5J3HD

Human insulin receptor domains l1-cr in complex with peptide s519c16 and 83-7 fv
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
112
structure length
112
Chain Sequence
DIVMSQSPSSLVVSVGEKVTMSCKSSQSLLYSSNQKNFLAWYQQKPGQSPKLLIYWASTRESGVPDRFTGSGSGTDFTLTISSVKAEDLAVYYCQQYFRYRTFGGGTKLEIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hormone receptor/immune system
molecule keywords Peptide S519C16
publication title Insulin Mimetic Peptide Disrupts the Primary Binding Site of the Insulin Receptor.
pubmed doi rcsb
source organism Mus musculus
total genus 25
structure length 112
sequence length 112
ec nomenclature
pdb deposition date 2016-03-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5j3hD00
3RBGA 4NRYA 3NGBB 5F8QC 1RHFA 5IHZA 3GO1H 3G6DH 3C6SA 2HFEA 3V6ZB 1CGYA 4G8IA 3F7PC 2VLRA 3DVNB 1DQTA 4FTVE 3PDOA 3TJHC 2XWBA 5HHOE 1FJ1A 2EH8H 4JFDB 1PZ5A 2AJSH 1WQVT 2XIDA 3KYAA 1JNJA 1IJ9A 5IQ9B 4Z5RA 5IJVA 5ADPH 4K8RL 5DEGB 2CLZB 2X7LA 3HI5H 1MWAB 3GSRB 1NCDL 3IVKB 4K8RC 4PREB 3LEVH 5D6CB 5JHDA 1FRGL 5C0FB 2FHCA 4WO4D 3UPCA 3ULVF 1QSFE 4DKDC 4F8TA 2R1XA 3R1GH 2W59A 1VPOH 5L2KB 2V5TA 4F7TB 5EUOE 3SE9H 1P84K 4NNXB 2MKLC 1IARB 3DUUB 2V9TA 5KSUA 3GUTB 1T2XA 5IFHH 1I85C 3VXRA 3PGFL 5EU7E 3I50L 1CR9L 2JELH 2LU4A 2QQKL 1IKNC 4KJQC 4FTVB 1XCQA 3MNWB 1FO0A 2Z93A 4XPBH 1FE8L 2A77L 2VDRL 3VI4F 1KELH 3HI6H 5F9DC 5HHOB 4B53A 3L5JA 3VD9A 5JW3H 5KSBE 1W72B 1SVZA 3FTGA 4JDVB 5C0IB 3L3KA 4Y8DC 1KXQE 4XP4L 5LXGL 4LLQB 4P5KA 4FXGB 3CFBB 1P2CB 3HRZA 2A9NH 2FECL 4OZFB 3WSQL 4XNUH 3TPUB 1YNKH 2FLBT 5HYQA 1X4ZA 1NLDH 3BSZL 3DBXA 4L29B 5DQ9A 1QSFB 3F7YB 4MNHA 2QQQA 2DQFA 2BNRA 4O4YH 4G7VH 1H3VA 4QXTB 5EUOB 4JFFA 4EUPB 1GAFL 4UNTA 3UPAA 4KGLA 1UZ6E 4PJ8A 5ALCH 2NMSA 3TN0C 3JV0A 3VFOA 5TQ0L 5DJDB 5KVGH 1LEIB 1UKTA 3K1DA 3AMLA 4PJHE 4NQCD 4X4MA 2FLRT 3GNMH 3W5NA 2ZCHH 3MCKA 4JM2C 4FXKB 4K23L 1U2HA 4OQTL 2ZOKB 5C09B 5GZNC 4OCSL 1KB9K 3EFDL 4X5WB 3VW3L 1G6RB 1S7VA 5FA3A 5KSBB 1DQJA 3LCYA 3LN5B 3FO2B 5CGTA 4IM8A 1B90A 3JWOH 3UO1L 3KPRD 4PJAE 5IB4B 3IFNL 4EI5C 5IW3A 1KNOA 1PQZB 3QCTL 4Y7MA 1FPTH 1JZ5A 2D7NA 3FB8A 1EGJL 3OGCA 3GK8H 1TNMA 4X5XA 4HT1L 2GITA 1BD2D 4IDJH 4JO1L 4ODSH 5E6IB 3ARBB 3HZYA 3KXFD 3RGVD 2APBA 3B3IB 2R9HC 3D0VB 4TVPL 3S4SG 1UKSA 1V7ML 3EYSL 4FQHA 5BJTB 1QLRA 4UTBL 1JPST 1XH3A 5AZ2L 5HPMA 1ZA3B 3BP7B 4V2BA 1UB5A 3MRNB 4PJHB 5TF0A 1TTUA 4NKOA 2Y5TA 4OLXH 3STLB 3T0EA 4U0RC 1XGUB 4OF8A 4WIQA 4JPVH 1XR9B 3L3JB 4LEOB 1NMCC 1CFNB 3U0TA 3S3SA 1I75A 5EO1A 1HHKB 3QXAB 2Z31B 3REVB 3L3IA 2WWKT 4XCYA 5T1KA 3L9RA 3MRBB 2DQCH 4ENED 1YECH 2P46B 1HQRB 3ZDYF 1R3IL 3BGMB 4PJAB 4LLWA 2EXWD 4JZJB 1ZS8A 1AO7D 3E6HA 3JWDH 4HUXB 4KK8C 1DANU 4HUVA 5EZIL 4JCLA 3LKPB 2LAAA 3SCMC 3PXHA 4DQOH 4OD1L 3SOBH 3QNXB 5KTEL 1KIPB 3WLWD 4U1HA 3QI9B 2Q7YB 1UT9A 2OTUA 3OAUH 1QLFA 2W91A 3DV4A 4J6RH 4FQQB 2BRRL 2RAMA 1FH5H 2VNCA 2YD4A 4PJCF 3BP4B 3MRLA 3O2DH 2W65A 4TNVF 4UT7L 2KPNA 5E8PB 4LDEB 4POUB 2EYSA 5DGQA 3FQUB 2YRPA 3IETA 5FHBL 2VR4A 5I1KL 3MJ8A 4QXUH 2DKSA 1CIUA 2HAZA 4M6NL 1FLTX 3NCYS 2YN5A 4XNMA 1ZT4B 2CJUL 5L9DL 4DN3H 3EO0B 1A9EB 3ZKXC 3PL6C 3TNMB 1H5BA 5ICYB 1CD1A 2JJSC 4NJAL 2E6QA 4GBXB 1ADQL 4HIIB 4YQXH 4Y8AA 5DMJB 1N4XH 1RHHA 5L6YH 5GRUL 1ZHBB 3GI8L 3QSKB 5D1QC 1WLHA 2PTTB 1S7QB 1AXIB 3U7YL 4XP5L 3HNTL 1Q0XL 4O2FB 4K7FB 1R3KB 4LLAA 1UM6L 5D71L 2IBZX 3RDTB 2IANA 5ITFB 2NZ9C 5BQ7A 1DVFC 4YPGA 5E2TL 3UTSA 4UAOC 2AJ3A 1GC1L 5C0AA 4OZIF 4PRAB 3JZ7A 1Q0YL 1V05A 4AIZB 2NXZB 4YUEL 5EORH 4GMTL 1GC1C 4OZHE 4K94L 4Z76A 5B3JF 1FYTA 5DK2B 5C0GA 2Y25A 1J11A 4XP6H 1GOFA 2OJEA 4QRRE 5EOQL 3S97C 1G0YR 1X6LA 3MBEB 4K94C 1EUTA 3GMQA 2D3VA 5J89A 2KBGA 3AY4A 1VGEH 2YA1A 2EE6A 3P11L 4F9LA 2V7HA 5DFVC 4NN6C 3HPLA 5IHUL 4EN3B 4WFGD 3O3EB 1FZMB 4NO0B 3LQZB 5IB3A 3IFOB 4JREB 1FP5A 1IC5L 2DLFL 1I9IH 3DJ9A 1ZHNB 5DA4A 1PKQE 1EFXA 2Y4SA 1DFBH 4YHML 2BVUA 4C57C 3OWEA 3RI5K 5HHQB 1OB1B 4FFWD 1C7SA 3UDWC 4ZAKD 3HZMA 3FT4B 3GSOA 4HEME 3JBG7 2ZPKL 1GGCL 4F58H 3KJ6H 1W0VB 3OX8A 1HH9A 4HQQH 1LEKA 1N0XH 1DL7L 4XCCL 3DX7B 1XIWB 5IQ7L 5CSBA 5IVZB 3O3UN 1BFOA 2H2SD 4MCYA 4QRRB 4WTXA 3ULUE 4LK4A 1J1XL 4H20L 2C4FT 5F7LB 2WAHA 2AVGA 1EEZA 4MA8H 5M94B 5I76A 4FQPA 4MA1B 4EVNB 2YR3A 2P8PA 2FBJH 3BH9B 2Z91A 1TTGA 2NX5D 3DMMC 3G6JF 3WHXB 3TIDA 3BPOB 1PKQB 3FL7A 2ICES 4U1KB 1OGAD 2YD8A 5IB1B 3O2DA 1BVLA 4NNYB 5F44A 4QHMA 4YDKH 4ODVL 2SEBA 2VLKD 3SDAB 3V52H 1I3RA 1JNHB 5HVFB 1MH5B 4ZXBC 5ERWA 4XP9H 2AV7B 4PJDE 4PV9A 1MCCA 2MTPA 1LK2A 2VB5A 1Q94B 2HJFA 3CGTA 2G75B 2FJFA 2HT2C 1CU4H 3ES6B 5EWIH 5ESQA 5F7EH 2YPLE 1RD6A 4O9HH 1X5XA 2OM5A 3IDNB 3O41B 1DBJH 2Z92A 1KB5A 3IDUA 3TCLA 3LY6A 3N1FC 4NQSA 4ZTPH 1WSST 4LQFL 3LS4H 4NQTA 2GW5A 1AD9A 1TITA 4G3YL 4I2XA 5DT1L 2P44B 4QRSB 4IOIA 2ED8A 35C8L 3QG7H 4FQ2H 4QGYA 2OR9L 1F3RB 1JYWA 4GRLC 3ZKMC 3CLFL 3BHBA 1V3JA 4R4BA 3D18A 5FF6B 3I6GB 5F97E 1SYSA 3HI1B 5J12C 3SKJL 5IF0A 3U46B 2DTSA 3FFCA 3VXQB 4Y5VC 1X9QA 1MCNA 1ZXQA 1A6TB 3TA3A 3G9VA 4U6TA 1B2WH 3C2AH 4PJDB 1ZLVH 1JRHH 3O6FC 2A73A 1J0YA 4GOSA 1OAKL 4KUCF 5SWSE 2EKSB 3SEPA 3V6FB 2H2PC 1J0KA 5GISH 1FN4B 3REWB 2VZUA 1Z9SA 5DMKA 3NCEB 2YPLB 2MPAH 3MBXL 2R56H 1RK1A 3UYRH 2OTPA 3H9HA 5EBGA 2ATPA 1NMBL 5C0BE 5IGXL 4CAGA 3MROA 1U8MA 4YX2H 2BY2A 1ZT7A 2AGJH 5F7DB 1A64A 4NP4L 1E6OH 3TBVB 1ZHKB 1I9RH 1MY7A 4HWNA 4M7LL 3T1WA 1LEGA 4LPYA 3DSFL 5I16A 2XA8H 1JNNH 3AXLA 5EPMB 2BX5A 4W68A 5C0JA 2AAVA 5CHNA 5LJYH 5GGSB 4PJ5D 3DUSA 1OSPH 3QIUD 1MCEA 4XCFL 4C54A 3ALWA 5ICXB 4ZUTB 3QB7C 4JZOA 3D9AL 3V5KB 4L9LA 3CH1B 4UQ3B 3VE0A 2Y06H 1NCCL 3EJZD 4HDIA 1CWVA 3OKNB 3QUXD 4Y16D 3IDGB 5SWSB 1H3GA 5E4IA 4DW2H 5JXAH 3EYOB 5I18L 4D0DA 5K9OA 5DWUL 4OLYL 3QQ9D 3VWKC 5IKCA 4PTTB 3D2UB 2BC4A 4LCWB 4H0HB 5ECJE 2ZUTA 3SPVB 5C0BB 3AS0A 3U36B 3ZSTA 2DWDA 1F6AA 1PD6A 4LU5H 2NTFB 3RTQB 4NKIL 1FIGL 3B2VH 5I30H 2BSTB 3UC0L 3E8UL 3L95B 4JR9H 4O02H 2D9QB 5E1AA 3UJIL 2VAJA 3RNKB 4AEIL 1QKZH 1UM4L 3O8XA 3VXTA 3N1GC 4WU7B 2CXGA 3GSUB 3SDCB 5CP3H 1B0WA 3CFKB 5JUEL 4MJ6A 3B43A 2GY5A 2V7NB 2VLMD 3ESVF 4JFHD 2B20A 3HE7A 2Y36H 4L4VD 2NYYC 4H8WL 2BHYA 3O6LH 1A6WH 2N1KA 4J4PC 5LAXA 2YHGA 4NDMB 2KL6A 4P46B 5IB2B 4I4WB 5EU6A 3P40A 1NAMH 1WCQA 4I0PB 1I1YA 4PJGE 3P0VH 3LSOB 2VISB 3MREA 2WBJB 5IR1A 2YC1A 5IUSA 5J11B 3F7QA 1OP3H 3QUYB 4WHTB 1S3KL 3LS5H 4HH9B 4QEGA 2VIRA 4LLYB 3V5DA 5JLZB 3C60C 3RX5A 2BOBB 2AJXH 1A1NB 4PS4L 3TJEH 2C1PB 1INEL 1DBAL 3EFFB 1GGYA 3QDJA 3QIWB 1LDSA 1NFIA 1W8OA 4M43H 3WD5H 4U1GC 5D7JD 2X4QB 3RJQB 2JE8A 2EC8A 5A16B 2EDJA 4TUJA 4KTDH 1YYML 5MENE 4HIXL 1TZIB 1UKQA 5DDHA 4HIJA 4L3CA 3FAXA 2WP3O 4XBGA 1P4LB 3ZKNC 2JCCF 4XPGH 5JIPA 3B9KB 2DTML 4A2MA 5F6IB 25C8H 4NFCA 5CEYA 1IBGL 3QULB 1CF8H 5IHLB 1QFUL 2NY0D 5L8KB 5CWSA 4PJGB 1RIUL 3EOBB 4QTHB 4D9RE 1D5IL 1JHTA 3EYFB 4GAFB 3ZHDA 2IFGA 1QFWI 1J86A 3LKOB 3QHFL 1A1OA 1AH1A 1DSFH 4Z7UA 2X1OA 5ACZB 2ZSWB 4CW1B 1OTTC 4G6FB 1ORSB 2A6KA 2PO6B 2X89D 1CFTB 1NDGA 2C3GA 3ZHLA 2GFBB 4FZEL 5DSCA 3ARFB 3E0GA 4G6AD 1U8LB 4I3RL 2CH8A 3DXAD 5I66B 4YNYB 3MACL 4PB9H 3RWDA 3VMPA 4ZFOB 3F7RA 1T22A 5ID1A 4MZ2A 3E1F1 2GSIA 2J4WH 3L3GA 4KTEL 3UPRB 4N68A 5MENB 1ZHLB 2GK0B 3PE9A 2ZOLB 3ULUL 4I3SH 1RJYA 2DBLL 3KYMB 4ODTL 5KW9L 4PJCB 1SJEB 4P49A 3V4VL 4D9LH 5D7SH 3ARDB 5LBSH 4WI5A 3QRGH 2HN7B 3W81A 1JGVH 4LCCB 2CUIA 4TOYH 1I4FB 3ZL4H 1JHKH 1TENA 2IAMD 3CDGA 3CU7A 3PGCB 1JGLH 5E2VL 5CEZD 4FNLH 4M6OL 1T1XA 2DIJA 3F58H 4OF0A 4G8GD 4OD2A 1O0VA 1NCNA 4HPYL 2QTEA 4G6JL 4LIQH 3N85H 5J1AA 1NDMB 4XH2B 1HYSC 2WQRA 1LE5A 3CSGA 5JW4N 3C2SA 1UB6A 4FQXA 5CP3A 2H1PL 4PJ9B 3GSVA 4HUNB 2FSEA 4L4TD 5T33H 5I6XB 3ZHKA 4D3CH 1IAKB 3SDDC 4M7ZB 1AP2A 1BJ1J 1G9MH 1R5IB 1RY7B 4LEXH 4JPIB 4TULL 5CSGA 1H8NA 4F33A 3PP3K 3HE6C 4TRPL 1J12A 4EBQH 5GQBA 2C3VB 2DQGL 1FNSL 3CVIL 1FL6B 3NFPB 4PJXA 3DI2B 4HEPG 2FO4B 1NAMA 1GZQA 1R24B 2ADIB 3MMEA 4QTIH 4DVRL 1NCBH 5DQDH 4OZIB 3T3PE 5FAAA 4R26L 5F3HA 1QHPA 4N0YH 1IMHC 1XMWA 3BWAA 4MHHI 4X99B 1FZKB 4RFOL 2QQNH 2I9TB 2PXYA 3TT1L 1G0DA 5AYQA 8CGTA 5T3ZL 1BPVA 5FYKE 2X1XR 5H2BA 3LRGA 1TPXB 4KAQL 5FYJE 2Q1EA 2X1WL 1P4IL 3GM0A 3T4YA 3TFKC 2PCPA 5LWYL 3RPKA 1Z3GH 4JFXB 3WJLC 4G8FA 2Q7NA 4LGSB 1FFOA 1M6OA 5C3TA 1A7RL 4JY5H 4RIRB 5GZOC 3MLTA 2R0WH 5KG9B 5HVHB 4KY1L 3LOWA 1ND0B 4ZFFA 5CBEB 1T7WA 3NN8A 1EZVY 1ZA6B 4QLRA 1OP9A 1U0QA 3C5ZD 4PRPD 3O4OB 5BV7B 1OF2B 4I18A 3MYZA 3DHJA 4MA3A 5HYSA 4HUKB 4KDTC 1UWXK 1RUAL 1X5HA 3HMXL 3BZEA 2O93L 4R97C 3RWHB 3AUVA 2JIXB 5INDB 4Y2DD 4JO2L 4IS6A 1JHLH 1BZ7A 1KJMB 4IRZH 1KIQB 1VFBB 1UACL 5D2LE 4NJ9H 3CC5B 4PGCA 3ZDXE 1CD9B 1OPGH 4XX1E 1FL5A 4X9HA 1AD0A 1QBLL 4LKCB 1MI5E 3BD4A 3P73A 3G6JB 3HAEH 1HHIB 2XZAH 3IU4H 4KROD 3VDAA 4XMPL 5IB5A 2H6PB 4CN1A 5ESAB 1XF4B 1NBYB 4N8CH 4JY6A 3MRJB 4NYLB 4AL8H 3VXRE 2CLVB 3BP5B 3OKOA 4ZO7A 5F9JA 4IRSD 3VFPA 4WW2F 4UIMA 1NKRA 4YHLL 5D5MA 2ZUUA 1DE4A 2AS5M 3D6GA 3KJ4B 1F3JA 2OMNA 4HJJH 4YLQT 3WS3A 2E7CA 5DRZA 3CDYA 4WY7H 4K3JH 3TWCH 1NSNH 2BNUA 5IJVB 4HJ0C 4P2QE 5D2LB 2IJ0C 1CZ8H 1MCWW 5DD6A 5HXMA 1WC7A 2BSRB 3BE1H 4L8DB 4WV1B 5EC1A 1MI5B 4CMHB 1HE7A 3MFFB 1IGCL 3SE4C 2EYRA 2V9QA 2BNRE 3CD4A 3S98A 1G9EA 4P4KD 2FIRT 4JFFE 3QUMH 5IG7A 3D3VE 3VFUA 5I1IL 4POZC 3EIFA 3QG6A 4LLVA 4XXDB 4OKVB 4Y4HC 4M1DL 5SWQB 4HKXB 4F9PC 1L0QA 2X4UA 4P5TB 3SQOH 4JQIH 1KCUL 4RISH 2P5ED 3P4NB 2WANA 5IFJA 5FYLL 5F96H 4M6AA 4UB0L 1N6QL 3VFRB 1VEPA 2E9IA 4NSKB 4KMTL 4YC2B 4IHOA 4J3SA 2BDNH 1OD7A 4QYOA 4WEBH 1MCIA 5T5NF 3QNYA 2YPVH 4P2QB 5JPMA 1NC4D 1X6NA 1KT2A 3QAZC 3TV3H 4X7CC 3U9PH 3W2DH 1D6VL 3D39D 3BKJH 4JPWL 2FDBP 5DJAB 4UU9A 3Q3GA 4QGTA 4WJ5A 1HN1A 1MVUA 2BNRB 2Y9RT 4XI5D 2OJZH 4GG8B 4G6KH 1U58A 4JFFB 1BLNA 3D3VB 5CBAA 1CVRA 5JDJA 1S9WB 2HVKB 3IYLW 2R0KL 3LKNB 4LLDB 5IW1B 3SGDH 2AQ2A 4D2NA 1TJIL 1RJLB 4YH6A 2ZNXA 3KR3L 5BZWB 1XGPB 3P30H 5D1XC 5TDOA 4YJZL 2FJHB 1Q9KA 4XT1C 1F3DJ 4JFZL 1W0WB 3VMOA 3X14B 1A3LH 4OQ1A 5C7XL 2C7UB 3WIHH 5GIRA 2IFFH 2A6IB 4BFIB 3X3GH 2FEEI 3PWVA 3V0VB 1YDPA 1CXIA 3G04B 3QXVA 4BFEA 1W0YT 4KMLB 1M71A 4MLIA 2YK1L 4UZGA 3RY6A 4NUJA 3CIQA 1HHGA 3VD7A 4KDWA 1I8MB 5CEXB 3HAEA 2MCG1 3SKNA 4NPYA 3G9AB 1UCBL 4LHUD 1AY1L 2F5BL 2XTJE 4FOMA 1F42A 1FC2D 4M8QA 1QFWL 3JV4B 3MLVL 1II4E 2JCCE 1MQ8A 4JHBA 5D93B 1NFDF 4RGMB 3QIBA 4C83A 4ZMAT 2GK2A 1A6UH 3T77A 2GT9A 1CICC 5F9WB 3IJYB 3LH2L 3DYMA 4J3OC 4M5ZL 1BAFH 2AJZA 1DUZA 5D4QA 3L5XL 1XGQA 3BD5A 3W9DA 1JCKA 1CFSA 1P7KB 4Y4KD 3MZGB 1SQ2N 1EMTH 1P9MA 4MHHG 1C08A 3WFDH 1FL3A 2VE6B 5L2JA 5EO0B 5JW5A 4PG2A 1YEEL 2BFVL 4U7MA 3QDMA 5I15L 1AJ7L 3T08A 4LASH 4J3XA 1OM3L 5JA9A 1Q1JH 4M5YH 3RX8A 4LPVA 1A9BA 3QUMA 2NXYD 1AQKH 4HKZA 4U1JB 4XNYL 2EIZA 2XTJB 4HBQA 5F71A 2MWCA 4ODXB 1UXWB 5E95B 1RZ7H 3NACH 3PF2A 2IPKB 1LNUB 2JCCB 5FYKL 4D94A 3EBAA 1OQXA 1AHWA 4LSSL 4OGYH 5JO5B 2OZ4L 1KCRH 3BAEL 3SJVE 5FYJL 2FRGP 2MOVA 4QRPD 1INQA 5E9DD 4K9EC 4YDVA 5B8CB 4NT6A 5DRNB 3HC3L 3PP4H 5F70A 3K0WA 3K2MC 3Q1SH 4TNWK 2ADFL 5T1LA 5CLTA 5DMGD 3MRGB 1MFEH 2WBKA 3HNSH 1FG2A 4HZAA 1Q72L 1RZGB 2C3HA 1HOCA 1UC6A 3WDIA 5C07E 5MERB 2YPKB 3QEQD 2UY6A 4LMQI 4K07A 1YPZA 1CGSH 4RDQF 5IESH 4WWID 2I07A 3U79A 3GSNA 4FMKA 3O6MH 2OSLA 5DC4B 2HTKC 4S2SB 1ZANH 4ORGA 3FONB 3DX8B 3JUYA 4MAYA 2EDLA 4PJEF 5IHBA 3VXOA 5FCUH 5E99H 1SVCP 2IWGA 5TH2B 4CDGC 5JORB 4ZYKA 4MJ5B 2NLJA 2WMPA 1UWGL 3SJVB 5F1IB 2CDFB 4QXWA 1E4WH 3ARZA 1JN6A 3H3PL 3I2CL 2OS7A 5DURB 4YBHA 5C0CE 1VFAB 4GJTB 4XC1L 4UOJA 5CJQL 4LAJH 4PJFF 1JWSA 3EO9H 3OZ9L 1H3TA 4P59L 3QJFB 4WDIA 5C07B 32C2A 2QL1A 4GW5B 4QHLB 3VFGL 3OKKA 2PW1A 1IGJA 2G60L 3GJFB 1MFAL 1V8HA 1CDGA 2GTZA 2FHFA 5I1EL 2NY6C 1U9KA 3B6SB 1FO0L 3TVMB 3QFJD 4XNQA 4L8CB 2DI8A 3PHQB 2FD6H 4Y5XA 1MHPL 4NQVB 1IGYB 1NGYB 3DVIA 3TO4D 3CMGA 3WHE1 4YWGL 4YXLH 4Z0XA 5IBTH 2A6DB 1MJ7L 3HB3D 3NZHH 5GGTH 3E2HC 5IMMB 4PG9B 4KGJA 3WLBA 4X6DA 2QADB 5AYUH 3OF6D 1R3JB 4M93C 2XPGB 4KI5D 2P5WA 3S34H 3MLSL 2HFFB 2X70B 3NFNA 5C0CB 2MNUA 3DHMA 4KZDL 5KN5B 3ARGD 5ENWB 5TDNA 3V6BR 4CVZB 5HDBF 2BVOB 1XF3A 1N6VA 4U6VL 1BF8A 3CMOL 3GBML 2GTWA 4RGNC 3BGAA 3T1FA 2EDWA 3VXSA 4I13B 2AQ3A 1J05A 2DQHH 4PJ8C 2VERN 4IOFD 1I1FB 1WFOA 3RVWD 1UXSB 1MCPL 3AB0C 4QOKE 4CNIA 5EUKB 1IKFH 4WFFD 1KPVA 1XGRA 2X4RB 1KJ2B 2VDML 2VDNL 4WUKL 4R90L 1IAIH 4ETYA 3V7AE 4DKFL 5J9PA 4YXKH 4YE4H 1YY9C 1KUMA 5GS0L 2OCFD 3QEGH 3NFSH 3D69A 1RFDL 2QHRH 2XKSA 5GS0C 5EN2A 4Q6IB 5HHNB 1MREL 3VXME 1NUFA 5HBBA 3ILQD 4W4NA 4BH7A 1F6LL 3KPSA 3H3KA 5CMAB 4MDJB 3GO1L 3G6DL 2OI9B 4GRMB 4OFIA 5KZCB 1KCVH 3P4LA 2Y72A 4LHJB 5FEBA 3ILPB 3T0DA 4MDIA 1QP1A 2EH8L 4QOKB 3T0EC 2AJSL 1DQDH 5DYOB 5F6HJ 5HYJD 3IF1A 3B9EA 4ERSH 4M3JA 1HHHA 5ADPL 5SX5H 4M4RA 4RWHA 4PV8B 5BS0D 3SGEI 3HI5L 2VSCA 4R4NC 2IH1B 3JV5A 3CJJA 3NIGF 3LEVL 5EU3A 5F1KC 5KSVA 5AAMA 1S7XA 3BP6A 5D7KD 3R1GL 4MXQC 1VPOL 3PV6B 3SE9L 3VXMB 1UZ8A 3O4LE 4P23B 3U7AA 3S6CA 4JKPH 1CI5A 3LPFA 3WKNA 3WFBH 4LSUH 4BQ6A 5IFHL 1H15A 4M7JH 3K46A 3WFCH 1BVKA 4D0CB 2JELL 4XHJD 4GG6F 4MB3A 1D5XA 4JFYA 2F74A 4XPBL 4EDXB 2WIMA 1KELL 3HI6L 2Z35B 1WIOA 5GRVL 3MGTA 1J5OH 5FXCH 1T4KB 4XRCA 1BOGA 2OXHA 4KK5C 5JW3L 1AKJD 3P3YA 4MZ3A 3R06B 2Y7QA 4QRUB 4BUHA 3DUSB 3HKFA 3TBSB 4CUCA 2F53D 1KTLA 1JRHI 1JI1A 5TDPA 5GGTA 1HSBB 3HG1E 3BH8B 4Y4FD 3I75A 5DHVH 4R7DB 2A9NL 3MRMB 5J13B 4XNUL 3VRJB 1YNKL 4JFEE 1A4JB 4WUUA 5CINH 2PKDA 3NMEA 1NLDL 3BRFA 1RAMA 3F7VA 1RZKH 4XNZB 3QP3A 3PHOA 1RI8A 2X42A 2AK4D 4O4YL 4G7VL 1G9NH 3W9EA 2Z8SA 2N56A 1P7QB 2AP2A 3CUPB 3O4LB 1H5BC 4KDVA 3V8CA 5HVWA 3BZ4B 4KKLC 5KANI 1P7HL 3LQAH 3IGAB 5FECB 5HSFA 5ALCL 4ZNEE 3SCMD 5KVGL 3BW9A 3GNML 2ZCHL 1XZ0B 1LWRA 5EO9B 4FMFA 2NZIA 3T0WA 5J1TC 1X5GA 2BHZA 1X5FA 4MX7A 3TZVB 1ZWIA 3DNKA 3WXWH 1EEYA 1PEWA 1XEDA 3QH3B 3FFDA 1A6AA 2Q20A 3JWOL 3HG1B 4OI7A 3IJHB 4G8EA 3RIFK 1FPTL 4U6YB 3WKMH 5D9SB 5JMOC 2B1HH 2W38A 3I85A 4JFEB 1KCLA 3DECA 1K8IB 3GK8L 1M7DB 4PGBB 4XVUC 4D0BB 2DQJL 1NFDE 4IDJL 4ODSL 4KHTH 2PYFB 5BCAA 1L7IH 1OLZA 3AY4C 2VXUH 3TYFA 4QWWD 4F9LC 3CSPA 4KRPD 2EC9U 3PL6D 5HGBA 4H25B 4OLXL 4PGZA 1JYVA 1L6ZA 4N5UA 1A4KB 2W0KA 4OJFH 5D1ZB 5C08E 4A6YH 4JHWH 2IADA 3CVHH 1WUNT 4K3HA 4JVWA 3TESA 1T83A 1WK0A 4JFDD 5F7UA 4H1LB 2NZ9D 2QV2A 3OJMB 2DQCL 3E3QE 4NQEE 1YECL 4WWKB 3JTTB 1BBJB 4F3FB 3TBYB 3UTTA 3JWDL 2P8MA 2CD0A 3DETD 4V1DE 4IRJB 4QY8A 3L3OA 1NFDB 4DQOL 1YUHA 3WFHA 1QACA 3SOBL 1N59B 5E7FA 1X5JA 1U92B 2G2RA 4EJ1C 2J12B 5L2KD 2MSPA 3OAUL 3GMMB 4J6RL 2UWEF 2VDLH 4BSJA 4P2OA 2YMXH 4RMUA 1U8KB 1FH5L 4NNPH 4M61B 3O2DL 2ZUXA 3KS0J 3GMNA 4HGKC 3SKMA 3BN9D 5C08B 3Q0HA 2NCMA 4FTVD 5KSAA 1AXSB 3O11A 3Q5OA 3DUHA 5HHOD 4PY8J 5DJYB 1U8PA 1NCAH 4MQTB 4NQEB 5EZLB 4BELD 1VDGA 4PJEE 4PLKD 3RI5F 1IQDA 2AKRB 3VH8A 4R7NA 5DHVA 4KKBC 4GAGH 5C6TL 1JZ8A 2M2DA 1JGDA 3AGVA 5BZDA 1MHEB 4DN3L 1KB5L 1ONQB 4V1DB 4JFOB 1C5CH 5DVOA 3NIFE 2BCKA 1BWWA 3C09C 2EO1A 3K8KA 1NBVH 5E4EB 4YQXL 5IJKA 1N4XL 5L6YL 4JFQA 2GUOB 1IM3B 4N0CD 2X9WA 1QO3B 4RMTA 5INCB 3BEVA 1GPOL 3LEXA 2A6JA 3PQYE 2LTQC 2DLEA 4ZOCA 3FOLA 5MEOA 1NEZB 4HGWB 4PJFE 1O7SA 1T89A 4OZGA 1FVDA 4HWEH 4Y5YB 2HMID 3KPMA 2C4XA 3H9SD 4WW2A 4AIXA 3TIEA 1KFAH 3MRCA 3VFTA 5E8EB 1Z2KA 4HWBH 1FGNH 1WZ1L 1ZV5A 3IDJB 4XZUA 4YHKH 4UDUB 5EORL 3RWJA 4JZNA 2GHWB 3TA3C 3BPLB 3FZUD 5C0DA 3MLZH 1U8JA 2H32B 4PJEB 3SO3C 3CK0H 4XP6L 5K33A 2GYSA 5C70A 2A77H 2C5DC 2JB6A 4X7TA 2V5RA 4F7EA 1VGEL 3CFEB 1YNTB 5DD1H 2VAAB 4F7CB 3FHQA 2EXYC 5MI0B 2N7AA 2ZG2A 3GJEB 5E6ID 3LV3A 2WWMC 4K2UH 1FQ9C 1QSEE 3MO1A 3CX2A 4Q9BA 5FYKU 5GS3A 3FQRB 1I9IL 4X6EB 2LQRA 1CDUA 1R5VA 3V8OA 5FYJU 3PQYB 5IW6A 1DFBL 2FL5A 2Q86A 5HDBE 1Y0LA 4PJFB 5IVOA 2Q76A 1F4YL 5GXBB 2AJYL 5BRZE 4ZPTA 3CVHA 4OAWB 3VGDA 1TVHA 4GRLD 4KXZI 4TPRL 4YAQA 4F58L 2LU7A 3KJ6L 4L9LC 3DPBA 2XWJA 2GI7A 2Z31D 3PWPE 4ZFZB 2CDEA 1N0XL 5HJ3A 1JI2A 4QHNB 4WFHE 5HI5D 3GMOA 4WO4A 2VQUA 3R0MA 5CD3B 4TTDD 5TE4H 2V5YA 3VD3A 4OCSH 1JK8B 1FFOB 2H2PD 1MHCA 5D96B 4MA8L 4LKXA 1KACB 5EULV 5GGRA 5JW4Q 1IEAB 1QSEB 2FBJL 1S7WB 3G5YA 3L3DB 5CJBA 1G7PA 3P77A 3U6RB 2DLGA 3QI9D 3QCTH 5C9JA 2FATH 4OCYH 2DKUA 5A2JH 3VG9C 3T3ME 3BZFA 2YD1A 1NL0H 1QPPA 1I3UA 1UADC 1WV7T 1ZSDA 4YDKL 4X6CF 5BOPA 4NQXB 3O8XC 3V52L 5BRZB 1CE6A 4TVPH 2DM3A 4XP9L 3QZWB 3C5SA 3KPOA 1I1AB 3EJJX 3FHAA 3UTQA 3HE7C 3PWPB 3F12A 5GGSY 3TNNA 3MFGB 5JHLH 4XMLH 3S5LB 2O61A 3F62A 1BF2A 4GLRH 1CU4L 3QXUA 5EWIL 4ZAKB 5F7EL 2BOCB 4CMMA 4U1IB 1CTNA 1BX2B 5DK0B 3HUJE 5SWZE 2HT3C 4WU5A 5FDWA 4P3DB 1DBJL 3B2UD 4P2RD 4ZTPL 3LS4L 1OTSC 3P4MA 2HG5A 4I8DA 1AGBB 4NQCA 4JY6B 4GBXD 5JOFA 4WEUD 1HILB 3QG7L 4FQ2L 4AH2B 5B38B 4S1DD 4Q9RH 1FV1A 3NIGE 3DVGB 4UV7H 4HKJA 3KYOB 3AROA 2AJUH 4D9QE 3GB7A 4HK0B 1G7LA 4LSTL 2ZG1A 5FUCE 3V5HB 3RDTD 2XT1B 1T03H 4U3HA 2OR8A 1YEHH 3KPRA 1JF1B 3DO7B 1B2WL 3C2AL 3L6FA 4OLZH 5EBWB 5I75B 1JRHL 1UQSB 4HWBA 5JPNB 3BGFC 1UG9A 1BMGA 1MRCH 1NGWA 2NY3C 3PABB 4RWYH 4EIZC 3VU2A 5GISL 4GKZA 1J8HA 1BD2A 2NXZD 4MCZA 4HV8A 5F1NA 1D9KB 1YEFH 2R23B 1E0OB 1TVDA 3RGVA 3AVEA 2MPAL 4J4PD 2R56L 4U2ZA 1ZVSA 3VFMA 3HUJB 5SWZB 5GSRA 1ETZB 3BPOC 3UYRL 3ALXA 3MYJB 4JE4B 4U31A 5E8DH 4YX2L 3MBED 3MTRA 1YEJH 2AGJL 1WT5A 2E6PA 1QR1A 3K81A 1E6OL 4JQVA 2NY4D 1I9RL 1HQ4B 3D25B 2G9HB 2VXVL 1FBIH 2UUDK 1JE6A 4EN3D 1MHHB 4ONOA 5E00B 3C6LA 2XA8L 1JNNL 5JQ6H 3HR5A 4NO0D 3H8NA 2XWTA 4MQXC 5L9DH 1OSPL 4MQ7A 5E6ZA 2JTDA 4BH8A 4NRXB 5B22A 5FB8B 1H0DA 3KLHC 1T3FB 3QPQD 1SM3H 1PFCA 4Z95H 2Y06L 4PJBE 4KKAC 2J6EH 3VRIB 1F11B 2E9BA 4UDTA 3AREB 5E94A 5ID0B 4OLUH 1GOHA 2FEDC 4TSBL 5I8EA 1AO7A 4DW2L 5JXAL 3BMWA 1NMAH 1ZEAH 4BFGA 5EIIB 3EYQC 3BISA 1XIWD 4ZOBA 3SDXF 2K3TA 3FB5B 1YA5A 1JZ3A 4QRRD 4EI5A 2ZUWA 1Q9LB 1WFUA 4I48B 4LU5L 4HUWA 4YUEH 4APQB 3B2VL 1ZLWK 5I30L 5IVXE 4KK6C 3THML 4JR9L 4MNGB 1UEYA 4O02L 3TBWA 5I8CA 5C0EA 3SKOB 1QKZL 5CSZB 1DEDA 4HKBA 5IM7A 4CN6A 3RZCB 4P57B 3T8XA 3NZ8B 4PLJD 4E42B 5HYSG 4JRYA 1CFQA 2FJGA 2Y36L 4OV5B 4FQXC 4PJBB 1Q9WA 3QDGE 1HHJB 2W60A 3K4DA 1A6WL 3O6LL 3SDAD 3BZDA 5DJ2B 2E9JA 4RFNB 5IK3A 4LBEA 1RUPH 2ENYA 2VJXA 1QHOA 1G7JA 1NAML 1L7TH 4HGMA 3RFZC 1P84J 3FT3B 3ULVC 4XGZA 3WNLA 2FYYA 3Q5TA 3DX6B 3MV9E 4Y16B 2ZPKH 4M9PA 2MCPL 5IEKA 3ULUD 4MA7H 1J87A 1T66C 3EOYG 2D0FA 4ESKA 3L5WA 1DL7H 5IVXB 2XN9A 2NW3A 3QEHA 4M8QB 4M8VA 2AJXL 1QSVA 4MSWA 5EU5A 4HK3N 4N5EC 2BVQB 3TJEL 1KTDA 1DBKH 2PXYC 1MSPA 3CXDH 3STZB 1ZLUK 3G5VB 4M43L 3WD5L 4RBPK 1AGCA 4KTDL 4ZS6C 2WINB 1HYSD 3QDGB 3WN5B 4XPGL 4F7PB 3RWIB 1FIEA 3MUGA 1IL1B 4U49A 3H9YA 3RGHA 4GW1A 25C8L 4IIQB 3VI3F 1E27B 5HD8D 1OP5H 5L0QC 1CF8L 5FHAH 2B5IC 1TCRA 5TFSH 3FO0L 1I7ZA 4GMSH 4X4YA 4AT6A 2YPLD 1VA9A 3FOMA 3QCUH 4E5XB 3SDCC 3MV9B 1DSFL 4OD3L 2H9GA 4OZ4B 4J3WA 3FQTB 5FV2A 3FRUA 4I18C 3PWNA 1LE9B 1NGXB 1FCCA 3NPSC 1KB9J 4PB9L 3V2AR 5AD0A 5A40E 2DI9A 1BZ9B 1TQBC 4M7LT 3EHBD 1EHNA 5J6HB 2J4WL 3SE3A 4LQFH 3EUUA 5I19H 4I3SL 2J6EA 3DARA 3RWFB 5T1LB 35C8H 4W6WB 4RZCB 4UNVA 3PWJA 1MQKL 1FNAA 4PTUB 3MR9B 4MXWH 3VGAB 4D9LL 1RMFH 1Z5LB 1FFPA 3CLFH 4HUMB 5D7SL 5LBSL 3EDFA 5SWSD 1IILE 2N4IA 4NC0B 1G7HA 1CLZH 3GIVB 1WCBA 1JGVL 1MCBA 1X44A 4WHDA 5DC0A 4XCNB 5BVJA 3QIWC 3D2UD 4TOYL 3ZL4L 1JHKL 1I8KA 4XXCA 1JGLL 3OR6B 2D0GA 3PHSA 4ZUVA 2F15A 3A67H 4FNLL 1K2DA 5C0BD 3F58L 1OGAA 5CGMA 2CIKB 2NY0B 4LIQL 1N7MH 3VXNB 3N85L 3RTQD 1VGKB 4W4OA 4WI9A 2OL3A 4NC2B 4WENB 2VLKA 5DJXA 4PRDB 3T0VA 4ELME 4R2GB 3X11A 2RHEA 4UOW0 3R0NA 3MNZB 3C8KA 3OMZA 3KPQB 1FYHB 5T33L 4D3CL 1K6QH 1G9ML 1A1MB 4LEXL 5DS8A 4NUGH 3VFNA 5FK9B 4RCAA 3DXAB 5EOCH 4Q74A 4PJIA 3ECBA 2NY1B 1LILA 3WEXA 1G9MC 4EBQL 3UX9B 1S5HA 2VL4A 5DQJA 2PO6C 3O45B 3IU3B 3UDWA 4NKMB 5IV2A 4PP2B 4LF3B 3OXSB 4QTIL 4P46D 1NCBL 5DQDL 2IF7A 2P24A 2AXFA 2FX9H 4MNQE 4RMWA 4I0PD 5DJ0B 4LP5A 4BKLA 4N0YL 1LDPH 1DDHA 3WUWA 2WBJD 5HGAA 3HAEG 3VD4A 2QQNL 3MJ6A 4BQ9A 3QHZL 4GG6A 3LRSA 3QUYD 1IQWH 1IC7H 2L7JA 3OKLA 1TVBB 4LGRB 4H5SB 4U6HA 4JHZA 4AIOA 4ELMB 1HDMA 3ARDC 3BKYH 3S8WA 5HYEA 4QNPF 1L0XA 3PV7A 2J8UF 1PZUB 4LCCC 1VKXA 3UZQA 3BXNA 4NKIH 1PSKH 2DJUA 4PGDB 1Z3GL 2AV1B 4ZSOE 1RUKH 3UC0H 3V6OA 2JF1A 3QUZB 2QKIB 2WIIB 2BVPB 4JY5L 1WBZA 3FB6B 5DVMA 3B9KD 1OTUC 3IFLH 4B7IA 2R0WL 1RZJH 3SKUD 2V2TB 3GI9H 2G5BB 5LKNA 1T1WB 3BVNA 4MNQB 3DIFA 4OCNC 1VACA 4PJ7F 3G5XA 2ORBH 1SYVA 3N1QC 4HC1A 4POZD 3BQUB 3GRWH 2OR7A 5AUMA 4PJ5A 3DTXA 3QIUA 3VFSB 4G6FD 1A5FL 3LZFH 3F5WB 3QWOB 4IDLA 4PRPE 1JHLL 4IRZL 3KLAB 3ARFD 5F6HI 4H26B 5FKAB 4NJ9L 1SY6A 1OPGL 3QUXA 1N8ZB 2VR9A 1DEEA 5E08L 4PR5B 2HWZH 3QO0A 5HHPA 1I7RB 3IFPB 3LIZH 3IU4L 4ZSOB 1QUNA 2XZAL 5MEND 2YN3A 5I17A 1E6JH 3TPKA 2VR5A 3BN3B 3T4AB 5JZ7D 3AU1B 3MXVH 4GO6B 3RY6C 1QPXA 1KSRA 1SMOA 1IM9D 4CADB 2FIKB 4N8CL 1RZ8B 1JV5B 2H8PA 2ZUSA 1FCGA 1MFDH 5CEZH 1B0GA 3Q6FB 4LLMB 3SBWA 3O6FA 3GSXA 1CBVH 4OLVH 3EDJA 2A74A 4JAMB 4D9RD 4X80H 3OXRB 4P48A 3CZFA 4HJJL 2WWKO 4WY7L 3FCTA 1OCWH 2GSGB 4K3JL 3T0BA 4IMKA 3RNQA 1NSNL 4GKSA 3TWCL 5T3XE 4PRPB 4NZTH 4LNRA 1C5DA 4L4VA 1JPFB 4LOUC 5FO8A 1CDCA 1CCZA 1CZ8L 2AEWA 3C5JB 1SEBB 3RVXC 3EOTH 2AQ1A 5KOVC 3T0XA 1MLCB 3BE1L 3BEWB 1F4WH 5TF1H 4PJ9D 4ZPVA 1P9MC 3ZE0F 4DGYH 5TE7H 1AGDB 2X4SA 5E5MB 4PG2C 2OP4H 3VFWA 2BSED 4I3RH 4O2CA 4LVHC 5FOBA 3QUML 4GAJL 2HJLB 2VQ1A 3MRFB 4X83A 5GRWA 2R1WA 1G7IA 1PDKA 2R15A 2EZ0C 5IMKA 3SQOL 4KKCD 4JQIL 1SBBA 4KROB 4JM2F 4RISL 1VESA 3B5GA 2UWEA 1UVQA 1L0YA 1UJ3B 3UMTA 8FABA 4QXGH 3F6LA 2Q8AH 5D7JA 4LPXA 1Q9OA 2YEZA 5C0ND 4DGVH 1S7SA 4FQ1H 2ED7A 4WEBL 4W81A 2YPVL 1RU9H 2CRZA 3EDDA 3TV3L 3U9PL 4WCYH 4U33A 1KXTB 5DFWH 3W2DL 3UJTH 3BKJL 2LVEA 3W11D 4HCRH 4G80B 3O0RH 1OSZA 1B6DA 3RKPA 1F90H 1KENH 3MJ7B 3RVVD 2OJZL 4G6KL 1VCAA 3UTZB 4N1EA 3V4PH 2YD7A 1KG0B 5FUOH 4CGTA 1F5WA 1B0RA 5HGGS 4Z7VA 4X9GA 1YY8B 4MAYC 4UINH 3ROLA 2X89A 2UZYB 3GKZA 3NIDE 3MRRB 4JDZA 4RAVB 1CLOH 1CXFA 3P30L 3GRWA 1HH6B 4M00A 4DCQB 3MOAL 1A3LL 4LFHG 4FXLA 3Q6GH 5J3HC 1ZWIB 5DUMH 3WIHL 2IFFL 2JIXD 3X3GL 3FFDB 4R26H 2UYLB 4NCC2 5FYKD 2E7BA 3HS0B 4U3XA 1OLLA 4Y1AE 5FYJD 4NOBA 1YMHB 3H0TA 4JN1H 2Q6WB 3FO1B 5FM5M 3MRPB 2V2XA 2X4OB 1N3NA 5BXFB 4TNWF 4PFEA 1K3IA 3UBXB 3K80A 4JJ5B 3V7MA 5EH1A 3B9VA 2IAMA 1S7RA 3WUZA 1A6ZB 4UUJA 7FABH 5ANMB 5D7IA 5HHME 3M45A 3MLRH 3OPZH 2HTKD 4G8GA 2X4TA 4PLNC 4Y5XC 1C16B 1MCWM 4NO5B 5I71B 3VI3E 4CL7A 3NA9H 3WL9A 1A6UL 4ZUUA 4JKMA 3RA7H 3TBTA 2VLJE 2ZUQC 4HMCA 4ORZC 1ZKAA 4LCIH 2Z0BA 3WE6A 1BAFL 1P6AB 4KQ4H 4J2XA 1YMME 4ELKA 4L4TA 1ES0A 3NH7H 4ZUWB 5DD5H 3BKCH 2IBZY 5HYFA 3EOAA 4PY8I 1HCVA 1A22B 1EMTL 3WFDL 4EI6A 1JFQH 1QTYT 5ICZA 1J10A 2X9XA 5B39B 1U8OB 2RFXB 4Y1AB 4DZBB 2PNDA 3NCBB 4LASL 3UYOD 4QO1A 5MHSE 1YEGH 5EZOH 1YUHB 1MI5D 1Q1JL 2YBRA 5L8LB 4M5YL 1IC4H 3FO9A 3HZVB 4ZFGH 4YDJA 1AQKL 2HTLD 1OT1A 5I1DB 3P4OB 3UJJH 4ZO8A 3GMPB 3OTTA 4FG6C 1OAYH 4HUUA 1U8HA 2VWEC 1RZ7L 3NACL 5HHMB 5C1MB 3DRQA 1U3HB 3ZYIA 4R3SA 2ITCA 2W9DH 4OGYL 4MJ2A 4IMLA 3VXRD 1KCRL 2FZ3A 4P5TD 1I7UA 3EDKA 1T5XA 4KJPD 4OV6F 4KUCD 2VLJB 4D8PB 2HLFC 4M1CD 3MRIA 3HNVH 4OF6A 3VWJB 4RAUA 3PP4L 4M7KH 1YMMB 3QR2A 5FO7A 4ZG1A 4X6CA 3Q1SL 1X4XA 4PRNB 3ULSB 1MFEL 1U93A 3HNSL 4YDIH 1XAUA 2WZPD 4QRPE 1SJVA 3CCHA 3VXUE 1ZE3C 2VUOA 4P2QD 1TLKA 2LE9A 3RL2A 1CGSL 2CGRL 1IE5A 1BIIA 4LRIA 5IESL 1IGTA 1G1CA 4HCRA 1K5NB 3OKEB 4OFPA 1ZANL 4PRHE 2X4NB 3C5ZA 3CFDB 4X7SH 2NY5L 5F9WC 4GUPB 1D5ZA 5E99L 5FCUL 4JO3H 4RGND 4JFQB 2BNRD 1G7MB 5I1LB 4YBLC 4JFFD 5F7NC 3D3VD 3KPLA 1MFBH 1AR1D 4N8VB 2YS4A 2NY5C 5DVKA 2R2HA 1U8NA 4HFWB 4PJ8D 5DHYB 4Z7QE 1BQSA 5TPWH 1JWUB 2Z4QB 1PG7H 4Y2DA 1JMXA 1IAOB 1E4WL 5A2FA 2KH2B 1Z6JT 3CX5K 3KPPB 3S35H 3T2NH 3EYVA 4AK1A 4MVBC 2DS4A 3DGGA 5MEPA 4Z78A 4JZNB 4H0GA 4OI9A 1C12B 4LCYA 1TZHB 3EO9L 2Q8BH 1KPUA 1Z0MA 3IDIB 4QRPB 5JDSA 3VXUB 2BP3A 5AEAA 2EDRA 4ZS7H 1DBBH 5DVNA 3MA7A 3NCMA 1N6QH 4L3EE 4URTB 4BFBD 3WDHA 1QVOB 2OTWB 3PP3H 4PRHB 3FN3A 4QNPE 4F2MA 1QYGH 4IRSA 1RZIA 2DWEB 5DJCB 2J8UE 4RNRB 3QXWA 1U2CA 2D31B 1KIRA 2IQAB 1F4AA 4YXLL 5IBTL 3NZHL 1GL4B 1PEZA 5GGTL 1V5JA 3HFMH 4G9DA 3R4DA 5KSBF 2YD5A 4J8RB 5AYUL 4A6YB 1X5KA 3FQXB 2GQHA 3MLXH 4Z7WE 3S34L 3WIIH 3HC0A 3U30C 4UNUA 1GGIL 4NWTH 4ZDHB 2E8YA 1T21A 2R39A 4JLRB 2COQA 4L9DA 5FGCE 5MEQB 2DQTH 2HRLA 1BVZA 3LPGA 3KR3H 1S78D 4ZQKB 43CAA 1GZPB 1LVEA 1GVIA 4YFEA 4G5ZH 3U9UB 4P4KA 1QNZH 3CXHK 3RWEB 1MEXH 1VEMA 4L3EB 3PWUB 3M17B 1GCFA 2DQHL 4OF3A 2PF6A 3SDXA 4X0KA 3WNKA 1T04B 4YHNA 2EDFA 4R0LA 4DN4H 3VFVB 3X12B 1MF2H 2ADJB 2J8UB 1IKFL 4ZNCD 4YHYB 3LRHA 2XTJD 2CKBH 1K3ZA 3MV7E 4U1SA 1IAIL 6FABH 4GH7B 5HI4D 3IXTB 1H3WM 4AYFA 4YXKL 4YE4L 1ZGLA 3BIKB 3S9DB 1YNLL 1LP9F 3W82A 2CDGA 1NC4A 2A83B 4Z7WB 1I7TB 3QEGL 4KK9C 3NFSL 1KCKA 4HIEB 4PBXA 3LKQA 2QHRL 5FGCB 3D39A 2DQEH 3OR7B 5DUBB 2BMKA 3LQMA 2F8VA 2ZNWA 1JUFA 1DZBA 4FABH 2QSTA 3BPCA 4LSQH 3EZ8A 3VH8G 3GM8A 5FDWB 4N9GB 4L5FH 4OFDA 2IH3A 5DGRA 1KCVL 5ALBH 4E0RB 4GRWF 4JFPA 5ESVA 2DM4A 4BSVA 5C8JA 2UVFA 1EHLH 3PWLA 1DQDL 2IEPA 3ZE0E 1G7QA 2MKWA 1P6FA 5ETUB 4H88H 3C08L 4KRLB 4ERSL 3MV7B 2ZUYA 4JCMA 1DQMH 1T83C 2IAND 4MD4A 3FQNA 3SDYH 1BIHA 1DLHA 4M03A 3SJVD 5E7BA 3S35X 5I9QC 4YIQB 4XVJL 1U91B 4XNYH 1MRFH 5DURD 4O2EB 1TDQA 2ICWB 4K9EH 5DI8A 3A6CH 1A7PL 5EBMA 3MUZ1 3RIFF 4YBQC 3DRTB 1CG9A 2IBBA 4Q0XH 4JKPL 2WBWB 4NGHH 1ZVSB 4LHUA 4WI4A 4NN7C 2F54A 4LSUL 5C07D 4M7JL 4PRBB 3WFCL 1S8DA 3B5TA 4LSPH 3BYYA 2YUZA 1T6WA 3OKDA 2LV4A 4MS8C 4P2OC 2V2WA 1HEZB 1UJTA 3S37X 4NO3B 1J5OL 1S9XB 1S9YB 3TVMD 1AGFB 1FNGA 3W39B 4YHPB 4LPWA 1URLA 5KSAC 5IMLA 3KG5A 5JR1H 3RL1A 4X6FA 1EFXD 2VXSH 4CVXB 1P5VA 4JRYE 2EDKA 4OTXH 4Y4KA 4TVPE 3TN0B 3P9LB 2QADD 3CPLB 4PGJA 3O3DA 4LPTA 4NQDE 4PD4K 2APXA 3D1MC 1RZKL 5B4MD 1X5IA 3H9ZA 4JM2B 5C0CD 1EZVX 3I84A 1G9NL 4OUUB 4G7YH 4JO4L 1RZKC 3LQAL 5DTFB 5IJKC 3LQAC 3SE8H 4XCEA 4HHAA 3C9NA 1EO7A 4OKDA 4C4KO 1NGPH 5DRXB 4X6BB 1CK0H 5DJ8A 3FN0H 4XVSH 4M6MH 5H35A 5E9DA 4KMQA 4WW2C 3MODH 4G42A 3KGRA 1H9VA 4NRZB 4P23C 4BJLA 2ICCA 1FAIL 2MHAB 5E8OA 1ITBB 3WKML 3QEUA 5I1EH 3RKDD 4OZHF 3LN4A 5KAQF 1IEHA 4XTRD 1IFHH 2B1HL 2J5LC 1AKJB 3S36X 5A1AA 2B8OT 1R3HB 3QEQA 4NQDB 1K4CA 3MRHB 4U0RB 4KHTL 5DEFA 1L7IL 4U1LA 1NMCB 3KWWA 4Y4FB 1QFOA 3GBNH 1XGYH 5D7LA 3EGSA 2VXUL 4Y19E 4X4ZA 3SHSA 4HWZA 2D03H 3LKSA 4U1NA 1X7QB 2CQVA 2AW2A 1WITA 2JK5A 4JG0H 4PPTA 1FVCA 4ZUSB 1CT8B 3BUYA 3IXAB 2PW2B 5KZCD 2FH6A 2HJKA 4OJFL 3TH3T 4A6YL 5F7MC 1NH6A 4JHWL 1JF6A 3CVHL 2D7TH 4HXAH 5E0QA 4XBPB 5A3ID 3SCMB 3O9WA 2P43B 1J1PH 2ARJQ 4QOKD 1D5BB 4HS6A 4X8JA 3FT2B 3IKCB 3O3AB 3U0WL 5GPRA 1N5AA 1RIVH 4KHXH 5LGHH 4YEEA 4P5MB 1E28A 1WZLA 4WO4C 1S9VB 3MLWH 3CSYA 2VDOH 3BFOA 1WBXB 1A2YB 2ZWLT 3ULUF 1XGTA 3MNVA 1P69B 5IIEB 2QEJA 2VDMH 1AIFA 2BSSA 2ICWJ 3QUKA 1OP3K 4Y19B 4BYHA 3VXMD 3QFJA 2VDLL 4NCC1 1WICA 3G6AA 2YMXL 3ZTJG 2EYTA 4NNPL 4NKQB 3TO4A 2E9WA 4NO2A 3FRUB 3S4SB 4G6MH 3LPWA 3M1BA 3P9MB 4PJ7A 3F6IA 1Z9LA 4PRIE 3ZKXB 3OF6A 3PL6B 1NCAL 2CIIA 4TUOB 1TZGH 2NNAB 5I1JL 1FZJA 5IOPA 4PJDF 5F3BA 5D1QB 3IJSB 3WO4C 2BVTA 4LHQB 5HGHB 4GAGL 3ARGA 3RHWK 4Q2ZB 1BOYA 1RVFH 1WISA 5GS1A 1BFTA 5TGBB 4BSWA 1MFNA 2VABB 4J7RA 4HX1A 2FR4B 1C5CL 2R2BA 1DVFB 4QT5A 1EXUB 3U4EB 1QFWM 4W70A 1NBVL 4UAOB 1EIBA 2XG5A 4AG4H 4QRTA 3VCLA 1T1ZB 1U8QB 1P7QD 3O4LD 1QEWA 2XKUA 2XKNA 4HW6A 5DO2D 1FSKC 3RVUD 1BQHA 1KJVB 4HWEL 1DLFL 2F8OA 3CLEH 1KFAL 3QFDA 1BFSA 4G43A 4PRIB 1P1ZB 1LO2H 3I6LE 5FA4A 4HWBL 1FGNL 4YHKL 5FO9A 1TQCC 1EO8H 4NN6B 4XPFH 3AM8A 3TZVD 2VC2H 2XNAA 3MLZL 3H9SE 1LO5A 1SJHA 5J6GB 3CK0L 3HG1D 4JRXE 5SX4I 3KYNA 3OJDB 3H7BB 3HE7D 4TSCH 2OQJB 3RBSA 3RGVC 5DD1L 4JFED 4OBRA 1RK0B 4ODBD 2X4PA 1T0NB 1INDH 4Q6YA 1WZMA 4K2UL 3PJSA 1ERNA 4OLEA 4JANB 1KPRA 1WT5C 1F8TL 4JQVC 1YN7B 1NFKA 3C6LC 3C87A 1J1OH 4DK3A 5HYJA 1MCLA 1T0MA 4HZLA 5HVGB 1JPGA 1NBZA 1ZMYA 3L7FB 4HIHB 4BQCA 5D1ZD 1JGEA 5B21A 5BS0A 3BO8B 3EZJB 4XHQA 3X13B 4ENEC 3GHEH 5D2NA 1KLUA 4OQTA 4RGOH 4CVUA 1MWAH 2EXWC 5KS9E 3H9SB 3OKYA 5DUPH 5GS2D 2MFNA 1A7OH 4DVBB 1JWMA 1VADA 4WWKD 5GJTH 4HPOH 1YEDA 5TE4L 2CO6B 3DMMB 2R69L 4ZD3H 3QA3B 4JRXB 4JKKA 4DZ8B 1FFNB 2W9LA 4KQ3H 2ZSVA 4AENB 2IC2A 3WLWC 4IRJD 2VITB 1KXVC 1EGJA 4MMXC 3TO2A 4ZXBB 1LP9E 4ONHB 1LMKA 1YQVH 5HI3D 2FATL 4OCYL 3QNZB 1KJ3H 2R2EB 5CILH 1SYVB 1FFRA 1NL0L 2DQJH 3DLQR 2F53A 4WI8A 4YHIA 3LDBC 1W72H 3G5ZB 3IT8D 1A6VH 5C08D 4MD0B 4BUGA 2HLAB 3KNBB 5IEHB 1U8IA 4YGVB 3RWCA 3WNMA 1NUDA 4GRWE 3MSPA 3OKMA 5JHLL 5GGUB 4S10A 4XMLL 5EOTA 2VKWA 4NQED 2P7TA 1R3LA 5KS9B 1GGBH 4EIGB 4R96A 1D5MA 2AK4A 4GRLB 4ONGH 2YSSB 1MLBB 1OAZH 3AAZA 4PJGF 4Z77A 4EUPH 1NJ9B 2H3NA 4V1DD 5J12B 3KPNA 4L1HA 3PGDB 1YJDC 4M48H 4Y5VB 1DQQA 1F6FB 2I9LA 5F88A 1LP9B 3O3BB 2P8LA 2ATKA 4Q9RL 4XC3H 3RWGB 3R8QA 4B5EA 4UV7L 3GGWB 4X98B 1B88A 4ODWA 4P2RE 2AJUL 4XP1H 4KUZH 1XCTA 1T03L 1G6RH 1YEHL 1WWWX 4OLZL 4Q97A 1NANI 5DRWA 2YUWA 1T2QH 4LCUB 3IDXL 1MRCL 4GRWB 4I5BB 4RWYL 4HS3B 3MUHL 5C0RH 1A7BA 4HJGA 1A14H 1YEFL 1XR8A 2NY2C 5GHWH 4QKXB 2XFXA 4MD5B 5IMOB 3KAAA 3DURB 5CGYD 3AS1A 1EEUA 1XF5B 5E8DL 1Y18A 5A43C 2IMNA 4QRQB 1YEJL 5TE6L 2BZDA 4X4XB 1PY4A 5I2IB 1FBIL 2EO9A 4MWFB 3V6ZA 5C2BL 5JOPE 5JQ6L 5C6TH 4BZ2H 3DVNA 5AZEH 3BPNC 4P2RB 1KB5H 3VWKB 4N1CA 4JFDA 3PQYD 4FFWC 3WUWG 1SM3L 4ZAKC 1RIHH 2IPUK 4MJIE 4Z95L 1UGNA 5IQ9A 2J6EL 1M7IB 4OLUL 3CZJA 3SE3C 1A21A 1A8JH 4NOFA 1OAQL 1EVTC 5DEGA 4NN5C 3GSWB 1GPOH 2CLZA 1NMAL 1MWAA 1SJXA 3GSRA 1ZEAL 2H2SC 3IVKA 4PREA 5D6CA 5C0FA 4X9FA 1J7VR 2D4FA 4JQXA 5HDOA 4NBZB 2C1OB 5L2KA 4F7TA 3H2WA 1ACYH 1HXYB 4NNXA 4OGAD 5E8NA 3DUUA 1FZOB 4C56E 1WZ1H 1CD0A 4ETQB 3GUTA 4PB0H 2R0LH 2B0SH 4XXCC 2EDQA 4OT1H 5GSVB 1QSED 4FTVA 3MNWA 4OM1L 5HHOA 4W4OC 3LKRB 1EJ6A 2NY4B 1A3QA 2Q3AA 1W72A 2CLRB 3JV6B 5FGSA 4MJIB 4JDVA 5C0IA 3MXWH 3M8OH 3LVEA 4K7PH 5CD5D 3ME0A 5BRZD 1MUJB 4YFLF 4LVOC 1LD9B 4LDOB 3VGBA 4LLQA 4FXGA 3OSKA 3CFBA 1P2CA 1RUPL 1I1AD 4OZFA 4UI2A 3TPUA 3PWPD 1L7TL 3DV6B 3C60B 2DYPA 4L29A 4WFHD 5IP4A 1D6EB 1F4YH 1QSFA 2AJYH 3F7YA 3PIQB 1NGZB 4TPRH 4QXTA 4U1GB 3T3PF 5EUOA 4EUPA 4MA7L 4JVPA 4N1HB 3ETBF 4C56B 4XAKE 3L7EB 3VGGA 5F7YC 4F8QA 5K9KB 4H0IA 4OZHB 1LEIA 2ZZUT 5DJDA 3P0YH 2R29H 1NC2B 3ZO0A 1S7TB 3MGOB 2Y6SD 1DBKL 3CXDL 4FXKA 4OSUH 3WL9B 5C09A 4TTGA 1QRNE 1Z0NA 2F9BT 2ARJA 4AM0B 4X5WA 1G6RA 1Q8MA 3T65B 1QA9B 5KSBA 4R8WH 5EA0H 1KBGL 4HFUH 3LD8C 2R2CA 3FO2A 1EFQA 2UZIH 4W6YB 5F89B 5BVPH 3CDFA 2GAZB 4LPCA 5F93C 5IB4A 4V2CB 1PQZA 3D0LB 1K4DB 4WW1B 5CIPB 2BY0A 4OIBA 3DX9B 5FHAL 3V6OC 4ONFH 1F02I 5IFAH 4GW4B 2VUYA 5TFSL 5GGVH 5KVFH 3GMLB 5E6IA 1D9KD 3K1KC 4GMSL 5ADOH 3ARBA 5JXED 3QCUL 2VZSA 3B3IA 4EDWL 3D0VA 1RJZB 3HZKB 5SWZD 4P3CH 2DICA 3BDXA 5BJTA 2F8XC 1WAAE 5IT2H 5C92A 1ZA3A 3BP7A 3SGEH 4PJHA 3MRNA 3STLA 3VXPB 3QIUC 1XGUA 3W0WE 3HCVA 1XR9A 3L3JA 1ED3B 2CR6A 4LEOA 1CFNA 1IT9H 2IALB 5HY9B 1HHKA 3QXAA 2Z31A 3REVA 1QRNB 1T1YB 5D2LF 4D9QD 2DDQH 3ZDXF 4YEFA 3MRBA 3EJZC 3RVTD 2BNQE 5I19L 3T09A 1S7UB 4JN2B 3QUXC 3QISA 1HQRA 4GS7C 1ZT1B 5I1GH 3BGMA 4PJAA 1FNEB 4MXWL 3ARED 1FLRL 3AC0A 3QQ9C 1RMFL 2XYCA 1NGQH 1WEJH 3CCHB 4JZJA 1CD8A 1NBQA 1DP0A 4HUXA 5JNYB 4N0UE 4ZOAA 4LSTH 1CLZL 3LKPA 5DK3A 1MIMH 3D85A 3BIBX 2ITDB 2YRZA 3QNXA 1KIPA 2QQLH 5T3ZE 3QO1B 3QI9A 2Q7YA 3SBWC 2R8SH 4GQ9H 3A67L 3SDDB 2VXTH 3JTSB 4FQQA 4RMSA 3HE6B 1TFHA 1N7ML 4XWGH 4N0FB 4APQD 1HXMA 3BP4A 4FQIH 5CJXA 3W0WB 1AQDB 1M05B 4HXBH 5E8PA 3TYGH 4XPHH 2CUMA 4IMKC 3RPIB 3OHXB 3FQUA 3SY0B 1K6QL 2HKHH 2ZJSH 2CRYA 4RAHA 5FCSH 4NUGL 1QQDB 2ARWA 1UWEH 2BNQB 2XXMB 3RZCD 5EOCL 2EIDA 1MCFA 2VXVH 3L5IA 4K7PX 3MUJA 4LCYB 1QLEH 2XI9A 1ZT4A 2RGSA 2L7UA 3EO0A 4N0UB 1A9EA 1KN4H 2CXKA 2I60H 3TNMA 3WJJA 3S88H 5ICYA 1KLGB 3GZKA 2FX9L 4GBXA 4HIIA 1LDPL 3BMVA 3QBTB 4QF1B 4HH8A 1ZHBA 5EZJB 1BEYH 4TSBH 5HGDB 2PTTA 4RFEB 5FUZH 3HN3A 1S7QA 4O2FA 4NKDB 4K7FA 1R3KA 3RDTA 4YK4C 1MCSA 5ITFA 1IQWL 1IC7L 2PYEE 3ZKSD 3NCYP 4BM7A 5D7JC 3FQWB 3BKYL 4X7FC 2AI0H 3G08B 3QIBD 3BJ91 4PRAA 2IBGA 4AIZA 4F37K 2NW2B 1U3ZA 1PSKL 3THMH 1RUKL 1MVFA 2YZ8A 2AXGB 4PGEB 3SGJA 1T5WB 4O51B 3SGKA 3QDGD 2QSVA 5DK2A 4I9WE 3IFLL 4R97B 2VOTA 1RZJL 3L1OH 3MBEA 1NQBA 3GI9L 1CDJA 3HLAB 4GAYB 2JJTA 4S0TD 3GEWB 1RZJC 2DF3A 2XQYG 3ZYZA 2ORBL 3H42H 3IRPX 4EN3A 3O3EA 1FZMA 4NO0A 3L3HB 5CUSH 3GRWL 5HHXH 3LQZA 1EHXA 3IFOA 4F7MB 3MV9D 4XVTH 4L8SB 1ZHNA 3OGOE 3LZFL 3ULVH 4G6AC 2EKJA 2J2ZA 3V9FA 3IDMB 3I02B 3PG2A 4YO0B 2PYEB 5HHQA 1N2RB 4L3AA 1PYWB 3FT4A 4UQ2B 2MCPH 3RUGE 1W0VA 2HWZL 2AK1H 4WFEE 2YWYA 3KDMB 1E4XI 3LIZL 2XY1A 5EBLB 3OB0H 1E6JL 3DX7A 1XIWA 1CLCA 3MXVL 4TQEH 3K4AA 5DMIH 4X8XA 2ICEB 5IROA 3QQ4B 5T1LD 2QSCH 4QRRA 4FZ8L 1SEQH 1M4KA 2W0FB 3IB4A 1ROWA 1MFDL 5CEZL 2F54E 4OM0H 5FYLE 4XBEH 1CBVL 2IAMC 3OJ2C 4OF7A 4OLVL 4QHUB 1PGRB 4X80L 3ZMRA 1WBYB 2FNBA 2FBOJ 4EVNA 1GGTA 3VJ6B 5T1DH 3BH9A 4YR6B 3WHXA 2GJ6E 1HI6B 2MQ3A 2P48B 1PKQA 1OCWL 2ESVE 4U1KA 5IB1A 4L1DA 4NZTL 4C59B 4NM4L 4NNYA 3FO0H 4B0MM 1BJ1H 1U95B 3SDAA 2GCYB 4BZ1H 1JNHA 5DJZB 3EOTL 1MH5A 4Y4HB 4R2GD 3JVGA 4OD3H 1F4WL 2AV7A 5TF1L 3RUGB 4DGYL 5TE7L 2G75A 2OP4L 1WWBX 4U1MB 5EG6C 3UAJD 3ES6A 5D70H 5ISZE 4U6XB 1K8DB 1R0AH 2NY1D 1R5WB 3IDNA 1OVZA 3O41A 3EO1B 2FWOB 4G9FE 4QRSA 3N1MC 3QAZB 3SO5A 4HMEA 5C71A 1IM9B 1MQKH 4QHKJ 5BO1H 3RU8H 1L4IA 3LB6D 2ADGB 4QXGL 2Q8AL 2GJ6B 1T20B 4Y88A 4J1UB 1HSAB 2ESVB 5FF6A 4U3CA 4DGVL 3E6FB 3I6GA 3HI1A 4FQ1L 3GMRB 2DMKA 3VMNA 3U46A 1RU9L 2ZKHH 3VXQA 2A0LD 1A6TA 2H26B 2GEEA 3TEUA 4WCYL 3FB7B 4PJDA 3UJTL 4HCRL 3GSQB 4K55A 1GGUA 4U0QB 3O0RL 1FN4A 3REWA 5D1XB 4WI6A 4YHZH 1F90L 1EAPB 1KENL 4FFZH 1T7ZA 4LRIC 5ISZB 1QG3A 3V4PL 3BWUC 2YPLA 2HVJB 5FUOL 1UH3A 3QUZD 3EJYD 1AGEB 3BYTA 3GKWH 3CFJB 4E41E 3C5ZC 5LVEA 4UINL 1I9JH 5H94B 2VLLA 2ZCKH 4KXZH 4PBWD 5C6WH 3K74B 5F7DA 4ISVB 3TBVA 2HA1A 4G9FB 1ZHKA 1CLOL 4MNQD 3WIFB 3QJHB 5EPMA 4JB9H 4QCIB 3BQUD 3C8HA 1O7VA 1BM3H 3BESR 4Y2DC 3Q6GL 5DJ6B 5DUML 4F15C 4A2LA 5ICXA 3V5KA 2CKBB 4ZUTA 1OQOA 3MV8E 1CFVL 3CH1A 2XRAH 5J56B 4EKXA 5I1CH 2HRPL 4UQ3A 3T0AA 4P4RA 4IJ3C 1IGMH 4JN1L 2XZQH 3OKNA 5KJRL 3MRQB 3IDGA 3QHZH 5SWSA 4KROC 1ORQB 4L8BB 5EU4B 3EYOA 3I6KB 3U2SB 3S96B 4WTZA 2W1NA 1CICB 4P9ML 1MELA 1OOAA 4PTTA 3D2UA 4LCWA 3QQ3B 1MNUL 7FABL 4NHUB 4E41B 3SPVA 5C0BA 3MLRL 3Q2CA 3OPZL 5EFIB 3U36A 4IRSC 1GHFH 2NTFA 3RTQA 3NA9L 1C5BL 2BSTA 2A38A 3RA7L 1IEBB 3L95A 2DMCA 3RNKA 4LCIL 5CAYB 1DN2A 3DROB 4KQ4L 4WNQA 4WU7A 3GSUA 3SDCA 3U0PB 3U83A 3NH7L 3CFKA 5DD5L 1YN6B 3ROOB 3BKCL 3MV8B 4Z7NE 2V7NA 2B4CH 4YZFF 1ZLSH 1XF2B 2VLRE 5FKPB 5LGJB 3N50A 1IGIH 2FECI 1JFQL 3HPJB 1ZLUH 5CP7B 1CTOA 4DFHA 4KJYA 1YEGL 2IMMA 1A5FH 4NDMA 4ODUB 5EZOL 1FVEA 4MXVF 4P46A 5I1AB 5IB2A 4P4KC 4I4WA 4HG4K 3RIAK 1H3PH 2YKLH 4I0PA 1IC4L 2GJZB 3LSOA 4ZFGL 2VISA 2EDHA 2WBJA 2ENSA 3MRKB 4S11A 3UJJL 4YPJA 1OAYL 4GKNB 5E08H 1RULH 4R0LC 5EC2B 3N0PB 5SV4A 1I8IB 3QUYA 2W9DL 4LHUG 4WHTA 5JHDE 4HH9A 2V17H 4LLYA 5JLZA 2BOBA 2HT4D 1A1NA 2ZCLH 3BOVA 4RQQB 2OX5A 5DEFB 5T1MB 3HNVL 4OCXL 2C1PA 4M7KL 3EFFA 3QIWA 4NRYB 4KKNA 5IHZB 3B4NA 2X4QA 4HF5H 1CGUA 4YDIL 3C6SB 5A16A 2HFEB 1MJJA 5T3XD 5CJ5A 1QZ1A 4G8IB 1TZIA 3VA6A 2VLRB 3PDOB 1P4LA 2XWBB 2UY7A 3B9KA 1FJ1B 1YEIH 1PZ5B 4Y2OA 4B50A 3OAYK 4XI5C 3QULA 1T80A 5D72H 3NTCH 4Z5RB 4X7SL 5IBUG 4B7LA 4PJGA 3EOBA 4QTHA 4JO3L 3EYFA 1YEKH 5BV7H 1MFBL 3LKOA 2X7LB 1TIUA 3ELAT 5ACZA 2ZSWA 4CW1A 1F3DH 3OB8A 1JF5A 4BA8A 5L88H 1ORSA 2KKQA 4E9LA 2VDPH 5JHDB 2PO6A 5TPWL 1CFTA 1PG7L 2GFBA 1FDLH 1HZHH 1VHPA 2R1XB 3ARWA 4RGNE 3ARFA 5J4MA 5I73B 1U8LA 4GAJH 3NCJH 5GGRY 4YNYA 3S35L 3T2NL 5I66A 4HAGA 4ZFOA 5KSUB 2NY6B 1YYLL 4UBDD 1CN4A 3VXRB 1HK6A 2EDEA 4X4ME 2XQBH 2QLVB 2Q8BL 5H37G 3UPRA 1OGTA 5MENA 1ZHLA 1CXLA 2GK0A 2CO7B 4OFYD 2ZOLA 1XCQB 1FO0B 1KN2H 2Z93B 4FRWA 4ZS7L 4DGIH 1DBBL 3KYMA 3QYCA 4PJCA 1SJEA 3E2HB 3B5HA 3ARDA 3FTGB 2HN7A 1QYGL 4M93B 3L3KB 4LCCA 1I4FA 4P5KB 5CFHA 3HRZB 4I3GA 2JLLA 3PGCA 5HYQB 1CQYA 2E6JA 3HFML 3KPTA 3DBXB 5DQ9B 3GSNH 4MNHB 1I8LA 4PLOB 2DQFB 4XMKH 2M1KA 4RGNB 4TSAH 3MLXL 1NDMA 4XH2A 3WIIL 3KLDA 3LAFA 4NWTL 3FN9A 4PJ8B 3WHE0 2DQTL 4Y4KC 4PJ9A 3VFOB 1IAKA 1R5IA 3T0EE 1ACZA 4JPIA 1N0LA 4G5ZL 3MCKB 1W8NA 4OBSA 3BRGC 1QNZL 1X3DA 1MCHA 3MOAH 1MEXL 2C3VA 3UTTD 4PUBL 4Y1AD 1S7VB 1FL6A 5FA3B 1HWHB 3NFPA 1DQJB 2NXYC 3LHPH 2FO4A 1R24A 2ADIA 4OZIA 4DN4L 3UTPE 5IBLD 1MF2L 1KNOB 4MGXA 4X99A 3FB8B 4J3UA 3OGCB 4K71C 2BVEA 1FZKA 2CKBL 4X5XB 2I9TA 1M1SA 5HHMD 2GITB 6FABL 4YFDB 1U3HD 4WEMB 3HZYB 4ZODA 4NC1C 2VLJD 4FQHB 1GRWA 1QLRB 2EE2A 5DMGC 1XH3B 4PP1D 5HPMB 3VWJD 2HH0L 1YMMD 2DQEL 1UB5B 4NKOB 2Y5TB 4DEPC 3T0EB 4FABL 2GKIA 4JFXA 2VZ1A 3WNNA 2E7HA 4LSQL 3U0TB 1OD9A 5EO1B 4L5FL 4KJWC 5IWLA 3L3IB 4LARL 4RIRA 5ALBL 4XCYB 4Z6AT 5T1KB 4C58B 3L9RB 4AZ8A 5KG9A 5MHSD 4P0DA 4WGVB 2V6HA 1CL7H 1ND0A 4AQ1B 4Z7UF 1ZA6A 4N0RA 1EHLL 2R4SH 4JG1H 1EV2E 4LLWB 1OF2A 5BW7A 2R1YA 3QQNA 1ZS8B 4H88L 3E6HB 1H8OA 3J7HA 4HUVB 1DQML 5DD3L 4NBYB 3O9WC 3RWHA 3SDYL 2CMRH 2JIXA 1BQHG 4K3EH 5CJOH 5INDA 4Q7DA 4U1HB 1KJMA 1KIQA 1VFBA 1HINH 2OTUB 1QLFB 3DV4B 3CC5A 1MRFL 1G1YA 3W5MA 1Z9MA 4YDLC 4LLUA 4K9EL 2IANE 4LKCA 3A6CL 3INUH 3V0WH 2VZ3A 3QWQB 3MRLB 1KGCE 3UTSE 2W65B 4Q0XL 3G6JA 4NGHL 1HHIA 5HDQH 2EYSB 3VXUD 3ZTNH 4MJ4A 5C0AE 5CLWA 1U41A 3X3FH 2H6PA 4LSPL 5ESAA 1XF4A 1NBYA 3IETB 3MRJA 1RQ5A 1J9CT 3MJ8B 4NYLA 2X10A 1KTKE 2CLVA 4PRHD 1C7TA 3BP5A 1LK3H 3TO4C 1FYTE 5I74C 2YUVA 4XNMB 3HB3C 5FM5O 5LG1A 5LCVH 1BQLH 2APFA 2CGRH 5K9QI 5JR1L 1H5BB 3WXVH 1CD1B 2VXSL 2AXHA 4KI5C 1MCOH 3TH4T 4OTXL 3RRQA 2NY5H 3CAFA 1RHHB 5HDLA 5JIHA 5D2LA 3ARGC 5GS1C 2BSRA 4L8DA 2IANB 4WV1A 5BQ7B 3NIFF 1MI5A 2BY3A 4G7YL 4YPGB 3UTSB 1I9EA 4PJXF 1QBBA 3MFFA 5MP6H 2AJ3B 5C0AB 2X09A 4AEFA 3SE8L 4IOFC 5E8NB 4XXDA 1NGPL 4OKVA 4L3ED 5SWQA 3RVWC 2HP4A 4HKXA 1CK0L 2RCSL 4OB5H 1EBAA 4M3KB 3FN0L 4XVSL 4Z76B 4P5TA 3IDYC 4M6ML 1FYTB 5C0GB 4F57H 4OCLC 3MLYH 4JPKH 2OJEB 3P4NA 2C3XA 3MODL 5C09E 3GMQB 5DC9B 2DM2A 4U4BA 3VFRA 2EE9A 2V7HB 4NSKA 3HPLB 3AM8C 4IOSD 1IFHL 4LGPB 4WGWB 4UIKH 4LMQE 4M62H 5IB3B 4P2QA 3D48R 1SMAA 3LN9A 1JIBA 1IGFH 4FA8A 1EFXB 3GBNL 3ILQC 1XGYL 2X05A 3OAZH 4XPTH 3TJHD 1U6AH 2DYPB 3RHWF 5DJAA 2BJMH 2D03L 4LVEA 3HZMB 3GSOB 2DQDH 4JG0L 4GG8A 1YQ2A 1GGIH 1HH9B 2H45A 3D3VA 3OX8B 1LEKB 2EH7H 4YZFE 4LRNH 1S9WA 4UT6H 2HVKA 3LKNA 4LLDA 5EDXA 5IW1A 2C26A 1CDYA 2D7TL 4HXAL 2VDKL 5I1HH 1RJLA 5BZWA 1BFOB 1J1PL 1XGPA 4K8RD 4MCYB 4MXVE 4AEHH 2W92A 2JB5H 2FJHA 3V4UH 1A7NH 2ARJB 1LO4H 1W0WA 3X14A 4BZYA 4PYGA 1RIVL 4KHXL 3MV7D 2FO1A 1MCQA 1EEZB 5LGHL 4I2XE 5D2NC 2C7UA 5I76B 2A6IA 4BFIA 2P8PB 3MLWL 2VDOL 4JY4A 3V0VA 3G04A 3ZLQC 2Z91B 3NOIA 3TIDB 5E1HB 4KJQD 1MPAL 3GJFH 1BVLB 1J8HD 1I8MA 4QHMB 5CEXA 3FFCE 3FKUS 2SEBB 1I3RB 1D7FA 1YNLH 4XHJC 4LNVA 5ERWB 1LO3H 4PY7A 3N9GH 3IS0X 4PV9B 4DJMA 1J88A 3T3MF 1LK2B 4G6ML 3AMKA 3BKMH 1QSZA 2HJFB 5D5MF 3JV4A 2I27N 2FJFB 2WV3A 5ESQB 1Q38A 5HTSA 1PG7W 3HCVB 3C6LD 3C09B 3IAGC 1TZGL 2Z92B 4Y4FC 1KB5B 3TCLB 3IJYA 2C3WA 4P2CG 3UEZA 4NQSB 1RVFL 1AD9B 4I2XB 2YD3A 1OP5K 4IOIB 2LTQB 4DKEH 2M26A 1P7KA 3FRPA 3TN0D 2N7BA 5K59F 5DVLA 3HUJF 1BQUA 2VE6A 5EO0A 3BHBB 3I3EA 4R4BB 3C08H 3D18B 3AS2A 2JJVA 4JM2D 3WMSA 2FX7H 4AG4L 1SYSB 5GZND 3D85B 5IF0B 3FFCB 1JYNA 3S3PA 3TA3B 5DEZA 3KVQA 3SO3B 5DD0H 4XVJH 4NBXB 2A73B 4U1JA 2APWA 1J0JA 4ODXA 4EI5D 1UXWA 3CLEL 2IPKA 1LNUA 2JCCA 1A7PH 1UH2A 3BDBA 1KJ2H 5DMKB 1HXMB 5E24E 1LO2L 5JO5A 1JPSH 1PLGH 1NAKH 2DIBA 1RK1B 5DA0B 4CJ0A 1EO8L 4XPFL 2CK0H 2VC2L 3H9HB 2ATPB 3JSSA 2IGFH 5B8CA 3MROB 1U8MB 5DRNA 2R9HD 1ZT7B 4DOHE 2BVYA 5B3NA 3ZE1E 3MRGA 4JRYD 1LEGB 4TSCL 1RZGA 5I16B 2AEQH 4TVPD 3AXLB 5C0JB 1RV6X 5E03A 4LVNC 5CHNB 5MERA 2YPKA 4NQDD 4LAQH 4KVCH 1INDL 4QWWC 3T2OA 4JZOB 4KRPC 2DLHA 4L9LB 4OZFG 4TN9A 1FG9C 4HSQA 1WF5A 3NGBC 4S2SA 3VE0B 1VFMA 3FONA 3DX8A 3GHBH 4KI1A 4HDIB 1J1OL 1N64H 2FEEL 2IPTH 5TH2A 5JORA 4EUPG 3TCXA 4D0DB 5EU6E 5K9OB 4MJ5A 4JO4H 5IKCB 2XN9D 4KK8D 2F19H 2BC4B 2X5PA 3GHEL 3SJVA 4PJBF 5F1IA 2CDFA 4RGOL 1MWAL 1RUQH 1OT2A 5DUPL 1A7OL 2DWDB 1VFAA 5E6YA 5GJTL 4DOHB 1F6AB 4HPOL 3DETC 4ZD3L 3VG9B 5A2LH 3QWRA 4KQ3L 5E1AB 3QJFA 3QDAA 5C07A 3QDJE 4QHLA 4GW5A 4FQJH 3O8XB 4JQXC 3VXTB 5K9QG 3UCRA 2NY2D 2RR3A 3GJFA 4MJ6B 1YQVL 1F97A 1FAIH 3KS0H 5GRXG 5IVXF 3HE7B 1KJ3L 1ZTXH 4Y19D 1C1EH 1KC5H 3B6SA 2X9YA 5CILL 3TVMA 4L8CA 1OW0C 3PHQA 3BN9C 5LAXB 4NQVA 1IGYA 1NGYA 1W72L 5JA8B 5EU6B 5CCKH 2A6DA 1A6VL 2W0PA 1I1YB 3CX5J 5IMMA 4PG9A 3ZE2E 3MREB 5IR1B 3CFIC 5KVEH 2YC1B 4PLKC 1R3JA 2XPGA 4EQ2A 4Z7UE 5HHVL 4CKVX 2HFFA 1GGBL 2PTVA 2X70A 4X9IA 1A6PA 5C0CA 4ZTOH 5D1QD 4WI2A 2A9MH 4ONGL 3QXDA 5KN5A 1OAZL 5ENWA 4CU7A 2VIRB 3V5DB 4CVZA 2EDBA 2BVOA 4M1GH 5TQ2H 1AI1L 3QDJB 1DVFD 4M48L 2OMBA 3VA2C 3EYUH 1NFIB 4N0CC 3U0WH 5E2WH 4XC3L 4TUJB 4HK3J 3BGFB 5DDHB 4EXPX 5LQBH 2NY3B 4HIJB 5DR5H 4L3CB 4LPUA 4XP1L 1I1FA 2O5YH 4XBGB 4EOWH 1A0QH 2HMIC 4KUZL 1UXSA 5EU7C 3D87B 4LQ1A 1G6RL 2FX8H 3CDCA 5EUKA 5CEYB 1CGXA 3ISWA 4QHKI 2X4RA 1KJ2A 1NCWH 1UYWH 5CWSB 1CDHA 4UT9H 1JHTB 1T2QL 4PRID 3FZUC 2OYPA 5FDYA 4O5LH 1A1OB 2J88H 5DFVD 5C0RL 4Z7UB 3RAJH 3ZT7A 3KHOA 1A14L 2E8ZA 1JZ4A 3JUZA 3PNWA 2X44D 2A6KB 1KEMH 4X9BA 5GHWL 1NDGB 5DSCB 4Q6IA 1YPZF 5HHNA 3CXHJ 4OCMC 1A7QL 5E6IC 3RWDB 3ARBC 2JJWA 5CMAA 5I1JH 4MDJA 1UEMA 1T22B 2EICA 2WUCH 4GRMA 3ARVA 5ID1B 1IAIM 2GSIB 3L3GB 1OWWA 4BZ2L 5AZEL 3ILPA 3WFEH 1RJYB 1JNLH 3ARYA 4QOKA 5DYOA 2WLZA 1MCJA 1RIHL 4NM8L 3ULVE 4PJXE 4H1LH 3OQ3B 2Z31C 5ILTH 5GS2H 1MIEH 1P53A 2XQYK 1JPTH 4PV8A 3ARTA 5HI5C 5I8KH 2R4RH 3I6LD 2D2OA 3CDGB 2IH1A 1GXEA 3ARUA 4TTDC 2XICA 4S0SD 1T1XB 1DLFH 3VG0H 5AWNH 4OD2B 4JZJC 4HBCL 3PV6A 1PX3A 3DMMD 1KYOJ 1ACYL 3VI4E 4JRXD 3VXMA 5J1AB 4P23A 2CKNA 1LE5B 4LCWE 1WIPA 4HS8H 4JHAH 4PB0L 2R0LL 2B0SL 1UB6B 4FQXB 2AEPH 43C9A 4Z8FH 1LGVA 3QI9C 3GSVB 2FSEB 4OT1L 2VSDA 4JGJA 4D0CA 1KCSH 2VLLB 4DKAA 1AP2B 4ZXBD 4BK5A 3BUTA 2FB4H 3ZTJH 2D7QA 4F33B 4EDXA 2Z35A