA 5T3ZE 1CI5A 4PJDB 4MHHG 1DJSA 1ZHNB 3IJSB 1A4KB 3UX9B 2R1XB 2ZSWA 5D1QB 4CJ0A 3MRDB 1AE6L 4IOIA 3CPLB 1WWAX 3FO9A 4R26L 1IZKA 1MHCA 4Z7OE 5JW4R 4BSVB 4P4KA 1T66C 1G7IB 2C1PB 3RWGA 3WFHB 4BQCA 5D2NA 3AB0C 4LCIL 5IVOA 2DQCL 5ID0A 1CLZL 1OW0C 4IRSB 1D3CA 3TCLA 1CVSC 3ARBA 1I8LC 1G7IA 2C1PA 3RWGB 2J5LB 1E0OB 2NY4B 5D72H 3T09A 4OKVA 5EPMB 1AXTL 4TVPE 3KHQA 4G9FE 3SGDH 3F12B 2GSIB 1PX3A 2ZSWB 2ADIB 3IXTA 1EJ6A 3NH7H 1FFOB 5T3XL 3O41A 2XZAL 4OLXL 4Z8FL 3LN5A 2X9YA 4Y8AA 5DFWH 2KPNA 1F02I 4MHHI 3CFDB 1FLRH 3TH3T 1KV3A 1FP5A 3PP3K 5T3XE 1KPRB 1QEWA 5GHWL 2EE6A 3O0RL 5CD3A 4LIQE 1TVDA 5LGHH 5BVJA 4J3TA 3W9EA 3MJ8B 2LFGA 3MRNA 1RFDH 5F93C 35C8L 2JB5L 3FN0L 5KVGH 2IEPA 1J18A 1MWAA 4KUZH 3BH9B 2HTKC 5DJXA 4O2FB 3DX7B 1M71B 3QQ9C 2X4RA 2XTLA 4K94C 5FO7B 5D1ZD 5F8RC 3MRKA 3V0VB 4FQ1L 2X4QB 4D3CL 1F11B 4XPGL 2QQKH 4TQEL 5FEBA 2NYYD 3LHPH 4YHOH 3V95A 5KSUA 4YWGL 2SEBA 2PR4L 3VH8B 3TT3L 4GKOA 4XAWL 3FRUA 5HGBB 3OAUL 4QHLB 3WFBH 3IETB 3CFEB 5EO1A 4M6OL 2XFXA 2PO6B 2DQHH 5JPNB 5JR1L 3RU8L 4EUPB 3KPMA 5IBLC 1U8JB 1UFUA 3ES6A 4P23C 1N5AB 3PWPA 5GS0H 1MCRA 2ZPKL 1IBGL 3MJ6A 1UH4A 3HAEB 1RMFL 4OLVL 2F9BT 4NBXB 5EC1B 4S1DC 4G5ZH 3TWCH 1KSRA 2AVGA 1JHKH 3B83A 2VWEC 1T89C 2DM3A 5DSCB 1CE6A 3GUTB 4H5SA 2VITA 1XF3B 5JHLL 3G6JA 5IGXL 3G6JE 3MQIA 2VISB 1P5UA 2W9DL 4L3EE 1EFXD 3V4VL 4GAYA 5D1QC 5D7IF 1I1AA 3GDBA 5ITBL 3CDYA 1R6VA 4GJTB 3QUXD 1T1WB 4YXHL 1U58B 4N9GB 4OCNC 1OAKL 2GTWA 3KAAA 2OR7A 2BHUA 4LRIA 5D9SB 2OQJA 3FN3A 4P3DB 3S96A 1HKFA 4UQ2B 4D9LL 3QUYD 1UKSA 1XGQA 2R1WA 3OKDA 3TBTB 5JLZB 1P2CA 3WS3B 1JGVH 1CDHA 4G6AC 1XH3A 1DL7L 4OCYH 5AWNH 3QHFL 4NZJA 1J86A 3ARUA 5B21A 3WD5L 3HE7D 1K8IB 1ZLSL 3ET9F 4ZUVA 2EICA 1A5FL 4OCSH 1NGQL 2EDJA 2Z0BA 4ALAL 3ARYA 3MRLB 1UC6A 4GAFB 5DEGB 3BZ4A 2CKBL 3TN0A 3GRWH 4U1NA 5IW1A 2PYED 2HMIC 3BJLA 3AROA 3MRGA 2F54D 3MOAH 1S7UA 4XI5C 2FO4A 4F37F 4UTAH 3SY0B 1I1FA 2ZPKH 1J7VR 2EZ0C 1ZOXA 1CTNA 3DVGA 2H32A 1TCMA 5SWQA 3GO1H 4E9LA 3QG7L 2V7NA 4PJXF 4TNVK 1VPOL 3IFNL 3S3JA 4UMGA 1ZHBB 1FQ9C 1IEAB 3EOTL 3DO3A 2R1YA 4NUGH 4F2MA 1CL7I 3QUXA 3X3GH 5FUZL 4XAWH 4JGMA 5E08L 4ETQA 3EYFB 3DXAB 2HTLC 3OX8A 2AEWA 3MRBB 3SJVB 3FB5B 4ZTOL 3S5LA 8CGTA 4LDLB 1BM3H 1S8DA 2HRLA 1PBYA 5BV7H 1N6VA 4DUWA 3CCHB 3FO2B 2NPLX 3VXSB 1S7RB 2V9RA 4Y4KB 5HGDB 3NFNA 3NFPA 3QHZH 5D7LB 3OKOA 3BQUB 5ESAA 1NLBH 5DK2B 3WHE1 3RL1A 1JPGA 3C5JA 3QWOB 3EZ8A 1MIEH 2YPVL 3MOBH 3REVB 3MA7A 3TBVB 1LP9F 1QVOA 2VQUA 4P23A 3WE6A 1FFNA 4KH2A 3DHJA 4TUKH 2CRYA 1IC1A 5K9QI 3EIFA 4PJGA 5ANMB 5D2LB 1D5BB 4LHUD 4HD9A 4P5KB 4FQHB 3W0WD 1JPFA 3SGKA 5EA0L 3KLSA 4D9QE 5D96B 1CF8L 1YECL 1EHLH 5F9WB 4LCCB 1G7HA 4OFIA 3BEVB 4WGWB 3C5ZD 2GTZB 4YDJB 2XZAH 1GGBL 4Z8FH 3MYZA 4YBHA 3BSZH 2DYPB 4U7SA 1N4XL 3D2UA 2ITDB 3C5ZA 1U2HA 1EGJH 1F8TH 3HHRB 5HPOA 1S7VA 2WUBH 2ZSVA 1YYLL 4QGTA 4JN2A 3K8KA 2GJ6D 2K3TA 3O2DL 5DD6B 3BP7B 3VG9C 1CXKA 1EEZB 4K7FA 4ZO7A 1V3KA 2FDBP 1D6EB 3BE1H 3EYVA 4X8XA 3HZVB 4HLJA 1OWWA 1RJYA 4PJCB 3QDMA 3MYJA 3QXUA 2AJUH 1YZZA 2DS4A 3TM6A 4D0BA 4U0QB 3AS3A 1C5BL 1F6FB 1HQRA 2G5BB 1ZLUH 2DQEL 4WHYG 4JFZL 4R97B 4APQB 4J1UA 5JZ7C 1I7RB 4RRPA 3SN6N 3IDIA 5EUKA 2BFVL 4FQQA 2XNAB 2NY1D 3IFPB 3OKNA 4TVSa 3MV7A 1U91B 4AH2B 3GSWB 3GBLA 3O0RH 4WFHE 1FBIH 3MV7B 1BGXH 4JY5L 5C0AE 3HI5H 1TIUA 4L8DB 2BOCB 1BFVH 3TLRA 4PRPD 5LAXB 3G08A 4AIZB 1KBGH 4PJ7B 4LPXA 1TJIH 4U1SB 2BNRD 1A7OL 4X6DA 4PRPE 5HSFA 4PRPA 4J1UB 2R0KH 2XXCB 5IFAL 3ZTNL 4KTEL 1LK2B 4DUVA 4HXBL 3S4SA 1AP2B 3H9HB 3GZKA 4P3WA 3SGDI 1DCLA 1BD2A 5DK0B 3BISA 4JDTH 4MDIB 1OGTB 3L7EB 3MLWH 3H9YA 4RDQG 4PYHA 3MLSH 1R5VB 4LSUH 1EGJA 4JVPA 1FO0L 2QR0B 5GISH 4XCFH 3MLYL 5MEQA 3HN3A 3O6FB 5DD6A 4NSKA 5ETUA 1UB6B 1S9KC 3LSOA 1ETZA 4U05A 1FAIH 1AXSA 5ALBL 4XNXH 1PAMA 1QLEL 4HWEL 1A2YB 5GJTL 2CDEB 5KS9F 5BRZA 4JQXC 3EFFB 4M43H 3Q1SL 4OT1H 4G8GA 5IR1B 3EOBA 2I60L 3CIQA 3ZKXC 4DTGL 4KV5E 1FVEB 5A43C 2OP4L 3SGKC 3UPRB 2O26U 1U8LB 2DRUA 2YPKA 4PY8I 3VFSB 1QNZL 1S3KH 3QPXH 3RVWD 4RGOL 2OM5A 4EBQL 1GL4B 5KSBF 5HYIA 2H6PA 2R2HB 3MRRA 1FYTE 2WNGA 2AV1B 2YD9A 1BD2D 4HWEH 1QVOB 3ZL4L 4PP1D 4Z18A 3RTQD 5GGTH 4U6XB 3O3DA 1OAZL 3GMPB 4X6EA 5DK2A 2NR6D 3B2UD 4QNPE 4AEFA 2YBRA 4HUMB 4NZUH 5F71A 2FIKB 4X7DC 5E8NA 3VFWA 2VQ1B 2Q86A 4QRPB 1SEQL 1KJ3L 3GEWB 4ZAKC 1S8DB 1X5HA 2VR9A 2DLIA 4XNMA 4OM0L 2C5DC 2CRIA 3WNKA 3ZMRA 43CAB 2BFVH 2X70B 1JGDA 4DVRH 2VWEE 1Q9WA 4GH7B 2HFTA 2JKXA 4MA1B 3C8HA 1D5IL 3MRRB 4GRWF 4WV1A 1MH5B 2Z4QA 2D7OA 1T1ZA 3V7AE 2VDOH 4F7MB 1G9NH 1AJ7H 1EJOH 2A9ML 4TUJA 1IAMA 3M45A 3L3IB 4F33B 5GSRB 5A2LH 3PL6A 5T33L 4M5ZH 1AFVH 4JFFD 4Z77B 1O7SA 1QR4A 3T0EB 2AKRA 2PYFA 1VFOA 4ZSOE 2OL3B 4Q9QL 4X9FA 5SWSB 1X6LA 2FL5A 3H9SA 4ORZC 4NKDA 1GGUA 43C9B 5DEGA 5A3ID 3MRLA 2Z93A 1YPZF 2WV3A 4NYLA 4Z76A 1T0PB 4EI5B 2PXYC 1ETZB 3EJZD 3BWAA 3O6FA 1IAIL 4YXKL 4R90L 3IDYC 3HZMA 5JXED 3GJEB 4BSJA 1OGTA 3L7EA 5CEZL 3MBXL 3RI5K 3VWJB 2R1WB 1ONQA 1DSFH 3C2AL 3GI8H 2Q8AH 2K1MA 3ZKQD 2CXGA 4PRPB 4LLDB 1U58A 3D69B 4OCYL 5AWNL 4CVXA 4TUOB 5J7CC 4XH2A 2PKDA 3JWOH 1SYSB 3MGTA 2FYYB 4ISVB 1T20A 4LIQL 1KIPA 2O5YL 5IVZB 3UROR 1RZ7H 2WBJA 4LMQE 4L3EB 3ZKMC 4RX4D 4HBCL 4PBXA 1SEBA 1T20B 3SDCA 1S9YA 3O6KH 4FMFA 2NW3A 3MCKA 2YRPA 3L9RB 4N0UA 4NBZB 3S34H 1N26A 3BXNB 2DJSA 4M7LT 4LNRA 1NFIB 2G5BA 3PWPB 1VENA 3CX2A 5DUML 1CFQA 4LU5H 5D8JH 5DVKA 3SKOA 1CR9L 3T08A 4JZJA 1H3TA 3KVQA 3HZVA 3DVNA 2VMFA 4BQ8A 2I9TB 1KTLA 4MCZA 4P49A 4LCCC 4X98A 1BZ7B 3RY4A 5JIKA 3BP7A 3PF2A 5IB1A 5ERWB 3RIAF 1N3NA 3FHQA 3TBWB 2R9HC 1K85A 2OTPA 4PJEF 1YEDB 4NYLB 3MREB 4HG4K 2DQGH 3QUXC 2EO1A 3MFGB 3VA6A 2AGJH 1FHGA 3ZZ1A 5TQ2L 3MLZH 1EVUA 4U6HA 2AKRB 4LPUA 3IAPA 4B0MM 4O2FA 1JP5A 2XWBB 2CR3A 4OQ1A 3DMMC 4KAQH 4Z9KB 4U49A 5FYKL 4EUPH 1NPUA 3ARGC 3JWOL 3MMEB 4LLVB 2KH2B 2JELH 1BWMA 3PGCB 4YFLF 3UYPA 1KPRA 2VIRA 1EMTH 1LDSA 3NAAL 3K8LA 4NQSA 4X4XB 1FH5H 2IBGA 4YHKH 3D6GA 4S1QL 2BVEA 3UJTL 2LE9A 5GJSH 3TZVD 2ORBH 4JFOA 1YEFH 3ZE1E 3G6AB 3LEYH 4PLOB 5HGAA 1RSFA 3RWFB 4PRIB 3FOLA 1FRGL 4G8GD 1MFNA 3OX8B 3G6JF 4YDIL 4WWID 4I8DA 3QDHA 3T1FB 3B2VH 1FIGH 4OI8A 4JFFB 3GKZA 4R7NB 4Z7UB 1JTTA 3NGBB 3FONA 4F7EB 5F7EH 1V7MH 3FO9B 5I9QC 3L95B 5T33H 2X1OA 4CVUA 4WHTA 5T1KB 4OZIB 1IEBA 5D1QD 4KJYA 4PJ9A 4YBQC 5DVOA 2FGWL 1GOGA 2H26B 3RTQA 2DQFB 1QSZA 1ZA6B 1HHKA 3K2UL 3B5GA 1NUDA 1T0MB 5HHVL 4JO1L 4P2CG 3D3VB 2HKFL 2J7LA 5TQ0L 3X11B 2BX5A 2XQYG 1NBVH 1K8IA 1A6ZA 5J8OA 4X4YA 3MNZA 4YEEA 5CIPA 1AXTH 3RX5A 3R0MA 4MNGE 2IGFL 3DGGA 4G9FB 3EYOB 5JR1H 4PRDA 1R5WA 3MBXH 1JNHA 3WS3A 2DIJA 1LP9E 2GK2A 4M1DH 4NQTA 4X83A 1FN4B 1CXFA 4NO3A 4N8VG 5HYFA 4OFKA 3GSQB 2CIIB 2X2YA 2OQJB 4PJXE 4WGVB 2WINB 4W81A 3U0PA 2EDOA 1KPUB 2Q76B 4PREB 1MJ7H 3BO8A 2GTWB 4KGLA 4X7FC 3SE8H 2A1WH 2JJUA 5ICYA 4KRMB 4PY7A 2HFFB 3VXUA 4MJ5B 1WEJL 2C4XA 2Y06L 4EXKA 4GAYB 5GGQL 4ZG1A 5I1JH 4R4BB 2G75B 3F5WB 2C4FT 2FEDC 1TTFA 1H5BB 1S5IH 1CE6B 5F1SA 1T2QH 1BQHB 4EUPG 1KC5L 4YFEA 1G9ML 4LVHC 4P9HH 3X13B 4QXUL 3SDAB 1ZGLA 4B50A 3GBMH 4NC0B 2VZVA 3VMPA 4IRJD 1A6UL 1NH6A 3VE0B 1YEFL 4QRTB 5J1AB 4NKIH 3X13A 2EH7L 3PGDB 3RVWC 2MCPL 3VDBA 4YC2B 5TF1H 3ULUF 4FQ2L 4HHAA 5IM7A 3KPSB 3DRQA 1FC2D 2WUCL 2B4CH 1OY3B 4I3RH 2HT4D 3EYVB 4ODXA 2JCCA 4PJGF 3ALWA 3ULVL 4KJWD 1NAMA 1FLTX 3LN4B 5JW4Q 4KK5C 4NWTH 3CXDH 2A6DB 1YC7A 5F7EL 4EVNA 4LAQL 3L3DA 1CGSL 3SCMC 5C70A 2OLDA 3IDNB 2AJZB 2ZUYA 4PJEB 2ITDA 3EYUL 5CJOL 1D9KC 4OIIL 2HA1A 1IFHL 4ZUWB 2X4RB 5C0EA 1DDHA 1CR9H 3MCG1 3BH9A 2O93L 5GGRA 1JF1A 1WTLA 2ICWI 4MXQC 1EUTA 1N7ML 2CLRA 1FGVH 5DGRA 4F7PA 2DQTL 4R9HA 1J5OH 3MRPA 5BO1H 2EXWD 2QLVB 1RZ8B 4GSDL 3SDXE 3BZEA 4JPWL 4LARL 1KT2B 5DZOA 3P9LB 2Y23A 1T4KA 3WFEH 3GIZL 4I18B 4P23B 3WE6B 2VXVH 3RZWA 2HH0H 1LQSR 2ESVD 3UBXI 3BQUA 3QEGL 4JPKL 3QNZA 5F1KC 2EXWC 5I1IH 4X6BA 4U1GB 5HYSB 1CGUA 3D48R 5FDWA 5HYJB 1IGCH 3LY6A 4F7EA 5CZVH 4O2EB 3OAYH 3JWDH 1CFVH 4O51A 3RWJB 1NGXA 1UZ6E 2KQMA 4XVUD 1OQOA 1VACB 3ILQC 4KRPD 5T1KD 3IRPX 3VFVB 2VDNL 5GS1A 1IMHC 4OAWB 3UMTA 2B2XH 5FGBA 3ARDD 2E5EA 4OLWL 4H0GA 3UTZB 2DQIH 1HYSD 4NRZB 3WFHA 1B0GB 5KVMC 3WNMA 2Q8BL 1CXIA 3R8QA 5HYSA 3L3KB 3QYCA 1CYGA 4OCMC 4Q9BA 4X6BB 4HPOH 1MJ8L 4IRJA 3QNZB 4JFEB 3R4DA 3UTTB 3ZHKA 3FQNB 4KK5D 2XICA 3BWUC 2LABA 1NCAH 3QO0A 2GQHA 3M1BA 1NCTA 3LD8B 3TT1H 4Z7UF 3BGMA 4Y4HC 4G9FD 4D0CB 4MQTB 2R0ZH 4WFED 4GRLC 5C0JA 3PGCA 1B88A 5DRWA 5F7WC 1D5MB 3HE6B 3F7YB 2XN9D 1F4HA 1XF5A 3UDWC 3QO1B 5I2IA 4Y16B 3MMEA 3O6KL 4HZLA 4GKZB 1TTUA 4HS3A 1NC2D 1P53A 2XN9A 4IRJC 4MA8H 1I7UA 3ZLQC 3JXAA 1T6VN 1R24B 3FMGL 3F6IA 1OP3K 3U30B 4GW1A 4HUNB 3X3FL 1ULVA 4XMPL 2LU7A 4NT6A 4Y4FB 1U3ZA 1YNTA 3WNPA 2ZJSH 3DMMD 4XCYB 4KQ4H 5DJ6B 1Z9OA 3D1MC 3MLRL 2AJZA 3FQWB 5GSVB 3BVNA 5IEKA 3GHBL 2A6DA 4PD4K 5CZVL 1HDMA 3NTCL 5IB1B 3IU4H 4KVNH 2NZ9C 1JPSH 1FAIL 3F8UB 1EEQA 3KXFB 4A2LA 3QI9C 4F57H 1N6QH 3QDJB 2VZ3A 1XF3A 3QISA 1FL6A 3KPSA 1LEIA 5A40E 1C5DA 3KPSE 4F8TA 1V8HA 2W1NA 2Y5TB 1DQLL 1MI5B 2FJGA 3KPSD 4KKCD 3V6ZA 4JCLA 5J3HD 2ATPB 2WP3T 2W07A 4KI5E 3WO4C 2OP4H 3HS0A 2NW3B 2IPUG 3IVKA 1KJ2B 3RA7L 1S9YB 1ZSDB 1FVDA 5EIQA 3VI4F 3MO1B 4EEEA 3FFCD 4JRXE 4KMTL 1OL0A 3OSKA 1FG2A 1NCDL 3CFBB 2G75A 4UILL 2XFXB 4FN0A 3TNMA 1WZLA 4QHLA 5BCAA 2HN7B 1NAML 5TGBB 3P3YA 3BHBA 1Z5LB 1HKLL 4YHPA 5JIIA 4ZUSA 1BBJA 1UYWL 4LASH 5E5UB 4APQD 2QKIA 4XCYA 4I77L 2F74A 1I7TB 5GS1C 5C0CD 1IM9B 4X9BA 4C56E 2GITA 3ARDC 4HWBL 1XF2A 1M71A 4FFVC 3LV3B 4X8JA 4YC2C 4PRDB 3DGGB 3OJDB 4G9FA 4HS3B 5HI5D 5CSBA 1UWGH 3B9KD 3ULVH 1ZT7B 5C2BL 5JHDD 1JF5A 2HYMA 3MNZB 2FEEL 3OKEA 5BW7C 4NO2A 4DKFL 3Q6GH 1XF5B 5C0DA 4GRWB 3QDMD 3ZTJG 5B38B 1D5MA 3OZ9H 2UUDH 4Z78A 4LAQH 5EA0H 3G04B 1T0MA 4IDJH 4YGVA 2VE6B 1AIFA 5CLTA 3ZSTA 5I76B 2HH0L 2OL3A 5DQDL 3NCFB 4P9HL 1CFBA 1S78D 4ZFOB 4R2GC 3QDGB 4JFDD 5H37G 1UJ3B 3VD4A 4LEXH 5E2VH 4IBLT 2I27N 2CRZA 5J57B 1HSBB 1KLGA 3D18B 3L3IA 4XVJH 1KULA 3R06B 1CDIA 2J6EA 4PJFA 3QJFA 5EPMA 3PQYB 2AJVH 1P5VA 2A1WL 4NRZA 2YXFA 3GMNA 4IRZH 2MQCA 4OF8A 4R7NA 4Z7UA 1OAXH 1EFXA 1BQLH 3N1MC 2LU3A 4YFLI 3NACL 5D7JB 1F3JB 1U8IA 5E5MA 4HZAA 5FUOH 1CVRA 4Y1AB 1HHHA 5EOCL 5H94B 1MHCB 1MRDL 4PJIB 5E8NB 3VFWB 4ZODA 1NMCC 1TCRB 1MRFL 4K3HA 5E6IC 3TYGH 1A1NB 3BKML 4M7JH 2E27H 4MNQB 3ULSB 1EZVY 1MHPH 5L6YL 1KCRH 3QWRA 1VPOH 3IFNH 3DYMA 2WWMC 3WFCH 4XWOD 3WKNA 4AENB 4FMKA 1ZVHA 3OHXB 2P5ED 1AY1H 1T4KB 1B4RA 3L5XL 1FPTH 4HUUA 1OT2A 1HXYA 2Y36H 5K9KB 5DEZA 4XWGH 1U2CA 2VLMD 1JN6B 3K4AA 3IFLL 1U8LA 2YPKB 5IMMA 2ZG1A 4Z5RA 1FVEA 3IDJA 1KXVC 4CMHC 5JORA 3EDJA 3C2SA 1RURL 3WFEL 1IC7L 5EB9A 4EQ2A 1YC8A 4U6HB 3BQUC 3H0TB 1URLA 5EBMA 2B5IB 2V9TA 4RNRA 3BRGC 5HHMD 2CR6A 5FM8A 3FQXA 2CO6B 3T77A 3VXOA 4FFZL 3L3DB 2B0SL 5GRYA 3QQ3B 3LD8C 2QR0A 3T0BA 1VFAA 1BQLL 2DDQH 4ZS6C 1RU9L 1T1XA 3SDCD 2V2WB 1BQHG 3DVNB 4UBDC 3P0YL 2VTFA 4F9PA 2R15A 1AQDA 4PRHD 4YX2H 2ICEA 3D39B 1EZVX 2R4RL 2WIMA 4YIQB 1H3PL 3HR6A 3PWPE 4K8RL 3H3PL 1CICD 1QSFD 4XP1H 2Y1VA 4DGYH 4LP5A 2EYSB 2H41A 4JPIB 1KEGL 3RX7A 5IJVB 1FYTA 3BOVA 5GRVL 5DD5L 3ILQD 4EN3C 3JV5A 4ENED 5GGVH 3KPLA 4CNIB 3WFBL 4F7CA 1ZVYA 4RGNB 5FF6A 1N6UA 2X5PA 2R56H 3O3AB 5DURB 4JO4H 3GIZH 2R0LL 4IMLA 4JM2B 5JUEL 1M6OB 4FQXA 5ENWA 5JOEA 1VFUA 1G1YA 4XWOC 1LMKA 1MSPA 1SQ2N 3RNQB 4RWHA 5E8OA 1CLYH 5LCVL 4NZUL 1Q1JH 1M7DA 2CIIA 4JRYA 2E27L 3FHAA 4LLAA 5I1CL 4XHJC 4PJBF 3MLVH 3QDMB 3DRTA 2WBJC 5I0DA 5GGVL 2A6JA 3MGOA 3CK0H 4IRSC 3EYOA 5L2KB 3V8CA 3RI5F 4J3UA 3QDGD 4IJ3C 4XMKL 1CZ8H 4JFHD 2NR6C 3B2UC 2CUHA 1V7ML 3BDYH 1TZGL 4RISL 1B90A 2ZUVA 3D3VA 3I02B 3BT2L 3E2HC 4RMVA 3VXRE 4N9OB 4Z95H 4DVBA 3H9SE 3SKMB 2ZWLT 5JXEA 4OTXH 4ZPVA 4Q9RL 2IJ0C 4KMQA 4H8WH 4LCCA 1XIWC 1QA9B 4GMSL 4HFUL 4NPYB 5C92A 2AJVL 3QWQB 1P6AB 1FFPA 4JFFE 4QLRA 4OJFH 1MH5A 3WFDH 4WV1B 1N5YL 4WEBL 5T3ZD 3QI9B 3JV4B 4LSTH 1XGPB 5FHBL 3STLB 3A67L 2CKBH 1A14H 4G8EB 5H2BB 5BV7C 3QFJD 4LLWB 3RL1B 4OV6F 2N4IA 4S0TD 2X4PA 1HHIA 4TNVF 2P5EB 3NFNB 3QFJE 5IIEB 3ZTNH 3PV7A 3QDAA 3GB7A 3MLRH 4PJXA 1M7IA 3EJZC 4WY7L 4BUHA 1BD2E 3NH7L 5ILTH 2ATKA 3K74B 2XPGA 4QHUB 1JTPA 3SE8L 5K9JH 5HDBE 1JZ6A 3BP6B 1WISA 4G6JH 5B39B 3W2DH 3O8XD 3MRBA 5H2BA 1FRGH 3B8SA 5L2JB 1A7NL 1YNLH 3QI9A 1NL0L 1OTTC 4HMCA 4DKEH 4FFWC 1MFAL 1OP5H 4XVUC 5I18H 1RUKH 3HC4L 4WWKC 1IEAA 1TJGL 5TE7H 3BPOC 5JW3H 3BKJH 5HHXL 4K3DH 1RFDL 1X9QA 5J0BA 4Y4FC 4P46A 4NJAH 5I66A 4KKCC 3SDXA 4EDXA 3QDJE 3CD4A 5IEHB 3CDFA 2FX9H 3VXTA 5J3HC 4GMTH 3IFOA 3Q1SH 4HMDA 3QCVH 2FO4B 1S7QA 4GFTB 4KKNA 4ONGL 1P4BH 1QFHA 4JFQB 1NCWH 2VLRA 2XTJC 3BPCA 1ADQA 4JFEE 4NRXB 3RVVC 3S6CA 3MREA 3MV9D 2UWEA 2R8SL 4ZUVB 2BRRH 5ADPH 3JBG7 3LSOB 1ZHKB 4M6NL 4UTBH 4JRYD 3V7MA 5DR5L 4Y4HB 3CXDL 2A83A 3ARWA 3TBSA 5BJTA 3CAFA 3SDAC 3HPLB 5K9OB 4ZAKA 5JIPA 3O6LH 1FC1A 4KI5F 3RY6C 5J1SC 4DK3A 4P5TA 1V7NH 3QUKA 4NOFA 1HH9B 5KOMC 2P4AB 3V52L 3I6GA 5MENB 1P1ZB 2VAJA 1JPST 1KXQE 2O5XH 1TFHA 5ISZA 5BRZD 3ULVC 3O2VH 5E8OB 1GZQB 4KJQC 4L9LC 3D3VD 4AIXA 2DKSA 3MA9H 5TH2A 4LSVH 4XXCC 1E6JL 2BJMH 1I1AB 5DO2C 1L0YA 1A22B 5C2UB 4XBPA 4L8DA 1BVZA 4P2RA 5DJCA 1DANU 1XR9B 2VDPL 2WBJB 2QJDA 4BK5A 5I1EL 3OKNB 3IFPA 2AK1L 5ADOH 1AD0B 1C12A 4NQVA 1BF2A 3FAXA 4YGAB 1S9VB 5E00B 5M95B 4AG4L 1I7RA 4LEXL 3U0TA 5L88L 4NQXB 1KN4H 4FZ8H 2XKNB 4OF0A 4CW1A 4HC1L 1RD6A 5EORH 5T1MB 1WTGT 3LS5H 4R4FL 1JV5A 4C54A 3BP5B 1J1XL 3OG4B 3GSOB 2OBGA 1P4LA 4ZXBB 2I07B 3GSVB 5TDOA 4UOW1 5DVNA 3K81A 3C5SA 4R0LB 3PXHA 5E9DB 3HZMB 1RZKL 4PD4J 4JO3L 4WO4A 1JGUH 2IBZX 4MLIA 5JPMA 3BWAB 3EDDA 1HN1A 4QO1A 4MYWB 2SEBB 4JN2B 5MHSD 5DT1L 5D72L 5EU5B 1NUNB 4PLKC 1NGZA 4KV5F 4HJGB 4YPGB 2QL1A 2A6KA 2E6PA 3VI4E 2AERT 3RVVD 3V0VA 3QUZD 5SWZB 3QIUB 2RFXB 2EH7H 3B6SB 2EDLA 3ROLA 4NM4L 3NCEB 1QRNA 3BEVA 2V2TB 1XGRA 4MD4A 3U48A 2X44D 3IDJB 3MRNB 5FFLA 1J10A 3F7RA 1JK8A 1IGCL 2PF6A 2J8HA 3QHFH 5J1TC 3ESUF 3VGAB 2EC8A 3QFDA 2CK2A 1ZT1B 2VLKE 5EU6E 2FECL 4QXTA 1MFEH 2NNAB 2ED7A 2IADB 1RK0A 4PRNB 4EOWH 2VLKD 5EU6D 1KIQA 4C4KT 1OSPH 2KKQA 2VXSH 3QWOA 4AG4H 4XNMB 1O5DT 2CXKA 1EXUB 1NGWA 4MNQA 3ULSA 4IS6A 1SJVA 2BC4B 4YBLB 4LVHB 3RZCA 1S78C 4LRNL 1FGNH 4PV8B 3NABL 1FE8H 2A38A 4NQEB 4XZUB 4LK4A 1YY9D 3RY6A 1CDCA 4LPCA 1JZ3A 1VSCA 4TYUA 2AJYL 3DXAA 4ZYKB 5FUZH 5HBBA 2AV1A 5EFIA 2IPTL 3LVEA 3KNBB 4OCWH 4PGBB 1DQQB 4UNTA 5CEYB 4U1KB 4XP6H 1RK1A 3ULVE 5C0IA 2HVKA 1RUQL 4IEFB 4ZNEE 4B7IA 2CLVB 2QSVA 5HPMB 5DHYB 5I1IL 2DL2A 1KLGB 3VGDA 4FP8H 4RCAA 4QHNA 2F5AL 3GBNL 1NGPH 4KVCL 4UZGA 3KPRE 4ZO6A 1UJ3A 3SY0A 3UO1H 2C3HA 2XKUA 3UTTE 5C8JB 3PWNB 5HD8C 2HT3C 1XIWA 3WJJA 2G2RB 2CDEA 3OKKA 3QSKB 3G04A 1H0DB 2Y7QB 4PGZA 4Z78B 1R3IH 2CKBB 4WWKB 1S7TA 4KXZI 4JFPA 5FYKD 4NO2B 3T2NL 1MCLA 1HE7A 1AKJB 2Q6WB 5D4QA 2N7BA 1T7XA 1INQB 4RAVB 1OP3H 1V3LA 1G7MA 5D70L 2EDNA 1IJ9A 1TZIB 1YMMB 5D8JL 4I2XA 4JHAL 1UXWB 4M1DL 1H3UA 2CQVA 2JCCE 1AP2A 2PO6D 3D0LB 1X5GA 5DUBB 4YE4L 2WW8A 4BQBA 2RAMA 1PJ9A 1C08B 5D7SH 5FO9A 1FO0H 3QNXB 3EO9L 3PWLB 4U7KA 5F9WC 4CJ1A 4MLSA 2WP3O 5FA3A 5KVFH 4PJ7A 1L0XA 4PB9H 1OAUL 1IL1A 3EOTH 2ZUUA 3G6JB 3CMGA 3GUTA 1QSEB 1UKTA 4JHZA 4Z7QE 1FNEA 3FMGH 2VZOA 4J12A 2P47B 3PDOB 1K8DA 3CDCA 3QEUB 1U3HC 4NZTH 2W60B 3T4AA 3DMMB 3B9EA 4HFUH 1W8NA 2JJWA 3RTQC 4S10A 2Q8AL 2BMKA 5CUSH 5GS2H 3VI3F 2IQAA 4PGEA 1N0LA 3LDBB 2CIKB 3O6FD 4XNQB 4M1CC 4N0CD 4OGYL 4ODTH 3GMRB 1JGLL 5C0AD 3MBEC 2BY3A 2V5TA 4XCCH 2UYLA 1N5YH 2HFEA 5TF1L 3VW3H 1MCPL 2C7UA 2IG2H 1IEHA 4LPWA 3GIVB 3K3QA 1A6TB 3C60C 4AQOA 4OLUL 3QH3B 5A3IC 3SGJA 4UIMB 3DO7B 1CZ8L 5GZND 3VH8A 3V79C 4JE4B 3NN8A 4WUUA 5J12B 5I16B 1PSKL 2DBLH 3UC0L 1JYXA 4OD2B 5C07B 3H3KA 4GKSA 4HSQA 2F53D 1Q9LA 5BMFL 1FNGA 3FO1B 5C0ND 2HKHH 1IKFL 2JJVA 1I7UB 1KCUH 3BD4A 1RHFA 4AEEA 1NC4B 3PL6D 4TNWF 3JVGC 1WZKA 4DQOH 2NMSA 4LOUC 3QO1A 4G6KL 1JL8A 1J8HB 3BAEH 3HE6A 3HG1B 4YDKL 5IESH 5AAWA 2G9HA 5DRWB 3EGSB 2J2ZA 1NEZA 1JTOA 4OFYA 5B39G 1MWAH 1EERB 5FYLE 3KS0J 3LRGA 3TBVA 5DEFA 1U8MA 2OXHA 3MLZL 1NAKH 4HLZG 1R3HA 4NCC1 1RULL 2GSIA 5KN5A 3BKMH 2CUMA 1DSFL 4M7JL 1WK0A 1JWSA 3RDTD 4QOKE 3GMQB 2R0WL 4WW1B 4YWGH 1B0GA 4JRXA 2ARJA 1QRND 3OAUH 3IDYB 5EZJA 3L5HA 4OAWA 4CAGA 3KJ6H 1VGKB 2B4CC 4M7LH 2BSRA 3VXNB 5DD3H 5CS7A 1IGTA 3C5ZC 4F2MB 4O9HH 3PP4H 1O7VA 4POZC 4NM8L 4MA3B 4MWFA 2F53A 4JZNB 3CPLA 4NJAL 4J6RL 3STBA 1UGNA 5JDJA 4E42B 4NDMB 4XP4L 4JQXA 2M26A 3L5WB 2JTDA 3U2SB 3VFRA 4O58L 1QFWL 3MOQA 1I3GL 1BFSA 1F3DH 1G7QB 2FRGP 1RY7B 1MLCA 1OF2B 2X1XR 1FLRL 4HWBA 3IKCB 4OCLC 4W4OA 2IG2L 5HHOD 5FYLL 3RP1A 1CXHA 2R0LH 3ZHLA 4JDVA 5AD0A 3HI6L 4IRSD 5IJKC 2CMRH 4PJCE 1J8HE 2FGWH 5ACZB 4G8IB 3KYAA 3WIFA 2BVOA 3V0WL 3C6LB 1LEGB 1ZANL 2X4UA 3GK8L 1BJ8A 1FYTD 4L3ED 4BKLB 1BLNA 5HVGB 3L3GA 1MJUL 4L8SA 5KSVA 3GSNB 4N9GA 5I1HL 4JAMB 5FYLH 1OAUH 1T1WA 5EBWB 2X7LA 2DI7A 3AY4A 4GRMB 2BHZA 5IFHL 3CC5A 5CGTA 5FOJA 5KSBE 2R4SH 5CMAA 5DTFA 3TESA 1U8PA 5J89A 2ADFL 2XY1A 2AGJL 1OP5K 1UWEH 4RZCB 4MD5A 1MQ8A 5JHDE 4KY1L 1TTGA 5LG1A 3VDAA 4XP4H 1FNFA 5EUOA 2Z9TA 5F7MC 4N0YL 5HDBF 3MGAA 1EX0A 3R8BB 1ORSB 5EWIH 4ODTL 2XWJB 4FQPA 3IDGA 3KXFE 3BKYL 1XR8A 3PE9A 5IB3A 3RZCD 2FH8A 5FOBA 2X05A 3E8UL 1N6QL 5C3LD 1ZKAA 3RHWF 2APFA 3WLWD 2Z35B 4BH8A 5CBAB 4QXGL 4XX1E 2FIRT 3BO8B 4NN6C 4P5MB 3ZT5A 2DI8A 4O2CB 1RZJH 1KB5A 2AEQH 1X5XA 3GSQA 1FN4A 5FB8A 4HS8L 4K94L 4MNHA 4F3FB 2YPLA 5I8EB 4PGJA 2QADD 1OLZA 5I71B 2CDFB 1LK3L 4PTTA 4YDIH 4H26A 3GGWA 5HY9B 4DVRL 4Z0BH 4EN3B 1AY1L 5KJRL 4R4ND 2L7JA 4J3VA 3MV01 4RRPG 3PGFH 5E6IB 3VD5A 3QJHA 5JHDA 2PW1A 1B3JA 1A6ZB 5IHLB 2CK0L 4YHIA 3QULB 3VXQA 5DGQA 2NY0D 4CVWA 1ZTXH 1OAKH 5FCUL 1LNUB 1A6AB 2OJEB 3VGFA 5LGJB 4GKNA 1FH5L 1KTKE 3CFDA 1YY8A 4WFFD 3TV3L 3OTTA 1XCTA 5HGGS 1T21A 4KUCF 2BY2A 5MI0C 4IOSD 5IBUB 2RR3A 3KWWA 1NFDA 5EOTB 1ADQH 4KJYB 1QBLL 4PJ9B 3OR7A 2VLJA 1S7SA 4YHZL 3JWDC 4GKNB 1IAOA 3LS4L 2F19L 1LNUA 3VWKD 2R2BB 2NY6C 1WAAE 3T2NH 1XCQA 1NCDH 3AS2A 3T1FA 4POZD 5DJ8B 3K80A 3P11H 4GO6B 4UB0L 5JQ6H 3E3QE 4MAYB 1IGYA 4J8RA 5CD5D 4X5XA 4FFYL 5KBNC 1SJHA 4P4KB 3HMWL 3IJYA 1NBYA 4KROC 3FFDB 1ZLVK