3RKDC

Hepatitis e virus e2s domain (genotype i) in complex with a neutralizing antibody
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
213
structure length
213
Chain Sequence
DIQMTQSPASLSVSVGETVTITCRASEIIYSNLAWYQQKQGKSPQLLVYSATNLAEGVPSRFSGSGSGTQYSLKINSLQSEDFGSYYCQHFWGNPWTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein/immune system
molecule keywords Capsid protein
publication title Structural basis for the neutralization and genotype specificity of hepatitis E virus
pubmed doi rcsb
source organism Hepatitis e virus
total genus 53
structure length 213
sequence length 213
chains with identical sequence L
ec nomenclature
pdb deposition date 2011-04-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3rkdC02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3rkdC01
5FUCC 1X5JA 2VLRA 3MV9B 1FCCA 4P2RB 3ARSA 2LVCA 3QAZB 4EIGB 3FB7A 5EIIA 3Q3GB 1DUZA 1LWRA 5ICXB 3BP7B 2KQMA 5J89A 4W4NA 3WN5B 4Z77B 3HI1A 4NRXB 5E6IA 2P42B 4JDZA 4FTVD 5ISZD 1CU4H 1OAQL 2YD4A 4HXAH 3HHRB 2CK0H 3FOMA 2JIXA 3MXWH 1OGAB 3NTCH 2QSTA 3TCLB 1SYVB 2IC2A 1IC4L 4W81A 2Y4SA 3MUJA 4JR9H 1N2RB 2B20A 3VI3F 1BF2A 4NJAH 5GRUL 5ANMA 3H7BB 2P5EE 5JHLH 4L4JA 4PYHA 1DQQB 4IIQA 5BZWB 1WTLA 5MEND 1RZ8B 1PZ5A 4RGNC 5FOBA 3IU4H 3V95A 1FFRA 3QDJE 2YPLE 1OAUH 5C0AA 1VFUA 3TYFB 5EZLA 3SOBL 4Y4KC 3UTOA 4GXUM 4GQPH 4R2GD 3H9SD 5GGVL 3TH2T 4EBQH 3WXWL 1YYML 4OT1L 4MAYA 5KSAC 5E0QA 3TZVA 4JCMA 3X17A 4X6FA 3EOTL 3RA7L 4XWOC 1IGTA 5I16A 2AKRA 1AC0A 2WP3T 5CIPA 2AXHA 1DR9A 3NIGF 4P0DA 5JOEA 3HC4L 1FLTX 2D0FA 3TA3D 2VXUH 2Y72A 3TNNB 3U9UB 5F6IC 1BJMA 3ILPB 3MA9H 3DYPA 2BY3A 5EC2B 3IDXH 3ZZ1A 1JPSL 4HUKB 1PW3A 1CGSL 1ZT7A 2L4OA 4M1CC 1NFDA 5CLWA 1HH6A 5IEHA 1QKZH 2IAMA 4K3EH 1NL0H 3U4BL 5JMRA 1ZA6B 4GH7B 2SEBB 1JPTL 4K3DL 1FCGA 3L7FB 4KRLB 5C3TA 5BV7L 3VFNB 3VXME 4JANB 4YJZL 3C5ZA 4MJIB 1P84K 1I8MB 3OXSA 1M7XA 2F74A 3RWDA 4CU7A 2DAVA 5DEZA 4MGXA 1QLEH 1U8IA 2NY5H 1FNEB 3F58H 3O3BB 3B9DA 2VAAA 4P5MA 2BMKB 5D2LF 3AAZA 1A7NH 3EGSB 3CMOH 3NMEA 5K9QI 5SV4A 2AGJH 1U91A 2ESVA 4F7PA 3IVKA 3WS6C 3ARFB 3MOQA 4FQHB 3RWJA 2EIEA 2LAAA 3K80A 2AJXL 1C5CH 1UH3A 4QRTB 2MHAB 4KROB 3IXTB 1EUTA 2Y23A 1LP9F 1QUNA 4Z7NF 3G6JE 1I85A 2OP4L 4NOBA 4JLRA 3TO4C 1H5BC 2D4FA 3UTSB 1CGXA 4JQXC 4OFVA 3DV4A 1J0IA 4Z7WA 2HLFC 4TNVK 3WLWC 4XVJL 4PJ9B 5BJTA 12E8H 5SX5H 5CZKA 4UIKH 1OVZA 1N0XH 4JY6B 1SEBA 4HIJA 1KLUA 3DUSA 5HYSB 1T03L 2DQHL 4DQOL 5I74C 1TMCB 4Q97A 3WE6A 5FGCE 3ES6A 25C8L 3KDMA 1SQ2N 1CK0H 2XWBA 1FL3B 3VFVA 1T80A 5I0ZA 3ME0A 1KJ2L 3V7AE 4EI6A 1OW0C 5DK3A 2NR6C 1FLRH 5E2VL 4I3SH 3ZMRA 3GMRA 5A2FA 6FABL 5IESL 5D7IF 4PJHE 2GSIA 3HI6L 4NQTA 1GAFH 4Q9BA 1A0QL 2RJMA 3GIZH 2OL3B 2YPVL 3KYMA 3GSNH 4UT9H 4AYFA 1WLHA 1HKFA 3D3VD 2AXJA 4E41D 4OD3L 5IBUB 5IFAL 4LLWA 3NIDE 4CDHA 5IBLC 3D5OF 5EH1A 4DN3L 3DV6A 5DHYA 1WFTA 1B0WA 3UC0L 1B0RA 1KCUL 1XIWB 3ZHKA 4HLZH 1N5YH 1DBJL 4OD2B 3S88H 4MNQB 3UO1H 2V2TA 1UC6A 1UFUA 1KG0B 1AGDA 1AXIB 3LIZH 3IF1A 1NGYB 5D7JC 5DJAA 1U8HA 5IJKC 1ZV5A 4HUNB 5IKCB 3O2WL 4U1HB 3HAEA 5F9WB 1FO0A 3R0MA 1HQRA 3VFTB 3OJVC 1KPVB 1AD0B 3B5TA 5T1DH 3PQYD 2NY6C 4ALAH 4PJBB 3MCG1 3SE4A 5GIRA 2VLRB 1EJOL 5CLTA 3SDDC 5EIIB 3S4SA 1DUZB 1SY6A 1TFHA 2JJSA 5GHWH 4RMWA 3P11H 4X98A 5E6IB 4JDZB 3Q5TA 4JPKH 5L7XL 5DK0A 4YQXL 2IBZY 4MJ6B 3VGFA 3PV6A 2AV1B 2JIXB 5E9DD 3GRWA 3O4LE 4QHLA 3V6FA 2VDNL 1FZOA 4FZ8L 3NACH 5CCKH 2WSKA 4PJFF 2FLRT 5KSBE 5TE4L 4YDIH 3NCFB 4IIQB 4MD0A 3SGEH 4P2YA 4JPVL 4O2EB 4XX1G 1PZ5B 1YA5A 5F6HI 2BNRD 4L3EB 4N8CH 1I1RA 1JYNA 3AROA 1WAAE 5C0AB 4EDWL 5FCUH 3W82A 2V6HA 5I66A 5EZLB 3T0EE 3NZ8A 1WICA 1MLBB 4DGVL 3GMOA 5I1AA 4WHTB 5IT2H 5CJBA 4P23A 4QRRE 1BQLL 4FQCH 1FVCB 3ARBD 5FUCE 4XC1H 4Z9KB 3V9FA 1F4YH 1DL7L 3GFUA 3TZVB 1WZMA 4X6FB 4IMKC 5I16B 1IGTB 4PRAA 1RD6A 1WZ1H 2VYRE 3WMSA 4JFXB 4CAGA 2CRIA 4LPVA 1QVOB 4OCMC 2A38A 4ZQKA 1ZT7B 5KS9F 1IVLA 2ARJQ 3VG9C 1NGZA 4K3HA 2A74A 1HH6B 3QP3A 1BFVL 1VENA 4ENED 5B8CA 5IEHB 2NXYC 3Q6FA 4NM4H 1CU4L 2CK0L 3PG2A 1Y0LA 3HZKA 3MXWL 2N4IA 3W81A 3ARYA 4DOHB 1G9ML 5E95B 3NFSH 2XQYG 4QOKD 4XNUL 5BZDA 4GAFB 4JR9L 1EJ6A 1C16A 4D0BA 2H41A 2WINA 5DMIH 4NJAL 1CL7H 1I1AD 3H0TB 4NN5B 3TPKA 5JHLL 1XGTA 1UM6H 4QHNB 3O6KH 2F74B 3CGTA 4JPIA 3RWDB 3NIGE 1Q72H 3MV7A 3MRFB 3TVMC 2CH8A 3IU4L 1DQJB 2DLIA 2HTKD 1U8IB 3WUWB 1OAUL 3SO3B 2DQFA 4KGLA 4MSWA 1QQDA 4D9QD 2XQYK 4G9DA 1BZ7B 2DMBA 1ZXQA 4F7PB 1KTLB 5KSUA 1TNNA 3X3FH 3IVKB 2YD5A 1QFPA 4KRMB 4AY0A 3RWJB 3BHBA 3SDCA 5C71A 4J8RB 3FFDA 4NQCB 4EBQL 3IDNA 3K4DA 1I9EA 1DSFL 3T2NL 4Y4HC 1JNJA 1NJ9B 2LVEA 4HK3J 3SJVA 4FQPA 3MFGB 4JLRB 3OR7A 3VW3H 3LQZA 3IAGC 3KLHC 2AQ3A 1KTRL 2E6PA 5TPWH 3MA9L 4Z7WB 3PWJB 4JZJA 3QIBD 4IEFB 5BOPA 3VXUA 4D9RE 3VGDA 5BJTB 1NMCB 4MZ3A 2C7UB 5B4MC 4JO3H 5MEQA 1QKZL 3EHBD 1UKQA 2HVKA 1SEBB 4K3EL 1QTYT 1NL0L 4Y5YC 4HIJB 1KLUB 3DUSB 3PJSA 4Y16A 4XP9H 2NCMA 2UUDK 5HGHB 1GGBH 3FL7A 4XI5D 4N0UE 3QDGE 3WE6B 3ES6B 3KDMB 4FFYL 4DEPB 3RJDA 4OQTL 4EI6B 2PCPA 4ODXA 4PJ7F 4Z7NE 2LU3A 1MRCH 5GS2H 2E7BA 3DGGA 1RY7B 1I1YB 3U0WH 2R56L 3KYMB 1D6VH 4QRSB 5IW6B 1QLEL 2NY5L 3F58L 4N0YH 4LHUG 5INCB 1CFSA 3JBG7 1A7NL 4I1NB 4LLWB 4PJDA 3CMOL 1DBBH 4M00A 3IXAB 2AGJL 4HDIA 5DHYB 5KZCD 5AYQA 1B0RB 1DJSA 4YFLI 1C5CL 3OL2A 1AGDB 3BGMA 5FYLE 3IF1B 2K7QA 4JDTL 1MLCB 2WV3A 3LEYH 5DURB 2R29H 3MLTA 5I30L 4NRZA 3QUMA 3EYFA 1QSFA 5BS0B 4JHWH 3UEZA 1HQRB 4N8VG 2P44B 3D39D 1OTUC 2P5WA 1XFPA 2BNQE 2DM2A 4Z7VE 2MPAH 3QA3B 4MXWH 4ONOA 4WI8A 12E8L 3P40A 5GIRB 3FFCD 4UIKL 3CFDA 3KLAA 1N0XL 3P9LA 1CQKA 4KU1A 4ZODA 1J0HA 2VLLA 5J12C 1CK0L 3UJIH 3HNTL 4PRHE 2IJ0C 4F9PC 1CLYH 2ARJA 2X9XA 3QRFM 5DVKA 2BHYA 5MP6H 1FLRL 3Q1SH 4I3SL 4IMLA 2GJ6D 3PUCA 3R0NA 4X98B 2HKHH 2EDRA 2F53A 5T1KA 2EKJA 5TE7H 1W0VA 4OFYD 3PV6B 2ED9A 1GAFL 3MROA 4YEFA 2PXYA 1MI5E 3GIZL 1BJ1J 1V8HA 3GSNL 4NUJA 3V6FB 4UT9L 1FZOB 4NQEE 3EW3B 4LVNB 4D94A 3GM8A 4LKXA 3UTTA 2EXYC 3MX0A 1WIUA 3S3PA 2I26N 4R9HA 3PP4H 2DIJA 4MD0B 1E4KA 2X4OA 4HS3A 4QXWA 1N5YL 3MOAH 3S88L 2IFFH 5CEZH 3UO1L 3LIZL 3QDME 5IQ7H 2O93L 3BP6B 3IDUA 5I66B 1BIIA 1N6QL 3NZ8B 4JRYA 4GS7B 4MS8D 2IBBA 3QB7C 3MBXL 3LHPH 4Q9QH 3EDEA 3GMOB 5IHLB 5I1AB 4P23B 5IROC 2APVA 4KK5C 5HYSG 4G7YH 5T1DL 1P1ZA 1N59A 4ALAL 4M43H 1U8NA 5C0BE 1MFDL 5EUKA 5FGBA 4WI9A 3PGCA 2DYPA 3SE3C 5F3BA 5HHOD 1G7LA 2HH0H 4OJFL 4XC3H 5DO2D 4LCUA 5IHZA 3ELAT 4ZQKB 2FO1A 5GHWL 5AEAA 1TXKA 1KN4H 1NGZB 3P11L 5B8CB 2Z35B 3Q6FB 4UDUB 1XT5A 4NQDE 4PTUA 1FFPB 5ESVA 3JWDH 3WKNA 1SHMA 1A5FH 3HZKB 5IBUG 3HB3C 3KLSA 1TITA 1FGNH 5EO1A 4X7CC 2ZOLA 4RRPA 4OZIE 2R0ZH 5CCKL 4NO5B 4XNMA 5BZDB 1KELH 4UV7H 4QRUB 1HHKA 4YO0B 4JN1H 4D0BB 2WINB 3BXNA 1JTOA 1KGCD 1CGUA 1CICB 4YDIL 4WENB 5D1ZA 4YHIA 5IK3A 3KXFA 3SHSA 4F7TA 3SDXF 5F1OB 4J4PA 4L3AA 4QT5A 3RTQD 3QXAA 2L7JA 4N8CL 4EUPH 4ZPVA 5F88A 2DQFB 4GKOA 5FCUL 4MSWB 1EGJH 4C56A 3OF6A 3V6ZA 4G9DB 2WANA 2HTLC 5I75B 1YMMB 2DL2A 4PLKC 5F6HJ 5KSUB 2OR7A 4ZUWB 5IT2L 1ZGLM 3BHBB 3SDCB 3FFDB 3KWWA 3IDNB 1IGYA 4FQCL 4YHYC 3MJGX 4XC1L 4ZS6C 1NAMH 1QEWA 1F4YL 3U83A 4KK8C 1G9EA 3CDCA 1A7PH 1VGKB 2GY7B 3LQZB 1WZ1L 2PTTA 3B2VH 5L2KD 4V1DD 5BV7C 4LKCA 4DUWA 4JZJB 3BSZH 4B53A 3VI4F 4FXGB 4HEPG 3LD8C 5FECB 2VL4A 1DP0A 5MEQB 4NM4L 2HVKB 2MFNA 3PJSB 4Y16B 4Z95H 1ORSA 4YDJA 2J8UA 1GOFA 3NFSL 5FYKU 5EBGA 3JWOH 1KYOJ 2VZTA 4J12A 4EVNA 4KMTL 4GUPA 2PCPB 1CL7L 2DWEB 1ZAGA 1WBYA 3DURB 4UNTA 1UM6L 2LE9A 4MD4A 4XMPH 1Q72L 1OP3H 3HZYA 1Q94A 2JJVA 4NC2B 3LKSA 3MJ6A 1UZ8A 5B22A 3PIQA 2XKUA 3V6OC 3QCTH 1IEAA 3GMPA 5DHVH 2HRPL 5M7QA 1J12A 1A6TA 1F5WA 3QUXC 3QQ4B 4HDIB 2A0LC 1AHWC 2J6EH 3N85H 2F54A 4LLYA 1IBGH 5DA4A 3MRKA 3VD9A 5JW3H 4P49A 5D6CA 4HWBL 3IFNH 4IRJC 3VW3L 5ACZA 4NRZB 3QUMB 5AWNH 3EYFB 1QSFB 5F9AC 1T1XA 5TPWL 1X4ZA 4U6YA 3VWJD 3LRSA 2E9BA 2W07A 1CF8H 3B9KB 4JO3L 3CFDB 3KLAB 3TT3L 3UJTH 3P9LB 2PO6B 4MMZC 1IAIH 3ETBF 2VC2H 43C9A 5HDQL 2VLLB 4NCDA 3TO2B 1U8KB 2DRUA 2R1WA 2FX7H 1X44A 5KW9H 1GIGH 1EMTL 4IMLB 1IGIH 1FFOB 2OCFD 5T1KB 3RZCC 1MRCL 5EOTA 3WUWG 1UM4H 1AD9A 3QEHA 2EDLA 3MROB 4OIBA 5JIIA 4EIZC 2PXYB 3U0WL 1D6VL 1NC2D 1OSZA 4N0YL 3F7QA 1MHHB 2EECA 4P2OA 4LKXB 2N7BA 5C0JA 1A64A 4XPFH 1DBBL 1XH3A 4P4KA 2VSDA 1T21A 2YSSB 1HN1A 2X4OB 5CS7A 2X6MA 4J3UA 1BD2E 2HN7A 4R4BA 3V52H 2O26U 1P5VA 1INEH 1MQ8A 4KMQA 3VFOA 2DM3A 1CG9B 2X4NB 4NQXA 1BIIB 2A83B 4K8RD 5C0EA 4XCFH 3I2CH 1SJEA 3LEYL 2R29L 4KGJA 3O45A 4HC1A 4IRSB 4Y4FC 2B39A 1U8OA 1IZKA 4XCYB 4W68A 1LO2H 2XWTA 2B4CH 2MPAL 4MXWL 4YXKH 1U8NB 3EO0A 5EUKB 2NX5D 3PGCB 4M8VA 2Z31A 2DYPB 1LILA 5F3BB 3P9WB 1HSBA 4LVOC 2R2HB 3UTSD 4LCUB 3UJIL 3O8XB 1CLYL 5IHZB 4DK6A 4NZTH 5MP6L 3Q1SL 3GSOA 2JE8A 2YD3A 4PJ9D 3S35H 3P0VH 4KKCC 2HKHL 4JQVC 1CXEA 5ESVB 5IBTH 5TE7L 1S9XA 4UBDC 2NY0B 3OXRB 5IUSA 1DCLA 5EO1B 4XPHH 5F97E 3X11A 1U3HA 3HMXL 5E6ZA 4XNMB 2ZUWA 4X6CF 4OZ4A 1HHKB 2I9TA 1I8IB 4OF5A 5D1ZB 4GW1A 4FQJH 5GZOC 1NEZG 3U7AA 3KXFB 4F7TB 4FMFA 1A6WH 4QT5B 3QXAB 3QUYB 4P9HH 2IFFL 4ZPVB 5CEZL 3BN9D 4K7PH 4ZAKA 1IT9H 5IQ7L 4FQXD 4RFNC 4ZO8A 3ZDYE 4C56B 3C6SA 4NN6B 3V6ZB 3AU1A 1OTSC 4RZCA 3MUHL 4N1CA 3LHPL 4Q9QL 1VADA 2HP4A 3MJ9A 3KR3L 3KWWB 4G7YL 4X7EC 1IGYB 4OFKA 4M43L 2KZWA 5BVJB 4MNQD 2VSCA 1EEZA 1P4IL 3CZFA 4L9LA 1QEWB 1BHGA 1E6JH 3F7PC 3VXSE 5FCSH 2PTTB 2HH0L 1FPTL 4XC3L 4QCIB 1IZJA 2IANE 2V9RA 4WUUE 3L3HA 4WU5B 4M93B 5DJ2A 4TPRH 4U3HA 1F4HA 1KN4L 1UM5H 4LOUD 4JO4H 4K55A 2VKWA 3CH8A 1A4JA 4LRIC 4UAOC 3FQWA 3JWDL 1W0WA 2VLRD 5HHVH 4PJCA 5KJRH 4YDJB 1A5FL 3CDFA 3T4AA 2J8UB 2W59A 3ZKXB 5FA4A 4L4VD 1KELL 4UV7L 3EJZC 4WVRA 3O9WC 4GUPB 4JN1L 2Q1EA 4ZUUB 1WITA 4B41A 5E6ID 1KCVH 4KUZH 3H3PH 4B7IA 3QI9C 2NLJA 3W0WB 1NBZA 3DHMA 3LKSB 1YZZA 4OUUA 2R23A 1CDCA 3PIQB 4NKQB 5I73C 3VI4E 4LF3B 2Q76A 1S7UB 3IFLH 1EGJL 4O02H 3GMPB 3S7GA 5JZ7D 4KI5D 2AXFA 1A6TB 4WFGD 4U0RC 4J1UB 3RX8A 2EDDA 4MA1B 4HZLA 4HKJA 4KDTA 4IDLA 2F54B 1NAML 4N9GA 3MRKB 1MAKA 4OCNC 1OQOA 5D6CB 1ETZA 5AYUH 4HV8A 5ACZB 3B2VL 3ZKND 2ADIA 3EJYD 3BQUA 4GMSH 4K3GA 3EZ8A 4U6YB 1DUYA 2D3VA 3FKUS 5HVHC 5EDXA 4MNGB 2HT2C 3LRSB 1VESA 5DDHA 4WWKC 1DZBA 4MAYD 4BJLA 1OP3K 4K94H 4Z95L 2NY5C 4Y19D 3T3PF 3T4YA 3JWOL 5JO5B 1J88A 1RIUH 4WO4A 2EICA 2KKQA 1EFXB 1RZFH 2DJSA 1B88A 4K9EH 4LIQE 3MFFA 5GGTL 1NEUA 1P7HL 1CDYA 3DMMC 4NRYA 2IAMD 3QSKB 5EOTB 4PJEA 4PRPE 4QF1A 3DXAA 4GLRH 1JGUH 3S3SA 2CO7B 4JKLA 5D93B 4F37F 2DF3A 5DR5H 4WTZA 3V6OE 1OSZB 1JZ4A 4P2OB 5GGQH 3QCTL 4QXTA 2WBJD 5EPMA 2DIBA 3C5ZD 1XH3B 4P4KB 1T21B 4H8WH 3DVFA 2FD6H 4D0CA 4YFDB 4I0PC 4WWID 2J6EL 1BFOA 3N85L 3TFKC 2HN7B 4R4BB 5JW4N 3H9YA 5AZEH 1IBGL 2MMXA 5EUOE 5KVEH 4NQXB 4O5LH 5C0EB 3IFNL 3RIAK 1SJEB 2C26A 3C6LC 3O45B 4PLOB 5F9JA 5AWNL 2BSTA 4OZFA 3L5JA 2ESVD 2CKBH 3S36X 4WW2C 3RVWC 3PL6A 1MCNA 2GY5A 4U0QB 2XWTB 1A7RL 4N0CD 4Z7UE 5SWQB 2YN3A 3ARGC 2Y5EA 1U36A 4ZXBC 1CF8L 4N0RA 4FNLH 3UJTL 3HRPA 2Z31B 2O5YH 1T1YB 3CLFH 1IAIL 1HSBB 2VC2L 1P6AB 4Z0XA 1B4RA 1KNOA 4MQ7A 3SY0A 2FX7L 5E8NA 5KW9L 1GIGL 4ZNCD 3KPMA 1IGIL 4POZC 4F58L 1P7QD 1S9XB 1UM4L 1QRND 4WW2F 5SWSB 2F5AH 4ETQB 2P7TA 4LCWA 3CPLA 4CBPA 4PGEB 1U3HB 4K71C 4YK4B 2I9TB 4FABH 1HI6B 4GW4A 3KPRE 1C5BH 3WO4C 2HLAA 4XPFL 2RCSH 4GW1B 4PJIE 1EV2E 4MB3A 5J4MA 4PP1C 5FO7A 3V52L 4I77H 1XMWA 2ADJB 2DLGA 4XXDA 4ZAKB 5ALBH 2G2RB 4P46C 5IB5B 4G6FB 1J1XH 4XCFL 3I2CL 1A3LL 4RDQF 3AU1B 4RZCB 4GXUN 4Z6AT 3AB0B 4R97C 1HWGB 2YOCA 1LO2L 3BPOC 4PY7A 2B4CL 1QFUL 2C3VA 3KPSE 5BW7A 2BC4A 1EEZB 3RGVC 3CZFB 4FZEH 4L9LB 4E5XA 1CDHA 2R69H 4O51A 4TUKH 4EN3A 2X9WA 4UMGA 4XB7A 5DURD 2YRLA 3KYKH 5DA0B 3TJEH 4U6HA 4WDIA 4R0LC 3WJJC 2Y06H 3RX5A 1FIEA 3QO0A 3WNPA 1MCBA 1CVRA 1I3UA 1MSPA 1UVQB 2PYFA 2YD9A 3P0VL 4GKNB 4ZDHB 3BH8A 1A4JB 5FXCH 3FQWB 1W0WB 5IBTL 5C0NC 4JVWA 3RVTD 1P53A 1T7ZA 3T4AB 5C07E 3IKCB 4XPHL 2BRQA 3DHJA 3JVGA 4NWUH 3H9HA 3ALPA 2GIYA 1NANH 1ACZA 4JCLA 3SE8H 2NY2D 1JL8A 3PWVA 1G9NL 1A1NA 1TQCB 2JK5A 2RFXA 4FQJL 3O6MH 3HE7A 1A6WL 1YY9D 1H0DA 3JXAA 1RZKH 2R9HD 4P9HL 4OUUB 2R23B 1ERNA 2F15A 4X9GA 2J4WH 4K7PL 4NOFA 2X4RA 3V0WL 1IT9L 3TBSA 2EDFA 3GHBH 4U6TA 1ND0B 2AXFB 3FOLA 4JFZH 3MRNA 3FHQA 1WUNT 2WUCH 2G75A 4PY8I 3BRGC 4HKJB 2XT1B 3ARTA 4XX1E 2IPUK 3WO3B 1RIVH 4N9GB 3U4EA 5KOVC 3FRPG 4OF0A 4O4YH 1E6JL 3GSVA 3C8KB 2GHWB 4HV8B 2P1YA 2Q86A 5F7DA 1C08A 3TBWA 1HQ4A 4GBXA 3EOBA 1ZHKA 1DUYB 3UTPE 3VXNA 1E28A 3WXVL 4TPRL 2AK1H 5DDHB 1JGVH 1UM5L 1MFBH 1X5ZA 5JDSA 3RWGA 2P5EA 1MJJA 4Y5XA 5HHVL 4U1NA 5KJRL 3U2SA 2N7AA 5FV2A 4CN6A 3QDJA 4WO4B 1TVBA 4CU6A 2YPLA 3FRUA 3MFFB 3VCLB 4IOFD 5HGAA 1Z9MA 4HUMB 4NRYB 4PJ5D 5J1SC 1KCVL 3ZSTA 3MTRA 4KUZL 3H3PL 4WEMB 3RX7A 3UTZA 4QF1B 3DXAB 3RQ3A 2XTLA 4P99A 3UXFA 4RMUA 3P77A 4NT6B 3C08H 4OTXH 4QXTB 4HJJH 3WNMA 3IFLL 1WK0A 4O02L 3K4ZA 3WLBB 3WYRA 3RUGE 3TIEB 1FGVH 2WWKO 2VISB 4OBRA 3BPNC 2O5XH 3MV7D 2H9GA 2YS4A 4XP4H 1KPUB 5E1AA 3DSFH 2JB6A 4YDKH 1JZ6A 4HWZA 1WTGT 5AYUL 2VZUA 3ZTNH 5F9JB 3BO8A 1MAJA 2BSTB 4OZFB 4OF7A 3QJFA 4GMSL 4IOSD 4NNPH 5J3HD 3PL6B 2OTUB 4U49A 1WIOA 3BDYH 1G7HA 1W8OA 4HKZB 3MV9E 3VXMA 4P2RE 1KV3A 1Q0YH 1LK2B 3AY4C 3X12A 5EBMA 4K94L 1MCKA 32C2A 3ARDB 3SJVD 2QLVB 4G8FA 1FZJB 1UCBH 3QPQC 4XRCA 4GRWH 1Q1JH 2XI9A 3L95A 1RIUL 1KNOB 3LZFH 4MQ7B 2VRAA 3OPZH 1RZFL 1L4IA 4EI5C 4K9EL 2CKNA 5E8NB 2XA3A 3LN5A 4JB9H 3RDTA 3VXUD 2GAZA 3QUZA 1NLBH 3KPMB 1PAMA 1OGAE 2JCCF 2EZ0C 5DFVC 3GSUB 1OHQA 1X5IA 3BPCB 3EYQD 4KK9D 1JGUL 5GS1C 4UUJA 2P7TB 4LCWB 5DR5L 1U58B 3WDIA 3G6JA 4FQ2H 2HLAB 5KN5A 5MHSD 2VWEC 4JKKA 2CGRH 3RKDD 4H8WL 3BJ91 4UQ3B 2XKNA 1CBVH 3RY5A 3HMWH 5FO7B 2YHGA 3WDJA 2B5IB 5SWZE 4XXDB 5KVEL 3FQRB 5DZLA 1FL5A 4CVXA 4WRLA 1J1PL 4F7CA 5AAWA 3GDBA 1RZJL 2CKBL 1X4XA 4CNIA 1ES0A 3C9NA 2H8PA 3DX9A 1ZVSA 2BC4B 3CFJB 3CVHB 5FYJE 1QSED 4FNLL 3GB7B 4O51B 4MA7H 3A6CH 4DGYH 4EN3B 1TETH 2O5YL 4PJHA 4CL7A 1D5XB 5JR1H 1IEHA 4QNPF 1QSFD 2CRMA 2B7DT 2X7LA 1XF2A 2P5WD 4YHLH 3QO0B 1WWAX 3K2UH 4XGZA 4JM2A 3BH8B 4F9LA 2GJJA 4TVPH 4PLJD 1GOHA 5F9DC 4IJ3B 1G6RB 1GGUA 2F5AL 1Q8MA 3HS0A 4U7MA 1Z6JT 5E99H 1P2CA 2Z9TA 5TJWK 4H1LG 2JTDA 4FABL 3T2OA 4MVBD 5F1IA 2F8XC 5LGJA 1C5BL 4MX7A 3IB4A 2QADB 3PWVB 2DQEH 2F53D 2RCSL 5T1KD 1A1NB 5MI0B 5K9QG 5L88H 1H0DB 4ONFH 2PXYD 1EPFA 1OT1A 4I77L 1BVKA 4M1CD 2GUOA 3TEUA 2M26A 2X4RB 2M2DA 3TBSB 5ALBL 4YPJA 3MOBH 2W91A 1J1XL 2VOTA 2XQBH 3TLRA 3LEVL 3UTTD 1T5WA 1DLHA 4WI3A 3FOLB 3STLA 3MRNB 5DRWA 2G75B 3IDYC 2Z8RA 1T89C 3T04D 3JWDC 1ZHNA 4FZEL 1MCWW 4R2GC 2R69L 3RHWF 3C2AH 1WGOA 4GRLD 3GSVB 4OCYH 4KUCD 2Q86B 4JRYD 5F7DB 3KYKL 3D2UA 1C08B 1JF5A 3O4LA 4LPWA 1HQ4B 4QYOA 3TJEL 3EOBB 1ZHKB 2FEEI 1MVFA 3OGCA 2Y06L 3VXNB 5DI8B 2W9EL 2VDRH 4YX2H 1E28B 5JDSB 3NCJH 3RWGB 3AXLA 3TA3C 4BH7B 5KSBA 1K9TA 1DDHA 4ZG1A 1A9EA 3HN3A 4Y5XB 4U1NB 4Q6IA 2DYPD 4Y2OA 1A14H 3RIFK 1MHCB 1YEHH 2PYEE 3S98A 3DVNA 3QDJB 4NWUL 4Q6YA 1WAAA 2YPLB 1JNNH 5DJ0A 3FZUC 4JRXE 4KJWD 3UZVB 5F44A 3T0EA 3SE8L 4M1DH 5AZ2H 3WFBL 4J6RL 5F96H 3UTZB 1X5LA 2GI7A 1V05A 3O6ML 1JUFA 1GC1L 1S8DA 2Q87A 4NNYA 4QRRA 4EXPX 1J86A 4IHOA 3TGXA 4ODSH 1J7VR 3G9VA 3NABH 3TV3H 2J4WL 4R26H 2PW2A 3GHBL 4FG6D 2ZP0T 2WIMA 1G0XA 5K9KA 4OCRH 5A40E 3T2PA 5CIPH 1CT8A 2WUCL 1AXTH 4J4PD 2H9GB 3OAZK 5HDBE 3PP3H 5F21B 1RIVL 5E1AB 5DEFA 3UPCA 3A6BH 2CDFA 1JPGA 4O4YL 4P2QB 2JB6B 3V4UL 4LHJB 5JHDB 3JWOC 5TDNB 4C56D 4HWZB 1VGEH 1AO7E 3U0PA 1G1CA 5EZOH 1R3KB 2C9AA 3QJFB 2J3SA 4AIOA 2H2SD 3MRCA 5JOPE 1G7HB 1JGVL 1MFBL 3VXMB 3OB0K 1NSNH 3LB6D 3X12B 1LDSA 2RGSA 1W72H 5EBMB 4JFHE 4KHXH 5C0FA 1BX2B 3OAYK 3L3GB 4G8FB 4OSUH 1WBZA 3BKCH 3VXOB 1VHPA 3O2VH 3WBDA 3EFDH 5FF6B 4PV8B 3QWQB 5DJDB 4A2MA 5FUOH 3CFBB 3HG1E 3LN5B 3RDTB 3QUZB 3H6JA 1D5ZA 5EB9A 4DVRH 1QD0A 5D5MF 4MJ4A 1EHAA 1DEEA 9CGTA 3T1FA 3JTTA 4F3FB 2WNGA 4HUVA 4PJGF 3NPSB 1KIPB 3C08L 3CUPA 4OTXL 4HJJL 3G6JB 3LY6A 5IB2A 3FTGB 5FYKD 2D7OA 2BSSB 1GZQB 5KN5B 3HKFA 1P4BH 2IPKA 4QRPD 5DRXA 2A73A 1FGVL 4L3EE 5A2KH 3R06A 2NY4B 4FXLA 2X70A 2O5XL 5HI5C 1VFMA 5DD0H 2R2BA 4TUOB 4M4PA 4XP4L 2RB8A 2RAMA 3LVEA 3DSFL 1FL5B 1J0YA 3UBXA 1GGYA 2IG2H 4YDKL 4CVXB 1XGYL 3ZTNL 4F7CB 3THML 3BWUC 3OJ2C 5D7LE 4N0UA 3QDGA 4LLQA 5FGCB 4F8QA 2JJWA 4LLMA 4NNPL 1ES0B 3C9NB 2H8PB 7CGTA 5T3XD 3BDYL 3NIFE 4C4KT 3DX9B 1Q0YL 2CK2A 3VJ6A 5IMMB 2CIIA 1LMKA 4ZFGL 4PJHB 1UCBL 1D6EA 1JZ3A 1Q1JL 1UH2A 2X7LB 1GCFA 2GJZA 3FQNA 5DJCA 2AEIT 3OPZL 2ADFH 2W60A 4TSCH 2GK0A 3EO9H 2EYRA 1NLBL 1B3JA 1X7QA 3WS6A 4PFEA 1V5JA 1CLZH 3GM0A 2ZZUT 3BUYB 3HS0B 1KYOK 5DMJB 1ZSDA 3VD7A 2OTWA 5F7NC 4XVTH 4XNXH 3CFKA 4H0IA 1T0NB 3BRFA 1FYHB 4M7JH 5LGJB 4FQ2L 5H35A 4G7VL 4YUEH 4GQ9H 1ZOXA 4JQXA 2CGRL 1ULVA 2B4CC 3CK0L 5IFJB 3UZQA 5EORH 3P4NA 1D9KD 4QNPE 3HAEH 1CBVL 2BNQA 1FO0H 3HMWL 1T66D 4Z7VA 1QLRA 1BVKB 4OZFG 2GUOB 4K07A 4PYGA 4P2OD 4N9OB 1T5WB 4NQCE 4P4KD 3STLB 5DRWB 2KZ1B 1Z3GH 2UVFA 4PRHA 3MXVH 3GGWA 4WHDA 2EC9T 1SY6H 4RSVA 1JNHA 3C8HA 4MA7L 4V2CB 1YUHA 3A6CL 4Z18A 1TETL 4Z7WE 3NCBB 2D7NA 5JR1L 3EYVA 1MI5A 3ARBC 1ZA3A 2BHZA 3O4LB 4QYOB 1QFHA 4NQEA 3OGCB 3SPVB 5HHPA 4YHLL 5CSGA 5I1IH 3K2UL 2XWJA 3AXLB 2OJZH 2IQAB 2VDKH 4ODVL 4P9HC 1ADQA 4R4FH 4UOW1 2QTEA 4Q6IB 3LEXA 4EQ2A 1K2DA 1LQSR 5E99L 2CO6B 2VDLH 4ENEC 3DVNB 3E8UL 3QDMA 5TGBA 2H6PA 4JFFE 1JVKA 3T0EB 2ZKHH 2DQEL 4MA3A 4I3RL 2GQHA 2XYCA 4YC2B 1JUFB 1S8DB 4NNYB 4QRRB 5I18H 5L88L 4ONFL 4G8GE 3VGGA 4IHOB 1T4KA 2EEDA 1R5VA 1T1WA 3T0AA 1I1AC 3ZDXE 4UTBH 2UWEF 1TDQA 5C0BA 2DBJA 2PW2B 2WLYA 3MOBL 2XZCL 5D1XA 2XQBL 5TF1H 1B0GA 1YY8A 3ULVE 3S6CA 2HTKC 4HX1A 1CT8B 2QSCL 3D9AH 4U05A 1D3CA 4I4WA 3L3IA 3L9RA 3PGFH 4NC0B 3TIDA 5DEFB 1Z0NA 1CZ8H 2CDFB 5BS0E 1M71B 1UCTA 4NQDA 3MRJA 3H7LA 3L7EA 4G6FD 1IGCH 4OCYL 2QQKH 1FVDA 3U0PB 5FM5M 2FCBA 4OZIA 1AXSA 1MH5B 2CMRH 4JJ5B 4NWTH 2VDRL 4YX2L 4ZUTB 1FZKA 1OAKH 3NCJL 1J0KA 1DQLH 2J5LC 3D0VA 4HSQA 2VN4A 1CTNA 3VFRA 2KPNA 5C0FB 4KAQH 4NC1E 3GKWH 5D2NC 4XH2B 1WBZB 1A14L 3QIBC 4M7ZB 4HQQL 4KPHH 5D96C 4JZNA 5CUSH 3STZA 3QIUA 1A9BA 4F57H 3EHBC 3O2DA 1YEGH 3O4OC 3QBTB 4DWHA 3QDHA 4Y4KB 2AJ3B 5EWIH 4KJPD 3LS5H 5I8KH 4XI5C 1E6OL 4M1DL 5ALCH 5F96L 1A3QA 4UILH 5LGHH 1P9MA 3DOSA 1LE9A 2CUMA 4S2SA 3B6SA 3ECBB 5KSAB 2ILLA 5FFLA 4ODSL 3NFNA 4WJ5A 3JTTB 4HAFA 3NABL 1UYWL 3TV3L 5T33H 3CUPB 3V0VA 2NPLX 5IB2B 1R5IA 3B9AA 3RWEA 2IPKB 3OMZA 2ID5A 4OCRL 2A73B 2WBKA 5SV3A 2X70B 4KC3B 1AXTL 1A6AB 4LSRH 3T77A 4ZYKA 4WI5A 4TNWK 4HKBA 2QR0B 2LTQB 2R2BB 4ODTH 1GXEA 4K94C 1FAKT 3A6BL 4JREC 2IPTH 2EDYA 5D2LB 3UBXB 3LMJH 2VR9A 4NFBA 5I1EH 3BW9A 1L9NA 4M4RA 4K9EC 5EZOL 1KLFA 3SDAA 4N0UB 3QDGB 4LLQB 1LDPH 1IAMA 3EYOB 3VWKD 3LQAH 2R8SH 3K81A 3K8KA 1NSNL 4DKAA 3VJ6B 1RMFH 2CIIB 1W72L 4KHXL 3TVMA 1X3DA 4OSUL 3BKCL 2FR4A 4P5TA 2QHLA 4H5SA 1D6EB 3O2VL 4KMLB 2OLDA 3HI5L 4LLDA 3OWEA 3EFDL 3BQUD 3FQNB 5DJCB 1YEIH 2W60B 2CXKA 2GK0B 2P8PA 5FUOL 3CDGB 3MLZH 4H8WC 2EYRB 5L8LB 1KPRA 5IOPA 2VH5H 4KKBD 1X7QB 2PETA 4KKLC 3TC9A 1IGJA 4DVRL 3QCVH 4F15B 3HCVA 1JYVA 2Y7QA 2P8MA 1NC4B 2IH3A 5L8KB 3CFKB 2HJLA 3TO4B 1T7YA 1RZJC 1J0JA 3Q5YA 4LFHD 5EU7E 5H35B 1FYTD 5LQBH 1P4BL 2AJSH 3D3VE 5D7IB 3I6LE 3MSPA 5J6HB 4LMQE 4FFVD 1T04A 3QUMH 4M5ZH 2BNQB 2VQTA 4NM8H 3V0AC 5CJXC 5DD0L 1H3TA 1Z9SA 3INUH 1QLRB 4XAKD 3CSGA 2Y6SD 4PPTA 2VKXA 4Y5YA 1YMME 2HVJB 4S1QH 2IG2L 5IB3A 1U95B 5I74B 2E9IA 3BMVA 4D9LH 1CDGA 1R6VA 1RJYA 4PRHB 5L0QC 1OLZA 3GGWB 2VQ1B 1JNHB 43CAA 2VUOA 3KJ4C 3QNXA 3DRQB 1C12B 3PQYE 4PG2A 3X3GH 3EYVB 1J05A 1MI5B 2X4PB 1ZA3B 3CNKA 5H94A 2HFFA 2R1YA 2XZQH 1JE6A 4NQEB 1YNKH 5HHPB 3PL6D 5HY9A 1EHLL 3EO9L 3OG6B 2XWJB 5JLZB 3FO0L 1HOCA 3QXVA 5C08D 4Y5VA 4JJHA 5DO2C 1MCSA 1HCVA 4WI2A 5T1MA 1CLZL 3LEXB 1QNZH 4AJ0A 1BD2A 3CXHJ 1YJDH 3UDWA 4YHKH 2VLJB 4PBVC 4X7DC 3BVNB 3MLVH 3QDMB 4XVTL 5TGBB 5HD8D 2H6PB 5E9DE 5MERA 4M7JL 3AFLA 5ERWB 1A8JH 1U6AH 4YUEL 2YA1A 4GQ9L 5EC1A 3W39A 4MA3B 2BVQB 1GGIH 2VL5B 5EORL 1ORQA 1FO0L 1T4KB 1R5VB 1T1WB 1ZHLA 4GKZA 4M9PA 4PJFB 3SGEI 5C0BB 4JFYA 4P48A 2BNRE 1TIUA 1IL1B 5D9SA 3RTQC 1PGRB 1YY8B 5I2IB 3IRZA 4HX1B 5CBAA 3QXWA 4WFED 3A0OA 1BAFH 2K9UA 1Z3GL 4FP8H 4I4WB 3L3IB 5F7FA 3MXVL 2VXVH 3TIDB 1TZIA 2IH1A 3FO1A 4PD4K 4MQSB 4UT7H 4NQDB 3U9PH 1I7RA 2J8OA 2D2OA 3L7EB 2ZCLH 1A6ZB 4L4TB 4UQ2A 1FVDB 4XZUA 4ZFOB 1AXSB 2OZ4A 2NY7H 1FZKB 5I1IL 3D0VB 5CD3A 2OJZL 4JAMB 3FT4A 4XAWL 3QUXD 4R4FL 4KY1H 4BH8A 4LQFH 3PWUA 2Z91A 1WF5A 3QIUB 1A9BB 2V17L 4LU5H 3ZT5A 2BCKB 1DTUA 1BOGA 5KS9B 4CRPA 4D0DA 3OHXA 5E5MA 2XXMB 3RKPA 1KJMA 2ZKHL 1B2WH 2HAZA 4Y88A 3U0TA 1BVLB 5IROA 5L9DH 1VFOA 4N0FA 5E8PB 1MHPH 4UU9A 1LE9B 3MJ7A 3SGJC 5I18L 3QFDA 5HHMD 1CL7I 4QWWD 3B6SB 3ZTJH 3G6DH 4L8SA 1B4JH 3HA0A 3V0VB 1BP3B 1J8KA 5CEYA 3S96B 3VXSA 3RIFF 1RURH 5TF1L 1JRHH 3IU3A 3RWEB 5C0IA 1I8KB 2QADD 1PY9A 4YXLL 1CXLA 1EK3A 1GGTA 4P3CH 1YEKL 3D9AL 3K7UA 3HE7D 4ZSOB 4ZYKB 2IANA 3GEWB 4WUUA 3VG9B 1T2XA 3SBWC 2NXYB 3MRIA 1CZ8L 5E8EB 3RZCD 4XNYH 3B8SA 1DBAH 3P3YA 1IGCL 2QQKL 3M8OL 3BW9B 3CDYA 3SDAB 3QQ9D 3JV6A 1A1MB 3MUZ1 2FJFA 1EIBA 2CMRL 1S7SA 5DVOA 4PRBA 1OAKL 1DQLL 1Q9LA 3VRJA 5DC9B 4YNYA 1UACH 3FCTA 5FYKH 5L6YH 3K0WA 2IBGA 4LAQH 3TVMB 1EA9C 3L1OH 1J8HB 3VWJC 1YC7A 2FR4B 4P5TB 4KPHL 4H5SB 3FB6A 4LLDB 5CUSL 4GBXD 4F57L 3CCHB 4MXQD 3UTQA 1K5NA 1EX0A 2HWZH 2JKXA 1YEGL 5K59F 5E8DH 1N26A 1HIMH 4FS0A 1NGWA 3DI3B 3LS5L 3V8OA 5FA3B 1KPRB 5I8KL 5KVFH 5IOPB 5EO9A 5ALCL 3DIFA 2P5ED 1IGJB 4UILL 3GSQA 2QKIA 4JDVA 4KZDH 3HCVB 1KN2H 2X1WL 2UY6A 5CP7A 3QDJD 2P8MB 3ARVA 3CAFA 5GRWA 2IH3B 1F11A 5T33L 1PG7H 1CGYA 3CXDL 3PWLA 2HJLB 4PJ7B 1WWBX 5EN2B 3F8UB 1ZWIB 3CMGA 4MDIA 3BEVB 3MBEA 3L6FA 1I3GH 4LLUA 1T04B 2VNCA 4LSRL 1J9CT 4U2ZA 4AENA 4ODTL 3B5GA 4JGJA 3HE6D 2QSVA 4Y5YB 4NSKA 3RPIA 1PKOA 2IPTL 3BN3B 4NNXB 4JY5H 3LMJL 4I13B 2M1KA 5IB3B 1FNFA 5B21A 4UBDD 3ULSA 3WSQH 1LDPL 1RJYB 3GJFB 3HC3L 1OB1A 1CFQA 1CVSC 1RFDH 2NZ9D 1PY4A 43CAB 4PRDA 2VZSA 4E42B 1Z0MA 3QNXB 5GRYA 4PRPA 2MJWA 1J05B 1KXTB 1XCQA 3FFCE 5H94B 1MJ8H 2HFFB 2R1YB 3V6OA 4R8WH 1YEIL 4BZ2H 1T20A 5HY9B 4GRWF 4NP4H 4RMTA 3MLZL 1MCRA 1NGQL 3SKMA 1CGWA 2VH5L 1HOCB 4OUOA 2XFXA 4Y5VB 3QCVL 3OV6A 5T1MB 3VRLF 3LKNA 1KB5L 3CD4A 2OM5A 4PJ9C 1J1OH 1MUJA 4LSVH 1HINL 5CKGA 2E8YA 1MAMH 1H3GA 4U1MA 5DSCA 4A6YB 5EUOA 1VSCA 3BEWA 2Y07H 4IRJA 4S1RH 5MERB 5I1LA 5IMOA 2AQ1A 3W0WE 5LQBL 4K3JL 3W39B 2MKLC 2QQLH 4HC1H 2ED8A 4M5ZL 3QXTA 1ZVYA 1ORQB 3U48A 4Z7UA 1FL6B 4HFUH 1IM3A 1RUKL 3MC0A 2RHEA 3INUL 5LXGH 1ZHLB 4LP5A 4JFYB 2A6DB 4EDXA 2DMKA 5DC4B 4D9LL 5GGVY 3BN9C 2FIKA 4G6JH 3S37H 3LRHA 4FQXC 4RNRA 4UB0H 1CR9H 1TZIB 2IH1B 4XPBH 4WV1C 2XTJE 3ZT6A 5GS3A 1M05A 1I7RB 4NKMA 3X3GL 1EZVX 1RSFA 3BIAX 4UQ2B 4MNGE 3QULA 1DBML 4XZUB 3QCUL 4OBSA 2XZQL 1C5DA 1UG9A 1YNKL 1K3ZA 1I8LC 1WBXA 3AREA 3KPRA 3WHXA 1TVHA 2GFBB 1AFVH 5CD3B 1VACA 2Q8AH 8CGTA 4PJIA 4WFFE 4OLEA 4OGXH 5CFHA 5DFTA 1QNZL 5GGSA 1JFQH 4Q9RL 4BH8B 1NDGA 4LOUC 1YJDL 3PWUB 4YHKL 3ORJA 4OV5A 3I75A 4KJYA 3MLVL 1BOGB 3TBTA 1O7VA 5DK2A 3DETD 1QYGH 2AAVA 3M17B 3OHXB 5E5MB 4JM2D 5DUBB 4WGVB 4XBPA 2ICES 3O3EA 3U0TB 1JP5A 2HKFH 3L3JA 2AV7A 4N0FB 3CH1A 4UU9B 5HPMA 3QFDB 2OXGA 4M03A 3O6FA 2HT2D 3BH9B 4OKVA 3KPSA 3MREA 3OKYA 2VR4A 1JHKH 4L8SB 5E6IC 2FJHB 2R39A 2VO5A 3W9EA 4PJAE 2FO4A 3ESUF 3KHQA 5CEYB 3I6GA 3FN0H 3IU3B 1NMAH 3QG7H 1NCAH 4JVPA 4PJBF 5CZXD 4BSWA 4JG0H 3DTXB 3SDXB 1P6FA 4ISVB 1BAFL 5LAXB 3K1KC 2IANB 2UV3A 4FP8L 2BXYA 5ADOH 2V5YA 3QNZA 5GQBA 4ZS7H 1N6VA 5JZ7C 1AQDA 3MRIB 4JQVA 4JHZA 4KI5C 5J13C 1KCKA 5DJXA 4UT7L 4IIQC 4X6DE 2ZCLL 4OD1H 5C07A 3JV6B 3R8QA 5IVXF 5F71A 2FJFB 4XWGH 1S7SB 4S0TD 3TP4A 1GHFH 4MJ5A 2IBZX 4BQ9A 1MCPH 4V1DE 1Q9LB 3OKKA 4L8CA 1FORH 2C3WA 3FCTB 1CFVH 3EJYC 3ZKNC 1NCUA 4WHYG 5F70A 1NUFA 2IADB 3QIWD 1CD0A 3D85B 4KY1L 4U1LA 3D2UD 3O4LD 4KI5F 4MAYC 2VXTH 3OQ3B 2CDEA 5CHNA 4LU5L 1OSPH 3TZVC 3VA2C 4I48A 4KRNA 5SWSE 1I7ZA 4YFLF 1DFBL 2Y1VA 3QZWG 5EO9B 3DIFB 4GAJL 1B2WL 1FP5A 5L9DL 2DBLH 3GSQB 5FEBA 4ODBD 2QKIB 1MHPL 4JDVB 1ZANL 5H37G 4Z7QF 2F8VA 5CP7B 2NNAA 3AUVA 3HPLA 3G6DL 1B4JL 3V6BR 2IAMC 4WU7B 1F11B 4HUUB 5JW5A 4RWYH 4BUGA 1RURL 4FOMA 1JRHL 3T0ED 3MBEB 4POYA 3FN9A 3L6FB 4LLUB 4P3CL 5E94A 4QRRD 5CJQH 4AENB 3LD8B 2WBJC 3TNMA 3C5ZC 4NN5C 4LRIA 5K59E 3TCXA 4NSKB 3RPIB 3CC5A 2EC9U 4CUCA 4XNYL 1ZT4B 1DBAL 3C5SA 2NTSP 3QO1A 5GSVA 1MIMH 4MXVF 5EA0H 1NFDF 3ULSB 3CX5J 4POUB 1MREH 2CUIA 3MRRB 4HIEA 1OB1B 2YR3A 1CFQB 3OBAA 4WEBH 2K3TA 4NQVA 2BOCA 3WJLC 4PRDB 2VZVA 1UACL 5FYKL 5L6YL 3PGDA 4LAQL 4PRPB 5IHUH 4APQA 1BIHA 2DI9A 4N0CC 4G9FD 5ITBH 3T1WA 1YQVH 1XCQB 1E0OB 1U8MA 3BMWA 3HTLX 4H25A 5BOZG 3BGAA 2L0DA 4YXHH 1T20B 5EBLB 5C1MB 4OV6F 5E8DL 1I85C 1HIML 2R4SH 5DQ9B 3SKMB 4UTAH 4M62H 4JZOA 1AHWB 1JF1A 2VXSH 3LRGA 3RUGA 4XCNA 3SO5A 2XFXB 4NBYB 4RIRA 1WCBA 1K4DA 4KZDL 3ZYIA 1KN2L 2WQ8A 2I24N 4O2CA 5ICYA 1JWSB 3BPLC 4LLAA 1MUJB 1NMCC 3GSRA 4U1MB 1NCCH 3RGVD 4HK3N 1PG7L 3BEWB 3O41A 4IRJB 5EUOB 5I1LB 5IMOB 3NN8A 2Z4QA 1KJ2B 4OQTA 1UWGL 1I3GL 1BOYA 4X99A 5K9OA 1BF8A 4RBPK 4DEPC 4DUVA 4PJ8A 2APWA 3D0LA 3MV9A 4LCCC 4P2RA 2UZYB 3BE1H 3PHSA 2MOVA 4JY5L 3Q3GA 1EHNA 2AK4E 2CUHA 3DI2B 2R1XA 5C0ND 4EDXB 4M3KB 4AL8H 3WSQL 3MACH 4HKXA 1KIRB 1KC5H 1RFDL 4D9RD 1OGAA 4AT6B 1II4E 1M05B 4PJXE 4NKMB 1LK3H 3QULB 2E7LA 1N2RA 1MJ8L 3R8BB 4R8WL 1C5DB 4BZ2L 3H7BA 3WFEH 1DQQA 1JTTA 4NP4L 4U6VH 4LCIL 5BZWA 1WBXB 3V5KA 4MJ2A 3WHXB 1TVHB 1RZ8A 3I9GH 4P3DB 1HDMB 1VACB 1KB9J 5T1LD 2EDXA 4PJIB 1HILB 4D3CH 3QHTC 2QHRH 5KANI 1MCOH 5GGSB 1KFAH 1NDGB 1J1OL 3D1MC 3SE4C 4OV5B 1MAML 2CLVA 3I75B 4KJYB 3PDGA 3TBTB 5SWZA 5DK2B 4AK1A 3RVTC 4LHUA 3UCRA 4Y4FB 3MUGA 4XBPB 3O3EB 1EDQA 3L3JB 2AV7B 2QQLL 3CH1B 5LG1A 1LEGA 4HC1L 3I02B 5FYJU 2ICWJ 5B39B 5HPMB 3O6FB 4ZXBA 4HFUL 4QHMA 4OKVB 3MREB 5LXGL 4X6CB 4YWGH 2NY2C 4PGCB 3CLEL 3W9EB 2FO4B 1IILE 2KL6A 3FB5B 4F2MA 1YY9C 3I6GB 4LVOB 4HBQA 4NKIH 2R9HC 4BSWB 2YUWA 4CVZA 1IQDA 3GK8L 4JG1L 4G6JL 3S37L 2EC8A 4N8VA 2HFGH 2ZJSH 4D2NA 1O7SA 1CR9L 1AQDB 1KCRH 2FEDD 5IJVB 5DJXB 3DX6B 4G5ZL 3KYNA 1PFCA 3REVA 5J6GA 3PF2A 3NCEB 4JANA 4S1DC 1OQXA 3GJFK 5LBSH 1I8MA 3C87A 5GJSH 3OKKB 1AFVL 4GS7C 1YEEH 1AIFB 4L8CB 5GXBB 2Q8AL 4OGXL 1FNEA 3O3BA 1FFNA 1KUMA 1JFQL 1ACYL 2WLZA 4U1LB 5CHNB 2CDEB 3BI9X 2PW1B 2HFTA 4RFNB 4P46A 1KTDA 4HWEH 1A22B 4I48B 4TSAH 5B3JF 1CD8A 1QYGL 1I7ZB 3ARFA 1OLLA 4L4VE 4RAUA 3LQMA 3QFJD 3IYLW 1WFUA 4OI7A 2BDNH 2HKFL 3IXTA 1LO5B 2AJUH 3ZE0F 4U1IA 4LPUA 2YBRB 3GNML 4IOFC 1KT2A 5IVXE 2NNAB 3HPLB 5HHQA 1JHKL 3PDOA 1D5BA 1ZLSH 5LKNA 1T3FB 4PBXA 3N1PC 1H8SA 5JW5B 4KKAD 5E2UH 1CGTA 2Q6WA 5I8CA 3FN0L 4W6YB 5IEKA 1IC7H 2EH7L 1NCAL 3QG7L 4JG0L 4YHOL 1R3HA 4KRPB 1XGQA 4HCRH 3LKPA 5DVLA 4JRWA 5E94B 4PS4H 4JY6A 3WL9A 5ADOL 3MA7A 4HHAA 3TNMB 4ZS7L 4PB9H 5HYSA 2D0GA 4BSVA 1DEDA 5C0BD 3CC5B 2JLLA 5BRZE 3PWPB 3C5SB 5D1XD 4OD1L 1A6UH 3MLXH 5GSVB 3TN0D 3TYGH 3IGAA 4PG9B 2PYEA 4Z7QE 5I1CL 2FB4H 3O9WB 5I8EA 4HIEB 4XWGL 4NO0A 1AQKH 1GHFL 5E00A 4B7LA 1MCPL 4JRXA 4NQVB 1O0VA 2BOCB 3V4PH 1FORL 1CFVL 1G7QA 3PGDB 2ZUTA 5J3HC 2YD1A 1J18A 4N5UA 1U8MB 3WIIH 4H25B 4I9WE 1ZLVK 5I73B 1UQSA 2VXTL 2NY1B 1OSPL 4Y2DD 4Y19E 1LVEA 1DVFD 5E70A 4LGPB 1OL0A 1N5AA 5JW4M 4EEEA 1JF1B 4ZUSA 4XCNB 4BQCA 2OXHA 2DBLL 1WCBB 1U8JB 3U30C 1K4DB 1KG0A 1BEYL 2ARWA 4MXVE 4DVBB 3DVGB 1X5YA 1Q9OA 4O2CB 5ICYB 2R2EB 3GSRB 2LU7A 2P24A 2XOTA 5LWYH 3O41B 4U1HA 4X6EB 1BQSA 1JGDA 2EXWD 4RWYL 3EYQC 4KK9C 3RVXC 2X5PA 5J11B 5HYEA 2Z4QB 1KPVA 1UWEH 1AO7A 3F65A 2GTZB 2YD7A 1N8ZA 3GZKA 4X99B 5HVHB 4NIKB 3REWA 4PJ8B 1MHEB 1CYGA 3D0LB 2P46B 1MCFA 1WSST 4YBLB 4K7PX 2WZPD 3FMGH 3RKDC 4XXCA 5K33A 4HIXH 2XN9D 1CWVA 2R1XB 2H26A 5CEZD 1MIML 5D72H 5EA0L 3BGFC 5DVMA 3ARZA 1MREL 1UKTA 4HKXB 2VE6B 4OCSH 4WEBL 1XGRA 3HG1A 4MJ6A 1JWUA 2AV1A 5IHUL 4OLXH 2I27N 1IRAY 2H1PH 5ITBL 1F2QA 1YQVL 5JMOC 1AH1A 5E03A 2C1PB 4HWBA 2BY2A 3SDAD 1IJ9A 1PD6A 1VA9A 4AEHH 4YXHL 1RUAH 4WGWB 4ODWA 3V5KB 1PKQE 2R4SL 4O2EA 4MAUH 4GG6E 4UTAL 2YK1H 2VXSL 3E6HA 1EERB 2BXZA 4I0PB 4L3EA 3RWCA 5IIEA 5CBEA 5GISH 4RA3A 3K74B 3LKRA 4PJDF 2HG5B 2X44D 2CLVB 1QRNE 1J0ZA 4PLJC 3HUJF 5SWZB 5F7UA 1MLBA 5ADPH 2IQ9H 3C6LB 4LHUB 4WHTA 4YE4H 1E4XH 3MUGB 4OGAD 1FVCA 1YEJH 5D7LA 2WW8A 1LEGB 5BVPH 3ARGB 5L2JB 4ZXBB 2FEEL 4MVBC 4QHMB 4YFEA 4MB4A 1W8NA 3OKNA 3BE1L 3GSNB 4L8BA 4F2MB 3ULUE 1B6DA 4YGAB 4JFXA 1ZTXH 4WW1A 4G80A 4CMHB 1QVOA 2PXYC 3RBSA 4CVZB 1IQDB 4AL8L 1ZLWH 2FATH 3MACL 2FDBP 4Q2ZA 3L3OB 4N8VB 2G60H 1KF9B 1YDPB 4P2QE 5JHDE 1KC5L 1C7SA 3FZUD 4X0KB 5C6TH 1IKNA 3GI8H 1E4KC 2W9DH 2K7PA 2VLKB 4DAGH 3KYNB 1YJDC 1T2JA 3REVB 2ZUVA 5IG7A 3M45A 1LK3L 1AKJA 5J6GB 1GVIA 1INDH 4JEGB 1EO7A 3H0TA 4P57A 3DO3A 2D31A 3ZHLA 2VB5A 3MRMB 4QHNA 4U6VL 3WO4B 3QWOA 4GRLC 3ARQA 2OQJA 2X1PA 1JGLH 3MRFA 4XB8A 4LBEA 1DQJA 5GPRA 4D3CL 2QHRL 3WUWA 1FFNB 1JMZA 1KFAL 5I1JH 3S34H 5HYJB 1HE7A 1V3LA 1BZ7A 4P46B 5FGBC 1H3UA 1KTDB 3IFPA 3BYTA 5F7EH 1KTLA 3U1SL 1OAZL 2G5BA 4U4BA 4MHHI 4RAUB 4KV5E 4J8RA 4NQCA 3FJTA 2JELH 3G08A 1N6UA 1UT9A 2V9QA 1NANI 4U1IB 5EU5A 1NJ9A 2ICWA 4KJWC 1KT2B 4KUCF 1BD2D 5HHQB 3PDOB 1D5BB 3AS0A 2DQGH 4W4OC 5CGTA 4YH6A 3HMXA 5E8OA 2Q6WB 5I8CB 5IEKB 2NY0C 3PWJA 4NKIL 2Q20A 1IKFH 5M94B 4R0LB 3LSOA 4UOJA 4NCC1 1LEIA 1R3HB 2DD8H 1XGQB 3LKPB 2C7UA 4KXZI 2HFGL 3WL9B 4G6AC 2ZJSL 3MA7B 4HHAB 1V7MH 4FG6C 1KCRL 1IC5H 4BSVB 5HGHA 1M6OA 3KYAA 5DVNA 4UINH 1F4AA 1YN7A 2UZIH 2APTA 4J4PC 2B2XH 3DBXA 5IW1B 1EZVY 3IGAB 4FFWD 4U31A 2PYEB 5TDOA 5LBSL 4HMEA 5I8EB 4NO0B 2NY3D 5E00B 3UAJD 3SCMA 1X5AA 4JFFA 4JRXB 4OB5H 5GJSL 1I1YA 1YEEL 4PRID 4QRSA 1G7QB 4ZFZB 5IW6A 4J3XA 1FV1A 5B38B 4DGIH 3A6OA 2H2SC 4MQXC 2Q7NA 5GGRY 5HI5D 3PDDA 1YPZE 4G8GA 5INCA 2VLMD 1UQSB 4UNVA 4WCYH 3CSYA 5JPMA 3S5LA 3LB6C 3IXAA 3NA9H 2FBOJ 4HWEL 5B39G 1N5AB 4TSAL 1G84A 1I9RH 3MODL 4U7SA 5C7XH 4ZUSB 3QNYB 2ZCKH 2BDNL 2XY1A 1HYSD 2MWCA 4NZUH 5L8JB 1BPVA 2AJUL 2D9QB 1NEZA 4M93C 1CD9B 1N64H 2JJTA 4ZOBA 3CXHK 1Q9OB 3KPOB 4PJ5E 3FO2B 1MLCA 1ZLSL 2P24B 5EU6D 1G7PA 1JPFA 5BS0A 1JGDB 3GMMB 5E2UL 5ICZA 1IC7L 5F9OH 1AO7B 3ZKXC 2YRPA 1N8ZB 3QA3A 4HCRL 5I9QB 3REWB 4PS4L 4M6ML 4HH9A 4PB9L 3T3MF 4PGZA 2V2XB 4EUPA 5EFIB 3VXSD 2H26B 3FO9A 3MLXL 3MRLB 1INQA 1WCQA 3DX8B 2DQTH 4ODHH 3TYGL 1TZGH 5JUEH 2FB4L 3GMLA 1AQKL 4N90E 4WUUD 3D87B 3TBVB 1I4FA 1XGRB 3HG1B 1JWUB 3V4PL 2J8UF 4KQ4H 3DUUB 1NAMA 4R4ND 5A2JH 1R24A 1L0YA 4ELKA 3L5XL 2Q3ZA 4CGTA 2ADGA 4ODWB 5ABDE 3AM8C 5AG9A 3E6HB 3BPNB 3RWCB 5IIEB 4M7KH 5CBEB 1JZ8A 3LKRB 4DK3A 4QXUH 1X5KA 3BP6A 3U6RA 3QJHA 5IB4B 1DLFH 4WY7H 3G9AB 3JUYA 2JJUA 4XP1H 5IW3A 4NBXB 4AIXA 2JCCB 1UWEL 5GGTA 4LLVA 3WD5H 3P4OA 3MLYH 5D7LB 1CLCA 4L1HA 3BESR 3BAEH 4HPYH 4NQSA 3VI3E 2EIDA 1C1EH 3WCYA 3OKNB 1CFNB 4G8IA 3FMGL 4L8BB 1FC2D 1OWRM 4E0RA 4HIXL 4MMXC 1D9KC 4IDJH 3RVUD 4WW1B 4G80B 1T66C 2ZPKH 5D72L 3E3QC 1MEXH 5ESQA 1HH9B 4P2OC 4URTB 4Q2ZB 2Z35A 4UDUA 2FH6A 4HXAL 1FFPA 3NFPA 3BZDA 3HUJE 4P4KC 5IV2A 3DROB 3UMTA 5C0CD 3NTCL 3G04A 3N50A 5DRNA 4OLXL 5IG7B 4NO5A 5GS1B 3DECA 2H1PL 4QRUA 2V5TA 4YO0A 1AKJB 1QSEE 2W0PA 5HYIA 2DQIH 5A16B 4AEHL 4P57B 5E4EC 1CICA 4PV9A 2D31B 1L6XA 1RUAL 4PGBA 3QWOB 4RGNE 4WEUD 2OQJB 4N68A 5FYLH 4MAUL 2YK1L 4LBEB 3D3VA 1C7TA 2DWDA 3MMEA 5A2LH 4PRPD 4ZOCA 4KH2A 1RPQA 4RGMB 5GISL 2NQCA 1RAMA 4LSSH 1JWMB 1UJ3A 4HFWA 3IFPB 3T0VA 1YMMA 3W11D 3DNKA 4H20H 3RNQB 4PLNC 4ZUWA 5C9JA 2BJMH 2G5BB 2IQ9L 4YE4L 3DPBA 1A7BA 1ZLWK 1E4XL 4R3SB 1CXKA 1YEJL 2EIZA 2E7HA 3K2MC 2A6KB 3G08B 5BVPL 5EU5B 2ICWB 1T1ZA 1VGKA 3FQTA 1FIGH 4IS6B 1PBYA 2VXUL 2YPKA 5FO9A 2G9HA 4X5XA 5E8OB 2XPGB 3PQYA 1OAYH 4AQ1B 3IDXL 3LSOB 1DN2A 4FXGA 1U8PA 1LEIB 4HUXB 5FECA 4F37K 2FATL 1NMBH 4NZJA 5D2LE 2G60L 5C86A 3TM6A 1J11A 1M6OB 5C6TL 3GI8L 2W9DL 2GITA 1YN7B 3ALXA 4DAGL 3MRBA 3HR6A 2C4XA 3DBXB 1ADQH 5ISZB 3WIHA 5A3ID 1INDL 2DWEA 1LP9E 5TDOB 4U2YA 3DURA 5IMKA 1IFHH 4MB5A 5B3NA 2XZZA 5E9DA 5DYOB 3SCMB 4JFFB 1JGLL 4TRPH 2NYYD 4CU8A 1AC6A 1CLOH 1FV1B 3SQBA 1XGPA 1FG2A 2IGFH 4OIIH 1G7MA 3N1QC 3VXPB 4G8GB 5I1JL 5IFHH 1N4XH 2A2QT 3CSYB 3S34L 5JPMB 2FZ3A 1R5WA 3S5LB 5EOQH 3T0WA 5F7EL 4ZTOH 3QQ4A 4JQIH 2BNRA 3ARED 3KPRD 4NUGH 2E7CA 5SX5K 2GTWA 2GSGA 2JELL 3IDYB 3UYRH 4BFBD 1NEZB 1TENA 4LP4A 5I15H 2R0WH 4KJPC 4BA8A 2BY1A 4R2GB 3H9SB 5DQDH 5GZND 4CVUA 1G7PB 5JIHA 2V2WA 4M6AA 5D7IE 1JPFB 1NQBA 5DMGD 1CCZA 1L0XA 4HS6A 5ICZB 4ODUB 3ARBA 5DZOA 5F7LB 1IKFL 2EYTA 4Z78B 4J3OC 4HLZG 4FQ1H 3B9KA 2ORBH 2AEPH 4RDQG 2FHCA 5INDA 3SGKA 2BVOB 3O6FD 5IVOA 1V7ML 2PO6A 4HH9B 1IC5L 3KPSD 4R90H 3VFMA 4UINL 3ET9F 4EUPB 3RNKA 4KKLD 2YD2A 1V3JA 4PTTA 4MD5B 2B2XL 5HJ3B 3FO9B 3TO2A 1U8KA 1AE6H 4I18C 5EU3B 1INQB 1WC7A 2E9JA 1R0AH 3N1GC 4B50A 3GMLB 4RAVA 1FFOA 4PJCF 3W2DH 1I4FB 3EOAA 3O2DH 4OB5L 3UYOD 5CEXA 2YXMA 4JFDD 1NAMB 1U0QA 3VWKC 4DGIL 5DMYA 1MHHA 4KDTC 5C07D 3H2WA 2IMMA 4WCYL 2UYLB 1R24B 1ZLUH 1EBPA 4ELKB 3NA9L 2YSSA 1XEDA 2ADGB 5I6XB 3WFHB 1I9RL 4H0HB 1BWWA 3MV8E 3VXTA 1Q9WB 2ZCKL 3BQUC 2VLJE 4NZUL 1QHOA 4AG4H 1N64L 1S7VA 3U6RB 1CG9A 2X4NA 3VXRD 5JXED 2A83A 2NZIA 1L7IH 3FHAA 3QJHB 4KKBC 4NGHH 4M5YH 1X6LA 1BJ8A 4I2XE 4IRSA 4HJ0D 3TBYA 4XCYA 5DWUH 1MRFH 5F9OL 1GZPB 4LLVB 4FHBD 4RFOH 3P4OB 1HNFA 4WO4C 2UZXB 3LN4A 4PJFE 1F8TH 2NXZD 2W1NA 4JO1H 4NQSB 3ZYZA 1QFOA 4QRPE 4PJGB 2DTMH 1BFSA 1HXMA 3IS0X 3BZ4B 4G8IB 4NFDA 2YZ8A 4E0RB 4FFVC 3BIKA 4GOSA 1F02I 3FRPA 2R2HA 3DVIA 3O8XA 1IMHC 5FM4A 2DQTL 3EYUH 4ODHL 1TZGL 2Y6SC 5DHVB 5ESQB 5JUEL 1I7UA 5B38G 3IETA 2Y5TB 4JPKL 3C8DA 3NFPB 3QQNA 5IR1A 4L4TE 5IV2B 3OXRA 4KQ4L 2X4SA 3G04B 3MCLH 1HHJB 5DRNB 5T3XE 4HF5H 5C6PB 2VDPH 3NACL 3KPTA 4JFPA 1I8IA 2BP3A 3LDBC 4O2FA 4PJEF 4PV9B 3V2AR 4PGBB 5TDPA 4OZGF 3RWIA 5ITFA 3QUYA 3D3VB 2DWDB 3MMEB 4E41B 3PL6C 4M7KL 4APQD 2BFVH 5KS9E 4N1HB 3QEQE 5I1DA 4QXUL 4G8EB 3C60D 4XPTH 4PB0H 1UJ3B 1DLFL 4HFWB 4WY7L 2OI9C 1NCDH 4OFPA 4X4YA 4XP5H 1FJ1A 4XP1L 5C9JB 1JHTA 3WD5L 2EIZB 4OIAA 2VDQH 2X2YA 3VFSA 5BVJA 5HD8C 1G0DA 3BAEL 4HPYL 1T1ZB 1C1EL 3FQTB 2APFA 1KULA 4K7PY 2YPKB 5FO9B 2G9HB 4X5XB 2VABA 3PQYB 2AJYH 4IDJL 4QCIA 4ZSOE 4LSDA 4WU5A 1YMHA 1DQMH 1MEXL 3FFCA 3JV4B 5D1QD 1U8PB 2MNUA 1MFCH 2W92A 2X41A 3FAWA 4U1GC 1BQHB 3GSWB 3IJHB 3MV9D 4P2RD 3CIQA 2GITB 1E4JA 3MRBB 1Q38A 5GRXG 3Q6GH 3DGCR 2I9LB 5TQ2H 2DLHA 3CX5K 3I50H 5DMIL 4ZUUA 2DQIL 1UZ6F 4LRNH 3RJQB 1S9VA 5IMKB 1TPXC 4XP6H 1KCLA 3QHFH 5E9DB 1IARB 3O6KL 1J8HE 2YA2A 3W0WA 1OGAD 4M7LT 1XGPB 4PP2A 1FG2B 1G7MB 4LF3A 2G5RA 4LSSL 5BW7C 1S7UA 1IGMH 2FZ3B 1R5WB 4H20L 4EN3C 2BNRB 4J1UA 2BJML 3X3FL 4U33A 1CD1A 1BBJA 1WWWX 2EO9A 2GTWB 2GSGB 4RMQA 1UB6A 3OKOA 1JMXA 1XAUA 3SN6N 3WS3B 3QISA 4PJ7E 2V2WB 5SWZD 4IJ3C 4HS6B 8FABA 1JI2A 1QLFA 1OAYL 3ARBB 4LHUD 4QWWC 4MNGA 2EYTB 4XVUC 5CSZA 1RQ5A 4KQ3H 3JVGC 1NMBL 5INDB 2QBWA 1V7NH 2OZ4H 4XP9L 2UWEB 1GGBL 2QADC 3VFMB 1I3RA 5FYJD 2X10A 3RNKB 3HE7C 4PTTB 5JO5A 4Z0BH 3VDAA 2FRGP 1EFXA 1ADQL 1WC7B 4ELMF 4YPGB 1BQUA 4RAVB 1IFHL 1KSRA 3D48R 3EOAB 5CEXB 1I75A 4TRPL 2AABH 3QQ9C 1CLOL 2XICA 2IGFL 3GSXB 4OIIL 5IFHL 1N4XL 3BX7C 4DFIA 5KG9A 4MJID 5TFSH 4RGOH 2EE6A 5EOQL 1FRGH 4PJAA 4ZTOL 4H1LA 3RTQA 4JQIL 1D7FA 1TTFA 3SE9H 5DD6A 1O5DT 5HI4D 2ZCHH 5DXWA 1KB9K 3VXTB 1KJ3H 4GBXC 1IC4H 4MXQC 3UYRL 3NCMA 4LMQI 1S7VB 4DZBA 5I15L 2R0WL 4FMKA 3VMNA 2GEEA 4BFEA 1VFBA 2EDEA 3ROLA 1T2QH 5DQDL 2ZOKA 1QP1A 3WHE0 4Y5XC 4JHWL 2EKSA 5HTSA 3WFDH 3TBYB 2NTFA 4F7EB 4X6DA 4JGUA 3ARFD 5F7HA 2C4FT 5SWQA 3LN4B 4KROD 2AEPL 3SOBH 1RHFA 4OFIA 1OARH 4V1DA 1T1YA 4R90L 1HXMB 3J8F7 1KIQA 3BIKB 5D2NB 5D96B 1AE6L 1G0YR 5IQ9B 3HE6C 5HYQB 1R0AL 1I7UB 1GJIA 1OF2A 3IETB 4HEME 3C09B 3W2DL 3O2DL 5SWSA 1MWAA 5IR1B 5JTWA 4U1SA 2FJGB 3PXJA 2X4SB 4ETQA 4GXVH 1J10A 3S5LG 3NZHH 1M7DA 4PGEA 1BLNA 1TQBC 4JFPB 3MPCA 1H3PH 1HHIA 2NZ9C 3RBGA 1HI6A 1DQTA 4O2FB 3FQXA 3PP4L 5TDPB 2BZDA 1SMAA 3RWIB 3V4VH 3MV11 3RHWK 5ITFB 1QOKA 2D03H 3MOAL 2JB5H 4KWUA 5JPNA 2ADJA 4AG4L 4PGJA 5JIKA 5DUPH 5I1DB 2CLRA 2G2RA 5GRJH 5IB5A 4TVPD 1L7IL 5KZCB 4NGHL 5IVZB 4M5YL 5C2BH 4X4YB 1QBMH 4X7TA 1FJ1B 2ICCA 2XY2A 4R7DB 3MQIA 1RV6X 3K46A 5DWUL 1MRFL 1S9YA 5GS0D 1JHTB 1IC1A 1XIWD 3V5DA 4RFOL 5C0RH 5HVWA 3VFSB 4EUPG 1F8TL 4JO1L 3HNSH 1FYTE 1BZ9A 3RDTC 2DTML 1G7JA 3IAQA 4LIQH 3D39B 4OZGE 3SDXE 2VABB 4U1JA 4XAKE 1YMHB 1AP2A 3QT2A 3V7MA 3FFCB 1AO7D 3EYUL 1UVQA 3NPSC 4JY4A 4GKNA 4ZDHA 3N06B 2EYSA 3KJ6H 2A6IB 3D69B 5JOPD 3VU2A 1FBIH 2DI8A 4H0GA 2BERA 4XNZC 2WBWB 1FGNL 3MCLL 3IKCA 2NY4C 1U2HA 4HF5L 2R0ZL 1TJGH 3ARUA 4JFHD 4HWUA 2GJ6B 2PTUA 2FGZA 2Y36H 1MY5A 4LCYA 1S9VB 4B0MM 3LKOA 4PIRF 4OZHF 4JO2H 2VXQH 3W5NA 2CKBB 4NKOA 2DQHH 1OTTD 2JIXD 2YEZA 4L3CA 1LO0H 1FSKB 3QPXH 4PP2B 1OP9A 2BFVL 5E2VH 3G6JF 5C08E 1KEMH 3DYOA 5H2BA 4XPTL 3OAUH 6FABH 1R3LA 5IESH 1ND0A 4LSTH 5E5UB 4PB0L 5LCVH 3HI6H 5J56B 1NCDL 4XP5L 2AK4A 4MLIA 5J9PA 1CD1B 1BBJB 4M8QB 2VDQL 4L3ED 1UB6B 3OKOB 1YQ2A 4JVUA 4OD3H 5C0AD 3U82B 1GGCH 3DETC 1A7PL 1NKOA 1UZ6E 3O3UN 2X1XR 3KJ4B 4JM2C 1LE5A 1P69B 3C8KA 2XTJB 3UC0H 4PJXA 8FABB 2AJYL 4GG8A 1QLFB 3BZFA 3BSZL 1DQML 5CSZB 1M7IB 3ARRA 2EDQA 4YHNA 4PJHF 3TZVD 3RP1A 5I71C 5CZXC 4WFEE 4Q9CA 4HMDA 1I3RB 3BISA 3MZTA 4Z76B 3Q6GL 4KK6D 1GOGA 1CDUA 1B6UA 3VCLA 1XF4A 3ZLQC 4U6XB 5CKAA 1HK6A 4JM2F 3I50L 3NIDF 4LRNL 2OR9H 3S8WA 1NBQA 4XP6L 2EE2A 3QHFL 4Y1AE 5DQJA 2IFGA 4XMPL 1RULH 4J3VA 4NT6A 1W2KT 1REIA 2EDHA 1S7WB 4F33B 2HT4C 1IGML 3WLBA 5KG9B 3N0PB 4PJAB 4H1LB 3RTQB 3TIEA 5DJ6A 2VISA 5DD6B 1FZMA 3T08A 3QIWC 1QFWM 3EYSH 4FZ8H 3VD5A 1NCWH 1KPUA 4FQXA 3ILQD 1F58H 1CFTA 1SJHA 4PD4J 5JW3L 4DZBB 1MVUA 4ELME 4X80H 5FDWA 4WFHE 1VFBB 4F8TA 3ROLB 2ZOKB 2GYSA 2BNUA 4JPVH 3HRZB 2EKSB 2NTFB 4Q6IC 1BQHG 3VH8A 4X6DB 5CGYD 2OTUA 1NCTA 4NQCD 4EDWH 4HKZA 1GPOH 4KQ3L 2EE9A 4QLRA 1ZS8B 1LK2A 4R96B 1JRHI 4O9HH 1V7NL 2OZ4L 5L2KB 4V1DB 3ARDA 3SGDH 3T0EC 1FZJA 4DZ8A 1FG9C 4DGVH 4HK0B 4HPOH 4BSJA 4AM0A 3F6LA 1KIQB 1QBAA 4Z0BL 1IAIM 2WAHA 1F4XH 5KSBF 2ZWLT 1DL7H 3MRPA 3D18A 2QL1A 1B9ZA 5DJYB 1OF2B 3GSUA 2CXGA 2IALA 2DJ4A 2DDQH 3BPCA 1MWAB 4U1SB 4L4VA 2AABL 4OQ1A 1WZLA 4Y0GA 1M7DB 3QH3B 1WAAF 4P59H 1BLNB 1V3KA 5JQ6H 1WV7T 1KLGB 1U58A 1BFVH 1HHIB 1AJ7H 5KANG 5IVXA 3FQXB 5TFSL 4RGOL 1FRGL 1NGPH 2BVEA 2CPCA 3EIFA 3PE9A 2FWOA 4UQ3A 2XACC 3SCMD 3SE9L 1G9MH 4JFFD 2ZCHL 4XNUH 3BOVA 5C09E 1KJ3L 2DICA 3NBNA 1KCSH 5JPNB 1V3MA 1INEL 2FH8A 3FB8B 3M1BB 4P4RB 3T0XA 1T5XB 3FQRA 2CLRB 2Z93B 1E27A 4G8GD 3VRIA 1WEJH 3E2HC 1T2QL 4DW2H 4DN4H 4GMTH 3GO1H 1I3VA 5BRZA 5J7CC 4X7TB 3WFDL 1KEGH 1SJXA 5DTFB 2OMNA 3PNWA 4U3CA 4M7ZC 1S9YB 3ULVD 3V5DB 1RUMH 4AEFA 4KTEH 1D5MA 5EG6C 5I76B 4X6CE 4YXKL 1LO3H 3CFJA 3CVHA 5HHXH 2BOBA 5EIQA 4RMSA 3P2TA 1BZ9B 3GB7A 1OARL 1JGEA 1G7JB 3UPRA 1D5XA 4EZMA 3ZO0A 5BS0D 3VWJB 3HZMB 2DS4A 3VXQA 2NW3B 4U1JB 1DSFH 3T2NH 1AP2B 5KBNC 2IWGA 4NZTL 4JY4B 4LDOB 3S35L 4QHUA 4AZ8A 4LNRA 4Y19A 2EYSB 3BKMH 2GCYA 1G6RA 2ZNWA 4KFZC 4GXVL 2DQUH 3NZHL 4CADA 4HT1H 5IHBA 1PQZA 3AMKA 5F89B 4YDLC 2LTQC 1H3PL 1PEWA 4DJMA 2X05A 4LCYB 2Z92A 3PV7A 4LPTA 3OX8B 1CN4A 3LKOB 2IPUG 4S10A 2B8OT 4NKOB 4QKXB 1NC2B 3V4VL 1NUDA 4UV4H 3MNVA 4FFYH 2YEZB 4L3CB 2D03L 4LSUH 3SDYH 3NAAH 2P45B 2JB5L 3FAXA 4OQTH 5DJZA 2WBJA 3VGAC 1N0LA 1W72A 5DUPL 4X4XA 2V5MA 5GRJL 3WEXA 5H2BB 4KXZH 1R3LB 3EO1A 4GRWB 5C2BL 2YD8A 1QBML 1RI8A 1A47A 4HUWA 2AK4B 2UUDH 2R56H 5FHAH 5J9PB 2FBJH 4S0SD 5C0RL 2LV4A 4J3SA 4S1DD 4R7NA 3HNSL 3WJLA 2APBA 1LE5B 4OZHE 1BREA 3FT2A 4LIQL 3GHEH 1JZ5A 1RZGA 3O3DA 4PJXB 4GG8B 1F2XK 5DD1H 4F15C 3BZFB 5DI8A 4P23D 4GKSB 2NX5B 3NVQA 4JO4L 4TTDD 4BH7A 4JDTH 4YHNB 4NQUA 3PWPE 5I30H 3KJ6L 1PKQA 1FBIL 3QXUA 2A6JB 4CJ0A 5ILTH 1F3JA 4GG6A 3IJYA 2CR6A 1PZUB 1MHCA 3OGOE 1TJGL 3ZL4H 2FEDC 1XF4B 3QYCA 4G43A 2XG5A 3WNKA 2Y36L 1P7QA 4YIQB 1QRNA 1NCBH 4JO2L 2VXQL 5DQJB 2P8LA 5J06A 1ZGLP 1WT5A 4X9IA 1UA6H 5GRVK 4NO2A 2KDGA 3HNTH 1LO0L 3QPXL 5E2WH 4WTWA 1KEML 4RQQB 4LCCA 1ZGLB 3OAUL 5ACMA 4LSTL 2YC1A 5AD0B 1CICD 5LCVL 5DJ6B 4NDMA 5E24E 1VKXA 1FZMB 3T3PE 5FYJH 4Z7VF 3I6LD 4FQXB 5GRVL 1CFTB 2CRZA 1SJHB 3KNBA 5EO0A 1MVUB 1GGCL 4P2QA 5FDWB 3MYJB 5JHDA 1A7QH 4WV1B 5TDNA 5IM7A 3MJ8B 15C8H 1PG7X 1TLKA 2BNUB 5CMAA 3T8XA 3SKOA 1YMMD 1R3KA 3KYOB 3RY6A 3VH8B 3ESVF 3SDCD 1XZ0A 4FA8A 3SKNB 4Q0XH 4BFGA 4HGMA 4X7SH 3RY4A 4KKAC 1N6QH 1BX2A 1W0YT 3L3GA 3MBXH 4QRQB 4DZ8B 3VXOA 2BHUA 4AM0B 1F3DH 1H8OA 5FF6A 4PV8A 5DJDA 4ZFFA 5GSRA 1I1CA 3CFBA 1MFDH 4BYHA 3MRPB 3D18B 1CDBA 2OR9L 1XF1A 1EXUA 5FOJA 2IALB 2DM7A 4Q74A 5D1XC 3QEUA 3FB7B 4Y16D 4OJFH 3RVXD 4L4VB 3TN0C 1RULL 4M6OH 5HGBA 4F3FA 2FL5A 3OJDA 1KIPA 3OJMB 4FN0A 5GGQL 4BQ6A 5FO8A 3HI1B 5IVXB 3FTGA 2LABA 1ZE3C 2BSSA 1GZQA 3DLQR 5FAAA 2ZUQC 3FOMB 5CP3A 4MCYA 2FD6L 2FWOB 5EOCJ 1MCEA 3EYSL 5TH2A 5AZEL 4TUOA 1NCWL 4Y2DC 2W0KA 1DVFC 1F58L 2AJVH 2E8ZA 5ANMB 1JZ2A 4X80L 5J13B 1E27B 1LD9A 3VRIB 2F5BH 4O5LL 3GUTA 2VR5A 1PG7W 5BRZB 5J1TC 5FOBB 3DO7A 1QBLH 3PNWB 1D5MB 3QIUC 3G5XA 1GPOL 3WFZA 4GJTB 5BO1H 2EXWC 2BOBB 5IMMA 3LH2H 3MZGB 4O9HL 1BM3H 3T65A 4P3WA 1JGEB 3TJHD 3UPRB 3VFPA 3CLFL 4HPOL 2R4RH 4OZIF 1P9MC 3RWHA 3VXQB 3X13A 5T5NF 2OL3H 3KS0H 4MAYB 3KVQA 1F4XL 1YPZA 5FGRA 3S37X 4QHUB 4LNRB 3B9KD 2AKRB 4Y19B 2VLKE 4HAGA 5CIPB 2GCYB 2DDQL 2PO6D 3E6FA 3P4MA 5C3LD 1JPST 3BUYA 1KOAA 4CADB 5GS0H 1PQZB 4P59L 5JQ6L 3ZE1F 1NFDB 1MJUH 1T0NA 4PJ5A 1AJ7L 2IAMB 5D7KE 1F42A 2Z92B 5TQ0H 4G9FE 1CXIA 1NGPL 5IFJA 1NLDH 1CS6A 1VPOH 3MNVB 3U46A 3SDAC 5BCAA 1KCSL 5HYJE 4KMTH 4MHHG 1U8QA 4XHQA 5DJZB 2WBJB 3NH7H 3ZYJA 3C5ZB 1W72B 3ZKMD 1L0QA 4KJQD 1F00I 1Q0XH 4X4XB 1J5OH 3WEXB 3OXSB 4F7MA 1WEJL 3EO1B 4DW2L 4ZOEA 1U3JA 4GMTL 4DN4L 3GO1L 3AGVA 4HG4J 5AUMA 1KEGL 1H8NA 4M1GH 4HUWB 4M48H 4P5TC 5HSFA 1RUML 4KTEL 3TH3T 2VAAB 4P5MB 5F7WC 1LO3L 5HHXL 3AAZB 4R7NB 2Y25A 2HRLA 4TUKL 1K3IA 2HRPH 2MKWA 3NGBB 1U91B 2ESVB 4LVHB 3RPKA 3FT2B 4OGAC 4WTXA 4IRSD 1RZGB 3O3DB 3C2SA 3ARXA 3SPVA 1MCIA 1U3YA 5K9JH 4HWBH 2IQAA 3BKML 1LNUA 4KVCH 1PKQB 1UEYA 1F3JB