5J3HD

Human insulin receptor domains l1-cr in complex with peptide s519c16 and 83-7 fv
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
112
structure length
112
Chain Sequence
DIVMSQSPSSLVVSVGEKVTMSCKSSQSLLYSSNQKNFLAWYQQKPGQSPKLLIYWASTRESGVPDRFTGSGSGTDFTLTISSVKAEDLAVYYCQQYFRYRTFGGGTKLEIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptide S519C16
publication title Insulin Mimetic Peptide Disrupts the Primary Binding Site of the Insulin Receptor.
pubmed doi rcsb
source organism Mus musculus
molecule tags Hormone receptor/immune system
total genus 25
structure length 112
sequence length 112
ec nomenclature
pdb deposition date 2016-03-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5j3hD00
2BOBA 4X5WB 2H2PD 2VDPL 2XZCL 3BZFB 3X3GH 2JB5H 4J6RL 3QEQB 1LDPL 1VESA 4F7TB 4PD4J 1LEIB 2GFBA 4C55A 2JCCB 1XGUA 5E6ZA 4Y4KB 3L1OL 3V95A 4N0YL 1YJDL 2OS7A 4JFEB 3SDAB 3V4UL 4K7PX 4RGNB 5D9SB 3VGHA 1NCAH 4YHZL 3VXSB 3O9WB 5DD6B 1P7HL 3NCFB 3NTCL 3QCUL 2V9RA 1ZHLA 5K9OA 4EEEA 1ZLSL 3EYOB 2FATH 4KK6C 2DAVA 1FFNA 4FNLL 1MH5B 4ZOEA 4FQHB 4I4WA 3GBNL 4TNWF 1XF3A 1LEKA 5BV7L 1A4KB 1AC0A 4ZPVB 3RWHA 1QSEA 3FCTB 4PRPA 3EYVB 5C71A 1R5VB 5I19L 1YMHA 2H1PL 3K1KC 5F1KC 2OJEB 1A1OA 3WSQL 5ANMA 1DLFL 1F42A 4NJAL 3NCBB 4EN3D 1PKQE 1KNOA 3L6FB 4PP1C 3TCLA 5E8EA 2LE9A 4M1GL 2BSTB 2GSIB 4Y4HC 5C6TH 1LNUB 3VCLB 4HGWA 1F45A 4ETQA 4JB9L 3NZ8B 2FO4A 5KVEL 1UT9A 4KKCC 2HLFD 3CLFH 3ALPA 2Z35B 1JHLH 1MHCA 4HH9B 2VLJB 3QXVA 2YK1L 3DGGB 2HJKB 4LVOB 1DR9A 1MFNA 4GMTL 3FOLA 1JYVA 1UWXK 3GFUA 1T20A 4RSVA 5EU5A 3JWOL 4RMQA 3H0TA 1HE7A 3O2WL 2DQUL 3JV5A 5KVGH 1CGTA 3IXTA 4Q2ZA 5DDHA 3M1BB 4Y5YC 3NIDE 3RKDD 1MFDH 2BSSA 2BX5A 5DRNB 1TZHB 2XQBL 1AO7B 4G8EA 4JRXE 2RAMA 5T1KD 3O2DL 1PSKH 4M7ZC 5EU6B 1ZV5A 1J87A 4FTVB 3TO4D 2GHWB 4NQSB 1UB5A 2PKDA 1CIDA 5EUOB 2Q6WA 1UZ8A 3WCYA 3HRZB 4XTRD 3ZKMD 2VAAB 3UTTB 1HI6B 1RPQA 1ZVHA 4IRJB 1JMXA 5T3ZD 1ODAA 4CNIA 1DBKL 4EUPG 4PB0L 1PFCA 3CFKA 4UMGA 3QIBB 5FYJE 4KI5E 2Z91A 2V5MA 1SMAA 4KJYB 4PJ9B 1UJ3C 5BQ7B 3UJJH 3SKMA 2DQJL 3QO1B 5C2BH 4GJTB 1DANT 1CFQA 2L0DA 2B8OT 4NM8H 2WK2A 4DKDC 4Y5VB 3L5XL 4GFTB 4U6XB 5KVDL 4BQ9A 4PREA 3S88H 2P8MA 5C0CA 1KLUA 4XCCH 5FIEA 4AEFA 3W0WE 4A2MA 3WLWC 4M93C 2EDXA 3HR6A 3U7YL 1YNTB 1CGSH 5F7KC 1OF2B 4ZXBB 2ITDB 3N1GC 4YHYB 5FHAL 3NIGF 3C5SA 4Y19E 1I1RA 5GGQL 4S2SA 1DUYB 3TT1L 4JN1L 9CGTA 4R97B 3P77A 2EDNA 3QFDB 4QXUL 1UACH 4PJHE 4QEGA 1NGZA 2DQDL 2ED7A 3W39B 2OM5A 5E7FA 1WZ1H 3C8HA 3G6JE 4G6FD 1IGYA 3HE7A 3CFJA 3OHXB 1F4AA 5IVNA 2DQGL 5F9OH 3EOBA 4LLVA 5TPWL 1DJSA 1CXEA 1Q94B 5FYLD 5FHBH 1KPRB 3WXVH 1CVRA 4JEGB 3CDGA 4H26B 2E8ZA 1LO2H 2BRQA 3RZCD 2I60L 3QR2A 4P5TC 1J86A 3QDME 3L3DB 4KUCF 1WJ3A 4LGRB 5J9PA 2AW2A 3LKPB 2ZUVA 4UIMA 2C9AA 4TUKH 3GB7A 4P23B 2C26A 3H6JA 4DGIL 1CFSA 5HVFB 2H26B 3PDOA 2QTEA 1K5NB 4HMCA 3UZEA 4Z76B 4CVWA 1I7ZA 4TSBL 5IWLA 2CIIA 4Z7OF 2QQQA 2AI0H 4XWGH 2QQKH 2I9LB 4ODXA 2DBLL 4GQPH 4ONHA 3MRGB 4Y19A 3VXOB 4OGYL 5ENWB 3SE4C 1WZMA 4F9LC 4ODWB 5MEPB 4AEIL 4XP6L 5DRZB 3PP3K 4X98B 2GUOB 5D5MF 3GKZA 2B0SH 3HKFA 2NMSA 3WJLA 2VB5A 1GXEA 4OZIB 1FNAA 1YYMH 3E6FA 5C8JA 1SEQL 4PYHA 3KPSE 1WGOA 2ADJB 1Z2KA 4KK5C 3T8XB 1P7KA 3G6JA 3RPIA 3HE6A 1J1OH 3D0LB 4LNVA 1PZ5B 1RZIB 5DC0A 2XPGA 4NO2B 5A2KH 3U1SH 2APBA 2R9HD 5MEOB 3F7VB 2AABL 3WEXB 4KTDH 4EI5A 2JELH 5DSCA 1YEJH 4XNYH 4LRNL 1FDLH 4NNYB 3QEUB 5D5ME 4NSKA 4LMQI 3SOBL 3SQBA 1K3IA 3I50H 4JPIB 4I9WD 1U9KA 3RGVC 3RWDA 1UM5H 1JWSA 3GSNH 5AAWA 4NCDA 3FO0L 7CGTA 2WBJC 5KSAD 4RWYL 1U8JA 4JJ5A 5HHPA 5I16B 1CG9B 3KPOA 3Q5TA 1A3QA 1HNFA 3RWJA 3WD5L 4PG9A 2CMRL 4GW4A 2RQ8A 5CKAA 3WBDA 4DW2L 3WS6C 4G3YH 1NH6A 5F7LB 4L1HA 4NPYB 4WDIB 4GRMA 4N0UE 2E7BA 4HH8A 2FGZA 5LXGH 4RFNC 4GRLB 3SO3C 4YFEA 3P30H 3ME0A 1BD2B 2A6KB 4H88H 4Q58C 3S36L 12E8L 5FKAB 2ZUUA 1SYVB 3H3PH 2IH1A 4EDXA 3CAFA 2AKRB 1UFUA 3FZUD 4HLZH 4P4RA 3QSKB 3H8NA 3BJ91 1KIRB 2B1AH 3X11A 4M6MH 2FRGP 4WUKL 2NNAA 3GBMH 3FFDA 2P49B 3GMNB 3IETA 1B0WA 2XYCA 4IOFD 3BPCB 5EU7E 2MMXA 5ADOL 15C8H 5FYKD 1QBAA 4QRSA 3OMZA 2D4FA 3K1DA 1JZ4A 4QRTA 1MCRA 3BDBA 1I3RB 1HIMH 1IGML 5JDSA 4GAJL 4BK4A 5I6XB 4OJFL 5CMAA 5FOBA 1Y18A 4YBQC 2YD9A 4FN0A 5KSUA 4XMLH 4PRIB 4RFEA 1H15B 1FGNL 1T1YA 3NACH 4JO4H 4S1DD 1J88A 3LCYA 3MRQB 5IR1A 2XZQH 1E6OL 2ILLA 3DVNA 1EA9C 4CADA 1QBLL 1GGIH 5EA0H 4QWWD 2EE6A 4BQCA 4MA3A 4KKLD 4FQXD 3SDDB 1L7IH 1KBGH 2DLFH 4MA8H 1IT9H 4L9LA 4C83B 2WIMA 4I1NB 1AHWC 4X83A 2IFFL 2NY1C 4LL9A 4O02L 3ZLQC 1JGLH 3AB0C 4HEME 4NKOA 2I5YL 2WLYA 3SKJL 1I9IL 2W9EL 4NQEA 1XF2B 4XNQA 4HDIB 4OCXH 1GGUA 3O4OB 3KJ6H 4HWZB 5L2KB 4PRHA 1A6VH 1I8KB 2PYED 4HV8B 2AEQH 3GJEB 2GJZB 5JXED 3E6HB 2UUDK 5GGRA 1MUJA 1WEJL 4PV8A 3CVHA 1X5FA 2P5EA 3VDBA 5ICXB 2NXZD 5FECB 3LH2L 4NN5B 5D8JL 1R3JB 1AQDA 1S8DB 1NGXA 1DBBL 3SDXE 5DC4B 1MFBL 4NHCH 5K9KB 1MAML 3VA2C 4UBDD 1DQDL 3EDDA 5DGQA 4XXCC 1F8TH 5HYJA 2MWCA 3FAXA 3QEQD 1G9EA 4Y5XC 4IJ3C 3MNVA 4CJ0A 5DQDL 3LQMA 2JLLA 1JBJA 2WQ8A 4Y4KD 5KW9L 4XWOD 3O6FC 4JFED 3SDAD 3I02A 3P4NB 4JO2L 4WFFE 3VXSD 3O9WD 2FEEL 5CUSH 2WIIA 1YMMA 3QWQB 4LVHC 3X17A 1A0QH 3X14B 1J12A 3QHFH 4Z0BH 1XGYL 5C0ND 5GRXG 4S1RH 5E99H 5BXFB 4ORGB 1FSKB 1S78D 4LSVH 1MVFA 2AQ2A 4U1NA 3BDYH 2R0ZL 4N8VB 2X4OA 3VWJC 4Z95L 3GUTB 4YXLL 3GIVA 1D6EB 2HVJA 5HYSG 4EBQH 2XG4A 4ZOAA 4YK4B 2YD8A 1S7XB 5D7IA 2E7MA 3MRBA 2VLJD 1NCTA 3OJDA 3L7EA 4LCWB 4BH8A 4NQVA 1ZHBA 4L1DA 2EH7L 3MOAH 3IAQA 3DV4A 2VLRB 5GJSH 3P3YA 3QPQD 1NBVH 4FQCH 4UDUB 4M00A 2MPAH 3WJJC 1NCBL 1U8QB 1AO7D 3BIKB 4NKIL 3C9NA 4UQ2A 5ALBL 5EU6D 2J8OA 3BVNA 4OCRH 4XMKL 4MXWH 4FTVD 1YUHB 3QCVL 4MJIB 4XCYB 4GMSL 2OL3L 5HDBE 3BSZH 1P84K 2HN7B 4I2XB 5E9DE 4O2CA 3QJHA 5IMLB 1P69B 3UTTD 4F3FB 3SDCC 3OJ2C 1RZ8A 4BH7B 4IRJD 3RVUD 4I77H 3RY6A 3BH9B 2IADA 4MNQB 5ITBL 4HLJA 3QIBD 5ICYB 4M6AA 4H20H 4PJ9D 4KZDH 2CR6A 4LFHD 3QQ3A 1YEEL 4F7CA 5T3ZH 5KOMC 3QUMA 2AJUH 2K7QA 4JCMA 1RZGB 5BRZA 3UX9B 1TETL 5IB4B 1T5WB 2FIRT 2ZSWB 3LEVH 5EU4B 4BYHA 5C7XH 1CFTA 1BVKB 4F2MB 4K23L 5DXWA 1L9NA 4C57C 3PWVA 4RNRA 2V2XB 4ZXBD 3HS0B 4AEEA 4LKCB 4R4FL 3QNZA 2VR4A 4X6DB 3QEHA 2PCPB 3RWIA 2WZPD 4H1LB 1UM4H 3WIIH 4UUJB 4WRLA 4P9HH 1EK3A 3CZFB 4KQ3L 4MDJA 1DQTA 4NN6B 4PJCE 3DMMB 3KYOB 3ULSA 1AIFA 3GHBL 1A9BA 2IJ0C 3MRMA 5L9DH 3T2NH 5J3HD 5E8NB 4XBEH 1ADQH 3TPUB 1OGAB 3E2HB 4U31A 3NFPA 1Z5LA 2QSQA 5T1DL 4YWGL 4XX1G 1AP2B 1KJ2L 2BRRL 3D5OF 4YFDB 5F8QC 4BFBD 3TT3H 2LQRA 1A7RH 3DX9B 1S9WA 3IJHB 3MC0A 4GH7B 4OM1L 3TFKD 1B90A 4GBXC 3BE1H 3ARSA 1M71B 4LMQE 5FYLH 3DRQA 2ZUTA 4NUJB 1AJ7H 1VFBA 1MCOL 5IJKC 1VEMA 1Z3GH 4UDTB 3U4EA 3U82B 4WO4A 3VFWB 3QXAA 1A3RH 4P23D 5CEXA 4Y2OA 4GQ9H 4ZFZB 2ATKA 1DCLA 3HC4L 3PGFH 3FO2A 2NR6C 3FB6B 5T3XD 3ZMRA 3MA9H 1DE4A 4U7KA 3VFOB 5B39A 5JHLL 1QNZL 2DQHH 3P9MA 3ULUD 1PY9A 3L3HB 2WBKA 5TE7H 5CZVH 4HKBA 1T89A 3UTZA 3GRWH 4X8JB 2E27L 4LQFL 3ARBC 5FF6B 4JM2F 2Z92B 3VG0L 4PLNC 3HNTL 5HY9A 1NGPH 3DSFL 4PJCA 3JV4B 4JAMA 5TF0A 4J4PA 3MNWA 3KPMB 2VQ1B 3MXWL 4LPWA 4G9FA 4Y5YA 1KT2B 5GRZA 4DQOL 3KAAA 4NRZB 5BOZG 5C3LD 3EYUL 2K3TA 3DIFB 4MD4B 5CLWA 4HKXB 2EE9A 4TYUA 1GZQA 2FYYA 5HGAB 1WBXA 3IDYB 3V52L 4R8WH 5J6HA 1XR8B 1A8JH 1YZZA 3O81A 2X6MA 4WU5A 4ZD3L 3K2UH 1QSFB 3MJ8B 2A83B 5H94A 5JPNA 2B5IB 2XKNA 2DN7A 1RZFL 3TESA 4FP8H 3PXJA 4EOWH 4IHOA 5SWZE 1MNUH 2IH3B 2R29L 2DKMA 4Q0XH 3KR3H 4IS6A 1XF5B 3ZKQD 1K8DA 1Y6MR 1LE9A 4LP4A 2FIKA 3B3IB 2Q87A 3L3KA 1R3HB 4GRLD 1L0QA 1BD2D 2HTLD 2I26N 4Z0XB 2DQCL 1JZ8A 1WWWX 4R26L 5IVXA 5DQ9A 3O6ML 4NFDA 5DMIH 1N5AA 4MA1C 5TE6L 5I73B 3A6CL 4ZFGH 2HRPH 5HVHC 1QVOA 4XAWL 5CIPB 1RULH 3C87A 4B0MM 1EHXA 3MV7A 1CFNB 1Y0LA 3G08A 3WIFA 3LKNA 4XBPA 2YEZA 4HAFA 4IRSB 2Y1VA 4WHDA 1YN6A 2AXGB 2XY1A 4Y4FB 2QV2A 5DEGB 1DANU 1LP9F 1VFAA 4K07A 4Q6IB 2Y36H 3D0VB 3A67L 2NXYC 4HUWB 1GZPB 3FT3A 1ONQB 5FYKH 3GGWB 2EKSB 1UCBL 3SJVB 4K8RL 3BGAA 4MJ5B 4ZG1A 4LCIL 4E42A 1NGWB 3U0TA 4PRID 1MJJA 5DA0B 4PJXF 3CXHJ 3O6KH 2DWEA 4Z7QF 2MOVA 4ZUVB 4P5TA 4N0RA 2EDQA 5E5MA 2WINA 3ARTA 1B4RA 2EYSB 2NZIA 4NIKB 1T2JA 1U8IA 3D9AH 3PWNA 3OKOB 4PJBF 1CGYA 1RHHB 3K46A 1DLHA 2LAGB 3SDDD 1I9RL 1QLRA 1AQKL 3HI6H 4K94H 4W6XB 3QCTL 3QXUA 4JGMA 2DQIL 1J05A 2X42A 3TIDA 3MLVH 5IB2A 2BOBB 4PJXE 3HAEA 3GK8L 1FE8H 4E41E 1YEFH 4EJ1C 1XGUB 2VZ3A 5L2KD 5L0QC 3BHBA 3DX6A 4F9LA 3KLHD 3D3VE 3DETC 2X2YA 1P7QA 3QI9B 3IU4L 4GS7C 1MCHA 5JHDB 1ZHLB 5I1JL 3OG4B 1I7UB 5JW4Q 3L5WA 3WFCL 1FFNB 3HPJA 4I4WB 1LEKB 1XF3B 1N8ZB 2E7LC 4OCLC 4Q97A 1MAKA 3MLWL 5HHME 3PL6C 2F8OA 5CZXD 1PG7H 2V5TA 2YZ8A 1L7TL 1YMHB 3BKML 1W2KT 4OZHA 2HFEB 1I85C 5C07E 2AV1B 4B53A 3NCCB 5INDB 1FZOB 2PO6C 4FXGA 3KPNA 2IAMB 2X4SA 3OAUL 1OLZA 3O8XA 1BWWA 4HC1L 2MQCA 1QACA 2WBJA 1AGDA 3GJFH 4HGWB 4P2QE 4M62L 4ETQB 1W0WB 1QA9A 4X6CA 4F80A 5MHSE 4JM4H 4AT6B 3EJZC 4N9OB 4TUJB 3W82A 4MB5A 5K59E 4HULB 3I2CH 4O5LH 2P5WE 5GHWL 4GXUM 3PWJA 1RI8A 5DR5L 5F6IB 2D0HA 2CDFB 1J8HB 4Z18A 1T20B 4M6NL 2W07A 4ZNEA 3WS6A 2O5YH 2XKUA 4KDTA 1ZSDB 2YPLE 1IAMA 3RJQB 4X9BA 3D48R 3IXTB 3KPRA 4Q2ZB 3MV9E 4JREB 5DZNA 3V6FA 5DDHB 3WXWH 3E0GA 2Q1EA 4ELKB 5EUKA 1JN6A 2BSSB 4G8EB 4KXZI 5L8KB 1GRWA 1HXYA 4PJIB 3VXMA 4AL8H 1FO0B 5EIQA 5HHXL 4ZFOL 1BX2B 3MYJA 1UB5B 1XIWB 3O4LB 2J8HA 2ZUYA 4NP4L 2Q6WB 1QD0A 4LCWD 1EGJA 3WKML 3CPLB 2EC8A 3HZKB 4NQCA 2FX8H 4RDQF 5J12C 5DRXA 1ZT4A 4KTYA 1MRFL 3AXLA 2VLRD 4CNIB 5LCVH 4RA0C 1PG7X 3MLTA 1R3IL 4I3RL 2LAAA 3MREA 3CFKB 1X4ZA 2LU4A 1G9MH 3MV01 3CFIC 3RP1A 5F1NA 5FYJL 3V4PL 4XPBL 4JFZH 5IGXL 4JHAL 2P44B 3QQNA 5ID1A 3IRZA 4MJID 2J6EA 1CFQB 4WWKB 4XP9L 1KGCD 1GIGH 2VDOH 3UTQA 1B0GB 2P8MB 4K9EH 5IROC 1KLUB 3GNML 4NWTL 4M03A 5DJ0B 5IQ7L 2CLZA 2F5BH 3S6CA 5F70A 2JE8A 5CGYD 3EOTH 2PTVA 1HHGB 4MNQD 3C5SB 3PWUA 5JORA 1NAKL 5DYOA 4LCCB 3MCLH 2C7UA 2NY5H 2NCMA 1HN1A 2AXJA 2XTLA 3Q6FB 4LARL 3S35L 2RR3A 4RA3A 5CCKL 3EJYD 2XN9E 4X99A 3D6GA 1CT8B 3QIUC 4ONOA 1NGZB 3Q3GA 5I8KH 4YHKH 1XGTA 5IP4A 1AHWA 2F54B 2VDQH 2VABA 2KBGA 5J1TC 1OSPL 5CILH 5CLTA 1IARB 4NKQB 1IGYB 1C12B 1DQML 3HE7B 4JPVL 3CFJB 4DKAA 3EOBB 4LLVB 4RMWA 1ZT7A 2WQRA 4L5FH 5ISZA 1F5WA 2UWEE 4FZ8L 3I6LD 1G7QA 4JCLA 4PJFA 5GQBA 5I1GH 4F7EA 3DMMD 1XMWA 4PP2A 5EC2A 2DMKA 1E4KA 4R2GB 4LSSH 4UIMB 4FABL 1OLLA 5F96L 2LFGA 5BZDA 1OGAD 3MRPA 5D7LA 1CFSB 3JZ7A 2VYRE 2CUMA 2OR7A 4FQJH 1KEML 4IBLT 1I7ZB 3OGCA 1OAUH 3INUL 4XVUD 2CIIB 4LVEA 4DN3H 4HK0A 5D2LA 4ODXB 3HTLX 2H2SD 3NCJL 2WP3O 2XTJB 1NLDL 4WFED 1ZXQA 2KQNA 4WV1B 5DWUL 3BKYH 3TJEH 4EUPA 3WUWG 2YPVL 2XRAL 5MENE 3BT2L 4NO3B 2R39A 1U8OB 4LPCA 4X5XA 5HHOB 1NMAH 3BAEH 1YY9D 3TH3T 2BFVL 3VWJA 1P4LB 3U30C 1U91A 2H2PC 3CFEB 3QDJB 4F8TA 2NY7H 4B5EA 1VKXB 3N1PC 4GOSA 1NGQH 3HE6B 3RPIB 3IU3A 1V7ML 3WO4B 4X4ZA 4JG0H 5CJOH 4HUKB 1KTDA 3I3BA 1NQBA 3NCMA 1VPOL 3KXFE 2YSSA 1KC5H 4GXVH 2ZPKH 4L4TA 3LKOA 3MLSL 1Q9KB 3I84A 4ZSOE 4D9QE 5T3XH 1T7VA 3BKJH 2UWEA 1NGYA 4NSKB 4GW5A 2Z31B 3ULUH 4G8FB 1JWSB 1IKFH 3U0WH 3RZWA 3KPLA 4UNUA 2A9NH 3B2UD 1FYTA 5C92A 1U8JB 5HHPB 4FG6D 1GGCL 4R7NB 3N1QC 2VKWA 4HUVB 1F4HA 3V5DA 4J1UA 4ZFFA 2NLJA 4P3WA 1GGYA 3C5JA 5SWSB 4FQ1L 5C9JA 5E08L 4QHLB 1CXIA 4EN3C 1MRDH 2GITA 4GRMB 4DGYH 2JJTC 4PLKC 1DQQA 3U4BH 4OT1L 2A2QT 1TVDA 3OWEA 2YD1A 2HLFC 4I8DA 4L8SA 3SDCA 3FO1A 1QSFD 1NFDF 3VH8G 1RJYA 2IH1B 4G6MH 5MENA 2CUHA 2F5AH 4P4RB 2DIAA 5GS3A 2EIBA 3TWCL 2CH8A 2DI7A 1IMHC 2VE6A 3S4SB 4EIGB 3RKDC 1C1EH 2VXSL 4BQBA 3SN6N 5LGKA 4JFPB 4JPWL 5EORL 3PABA 1NFDE 2DRUA 4YQXL 3TO4C 4D0DA 3MPCA 1IEAA 3KXFA 3VXUA 5EFIA 3WL9A 5JDSB 5SX4I 3HB3D 4XTRC 5E70A 3ZKMC 1SY6L 4IOSD 1GOFA 5CMAB 5FOBB 2X4NA 4Q9QH 3RWFA 4MHHG 1KJMA 1MLCA 3MUJA 3ZYZA 2BVOA 4IM8A 2XG5A 5FO8B 1T03L 1PGRB 1E4WH 4RFEB 2NY6B 4IRSD 2KZ1B 1T1YB 2YS4A 3AMLA 1DQJA 4Y4FD 3VFMA 1NLBH 1H8OA 5IR1B 1FVEA 1ZLUH 4HQQL 2EDFA 1OWWA 3DVNB 1RUAL 4UOW1 3LAFA 5FYJU 4CADB 2FX7H 3GI9L 4WHTA 1QOKA 3RY5A 4MA3B 5F88A 1I8LA 3LPWA 4G5ZL 4PJ5E 2BNQE 5GISH 3WNMA 1CD1B 1MAJA 3SJVD 4L9LB 2IBZY 1DQLL 4OLWH 5B8CA 4NKOB 1N7MH 1BFOA 3VFUA 5I15H 4NQEB 4GBXA 5IHLB 2W9DH 4NNXA 3X12B 2ARWA 5DK0A 1JHTA 4PRHB 4Y1AA 4HPOH 1D5IH 5IJKA 3RQ3A 5GGRB 1J1PH 2VH5H 4PV8B 3CVHB 3T1FA 2P5EB 4KZEL 1BQSA 4WUUE 4MA7H 3H42H 3JWDL 2OTUA 1AQDB 3U46B 1NGXB 1JPGB 4ZUTA 1I75A 2B4CL 3I6KA 2WNGA 4LNRB 3FN0L 3VFGH 4HZAA 4BZ1L 5HYJB 3PHOA 3FB8A 3MNVB 3GSQA 5E6IC 3HNSL 2ZP0T 4JY4A 3BQUB 4LPUA 3DO7A 3WDHA 2DLEA 1I4FB 2JJWA 2V5YA 3RVTD 5BV7B 1M4KA 2NW2A 4XMPH 3IKCA 3QZWB 3I02B 4A6YA 1P53A 3QI9D 4Z7WF 3RZCC 2R4RL 2EDOA 1YMMB 2VLLA 4RQQA 4LFHG 5JHDD 4DKEH 5HHQA 2BVQA 1KN4H 4LSDA 4P4KA 3KPQB 1UCTA 1YEGL 4XPFL 1ETZA 4LBEA 4F7PA 4M7LH 3IDMB 4U1SA 3FRPG 4U1NB 3DNKA 1EJ6A 1UKTA 3QIWB 4PJ5A 2X4OB 2HFGH 1OAYH 1J8KA 4QRRE 1ZGLB 2P8PA 1DN2A 4O4YL 1VEOA 3GIVB 2XWBB 1MJ7L 4MNGA 1F13A 1H3UA 1N5YH 3T2PA 3IJYA 4MCZB 2IAMD 2D9CA 4DK6A 1B4JL 2BC4A 4OCYL 3REWA 5D7IB 4PG2C 1MFCH 3QG7L 4R0LA 2CIKA 4RBPH 3KYNB 5JXAL 3BWAB 4OZGE 3MRBB 1MCSA 3RX5A 3CCHA 1PY4A 2W60A 3L7EB 3OJDB 4BH8B 3BRGC 4EVNB 5FFLA 3UTOA 4WUUA 1J8HD 4EI6A 4M3JA 3DV4B 4W4NA 1WWAX 3UPAA 1MWAL 3ABZA 2CJUL 2CXKA 3CNKA 4YC2C 4CGTA 3VMPA 2C3WA 3C9NB 4UQ2B 1TJIH 1XGPA 4ZUUB 4AG4L 4U6VH 2ZOLA 3FHAA 5J1SC 1UYWH 1FIEA 3MLYL 1CYGA 3NFSH 4OM0L 2RCSL 1XIWD 4P3CL 3O4LD 1RIUL 1T2XA 3WFEH 4HIXH 3CFBA 1VGEH 4YDLB 3ULVF 1KXQE 5INCB 4KVNH 4NRXA 4O2CB 5KSAC 2GJ6E 1EUTA 2FR4A 1RZ8B 4KH2A 1KPUA 5I0ZA 1RY7B 2C1OA 2VQUA 4KI1A 3MLZL 4UQ3A 3U7WH 5LWYL 4NO0B 1NFIA 1NBYA 1EEZB 4NQDE 4QRRA 3FQXB 3QQ3B 3STZA 3V4VH 4NNPH 3T0EA 5AYUL 2HFFA 5DJ2A 4WWKD 3ARYA 3HMXL 4KPHL 3OAZK 3GSVA 4NRYA 5F72S 3U9PL 3T4AA 3UZQA 3NPSB 3FZUC 4OCSL 4FXKA 5DLMH 4CRPA 1DDHB 1NSNH 2A1WL 4OZGA 1R0AH 3PWVB 4F15B 2ZCHH 4RNRB 4X4ME 3TP4A 4MZ3A 5DT1L 1S5IL 4H8WH 3F58L 3HZVB 3QEHB 3QUXB 4IOFC 1N0XL 2OTPA 2EEDA 1MOEA 4D94A 3C2SA 1D5MA 1A6PA 1A9BB 1UZ6F 3MRMB 4IMLA 5GGSA 2F54D 3ARGB 1IGTA 5LQBH 3MRHA 2O5ZH 2DQFA 4MXVE 5HYSA 3LN5B 3FFCE 2OMBA 5ID0B 3HE7D 3BPNB 4CAGA 1Z5LB 3O6LH 4ZS7H 1GC1H 4JO1H 2IANA 1LO3H 1R5WB 2IPKA 1MCPH 1NCWH 3V5KB 1ZA6A 4M43L 2G2RA 1MREH 4S1DC 2GY7B 4ODHL 1S9WB 4I0KA 4GG6F 4K94C 4FQLL 1FHGA 5EG6C 3P4MA 2AK4B 5JTWA 4PS4H 1AGBA 5FGBA 4QWWC 4D3CL 1INQA 4L8CB 5FA4A 5KAQF 1B88A 4R2GD 5IVZA 4JFXA 5I30H 2E7LA 2NZ9C 5CBAA 4KKLC 4YAQB 4H1LH 4FQXC 5A2LH 5JA9A 4WO4B 3QXAB 5DUML 3WFBL 4NGHH 2ZOKA 1P4BL 5HPOA 5EOCL 4Y89A 4YDJB 3NIFE 5SWQB 1JF1A 5JUEL 1Q9LB 2H9GB 4XX1E 1HH9A 4OLYH 4HKBB 3UTZB 1I8MA 2Y7QB 5DS8A 5JXEC 4KK9D 3BP7B 1RZ7H 3PWPB 4FQIH 2XTJD 1ZE3C 3ET9F 2NXZC 3WFDL 4DAGL 4PD4K 4O9HL 1NDMB 1G6RL 3VDCA 1G1YA 5GS1C 5HHOD 2RFXA 4JAMB 5CS7A 3I3EA 1UXSA 4YDKH 2W38A 4HXAL 4UBDC 5JMOC 3QDJD 5HXMA 5D7JB 4PGCB 1CIUA 4G9FB 1CLYH 2BY0A 1U36A 3HE6D 2HMID 4WJ5A 4Y4KC 4JFFE 1WCBA 1EEUA 1XFPA 4OUUA 3SDAC 4RGNC 4ODTL 1RJZA 3TVMB 2AEWA 4QT5B 4EI5D 3O9WC 3CH1A 5EZOL 1INDL 5B3JF 5AWNL 4BSVA 5HVWA 1X44A 4RISH 5T5NF 2Z31D 1MRCL 4WU5B 1UWGH 5C0NC 4ENED 3QFJE 1F6AA 1EO5A 4NC0B 3MR9A 1EFQA 3UPRA 2D0FA 3FB7A 3H3BC 4CUCA 1S78C 4UOW0 2W0FB 5H94B 5JPNB 1FRGL 2XKNB 3REVA 2YA0A 4IHOB 4EI5B 3QWRA 5SWSD 1MY5A 2R0WH 3UYRH 1NKOA 4S0TD 1UC6A 2M26A 4IS6B 1KCVL 1K8DB 5ACZB 5AZEL 2FIKB 1IE5A 2D7TL 3V6OA 3TEUA 4JRYA 3S7GA 5IROA 1I9JL 1W8NA 4HBCH 5CHNA 3OKDA 1YECH 2VDLH 1G9MC 3KWWB 5DQ9B 1N5AB 4LVOC 3OXRA 4RGOH 1UADC 1U8PA 1KF9B 3ZDXE 4M4PA 4CW1A 1J5OH 1KIPA 1YEKH 1QFUL 1HKLL 2GYSA 1F4WH 3T3ME 1BAFH 5IHUH 2X1PA 3QPQC 4TOYH 1Y0LB 3G08B 1KTLA 2VLKB 4XBPB 3WIFB 1A21A 4ODVH 1KEGL 4ZTPH 1CD8A 1NBZA 3QUZA 3QT2A 4K9EC 2DB8A 4L8BB 1BQLH 3Q1SL 4HUXA 4BA8A 2ESVB 2VSCA 2X1QA 2HLAA 5DJAA 3B6SA 1VEPA 4V2CB 4HKJA 3LMJH 5LGJA 5H37H 3Q48A 2NY5C 6FABL 4IRJC 3RVUC 4OKVB 3QFJA 5C0GB 1IL1A 3X13A 3U0TB 1MJJB 1LGVA 5GRJH 5HGBA 1FL3A 2NY6D 3QIBC 1FP5A 4N8VG 2XACC 3ILQD 2DWEB 3DV6A 2HKHL 4PJ9C 1HDMA 1T0MA 5CIPH 4LSTH 4N90D 1QR4A 4HJGA 1NCCL 1RUML 1G7JA 1RUQH 3EZJB 4Y5VC 1DTUA 2D7OA 5D71L 1BBDL 3BGMA 5C0RH 1FQ9C 2XY2A 1JPTH 4FFVD 4XNUH 1DLHB 3T0WA 1RZJH 5ICZA 3F65A 2Q7NA 3HPLA 2O5XL 5EULV 4HCRH 1J05B 2CGRL 3QDGA 1YPZE 1F4YL 3D18A 4XVTH 4ZXBC 4YHYC 1GAFL 1FNHA 3IAGC 4NQED 2P43B 5D70H 5HGHA 1ZLWH 4XT1C 4R97C 3DX6B 4PRHD 1TVHB 4PTUA 5I66B 2H6PB 4PJ7F 3O11B 4IRZL 1A7BA 2Z0BA 2P5ED 3LRSA 2CUIA 4U7SA 4NQXA 2W91A 3L5WB 1IGCL 5J3HC 3RA7L 1HQ4A 1NDGB 3HPJB 4NCC2 1X4YA 4NZRL 4JANB 1RUPL 4XAKD 5HYJD 1HHIB 5EIVA 4CN1A 4OZHB 3BQUD 1S3KL 1JZ3A 2XKSA 3AS0A 1F3DJ 4J3TA 3TFKC 5KANI 1NEZG 4FXGB 2DIBA 3KPNB 1JNNH 4KJPD 5T3ZE 4YEEA 1YMMD 3O8XB 2FGWL 1G9NH 5F89A 2VXUL 1AGDB 4Y2DD 2PXYA 1RK0A 4DGVL 1MJUH 4X6CB 4G9DA 2MNUA 3LRGA 3BOVA 1KJVA 4TSAL 4HS6A 4LEXH 4P23C 1A7NH 3PWJB 1QLFB 1DBJH 3D25A 3QIWD 1MQ8A 2K1MA 1JTOA 5IM7A 4OQTA 4WNQA 3ULUC 3V6FB 2JJTA 4Z7UE 3RWEB 2ATPA 4APQA 4MMXC 5HI5D 4E0RA 2KH2B 3HCVA 4H1LG 5GSVB 1HXYB 2B1HH 4POYA 1IGIL 3S3JA 4JR9L 3MGOA 3P0YL 4JVUA 2OJZL 3MYJB 2V9QA 1TTFA 4NQCB 3T65B 5DRXB 1ZT4B 5I1DA 5E2WL 4KHTL 3MLTB 1JZ2A 3LIZH 3EDFA 3T3PF 5F1NB 4YPGB 5E2UL 4NKDA 1FL6A 4JDTL 1RFDH 2IMMA 1K6QH 2V17L 3OB0H 2R1XB 4HS3A 1G7HA 2HKFH 3RPKA 1IQDA 3QUYB 5FYLE 5TF1H 5F3HA 1F4XL 3DHMA 1TZGL 3ETBF 3KLSA 4ONGH 1W8OA 1IEBB 1U6AL 4N9GB 2Q8AH 3OGOE 5BW7C 5HHVH 5GGTL 3AY4C 5IQ9A 4Y88A 1MIML 3RIAK 1QP1A 2CLZB 3LS4H 5EWIH 3T3PE 1KB5L 1FAIH 1WK0A 3RDTC 1BZQK 5BO1L 4NO0D 3VFTA 3EGSB 2E3VA 2IQ9H 3WIHA 5JPMA 3D85B 4V2BA 1IBGL 5D1ZA 2C7UB 5F7UA 3GMQB 2V7HA 1A02N 1Q72H 2BERA 2WLZA 2XICA 4GRLC 4JG1L 4G6JH 4X99B 4L3EB 2HTLC 3D2UB 4PJAE 4HUUA 3S37X 5L88L 5FUOL 3PNWA 4D9LL 1ND0A 1XGTB 3OR6B 4Q6YA 1PLGL 4GW1A 1SQ2N 1QLEL 4HIEA 4QHMA 4LASL 4OLZL 1IC5H 3H3KA 3MLXL 4QOKA 1ACYL 5ISZB 4P59L 3QUXD 3SGEI 2R2HB 5DTFA 4XB7A 1G7QB 4PJFB 4AIZA 5BCAA 3BPLB 3WE6A 4F7EB 3DOSA 4PBWD 3V0AC 3JBG7 4OI9A 1YEHH 2EICA 3ARGD 1H5BA 4BFEA 5BZDB 5I6XC 5IG7A 4LLYA 1KENL 3MRPB 4XPAH 3OSKA 5D7LB 4HWEH 4LU5L 2IBBA 1EHAA 2V5RA 4P2OA 2XXCB 3VI3E 3MRKA 4I9WE 3U9UA 4EXPX 2C4FT 3FB5B 3MRNB 3FQUA 3DXAB 1CLCA 4OF0A 1G1CA 1A4JB 3S98A 3KYKH 5EOCJ 4HK0B 1BJ1J 3ZTNL 1NAML 4I0PA 5D2LB 2AK4D 2VZSA 1TCMA 3V0VB 3HFML 4WU7B 3TZVB 5IBLD 4NZUL 5HSFA 5FDYA 5H37G 3IXAA 1UA6H 4XHQA 3SDDC 4UTAH 1FFQA 3CK0L 4WO4D 1YQVL 2Q8BH 4BZ2H 1KCUL 3AFLA 2A74A 2XA8L 4PJAA 1QFWI 1U91B 1AD9B 3BPOB 4HJ0D 1UVQA 3MBXL 1WBYB 5SV3A 5DMYA 3C2AL 3O4OC 3KLHC 1YYLL 2DL2A 4OV6F 2YMXL 3JVGA 5ALCH 2ORBL 2YSSB 4L4TB 1KTRL 3LKOB 2VC2L 3PWPD 4LEOA 3MA7A 4DKFH 5IVOA 4DUXA 4JDZB 4NN5C 4P2CG 2XWTA 1NGYB 1W0VA 3R06B 5A1AA 4GW5B 4KQ4L 2DJ4A 1JTPA 1ZA3A 3H9SA 5ESVA 4J4PD 5FYKE 5GS0H 5GRUH 1E6JH 2XNAA 3CLEH 5D7JD 1EXUA 5CZXC 1F58H 4G9FD 5GRWA 5EU3A 4BQ6A 1W72L 5AZ2H 5KG9A 5I1CL 1BFVH 3V5DB 4OCNC 1F11A 2J7LA 3C5JB 1U93B 3TVMD 4WCYL 1ZHKA 1F6LL 4JFQA 1NEUA 3NA9H 1P9MC 5HDOA 5JW3H 4BSWA 4XC1H 1BVZA 3MACL 5DO2D 5KSAA 2EXWD 2EECA 4U3XA 3MUGA 4L8SB 4NT6A 5KSVA 1RJYB 3QQ9D 4X80H 1FSKC 3ZE1E 1P84J 1KLGB 4AZ8A 3RIAF 3X3GL 3BW9A 2JB5L 1DP0A 1DUZA 1WC7A 4KFZC 5DJXB 3BP4B 3KYAA 5F1IA 1T21A 1OTSD 1TFHA 2EYRA 3FQNA 1J0IA 3GMPA 2AJSH 5AEAA 1E4XH 2DMBA 3Q0HA 3BEWB 4YK4C 1M7IA 3GMRB 3ARDA 3W2DH 1NCAL 5TDOB 1ZHNB 4D0DB 5F9DC 1IEAB 2FATL 4ELMF 4HD9A 3VXUB 5EFIB 3FT4B 3TBSB 3WL9B 4NQTA 4JFOA 4LLDA 2PYEE 4Y16A 1QRNB 2MKLC 1QKZH 5JR1H 2X4NB 1KJMB 3C6LB 3FRUA 2EKJA 4NBZB 4K3EH 1AXSB 2AXFA 2VLKD 3WUWA 5EN2A 5J6GA 5I8CB 3G5XA 3VFMB 2QR0A 3JWNC 2NY2B 2X4QA 3UP1A 4WEBH 4C54A 2ZCKL 4JPKL 2ESVD 3QEQE 5D1QA 1LP9A 5C6TL 2JCCE 2P46B 2LV4A 3ZZ1A 4YHOL 5C70A 4H8WC 4JFEE 3CLFL 4RGNE 1OTTC 1RK1B 1UM6H 2CLRB 2WAHA 1SJHA 3LEYH 4YHIA 4MDIA 3IJSB 4Y8DC 3HZYA 5CGYC 1X3DA 5DJ8A 5B8CB 4U1GB 1C08A 3VFUB 4BKLA 1GJIA 1IGFH 5JO5B 1EV2E 4NNXB 1RUKL 1S7UA 4Z7NF 5C0FA 5DK0B 4O58H 1FC2D 3EJYC 4D9RD 4FQXA 1T22A 1T83A 2YD2A 1GC1C 5MERA 4Q9RL 4MLIA 1RMFL 1IAIH 4JFYB 1A6ZB 5JW4M 4MJ6A 4XZUA 5L2JA 3OKNA 4ERSH 4PJBA 2WWKT 3QA3A 3AVEA 4RCAA 1TLKA 1UB6A 1AD0A 1MI5E 5J1AA 2VLJE 2X09A 1FAKT 2APXA 3ALWA 2EIZA 2NW2B 4NN6C 4A6YB 3DMMC 3VWKB 1F6FB 3UJJL 2Q86A 1HSAA 5IB5B 2VLLB 4RQQB 3MV11 5C2BL 5LBSL 43C9A 4ZTOL 2BVQB 4X5WA 4NM8L 2AGJH 3BZFA 3OJVC 4RAVB 1FNGA 4P4KB 3E2HC 3MODH 3S88L 3KDMB 1AO7E 2IF7A 4F7TA 1LEIA 1PKQB 5EU6E 3VFVB 3CVHH 4LBEB 4UB0H 5D96B 4FTVE 4YIQA 4U1HA 3RBGA 3MRJA 2P8PB 4G7VH 3VXSA 4XVUC 3O9WA 3QNXA 1C5DA 2N56A 4MNGB 4XCEA 4YX2H 2NY3B 3IJYB 1SHMA 1ZLSH 5DUBA 5ESAA 2H2SC 1MH5A 4U1LB 3O8XD 3K4DA 4FQHA 4YFLI 3SGDI 3U4AA 4DWHA 4FNLH 3MO1B 1UACL 2BC4B 3S9DB 4ZPVA 2W9LA 4R0LB 3VRLF 3FCTA 1G84A 2CIKB 4WI6A 1N3NA 4W81A 2R8SH 5IFHH 1WZ1L 2OJEA 4EI6B 3VXQB 3DGCR 3WSQH 3L6FA 3ZL4H 1XGQB 4NJAH 5C86A 1CTOA 4U1MB 5FHBL 5F3BA 2ZSVB 3MFFB 3IDXL 3EFDH 3WXVL 5BS0A 2GJJA 3ISWA 2MFNA 1LO2L 2C3HA 1QYGH 2B2XH 1A7QH 2VLJA 4HH9A 4CVXA 2ZOLB 2HJKA 2E6PA 4PIRF 2O61A 4ZDHB 5IMKB 4GMTH 3TBYA 1ROWA 4GKOA 1BHGA 4TUKL 3B2UC 3A6BH 4NQCD 3M1BA 3O2WH 2DQUH 4FG6C 4I3GA 2C1OB 1CN4A 5DRNA 1TZHA 4UQ3B 1IGJA 4NWUH 2VISA 1CXHA 3J8F7 1NBYB 2G9HB 1EFXB 2AI0L 4XWGL 1FLTX 2QQKL 3U6RA 3BN9D 4MS8D 5JW5A 3IDYC 5EUOA 2UZIL 2HWZH 3STZB 5F7EH 4QCIA 3HRZA 3T0EB 1K8IA 3IF1A 2HFFB 3QUYD 3PIQB 1SBBA 2VAAA 3UTTA 4IRJA 3PJSB 3CX2A 2B0SL 3D87B 3T4AB 1DBKH 4HMDA 3UDWA 3QIBA 1YYML 4PJDF 4PJGF 5KBNC 5C0BA 2VUOA 4PJ9A 2F15A 3VG9C 1J1OL 2WUBH 3QO1A 1BECA 3D85D 1NCDH 2DQJH 4Y5VA 4U6XA 4XGZB 4ZOCA 1WICA 4YHPB 3L5XH 5KVDH 1YEJL 3B8YA 4L3ED 5T3XE 3D2UD 1YNTA 3I50L 3ULUE 2DQEH 3U7YH 5I73C 1UM5L 3GSNL 3HB3C 4MCYA 4PJDE 4PJGE 2ITDA 4POZD 4XB8A 1OHQA 3V7MA 4ZXBA 3QUMH 3ZDZE 1DUYA 4HPYL 5JW4N 5GGQH 2IANB 3QAZB 4JN1H 2IPKB 4IRSC 1E28A 3QFDA 3JXAA 1SVZA 5ISZD 4Y4FC 1ZA6B 4J3WA 5D7KD 4LF3A 4OZIE 5H8DA 4D0BA 1RZJC 4QXUH 4Q6IC 3MZTA 3W39A 4G3YL 3P4MB 3NMEA 1INQB 5FA4B 5IMOA 5LXGL 4KV5F 4JFXB 3P30L 4TQEL 5CBAB 4HX1A 4MYWB 4QLRA 2ZNXA 1Q94A 4E9LA 4K3HA 1F2XK 5D7LD 2ZOKB 2I27N 2X40A 3MJ6A 4MD5A 2XFXA 4MQ7A 1MCJA 2B1AL 4JKKA 3DXAD 4M6ML 3QUKB 1BEYL 3GBML 1HH9B 1CICA 1NANI 4R3SB 3S4SG 5DS8B 4QHKI 1R5IB 3TZVD 5GGUB 4P23A 3DUSB 3FAWA 3BD5A 4X6BB 2ZWLT 1F97A 2GK0B 3NVQA 2RFXB 3TCXA 1CXFA 4PJEF 2BVPA 1CDJA 2B39A 4PV9A 5KTEL 2FLRT 4LSUL 2ADIB 5D5MB 1BD2E 5T1LB 2I9LA 3SGKA 4JFHD 4XMLL 4JY5H 4WJ5B 3UMTA 2DBLH 4M1DL 5ENWA 5C0DA 1EZVY 1WCBB 3NACL 5MI0B 3RVTC 5MEPA 3EO1B 4H0IA 3P40A 5FAAA 5DRZA 4QRPB 3QI9C 1U3YA 4L4TD 3CH1B 2GUOA 1N2RA 4BSVB 4OZIA 1N4XL 4MSWA 4J23A 4PJEE 4PUBH 4Z7VF 4O2FB 2ADJA 1NUGA 1F6AB 1L7IL 2NX5E 4U6YB 3K74B 1KBGL 1IT9L 5CINH 1RZIA 4EDWH 5LKNA 4B41A 2GCYB 3REVB 5MEOA 5HI3D 1JGLL 3WEXA 1HOCA 2AABH 1IRAY 3GSUA 2W0LA 3PHSA 5B38B 1HHKA 2DWDA 3HC3L 3KJ6L 3GSRB 3DTXA 4ZO9A 1A6VL 4PRIE 5BW7A 4JRYB 3MMEB 5KJRL 2LABA 3AY4A 5I16A 2YUVA 3TN0D 1JYNA 3DHJA 1DFBH 3OXRB 5F6IC 4DUWA 1D5BB 1KIPB 1PJ9A 4PPTA 5F7WC 2VTFA 4P2YA 4DW2H 4WDIA 3RVXD 3PQYA 1BIIA 4JREC 1WV7T 1NCNA 2WUCH 3RVWD 1BD2A 2A6KA 2QBWA 1C5BH 3N1FC 3JTTA 1Z9MA 3SDYH 4HUXB 1VACB 3QZWG 5CUSL 4P99A 1JK8B 2QL1A 1A0QL 2HLAB 1XIWC 4JO3H 3QHFL 4Z0BL 5L2KE 2ZZUT 4OI7A 3VXUD 2R1WB 2EDTA 4HKJB 5LGJB 1QRND 4LCYA 5EIIA 4S1RL 5E99L 4F9PA 4IIQA 4OGXH 3C6LD 3BDYL 3ARUA 1TTGA 1CL7L 3EDKA 1FL3B 5ADOH 3MRFA 4KJWD 1CDHA 2NY2D 4BJLA 1HDMB 4K8RD 1OARH 4EBQL 1G7JB 4UAOB 1TIUA 2CR3A 1RJLB 3BGMB 5BVPH 5ICZB 3MOQA 4PRIA 4OFPA 4GRWF 3QDGB 3MOAL 1QUNA 3BYTA 4PGZA 5DFWH 3ZDYE 3LQAH 4TSCH 1N6UA 2NPLX 4LCCC 2MPAL 2QLVB 2X1OA 1QBLH 1JV5A 5E03A 2OP4H 3S36X 2H32A 3SDDA 4P3DB 4OCRL 4MXWL 4OZFA 4C83A 4PY7A 1LK2A 2R0KH 5E2TH 1HQ4B 2Q3ZA 3G5YB 3FO9A 3BSZL 1XF2A 3HE7C 1OVZA 2V2WB 4WWID 4HDIA 3VXPB 1I9IH 1A7PH 2W9EH 4ODUB 5DZOA 3RWCA 2GJZA 4I77L 3E6HA 5EBWA 4LCWE 2X4TB 5ICXA 5FECA 4KKBD 1WEJH 4I5BA 3GMMB 1C5CH 3HAEH 4H20L 3VWKD 4KZDL 4ISVB 1LEGA 1S8DA 2VLRE 1PZUB 5D8JH 2AJUL 4XPTH 1I3GH 4R2GC 5F89B 4WI3A 2D9QB 2PXYB 1DBBH 2APTA 2Y07L 4Z7WA 1W0YT 3QDHA 3UEZA 2XQYK 4P4KD 1KJVB 3B5GA 3BI9X 4HS6B 4E5XB 5DD1H 3LEVL 3D25B 4U2ZA 2J8UF 1PKOA 4YHMH 1LE5A 4MJIE 5IM7B 1KGCE 5KW9H 4WW2F 4NC2B 5IWLC 3SY0A 4H0HB 5A2FA 4JO2H 4WEUD 3Q5OA 4I2XE 3BP6A 1QG3A 2FZ3A 2ATPB 3X14A 2NY3D 4APQB 1UM4L 4E0RB 1I1YA 4KK9C 4L9DA 4P9HL 3AM8A 5GS0C 3HCVB 1CD0A 1XGYH 2XTJC 1JPSH 1GGBH 3WS3A 3RX7A 3L3OB 1MWAB 3MGOB 4MNQE 5BXFA 2ZJSH 1HYSC 3EOYG 2D03L 4TTGA 2BJML 5CSBA 1IM9A 2J8UE 3WJLC 3M8OH 5EO0B 3GUTA 1JCKA 1GSMA 2H8PA 4XBEL 1ADQL 1JRHI 2J88L 5I1DB 1D6EA 1JWMB 5TDNA 2QSCH 3PUCA 3HE6C 2HMIC 1OSZB 5TJWK 1Z0MA 3WO4C 5D7SH 2BNRA 4HS8H 1S7XA 3EUUA 3K8KA 1A7RL 5IB3A 4NKDB 4EI5C 1HCFX 1FL6B 3HUJF 2Y06H 4HS3B 2DTSA 5C9KA 1IQDB 4XVJL 2Z31C 4YXHH 1JRHL 3RFZC 3G6AB 1AJ7L 5C0AE 5KSBF 4I0CC 2EH7H 2VLRA 5KS9F 3I6LE 1G7MA 4HEPG 1A3RL 4UDUA 1NMCB 1QPPA 3NN8B 1N6QH 5IQ9B 1RURH 1OPGH 4GQ9L 1CE6A 1U8QA 2RB8A 3DPBA 3PGFL 3BIKA 3FTGB 3A6OA 2GAZA 2D0GA 1EGJH 3VFTB 5EBGA 1L0YA 3MA9L 5ALBH 1OGAE 4UIKL 1YUHA 1EFXD 2DQHL 4XCYA 5D1ZB 2V7HB 3E8UL 5CZVL 2D31A 4NFCA 3O41A 2HT4D 4JDVA 3T0ED 4WI2A 1VSCA 3MGAA 2Z4QA 1VFMA 1ZLVH 3NOIA 1MIEH 3IGAB 2DQTL 1OP3K 3VGBA 1CU4L 1DSFH 1JVKA 4GW1B 4HWBA 1NEZA 2ERJB 3GKWH 4WFEE 2PF6A 3PWLA 4HIEB 2J6EH 4QHMB 5HYQB 5I1LA 5ICYA 2ZCLH 3MRDB 1MVUA 2AXHA 1Z6JT 2FSEB 5HDQH 3IDUA 2F8VA 2B20A 4QOKB 4CL7A 3KS0J 4D8PA 5DTFB 4AIZB 3QISA 1MLBB 3WE6B 5IB4A 2IPUK 1TETH 3WDIA 3TGXA 4KTEL 5EU4A 3O3EB 3P11H 2F8XC 3EFFB 5J8OA 1L9MA 2V2XA 3UAJD 3HS0A 4K23H 1Z0NA 3K2UL 1ZT1A 3I6GA 4X6DA 3JUZA 4QO1A 1I1FB 2IALB 1MJ8L 4MAYA 1TTUA 3WKNA 4YBLB 2IAND 4UUJA 4P2OB 3MRKB 1FLRH 3PGDB 5B4MD 2NY6C 3R4DA 3U9UB 2W65A 1CI5A 3DMMA 4WHYH 4EOWL 3ILQC 3FQUB 1KCSH 1MNUL 5IEKA 3LEXB 4L8DB 1A9EA 3KR3L 4I0PB 4QHNA 2OK0H 1CXLA 4GSDL 5IBTL 1FPTH 1OGAA 3BD3A 4GG6A 2VDMH 2BY3A 1KCRL 3DI3B 3IXAB 4FFVC 1P1ZB 3VXNB 1Z9OA 3GHEH 5DRWA 4L9LC 3QXWA 4KUCD 1KACB 2A74B 3I85A 2OLDA 2BRRH 3FONB 1BPVA 2C3VB 2HRPL 2DLGA 2APWA 4WFGD 1TCRB 5IFAL 1G6RB 5IT2L 1QSFE 2ZG1A 3TF7C 4JQIH 5E8PB 4NUJA 1OAXH 4OF7A 4OFIA 2Y36L 4LEOB 3VFWA 1HHHA 2HVKB 1MCOH 4QHKJ 7FABH 4ZFZA 1W0VB 4QTIH 4OV5B 3B2VH 3FB6A 3H9SB 4JM2B 4BFGA 3AAZB 4ZMAT 5FYKL 4XPHH 3TH2T 5ACMA 2OX5A 1EXUB 4EUPH 1L6XA 5T1LD 5JHLH 1M1SA 1QNZH 1ZANH 1MHHA 3VRIB 2E27H 2BMKB 5FF6A 1F11B 1CDGA 2Z92A 5K9QI 2E5EA 5I2IA 3BRDA 1ZHKB 1IAIM 3CSYB 4JFQB 4QRPD 3JV0A 3RUGF 4KJPC 3JV4A 3GSOB 4BSWB 4MZ2A 1ZS8A 1FZMA 3D9AL 2QQNL 1XEDA 1KT2A 4NRZA 3HI6L 4K94L 1CGUA 1JE6A 4NOBA 3DIFA 3QIWC 4MD4A 1BM3H 3MLVL 4HKXA 1FG2A 1CR9H 3TJHD 2HH0L 1RD6A 1YEFL 1DUZB 1WC7B 5F1IB 2HT2D 1XR8A 2EYRB 3FQNB 4LVNB 3MJ9A 5HI5C 3PHQA 2C5DC 1QSFA 3ARDB 4JRYD 4L29A 4Y7MA 2GEEA 2ID5A 4RMRA 5CP3A 1X7QA 4JFOB 4G43B 1RZFH 4F57H 5FUZL 3GDBA 4Y16B 2IH3A 4LAQL 4QXWA 2J3SA 1XGRB 1T66D 3CC5A 2DMCA 5F7DB 5DF0A 1PG7L 5J4MA 5CD3A 3B3IA 5EN2B 5J6GB 3ARFB 5E1HB 3QWOB 3JV6A 3D39A 4U1IB 4OLUH 1OP5H 5D1QB 5GPRA 1LP9B 3A6CH 4KC3B 1ZVSA 4YDLC 5CIPA 2CLVA 2FO1A 4AMKL 1TJHL 4JM4L 1CFNA 3RAJH 1K4DB 3I2CL 4O5LL 4HKZB 2YOCA 3SPVB 4YHIB 4MDIB 2AXGA 5JHDE 5DEGA 5DJ8B 3DYOA 4K7PH 3RY6C 1IQWL 4Q6IA 3BMWA 1C08B 4HCRA 1BQHA 3T77A 1ZGLM 3D0VA 4KRPB 5C0FB 3WXWL 2OQJB 4HUWA 1GZPA 4PRPE 4PJXB 5IESH 1T22B 4M9OA 4ZUSB 3GGWA 3LQZA 3IDNA 4M7LT 3SJVA 4AL8L 3CDCA 2LVCA 5E4EB 5CFHA 5IW3A 4JGJA 3MUY1 1NGWA 3FN9A 4MJ6B 4XZUB 3QB7C 1FC1A 3NPSC 5L2JB 1T2QL 2CKBA 4PJBB 4LHQB 3QDGD 2FX8L 3DJ9A 3KJ4B 4F15C 4JVPA 3F6LA 2BNUA 4ZUVA 2DKUA 3JTSA 2AS5M 1H3XA 4TUOB 5J1AB 3QUXC 3QHTC 2EYSA 5JIKA 4GAYB 1G9ML 1IC4H 2EIZB 1J8HE 5ILTH 5HHMB 2Q86B 2CQVA 3V6ZA 4AY0A 3H7BA 43C9B 2AQ3A 3QCTH 3ARGC 2DQIH 1GIGL 2VDOL 1FNGB 2APVA 3L5HA 2DIJA 2DBJA 2CSPA 3GK8H 4K9EL 4P2RB 3BPNC 4WFFD 3EHBD 1OGTB 4YIQB 2F5BL 3BJLA 4P2QB 1SEBA 4U1HB 4LQ1A 1HILA 3MRJB 1HZHH 3O4LE 1O5DT 3QI9A 4HIJA 3V5HB 3EOTL 2X9YA 3VI4F 3QNXB 2JB6B 1C5DB 1UXWA 5K9JH 5JHDA 1X6LA 4XCEB 1I7UA 3MCLL 5D2NB 2NY5L 5DUBB 5ESAB 2R2EA 3HR5B 3Q6GH 5IBLC 3G5VB 1N8ZA 1AKJA 3QH3B 5ERWA 2PXYD 4CVUA 4DVRH 4PGEA 4KVCH 2AK1H 5I8KL 4YHKL 1ZKAA 1T1ZB 4WO4C 3LOWA 4A6YH 1N3NB 3MLWH 5C0JA 5HGGS 3HN3A 2VDQL 4C59B 5CILL 2HFEA 1OCWL 4WHYG 2NQCA 4HJ0C 2AV1A 3VI4E 5INDA 1FZOA 2JJUA 4HK3J 2IAMA 3NIDF 5C0CE 4LSQH 4L5FL 5F3BB 5C08B 1FNEA 1S7QA 1T89C 4WEMB 5HHNA 4APQD 5BS0B 1W0WA 2R0LH 5DJDB 4AT6A 3ZSSA 2W0KA 1KJ3H 4J8RB 4M62H 1WSST 4TUJA 1B0RB 4FFWD 4CVXB 5AG8A 1C7SA 2O61B 1FCCA 1J8HA 2CDFA 4J4PC 4LSSL 1G0XA 4U1JB 3TBYB 3VD7A 4HW6A 1ZSDA 4U33A 3BH8B 3F12B 4OF8A 2Z93B 5D7JC 4ELKA 3V6BR 5FYKU 2X9XA 4FQJL 2F54E 1IGJB 1SJXA 4KI5F 4PJIA 2VISB 1FO0A 1OAUL 3TVMC 1Q9OA 3TBWA 5A16A 2DI9A 1DL7L 4JFDA 1BX2A 4DN3L 3U6RB 1XIWA 3IRPX 5JW5B 3O4LA 5F21B 4DFHA 3CPLA 1KB5B 4QCIB 2MCG1 5DO2C 1K8IB 3HZKA 2EEBA 2EXWC 3IF1B 2XQYG 4NP4H 4Z78A 3ES6B 3TJEL 3WKMH 3BKYL 2A6DB 3QQ9C 4NZJA 3U83A 1NMAL 1MCBA 3BAEL 4AJ0A 3EZ8A 1OD9A 4PRAA 1R3IH 2UY7A 4I3RH 2VWEC 2OI9B 3MLUL 2GI7A 4KXZH 5C0BB 5BMFH 4OAWA 3GEWB 3V4PH 4LGSB 4PFEA 1NGQL 1OTSC 5I1KL 2L7UA 1B2WL 5D1ZD 4JG0L 5IGXH 5CJOL 4WWKA 4JHAH 4QF1A 1B0GA 4PJHF 4Y4HD 4GXVL 2ZPKL 5I8EA 4R4BB 5T3XL 1BGXL 3W11D 3BKJL 2AP2A 5DJ0A 3CUPB 3GNMH 2YD7A 4NWTH 3G6JF 4UU9A 4MCYB 1HHGA 1X5JA 3U0WL 4RFOL 3C60B 3NFNA 2XTJE 2YXFA 4LCCA 3Q5YA 4DFIA 1NAKH 3Q6FA 1E28B 4QOKD 5E1AA 1VA9A 4KY1H 1ACZA 3S35H 4G80A 1CT8A 3ARVA 3NA4A 4Z9KB 3TNNA 5CCKH 4CMMB 4LF3B 2EIEA 1MCCA 4D0BB 4YO0B 2F54A 4G8GA 3P0VH 4M48H 5J11B 4DGYL 1CGVA 5IMOB 1C12A 3LQAC 3U4BL 5FO7B 1OSPH 1OB1A 2FDBP 4HX1B 1YN7A 2XV6B 1Q0YL 3UJTH 3RL2A 1WIUA 3N06B 2D7QA 2AJXH 4ZQKA 3OX8A 2F5AL 2VDNH 4P2OD 5E95B 4MD5B 4TTDC 2XFXB 4MQ7B 4FZ8H 1FN4B 1CXKA 3WYRA 5FM5M 1U42A 1JPFA 1CICB 4I0PD 1C1EL 1TQBB 1ORQA 5GJTL 3RGHA 2GSGA 4OGZA 2FH8A 5FUCC 5SWSE 1CGWA 4CN4A 5DZLA 3CFDB 3EYQC 2BVPB 5DQJB 2V5SA 2AJVH 3OPZL 4PV9B 1VFUA 4Q9QL 3INUH 4EQ2A 4X8XA 1AR2A 2YWYA 1E4WL 4WV1A 3S35X 5C0DB 3S5LA 4LSRH 1NLBL 1R3LB 1QFOA 4NO3A 5CWSA 1E0OB 2XRAH 1U8OA 1N2RB 1D6VH 4QHUB 5HHOA 3BT2H 5JLZB 3ZKSD 1W72B 4MSWB 1P4LA 2FX7L 1ZEAH 2D4DA 3CFEA 3QDJA 3H9SD 4JM2D 2Q7YA 1VKXA 3UROR 5GISL 2F53A 1O0VA 4FQPA 5BOPA 3IFOA 3IS1X 3RJDA 5BJTB 3QXTA 4OLWL 5ETUA 4I3SH 3U2SA 1N7ML 1HOCB 1Q9KA 2W59A 5I15L 2N1KA 1JYWA 4GKNB 4NYLB 3SE8L 2W9DL 3GSUB 1HHKB 2DWDB 2Z31A 3DTXB 4G8FA 4S0SD 3O8XC 4P49A 4PJ8A 3OKEB 1J1PL 2LVEA 2VH5L 4W4OA 3LKQA 2ADGA 4MA7L 1UWXH 3H42L 4R7NA 4HUVA 4I18B 3P4LA 1FFOA 3IS0X 4BK5A 1K4CA 1WAAA 5SWSA 4QHLA 1NFDB 4KDTC 4FQ1H 3VFGL 4F7MA 3PQYB 1BIIB 2R56H 5DVOA 2BZDA 4XNMA 1KPVA 2IEPA 3HNVL 3OL2A 3QULA 2FECL 5DA4A 4KROB 3HLAA 3JTTB 1CE1H 4OT1H 3GO1H 4XMPL 3ARDD 3S34L 4BFIA 3MOBL 1JGDA 4NQEE 4X6EB 5EBLA 4L4VA 4DKEL 3IYLW 5DUPH 3CFCH 1KN4L 4PRHE 4JN2B 5IEHB 4Y16D 4LCYB 5EIIB 1PD6A 3S4SA 4IIQB 2P5EE 4KK5D 3MXVL 3RI5F 4M7LL 2XA3A 5GRYA 4CU6A 3LN4A 5TE4H 2HFGL 4PGJA 1OAYL 4JFPA 3ARFD 4M7KH 1U58B 3MRFB 5F7YC 2YA2A 2EDBA 3ZE0E 2Z9TA 3BN9C 4MS8C 2OR8A 4YQXH 4R90H 4MJ2A 4XAKE 5HYJE 1LO5A 5D1QD 4YEFA 3BEVA 1SY6H 4Q74A 5FO8A 5IB1B 3W9EA 2MQ0A 3R8BB 1T03H 4LRIA 3AREB 1YMME 5FCUL 1OAQH 3KNBB 2FBJL 3MRRA 4CU8A 3R1GL 4KRPD 2CK2A 4L3AA 4DUVA 2CD0A 5F6HI 5SX4H 1JV5B 4XVSH 2H32B 3LD8B 1TJIL 43CAA 1CD1A 1FFRA 1FZKB 2PW1B 4G5ZH 4ZAKB 4U6VL 4OZFB 1UYWL 4PY7B 3UYOD 1LK2B 4UZGA 3BZ4A 3NFSL 4POZC 3SDXF 3WFEL 3FO9B 4HIXL 1EX0A 4KVNL 1I7TB 3X12A 2IC2A 4FFZH 4LDLB 1V8HA 4YHNA 5D7IE 2HJLB 3UJIH 1FNFA 3RWCB 3DYPA 3IDGB 3PE9A 5EBWB 4N1CA 2KPNA 1AGCB 3RIFF 3BPLC 1JFQL 4I5BB 2FEEI 4H25B 3RL1A 1WVZA 5HHMD 3U46A 1LEGB 1E4KC 1JPGA 3V4VL 5DHYB 2K7PA 4LNRA 4Z7WB 4EZMA 3KHQA 2FNBA 1CBVH 1FH5L 4P2RD 3BQUA 4NUGH 3I3DA 5DLML 1I4FA 4PGDA 1LE5B 3VXTA 3QZWA 4P2QD 2ZCHL 4M61A 1SJEA 3SY0B 5EZIH 5DI8A 3BP6B 2R4RH 2ENSA 2FZ3B 4Y2DA 1I1YB 3PP3H 3KPQA 3TZVC 4ODBD 3WS3B 3RU8H 4XPFH 1LDSA 3IDMA 3DARA 3QIWA 2ADFH 1IM9B 1U2CA 3GMOB 1ZGLA 5LQBL 2O5ZL 3MV8B 2H8PB 4OCWH 2XWBA 3BPOC 4MQSB 4QXGH 4O4YH 5BRZE 4WY7H 5TDNB 3O6LL 1MJ7H 4ZS7L 1GC1L 1NUDA 4TULH 3LKSA 4MCZA 5I8OL 1MCPL 5E8OA 3CMGA 1NCWL 5C08D 2BNRB 4HUMB 5BZWB 1MREL 5I18H 2BY2A 5BS0D 5IB3B 3KYNA 3BWAA 1BMGA 4OQTH 4XPGH 2JJSA 1OOAA 4EVNA 1GHFH 3CGTA 3O2DA 4P57A 5HDBF 2DICA 1FORH 4DTGL 1G7MB 5DJZA 3M17A 3VD5A 3PXHA 4UT6H 1OP9A 2CJUH 1CE6B 5HI3C 4LPYA 5FK9B 4ZUUA 2GAZB 1DVFA 1A3LH 3MLYH 4OLYL 2D31B 3O41B 4JDVB 5INCA 3F6IA 1RIUH 1RZ7L 3O3AA 4FQIL 2Z4QB 3C09B 5F44A 4L8SC 3VFRA 1DBAH 2V9TA 2UZYB 4LOUD 1KULA 2FX9H 1Y6KR 2AK4E 4NO0A 4PRDB 1AY1H 1NEZB 2N7AA 3CMOH 4YDKL 3ZT7A 5MEQB 3PWLB 5I1LB 5C0BD 3CSPA 5LWYH 1EEZA 4K3JL 1MVUB 4NO5A 3RVXC 2VZOA 3FQXA 4UV4H 1CLYL 1K2DB 4TN9A 4K7PY 4X6FB 3RVWC 4U4BA 4KRNA 1NL0L 2ENYA 4HHAA 3HC0A 1CDIA 4D8PB 2OYPA 5EOTA 4PJCF 3HMXH 4KPHH 1QSZA 4IDLA 2AAVA 3WIHH 1DDHA 2W1NA 2DI8A 4XCFH 3OZ9H 3K7UA 2VZUA 5IKCA 1UWGL 1ZT1B 3I6GB 3PWPE 3HZVA 3C60D 3C6LC 3QUXA 4XNXH 4MAYB 1I1CA 3F58H 4HFUH 4J3VA 1N0XH 3LDBB 2W65B 4KJWC 1WFUA 2ZKHH 4YXKL 3LHPL 2E9JA 2NY2C 4K8RC 2WW8A 2ICWI 5IEKB 2R0WL 3UYRL 1A9EB 3ARGA 4QHNB 5B38G 4G9FE 1MFAH 2DD8H 5K33A 3LN5A 2HRLA 4GG6B 5ID0A 1I8LC 4YDVA 2D3VA 1M7DB 5HDLA 1WFNA 4HBCL 1R5WA 4YHLL 1TENA 1YECL 2VDLL 5DGRA 5DRWB 4DK3A 2YPKB 4TNVK 4RGOL 2X89D 3V5KA 1J5OL 5B8CC 1YEKL 4U1GC 2AEIT 2YKLL 3GSXA 4P9MH 4LIQH 1F4WL 3ILPB 4NJ9L 1BAFL 4ODHH 2AK4A 4TOYL 4NBXB 4L8CA 2UUDH 2EXYD 4ODVL 1CICD 4ZTPL 3DROB 4YAQA 5IVXF 35C8H 4RX4D 3SHSA 2VWEE 1X5KA 3CVIL 2ITCB 4AYFA 2G75B 1HHHB 1V05A 2BHYA 4TRPH 1GH7A 3WFBH 4XP4H 2CRIA 1RIVH 3ECBA 3JUYA 4YDJA 1S9YA 3LMJL 5SWQA 5EOCH 1IKNC 3MCKA 4HGMA 1Q9LA 5E8DH 5DD3H 2H9GA 5HPMA 2LU3A 1RVFH 4NKMA 1Q1JH 5JUEH 1X6NA 5FXCH 1WFTA 2Y7QA 3BZDA 4S11A 1MHHB 2FJFA 1A7OH 4UV7H 3BP7A 3PWPA 5IVXE 5GRJL 1FVCB 4KKBC 5I2IB 1INEL 5H35A 1NDMA 3VWKC 3WFDH 8CGTA 1IAOB 4WGWB 4O9HH 3MV7E 1RUQL 1ZS8B 1FZMB 1T0PB 1NFKA 5D7JA 4PLJD 3F5WB 4PGCA 3P73A 4P4KC 2VKXA 4HXAH 4XNUL 4ZNCD 1RZJL 4Q9CA 4OLXL 2VR5A 1WIPA 5D96C 3TVMA 3BESR 4QT5A 1FG2B 4XVTL 2BDNH 4ODTH 1H3TA 5D70L 1Y6NR 5EZOH 1INDH 2NY3C 2AJ3A 3SCMA 3EYSH 4L3CB 3PHQB 4OFYD 3N0PB 5T33H 4DCQA 1UH2A 5D72H 4R0LC 4L29B 2W0FA 3ARQA 1IJ9A 3TYFA 1A6AA 3TV3L 2BVEA 4OFKA 1QO3B 4HBQA 1X7QB 1Q9WB 2MCPL 4D9RE 3U30B 4K2UL 2HT3C 1OWRM 2RBLA 3VGAB 4FZEL 2BHZA 1X5IA 5J06A 3CC5B 2BOCB 3SKOB 2COQA 5FUCE 3PQYD 5ACZA 5CD3B 4P5MA 2HAZA 3G6DH 2G5RA 4KROD 5TH2B 1V3KA 5EH1A 5D4QA 2HG5A 4JJHA 3JV6B 1A6UH 2QSTA 3D39B 2ZUQB 1RU9H 3KWWA 3VGEA 1JNNL 2VITB 1G9NL 1ZVSB 3UYPA 1S7RA 1TNNA 4ALAL 1MJUL 2CLVB 1PBYA 1HKLH 2VLKA 4LEXL 4OD1H 3KHOA 1RJCA 4XP1H 1TZIA 1DBJL 1AI1H 1UH3A 4PRBB 4L8BA 1KEGH 2YD6A 4R9HA 3NZHH 4IOIB 1D5ZA 1BQHB 3T77B 2ESVA 3FQTA 1TQCB 3N85L 3BRFA 3SKUD 2HT4C 2DF3A 2X10A 4M9PA 4EXKA 3T0EC 2FHBA 3PP4H 3LQZB 4TPRL 2B1HL 3IDNB 4FFYH 4ACPA 4N8CL 1U3HA 4OZHE 2CDEB 2VXVH 3DVIA 2DLTA 1CD9B 3P0GB 4OKVA 1P6AB 1R6VA 5C0GA 1VADB 1EJOH 2CKBB 3ARED 2FBOJ 4YPJA 3VFPB 1WT5A 4TNVF 4XBGB 2BNUB 4LLQB 3JTSB 4X6CE 3K80A 1X5HA 5GGSY 5SX5K 3LIZL 1HQRB 3T2QA 1NCCH 1RUMH 1REIA 4NBYB 5F6HJ 1RFDL 1BBDH 4ZNEE 3OKLA 3V6ZB 1A5FL 4ZAKD 2HKFL 3H7BB 3KPRE 3OKMB 3ZSTA 5TF1L 1FGVL 4PJ7B 1Z9LA 2QHRH 3UAJC 2Q8AL 4HJJH 3VXME 1AR1C 4YE4H 2VRAA 3QAZC 1TVHA 5I66A 1SEBB 2H6PA 2OSLA 1HILB 2AV7B 2DDQL 3O11A 4HIJB 1N0LA 3NGBB 1UXWB 4UT7H 4G6AC 2IQ9L 4NQCE 3L95B 1FBIH 2YD3A 1Q72L 5FGBC 3D1MC 1NDGA 2R2EB 4RIRB 4OIIH 5EZLB 3RA7H 4JANA 2BK8A 1AKJB 5ERWB 4AH2A 4PGEB 4MB4A 3GM8A 5K59F 2XT1B 4FQQA 1HHIA 1NC4A 2JK5A 5C0JB 4M5ZL 4ONFH 2BVTA 5F9WB 3WNOA 4XP5H 1FNEB 1S7QB 4YNYA 1MFEH 5HHNB 4XCNA 4WW2A 2FGWH 1FNSL 1JNLL 4OIAA 4X0KB 4C4KT 3VXRA 1I8IA 4TSAH 1QLFA 2A77H 5HD8D 4HIHA 4WFHD 1YEHL 3KPPA 1OM3L 1ED3B 1IM9D 5CEZD 3MV8D 3E1F1 1CDBA 4XPAL 4L3EE 3RWEA 3ARXA 2F74B 4HWEL 1JL8A 4WI7A 5E6IB 5GSVA 4CVZB 5MI0C 2BNRD 1AFVH 5B22A 1Q9OB 5A16B 3TBWB 1V5JA 4IMKC 1IGIH 4JFDB 3KYKL 3P0YH 2W0PA 1HWGB 2OJZH 2VERN 3R8QA 4Z78B 3T65A 3HUJA 5ISZE 5F7FA 5D7KE 2GTZB 1UA6L 3CDYA 4UTAL 1PAMA 4PJFE 5EO1A 2OL3A 4BZ2L 2Q8BL 3ESVF 4UNVA 3S96B 4PRAB 3BP5B 2P4AB 4YPGA 3ULVD 4OAWB 3TA3B 3HRPA 3TJHC 1J0ZA 2R1XA 1H3GA 2HT2C 1G7PA 1YC8A 5F1SA 1J11A 2V17H 3VMOA 3O3BB 3QUYA 5D7LE 1ZK9A 4N0CD 3GIZL 3AROA 4QF1B 5DJCA 4RZCB 3STLB 1IEBA 4N9GA 3V6OC 3G04B 5I8EB 2AJYL 4JKPL 1XH3B 4Z8FH 1U6AH 1N64H 2N4IA 1YEIH 5CJQL 2YXMA 1MIMH 1GPOL 4UU9B 2YBRB 1JI2A 5D2LE 3BYYA 4KMQA 4F33A 1KB5H 3EGSA 3EO9H 5GS0L 3QEGH 1PEZA 3NFNB 5GRUL 1E6JL 1T66C 3D85A 4FMKA 3CLEL 3GMQA 1F58L 2YN3A 5E56A 4BM7A 4OF5A 5E00A 5E1AB 4M8QA 1WCQA 1T80A 4L3EA 4JZJB 2UWEF 3D2UA 3DUUB 3QUZC 4G80B 3TNNB 4AM0A 2RIKA 5FGSA 3NA9L 5FUOH 3TYGL 3OR6A 4G8GB 4M7JH 4GAGH 1HEZA 3VD9A 4S1SH 1FVDA 1QFHA 1PLGH 1OB1B 1KOAA 4OLVH 1YN7B 1VHPA 4LASH 4L4TE 3MLXH 3RL2B 4X80L 3EDEA 4ZQKB 3OX8B 2R2HA 3UC0H 4MAYD 1ACYH 5IJVB 4FS0A 5FDWB 3H7LA 4GO6B 4M6OH 1KJ2A 5SX5H 3S97C 4LHJB 4X4YB 1JPFB 1FYTE 2ICWJ 2AJSL 2Z8VC 3CSBA 1U95B 1ORQB 4XC3L 4UAOC 2ICWA 5L7XH 2GSGB 1IAKA 1KENH 1E4JA 5FKPA 4RMSA 5C6PB 1BVLB 3OF6D 4NZTH 3V79C 3SGEH 2X7LB 3FB5A 4LCUA 3SEPA 3MRNA 4JHWH 3DXAA 4YUEH 1KFAH 1A4JA 1BBJA 1QKZL 4J3OC 1A6WL 2H41A 4M5YL 3E3QC 2I07B 1G7IB 5E2VH 3V0VA 4K3EL 1QBBA 4WU7A 3ZTNH 3HHRB 1IZKA 3TZVA 1H3WM 1XZ0B 2FL5B 2OTWA 3S5LB 2VL5B 4LLUA 3L5JA 4YZFE 3EAKA 4JZOB 4WEBL 5CWSB 2V6HA 2CXGA 2GK2A 1F00I 3BMVA 3P9WB 6CGTA 1WF5A 1AD9A 2XA8H 3SKNB 3DX7A 3QQ4B 3T04D 2Q7YB 1WBYA 2F53B 3N9GL 3EHBC 5LG1A 3IFOB 1UM6L 3LEYL 3F7QA 2FJHB 5C09B 5ETUB 2FHFA 3VXUE 4JDZA 1IGFL 4OKDA 3R06A 4JY6B 4FQ2L 1CWVA 3QNYB 4N1EA 4KQ4H 5T1MA 4PJ8B 4M1CD 1QFWH 1WBZA 2PXYC 3LKQB 3RUGA 2WM0A 2ADGB 3DYMA 1IAIL 2ARJA 4GG8B 1F90H 1FFOB 1OL0A 1K4CB 2R2BA 1PW3A 1U93A 5I1CH 4W6YB 1U8KB 5I1EL 3UBXB 2IWGA 4F7MB 4DEPB 1U3ZA 1S9XB 4XNMB 3SQOH 1KPVB 1R24A 5TQ0L 4RMVA 3QULB 4APQC 2JIXB 4OB5H 4I48B 3HLAB 3MACH 3TN0A 1U8LB 4FFWC 5ELIA 4BFIB 1JGDB 5EBLB 5DJ6B 3NCYP 1ZVYA 4L4VB 5CJXA 3O0RL 1EBAA 1KLGA 1QTYT 2AGJL 4Y1AE 4PGBB 3MODL 1T1XA 5DJXA 3BP4A 4ELMB 3CVHL 1AXTL 4UB0L 5CSGA 4YGVA 3BEWA 3LN4B 3GJFB 2VR9A 2KDGA 3GMRA 3TIEA 5CBEB 4G7VL 2WWKO 5TDOA 1MPAH 3W5NA 1ZHNA 3QO0B 3RY4A 4C56A 2UVFA 4YX2L 3D39D 3FT4A 3TBSA 3TPKA 1YNKH 4KKNA 1LO5B 1QRNA 3BEVB 5KANG 3C6LA 1JHKH 3EYFB 1NMCC 1AXSA 3W9EB 2R8SL 1EEYB 1CFVH 1MHPL 3RNQB 3OBAA 5IFHL 5I8CA 3X3FH 3MLRH 5ITFA 3QRGL 1U2HA 3THMH 3MRRB 3ZL4L 5I1HL 2R15A 1K9TA 2ZCKH 4JPKH 3UTSA 5D1ZC 2EDDA 4K3DH 1EMTH 3EFDL 5D93B 1LO4L 4PLKD 4HT1H 1HXMA 1TJGL 4LP5A 43CAB 1CZ8L 3I75B 4YHOH 1QYGL 2B2XL 1A7QL 1RK1A 2CLRA 3W11C 3CXDL 5L6YL 1MI5B 3IJSA 5GSRA 4MNGE 3BZ4B 4RWHA 2WMPA 4N5ED 4CBPA 2ERJC 3QP3A 5JO5A 3BXNB 4OF3A 5DD5H 3A6BL 4XHJD 2VXTH 4YHNB 4JQXC 1RUKH 1JPST 2X70B 2E9WA 2ICES 1H3PH 1BOGA 1IVLA 2VLMD 4NWUL 4RDQG 1MEXH 4Q9RH 4JFYA 1A6ZA 3RL1B 1HCVA 1RMFH 1J1XH 2IGFH 4OGAD 1RZKH 2HWZL 3MLPA 5F7EL 1MQKH 2NTSP 5FV1L 1A14H 3FMGH 1IKNA 1KG0A 3DLQR 1H5BC 1KV3A 1U8MA 3B43A 1SBSH 2H32H 1SYSA 2EZ0D 2FD6L 4HIIA 4OSUL 4JQVA 3VRJB 4YBLC 4OZFH 4P2OC 2CK0H 4PGDB 3VXTB 3VWKA 4M61B 1T5XB 1SJEB 3VGDA 3KLAB 3VE0B 3ARRA 5IB5A 5E5RB 5DI8B 2WUBL 4I0PC 4Y2DB 1NCDL 5LBSH 2C3XA 4RAVA 4ZTOH 4ODSH 3KDMA 1PKQA 3U0PB 4J3UA 3VFVA 1AKJD 4OTXL 5F71A 4OZGF 3KYMB 4HC1A 1XF1A 2IQAA 3RNKA 2DQEL 4HZLA 5D1XA 2EDEA 3QUML 5I17B 2DKSA 3T0EE 5JQ6H 1I3VA 4JHBA 3RBSA 3LKSB 1U8NB 3QHZH 5I71B 3GMLA 4U1LA 4LLWB 1A47A 4F37F 5E8OB 1EHLL 3MO1A 3JVGC 1OAKH 5HGDB 4X7CC 1NMBH 2DTMH 1YDPA 3EOAA 4JRXA 4PRNB 4P57B 3IT8D 3VXQA 4JM2C 4ZFOA 2KL6A 1XGQA 1EAJA 3NIGE 5HBBA 5DJZB 3M17B 3ZKND 4U1MA 2ZSVA 4KK8D 3MFFA 5IW6B 2R9HC 25C8H 1J7VR 5JOPE 3IDXH 1BJMA 5E6ID 3SGDH 2IMNA 5CEZH 1LMKA 5E7BA 3W9DA 4JFDD 1DVFB 4ZDHA 5IMKA 5IW1B 1T3FA 1U8HA 2EH8H 2IANE 1X4XA 3CSGA 4H5SB 1KYOJ 3O3AB 5DEFA 1JI1A 3VFRB 4X7TA 5F9JB 3QPXH 5E4IA 4P0DA 2G9HA 3W0WA 1EFXA 1KELH 5CGTA 3TA3D 1CF8H 4AEHL 4NO5B 1QZ1A 4KHXH 4QXTA 4RRPA 2HJFA 4LVNC 4PJDB 4PJGB 4JY5L 4G6KL 4HHAB 4MNHB 2UZIH 3T0XA 1I3UA 3O2VH 3HC0B 3PIQA 3AGVA 5EOTB 5LJYH 3ULVH 4K7FB 3ARDC 3PJSA 3MRLB 5GS2D 4WFGE 1PEWA 1LVEA 3FQWA 3ALXA 4PJHA 4PUBL 3NH7L 1V7NH 4MXVF 5IKCB 4DOHB 4Y16C 2P8LA 4Z7OE 5F93C 3WHXB 2F19H 5C0IA 3C6SA 5CINL 5C3TA 4EDWL 2OZ4L 4XGZA 1QBMH 3WN5A 3ARFC 32C2A 4YHPA 5D6CA 3M07A 3Q2CA 4UT9L 4HWBH 3F8UB 4HXBH 1IC7L 2JTDA 5EDXA 4G8GD 5F9AC 4X7DC 5D1QC 1O7SA 3MZGB 2QHLA 1HINH 2KKQA 3KPTA 3ZHLA 4YDVB 3UXFA 2G60L 3QDMA 4OFVA 4HPYH 3KS0H 1LO0L 4ZPTB 3IFPB 2X4RB 3MRCB 4QRPE 1DFBL 1S7SA 1FIGH 1YQ2A 3GSXB 3NIFF 3RDTB 2VXQL 2BY1A 4KRPC 1SM3H 3U36A 1EPFA 4GKZA 3TBTB 2WUCL 5TGBB 4D0CA 4EQ3A 4ZO7A 1C5BL 5GZOD 4TQEH 3SDYL 1T83C 4IDJH 1B3JA 5E4EC 4W70A 1LWRA 2VDKH 5ADPH 4JO3L 3ECBB 4OD3L 3BD4A 1TDQA 1OAZH 1S9YB 2R23A 3KJ4C 1PX4A 1JWUA 3MCKB 3VDAA 2L7JA 3MX0A 3V6OE 5HPMB 4JRYE 1HSBA 3QUKA 3I9GL 4NKMB 4OGXL 3QXDA 1Q0XH 1T4KB 4R3SA 4PJEB 1BEYH 2FJFB 3KPSA 2V7NA 1PVHA 1R5IA 5GGUA 2VSDA 2NX5B 3DUSA 3QG6B 5H35B 4X6BA 4KUZL 2E6QA 2GK0A 1OARL 3V9FA 3B8SA 1S5HB 4V1DB 1J9CT 2ADIA 5D5MA 3P73B 5T1LA 2PW2B 5BVPL 5KTEH 4LSUH 3OR7B 2F53D 1QHOA 4MAUH 1NANH 4Z7VB 3OAYK 4XWOC 3EO1A 2YRLA 2A9MH 4M1DH 5C09D 4IMKA 4QRPA 3LQAL 5DVNA 4TSCL 5GGVH 4YBHA 2P47B 5J57B 5EC1A 4PB9L 5TFSH 1CDCA 5D2NC 1RHFA 4GT7A 5A40E 2AJ3B 4G42A 4WI5A 1NC2A 3SCMB 1N4XH 4O2FA 3F7YA 2R69L 1FL5A 2OP4L 4DCQB 4PJ8D 4U6YA 2FB4L 4GKSB 4G8IB 5CGMA 2QQLH 2NZ9D 4N0UA 5IIEA 4RGMB 1PDKA 3TYFB 4HSQA 1XCTA 1A6AB 2GCYA 4OZFG 2R0KL 4HAGA 1J10A 5E2TL 3HI5H 3ZDXF 1S7VA 2CRMA 3G9AB 1MY7A 4XI5D 4X9HA 3T3MF 3HG1B 5B38A 3V0WH 1A7PL 1T0NB 3ZKXB 3GSRA 5EZJA 3OKKA 3HC3H 1D9KB 1G6VK 4P5MB 1NCUA 1QHPA 3MMEA 2JIXD 4NM4H 2HG5B 3QDGE 5ESQB 3HMWH 5KJRH 3BFOA 1C5CL 3LRHA 3E3QE 4XPTL 1D5BA 1I3GL 4L4VD 3MJ9H 1S9KC 1S7RB 4KMLB 5M94B 5DMJB 1S7WA 1AGEB 1CVSC 2R4SL 3PGCA 5DD1L 3MNZA 1SY6A 1TZIB 4MD0A 4YHML 5IBUB 5I76A 1VACA 5CP3H 1D5ZB 1VFOA 4RGND 1JK8A 1MCKA 3FQTB 2IPTH 2R1WA 3OAZH 1CDYA 1BF8A 1JPSL 1FZJB 1GGBL 3O45A 1N26A 1U3HB 2DL9A 2ZJSL 4P46B 1AE6L 5LGHH 1WZKA 4LOUC