3RKDC

Hepatitis e virus e2s domain (genotype i) in complex with a neutralizing antibody
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
213
structure length
213
Chain Sequence
DIQMTQSPASLSVSVGETVTITCRASEIIYSNLAWYQQKQGKSPQLLVYSATNLAEGVPSRFSGSGSGTQYSLKINSLQSEDFGSYYCQHFWGNPWTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Capsid protein
publication title Structural basis for the neutralization and genotype specificity of hepatitis E virus
pubmed doi rcsb
source organism Hepatitis e virus
molecule tags Viral protein/immune system
total genus 53
structure length 213
sequence length 213
chains with identical sequence L
ec nomenclature
pdb deposition date 2011-04-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3rkdC02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3rkdC01
2CLVA 3U6RB 3HZYA 1MCRA 3EDDA 3WV0A 3T1FA 1MJ7L 1CVSC 3EFFB 4QF1B 2VABA 4I3GA 5DTFB 4NRYA 4F3FA 2Y25A 4ZPTA 3S5LA 1KN2L 3MMEA 1U58A 2IPKA 4MNQB 4ZXBC 1WITA 3RZCB 2EE9A 3VMOA 3PWLB 1YMHA 3IAGC 5DVMA 1CDGA 2C1OA 3B2UD 3D2UD 2X4RB 5HHOE 4YNYA 5KVDH 4LLQA 4JRYE 3MXVL 3QXAB 3BIKB 1UM6H 3ZDYE 3QCVH 2R2EB 3TPKA 4ZODA 1RUKL 2XZCH 1T03H 2X4TB 2IPTL 5KSAB 3RPIB 2VERN 4QRTA 4JRXB 2HVKA 3MRDA 3PHQB 5DMIL 3HR6A 5TE7H 3BZDA 4WI5A 4JO4L 1HDMB 4JY4A 3MODH 3LRHA 2ATKA 5FGCE 3TPUB 3QQ3B 2V2WB 4QRRD 4BQ6A 4EDWH 4M7LT 5TE6H 2HLFD 3PWPA 3JUZA 3QH3B 2VAAB 4X6DB 4ZAKA 1FYTA 2BY0A 2M26A 4G8GD 5J3HD 1QSEA 2HMIC 3WNLA 3OB0H 3S3PA 1A4JB 1I1AC 5FHAH 4KJPD 4ZUSA 3ZMRA 1KJ3L 4Z7UA 5FYLH 3MV9D 3H9YA 3U4BH 2APFA 2BOBA 4J3TA 4LSSH 2YN5A 1KTLA 2WWMD 4LCCB 2YRLA 43C9A 3QUZC 3ZTNL 4GG6A 4O5LL 3QA3B 2SEBB 4KPHH 5BZWB 3RJDA 4F33B 3MCLL 5F9JA 1MY5A 4P3DB 5JOFA 3ZHLA 4NQVA 3TNNB 4LSPL 2EDKA 2G75A 2XA3A 4RQQA 3NIFE 1ZLVK 4MJ4A 5I1DB 1UM5H 4HFUH 1PSKH 1EJOL 1CCZA 4G8FA 3RY6A 3P0VL 3QHFH 2XFXB 3QG6A 5AAWA 5IM7A 1A9EB 5A2JH 5JOPE 1IT9L 2EDFA 5INCA 1HHHA 3C08H 2CKBL 5IBTH 4Y1AB 4YC2C 1AXSB 3IRZA 3U0TB 1YEDB 4YXKL 35C8L 1IM3B 2GJ6E 4JDZB 1YEHL 1AFVL 6CGTA 3HMWH 5GJSL 1DBBL 4OF6A 4EXPX 4LHQB 4A6YB 1XH3A 2BXYA 5IMOB 5EWIL 5SWZB 5B38A 1JPSL 4NUGH 2DTSA 4PRAA 1T7ZA 2VITA 4RGOL 4FTVB 4XH2B 5JW5A 2WAHA 3QPQC 3FN0H 2ZOKB 4WW2C 2CIKB 4HK3N 3I3BA 4ZYKB 4PJDE 5F7KC 5HI3C 2XACC 3VWKC 2JCCA 4L4VA 4EBQL 1NDGA 4O02H 5ISZA 1DZBA 3VXTA 3BDYL 1S9KC 2FJHB 4ZFFB 1XIWD 3CCHA 2X7LA 4PJ8D 3FHAA 1QHPA 2R1WA 1I8KB 1P4IH 4OZ4A 3OQ3B 3D87B 4WY7H 1FNSL 4LIQE 4WI9A 3MJ9L 3FCTA 4R0LB 1NCAL 4RRPA 1KJMA 3DVNA 1YEKH 3SGDH 2ITDB 4E41B 4QRPD 5BRZE 4LKCB 1AI1L 4CW1B 1PW3A 4FFWD 4AENA 4Z0XA 1HZHL 1G7MB 5MEPA 4ODVH 3CLEL 1ZA6A 3MROA 1DDHB 4JDVB 1DN0B 1E28B 3NFNB 2B2XH 4OLWL 1CFVL 3OKYA 1MHCA 1X6NA 2FDBP 1JZ3A 4G8EA 4XNQB 3BPCA 3GSXB 1T0MA 4PRIA 5BCAA 5IHUL 5C0FA 5JMOC 1P1ZA 1G84A 4H20H 5I2IA 4HX1B 4NT6B 1S5IL 4DN4H 1ZT7A 3LEXB 2GFBB 4NN5C 4XP4H 1VFOA 3GO1L 4ZS6C 4PD4J 1CGSH 3L3OA 2OJZH 4JPWH 4DWHA 4GKZB 3RY5A 2DOCA 3ZSSA 3CH8A 3KYMA 3OXRA 1INQA 1IAIL 3EZJB 4I48B 2OR8A 1F8TL 2HLAB 4XGZB 5GZND 3OGCA 2CMRH 2P8LA 2VN4A 3L95A 1H3UA 4GS7C 3VI4F 2MNUA 3DSFH 4ZSOB 4ENEC 5I73C 1QBAA 1QBML 2PCPB 1KIUA 3LKOB 1REIA 3OBAA 3NPZB 1ZHNA 4WO4A 4FQJL 1IGIH 4G3YH 4NO0A 3VXMB 1IZJA 2VXVL 4OZFG 3QQ9C 2H9GA 4GXUN 1F4HA 2W9DL 4PFEA 3K4AA 1YEJH 4P4RB 4WUUD 1BP3B 3BZ4B 3MRQB 5KAQG 4YR6B 1IGCH 3B8SA 3KHQA 1GOHA 5IEKB 5M95B 4UT9L 1IRAY 5I1EL 3TNMA 1KG0B 2J6EL 3JWDL 4KK6C 4RFOH 4PR5A 3WUWA 5MERB 1NSNL 4PRNB 4PJ7F 5A3IC 3TZVC 4KK5D 1G6RA 2OZ4H 4UILH 4MA8H 4PJCF 3T0WA 4PGBA 5E9DE 3FQNB 3QT2A 4JFQA 4AIXA 3BO8B 3C60B 3UP1A 1IFHL 3NABH 4LCYA 3V6OC 4N8VB 1PJ9A 3NCJL 4TVPD 4H0HB 3MGTA 5E99L 3GUTB 2RFXA 1YMMA 4PJGA 3V0VB 3N06B 1WSST 1X5LA 1LNUA 3CSYA 3T8XA 4PB0L 3BH8A 3X12B 2XTJD 1A7PH 3PGDB 5CJXC 5EZOL 4JG1H 3BN9D 3KYKH 1N6QH 4O58H 3PV6A 2RJMA 1LILA 1T3FB 2E5EA 2GSIA 5LWYH 5KG9B 4XCEA 3BKJL 3SDDB 2PYEB 4GRWH 3QJFA 5ICZB 4F37F 5IFJB 3ZDYF 3DYPA 4ZS7L 3FQRB 3QDGB 1MWAL 4M7JL 2NY5H 4R97C 2ADGB 4X6CE 1EGJL 1KFAL 3MYZA 4NQDA 1WZ1H 4MNGA 4N90E 4OD1L 4C56B 5FFLA 4ZQKB 4UQ2B 5FO7B 3QDMA 3LV3B 3D85A 1OTUC 4TNWK 4X5LA 2VQ1A 3C09C 9CGTA 4X99B 5TDOA 2HFTA 1WT5A 3ES6A 3H9SE 5D9SB 5EU4B 2FL5B 2X9YA 2IH3A 5DSCA 3RTQB 5E7BA 5SV3A 3KLAA 5F8RC 4OIIL 4HXBH 2AJXL 2ADFL 3F8UB 1CFBA 3RIFF 1RMFL 3V5DA 4OD2A 5EZLB 4G8IA 5D96B 5DMKB 4L8BA 3VFPB 1MJJA 4HV8B 4F7TA 2F58H 4JQVC 3RDTD 1D9KB 1I7UA 4CVXB 1N4XL 3F7YA 1LK2A 2VDOL 2Z8RA 1NDMB 1J8HA 5ANME 2K3TA 1BJ1H 1S7VA 4FOMA 5LCVH 4MJ5A 1YNKL 3DROA 1BOGA 4HIHB 1UWXK 4K2UL 2VDPH 3BP6A 4YQXH 3GMOA 5T1MA 4KUCD 4B0MM 3AB0B 2ICWB 5FYJD 2Z35A 4RZCA 3F7VB 3MLXH 4NO3B 1I8IB 3UYRL 4ESKA 2CDEA 2DJ4A 3NIFF 1JZ5A 2XN9A 3GM8A 5C0DA 5AG9A 3WFEH 2HKFL 1KB9J 1NMCC 4GRLC 1CD1B 4OGAD 4PJBE 4Z78B 5DYOA 2NTFB 2D3VA 3FT4B 4JRXD 4N0YL 3BWAA 1MFCH 3VFNA 1XGPB 2B39A 2VLRA 1DP0A 1QPPA 2DQUH 2G5BB 4XPBL 3P30L 3RP1A 1MI5B 2NLJB 3MRNA 3MXWH 4NM4L 4RGMB 5CP3H 4MZ3A 4GAGL 4IRSD 4DGIH 3ULVD 3GB7A 1XGYL 1Z0NA 3V8CA 5IJKA 1F11B 2DL2A 4D0CB 4M8VA 1HXYB 3W9EB 4NNXA 3J8F7 1CDCA 1IEHA 4QTHA 3TCXA 2OYPA 4PJDF 2R0WH 5K59E 1RHHA 4KTEH 3SDAC 2E9BA 4UTBH 3HR5A 1OAXH 1MIEL 5FGBC 3WDHA 4O51A 4PG9B 2YD5A 4LLYB 2RIKA 1LP9B 5ESVA 5C07E 4JFOA 3H42L 1GHFH 2FO1A 1PQZA 1DQQA 2DJSA 1K8IA 3SQOH 3U4AA 2AP2A 2FH6A 4Y5XC 3CDCA 3A0OA 5GQBA 3C8KA 2DICA 5EFIA 3EOTH 5AUMB 4JFYA 1MCSA 1MJ8H 2A0LC 1Q38A 4F9PA 1T6VN 1G6VK 2CK0L 4XWGH 5ESAA 5M94B 4M93C 5JO5B 3Q3GA 2VMFA 3EYOA 4DGVH 1JNNL 3KWWB 2HH0H 2Q8AH 1QLEL 1HYRC 5BQ7A 3BXNB 3MV01 2EDRA 2F5AL 5D1QA 1NEZB 2VKXA 2VDRL 4NQSA 2PTVA 2BHYA 2W65B 3I75B 2EH7H 3QEGL 4J3VA 1ZKAA 3B2VH 5B4MD 5GGVY 4WV1B 3MV7E 4LPVA 1OP3H 1Q0YH 1FL3A 3CVHB 2WUBL 1T1ZB 1G9MC 1MQKL 3CFBB 4K94L 4IRJC 1OGAA 5DA4A 1YECH 3KPNB 4OF7A 2FNBA 5DJCB 5GS0D 2BMKA 3HC4H 3KGRA 2YC1B 3QRGL 4LAQH 3L5WA 3GK8H 1CE6B 5FM8A 3EJYD 3D3VE 1JGEA 1QEWB 2AJUH 4X83A 2Q3AA 3JTSA 4JZJA 4LRIA 1F6AB 1F4AA 5E8OB 3DBXB 4GG8B 4KGJA 1JI1A 3VXRA 3KPRE 2EIZA 3CXDL 2JIXB 3AAZA 3NH7L 3QO1A 1M6OB 3TJHD 2Y4SA 4L9LB 3DSNA 2ZCHL 2I9LA 1LO2L 3B3IB 1WIOA 1WFTA 2DBJA 1A7RL 1IKNC 4NRXA 1MAJA 5IROC 4JREC 1KACB 5DJZB 5FA3B 1GJIA 3LEVH 2FX9L 1MQ8A 3PWNA 1HI6A 3OPZH 4UT7L 2MCG1 3PL6C 4FQLL 4KUZH 5E6ZA 2GTZA 4HD9A 3MLZL 3O6FA 1ZA3A 3LKQA 4L1HA 3DTXA 4YX2H 2HRPH 3TJEH 5ECJE 4OCNC 1HHGA 3IU3B 4DCQA 1F4WL 4OF5A 1A2YB 2CJUL 1QSFB 1YMMD 2BVPA 2ZUWA 3BE1H 1BQLL 1X4XA 3QR2A 2BVYA 4HMEA 2BOCA 1JNLH 1T20B 1Q1JH 2VH5L 3U7YH 8FABB 4EI5D 2X89A 5T3ZH 1KTRL 5CWSA 5DRZB 4UOW0 1SVCP 2F54E 4PGCB 4XBEH 3IDGA 1UA6L 4PJ5B 4U1MA 5GJTH 3KXFD 4FQIL 2HYMA 1ZT1A 1Q9KA 5KVGL 3BOVA 1ZVSA 5E5MB 4G80B 4NQCA 5SX4H 4E9LA 1JYXA 2CUHA 4YGVA 1Q9LB 3FFCA 3IDXH 1V7NL 3OR7B 5LAXA 1K3ZA 3RWGB 3SE8L 3VXMD 4P2QA 2CKBA 1J0ZA 1JV5A 3FQUA 4WUKL 4YE4H 1DANU 4L5FH 4XBPB 5DJ8A 4GMSL 3OB0K 1X44A 2W59A 1T83A 3EZ8A 12E8H 2BSSB 5DI8B 4Z6AT 1BF8A 3STZB 1KTDB 2HWZH 3PP3H 5D7IB 5FF6A 4X6CF 3BSZL 1OY3B 4QOKB 4JN1H 1MVUA 1W0WB 4PTTA 4J4PD 3JBG7 5ACLA 1YA5A 3T0XA 3ZKXC 3T2NL 3W0WD 3V9FA 1PBYA 3AXLA 4JKPH 2CDFB 1IC7L 2YZ8A 4R4ND 3N1PC 2FR4B 5KS9B 1XEDA 1EH9A 2HLFC 4LHUG 1VGEL 2X4PB 5FYJU 5CEXA 2JB5L 4L4JA 1U92B 5J3HC 4S2SB 4KJPC 4DOHE 2Z93B 3CDGB 2LABA 1TMCB 3KR3H 3EYQD 4JVPA 3H0TA 1B0RB 3S96A 3ULUD 4S1QL 5FXCH 2WWMC 4X6BA 1TJHL 3MJ9A 5JIKA 4PLNC 3GMQB 4NZUL 2MPAH 2JLLA 4O9HL 2GYSA 4ZO7A 5I74C 4XNMA 3TO4B 5H37G 2PTTA 3TIEA 1E4KA 1ZAGA 2BVQB 2YMXL 4OLYH 2ESVE 2MHAA 5BS0E 4L8CB 4OT1L 3B9KD 4Y16B 3CFKB 4WW1A 3HC3H 1RD6A 1BAFH 3SDDD 2PYED 4WCYL 5I15H 1XCQB 4JHAH 4M6NH 2OXGA 4AL8L 1DBAH 4F7EB 1ORQB 3T08A 2QQLL 1BVLB 3C5ZB 3QG7L 2ZUYA 3KS0J 1MOEA 4PLKD 1TVDA 4PJBF 1OLLA 4PRPD 4YDLB 1G6RH 2FX7L 3K1DA 2WBJA 1JUFA 1NH6A 2XT1B 4U4BA 3QDJB 4Q6IB 1ZSDB 3SJVB 4L3EA 3SDXA 2MFNA 2FZ3B 1JZ7A 5C2BH 3WEXA 2JELH 1INEH 1KN4H 3Q6GH 4N0FB 2AVGA 4XXCC 4I9WE 4ERSH 4D8PA 3ARDA 4IMKA 4RDQF 4BH8B 3MR9A 2ICCA 2H1PH 5HDBE 3IJYB 2XXCB 3QEQA 5K59F 1UJ3C 4NC2B 1XIWC 3P9LB 4X4YA 4PJ8C 5FHBL 4L29A 2VUOA 1E6JH 4OV6F 4AEHL 1HEZA 4HKBA 5SWSA 4UU9A 3FQTB 5H35B 1DQMH 4LU5L 1RI8A 4P57A 1IGFH 4MJIB 3O2WH 4Y5VA 2IGFL 2CIIA 4YHIB 5DK0B 1YYML 1KBGL 4HS6B 3WN5C 2BVEA 4QYOA 1FJ1A 2BSTA 5D1XA 3REWB 1NLBH 4FFWC 4Z7WA 5JPMB 3PDOB 3PV7A 4QHUA 3IDNA 5KSUB 4L4TA 4WEUD 2E7LC 4P5TA 2J6EA 3QIUB 4P2OD 5DJYB 3EYSH 1P7KB 5EB9A 4ZNCD 1IBGL 4MCYB 1DUZA 2DQHH 1ITBB 1HHKB 1BFOA 1U8QA 5HVGB 4QGYA 4KV5F 3SKMA 4PG2A 1TZGH 3MLUH 1NGZA 3QFJA 4XPFH 5MENA 1DBKL 1TTGA 3IB4A 4YO0B 1OGAD 1HINH 3OKKB 4HKXA 4XNYH 2C5DC 4GAYB 5DJXA 5JQHC 1EBPA 2GTWB 4ELKB 4JFFB 3RIAK 1SJHA 3QWRD 1M7IA 3E2HC 7FABH 5C0CB 4HZAA 2CGRL 4M7KL 3BDBA 5C0AA 2EC9U 1VADB 4ZD3L 5E6IA 1MCPL 2AK4A 3L3GB 5EN2B 3MZGB 3AU1B 4XVSH 1Y0LB 3TBYA 1X7QB 3KJ6L 2Y07H 2ATPA 4NKOB 1FBIH 3W9DA 5GZNC 1NCCH 4S10A 3BVNB 1Y6MR 4F9LC 1JGDB 2QV2A 3M1BB 2GJJA 4LRNH 1V8HA 3BPNB 4IS6B 5CILH 3VFOA 4MLSA 3GSNL 1NBQA 4KDVA 3ZDZE 4U1SA 5D72L 3SOBL 1MWAA 1UWEH 2YWYA 3FMGH 5D6CA 4XPTL 5EG6C 5D7SL 5K9JH 2A6JA 1UCTA 5F7WC 4OGYL 3FO0L 1JCKA 1YUHB 2BY1A 4L3CA 2E9WA 4ISVA 2P5WA 2NTSP 3GMNB 3DURA 1H0DA 2VR4A 3P11H 4K3JH 3V79C 3V6FB 5A2IH 4KK5C 1NBYB 1KCVL 3E3QE 4J12A 4KMTL 5DO2D 4POYA 3O4OB 4I0PA 2AQ1A 3M17A 3TV3L 1MCBA 4HW6A 3FKUS 5I8KH 4DQOH 5CBAB 5E8PA 1FVCB 1DQLH 4PUBH 3SDYL 4Y4FA 3I6KA 2V6HA 4H0IA 1WVZA 4CL7A 3NA9H 4K3DH 2QTEA 5CSZA 2OX5A 4OZGA 3GZKA 3E6HA 1JHKH 2XTJC 5IFHH 2DF3A 3E8UH 4P2QD 2BRRH 4PJHE 1ZV5A 2IPUG 3MNZB 2OLDA 3BGAA 3FHQA 1LEKA 3ARBA 4JFDD 1I3VA 3QZWB 4JGUA 1NGWA 3MGAA 1KIPA 4DEPC 3WFCL 3B8YA 4Y0GA 5D2NE 2ICEA 3CXHK 3GRWL 3KYNA 4RFNC 2CRMA 4AQ1B 4HIEA 4PPTA 2P46B 2WBKA 3X11B 2OSLB 1A6UL 1YC7A 4F57H 4G6MH 3MLVL 2DQFA 4I18B 5IEHB 3SPVB 4CN1A 2W0LA 4GW4B 2FECI 2YPVH 2YD6A 4V1DB 2IANA 4WFHD 4M3JA 2J4WH 2ZOLB 4XVUD 3RUGB 5F1SA 1FNGA 1F97A 4HS8L 2NY7H 2FX8H 3HRZB 3MA7A 1FG2A 5I9QC 3UJJL 4OKVA 4YHYB 3BP7A 3MV11 3QFDB 4DAGL 2AXFA 2GI7A 5INDA 4L8DB 2HFFA 5J1TC 3BZEA 5GGSA 1MJ7H 3RDTC 1DUYB 1QVOB 2FEEI 3EYVA 5CD3A 5HHXL 2Z9TA 4E0RA 1KN2H 2ZNWA 2C3XA 5FK9A 3X3GL 5HYIA 2ORBL 1EXUA 3EDEA 2V9QA 3UTSA 4WI7A 2VXSL 4JZNA 1PGRB 3DIFB 3RY6C 4PJ5D 5IV2B 3MXVH 3MRMA 3LPGA 3NA4A 1LO5B 1RUKH 2BHZA 3H3PL 4HGWB 5EUOE 4FQCH 2X1QA 3JV4A 2P48B 4CMMB 2PR4L 2UWEB 1H5BA 3OJVC 2YBRA 2P43B 5D1ZA 3WYRA 1MFAL 1QTYT 4OGAC 1C5CL 2EDOA 4AG4L 5EOTB 4Y7MA 4JANA 3LY6A 3EGSA 5DZNA 3O9WB 2NW3A 3GEWB 4QOKD 4WRLA 4CDHA 1T2QH 1KOAA 3VXUB 5B39A 2GEEA 2CUMA 4KVCL 1PG7X 2CLVB 4IRSC 4C4KT 4G43A 5SX4I 3HZYB 3ULVC 3I3DA 1KJ3H 3T1FB 3PHSA 1P6FA 4U6HB 3LIZL 1M71A 1U36A 2YZ1A 2VABB 3TH4T 1WLHA 2BNRA 4NRYB 4XTRC 4F3FB 3T4YA 4MQXD 1U58B 3DGCR 2FEDC 1SYVB 2NXZB 3QIWA 4O5LH 2NZ9C 5KJRH 1MHEB 1YMHB 3MCLH 4MQSB 2HT2D 1QO3A 5HDBF 1UCBL 3IJHA 3QNZA 4HPYH 2C1OB 4ZUVA 4G9FA 5C0BE 4XVJL 3TESA 1VDGA 5CBEA 4LLQB 1HSAA 4POZC 4LSPH 3S4SA 2BERA 5BW7C 4LCCC 5D2LB 3UC0L 1WZLA 4PYHA 4HK3J 4I2XE 1N2RA 5GS2H 3GSWA 1NBVH 1EJOH 3B83A 3EJZD 3HAEG 3MJGX 3P0VH 3GNML 3D9AL 2KUTA 3MRDB 5D6DA 2YD3A 1OP3K 4XP6H 4KMLB 2X70A 3SDCD 3UJTL 4BZ2L 2CKBH 2XQYG 4N1HB 4JY4B 35C8H 4Y16D 3F12B 4ORGB 2ATKB 1AD9A 3P0YL 2PO6A 4JM4H 1YEHH 5MEND 4R4BA 4OLUL 3OGOE 3IAPA 4P2CG 1JGLH 5GJSH 1DBBH 3OAUH 2P8PA 3ABZA 3RL1A 1XF3A 3QXVA 4ZAKB 1FYTB 4X6DE 3VH8G 3C5ZD 1QSEB 1S9YB 3WHE1 5C0IB 1RZFL 3LD8C 4Z7UB 5E6ID 5B4MC 2FJFB 4NNYA 2BOBB 4GW1A 3SJVD 3HN3A 1QBLH 1VB9A 4EBQH 4BQ8A 1PKQE 5CEZL 1RZJL 5DJ6A 1HCVA 5GGUB 3BDYH 3HG1E 2HVJB 5GS0C 3GMMA 1KPRA 1AGEB 4F15C 1NLDL 4NQVB 5KW9H 25C8L 4BQBA 4WO4C 2AEPL 4RQQB 1B4JL 1FNSH 3MJ9H 2DKUA 4HFWA 4UNUA 3HKFA 2VLJA 3UTPD 1GOFA 3DVGA 1EZVY 4G8FB 5IM7B 4N9OB 5C70A 1AI1H 4X4XA 1HHHB 1YQVL 3M8OL 1BZ9B 4Y1AE 1CR9L 5CD5D 1HZHH 5HY9A 3PQYA 3IKCA 4NQXA 5CZXC 4NM8L 4H5SA 3QIBA 4KC3B 3ZDZF 3DLQR 3L1OH 3CLEH 4GAJL 1XH3B 4IOFD 3S7GA 3R0MA 3LN9A 5B38B 1K9TA 1DFBL 2FO4B 1WIPA 4Z7VB 5B21A 5SWZE 5L2JB 4OLWH 1CFVH 2VITB 5JW5B 4FTVE 3QIUD 3OAZH 5J57B 3X17A 1ZT4A 2RR3A 2NXYD 2JCCB 4Z5RB 3LHPL 4L4VB 5DD1H 4HSQA 5ISZB 1UZ8A 1S5IH 2QR0A 4KAQL 2YWZA 1E6OH 1UWGL 4OM0L 4RAVA 4TUOA 2FH8A 3CCHB 5E03A 2MSPA 5FGSA 2X7LB 2W9EL 1YN7A 5C0CD 5HGDB 2X42A 3S37H 4DK3A 1ZVYA 3VRJA 1CFNA 3DVNB 4EI5C 1QBMH 4AM0A 1CFSA 1FP5A 2Y5EA 1LE9B 1RK0A 4E41E 2F53A 1G7HA 3PP3K 5IOPA 3O11A 3KG5A 2OR9L 4FQJH 1NANI 3KLSA 3PXJA 1G7PA 2VRAA 4FNLL 4PJHF 4G6FD 3HUJA 1T80A 5EU7C 3MV8D 4UT9H 3MROB 4TPRL 5C6PB 5I1EH 3F65A 3VFRA 1MHCB 4K7PL 2J6EH 3DETD 5T5NG 4F7CA 2XA8L 5F96L 1Z3GL 7CGTA 3BPCB 1JWSA 3VW3L 1T0MB 4Y19D 3MTRA 5C0FB 2YPLA 4MAYA 5I2IB 1Q0XH 3V52L 4U1LA 1HILA 1GPOL 1I4FA 4J4PC 4P49A 4X8JB 1ZT7B 5EU6B 2R39A 4Q6YA 5IWLA 4OKDA 5HPMA 4OCRL 4R4NC 1MHPL 1IFHH 3FB5A 2EDBA 3WNOA 1J88A 2YUZA 3KYMB 3OXRB 1INQB 3NCJH 5EULV 2DB8A 2P5EE 4NOFA 4K23H 2K9UA 2Q3ZA 3OGCB 1U93A 5E99H 3H3BC 3L95B 5L6YH 2NX5A 4U49A 4ZSOE 4L1DA 4F2MA 1ZHNB 5E4EC 5T1LA 1YPZA 4XMKL 4JO3L 3V5KA 4PB0H 1X5HA 1KCSL 3QWOB 1X5XA 2RQ8A 3ULUC 4O2EA 1F00I 5K33A 5EZOH 4N68A 5GRVK 4Y5YB 2HN7B 1L7TL 4YPJA 4JFPB 1JF1A 1MEXH 2EE2A 3EDFA 1C16B 2H6PA 1RJLA 1SEQH 4YHOL 3BKJH 5DMYA 4KJYB 2NY1B 4HUNB 2X41A 3UXFA 4ZS7H 3B9KC 4EXKA 3BUYA 1MWAH 2W60A 4I4WA 2QADC 1LEIB 5EUOF 1KFAH 4PR5B 5F88B 3VFMA 2X1WL 3G04A 3MRJB 3W5MA 1ZOXA 4HJGB 4PGBB 2DTML 2D9CA 2W38A 4PLKC 3KVQA 3DMMA 4FRWA 5IJKC 3B43A 2APXA 4LCYB 3D39A 5KSVA 3FN9A 4OIIH 4W4NA 2AJXH 4M03A 1RMFH 1FNLA 3RWEA 2RFXB 2GKIA 2PXYD 4QXWA 3QIWD 3V4UH 2AJ3A 2J1KA 3CGTA 1JHTA 1LNUB 3CSYB 3BH8B 3SGJC 3CD4A 1M05B 4LCUA 3DOSA 1IGYA 1YNKH 3SY0A 5IIEA 3MBEA 3IDIA 5IESL 4K2UH 1AO7A 4BFIA 4RAHA 5I1GH 2EDDA 2GSIB 3BEWB 4MHHI 4AT6A 5FOBB 4JO1L 5BXFA 3QJFB 5JA9A 4ZTPL 1YNTA 3RWJA 3UYRH 3W82A 2HAZA 3L9RB 3QDGE 5L0QC 2IALA 2E6JA 2PO6D 2DQEL 4NQDB 3AB0C 2ZPKL 4NQEB 5EOCJ 3NOIA 4C56E 3ALPA 2VLLA 4F8TA 3QDMB 1BD2D 3QEUB 4M5ZL 1JBJA 1I1YA 3D85B 2VQ1B 3WS6A 5JLZA 2Q8BL 1T04A 4ZOAA 1RZKC 4N0YH 1NAMB 4P2OC 2Z0BA 5E8NB 4UDTB 4XPBH 1DLFL 3P30H 3SE3A 3V5DB 3WUZA 1FGVH 1GH7A 4GAGH 2AXJA 4BZYA 4X6DF 1XGYH 3IDJA 4K3EH 2P8MB 3KYOA 3KPMA 5CJQL 3KPQA 4Z95L 3O9WD 5E2TL 1KYOK 5JW4Q 4J6RH 3VXUD 1W8OA 5EBLB 4KU1A 4WJ5A 3WDIA 2YSSB 4E42A 1BVKA 1J8HB 4RGMC 1S7VB 3GJFA 2MKLC 3CFCL 3AROA 1OM3L 2VLME 43CAA 4UDUB 1MCOL 2F5BL 1BOGB 3DROB 4PJXB 4MA3A 4OFIA 5J06A 2B5IC 4JZJC 4JFZL 4LRIC 5T1MB 1ZANL 3ZTJH 3H9HB 5AWNH 1NC4A 3PGCB 4U6VL 3BRFA 3VGFA 2Z35B 2NXZD 1ODAA 3S35L 2CUIA 2BSRA 4XBGA 2M2DA 5JHDE 5C0DB 5T1KA 5L2KA 4WI3A 2ZG1A 3QIBD 3O8XA 2JK5B 3QXUA 1QRKA 3CZFA 2CK0H 5SX5H 3MC0A 2WV3A 5DYOB 3GRWA 2Q76A 4M6OH 4C57C 1OB1B 3MO1B 4MJ2A 1JNNH 3BWAB 3FOLA 3LAFA 1NFKA 2MQCA 1QLEH 3O6FC 5HYJA 4LCWA 3IKKA 4UINL 1IQWL 2F5AH 4CNIA 4ETQA 3U46A 3NN8B 2VDRH 1S9WA 3MRNB 3WE6A 1MI5E 2DYPB 5DJDA 1FZMA 1NBZB 4UIKL 4NHUA 1JFQH 3QEGH 4UTAL 1E27A 3GB7B 4BFGA 3MFFA 3QUYA 4MNHB 5EU5A 3ARFD 5DO2C 1MLBA 1RHHB 1OWWA 1MQKH 4PJFB 3DX6A 4K94H 4OZFH 3TVMA 4JY6A 4UAOC 1ACZA 4OZIA 3QUKA 4EUPG 1LP9E 1XR9B 5C08D 1FZOA 4DN3L 4YHZL 2GK0B 1DQQB 15C8L 1K8IB 3F58H 4PBWD 1HHIA 1BQSA 3BPLB 1G9NH 1A6AA 3O0RH 2ARJB 1FO0H 4I1NB 3TA3A 2AV1A 4G7YH 4LLVA 3NH7H 3ARZA 5JOEA 1U8KB 4IMLA 3G5YA 3C6SB 2ZCHH 3BISA 1LO2H 2DBLH 3A6CH 1K85A 3FO1B 1ONQA 2FSEB 3LS5L 1P7QA 5BQ7B 2FX9H 3U7AA 5D1QB 1JPTH 5T5NF 3V0AC 5HVWA 2X40A 4FQLH 4MXWL 5T3XL 3MACL 3MLZH 1D5ZB 2KQNA 4J3UA 4YDKH 2XXMB 3ZKMD 4NCC1 1J1XL 4NCDA 4LVOC 4F7PA 1A6WL 5KN5A 4AIOA 4WTWA 1B6UA 2PETA 3LQAC 1G1CA 4ETYA 4HULB 5HYSB 4XVUC 1R3KA 1S7RA 2BMKB 2CJUH 3B5HA 1CQKA 4APQB 1KGCD 1BQLH 4U3HA 3L5WB 4HG4K 4ODSL 1I7TB 2VH5H 2QSCH 3RVTD 3T2PA 3GIZL 4G42B 3VGAB 1CK0L 5HGBB 4JAMA 5ICYB 3Q6FA 3WXVL 4U6TA 3MNVA 3TCLA 1JWUA 1S7SB 4HGMA 3PWJB 3VXRB 3VFWA 2VSDA 1PY9A 3AAZB 3O4LA 1UA6H 3QO1B 2OXHA 1WFNA 1Q72L 1E4KC 2VZ3A 4FQIH 4PP1D 2I9LB 1A7NL 3ROLA 4X98A 5KVGH 5I1LB 3LKNA 4GRMA 3DX7A 4GAFB 1VKXA 1WBYB 4J3SA 3SE8H 2EXYD 1V7NH 5ENWB 2BDNH 4JDTH 4NO2A 4WUKH 5CEYA 3RWCB 3RAJL 2GTZB 4GMSH 3IFOA 1ZA3B 1V3LA 3DMMD 2DMCA 1IAII 5IK3A 3BSZH 1H3TA 1NGPH 3DX9A 5I66A 3MRCB 1R3JA 4HUUA 3LEYL 4TSAL 2DWDA 3AREB 3L3DB 3SKNB 2KL6A 5FYKD 3T2NH 5BVPL 2QLVB 4WFED 1IC7H 1JF5A 1QSFE 2BVPB 1KB5L 2ZCKL 5H94A 2QJDA 1IVLA 2I9TA 1VGEH 4CADB 3DV6B 3EAKA 5EU6D 2JB5H 3GMPA 5TH2A 4GKNA 5I8CB 5HHMB 4IMKC 5D93B 3U48A 1EBAA 2ZKHL 2A73B 3C6LA 4M9OA 3PWVA 1D6VL 4H1LA 3UROR 3IDGB 4GKOA 4P2RA 4S1QH 4U1MB 4FXKA 4ZFOL 1Q9KB 3VG0L 1RHFA 4NZUH 2VLKA 4O9HH 5B3JE 5DVNA 3UYOD 4NQCB 1IMHC 1A4KA 1I3RB 4YGVB 3VFUB 5LAXB 5IBUG 2YMXH 5TFSH 1GGCL 2VZOA 4OI9A 1PYWB 4KDTA 1N6UA 4K9EC 4CUCA 3GKWL 3EJZC 5E2WL 1A7QH 3JWDC 4A2MA 1H9VA 2VE6B 5FF6B 5K9KA 1QRNB 4WCYH 2FB4L 5D7IE 2X1PA 5H2BA 1MVUB 3SDCC 4AL8H 1MCWM 2QQLH 2BC4A 1D6EB 1IJ9A 1GAFL 1SYSB 3MUJA 4JFEE 4QHKJ 2V2TB 2H32A 1DSFL 2AK1L 3OKLA 2DQGH 5FYLE 5KS9E 4HF5L 4JVWA 2FX7H 3LKRB 3Q48A 2K7QA 3T0EB 4LKXB 4CVZA 5DURD 3QI9B 4OUUA 4WFGD 3GSUB 4HH9A 2PF6A 4TNWF 1GSMA 5DQJA 5E6IC 4C83A 4GOSA 1GZPA 3H0TB 5J56B 2IQAA 5D7KE 4EI6A 1CN4A 1NCDL 1EAJA 3Q1SL 2IFFL 4NYLA 3I6GB 3WFDL 4X7CC 4QXGL 4W70A 5FHBH 3CLFL 5DZOA 5MEQB 4LU5H 4TRPL 3OAZK 4Y2OA 2IGFH 1S7UA 1YYMH 3HC0A 4WW1B 3ZHKA 1KBGH 2EYSB 2DWEA 2A6KA 4LCWD 3BEVA 1C12A 4LNRB 3UCRA 1AD0A 3OKDB 5CD5C 3VXSA 3U9PL 5E2UL 3I6LD 4I5BB 1DJSA 3OXSA 4NQED 1U6AL 1IBGH 2J3SA 3QNYA 2WBJB 1JUFB 1F3DH 1RU9L 2X4UA 4IOFC 4PREA 4AMKL 1WBZA 3QDJE 4L3EB 3SDXB 3IJSA 5F1NA 2DIJA 1LDPH 3OKNB 5EBMB 4JM2B 1T7VA 4J3OC 2FGZA 3WEXB 4XPHH 2NXYC 2Q7NA 3L7EA 2AGJL 4KTDL 1FORL 4ODBD 5LKNA 2ZSVA 4M7KH 2CGRH 4MX7A 4S1RL 3QEQB 5JW3H 3UTZA 4ZD3H 2IG2H 1MCPH 3FOMA 4U0QB 1JPFA 4X4YB 1W72L 4FFVD 4L29B 1LP9F 2V5RA 4M61A 3AS2A 1HEZB 4UU9B 2Y23A 5I6XB 4MJIE 4Y5VB 1GC1L 1X5AA 2CIIB 5C2UB 1G1YA 2IMNA 5GGQH 5IUSA 5D7JD 4Q9CA 1TZHB 1P7QD 5GSVB 2BSTB 2DQCL 3RNKA 3TYGH 3TN0A 3DNKA 1EMTL 2WZPD 4NZDA 3IDNB 5D72H 4WFFD 4OUOA 1DLHB 5DRNA 4LLWA 4XPTH 2R9HD 3HE7A 1DUZB 4YJZL 5HGHA 2D9QB 1BFOB 1J18A 4OGYH 1U8OB 3SKMB 4AEEA 3N9GH 4HK0B 3VWJA 5ID1A 1BZ7B 2B1AH 3DETC 4HKXB 4NZTL 2AQ2A 3FB7A 4PIRF 3PNWA 1SJHB 1ZGLP 4XX1G 1KCVH 3IU4L 2NY0C 4R8WH 3F5WB 2XWBA 1QFPA 2BNQD 2E3VA 5IB2A 2AK4B 3V7MA 1T1XB 3TV3H 2X9WA 3HAEA 4I3RH 2EEDA 5DUML 3TBYB 1J8KA 3HS0A 2NY4B 1BX2A 1K2DB 3ARTA 5B8CC 1NMBL 3OZ9L 3SDYH 3GJFH 5I0DA 5T5FH 5CZKA 2O5XL 1NGQL 2IQ9L 4M00A 3KDMA 1MAML 3CH1A 4OF0A 4P23A 1WICA 1NFIA 4YBLB 2HJKB 1IEAA 1R3HA 4BQ9A 5FGCB 3VFOB 5FCUL 3P77A 2A74B 1L7IL 3GBMH 5FYKU 1C5DA 2C4FU 1MWAB 3ARGA 4YBHA 4MD4A 5D6CB 1EO8H 2IAMD 5JZ7D 2A6JB 2R4SL 3WFCH 5CZVL 5DEFB 5CGTA 5C09E 4KKNA 3GRWH 4MD5A 3HPLB 1I7ZA 2DDQL 4PJ9A 5JXAL 1T5XA 5C0EA 5TDPB 1ZWIB 4S1DD 1A6UH 1TPXB 3BQUD 3MLVH 1YNLL 4AH2B 4PGEA 4YXLL 4Z18A 5EUKA 1BWWA 4ONHB 1JI2A 3PJSB 3QHZL 4I0PB 4GQPH 4LARH 5JIHA 5SV4A 1U3HD 3M17B 2ZUVA 4HS8H 5KVEL 5I76A 4QNPE 1TETL 5H37H 4M3KB 3EYFA 3EDJA 2Z31D 3UJJH 3CFDA 4Y4FB 4HIIA 3I6KB 3LN5B 3FTGA 4OCWH 3LSOA 3U0WL 1FN4B 3ALXA 1LD9B 4BELD 4APQD 2PXYC 4ODWA 1G7QA 5D7LE 3QIWC 4P4KA 1PEWA 1CLOL 4OZGB 2YXMA 3QISA 3STBA 4TSCL 2LU7A 2JF1A 2GJ6B 2ID5A 5HHXH 2VL5B 4GRWE 1Z0MA 2HTLD 4QLRA 3X3GH 1LEKB 3ARBB 1SBSL 4QT5A 5DC0A 1QFUL 2VXSH 3WBDA 5C9JA 5B3JF 2DLFL 5CAYB 2CXGA 4OQ1A 5D6DC 2FJGA 3TC9A 3H3PH 3QUXB 5CJOL 5ABDE 4OM1L 4M62L 5JHLL 4DZ8B 1LVEA 4HIEB 2VIRB 1G9ML 1YY8B 5DD0H 2PO6C 3S36X 2PR4H 4OV5A 1XGUA 2DQFB 4XXDB 5F7DA 4FQPA 1D7FA 2VDQH 4KKBD 2IANB 3IDYC 4V1DE 5D7IF 1FIGH 1C5CH 5I1CL 1EEQA 5LGKA 4AG4H 1FNGB 3UMTA 2C7UA 4WU5A 1J0JA 5F3HB 5FAAA 5FV2A 3WS3B 3DYMA 1KPVB 2H41A 1FG2B 3LDBC 2C3HA 4ZXBA 4OKVB 3BP7B 5KS9F 2JKXA 1XGRA 3ARED 1KLGB 5CGMA 3R8QA 2V7HB 2AXFB 4KVCH 4FQ1L 3SCMB 1FSKB 5INDB 4M1GL 2HFFB 5BRZB 2Y7QA 5GGSB 1A3RH 1K3IA 3O9WC 1IKFL 3LIZH 4IOIB 4MCZA 3EYVB 5AYUL 5CD3B 5HGAA 5HHMD 5SX5K 4E0RB 5F71A 1EEZA 1AR1D 5FK9B 3QULB 4NQTA 5EBWB 5ADPL 4X9IA 1UCBH 4TULL 4GO6B 3UTSB 3P4LA 4XVJH 3GBNH 3MRMB 3HMXL 3KLDA 5EA0L 2R0LL 2JJVA 3KPPB 1CLCA 4JY5L 4YPGB 1GRWA 5BOZG 4NJ9L 3IFPA 3TM6A 3VRIA 1T7YA 1HH6A 2B4CH 2ZUUA 2CO6B 3QIBC 5F6IC 2NY2D 2NY3B 5D1ZB 3UJTH 4YFDB 1H3PL 4WEBL 3H8NA 3MJ8A 1GGIL 3P0YH 1FL6B 1D5XB 4GMTL 4OLUH 4JANB 1RJYA 3JV5A 5BV7L 4NPYA 1G7IA 1AIFA 2FBJH 1TLKA 5B39B 4OFKA 5A16B 1AQKH 4OZFB 3BYTA 3CX5K 2ZG2A 2CDGA 2FATH 1EHAA 1RZFH 4KZDL 4PRDA 3K3QA 4DVBA 1JGVL 3JVGC 5GS1C 2G9HB 3WNPA 4JQIH 4X0KA 3T0ED 3MCKB 2CLZA 3ARFC 2BNRB 4BUGA 3QXDB 3T4YB 2P24A 3C2SA 5CEZH 4N1EA 2MJWA 3K8MA 4QKXB 1XZ0B 5I75C 1QO3B 1N7ML 1ULVA 1YN6A 1NLDH 1EVTC 3QNZB 4ZUVB 4G9FB 2Y06H 1FO0B 5GRJH 3U36B 4MDJA 1X6LA 4JPVL 1HSAB 3S5LG 25C8H 2YD1A 2D7QA 2AEPH 4OBSA 1B4JH 1U0QA 4M8QA 3B4NA 1AKJA 1YJDH 3UBXA 4NC1C 4OFYD 1S7QB 3GSWB 3WIFA 1B0GA 2X70B 1EEYA 1VACA 3HE7D 5EBGA 1YQVH 4G6JL 1T21A 3M8OH 2EYTA 4WW2A 3WIIL 3ZYOA 2CO7B 1OF2A 3O3EB 2LV4A 4IDLA 4R4BB 3VWJD 2WNGA 4NM8H 4GXVL 4OSUL 5E95B 4GAJH 4PP2A 3PWPE 5F93C 4UB0L 1N64L 4K7FA 1DFBH 1XF3B 3ZKND 3V6ZA 3GHBH 3ARWA 1FYTE 4GLRH 4HDIB 4NP4H 1QSEE 5JIPA 1KCLA 2H32H 3OKMA 4X4ZA 1FH5L 4Z7UE 1KB5A 4NNYB 5AAMA 4OF3A 3ZKMC 4GW1B 4QHNA 4YHPA 2KDGA 2WMPA 4KAQH 2Q86B 4GG6E 3INUH 1UWGH 4OM0H 1TNMA 3THML 3GMMB 4YHKL 3FAWA 1KJ2L 1F45A 4XCNB 1X3DA 3LH2L 2W9EH 5E1AA 4U33A 3IXTA 3GM0A 1QR4A 2ZWLT 2NYYD 4HFWB 2RBLA 3RVTC 3PIQB 4QRSA 5FA4B 3RIAF 4X6CB 4ZTOL 4PRHA 4NUJA 1NKOA 1MLCA 3ROOA 2BP3A 3GJEB 5FKPA 2YPKB 3LN4A 4PY8I 5EZJA 1QNZL 2OR9H 1BGXH 4FQXA 3VFVA 4EN3B 5F9WC 4MJ6A 1MREH 5J1AA 3EO0A 4FNLH 4MB4A 1FLRL 5BO1H 1MJUL 2P7TA 3LZFL 4PJIB 4GBXD 2EXYC 2AJVL 5CJBA 2WWKO 2VZ1A 2OMNA 1I1RA 4K7PH 1TQBB 2XA8H 3MREA 5F96H 1ZT4B 4OZHA 1A1NB 3RQ3A 4H88L 4PS4L 3VW3H 3DMMC 2JCCE 4Q7DA 3DUSB 2PW2A 5FKAA 4AEIL 4L4VE 3U30B 4JEGB 3DXAA 3FQWB 3V52H 3BWUC 1GPOH 5CIPH 5ISZE 5E5RB 1NGXA 4UI2A 1NJ9A 1U8JB 4OCRH 2YKLL 5T3ZE 2KQMA 3U2SB 3WLBB 2NPLX 1TXKA 5IMLA 3RL2B 5HYFA 3UAJC 1IAIM 2EKJA 4QNPF 5ETUA 3BYYA 5F6HJ 3RGVA 5HHOD 2EZ0D 4JRYD 1CFSB 4MQ7B 1RK0B 1ED3A 1IC4L 4OLEA 1FV1B 4XMKH 4JO3H 5IOPB 4PJBB 2ZUQC 5K9QI 5JQ6L 5CLWA 1OD7A 4P9ML 3UTTA 3TZVA 4GRWF 4GW5A 2HKHL 1CG9B 4JHWL 1NCNA 4M43H 4YHOH 3IFNL 5IQ9A 4ODUA 3MA9H 4Y5YC 5HDOA 1VFAB 1EFXB 3JZ7A 4MZ2A 4ZOBA 4YAQA 4Z7OE 4Z77A 1ETZA 2I24N 4PRIE 4NKMA 1HQRA 4MAYB 3DX8B 2YN3A 4U1LB 1HILB 2DTMH 1WWBX 3SE3C 1UJTA 4Q9RL 3OKOA 1OHQA 3LRGA 1AY1L 3FB5B 1T1YA 4HIXL 3RUGF 3GDBA 1Z9SA 2H3NB 4DVRL 4HBCL 1FL5A 3U0PB 4DGYL 4LMQI 1JMZA 5HBBA 3MLSL 3NFPA 5TGBB 3HAEH 2H2SD 4KRMB 4F2MB 3O3BA 5T1LB 1IQDA 3V5KB 1W72A 4NKIL 3T77A 3RBSA 1P4LB 1M1SA 4PBVC 1OP9A 5JOPD 3C2AL 5BVJA 1AGBA 4KROB 4PRBA 5KOMC 5DJ2A 3S3JA 2H6PB 1B6DA 1HKFA 5GGRY 2OQJA 5TE4L 2GJ6D 1TVHA 4R96B 1N59A 1OAQL 3DO7B 4ZTPH 5EO9A 2ZP0T 3X14A 2WW8A 1FFPB 3BUYB 2W60B 4I4WB 1DVFA 4FZ8L 3MV7B 2DQEH 1XAUA 2ZPKH 4ZUWA 2OTWA 3VFMB 2VWEE 3N85L 2X4OB 4M5ZH 1P2CA 2UWEF 3QUXD 5F89A 2IMMA 4ALAL 3VFGL 4JFHE 3Q5OA 3WUWG 5LQBL 5HXMA 4TVPL 4FQHB 4U1GB 3QUYC 5C0JA 4GKSB 1P4BL 3EHBC 4K3HA 3T3ME 3RWEB 1RURL 4KVNL 4G5ZL 3OG4B 4PJGE 5DD6B 3TVMC 4Z95H 1CL7H 5BMFL 2WK2A 1T1WA 1FE8H 5HGGS 2IWGA 1QR1A 2UVFA 1RAMA 5J13C 3K74B 2EYRB 1OM3H 3CFCH 3SCMD 1IGYB 1MCOH 2F5BH 4LK4A 3SY0B 5IIEB 3MBEB 1F2XK 3IDIB 5BRZD 3FO2B 3PGFL 3GHEL 4MA1C 4BFIB 4JFZH 4GRLA 1ZANH 2LTQB 5C1MB 4WHCA 1GGBL 4Q97A 4U1JA 4U6VH 1C7TA 4FFVC 1FDLL 1J1PH 4HT1L 5GGTL 3RWJB 5FEBA 3S35H 1V3MA 2R15A 4GH7B 1I3GL 2IALB 1XF2B 3MYJA 4NZRL 5HPOA 5EU7E 1AP2A 5JNYA 5JW4R 3MOAL 4NQDE 3CZJA 5AYQA 1VEOA 2PNDA 5D7JC 3U9UA 3G5XA 3QDME 1MCIA 1OAYL 1RZ8A 5EC1B 3RWHB 4NZJA 5C71A 2EEAA 2DS4A 2NY3D 2R9HC 4KJQD 2UY6A 4FMFA 4UINH 3FQXB 5FGBA 3RVVC 3GJFK 5I8EB 3RWFA 3IS0X 5HSFA 4UIKH 4K71B 3L5XL 4UTAH 1UM4H 2RGSA 3IDJB 2F54B 3KPMB 4M9PA 4EZMA 3KPQB 1MFBL 4WIQA 3KPLB 5KZCD 3H3KA 5MI0B 3ZYIA 4Z7UF 1M4KA 4UZGA 1BVKB 1CICD 1J8HE 2Q20A 4JQXC 1G7LB 3V7AE 4MA3B 5FYJL 1HIML 3LKSA 1BM3H 1AGFB 4GT7A 4GG6F 5BJTB 5J12B 1JZ4A 1NC4B 4YHZH 1QA9A 4QHMA 1IM9D 3LQZA 1ZLSL 15C8H 3V7AG 1HK6A 2BSRB 4FQXD 3GSQA 5E4IA 1NCWL 2XN9E 4LF3B 1CDHA 5L2KB 1F13A 1F6FB 1VPOL 3V0WL 4LHUB 5IB3A 2R4RL 3AMKA 3I84A 1X5FA 4M4PA 3FOLB 3RFZC 2VLRE 5HYJB 3Q5TA 2IAMC 4IRJA 5JZ7C 1J7VR 5E9DD 4LLUB 3ULVL 2VR9A 1S9WB 5EU3A 3WE6B 1PG7L 4KXZH 2ZUTA 4MXWH 4NHUB 3ZT5A 3MLWH 1E27B 5T3XH 4DOHB 2HT3D 4YH6A 2IBGA 3IDUA 3AY4A 5HJ3B 3MFFB 4M7ZC 5EU5B 1J1XH 1ZEAL 1TJGL 3BQUC 4X7DC 1A6WH 1EVUA 5F7UA 3JV6B 1MLBB 3MUGB 2JCCF 1JNHA 4QRQA 3MBXL 4JY6B 1U3HC 3ZYZA 4OZIB 1RZJC 5JDSB 3QUKB 1FLTX 2E6QA 3LVEA 1SQ2N 5LGJB 1F4YL 1FZOB 4ODSH 2Z31C 5BS0B 4MMZC 1NEUA 5I8OL 1CK0H 1HHIB 3G6AA 1GOGA 3WXVH 1T0NA 1GZQA 1ROWA 1A6AB 3VXQB 2YUVA 2DIAA 3PL6A 2A83A 4GLRI 4L8SA 3HMXA 2XZAH 1Q72H 5HHQA 2BCKA 2XZZA 3ULSA 4Z7NE 1A7NH 1NCBL 2QSTA 1BEYL 3KPSA 2HTLC 3U79A 4N90D 4U1IB 1MFNA 4D0BA 4JE4B 4ODTL 2ICES 5DDHB 4U7MA 4W81A 3JUYA 3L6FA 3HE6A 3QUMB 4EN3D 3H9SD 5KVFH 4A6YL 5IHLB 4D9LH 3RAJH 4ZOEA 1S9VB 4F58L 3MCG1 1A1MA 2W0FB 4P9HC 3MJ6A 1FZKA 1NC2A 2F74A 5J9PB 1OAUL 1R5VA 3ARSA 4MHHG 1BQUA 5KN5B 4Z7OF 5GS0L 2DQTH 1WWWX 4KKBC 3ET9F 1CT8B 3LEYH 4TSAH 1H8NA 2AABL 1LDSA 1KB5H 2ZCKH 4JRWA 3BN3B 3O3AA 1JZ6A 3RNQB 3Q6FB 3D2UA 1JWUB 1MRCL 3BGFB 2ZKHH 3VXRE 2A6DB 3VFWB 5HVFB 1D6VH 2I5YL 3FRPG 5E08H 3O4LB 4JFXB 4JKKA 1YEIH 4LVNB 5ID0A 3QPXL 4XNXL 2AEQL 2EICA 4TQEH 5AZEL 3HZVA 1HH9B 2OP4L 4X98B 3VG0H 4RSVA 1AR1C 4GRMB 4JN2B 3DX7B 4CU6A 1FCCA 1UXSB 1F90L 4C58B 1MFEH 4ZO9A 1W0VA 2HA1A 4NO2B 4QRRA 3A6BL 2IADA 4E5XB 1GGCH 5ACZB 1XF4A 3SO3C 5D70L 3GKWH 4NSKB 5E2WH 1QD0A 5IK3B 2BFVL 2XRAL 4G8GA 3BPOC 2FB4H 3DX9B 2XOTA 3QSKB 2NY2C 4OF8A 2N4IA 2HP4A 1S7WA 4JCMA 3MV9A 1EFXD 3HCVA 5DS8B 2VZVA 5HHVL 2AK1H 3FO9B 3UDWC 3EOBA 4HF5H 2I9TB 5I1JL 4UOW1 1CE1L 2AI0L 2EXWC 3GMPB 5TH2B 4GKNB 1TCRA 2C3GA 4CBPA 1FG9C 4NKDB 5C07D 4XI5D 2XNAB 3T3MF 4XRCA 4QHLA 1PX3A 2ZJSL 4G7VL 3V4VL 3G6JA 3PWVB 1KJ2A 4N0UB 4PJGF 3OJDA 4GSDL 1YEFL 3GIVA 2D31B 1NMAH 1U91B 1RK1A 3DV4A 1L4IA 3CFEB 1NCDH 5IF0A 2QBWA 4HKJB 1KT2B 4I0CC 4NQCE 4CGTA 1QPXA 1A9BA 3WFDH 3HI5H 4QXGH 5DQ9B 3FFCE 3CLFH 2IBZX 2MTPA 1ZS8A 4CN4A 3MRPA 4O2CA 3HNVL 4M1DH 4R7NA 1DE4A 4N5ED 5DT1L 5J11B 2A6IA 2GJZB 1QRNE 3O3UN 3HE7C 1VERA 2YRZA 5SWQB 3KJ4B 2DM3A 1UACH 2BC4B 3U9PH 3MV7D 1EDQA 1WCBA 2FBOJ 4UQ3B 5E2UH 2R2BB 3CUPA 3TYFA 3VWJC 4G6AC 4BA8A 2H32B 4RGNB 3OKLB 1RVFH 4NJAL 3R4DA 1Y6NR 5EOQL 1RU9H 3HNTL 4LSVH 3TO2B 1ZGLB 1JYVA 1R3IL 3ZKNC 5I1IL 4W4OC 4YGAB 1E4WH 1EERB 1XIWA 2UYLA 3ARXA 4OUUB 4HH9B 5CHNB 5C86A 2LQRA 4PJEA 1IGJA 3IXAB 5DQJB 1QFWM 4C83B 5LVEA 4P46B 2X5PA 3D3VD 2AGJH 4NFCA 4KTDH 2IQAB 1OTTD 3VU2A 4EI6B 3WJLC 2L7UA 3MRRA 4PJHB 4RMSA 5DJAA 1PDKA 4P59L 4S1RH 3KPRD 2UY7A 5FB8A 1T7WA 3WN5A 4YFLF 1BBJA 2WIIA 2O5YL 4NYLB 1WQVT 3S37X 3UPRB 1W72H 2E7LA 3I50L 2JB6B 2NYYC 4Y8AA 2RCSL 1CFQA 2VDKL 1U9KA 5E8EA 1S7UB 1N5YL 3ARGC 1BFSA 2DWEB 4OJFL 4HQQL 3WNMA 3BEVB 4DZBA 1MELA 3NZ8A 1EMTH 1AD0B 1L0QA 5I6XC 4YUEL 3VXSB 2H2PD 1AJ7H 5GIRB 3NAAH 4ODXB 3R06B 2KPNA 3NPSC 5I1AB 4YK4B 5IBLD 1OGTA 4YFEA 4PREB 2ZSWA 5DLML 3MNWA 4GBXC 1PZUB 3IJSB 4L3EE 3SDXE 3SKOA 5CIPB 1Q9WB 4X9FA 5GRUL 2R69L 5JXEA 4NZTH 1EHLH 3WHXA 3QCTL 3ARRA 5IMKA 2GUOA 5FO9A 3D5OF 3IU4H 1X4YA 2DAVA 2OI9B 2XWJB 1S7TA 4F9LA 5ILTL 4HEME 2F54D 1QZ1A 2AAVA 5HI5D 3QEQE 3FOMB 2W0PA 2R1YA 5DUMH 1Z6JT 2RB8A 2YR3A 3QQ4B 4MS8D 1FVEA 2BX5A 2YD4A 1NMBH 1T5WB 3G5ZB 4WHTA 1EO5A 3OZ9H 5EUOB 4IIQA 4NWTL 5ACMA 4WUUA 5SWSE 1ND0B 1NUFA 2EIEA 2O5XH 1NGQH 3G9VA 2O5ZH 1MAMH 1INDH 2ED9A 2EZ0C 2G2RA 3ZKSD 4M6AA 3BHBA 4EOWL 4LPYA 2HJFA 2W92A 3TN0B 2P49B 4X7TB 3GMLA 4Z7WE 5FCUH 2M1KA 4L4TE 5FDWA 4Z7NF 3ILPB 4P2YA 4LHUD 3HLAA 2R4SH 1FFQA 1JPST 2HG5B 4MAUL 3QFJE 5JXAH 2XKNA 4JZOA 4F7MB 3CU1A 1U41A 3FB7B 1L0YA 1PG7W 3PNWB 1JPGA 1V3JA 1A47A 4YXLH 2XQYK 4WU7A 2XWBB 1MFDL 2R29L 5IB2B 5C0AE 3OJMB 2AK4E 5C0BB 4YHNA 3HAEB 1TPXC 3QNXA 4PGJA 1X5JA 3HS0B 3DVIA 1BX2B 2D7MA 3DUUA 4F8QA 2ITCB 3QAZC 1WF5A 2Z92B 4I2XB 3C5SB 3U0WH 1FFOA 3KDMB 1K4DB 5I71B 5FO8A 2R1XA 4P23B 4WWKA 2H2SC 1XMWA 2ESVD 1CLOH 4IJ3B 5BS0D 3PE9A 4KXZI 4TSCH 2VYRE 3VH8B 3P77B 5GGTA 1U8HA 5DWUL 5CUSH 1QBBA 2LFGA 1C5DB 5IJVA 1UKTA 3LPFA 2VAJA 1SBSH 4WTXA 4MD4B 1QFUH 1MCWW 4LPTA 2DLFH 3UZVB 1RZ7L 1T7XA 3STLB 5IR1A 5CJOH 4OM1H 3TEUA 2O61B 1I7ZB 1YZZA 2P5WE 1BLNB 1G9MH 4MDIA 2UZIL 3GSRB 1B2WH 2XG5A 4XPGL 1ITCA 1PKQB 5M7QA 5F7NC 5DD3L 2Q6WA 3QUXC 3HG1B 5I1CH 3CVHL 3RDTA 1DQTA 4D94A 4I9WD 4KKAD 1A02N 4LLMA 5EPMB 4KRPB 1QSVA 1FAIL 2BSSA 1QACA 1JHLL 3UBXI 2XKUA 4HIIB 1R0AH 1RIVL 1JIBA 3EFFA 3LSOB 4F37K 3OX8B 4FQ1H 2IEPA 1HSBB 5DTFA 4M1GH 1G7QB 4X9BA 3RX8A 1UEMA 4NKQB 3NFSL 3Q0HA 3UO1L 4P4KB 5ITFB 1IKFH 1A14H 4MNQA 4X6EB 3RZCA 4OZGE 5B22A 2NR6D 3PWLA 3LB6D 4S0SD 1PZ5B 4WHYG 3SCMC 2X10A 2EECA 3BIKA 1N3NB 5MHSE 2YD8A 5F9DC 4QT5B 3DHJA 4TULH 5C9JB 2X4TA 4RIRB 5KSAA 1IC1A 3HMXH 1GIGH 3RPIA 2JE8A 5EA0H 2R0LH 2I07B 5FV1L 4JRXA 3VG9C 1R5IB 3PHQA 3WNNA 2KZWA 3FB8B 4NJ9H 4MVBD 3GBLA 3LQAL 3NCBB 1W0YT 1XGUB 3TPUA 4IRSA 3W5NA 3NTCL 1BREA 3MLTB 5L8JB 4U6XB 1H3PH 1L6ZA 2DQIL 2IANE 4WEBH 2ADJA 4Y4KD 5I18L 1GGIH 3OKEA 4LBEB 1FYHB 2CKNA 3QH3A 1OCWH 4WU5B 3H2WA 2D2OA 1OSPL 4KFZC 5BV7H 4ZXBB 3REVB 5DHVA 2VQTA 2GSGB 1V05A 3T1WA 4Y89A 4LCCA 5BW7A 4FA8A 1JGVH 1UB5B 3QA3A 4DUVA 5BZWA 4F33A 5HGAB 1HOCA 3S8WA 3EJJX 4P3DA 4HHAA 1CICC 5F7LB 5T33L 3CXHJ 3TNNA 3QCVL 3ZTJG 4HUVB 1BWMA 2XZCL 3N1QC 1T03L 3UTSE 4JPVH 4OCMC 4U0RB 1E4XL 3T2OA 2XFXA 5B3NA 1PAMA 1BJ1J 1J5OL 5HVHB 4FQXC 3D0VB 5EO1B 5TDNB 1AXSA 4YDJA 3SE9H 3U0TA 3VRIB 1YEDA 1HH6B 1IM3A 3L3KB 4JDZA 1EX0A 4GUPB 3QYCA 5FECB 1I1AB 3P9MB 2ENYA 5TE6L 3WIIH 4A6YA 1X5GA 4QY8A 1AXTH 4PV9A 4W6XB 2CK2A 5IT2L 5JXED 4KGLA 1RJYB 4HLJA 4GXVH 3QUZB 3QEHB 4UB0H 2P5EB 1N64H 2ZOKA 4R9HA 2CIKA 5IB1B 3F6LA 1IAOA 4UNVA 3U4BL 3SDXF 1RULH 2CDGB 2HT3C 3IS1X 3WFBH 3NZHL 5GXBB 1FH5H 4JM2F 3JXAA 1OTSD 5B39G 5BZDA 5DQDH 2UVEA 2CLZB 2MOVA 4ZFFA 2BNRE 3S97C 5IGXH 1RY7B 2CH8A 1I8KA 3U7WH 3VXOA 2V2XA 3RGVC 3THMH 4U31A 4P46D 4YC2B 3MUZ1 4YHKH 1QQDB 5IB5A 4G9FE 3LH2H 2FHBA 4CJ0A 4K9EL 4M8QB 3DECA 3OL2A 5DRXA 4D9QD 4LKCA 4XMLL 4CW1A 3RVWD 1JTOA 2C3VB 4ZTOH 3WIFB 3C08L 1B0GB 3S4SG 3WO3B 1G7MA 4KKLD 4POUB 1VACB 3L3IB 3OHXA 3WD5H 3HMWL 1T21B 3D0LB 4KHXL 3VWKB 3DRTB 1OF2B 1DDHA 4J23A 4JDVA 5CP7B 3NFNA 4NUGL 1FLRH 1SBBA 1MHHB 1VFBA 3FN0L 2W0KA 3LZFH 3TBVB 4K7FB 4XNQA 2AJVH 4KDWA 4EN3C 1J10A 3HZKB 4NT6A 4MSWB 4H88H 4LSTL 1JTTA 4PS4H 1KB5B 3LEXA 2GFBA 4AEIH 4QWWD 3W39B 4EI5A 5DC9B 4ZFGL 1R3LA 1J12A 4WY7L 2HLAA 4XGZA 2AJYL 2EIDA 2YKLH 4GQ9H 1MNUL 2IH1B 1JZ8A 3B6SA 3L3JA 2D7PA 1RZIB 3KXFA 4WWKD 5E1AB 2HRLA 3BH9A 2DN7A 3IDMA 3BESR 4NHCL 4KRLB 3RX7A 4PGDB 1HHJA 2WP3O 4QRSB 4QCIB 2VLJE 1H3WM 1MLCB 3LS4H 4XP1H 3ROOB 3VXMA 5FKPB 1IC4H 4OCXL 1GC1C 2YS4A 2NMSA 2VDML 3DWTA 3WL9B 3EO1B 4ODVL 3MRQA 1UXWA 4YR6A 3VFVB 4XB7A 4LSQH 3GI9L 5IEKA 3BT2L 3PQYE 1UFUA 5J1AB 4Y2DD 1YYLL 4JJ5B 2HKHH 1J86A 3WIHH 3HA0A 5JUEL 1KG0A 1DVFC 2GT9A 4J4PA 4JHWH 2A77L 3BIBX 3DI2B 4NN5B 4PJIE 3W0WA 3IFNH 5MERA 3VD9A 3I02B 5E56A 5F1IA 3MREB 1R6VA 1MRFH 4TOYL 5I1KH 4OZHB 1ES0B 2G60L 4LPUA 1N5AB 5FKAB 2PW2B 4GS7B 5I73B 3DXAB 5DRWB 1CGSL 3BO8A 3GSOA 2J2ZA 2OJZL 2QQKL 4JPWL 4O2FA 3S34L 3EYUL 3DI3B 2KBGA 1NGXB 4JO2L 4OGXL 1NJ9B 5CKAA 5C0ND 1EEUA 4HIXH 1OL0A 3GUTA 3ZLQC 5IMLB 3IVKA 3K2UL 4MNQD 5ETUB 3RZCD 5FUZL 4RX4D 1MSPA 4X5XA 5JHDB 3AGVA 5C0BD 2H8PB 3X12A 3PGDA 4XI5C 1NGYB 3QCUH 4G3YL 4YDVA 4KI5E 2F53E 5J6GA 4ONGH 3B9KA 4R4FH 3FT2A 5CSBA 3DUHA 5KSAD 4OZGF 1WIUA 3PWUA 1IGCL 3UTTB 1UADC 3RKDD 3C2AH 4D9RE 5KG9A 1FGNH 3TZVB 3SDDA 2PYEA 4R90L 3K80A 1N8ZB 4Q0XL 5ICZA 5IFJA 3SGKC 4OLXL 3HUJE 5TE4H 4WNQA 1TQCB 4RFOL 1JRHL 2P47B 1OAQH 1MCDA 4FFZH 1RIUL 4NN7B 2GAZB 4ODUB 4PRPA 2OZ4L 4A2LA 4ZQKA 3T65B 4UQ2A 3LV3A 4FZ8H 2DM7A 4YAQB 2VISA 4FXLA 1ETZB 4EUPB 4BZ1H 4P5MA 3CDYA 4X99A 4NKMB 1HQRB 2YPLE 3N85H 1OD9A 3FONB 5D9SA 1EZVX 5EU4A 3ZE0E 1BJ8A 1H8SA 3NABL 2FL5A 3VFGH 4LVHB 2DQDL 3SGJA 1A6VL 4NFDA 4HKZA 4OFVA 4TVPH 5GSRA 5DMKA 4JGJA 3HG1D 3TH2T 3BKML 1P4BH 2XWTB 3PABA 1RURH 4TYUA 4G5ZH 2NX5E 1NDMA 1UB6A 5BMFH 1F2QA 3O3BB 4JG1L 4HIHA 5F7EL 4YIQA 4C55A 1KPUB 1W72B 3W81A 4O58L 5AD0A 1CXKA 1OTTC 3E6FA 2AJSH 4I0KA 2ICWA 5IMMB 3EBAA 1AGBB 3PGFH 3GHEH 4PRBB 4Y1AD 2C26A 3L3HA 1I8IA 1GGBH 2OQJB 3C09B 1G0XA 4B53A 3LMJL 1F58L 4HT1H 5GGTH 3X14B 2LVCA 4P2OA 1DL7L 1WZ1L 1KIQA 3ZE2E 1OW0A 1BMGA 1I3GH 3CSGA 1DBML 4WTZA 5SWZD 4NZRH 4Z78A 2NTFA 4FTVD 3FT4A 5IQ7L 3P73B 1P2CB 1XGPA 1OAYH 2IBZY 2H2PC 3DGGB 3QWRA 2NLJA 2H26A 1ZVHA 3VI3E 3AY4C 3FRPA 5IBLC 1F11A 3D39E 5C0JB 2F58L 3W9EA 2ENSA 3J7HA 1ADQL 4FXGA 2X4NB 1ZLUH 5GRWA 5LCVL 5D5MA 1WBXA 1WJ3A 1MRDL 1QSZA 3HNSH 5KAQF 2GK2A 4LLYA 3QXWA 3BAEL 4KK8C 1LP9A 4E41D 1F5WA 1JVKA 1HIMH 1AO7E 5FYJH 5HI5C 4GRLB 3IFLL 3MLXL 5MEOB 1HN1A 4MS8C 4U1JB 1AGCB 4ONFL 3BRGC 3BZFB 4L8SC 3NCYS 4MWFB 1IEBA 4LSUL 3OSKA 3S36L 3MUY1 5CFHA 1CLZL 1RV6X 5J12C 1AC0A 3B9VA 4HH8A 4N8CL 1VPOH 3U9UB 2R4RH 2Y5TB 3KNBA 1MFCL 3KWWA 1XCTA 2NW2B 3PF2A 5JW4M 1J0IA 1GXEA 3BXNA 3HE6C 3OV6A 2J5LC 1OSZA 5FIEA 2OK0L 3MXWL 2QSQA 3I75A 2QKIB 3SDAB 4DGIL 5TF1L 1I1AD 4LLDB 3ULVH 1KLFA 5BV7C 2PN5A 1PG7H 5K9QG 3RWFB 2E7BA 4NIKB 3CVHA 5ESQB 1T1ZA 3CFBA 3QUZD 2YA0A 1I1FB 4Y5XB 1MCCA 5DHVH 1ZEAH 1OAZL 1TJGH 5IBUB 3MOBH 4QXUL 1C7SA 2YC1A 4CMHC 3MBXH 4NWUL 1CE6A 3LKSB 1EAPB 1U8NA 3SQOL 1FNHA 1NQBA 3B2UC 4JG0L 5JR1H 4M93B 1F4YH 3JWOC 3DBXA 1TDQA 2WQRA 1V7ML 3TF7C 5I8OH 4JFDA 4P3CH 1M6OA 4RCAA 2V17L 2VSCA 3C9NB 5L2KE 3ETBF 1R5WB 2WANA 3BGMA 4GXUM 4DGVL 2J8HA 5F1OB 3T2QA 1TZIB 1DBJL 4N9GA 5FA3A 1NCBH 3MFGB 4RNRB 4JFEB 1BEYH 5EIQA 4G9DA 5HYJE 4IRJB 1CS6A 5ALBL 5GGRB 4D0DB 1KYOJ 3B2VL 1P84K 3IYLW 1A7OL 3VWKD 4A6YH 1N26A 1T6WA 3C60D 4PJIF 4EIZC 1ORSA 2JJSC 1OAUH 1MUJB 1YECL 1VHPA 1OQXA 3OAYH 3HC4L 5GS0H 3GFUA 3U4EB 2C4FT 2X9XA 1DR9A 5I16A 3WO4C 1T20A 3O2VH 4KKAC 4OZIE 1KULA 3VGDA 5EIVA 2AABH 2AJUL 8FABA 1C8PA 4Z8FH 4B50A 5DRZA 5F8QC 4JREB 4K8RD 3O41A 5IKCA 2GCYB 3G6AB 1SJXA 3BX7C 2X6MA 5JORB 4PJ5A 1MRCH 2I5YH 1JYNA 2A83B 4OQTL 4RMWA 3VDCA 2CD0A 2NR6C 1UH3A 4KI5F 3LB6C 3QDGD 3WKNA 3QPXH 4XNXH 2AEQH 5HHQB 2OP4H 3KPOB 3Q5YA 3KPSB 3BGFC 3OR7A 5C0GA 3RWGA 2AEIT 4C56D 1WISA 4KHTH 5DVLA 1F90H 3NCCB 2B20A 2W07A 3BUTA 2BY2A 4LVNC 3L6FB 4M02A 4B41A 3HUJF 4XP5H 4EVNB 5TQ0L 1SEBA 3TJEL 2APVA 3RTQD 4QOKA 4XC1L 4ZPVA 1QFWL 3VFTB 1FZKB 2F74B 3MOQA 4XP9L 2BFVH 1D5IL 1JZ2A 2AW2A 2XRAH 4U1HB 1AXIB 2VB5A 1F3JA 2XI9A 3E0GA 5KVMC 1I1CA 4HJJL 4OCYH 4Y4KC 1D9KD 1JNLL 1HCFX 3ZE0F 1U92A 5HHVH 3U7YL 3VE0A 2VLMD 5I1JH 4S2SA 1CE1H 2AI0H 4LVEA 2Z93A 3CDGA 3O3AB 1MPAL 1URLA 1NFDA 2ZJSH 5GJTL 4G7VH 3V4VH 1CGXA 1GCFA 1FQ9C 2BHUA 4GSDH 3O4LE 1YEFH 3RX5A 4I77H 5JHDD 2R2HB 4CU7A 3TO4A 4DKEH 3L5JA 5I0ZA 2BVQA 3NGBC 1FVDB 3SDCA 1Z5LB 3VD4A 2HFEA 4YE4L 4L5FL 3M07A 1KENL 3ZKXB 4Y16A 4RISL 3CK0L 5I30L 3CFKA 1SM3L 4QRRB 2AV7A 1P6AB 1NANH 1IAMA 1P7HL 2PW1A 5GGSY 1XF4B 3HNVH 3JTTA 1KEGH 5HHNA 4HWBL 5DEGA 3ZE2F 4F7EA 1MI5D 1ORQA 3C5ZA 4G8GB 2WIMA 2JJWA 5FYKL 4JPIB 4HG4J 1C1EL 3MUHL 3P3YA 4UUJB 1T66D 1MCEA 3HCVB 4J8RA 1KXVC 4Q6IA 5E00B 3WFHB 3SJVA 1UYWH 3CFJA 5JXEC 2FZ3A 4NJAH 1XF5B 3EOBB 4HUMB 1A1OB 4HWNA 3HNTH 1R3IH 3VI3F 5I1IH 3U82B 2D0FA 3PHOA 3KAAA 4N0FA 4MXVE 5CEZE 2B0SL 3KR3L 4LEXL 4FFYH 4XRCB 1AR2A 3ULUH 3WKML 4TUKH 5DK2B 4BH8A 3G6JB 3RZWA 4N0UE 1IZKA 3IJYA 3OJDB 1OTSC 4MXQD 4M48H 5EZIL 4P2RE 2KKQA 3DV4B 1BJMA 2Q7YA 4FP8L 5FGRA 3NCFB 1HQ4B 4IIQC 5IF0B 2IFGA 5IG7B 2O5YH 2VLKE 1EGJA 1BPVA 2L0DA 4H1LG 4P46C 2R2CA 1JN6B 4MJIA 2BRQA 5C09B 2V5TA 4YHIA 3IAQA 1GGTA 1WV7T 1I7RA 3HC3L 4M5YL 1BAFL 2RCSH 1BFVL 2ADIB 2VDKH 3RVWC 3REWA 1DBAL 5JPMA 2F19L 5K9OA 5D2NC 1N5YH 4OJFH 4OCSH 4HQQH 4KKLC 3QIUA 2GQHA 1KUMA 5DJYA 3S88L 1P7KA 1HXMB 3B5GA 3V6BR 4YUEH 1T2JA 1HHKA 3NCMA 3CUPB 1VA9A 4HIJB 2C1PB 4OTXL 4RGNE 3MRLB 1XR8A 1AC6A 4OLVL 5DLMH 1UJ3B 4Y4HB 4AEFA 3SBWC 2UYLB 4JFFA 5D7LB 5GRUH 4PJ8B 2R69H 3MJ7A 4RBPK 1DQJB 1KEML 2O93L 1EHNA 5EORL 1AHWC 4HUWB 5C0CA 3QCTH 1IGJB 4LP5A 4PJEB 4YLQT 4PJAA 4GRWB 1VADA 4QWWC 3MRRB 4JKWA 1KLUB 5ILTH 3BN9C 4X5WB 3VCLB 4QRPB 4AYFA 3WN5B 2JIXD 1P5UA 2WIIB 5FM5M 2VN7A 2MCPL 1JE6A 4RMTA 2EH8H 5LGHL 4WWKC 3UZEA 3BVNA 4XCFL 1IGMH 1ZHKB 4ZFZB 4NWTH 4XB8A 3DJ9A 3OMZA 3M1BA 2JTDA 3MV8A 4IS6A 4YDIL 3TBWB 1RJZA 1Q9OA 1RZKH 3EYSL 4DZBB 4WI6A 3NZ8B 4RFEB 4XHJD 5EIIB 1S8DB 2DQHL 3VXSE 4Y19A 2OZ4A 5H8DA 4H25B 3E2HB 1DQDL 4Y2DC 5IW3A 4BH7A 4CRPA 1YUHA 1OGTB 3V4PH 3FRUB 5F7HA 1HINL 1NAML 3GMNA 3MNWB 1IGTA 1QSFD 5E6YA 1FRGL 5L9DL 4RMUA 5B8CA 2CRYA 7FABL 3UYPA 3WHXB 3O3DA 5FO9B 1I9IL 2J8UA 2L7JA 1QG3A 1RFDL 1MFDH 2R29H 1K4CA 5CBAA 1FVCA 2Y07L 4QTIL 1HYSD 1WWAX 5C0NC 3QO0B 4OZIF 2P45B 4WHTB 3B9EA 1BQHA 3RZCC 3I2CL 3OR6A 3VD5A 3LKPB 2IPTH 3D69A 3R1GL 1UEYA 2UUDH 1KJVA 1K8DA 2G2RB 5DMIH 3BHBB 5HHPB 3DO3A 4JO4H 1HWGB 3QZWA 4EDXA 4YWGL 5KSAC 1BVZA 1JP5A 5DWUH 5I71C 3RKDC 3EDKA 3T4AA 4HMCA 3IF1A 4FZEL 2E7MA 4JLRA 2OSLA 4JFED 3K4DA 4K3JL 5FYLD 2ZG3A 1S78D 1XFPA 2V5SA 4J7RA 2QHRL 2UZIH 2ARJQ 2ZOLA 3RUGA 3C8HA 4ZPTB 3S5LB 3MMEB 2PXYA 4WU7B 1I9RL 2IPKB 3MPCA 5DD3H 3ZTNH 3HRZA 1WEJL 5FUCE 3CVHH 1ADQA 3ARVA 2R23A 4YHNB 3QFDA 5D7KD 2C9AA 3TH3T 4YNYB 1KC5L 2K1MA 1FAIH 2AXHA 3AC0A 3DUUB 4X7EC 4K3DL 4L8DA 1RIVH 3L5IA 1DUYA 4LHJB 3TO4D 4QRTB 1JHKL 4DEPB 5IFHL 2R1XB 2HVKB 3NFSH 3UO1H 1IT9H 2FGWL 3TBTA 5ELIA 2AEWA 3EO9L 5E8DL 1OARL 4YXKH 3GGWA 1AFVH 1Z9OA 5IV2A 5F3BA 4N1CA 3PWPB 1LO5A 4J2XA 1BD2A 5EWIH 4MGXA 1A7BA 2DKMA 1JPSH 1V5JA 4CMMA 4RGOH 5IR1B 4KJWD 2UWEA 5KOVC 4ZUSB 5I9QB 1ZLUK 2YPVL 3LQAH 4MDIB 1KV3A 3QDJD 2PYFA 4X4MA 4Q2ZA 3ECBA 1KTLB 1KCRL 43C9B 4XHQA 3UZQA 3NTCH 2NY7L 4GG6B 2Q6WB 2DQIH 3O9WA 4NO5A 5F9JB 3VXUA 2X44D 1EA9C 5JOFB 4XNUL 2G75B 3EJYC 1NCAH 4KH2A 4U6HA 1JWMA 4ZNEA 1U42A 3QG6B 4MXVF 5INCB 3O81A 1SYVA 1T0PB 1TTFA 3QDHA 3SKJL 3TJHC 1MHEA 4MJID 1LEGA 4R0LC 5T33H 1O7VA 2WM0A 1Y18A 3ZKQD 4LFHD 5MP6L 1P9MC 5D2LA 2GIYA 4XMPL 2CQVA 4FQCL 3UPCA 4PRAB 1E4XH 3TBSA 4P9HL 1J5OH 4L9DA 5J1SC 1T2XA 5FCSH 5IHUH 5HDQL 3F12A 4ORGA 4U0RC 4Z76A 3HI1A 1NDGB 4IRSB 5J8OA 4S11A 3RA7L 3AVEA 3VXTB 3O6ML 1FZJA 2ADJB 1MAKA 3GO1H 1MY7A 3JVGA 5GS1A 5HVHC 3OKEB 1T2QL 5TJWK 4JFFD 3MLYL 3ARFA 5IT2H 2R1WB 4R26L 4OZ4B 1E0OB 1IAIH 1S9YA 5C0IA 1AE6L 1F8TH 5DHVB 2QL1A 3FCTB 1KJMB 2FJFA 5C08A 3NZHH 2LVEA 5GGUA 5KJRL 3CSBA 4AENB 2HVJA 4NN6B 1HOCB 1LWRA 2VXVH 1AGEA 4Z0XB 4HHAB 4HPYL 2W9DH 5MEPB 4U05A 1SMOA 2QSVA 4QO1A 4BSJA 1ZA6B 2FWOA 4V2BA 2DLGA 4CKVX 5F72S 4OQTA 5J7CC 1NBVL 2WUCL 4K9EH 4PLJD 4NDMA 3JWDH 5ADOL 5IFAL 3C87A 4G8EB 4XMLH 4XP6L 3KLHD 2MKWA 1BZ9A 1NSNH 2N7AA 3FT3A 4PRIB 4YDJB 1P1ZB 5C09D 4H0GA 4LEOA 5J89A 1FNAA 4JM4L 3OAYK 1JGLL 3MRHA 5HD8D 3LD8B 3P2TA 5KSBA 3OAUL 4KHXH 4QY8B 4PV9B 2FO4A 3L3OB 4Z7VA 5T3XE 5L2JA 4FS0A 1F02I 1LO3L 2HJLA 2YA1A 2VZTA 2OMBA 4U3CA 2P8LB 1IAOB 4KMQA 4F15B 1T89A 4Z5RA 3C60C 1BBDL 1QBLL 4Q9BA 4WO4B 4R2GB 2X1OA 4P3WA 4LSTH 3EYQC 5BZDB 4KI1A 4NO0B 4Y4HD 1Q8MA 4ZFGH 2H9GB 5KBNC 5D7LD 5GGVL 2XZQL 5KW9L 3VXOB 4TUJA 5HGDA 2V2XB 2AJYH 1MNUH 5C3TA 5IB5B 2EDTA 2HFGL 4YHML 3EOAA 4NHCH 3TNMB 4BM7A 1LE9A 4K8RC 5DRXB 3PDDA 4M7JH 3CMOL 1EGJH 3WUWB 3I3EA 1G6RB 4OD1H 4ZDHA 4G6KL 4OCXH 3SDDC 4M7LL 5JW4N 2VDMH 3OHXB 5ERWA 3UBXG 5E94A 3L1OL 2DQJL 4JFQB 3GI9H 4H8WC 3BT2H 4LSDA 1YYLH 1I8LC 3CX5J 4HWBA 5JUEH 4V1DD 5HYEA 1VFBB 1LGVA 2A77H 2ADFH 2X4SA 4J1UA 1YDPA 3MGTB 1UC6A 2EDQA 1YMMB 3CDFA 4PJGB 3HRPA 1A5FL 3B5TA 5GZOD 5DD1L 2YD9A 3RTQC 1YC8A 4TOYH 5HYQA 3T8XB 4X8JA 1N4XH 5EU6A 4PV8A 5F9AC 2G60H 1OT1A 1E6OL 2VDOH 3MLPA 4EI5B 5D96C 5C92A 2ICWI 1RIHL 2QQKH 3S34H 4WHYH 3EYUH 3T0DA 5DA0B 3ARQA 3PV6B 2YEZA 1R3LB 4JO2H 4OGXH 4OGZA 3JWNC 1D9KC 1DCLA 3MX0A 4OI8A 1EUUA 3S37L 3B6SB 3L3JB 4XCEB 3KXFB 4LGSB 3BH9B 3IDMB 3K2UH 3O6KL 2LU3A 3GSNA 5FUZH 5JMRA 2BVOA 1HHJB 4XNZB 3QWOA 4PRHE 4JB9L 2HKFH 4MNGB 2R0KL 4Y5YA 2HN7A 4D3CL 1G0YR 3BJ91 4JFPA 1UXWB 1C16A 1O5DT 5TDOB 2Z91A 3ES6B 3UTOA 4LGPB 1A6TA 4R90H 1GVIA 2IH3B 4Q0XH 3C8DA 5DSCB 1OW0C 4KJYA 4OLXH 2GT9B 1TVBA 3KLAB 3VMPA 3DYOA 1JRHH 3W0WB 1LEIA 4NM4H 4OD2B 2ERJB 3RHWK 4G8IB 4HUXA 3AS1A 1RIUH 5F88A 4HCRL 4L8BB 1TCMA 3RI5K 5F1IB 3G9AB 1MJJB 3D6GA 3MRJA 4F7TB 1Q0XL 4HJGA 1I7UB 3MRIA 1A0QL 2J12B 4OZHE 3F7YB 1LK2B 1TQCC 2EE6A 5LG1A 2BNUA 4MJ5B 4NN7C 4XVTL 3DXAE 3GSOB 3BKYL 4O2FB 1MIEH 3BP6B 3AM8A 5E4EB 3GMOB 1T66C 2DQDH 5TPWL 1A6VH 3H42H 4K23L 1CXEA 5L6YL 3IVKB 1F4XL 4RZCB 5GRZA 4DUXA 3BKMH 2ILLA 4LVHC 2CDEB 4X5XB 2IJ0C 2XN9B 3P4NA 1M05A 1ZGLM 4YDVB 4DFHA 5ALCL 3B9DA 5J6GB 5F7EH 1WWCA 4UMGA 3B9KB 4MXQC 3FT2B 1MEXL 2QADB 1CLYL 3PWUB 2VZUA 5C6TL 3BEWA 1FFNA 3UTTE 1SEQL 5FOBA 3VFNB 2VLRB 3HZMA 2WINA 1OAKL 4V2CB 4WNQB 3L9RA 3VD3A 3LMJH 2ZCLL 1AQDA 1F58H 1S7XA 3MLRL 4PRPB 1DL7H 4PYGA 4NQEA 3PWPD 2Q1EA 3V6OE 1DBMH 3QEUA 1ZXQA 4NNXB 2VISB 4ZAKD 1FYTD 4QTHB 2WUBH 4P5MB 4QRUA 5DF0A 2WQ8A 3VJ6A 1QSED 4DKAA 5IQ7H 1NAMA 1ERNA 5CLTA 1KNOA 3HR5B 1OVZA 4O51B 1SMAA 5E8NA 2JJTA 4UDTA 4ELMA 4WV1C 5ESVB 4JFOB 4HKZB 3QRGH 5GSRB 4IOSD 1PQZB 2YA2A 3RJQB 4BYHA 2P8MA 3V4UL 3C8KB 4JKMA 5EFIB 3PABB 2BVTA 1ADQH 4JKLA 3AUVA 5EBLA 4JFYB 1MCFA 1QLRA 2YSSA 4Q58C 3CXDH 5EH1A 1UB6B 3QBTB 1MCJA 4UDUA 1MRDH 4PJXA 4YIQB 5AD0B 3ELAT 3Q2CA 5ESAB 5L0QB 3Q3GB 4OB5L 5I1GL 3BAEH 3E6FB 4OIAA 1A7RH 3H9HA 3EYOB 4X8XA 5JDJA 2XQBL 5D7JA 3PGCA 1EK3A 4NGHL 3RPKA 3IFLH 3HTLX 3L3HB 4XCYA 3V95A 4L9LC 4NQSB 4UT7H 4YEEA 3L5HA 1II4E 4ONFH 1TNNA 4BSWA 1OPGL 2DRUA 4P2OB 3VFSA 1KIQB 2DI7A 2JK5A 4LSUH 3S36H 4Y8DC 1CLZH 1FL3B 4N8CH 4EJ1C 4R3SA 1OB1A 3MO1A 1JGUL 5GRYA 1F4WH 1OGAB 1GGYA 4ZUTA 4XHJC 4RMRA 4PY7A 5IVXA 3T09A 3NN8A 2OK0H 2EDJA 2CRZA 4L4VD 2DYPA 1A6ZA 2H26B 3K8KA 1NBZA 2X09A 1FGVL 2DM4A 4JQXA 5ISZD 5TF1H 4K3EL 1H3GA 1WAAE 2BNQA 1JGEB 3JTSB 2B5IB 4JZJB 4N8PA 5T3ZD 4MNHA 4J6RL