5CEZE

Crystal structure of the bg505 sosip gp140 hiv-1 env trimer in complex with an early putative precursor of the pgt121 family at 3.0 angstrom
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
213
structure length
213
Chain Sequence
SVLTQSASVSGSLGQSVTISCTGPNSVCCSHKSISWYQWPPGRAPTLIIYEDNERAPGISPRFSGYKSYWSAYLTISDLRPEDETTYYCCSYTHNSGCVFGTGTKVSVLGQSKANPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein/immune system
molecule keywords Envelope glycoprotein gp160
publication title Affinity Maturation of a Potent Family of HIV Antibodies Is Primarily Focused on Accommodating or Avoiding Glycans.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 42
structure length 213
sequence length 213
ec nomenclature
pdb deposition date 2015-07-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5cezE01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5cezE02
3IKCA 2BNRD 4YR6A 3UTTD 5E1HB 4U6VH 5KAQG 4Q9QL 4RDQG 1A3LL 2IAMA 1MHPL 3CLEH 3TZVC 5ENWA 2EICA 3RGVB 3NCCB 2EDJA 1T7YA 1PEZA 1IBGH 4GG6F 3T4YB 2AK1L 3LZFH 4JQVC 2NY4D 5JXAL 5GGSB 3VXOA 2IWGA 3NIDF 4M8QB 3X14A 3MUGA 4X4YA 4WUUD 5SX5H 1JTPA 1ZE3C 4JRYA 2AKRA 3DUSB 2EIZB 1O7SA 3LKOA 4ALAL 4LU5H 1QLRB 4N0CC 3ZE0E 4Q9CA 1NGPH 1A6ZB 3LEXB 3DX6A 3V2AR 4L8SC 5D1QA 3HG1A 5MENE 3I2CH 4JLRB 3RVXD 1A9BB 5BZDB 5F9DC 2NXZD 2EIDA 3OF6A 1MAML 2EDBA 2EYRA 5KN5B 2CIIA 2DM4A 5DMJB 3GM0A 4RMUA 1UWGL 2FHBA 2XN9E 32C2B 4U1NA 4Y1AB 2LTQB 3BPNC 4HD9A 5HGBA 4IIQA 1CQKA 4X6DA 1QSFD 3WIHA 3FB5A 4D9RE 2BNQB 1H3XA 2D7NA 1RPQA 1U8KB 1AHWA 4L3EB 2Z93B 3ZDXE 5DZOA 4XCNA 5CJBA 1OGAE 2WBJA 1VPOL 1SM3L 3TVMD 4TUKH 4YHKH 1F6LL 5DUPH 4PB0L 2FX7H 4Z95L 3WXVL 4HFWB 6FABL 2O5ZL 1YYMH 1YMMB 3DMMD 3GMOB 1XF4A 4JKWA 1R3JA 1UM4L 4P2QA 3VCLA 1JBJA 4NN6B 5B4MC 4DEPB 4UBDD 3G6JF 4QXGH 1ORSB 1QFWM 3HMXA 3MREA 4NKIH 5B3JE 3B9KD 1RK0A 4XB7A 3UTSB 5CINL 1VA9A 4MS8C 3WHE0 1TCRA 2Z35B 5TE4H 1F4AA 1A5FH 3LY6A 5HJ3A 3LN9A 3PL6D 4YEEA 5HYSG 3VDBA 1J1PH 3ZKXC 2A73B 1JZ3A 2LFGA 3HI6H 2R1YA 3SDCD 3FRUA 3NFNA 3IB4A 5CAYB 4XNZB 3BZEA 3A6CH 2RR3A 1BVLB 3QT2A 4OLXL 3HI1A 2ESVA 4Y5YC 5CEXA 2E6PA 3PXHA 2H32A 4L8BA 5JW3L 35C8H 1MCPH 3MNZB 1YPZB 5CZXC 3TPUA 4EOWH 1IGMH 4XPAH 1U9KA 3OKKA 1BZ7A 1NCAL 1Z6JT 2B0SH 4HJ0C 2EH8H 5E6IA 4PJHB 2P5EB 4QHLA 2F19L 3PWPA 4LCUB 3B2UD 3HUJE 5I74B 1U58B 1CK0L 2XKNA 5EWIL 5I30H 4YUEH 5E8NA 2E27L 1G9NL 5D9SA 1BVZA 1R3KB 2CQVA 3BKJL 2KH2B 3RWFA 3FCTA 3MLXH 1Q0XL 5F72S 3LQAC 3VRJA 4TSBH 3JTSB 3MZGB 4AEFA 3MLZH 2X4SB 3QDJB 2ADGB 3KYOB 1X44A 4UI2A 4OKVB 2HFFB 1FSKC 2VC2L 4UUJB 1J1XH 3UO1L 1FNSH 4NM8H 3C08L 3WO4B 1WBXB 3BPLC 4NRZA 4MCYB 2CDGB 3FFCA 4JRYE 2I9TB 3HE7B 4E41D 2B39A 3DGCR 3KYNA 1EAPB 2YN3A 4IHOB 5F1SA 5ACMA 5C07E 4DQOH 4FZEL 4ENED 5LGJB 3MLWH 3HG1E 3NFSL 1JRHH 3C87A 1XGUA 3ULVF 1ZVHA 3UTOA 5ETUA 4LLYB 1ZGLB 4OQTH 2WUCL 3GMNB 3IFPB 4JZJB 3TCLA 4U1GB 3BUYB 4DKAA 2IAMC 1FAKT 1EV2E 3HAEA 4HWBL 5FOJA 3RL1B 3TM6A 1KJ3H 1EJOL 4NFBA 3RGVD 1AY1H 2X4QA 1PG7W 1RUQL 3QULA 3DI2B 4HIJA 4YXKH 4XTRD 4MD4B 3MLSH 4PRAA 3QA3A 4Z5RA 2DMKA 3BX7C 4FRWA 2EDFA 4W6XB 3WN5C 5KSBB 3LS4H 1F90H 3DTXA 3RIFF 3X11A 3FFDA 5ESVA 2GCYB 1CD1A 5DA4A 2W9DL 3BN3B 5JZ7C 2VITB 3RWIA 4KVNL 4ZG1A 4F33A 4F7PA 3E0GA 4DN3H 1NL0L 4YQXH 2GFBA 2AQ1A 5CP3A 12E8H 1F8TL 4KVCL 4O00A 1CD8A 4D2NA 4Y4HB 4PUBH 3DETC 1RK1B 1F13A 5DD0H 2OQJB 5I75B 4DVRH 3OBAA 3DYMA 3P9MB 3QPQD 5DK0B 5SWSB 2FGWH 2N4IA 3SE4A 5CKAA 2K3TA 2ZUYA 3OKDB 4Y1AD 3UZQA 3SE8L 4HWNA 1SEQL 5HGAB 2WM0A 3MLTA 4JRXE 1S7VA 2HFEA 5H2BB 4YXLL 2BNQD 1YC8A 1CDCA 4ELME 2ESVE 4L3ED 2EDOA 4OCXH 2WBJC 5TDPA 3F7YA 5FYJU 4GW4A 2YZ1A 3V7AE 4YHMH 3DURB 3EYSL 3V4VL 3MNVB 4I48B 1ZXQA 4IRJA 1YMMD 4I18A 4GKSA 4RNRB 3TJEH 1I1YB 3PWPE 2B1AL 5D6CA 3WFCL 3L3HB 3VFSA 5B39B 4QRSB 1FJ1B 3JXAA 4CMMB 2H9GA 4UT6H 3T8XA 1WLHA 3FQTA 1S9XB 1BWMA 3T0DA 5CILL 1CLZH 4BYHA 2Z4QA 1X5HA 2Q8BL 1YEDB 1OP5H 4M00A 3FOMB 4P2OA 1DQLL 1GC1L 4P9HC 5BW7C 1T3FA 3TWCH 3SQOL 4OFIA 4P5TB 4BFGA 1G6RB 3TYFB 4HT1H 4JFEA 4QRPE 4NNPH 2V5RA 1A6UL 4KJQC 5JOEA 1BIIB 3WUZA 3RTQC 1XGYH 4LPCA 3V8OA 5BQ7B 1K2DB 4YHNA 1MI5E 3W81A 3ET9F 2N1KA 2BVQA 3FFCE 4HMCA 4Q9RL 2XY1A 3QNZB 1JV5B 1UKQA 2E3VA 5L2KA 2YD3A 3PABB 1TJGH 3OR7B 5E6IC 4XNYL 1SHMA 4HGWA 1X5KA 5J9PB 1XIWA 3B5TA 4TSCH 5KVEH 2P5ED 5ANMA 3HNVL 3MRHB 3X17A 4JAMB 2H8PA 2CKBA 1EEZA 3P77A 3CSYB 4Y89A 4HG4J 3KAAA 1YPZF 3Q6FB 4WU7A 5D7KD 1MCKA 5K9OA 1CZ8H 4XP1H 1J7VR 3QO1A 4R3SB 5IB2B 4LFHG 1CLOH 5I2IA 4TTDD 2YUXA 3IRPX 3QUZA 4MZ3A 1X5FA 1I7ZB 3MRJB 3QDJD 1A6WL 1B2WH 3OKYA 1OP3H 5GS1C 1J86A 4LP5A 1PKQB 4EKXA 2BSED 1NDGA 1WTLA 4FQXB 3U4AA 1JGEA 5IVXA 3MR9A 4M93C 1K5NB 1WV7T 1PSKH 4HKZA 4Z76B 3KPQA 3HE7D 3BH8A 3QIWB 5ID0A 1FCGA 3BGFC 2GW5A 4M43L 1D3CA 1NJ9A 3V0AC 3AGVA 4NP4H 1JGDA 3VWJC 2W0LA 4NM4L 3P0YH 2BOCA 1PG7L 1AH1A 5TE6H 5C1MB 4J6RL 3H0TA 5JMRA 2WIIB 1MJUH 4ZFGH 2R0LL 3V52H 4ZFZB 3KYKH 4IBLT 4P2RB 5DR5H 4TUJA 4EUPA 5C0GB 5ICYB 1UXSA 2GY5A 2OR9L 3KJ4C 3O6KL 4DW2H 1U3HB 4X8JB 5D1ZA 1AQKL 4R7DB 1RVFH 1FHGA 2HVKB 4XP4L 1X7QB 5IBTH 4GRLA 5FCUH 4XWGL 1E4KA 3CU1A 5E56A 1IKFL 1MREH 1F4XH 2O5XL 2NYYC 3WHE1 2B1HL 1KC5H 2H26A 1DE4B 4N8CH 4F37K 4OLZL 3VE0A 5D1XA 1NAMH 2X9WA 4YNYA 3NCJH 4NQVB 5CJ5A 1UYWH 3WIIL 3NCYP 1K3ZA 5KSBF 4Y4HD 4Y4FA 1IEAA 3L3GA 5J1TC 3C5ZA 4WW1A 3ZYIA 4G8EA 2GSGA 3GSUB 1CIUA 5EC1B 4Q2ZA 3JBG7 3SE4C 5SWSD 2EXWD 1SY6H 2W0FA 3QO0B 5LXGH 3LN5A 4Y4KC 2I5YH 1YEGH 4ZUUA 5A2LH 5C0EA 2IPTL 4JFEE 5DRWB 2E7MA 1WFUA 1U8LA 4NBZB 2B5IC 2MCPH 2IBZX 5AUMA 3C2AL 1U2CA 4PJBB 2CUHA 1ZLVH 1O0VA 4MA8H 1BHGA 2CRYA 3QDMB 1HHGB 4LSTH 3BGMB 4KKCC 5L2KE 5HVWA 4KKBD 5MEOA 2X10A 1AJ7H 3UBXI 4GMSL 4ZTOH 3IFLL 3OAYK 1RY7B 4BFBD 1HWGB 3EYFB 3HZMA 3ES6A 4JPIA 4U1SA 5ANME 4BSJA 1CU4H 5A1AA 5SWQB 2FWOA 1RJCA 3DI3B 1JE6A 4MJ6B 4RWYH 4FXGA 1A3RH 1MCNA 5IR1A 1UB6B 2AJVH 1R5IA 4NKOB 3I6LD 1ND0A 2FR4A 4O2EB 1P7QB 2ATKB 4LASH 4K8RH 4KZDL 5ADPL 1LMKA 4P5TD 1MQKH 1PD6A 2CO7B 3NACL 1OAYL 1P84J 4Y5XB 3IDJA 5C0RL 2QKIB 1CXEA 1QP1A 1MCJA 1TQCB 4MAUL 5CGTA 5E94A 4FQ1L 4XGZA 2PR4H 5A3ID 1T21A 1KTDA 4M5YH 4LVNC 3MRKB 3VFPA 1T1WB 3OJ2C 3QQ9D 1BVKB 3CMGA 5DRNA 3ROOA 3AS0A 1LDPL 2VDNL 1ZHBB 1MJ8H 4MA3B 2HWZH 5MEPA 5F8RC 4HBCL 4I4WA 1ITCA 3ZE1F 4NJAH 1HIML 4HUWA 5JR1H 4OZHA 3GMLB 4F7MB 2FL5B 4X7TA 3PIQA 5FXCH 2EXYC 1NC2B 3ARDA 1QYGH 4FQIH 4PJAA 3TV3L 4D0CB 3QUZC 1BX2A 4PTTB 3IETA 4JR9L 5KTEH 1QSEE 4LCCC 4YHIB 1MNUL 4E9LA 1LEIA 2BFVH 3T77A 5TDNA 5H94A 1E27A 4JDZB 3BDYL 1X5JA 3WFEL 4PJ8A 4MNGB 4FQXD 4HKJA 5M95B 2RJMA 3WS3A 4UIMA 3O6MH 2E7CA 3S36H 3MJ7B 2X89A 5AYUL 1KTKE 3QIWD 5DMIH 1IGFL 4G43A 4I5BA 2IADB 4P9ML 4YBQD 1BEYL 4MB4A 4YPGA 5ECJE 5GRUL 3RQ3A 1DN0B 4PG9A 4FP8H 5IQ7L 4XMPL 2VE6B 3KHOA 4KROC 4N8VG 2OL3H 1T83A 1FRGH 4LPXA 3BO8B 1S7RA 4OLUL 5KOMC 1NKRA 5EZIL 1A1MA 4X6BB 4P2RD 4LEXH 2BHZA 1DQJB 4JO1L 1AGCA 4PV9A 4DGYH 1OQOA 2D03H 4HEME 3OKNA 4JFOA 2UVFA 2G2RA 1MIMH 2FIKA 1NAMB 1U3HD 3GI8H 5GGRA 1KN2H 1FGVL 3DHMA 2EDNA 1YEIL 1NAKL 5C0ND 2D0GA 2LVEA 4KMLB 4OI8A 5FGCE 4U6XB 3LRGA 2FZ3A 1FZJA 2JB5L 4XP5H 3BUTA 4XAWH 4M62L 1S5IL 4NN5C 4PJCE 3MRMA 3RNKB 4AT6A 4ZDHA 4YXHL 4HWBA 2KZ1B 5DD6A 4ODSH 4HKBA 4ODVH 1WAAA 2ZCKL 4Y4FC 3C5ZC 4B50A 3MACH 1CD0A 3TBYA 2F8VA 5CJ8A 4J4PD 1OCWH 1S8DB 3KPRB 3K7UA 5CUSH 5EZLA 3RIAK 5I1AA 1AC0A 5HHPA 5CGMA 5JPNB 1JPFB 3W9EA 1X5AA 5FYLL 3BPCB 4KJWD 1FO0B 2NNAA 5BV7L 1OLZA 4WI4A 4IJ3C 1HQ4B 4Q6IC 4GW1A 3RAJH 3UPAA 3RZCC 3QDMD 1K8DA 2BDNH 1KBGH 1Z3GH 3IJYB 4P3DB 3NOIA 1NMBH 3ZKQD 5IEKA 2BOBA 4K71B 2AEPL 2VYRE 4ZYKA 5BVPL 2IANA 4OCRH 1Z0MA 5DVKA 2MPAH 5DYOA 5E2TL 3RY6C 1R3IL 2YD8A 3NA9H 3U0TB 3VI3F 5L0QC 2C7UA 2CJUH 2HTKD 2AI0L 3RBGA 3STZA 3MRBB 3BMVA 2OI9C 1R0AL 2Q3AA 4JZNB 4X9GA 1EA9C 3GNMH 4OZHE 1OPGL 3WIFA 5DVNA 1BQLH 5BS0B 2V17H 1N6QH 3MRIA 3MCLL 2VAJA 3JV5A 2D7TL 4WFFD 2QBWA 2IJ0C 3ZKMC 1P7QD 3HZYB 4FFYL 1RZIB 3KPMB 1N5AA 4U3HA 1NGYA 3FQWB 5FYJH 3RVTD 4IOIA 2ID5A 5D7JC 4I2XB 5I18H 3W0WA 4XC3H 5J57B 2B8OT 2EC9U 2J6EA 4QOKE 1ED3B 4MJ4A 4NO3B 1QFUH 1GGBL 3E6HA 1TDQA 1AI1L 3QUYC 3NIGF 5FCSH 4XNXH 2VISB 1C1EL 1KCUL 5DJAB 4LLVB 1U92B 1H3VA 5EU4A 1VEMA 4MD0B 1G6VK 4N1CA 2WZPD 4G8GB 5IMKB 3FQXB 1N64H 4NUGH 4TN9A 3CZFB 4IMKC 4DAGH 5IBUB 4HIEA 4DFIA 4TQEH 1NC2D 2VLJE 1PDKA 4LCYA 1UACL 4G9FE 1V8HA 1B0RA 1WICA 2X4TA 1SYVA 3BXNB 1N4XH 3WLWC 5CJQL 3QCTH 4U7SA 3FQUB 4MXWL 2ED7A 1F5WA 1T7VA 4LLMA 2OYPA 3HS0A 3KGRA 1KOAA 4PJ8C 3MYZA 4S0TD 4JRWA 3CXHK 4YH6A 4GKNB 1I9EA 4AENA 2FEDD 3P4LA 5EU6A 3TT1H 1ZLSL 3C5SA 4PB9L 5IROC 1GYAA 2GEEA 3L7EB 1HKLL 3QZWA 1GHFL 1G1CA 3UBXG 3L3IB 3W5NA 5JXED 2RFXA 2ZUXA 5EUOA 4XPFL 2VLRB 2M8XA 2W92A 3SDYH 1HN1A 3PHOB 5H37H 3CC5A 1IRAY 4OFDA 3QQ4A 4LSPL 4O2CA 2WUBH 4ZXBA 3G5XA 2QR0A 3ZKND 3QUXB 4KK6C 4NRYA 2DKUA 2ZSVB 1DBKL 3AXLA 3LRSB 2JJSC 2VXQH 1MRFL 5DJYB 4RA3A 3ZSSA 1I3VA 3KPSA 3ARGC 3B2VH 3DSFH 1UZ6F 4K7PX 1MCHA 1UVQA 5T1MB 3WNLA 4PRPE 5ESQB 2CDFA 4E42A 4K9EC 4KDWA 5E95B 4GRMB 4QO1A 5IW6B 3LKRA 2YEZA 4GT7A 4WI2A 1YUHA 2F8XC 3IFNL 1KLUB 4N0FB 1OTSC 1PYWA 2IANE 4DK3A 5IIEB 3AM8A 4WTWA 5GHWH 3GSNH 2JJVA 1B88A 1HSBA 43CAB 1ERNA 2DL9A 3D69B 1LD9A 3QUKB 5GS0H 4KRLB 1FAIL 2IFFL 5F9WC 1JGLH 4E5XB 3GJEB 5EOQL 3MLRL 3H7LA 3PP4L 4NN7B 4I77L 3LIZH 4NFCA 3SO5A 4CL7A 2P24A 3KPRD 1TQBC 3IDGB 1XGQA 2UZIH 3MRNB 1DBJL 2DQIL 4XNUL 2WWKT 3LN4A 3TN0A 3VGHA 2HRPH 2J12B 1OAUH 5EBWB 1RZJL 1M05B 1TMCB 4PJ7E 4M7KL 1GH7A 1C12A 2Y5TA 3P73B 2M1KA 1JHTA 4JJ5A 2AV1B 1ONQA 4GG8B 3JWDL 1YEEL 3ARFB 2ATPB 5TE7L 2XZQL 4K8RD 4ZUTB 3G5ZA 4QF1A 1J5OH 2VDOH 4O9HL 1T2JA 1VFUA 3D85B 3CUPB 1DBBL 3GBNL 2WP3O 4LHUA 1HZHH 3JV0A 5IT2L 5BVJA 1M7IB 4S2SB 1XR8A 4RGNE 5BS0D 5D6DA 4U0QB 5D2LE 3QXAA 4TRPH 1V3LA 4JQIL 43C9A 3VD5A 2YK1H 4PYGA 5C0CB 3ARXA 2DICA 4R2GC 1T22B 5JQ6H 3SDXA 4IRZH 2ARJA 4HKXA 3HC4H 1LWRA 3GSOA 1FLRH 1FBIL 3BH9B 3QBTB 1TNMA 2DQDL 4DN4H 1LO5A 3TNNB 5JHDA 2GK2A 4W6YB 3HMWL 4OZ4B 3DVNA 3U4EB 5EA0H 4WHTA 5EU6E 5A2IH 1CICB 1VACB 1CFQB 4CMHB 1KYOJ 3GM8A 1AXTL 4KKAD 5FAAA 3I6GB 2OTUA 3IU3B 1GGYA 1ZA6A 4Z7OF 4OBSA 3BMWA 3HRZA 3I50H 1A9EB 1KIRB 2R56H 4U1HB 2D7PA 5FHBL 4G7VL 2IH3B 2CUMA 3TO2B 4KKLD 3BRFA 5DQ9A 1H3WM 5I1LA 4JHWH 4G8GD 3OKMA 4G6JL 2NW3A 4UINL 2JCCB 3MUZ1 3ZHLA 1HILB 4QCIA 3LKQA 4P49A 3V4UH 3R1GL 3X3GL 2APVA 1ES0B 5EOTA 2DQEL 1MCSA 2MQ3A 5FK9A 1PX4A 4JDTH 1Y18A 3PQYA 3UX9B 3J8F7 4HUMB 5C0IB 1SBSL 1K9TA 1KIQA 5C0BA 5CMAA 4JPVL 3NPZB 5DS8A 5DO2C 4WTZG 3I02A 1V7NH 1MFCH 1Q9LB 3RWGA 2CIKA 4QEGA 4GW5A 3MRFA 3O2WH 5HHQA 5ILTL 5FA3A 3OJMB 1TCMA 4Z9KB 4JFDB 5INDA 4GS7C 2IEPA 4XBEH 2J88H 3E2HB 1DUYA 1EO8L 1HOCB 4Y88A 3V6OA 5EOCH 2VDRL 1KEGL 3PXJA 5IKCB 2VLRD 2ZZUT 3SN6N 3KLAA 3NPSC 4CU8A 1YEJH 3MBEC 4HG4K 1VSCA 1WZKA 4DVBB 3GB7B 3HC3L 3QUXD 2J8HA 2X4UA 1CFTB 1EAJA 2XTLA 3SCMA 1RZKH 3HR5A 3C09B 4DWHA 3S5LG 3R0MA 3GSNB 3TCXA 1NLDH 2OTWB 5DTFB 4D9LH 1AGFA 2ZUVA 2YBRA 4RMTA 4BQCA 1RUKH 3LEYL 4ODWB 1JHLH 3ZE2F 2YA1A 4LPVA 3P4MB 5DHYA 2IBBA 2UWEB 2Z31B 4HEPG 3PGDA 3WUWA 1UA6L 4IDJH 1U8PA 2YPVH 5BZWB 1TVBB 5DGRA 4LSRH 4HWZB 4OCSL 4YAQB 4U1LA 1T7ZA 3KXFB 2RIKA 3MO1A 1N26A 4CADB 3NCFB 3RWJA 5I71C 2WLZA 1VFBA 1RMFL 2QQKH 2E9IA 1FV1B 3MV9B 5HPMA 3LPWA 4XVJH 5IFJA 2V5TA 3RA7H 3I85A 4P46A 2ENYA 3EUUA 2AJXL 5CGYD 3SDXE 3UPRB 2AJ3B 2OLDA 4OM1H 4RAUA 3QCUH 3OTTA 4C56E 3DV6B 2GJ6A 5JHDE 3ZMRA 3CPLB 1JP5A 3BW9A 2PN5A 4XWOC 5C0AB 1WEJH 3SDDB 3MBXL 2WQRA 1RUML 4LARH 3LMJH 1PZ5B 5C86A 2XG4A 2YOCA 3X3FH 3DRQA 4MB5A 3U36B 4XPGH 1S9KC 1NCCL 4S1DD 3ARFD 1H5BB 1QQDB 3S3JA 3JSSA 4X80L 2VL5B 4ZFOL 3D85D 3OR6B 1HHHB 2HJLB 3P2TA 4W4NA 4NQCB 5FYJD 3FT4B 5GRVL 5BOZG 3TBTB 1S7SB 4NYLA 3PGFL 3MCKA 4IS6B 3EO9L 4UDUB 4OCWH 1IMHC 3PG2A 1DVFA 1IC4L 4XP6H 5E5RB 5C0CD 3IGAA 3GKZA 2QSCH 2FBOJ 2ILLA 4WY7H 5SV4A 2NQCA 2V7HA 3EJZD 3O8XA 4JG0L 4UIKH 4OTXH 3RFZC 3ULVL 4OD3H 3VXUA 4YFLF 3GSXB 1MFDH 3MGAA 2G9HA 3TBVA 1QOKA 1R24A 4QRRB 3RWCB 2R2EA 3ECBA 1CICD 2KZWA 4JFZH 2VMFA 3MNWA 5C0DA 3REVA 2X40A 4XI5D 1BOGB 4TPRL 4R97B 3WNNA 1EGJA 1P5VA 1F3DH 2AJZB 4LSVL 4UDTB 1CT8B 4PJDB 3P0GB 1FLTX 4OF8A 1RHHA 5E8PB 3VA2C 3FO9A 4P48A 1NC4B 1A7PH 2VXSH 2EYTB 1WZ1H 5HVGB 1ORQA 1OAXH 5T1DL 4C83B 1S9VB 2R39A 2PTVA 3PWUA 3WJLA 3QUML 1VADA 5ICZB 2V2TB 2R15A 4R96A 3MLVH 4YDVA 4HDIA 1UWEH 5CEYA 1P84K 4YDJB 2W59A 2JCCF 3QEQA 1BOYA 1WFOA 4RAVA 4ETQA 1OTTD 2XA8H 4EBQH 4AL8L 1OSZB 4CVXB 1INQB 2R23A 1JNLL 2D31A 1FIGL 1IAOB 5LCVH 1NBVH 1I7TA 3VFNB 4PGDB 3BVNA 3O2VH 1CF8L 4JFDD 5GRWA 4FTVE 3N85L 2I60H 3DV4A 2UZXB 4Y5VB 1T7XA 1UJ3A 3MYJB 1T5XA 3H8NA 4XNQA 4PJ5B 1LE9A 3IDUA 2Y23A 2FRGP 4U49A 5GIRA 1MFAL 4UV7H 4DOHE 2H1PH 4U1JA 2NR6C 5A16A 2AP2A 3QFJA 5HHVH 1C5BL 4P4KA 5I1EL 5ITBH 3ALXA 2A74B 2HTLD 4G9DB 3JZ7A 5D70L 1D5MA 4KK5D 4FQHA 3O41A 3UPCA 1P2CA 2HAZA 3S35H 5F7UA 5DZNA 2X2YA 2NY1C 3LKPA 4I0CC 2CDEB 4C55A 4MJ2A 2VDMH 5DJ2A 2EDRA 1NBQA 3O4OC 4QXTB 3MLPA 5DEFB 2H6PB 5I9QC 5DHVB 5CBAA 1Q1JH 4DKFL 5LVEA 2PUQT 4Z8FH 1HH9B 3PV6A 3VXMA 4K3DH 5DK2B 3BISA 4NT6B 2HLAB 5FYLE 4WNQB 1BFVH 4JKPH 3QWRD 2YA2A 4U0RC 4UQ3A 3KXFD 3LHPH 1AQDA 3O6LL 4OAWB 2YD2A 4GQPH 4J3TA 4XCFL 2VUYA 4MD5B 3MV9D 3QHFH 4GXUM 4OGYH 3VXQB 3N9GH 1BAFL 3VDAA 1YEKL 3HLAB 4X7DC 1II4E 4KI5D 4S1SL 3CFCH 3LV3A 4LNRA 5CP7A 4H20L 3D25B 1VFAA 1QBAA 3BIAX 4Z78B 1EHLH 1OVZA 4PRBB 5HYQA 1HQRA 2DM2A 3VXUE 3C5JA 3WE6A 3L3DB 1BLNA 3MLYL 1CG9A 3QEUA 3AMLA 4AH2B 1OM3H 4KI5F 5C0AD 1NGWB 2VABA 4KHXH 3SDDD 4CVZB 1IZKA 3L5XL 3DJ9A 5J6GB 3L7FB 1RZ7H 4YK4B 1MRDL 4LBEB 3BT2H 1JN6B 3PJSB 1JHKL 5E2WL 2RCSH 3O81A 4EQ2A 5CJXC 3VFUA 4J1UB 3GKWH 1HH6B 3WCYA 5I17B 5AZ2H 2ENSA 3IU4H 1RIVH 1A21A 3RWDA 2VRAA 2P5WB 4NQSB 5FOBA 2O93L 5DMGC 1F97A 5EU5A 4NQCD 1DLFL 1JGUH 1LILA 4OB5L 3BD5A 2CGRH 4UT7L 1XZ0B 4XBGA 3T2NL 1U95B 4GAYA 2YMXH 4ZPVB 1A0QL 1A3LH 3CXDH 4LOUC 1AE6H 4ZTPL 1BFTA 1H0DA 1YYLL 3O8XC 3WS6C 4RFNC 3FMGH 3T1WA 5FHAH 4ONGH 4J7RA 1RUAH 1FVCA 1KPUA 4U6VL 4CW1B 2XWBB 1VGKA 3BP5B 2X4NA 4QRRD 5JNYB 3CLEL 4GLRH 4O4YH 1HCVA 3EFFB 1G7MA 1FFPA 4WO4B 1IJ9A 1IBGL 1B90A 3LZFL 4NKDB 5T3ZD 5KW9H 5HYSB 4O51A 3O3BA 1QZ1A 2P8PB 2UYLA 3NCBB 4LVOB 3MRGA 2OR8A 3BN9D 4M7ZB 3SKNB 3BAEH 1NC4D 2AXGB 2A6KB 2DL2A 4LU5L 5KANI 2LQRA 1DEEA 1NGPL 1KV3A 1U8QB 2AVGA 3U0PA 3QFJE 2R1XB 1MCLA 3UTQB 4PJEE 1EEQA 4PJDF 1TETH 2RB8A 1KB5H 1PEWA 3C60B 3QIUC 2ICWB 4DCQA 1I8MA 1JMXA 1O5DT 3MV8B 3S97C 1AGEB 4GG6A 4LAQH 2BNRA 1GXEA 3UTTA 1AD9A 2KBGA 1N8ZA 1QEWA 3PGCA 3WKML 1J8HE 1YQ2A 3NAAH 1A6TA 3GUTA 3CDGB 4L9LC 3QG6A 3WNMA 1IM9B 3EO1B 3VXME 5BJTA 1MQ8A 4M9PA 2Y25A 3B8SA 2CR3A 3MRLB 2YKLH 4CU7A 2YC1A 3REWB 4U6TA 1FVDA 4TUKL 3MUHL 2DQTH 5DUPL 1UJ3C 3K8KA 2JF1A 4PJFB 4LHJB 3ZTNH 1KN4H 3BP4B 5BO1H 1YYML 2ZCHL 4JFFB 4PJ5D 2C26A 4WI5A 3CSBA 4PP1C 4FQCH 3EOBB 1B4JH 4R7NA 2NLJB 3UJTH 2APFA 3BDXA 2K7PA 1ZHKB 4O2FB 3STLB 1XMWA 4NKIL 3KWWB 2JB6B 1U91A 2NY5L 5KSVA 3P4NA 5TE4L 1A5FL 3P3YA 5E9DB 4CJ0A 1DANT 3ESVF 1J1PL 4HIHA 2FYYB 2EC9T 4U6HA 2VZ1A 5FM8A 3QXWA 5E5UB 3HI6L 5E5MA 2VIRA 1QSFA 5TPWH 3SGEI 3AROA 4CN6A 2FJHB 5ERWA 3WLBB 3A6CL 2PYEA 1IGJB 5JHLH 2VZ3A 4BQ8A 1XGPB 1OY3B 1KJ2A 2F19H 3G6JA 5F88B 2E7LA 35C8L 3G04B 1MCPL 1BECA 2P46B 4YBLC 3TVMA 2BRRH 2VXVL 5EWIH 4EOWL 4XPAL 3UJJH 1FZOA 5D71H 1JTOA 2C4FU 2B0SL 4BSVA 2EH8L 2MHAA 3DMMA 4LLQB 1F4YH 1H3UA 5TDOA 3T08A 3AS3A 3P9LB 2GKIA 4WV1C 5GRYA 5I30L 4YUEL 1RV6X 1PZUB 1QSVA 5KAQF 2VXTH 2E6QA 1YNTA 4RDQF 2F5BH 3MLXL 1FNAA 3B9KA 3WNOA 4X4MA 2VC2H 2W60A 1T5WA 1F42A 5DHXB 1BQHG 4NZRH 4TSBL 3PL6A 4U4BA 1IKNA 3T2QA 1MCRA 3K8MA 5I66A 3MLZL 2BVPA 1SMAA 5A40E 1D9KB 3SDCA 1ZSDA 2BSTA 2SEBA 4GKZA 4LSDA 4OI9A 1NCDH 2NY7H 3C2SA 4NM8L 1C16A 1OT2A 2GAZA 3EYOB 1SJEA 4OF6A 2P5WD 1OL0A 1RZJC 1Z9MA 4RISH 5IFHH 1BF8A 1UZ8B 4PRHB 3SPVB 2VL4A 4PPTA 2YD5A 1JRHL 3SE9L 4I0PB 5HI5C 2HVJB 1HI6B 2Z92B 4AMKH 3CFIC 3N1GC 2RAMA 2OS7A 2E9JA 3L3KB 4GG6E 1J0KA 4LRNH 4OQTL 1NGZB 4PBWD 3M17A 4ZFOA 1H9VA 3TJHD 4Y8DC 2ZOLA 3V6FA 2VKXA 3C9NA 1DDHB 2PW2B 1LEGB 1KJ3L 4HS3B 2XWJA 4J12A 4LK4A 1AY1L 3CX5J 3F58H 4WO4D 2AW2A 1FG2A 4YXKL 1U6AL 4C57C 3WKNA 3OJDB 4MDJB 1MH5A 1KB5B 4RIRA 5DRXB 5F7HA 4KVCH 3DX8B 4G6AD 3LS4L 1F90L 4ZAKB 1DLHB 2PTTB 3DX7A 4E41A 4GKOA 4DN3L 4YQXL 3FT3B 12E8L 2NCMA 5LWYH 5C7XH 1W0WB 1HKFA 2Q76A 3KS0H 4JREC 4PUBL 1XGRA 4C58B 5DD0L 4TULH 4ONHA 3BPOC 4HIXH 3C60D 3JV4A 2CLVA 3VFMA 3MV8D 4LIQL 3WDJA 5HI4D 5F1NB 1FGNH 4F9PA 3QCVH 3TP4A 1AGDB 4LGPB 2C3GA 3V4VH 2PYEE 1KYOK 3V5DA 3RGVA 1IM9D 5J11C 5KVDL 3QUMA 4WW2C 3G6JE 1CE1H 4OCXL 3WFCH 2GYSA 3VG9C 1E4WH 5GGSA 4Y2DB 3BZDA 4M8QA 3H42L 2Q8AH 5F7KC 2VXUH 1SYSB 2J6EH 1I8LC 4KJYB 4PJGB 3C6LB 4JFFD 3DUSA 4TUOB 3TJEL 2EIZA 3U46B 2I24N 1VFMA 4LLDB 4C4KT 4WHYG 3UCRA 1NSNH 1YN6B 4POZD 4QHMB 4UT6L 3VU2A 1GC1H 1A6ZA 1LE5B 1JK8B 3LEXA 4I3RL 1ZEAH 5HDLA 1CLZL 3RVXC 5FKAA 4X4ME 4PJFF 1A6UH 4JLRA 4ZOCA 1BJ8A 1A9BA 5BZDA 3PHQB 4EVNB 5EORH 3I6KB 5KN5A 3PP3K 5E9DD 5C9JB 32C2A 4DFHA 4Y1AA 3LPGA 5JORB 1VDGA 4PREB 2XIDA 4HT1L 4ACPA 4NNPL 2BNQA 4V1DE 1XGYL 4HX1B 5GPRA 3BHBB 4L3EA 2Z93A 4L4VB 5HVHC 1N2RB 1F4HA 5CJOL 1NBZB 3QAZC 1ITBB 2DJSA 1KFAL 5FO8B 1QRKA 4HFWA 1CVSC 1YMMA 4G8FB 4ZUWB 3GMOA 2WMPA 4TSCL 5KVEL 5KANG 4NZUL 4FQQB 1MCWW 3D18B 3GEWB 3I75B 1XCQB 3O45A 1VERA 4PRIA 1S78D 1DEDA 1ORSA 1A22B 1HYSC 3HPLB 4XP1L 5F97E 1K3IA 2Z35A 3PL6C 1CLOL 1IKNC 5IQ9B 2VDLH 1M71B 2YD4A 2ITDB 1B2WL 2V2WB 1D9KD 4F15B 5T3XE 4GAJH 1V3JA 5JW5B 1FYTB 4QYOB 2ERJB 4NM4H 1YDPB 1PG7H 2FH6A 1GSMA 1HHKB 3MXWH 4QRQB 3ULVE 1PSKL 3MNZA 4E41E 1YPZA 2R0LH 3FB8B 3PE9A 2BHYA 3FKUS 2F15A 4PRHD 4NP4L 4PJHA 4NQXB 2P5EA 3P0YL 4YDLB 3ABZA 3CDFA 4LCUA 4RMWA 5TE6L 3RWHB 4JDVB 1U58A 5GQBA 2OR9H 3O6KH 4I0PD 1MJUL 4ZFGL 3V52L 1R3KA 3SO3C 2APWA 3H9SB 4XP4H 1QSZA 3KYKL 3MMEB 5DC9B 5DR5L 1H3PH 3DVGB 2NY3C 3QWQB 4F58H 3MRCB 3P9WB 1IKFH 3JTSA 2O5XH 4DW2L 4HK3N 2B1HH 2X4SA 1RVFL 3QDJA 3JWOC 2ADJB 2AABL 4OLZH 4O5LH 1MLCB 3KYOA 1AR1D 1J0HA 4OKVA 2HFFA 5FCUL 2Y07H 5IBTL 4R4NC 4UUJA 3DX9B 1IAMA 1MREL 2X1XR 1F4XL 1WBXA 1U8IB 4MCYA 4GXVH 2FH8A 1KC5L 2CDGA 4ZAKD 3ULVC 4N8CL 3VD4A 1AC6A 2I9TA 3HE7A 1TVHA 5D93B 5L2JB 5K9JL 3VG0H 1NAML 4N5EC 1EAPA 5BRZB 4XNMB 5F7FA 4IHOA 4M6NH 2AEQL 1DUZB 1GGIH 4R0LB 5IB3B 1JNHB 3F6LA 1XH3B 4Q9BA 3C2AH 2BMKB 4LLYA 1ZGLA 2Y9RT 3GMNA 3IFPA 3D3VE 1SY6L 2I5YL 1YEGL 3OAZK 4OD1H 1X5YA 3BUYA 2MCPL 3RL1A 3KPTA 4L3EE 5SWZE 2YHGA 5DVMA 4MA8L 4MD4A 4LFHD 1BIHA 4LSTL 4OZFG 4MA1C 3ZLQC 5KSBA 5L8JB 4Y2DD 4QHNB 4L4TB 2YPLA 2EE9A 2GCYA 5EO9B 2VITA 1YMME 4K7PY 2UY6A 4I0KA 4MHHI 3C6LD 4RMQA 5GS2D 3VFVB 1F4WH 1FO0L 1CU4L 4MDIB 3V6ZB 1BD2B 4HC1H 5DGQA 4PRIE 1IC7L 5ADPH 4Y4HA 2C3HA 1RK1A 4MNHB 2OQJA 4RWYL 3FT2B 4NCC1 3D6GA 4QY8B 1A3RL 2NY2C 2HT3D 3DIFB 1IAII 3P9MA 4PJGF 5B8CC 2AJVL 4H8WL 5DK0A 5SWSA 4EXKA 3U7WL 4P23B 2LTQC 4K8RL 4LASL 1I85C 4KUZH 4N8VB 4OFVA 1MQKL 5F8QC 5HGAA 4HUNB 1HXYB 4IMLA 4X6CB 5H2BA 1KCSH 2DMCA 1JWUB 4QNPF 1I75A 2Z8VC 4L4VD 2OMBA 2VDNH 4MQ7B 2KQNA 2BY2A 4M5YL 1NCWL 3Q1SH 1YPZE 2V9TA 2IMNA 2C1OB 1MJJB 4NQUA 4YIQB 3DURA 4YHYB 3MNVA 4XAKD 4I48A 4YX2H 3LD8C 3QH3B 2P5EE 1UM6H 4RNRA 1I1YA 2H2PC 3LQAH 2EEDA 5HY9B 1Y0LB 2A6IB 2HWZL 3L3HA 5B39A 4QRSA 1FJ1A 2KUTA 4NJAL 4M5ZH 1X4XA 4UU9A 4DUXA 5D7KE 5IM7B 1S9XA 2F54B 1CFSB 1IGCH 1MNUH 4GSDH 5JR1L 2VDKH 1YEDA 4M7LH 1T66D 3B9AA 4KRPC 4MVBD 1QYGL 4FQIL 2AV7B 3TA3B 3FOMA 2EZ0C 3RHWK 2Q7YB 3VGGA 5KTEL 3D9AH 3GJFK 4P5TA 3WD5L 5AYUH 3TYFA 4ORGB 1T0MB 2BFVL 1BIIA 1J0ZA 5EZOH 2O61B 5BQ7A 4P9MH 1X5GA 4NOBA 4QWWD 1FYTD 3TZVB 1SEBB 2IQ9H 5E7FA 1Q9WA 3O6ML 3QNZA 1JV5A 2YR3A 5F1IB 3OR7A 1MIEH 3U30B 4JO1H 4ERSH 5J9PA 4OCYH 4TOYH 1P5UA 3MA7A 4FP8L 3MRHA 1LVEA 2FJGA 4L8CB 4JAMA 2OL3L 1FRGL 1KULA 1F6AB 1A1NB 3CSYA 3Q6FA 1I3GH 1U93B 2X41A 1FGVH 3H9SD 4RMRA 1FC1A 4LEXL 4TYUA 2BC4B 4DGYL 4R3SA 5IB2A 4TTDC 1E28B 4OIIL 1P4LB 3TPKA 3U0WH 1L0XA 1MIML 4RA0C 3V0VB 5IMMB 4LPYA 4OV6F 3GI8L 1RIUH 1I7ZA 3JWNC 4HH9B 2H3NB 5J1AA 2DJ4A 2Z8WC 4FFVC 2VJXA 3MROB 4YXHH 3BPNB 5DUMH 1TENA 3P11H 4FQXA 2EC8A 4XP5L 2YPLE 1K5NA 2ZG2A 3OJVC 2Y6SD 3IJSB 4Z76A 1LK2B 1FFNA 1MEXH 3QIWA 5JQHC 3ISWA 4FABH 3UXFA 2H2SC 5BRZD 5ACZB 3N1FC 4NO2B 2EDHA 4ODSL 4ODVL 1FDLH 1CGXA 1MCWM 2OTPA 2DBJA 4DUVA 5J06A 3MACL 2WIIA 5HXMA 5BV7H 4ZFZA 1OCWL 1RZGB 5CUSL 4P2RA 5LAXB 5JA8B 1TIUA 3VFTB 1U8NB 5C0GA 5MENB 3TGXA 5HDBF 3EDFA 1NFKA 3CH8A 5J13C 4X8JA 3QR2A 3T09A 2EE6A 4R7DA 1T6VN 2HVKA 1BJ1J 2XN9B 1X7QA 4Z0XB 3ZKXB 1WBZA 1GZPB 3IJHB 4KAQH 1A14H 3CNKA 1Y6KR 3S8WA 1R3IH 2KQMA 2BDNL 1KBGL 1Z3GL 4OCNC 4YHLL 1JMZA 4L4TD 1NMBL 1R0AH 1DE4A 2G75B 4Y5YB 4G80B 3VFGH 1CCZA 1TTGA 1A4JB 4AYFA 2PETA 5F3BB 5E4EB 2V5MA 2MPAL 3Q6GH 5C09B 3NA9L 1BD2D 5CEZH 1ZT4B 1IAIM 3OXSB 1EGJH 4NQVA 2CJUL 3SGDH 2C3VB 4AIZB 2VWEE 4Y4HC 3L9RB 4P9HH 3GNML 1X5IA 5I75C 2ZSWB 1BQLL 3UROR 5EIVA 2ICEB 2V17L 3O9WC 3UBXB 1N7MH 3CU7A 4J4PA 3GSUA 1RFDH 4NKQB 1WFTA 5I76B 1N6QL 3NGBC 4HUXB 3NBNA 3QO0A 1REIA 2XT1B 5E03A 5GZNC 5DRWA 5HHOE 4JJHA 5D96C 2FECL 4NC2B 1T20B 4RMVA 4GFTB 3BFOA 4PJBA 4X9IA 5FYJL 5I18L 2HT2C 3VMNA 4B0MM 2R8SH 3ZE1E 2VR4A 4Z7WB 3VJ6B 3QDMA 1HHGA 3BGMA 5F9OH 1WUNT 4KKBC 3HTLX 1FSKB 4ZNCD 1QFUL 3V4PH 1NMAH 2UV3A 4MX7B 4P5MB 1BQUA 1Y6NR 1JZ2A 5D8JH 3BPLB 3EYFA 3VXPB 3STBA 5SWQA 4XP9H 4JY5H 1YY9D 2VWEC 2WBKA 1N64L 3F62A 2F54D 4NUGL 2B7DT 5IESH 4KXZI 4DAGL 1IGTB 4MJ6A 1AO7B 1CDUA 4XRCB 3TA3D 1RD6A 4YZFF 1XF5B 3W9DB 4FXKB 4O2EA 4D0BB 4ZS6D 1N4XL 1P7QA 2ATKA 3L5WB 4MXVF 3QCTL 1IAKB 3ILPB 4GOSA 4Y5XA 2WWMC 2QKIA 3TBWB 5A3IC 2IAMB 2N7AA 5GGVY 2A2QT 1NUDA 3TZVD 4I13B 3IDYC 4K23H 1EPFA 2OR7A 3TT1L 1FFQA 4N90D 1HK6A 3DSNA 3HB3C 3MRKA 4XVUC 1EXUB 1TZGH 2FEEI 4LSPH 2DLGA 1BVKA 3PWJB 1XEDA 3OZ9H 3WN5B 4MHHG 4X4YB 3GIZH 4PY7B 1KXQE 3EDJA 1DBKH 1ZHBA 4F37F 4MA3A 4JRYB 5L9DH 1MRFH 3Q48A 3TYGL 4N0CD 3U6RB 4N0YH 2WUBL 1ZHLB 1GOGA 5EC2B 4YBHA 4KK8D 5C07B 3GMLA 4R26H 2DQHH 4OFKA 2FL5A 4D3CH 1JF6A 4DGVH 4F7MA 2D3VA 1NC2A 4M7LT 1JYVA 2VXQL 4D0CA 4PTTA 3C8KB 4UQ2B 2AK4E 2X7LA 1K85A 1LP9B 3B2VL 2AXJA 3DSFL 5F3HB 5F9JB 4YHIA 4U1NB 3OXRB 2E8YA 1XF2B 5IB1B 1JWSB 4JDZA 1A47A 4MNGA 3UC0H 1I8IB 4N0UE 3H9HB 3CK0H 5EULV 2GJJA 3H9ZA 4S1RH 1TZIB 4NUJB 3MJ7A 2IFFH 3QIWC 4HAFA 4RGMC 4KGLA 2I07B 2B4CH 5GHWL 4WEMB 2IADA 3GSNL 1JZ5A 2OCFD 1Z5LB 1DN0A 5JXEA 2E8ZA 4UNUA 3CDYA 2VE6A 5I1JH 2M2DA 2X09A 3NFPB 3BO8A 2OP4H 1WWBX 5C70A 4OLWL 5B4MD 4ODUB 4NNYB 4OGXH 2D7OA 4X6BA 4ZOEA 1DQJA 4X99B 2UZIL 2LVCA 5HYJB 1KXTB 1KGCD 5MEND 2E9BA 4Z7UF 1PAMA 2OZ4L 4MS8D 4PTUA 4PJ9C 1NAMA 4B41A 3JWDH 3S34L 5L88L 4YE4L 2HRPL 2YRLA 1OAUL 1T1XB 2P45B 2DYPB 3CX5K 3ZE0F 2XN9D 3VI3E 3WO3B 5C0NC 3BE1L 2R2BB 2DN7A 3QJFB 4U6XA 4D9RD 3BZEB 2R69H 5I1KH 3QFDB 3RIFK 4JRXB 1K8IB 1JPST 1NCUA 3RTQB 1IGIL 4ELMB 3HI1B 1IQWL 1SY6A 4EI5C 2DQFB 3KPLB 1XFPA 3EFDH 1FZMB 3RNKA 1J5OL 2VDOL 2DLFH 2XA3A 1G0XA 5JW4M 2CLZB 3TPUB 5C09D 5CZXD 1CDHA 2Z8RA 1BZ7B 2WIMA 5E6IB 1HZHL 3VH8G 5I1GH 4HJ0D 3PWPB 1FBIH 1G7LB 4UAOB 4TRPL 3ZDXF 1S8DA 4BQ6A 2VZUA 2YK1L 5D9SB 1BFOB 1W2KT 3EOTL 4TNWK 3RWFB 3FCTB 5JQ6L 5JPNA 1JPFA 3BESR 3NIGE 5I1HL 1KACB 4KJWC 3BPCA 1AXTH 1YNLL 1FO0A 1FLRL 4DN4L 3HE6C 2ZOKB 1FYHB 1C08B 1FNEB 5FHBH 1HQ4A 2MQCA 5EA0L 3ZYZA 4QRPB 7CGTA 3S5LB 3IJYA 4P3DA 5GS1B 2QHLA 2NZIA 5HD8C 3W11C 4R4FH 3I50L 1A7NH 2R56L 4M93B 2Z8SA 1MI5B 4NJ9H 3T3PE 4JHWL 3U0TA 5MI0C 2HYMA 3BGFB 4Z7WF 3SBWA 1A6AB 3MRBA 4KHTH 1EUUA 1FNHA 3AUVA 4P2CG 4JZNA 2HMID 3VWJB 5BS0A 3V4UL 4LKXB 2NW2B 3BWAB 1AO7D 1KJMB 2R29H 2HH0L 2IPKB 1ZHNB 3T4AB 4MSWB 3HZYA 3DXAE 5ILTH 1RZIA 5LGKA 3HPJB 3KPMA 3FQWA 5J4MA 3KJ4B 1NGQH 4I2XA 1CL7I 1OW0C 2AJYH 5KSAC 4MQXC 2GSIB 4HHAB 1W72H 3O2WL 5L6YH 3BP6B 4APQA 4HIJB 2YUWA 1ED3A 4NO3A 2QJDA 5KS9B 3L3JB 1K4CA 4P3CH 3MJGX 4HMDA 5I1IH 4XBEL 2J88L 2VISA 5DURB 3VRIB 8FABB 3O11B 4CJ1A 5EOCL 4L1DA 5DJAA 4LLVA 1U92A 1OOAA 2NX5B 5JZ7D 4JRYD 4WFED 2B20A 1KJ2H 3RVUC 1EJ6A 4G8GA 1UZ6E 1Q9KA 5IMKA 5D5ME 3FQXA 1YEJL 5D2NE 4HZLA 1I9IH 3CZFA 4Y0GA 5EN2B 5C07D 4POYA 1ZOXA 2GT9A 5IHUH 4RGOL 4QHUB 5T5NG 5DFWH 1RZKL 2HJFB 1I3UA 3DETD 1M6OB 3BXNA 2GI7A 2MCG1 3RIAF 3FQUA 1NLDL 4Y4KB 4D9LL 1H3TA 1RUKL 1YNKH 1CLYH 1JHLL 2OL3A 2B5IB 4OCSH 5DJ8A 2DI9A 4GKNA 5CCKH 4NQDB 1JNNH 4KV5E 1CXFA 3HCVB 5JDJA 3L7EA 1LP9F 4IDJL 3QXDB 3L3IA 5H8DA 2YPVL 4LSRL 4X5LA 2BSSB 3FO1B 3HC0A 1AD0B 3QWOB 2VLRA 3Q3GB 2QQKL 1CN4A 3PHOA 2QQLH 4MJIE 4XVJL 5D2NC 3RA7L 1URLA 3QIBB 3T8XB 3QUXA 1YY8A 2ZSVA 3MBXH 3LRSA 1DCLA 4M8VA 4PP2B 1RUMH 5HYJD 4OM1L 3BQUC 5F89B 2I9LB 4FZ8H 5DJYA 3D87B 4PJXB 4F7TB 3G9AB 3D39E 5JOPD 3V5HA 5CEZD 1P7HL 5MERB 2DYPD 3QQNA 5FGRA 1WEJL 2VLMD 5T1MA 5IFAL 3LMJL 3QDGE 5ESQA 1A7OL 2X70B 4GRMA 3X3FL 1ZGLP 2IH1A 4JRXD 5IW6A 3VFRA 3RTQD 4XPGL 5DD3H 4YHNB 1KLUA 4N0FA 3RWEB 5IIEA 3EO9H 4HK0B 5L2KB 1MRCH 4LVNB 5GISH 1C7SA 3FN9A 43CAA 5EFIB 3D69A 2D4FA 3NZ8B 5E6ID 1MY5A 3QUKA 4HLZG 3KYMB 5BS0E 3PWPD 4ELMF 4M61A 2W65A 4E5XA 3GJEA 4HFUL 3TFKC 4OCWL 1EEZB 3TO4C 3IDGA 4XP6L 5F7MC 4NQTA 3WNPA 5K9OB 1YECH 5KVMC 1CFNB 3MRNA 3K4DA 3SKOA 3O3AB 1UEMA 1H8OA 4WY7L 4UIKL 2J7LA 4OTXL 4BH7B 4OD3L 5F7EH 5EBWA 1MFDL 1M05A 4I2XE 4J3UA 1MFNA 3CVHB 3MFFB 4JFZL 2PO6C 4LCCB 1QBLH 4QRPD 3SE3A 1T89A 3P73A 5HSFA 1NCNA 2AV1A 4GG8A 4Z77B 1NDGB 3FOLB 4G3YL 3ARFA 2ATPA 4K8RC 1MI5D 1CGSH 4NHCH 4ZUTA 5AG8A 5ID0B 1A7QL 4G8GE 1A7PL 3EHBD 5IJKC 1XGTB 4ZQKB 1G7QB 2VXSL 1ETZA 1WZ1L 5ESAB 1M7IA 1OAXL 3VWJD 4S2SA 4HQQH 1W72B 3RPIB 4G6KH 4GJTB 1JNLH 2EO9A 4OQ1A 1JZ4A 5D72H 2HRLA 1T22A 1EHXA 5DF0A 3MLVL 3KHQA 1UWEL 3E8UH 4H1LG 3BH9A 1J18A 2R0ZH 3TNNA 1ZT7B 3VXSB 4EBQL 3LAFA 5E6YA 4OZ4A 4UV4H 5F7NC 3U4EA 5LCVL 3DUUB 3S36X 1QSEB 1CICA 3AREC 1VACA 1NBVL 3NN8B 3C8DA 4APQC 1ZANH 4MLSA 3O2VL 4WIQA 3I6GA 3IU3A 1MFAH 2DBLH 4X5WB 5DURD 1A9EA 1KIRA 4H0IA 2I60L 4TVPH 4WFGD 4U1HA 3OSKA 2H26B 2IH3A 3TO2A 4KKLC 2NX5D 2VLRE 1ZT1B 3S9DB 3VGAC 4NN5B 3WJJC 2CRZA 3OHXA 2JCCA 4YDIH 3BRGC 4UV7L 5J7CC 5KS9F 1HILA 2H1PL 4U7MA 1QFWI 4JCLA 1ES0A 5HHVL 2DIJA 4Y4FB 4S1QH 3ZDZE 1R3HB 5ITBL 2Z9TA 4K9EH 5EDXA 2GSGB 4TNVK 3WHXB 5LGHL 1T03H 4L3CB 3DVIA 4X98B 5GGUB 3S35L 1QUNA 1KLGB 4Y4KD 3LOWA 4LDLB 1Q9LA 2VDML 3MJ8B 4NO0A 4NQDD 3T2PA 1P9MA 4Q6IB 4Z8FL 5F96H 1EERB 4K3DL 2IPUK 3ETBF 4OJFH 4K7PH 4JFDA 1R6VA 4Y19E 3RZCB 1BFVL 4JKPL 4KKCD 4XPTL 2OSLB 3U1SH 1HOCA 3Q0HA 1MFEH 1CGWA 3LHPL 4D0DB 5C8JB 5IKCA 1IM3B 6CGTA 4XX1E 1LQSR 4PJCB 4R90H 4OGYL 3MLYH 3N9GL 4PY8J 1NDMB 5L0QB 3QIBD 4N5UA 3GB7A 1DSFH 2BVEA 2I27N 1AXIB 2OI9B 1CFTA 4ZOBA 3L5XH 2D2OA 4MCZB 5E00B 2XPGA 4NC1C 3GSNA 3INUH 3RNQB 3FAWA 3KPNB 3B9VA 2OTWA 3BJLA 1OM3L 2D7QA 5FUZL 5HHME 5HHNB 4KHXL 2DIBA 3VDCA 5DFVC 1RZ7L 3P4MA 2P47B 4NBXB 1ULVA 2UWEA 3BT2L 4RAHA 5D7JB 4PJXF 5FECB 4LMQE 2RCSL 3Q5OA 3GKWL 3T2NH 5JLZB 4OFYD 3QWRA 2OZ4A 3IU4L 1TVBA 1UGNA 1RIVL 2D9QB 3QI9A 4HWZA 3VFPB 4BZ1H 4YAQA 3KXFA 4RZCA 4H5SB 3QUYB 5FYJE 4CADA 3HN3A 1S7UB 1JGUL 1NEUA 1YYLH 4AIOA 1FV1A 2CGRL 2D7MA 3MV9A 4FFWD 2AQ3A 1NBYB 1L6XA 4X6EB 2YMXL 2VERN 2AJ3A 4ZSOE 3UPRA 3CXDL 1AE6L 2BVUA 4X7TB 1Q72H 3CAFA 3FMGL 3DV6A 3B3IB 3FB6A 5FHAL 4ONGL 1RUAL 5DSCB 2X9YA 5C0AA 3SDDA 4AG4H 3IS1X 2DWEA 4O4YL 1PZ5A 1T1ZB 4FQ2H 5H94B 2DMBA 4CVWA 4JG1H 4LL9A 1H5BA 2F5AH 5KW9L 1J0YA 1QQDA 3ZT7A 5EO0B 2VL5A 4QOKB 1NEZG 4D8PA 4ZFFB 3OG6B 4PBVC 3OR6A 5E2UH 1J05B 3MV01 2HJLA 3BAEL 4NQCA 1OP5K 2EDLA 1KIUA 3FT4A 3LS5H 3TBTA 2XXCB 1S7SA 1NFDE 2DTSA 4IS6A 3WKMH 4UDUA 1JYWA 1TETL 1S9YA 1KB5L 4PYHA 3L1OL 1FFOB 3QXVA 2VKWA 4PV9B 3ROLB 4JGJA 2E5EA 4QRTB 4LAQL 2VSCA 2A38A 2VLJB 4OBRA 2G2RB 4G9FB 1IC5H 3VXSD 3GSXA 1DP0A 3D2UB 3NAAL 1U8MB 5CZKA 3RWCA 4QRRA 1QSED 1GRWA 4NQEE 4CMHC 3ARGB 4V2CB 4LHQB 2ZCHH 4WENB 2V2XB 1GGTA 4U1MB 2HKHH 5JDSB 1BOGA 2YKLL 1BQHB 2COQA 2AJZA 4UDTA 1CT8A 4PJDA 2DQTL 2VQ1B 1DQQB 3ZTNL 5E8PA 1KN4L 2R4RH 5BO1L 4QLRA 2R2HB 2YD9A 3RVWC 5I73C 1NC4A 2NY5H 1X3DA 4DGIH 4IEFB 2EYTA 4FQCL 4C83A 1B4JL 4KQ4H 1S9VA 3ME0A 3R4DA 3UJTL 4Y4FD 5LJYH 5F9WB 3QHTC 1NANI 5ICZA 1NGXB 1EH9A 5F1OB 3MX0A 2V2TA 5GRJH 2G5BB 2FLRT 1TQBB 4AZ8A 1M1SA 3CXHJ 5GGTH 2NTFB 2APXA 1OSZA 4CVXA 1AXSB 2WSKA 2VXVH 5EIIB 5TPWL 3SDAC 4PGDA 3O6FA 5JHLL 2FB4H 5FGBC 4J3WA 1T2XA 1G6RH 3RZCD 4PRPB 4NCDA 5I8CA 2P49B 1I3RB 3ULSB 3VMPA 2BRRL 1L4IA 3GBLA 4Y5VA 3ARBC 3MYJA 3UJJL 5D71L 4ZYKB 1E4XH 2IANB 2UZYB 4PJ5A 2BJMH 1S3KH 4HMEA 4FNLH 1F4YL 1U8OB 1U8HB 4KI5E 2MFNA 2IPUG 2VXTL 5DI8B 2A74A 2F5BL 4G9DA 3GIVB 3DNKA 5ACLA 2OK0H 4JCMA 3KPPB 5FGSA 4PJCF 5JPMB 5AYQA 2YN5A 3DLQR 3FL7A 4NZRL 5GGQH 3H3PH 4R2GB 5GS0C 3ZKMD 5C0AE 1C5DB 1RJYB 3SGEH 2CDEA 1TZHB 5TFSH 2YPKA 5E8EB 3F5WB 4HUUB 4QXTA 1ZVSB 5DEFA 2H6PA 5DHVA 2D0HA 1NCDL 2NY7L 2PW1B 4PJ7B 1HH9A 5D7JD 5DK2A 4MJ5B 3WFBH 1NQBA 4NT6A 2HLAA 5GJTL 1QTYT 4WNQA 3QI9C 3EJYC 1HSAB 3SE9H 4M1CD 3AAZB 3QUYD 4HXBH 4PGCB 4EN3A 2P4AB 4NQCE 4RISL 4OAWA 5IFHL 3W5MA 3S3PA 2EDKA 4MD5A 5I1CL 2YA0A 1HXMB 4QXUH 3VXQA 1QLEH 5IHZB 2R9HC 3GMQB 4ZMAT 3HLAA 5I1DB 4X6DE 1SJHB 2XWTB 3GHEH 3RI5K 1DQTA 1S7WB 5TJWK 4AMKL 3MC0A 4LSUH 1OP9A 4Z78A 1R5VB 4LRNL 4PRBA 4WGVB 3HZKB 4BA8A 5D2LB 5ID1B 3Q2CA 1LNUB 1B0RB 1U6AH 3L3DA 1SYVB 4AH2A 1U3YA 4QRRE 4KZEH 5GGVH 2NPLX 1NGWA 3C8HA 1DQDH 4CVZA 2CK0L 4LLMB 5DFTA 3HS0B 5J6GA 3L7FA 3F58L 1YC7A 4Z0BH 1KXVC 3MOQA 4LBEA 4P2QE 5DWUH 3PUCA 1JN6A 3PJSA 4LVEA 3EYVB 4Q0XH 4J1UA 3S37X 3K80A 1HH6A 4N9GB 4JPKH 4QOKD 5D1QC 3MJ9L 2P5WA 4NQSA 3F7PC 5ICXB 4GS7B 4OFPA 2AGJH 5FDWA 3FONB 2AJUH 4LIQH 3SY0B 3QNYB 5LWYL 1XZ0A 5A43C 5C7XL 3RUGB 1U95A 2CUIA 3NPSB 4IIQC 3BEWB 1I9RL 4HS6B 4ZPVA 3MBEB 3WFHB 3OKEB 4TULL 3UAJC 4HIXL 4TVPD 3S96B 4NRYB 3UEZA 1AHWC 4KK6D 5KVDH 3FTGB 1T0PB 2V9QA 2VLJD 3EYQC 4K94L 2DLHA 4G9FD 4XCYB 2EDWA 2WNGA 1F3JB 1FGNL 2XWBA 4WEBH 1NFIB 3D2UD 3BP5A 3QCVL 5EBLB 2Y06L 2AAVA 3H42H 4DKDC 4LCWA 2ZUTA 5JNYA 3ARGD 1C7TA 4I9WD 4PJIB 1PY4A 3EFFA 5ISZA 5DJXB 1UVQB 4WO4A 1CE1L 4R97C 4NSKA 4NKDA 5AD0B 2VDPL 1BQSA 1E4WL 5HYSA 3BZ4B 3EAKA 2P8PA 2Q8AL 4I3RH 3KR3H 1EZVX 2VXUL 1A6VH 3B8YA 2J6EL 1GGUA 1OTSD 3SKNA 3SKJH 4MXQC 3UTSD 5E7BA 4XXDB 2A6KA 1V7MH 2MTPA 1U8QA 1GZQB 3SGJA 1NSNL 2R1XA 1G9MH 4I3GA 3VFWB 5I71B 1GJIA 4GBXB 1ZEAL 4XCCH 3S88L 4ODTH 5IG7B 3C60A 2ICWA 4G42B 1CGTA 5EORL 4GMTL 3A67L 3MV8A 4BKLA 1SJXA 2GJZB 1AGEA 3I3EA 2QQNH 5CJOH 5IP4A 2OX5A 4MWFB 3CH1B 1KFAH 3L6FB 1EBPA 1LO3L 4H0HB 3CDGA 2EDYA 1IM9A 3O6FC 2XZCH 3EO1A 1RZKC 4BH8B 4PRPD 5FKPB 3MRLA 4K7FA 4NZUH 3REWA 1N5YH 2HT4C 5DC4B 3NCMA 2RBLA 4PJFA 3VI4E 3BP4A 3MXVH 3JV6B 2IAND 4Y16B 4JFFA 4LSSH 1L0YA 4X8XA 2IF7A 4PJHF 3EOBA 3WXWH 4N1EA 2NLJA 1B9ZA 4HS8H 1ZHKA 4O2FA 3STLA 3GBML 5GRXG 3KWWA 4XPBH 4KC3B 4MYWB 2ITCA 4R2GD 5E9DA 2FLBT 2C5DC 1P4BH 2FYYA 2XACC 2VDLL 4C56B 3RKDC 3H3KA 2V5SA 3D0LB 2FJHA 4GAJL 3ALPA 1KTLB 3WLBA 4WHTB 2ED9A 1IGJA 2EDQA 2EKSB 1HNGA 1FNGB 5T5FH 3BZFB 3IRZA 5F88A 3MXWL 2WANA 4JY4B 4R4BA 2P5WE 3G04A 2ZPKH 1ZA6B 4EN3C 1UM5H 5K9KA 5MP6H 4MMZC 4PRNB 3WSQH 4LLQA 1C5CH 4PJ7F 2V7NB 3ZSTA 3LEVH 4OZFB 3P9LA 4XH2B 1ZVYA 3ZTJG 3DHJA 1QKZH 2MNUA 4ELKB 1A4KB 3QRGH 1RU9H 2NZ9C 2AABH 2DDQL 5FK9B 4YFDB 4OGAC 5IF0B 2GITB 3NCEB 1H3PL 3IDNB 4YFEA 4F58L 1P7KB 5KVFH 4LCIH 4KK9C 4LCWE 4C54A 3ULUE 2IBGA 3KG5A 3S98A 5ISZE 5B22A 1NLBH 3GRWH 4O5LL 5K9JH 1D9KA 5DO2D 4X9HA 1QRNB 2Y07L 3CSGA 4K3JH 5HI3C 1S5HB 5D2LF 3T04D 5ADOH 1RJLB 2JJTA 3OAZH 4ZO7A 2AEQH 4GXVL 3MOAH 5INDB 2QSQA 1I7UA 3VG0L 1UZ8A 3A6BH 4PRHA 3QP3A 3SPVA 1ZLWH 1MHCA 4M6NL 2ADIB 5FO9B 5F6IC 1GGIL 5F21B 3BGAA 1M7XA 4I0PA 3MBED 4JN2B 2HVJA 1HI6A 2QTEA 3L3KA 4JGMA 5JOFB 3T3ME 5MHSE 1NGZA 1IEBB 3TJHC 4FMKA 3HR5B 1BF2A 3JUZA 2DM3A 5GZOC 2VR9A 4OD1L 2AJSH 3RUGF 1DDHA 2PW2A 3ULUC 5C2UB 1LEGA 4HS3A 4IRJC 2DQCL 4I18C 1PLGH 3RDTB 2NY1B 5EO1A 4BQ9A 1FO0H 3OJDA 4MDJA 4WI3A 1KB5A 5DRXA 5I9QB 4G6AC 3DX8A 4PBXA 1JGVH 4OCMC 4PJFE 1IC7H 4ZAKA 1DLHA 3KLDA 2PTTA 3V7MA 3NA4A 1EVUA 4RCAA 4FTVB 3RPKA 1EHAA 4HIIB 4PJIF 3AS2A 4L3AA 3LQZB 1JVKA 1F4WL 4U0RB 3FT3A 4H8WH 4P2OC 4N0RA 1JZ8A 4HC1L 3U7WH 1W0WA 1ZWIB 4GBXD 1X6NA 1EBAA 1EFXB 1WT5A 1IGYB 2IGFH 3LSOB 1MUJB 4DOHB 5CFHA 3BEVB 5IVXE 2GK0B 5E9DE 3WFDH 1NCWH 4PY8I 4S11A 5F1NA 4KUZL 5HVFB 1JYXA 4WHCA 1AGDA 3SJVB 1KCSL 3GZKA 1XIWC 3BDBA 4XWOD 1T1YB 2ICCA 3L5JA 3Q1SL 1EEUA 4EI6B 4Y2DA 3GJFH 2BHUA 2MWCA 5INCB 5AAWA 5DJ6A 4KJYA 4PJGA 4YX2L 4LPTA 4Y16D 3C6LA 4E0RB 1JJUA 3BD4A 1UM6L 4TUOA 5AZEL 3LQAL 3U46A 1CE6A 2PCPB 4X7CC 3PWLA 2QEJA 4LLDA 4ZO9A 1KCLA 1YN6A 4QHMA 4XZUB 4M5ZL 1UFUA 1LE5A 1JK8A 3S3SA 4NYLB 1FL5B 1IGCL 3WD5H 1IAIH 4GSDL 4KRMB 1FNFA 4OM0H 4HH8A 5DD5H 2VDKL 2IMMA 4M7LL 4X0KB 3PHQA 4EVNA 3I6KA 1P53A 3IXTB 1QD0A 5C9JA 3UYRH 3D9AL 4C56D 5JORA 4PREA 3VXUB 1CBVH 4EDXB 2FSEB 2G9HB 5EZOL 3ECBB 3BHBA 4L4VA 3MNWB 1N2RA 2XTJB 2IQ9L 3EW3B 1NBZA 1QBMH 5FO8A 1F58H 1PQZB 4MA7H 1PW3A 4R6UA 1MIEL 1ZMYA 4PRHE 5I6XC 2X1PA 2VLLB 4ZUWA 5FF6A 4ERSL 4OCYL 4TOYL 4OIIH 4FQQA 2CH8A 3D18A 4IRSA 4OSUH 3I75A 3ORJA 1J10A 1XCQA 2QQQA 5D1ZC 5KG9B 3U7YL 5DVOA 1I3GL 5K33A 4PLNC 1VADB 4GRLC 1E4KC 3GSRB 1H8NA 3HPLA 4M7JL 1U3JA 1GGCH 4Z7NF 1TVDA 4RQQB 5IQ9A 3U0WL 3QIUB 2UUDH 1DFBL 4YDVB 5CEYB 1M71A 1RIUL 1IFHL 4W68A 1D9KC 5D1XC 4KKNA 1QRND 3RX5A 5DUML 3P11L 1IL1B 5JW5A 1FYTA 4LDOB 3FRPG 4L9LB 4QYOA 1HHKA 4QRQA 4XX1G 4UT9H 3AB0C 5FO7B 1MEXL 3FO2B 5IK3B 5CHNB 4ONFH 3FB8A 5EPMA 4FABL 1B3JA 1BP3B 4WTXA 4NQXA 2P43B 2KL6A 1FDLL 2DLEA 3RWHA 1LE9B 4JDVA 3C6SB 3FQRB 2YXMA 3H9SA 3MMEA 4PJEB 2E6JA 5FA4B 3GSWA 3MJ9A 1UJTA 3DVGA 5I8EB 3MRCA 4F3FB 3QHZH 1SJVA 3X13B 5BXFB 1UEYA 3B83A 1YEHL 4YHLH 1EK3A 1IE5A 4YHPB 3RDTD 2PF6A 1MLCA 2NY1D 4EIGB 5DJ2B 4PJBF 1J8HB 4KAQL 1A14L 4WWKB 3LH2H 3QJHB 5GSRB 3DX9A 3WL9B 1U8IA 3O2DL 5IJVB 3VFGL 4FTVD 5DD1H 5L2JA 1VKXB 4JO2H 5C71A 4PJAE 5C2BH 5BRZA 3Q6GL 5CEZL 1UQSB 1FN4B 1EGJL 1QVOB 4P9HL 1DUZA 2G60H 4R0LA 2HLFC 5IB3A 2LU4A 1D5BB 1EFXD 3K0WA 3VXRB 4QNPE 1JNHA 3SOBH 1XH3A 1KIPB 1N7ML 4HV8B 2BMKA 4WV1B 1RFDL 3RY5A 3GJFB 1BM3H 4Z6AT 1DANU 1TTUA 5HYQB 2O5YH 1U0QA 3AMKA 1FIEA 1K4DB 1YA5A 3SJVD 1W8OA 1IT9H 4W4OA 4HPOH 2VABB 1H15B 5H35B 2DIAA 1QPPA 1FPTL 1NMCC 2R8SL 5JO5A 4RRPG 5F9OL 4LKCB 2PXYB 3V4PL 1NMAL 3IDXL 4L4TA 4QHNA 3VRLF 4CRPA 5EO9A 4JFPB 5D8JL 5E08H 2GTZB 2A77H 4G8IB 1L7TL 3ARDC 5HPOA 2Q6WB 3VFVA 4ORZC 4XP9L 3V6ZA 4JY5L 1BD2A 5DZLA 3BIKB 4F9LA 3THML 5IESL 4IM8A 4A6YH 1FG9C 2XZZA 4MNHA 3FT2A 4QY8A 4WI6A 5H37G 3DIFA 4WEUD 2GIYA 1G9NC 1R3LB 3FN0H 3QYCA 4LOUD 2BVTA 4N8VA 2EYSB 3IXAB 4QXWA 3VXUD 3H7BB 4TVSa 3NIFE 1UWXH 5KJRH 1HXYA 4X6CA 3NZHH 2VDQL 5K59F 1JWUA 1MJ7H 2CKNA 1W8NA 2XTJD 1WAAE 4K23L 4MQ7A 5J8OA 1RURL 1MWAB 1KPVB 4HPYH 3CFJB 1T83C 3TYGH 2C1OA 3FHAA 3MRDB 4YIQA 3U82B 1TZGL 4AQOA 1BGXL 4JO4L 2A83B 3OZ9L 3LDBB 3MRGB 3GIZL 3QH3A 3DWTA 3M8OH 3KJ6H 5HY9A 4PGEB 1Y0LA 2A6IA 5T33H 4IRSC 4KI1A 5L9DL 2Q87A 3HZVB 3MRPB 4LRIA 4KXZH 1P69B 4W81A 4N0YL 1F00I 5IM7A 2W07A 1CFSA 3LQMA 5J1SC 3JWOH 1YJDH 1MVFA 4R26L 1N0LA 2DQHL 4D3CL 4DGVL 3EYUL 4JZOB 5T3XH 4JFQB 4JREB 4BELD 5SX4I 4YHOH 1GL4B 2AV7A 3TA3A 3QIUD 1UKTA 5DJCB 2Q7YA 1S9WB 3VH8B 3BYTA 1RZFH 4LEOB 3T0BA 4JM2B 1QEWB 4ORGA 3ESUF 2WP3T 1T0MA 3MCG1 2NY0C 5EIQA 1QR1B 1ACZA 2O61A 3VXTB 3EDKA 2ERJC 3UC0L 3I84A 3QG6B 3CK0L 3TZVA 1SEBA 4J3XA 3MGTB 4S1RL 3DRTB 3IDMB 2IFGA 4WW2B 1UG9A 2GUOB 5LQBH 2B4CL 3VG9B 5F1IA 4OLWH 4HLZH 3EGSB 4L8CA 2W0PA 2OZ4H 5I1JL 5DLML 3S34H 5DRZB 1OAQL 4PP1D 4YE4H 1F6AA 2OP4L 5L88H 3BRDA 1U93A 25C8L 1CFVL 1Z9OA 4OGXL 3W0WE 3BE1H 1T7WA 2BC4A 4OLYH 4M4PA 1E28A 1P4LA 4HF5H 2F58H 5CSBA 3V0VA 5IMMA 5JW4Q 1IGIH 1IQWH 1ZA3B 4HH9A 2H3NA 1INEH 1HWHB 2OM5A 5I16B 1J8HD 3MROA 4WWKD 4U3XA 2A9MH 4PJEF 2JIXB 3GFUA 2R69L 5I1KL 2HA1A 2PYEB 4L4TE 4P5KB 4O02H 3UJIH 3IJSA 3V95A 5HVHB 1LK2A 1WISA 1UCBL 1SVZA 1F11B 3EFDL 3QAZB 4OLVL 2DLFL 1BD2E 4K3EH 3EOTH 1U8JB 2D0FA 4NO2A 4Z7UA 3BJ91 3OL2A 4P57B 5I1HH 5I1GL 1CQYA 1YNLH 3VXRD 2WV3A 3OB0H 2FX8H 1RZGA 3BKYL 5IW3A 4B53A 5LAXA 2K9UA 3VFTA 1NUNB 1X6LA 5MENA 5FYKU 3MV7B 4AK1A 4W4OC 3WMSA 4HC1A 1GC1C 1KEMH 2MSPA 5I66B 3O3EB 3RHWF 2FJFA 4Z0XA 2V9RA 5EUOE 4NZJA 4EZMA 1GZPA 2ZP0T 3IJHA 1MF2H 2Q1EA 1OAKH 4PGBB 4A6YB 4H25B 1PVHA 2PXYD 4V1DB 5ITFB 2I25N 4R4FL 1A7NL 4G80A 4Y5YA 5GJSH 4RGNC 1A4JA 4N8PA 4NJ9L 5F3BA 2BNUB 2HH0H 4MXVE 5C09A 1WZMA 2XRAH 3OXSA 1FH5L 3M07A 5T3ZH 5TF0A 5DUBB 4TSAH 2C3VA 3KPSE 4AIZA 4BZYA 1N6UA 3L9RA 3CVHL 4KHTL 5DJZB 1AGBB 1F3RB 2ZSWA 5TQ2H 1JPTH 1P1ZB 3UBXA 2R29L 4RBPK 3VWKA 5I76A 1MCCA 3V7AG 5HI5D 5GSVB 3SO3B 3U7AA 4JM4H 3DO7B 2BX5A 3IYLW 3ZZ1A 4ZFOB 5E99H 2J5LC 2VN7A 2NY3B 4JHAH 1T20A 1PG7X 1W0VB 4B5EA 1NGQL 2AJYL 2MJWA 1WVZA 4N90E 3OGCB 1LO2H 4Z7WA 2LU7A 1W72L 3VJ6A 5L6YL 4U1IB 4W70A 3F7QA 1MHHB 2N7BA 4MX7A 4P3CL 4P5MA 4ZXBC 5I1IL 4M4RA 2CMRH 4RGOH 3VXPA 1KJ2L 3A0OA 5I8OH 5HHXH 4NRXB 1D6EB 4OV5B 3P0VH 4Q7DA 1YMHB 1I9IL 5IHLB 1JWMB 1N59B 1IGTA 5IHUL 1AO7A 3OKLB 3TA3C 1DL7H 3N1PC 1XF5A 3W9DA 4FXKA 1KENL 4PRDB 3L5WA 2M26A 1IAKA 3ILPA 4JM2D 2BY3A 3AM8C 3MV11 1CL7H 3HR6A 3TBWA 1B0GB 1YNKL 1CLYL 2JLLA 5E6ZA 3V5DB 3WYRA 5CCKL 4ZUVB 1JNNL 3GGWA 3QUMB 3T0EB 1EXUA 2F74B 5DHVH 5HYEA 4JM2F 3PWJA 3U30C 4BQBA 4MA1B 3HAEG 3WN5A 2AS5M 4PY7A 4Z7UE 4PLJC 3IF1B 5C08B 1X5XA 4NGHL 4X6FB 2QSTA 1T0NB 3TN0C 2VQTA 2X4RB 3LPFA 3OKOB 4HCRH 1MAKA 3OX8A 2QQLL 3U6RA 1L7IH 1WSST 3F7RA 2DWDB 3CX2A 1ZHLA 4KK8C 4WW2F 4XCEB 5EC2A 1I1AB 2RHEA 5C07A 2QADB 4OZGB 1W0YT 3R8QA 3HI5H 5FKAB 1KGCE 5IFAH 1A7OH 1I8KB 4FZ8L 5K9QI 5J12C 3SEPA 2NY2B 3C8KA 5B8CB 2OBGA 4UQ2A 3NABH 4HK3J 1CDIA 4YHZH 1LP9A 5FUOH 5F9JA 5F3HA 3D3VB 3AC0A 4OD2B 3OXRA 4J23A 1XF2A 5IB1A 1JWSA 2JIXD 2YWZA 1RSFA 1S7XA 1I8IA 3H9HA 2BK8A 2PYED 2EH7H 1TZIA 4NUJA 5DD3L 5SWZB 4PGJA 4H1LB 5D6DC 4HFUH 2I07A 1PBYA 3PQYE 1XCTB 1MRCL 5C09E 1U2HA 5FB8B 3OG4B 5GISL 1Z5LA 4R8WH 3B5GA 1DQMH 5MEQB 5C3LD 5C0BE 3LD8B 2R0WL 3KYAA 5CS7A 3NFPA 3QG7L 2GTWB 1BWWA 3O45B 5TF1H 4ODUA 3PWVB 4NNYA 4PRIB 3O2DA 4X99A 4FG6D 1MCOH 1YECL 3UTZA 5HYJA 1I4FB 3FB7A 2JKXA 1HYSD 3B6SB 2VOTA 3MV7D 5T1LA 4KRPB 3EZ8A 1PGRB 5F7EL 2YUVA 4G3YH 3QNXB 4K3GA 3V6OE 2Y7QB 1T1XA 3FHQA 2DYPA 4C59B 5BW7A 4Z7WE 2R2BA 4OF0A 1EHNA 1RUPL 1QBLL 3QJFA 1A7QH 2A0LC 1CGYA 3QFDA 3BP7B 4JRXA 1K8IA 3RTQA 1Q0YH 4V1DD 3W2DH 4ELMA 5F7DB 2YD7A 5CIPH 3L5IA 2DQFA 5E4EC 1V5JA 3KPLA 1CGSL 4NHCL 1FZMA 4WTZA 2B2XL 2DRUA 4UZGA 2CLZA 5T5NF 1QBBA 5F6HJ 1GOFA 1KCVH 2LV4A 2F8OA 3ARZA 1LDSA 4HQQL 1G7LA 1DBAH 1AO7E 2YSSB 3VWKC 4G6KL 4LLWB 4L9DA 4U2ZA 4WDIA 1BFOA 1A6PA 1IZJA 5D72L 9CGTA 5J3HC 3CMOH 1AFVH 4M02A 3E8UL 4NPYB 2NY3D 2R0ZL 2ZOKA 4EEEA 5F44A 1A8JH 1C08A 3V6OC 1FNEA 4UV4L 5CBEB 1A7BA 4H26B 1UXWB 3CFBB 4QRPA 4BUGA 1ZANL 5LBSH 3S5LA 5T3XD 5GS1A 4R4ND 1TTFA 2DQJH 1HEZB 2DBLL 3MUY1 4TVPL 1MI5A 4CDGC 3SCMC 1UH4A 4P4RB 2EO1A 4WFEE 3ULVD 1TVHB 3LB6C 4J3SA 5CSGA 4KTYA 2GJ6E 1BMGA 1A6AA 1EEYB 4N5ED 5LGHH 5IW1B 2HMIC 2FIRT 4AY0A 4YDIL 3MUJA 5T1KA 2BZDA 3VWJA 3GK8L 1HHJB 4LKXA 2NW2A 2LU3A 3BWAA 3IKKA 1BFSA 1KJMA 4S1QL 3O0RH 1GIGH 2IPKA 2VZTA 2P7TB 1ZHNA 3U9UB 4K9EL 3G5VB 3T4AA 3BKMH 4MSWA 2Z31D 1LP9E 1T03L 1XF3B 1HDMB 2IALB 3HPJA 3BOVA 3QXUA 4F2MB 1JF1B 4JFHE 2DQGH 2XQYK 4XPTH 5DQDH 5C6WH 3MSPA 1CYGA 2DOCA 5J13B 4KY1H 1WIOA 3DGGB 2GSIA 3DYPA 4HHAA 1ROWA 4P99A 3BP6A 4M1GL 5E2VH 5F96L 2UWEF 4OJFL 2E7HA 4K7PL 4PLKC 5KS9A 3T0ED 4EUPG 3L3JA 2HKFH 4P46C 3U2SB 3VRIA 2VO5A 3U1SL 1ZLUH 8FABA 2YPLB 3O11A 1MFEL 5C08D 2NX5A 2WINB 4HUVA 5FUCE 4R90L 1QFWH 2VZVA 1OAZL 4Y8AA 3CVIH 1I1AD 5EN2A 1DSFL 2QADD 4QHUA 5FUZH 5TH2B 5HYJE 1QLFB 4G5ZL 5FIEA 1NEZB 1EZVY 2HJFA 1RIHH 1M6OA 4ZO6A 3O9WB 5L7XH 5JOPE 2NY2D 3D48R 5CEZE 3INUL 2WBWB 3NGBB 5EUKB 5E8DH 1D5XA 3LKNB 4TNWF 3D3VD 4Y4KA 8CGTA 2VLME 1LK3L 4ONOA 2XY2A 2DLTA 4OZGF 5BV7C 4IMLB 2EEAA 4NQDA 3EO0B 5D96B 4FQJH 5IWLA 1MCQA 1A1OB 1CTOA 4NNXB 5SWZD 4UTBH 1FC2D 3HCVA 1TPXC 3FJTA 1BJ1H 4EDWH 3QXDA 4A2MA 1KNOB 1DVFC 1ZS8B 4BZ1L 1A7RL 2BSSA 3FO1A 4XBPB 1Q9OB 4F80A 1AD0A 2F53B 3QWOA 4IOFC 3CZJA 4N68A 3Q3GA 1AKJB 2C1PB 4NO5B 3QEQE 5FUCC 2H2PD 1KUMA 4XXCA 5EZJB 2XFXB 2P48B 3QIBA 4UU9B 4OUUB 4PRID 3QEHB 3NVQA 5I15H 4B7LA 2HG5B 5CIPB 4PP2A 1A2YB 5F89A 5IVNA 2I9LA 1Q72L 1MVUB 1QFPA 4KRPD 4PJXA 4F7TA 4KMTH 1UCTA 3RJDA 3MRQA 5MERA 2PYFB 2IQAB 2EZ0D 1V05A 4AEHH 2IG2H 1A02N 4AG4L 5HHOB 1DN2A 3WFZA 2X70A 4FQ2L 5HGDB 1K6QH 4U2YA 3SGKA 4LVHC 2ZUQC 2EDEA 4JG1L 2F5AL 2L4OA 3AS1A 1Q9WB 2CK2A 3EOYG 2OJEB 3IDYB 3RWEA 1NUFA 1O7VA 5HDOA 3WJLC 5F7WC 4OFYA 4HK0A 1OGTB 5E2UL 1G7HB 4GAFB 4ISVB 5EFIA 2FCBA 3L1OH 4WU5A 3NZ8A 3LS5L 3KYMA 3MA7B 4UAOC 1SQ2N 3UTPE 2PNDA 2FJGB 5FYKH 2DD8H 4M6OH 4LF3B 2A6JB 4I3SH 1CFNA 1KG0B 2L0DA 1ACYH 5IB4B 5K9QG 3O3AA 4O58H 1HHIA 2UY7A 1QA9B 4BH7A 1CGUA 4OIBA 4PD4J 1JIBA 4MQSB 1IC5L 2X6MA 4HXAH 3CVHA 2VSDA 3MFFA 5J1AB 3HRPA 4WUUA 3AU1B 4LCCA 5AWNH 2R4SH 4FFVD 2FHCA 3I9GH 5KS9E 3N50A 3ILQC 1XT5A 4Z77A 3Q5YA 1P4IH 2HKHL 1QNZH 3FOLA 4WFGE 3F8UB 1QO3B 2NX5E 4P4KC 2HFTA 3I3DA 2HP4A 1FFNB 1JPGB 2EIEA 4LLUB 2YRPA 4JO3H 2R4RL 5CD5C 3MPCA 4RGMB 5IMOB 3EHBC 2H2SD 4DGIL 3KLHC 1XGTA 4ZQKA 1G7QA 1KF9B 5ESAA 3FO0L 4JY6A 4KQ4L 1W72A 3RPIA 2BRQA 1VFOA 3CCHB 1D6VL 3S4SB 5GS2H 1FL6B 2BVYA 3JTTB 1R5WB 2BSRA 5GRJL 4JFXB 4YWGH 2ORBH 5C0JB 1FFRA 5IB5B 2FBJH 1ZT7A 5GGTL 3VXSA 3UDWA 4QHKJ 1INDH 5HDQH 2YD6A 3J7HA 4PJ9B 3DUUA 4NQDE 2AK4B 1QSEA 2IBZY 4PR5B 1RHFA 1G7PB 3NN8A 1WBZB 1N0XH 2FB4L 1G6RL 2VH5H 2W0KA 3QQ3B 3FQNB 4X5WA 4N0UB 2YPLD 3GMPB 1TJIH 4F7EB 4WJ5B 4X7EC 1ZT1A 3TIDB 5L8LB 2XQYG 4EI5B 1ZKAA 1E4XL 2QV2A 3DROB 2BJML 1S3KL 4NWTH 3ZTJH 3OAUH 4FNLL 3MA9H 3RVVC 2NXYC 4DUWA 1NANH 2CLRB 4UTAH 2BXYA 2JELL 1R3HA 3W39B 2B4CC 4TTGA 4JFYB 4PJXE 3CFEB 3O9WD 2OK0L 3WHXA 1FP5A 1TXKA 4L3CA 4BM7A 4J8RB 5I0ZA 4X98A 5GGUA 5GGQL 3H3PL 1KLGA 3SKMB 5GJTH 4GRWH 4MAYB 5GZND 5TFSL 3TC9A 3OMZA 4JANB 4QTIH 3MJ8A 3OPZH 3HE6B 5IWLC 1G7JA 1VEOA 4Q6IA 5I1CH 2HT2D 3IVKB 1ZTXL 3WFBL 2YRZA 1QG3A 3RZCA 3O3DB 2OSLA