3RKDC

Hepatitis e virus e2s domain (genotype i) in complex with a neutralizing antibody
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
213
structure length
213
Chain Sequence
b'DIQMTQSPASLSVSVGETVTITCRASEIIYSNLAWYQQKQGKSPQLLVYSATNLAEGVPSRFSGSGSGTQYSLKINSLQSEDFGSYYCQHFWGNPWTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Capsid protein
molecule tags Viral protein/immune system
source organism Hepatitis e virus
publication title Structural basis for the neutralization and genotype specificity of hepatitis E virus
pubmed doi rcsb
total genus 53
structure length 213
sequence length 213
chains with identical sequence L
ec nomenclature
pdb deposition date 2011-04-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3rkdC02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3rkdC01
3T2PA 3S35H 3LMJL 4KVCL 2FZ3A 2LV4A 3O6MH 4Y4FD 4TUJB 5AWNL 2OQJA 4JE4B 2ATKB 3D3VE 4S0SD 4JM2B 5GS0D 1E28A 4QHMA 3PL6B 5LGJB 1IKFH 5CP3H 5FB8A 4NQED 2ZOLA 5I73B 3TN0D 3S5LA 2IMMA 1H0DA 5MERA 1Q0YL 4P2YA 5FHAL 4DFIA 1S5HA 1PJ9A 4JFDA 2EIZA 1H3XA 4P5TC 5LWYL 4QOKB 4YIQB 1OB1A 5C0BE 5LCVH 3T1FB 1B2WH 2ZOKA 4PRPD 4AG4H 1UM6H 5ENWB 2W9LA 3OXRB 4TUJA 4XPTH 3V7MA 2WK2A 4XP5H 2X42A 4BKLA 4KRMB 4NM4H 1IILE 1BWWA 5JDSA 4Q6IC 2XWTB 4NFBA 5FM5M 3RDTB 5E4EC 2YOCA 1L0QA 5CJQH 4MJIB 4K8RC 2B4CH 4NN6C 2Q8BH 4AEIL 4HUUA 4DKDC 3S4SG 3U2SA 1U8PA 2AEPH 1XAUA 3LS4H 2ITCB 5AG8A 4LPYA 5MENB 1K6QH 3GJFB 4IMKA 2GAZB 3DGGB 1IQWH 3LQAH 3SPVB 3GHBL 1B4JL 3BP5A 4M48H 3GK8L 1EEYB 3SGEI 1IAIM 3O4LA 4O9HL 1CVSC 5C6TH 3VGBA 4WV1A 1RIVL 1G7QA 2C3VA 1P7QD 3CH1A 3HMXH 4KDVA 4U1SA 3TP4A 3OPZH 1JWUA 3QHZL 1IQDA 3QUYD 1NFKA 3RDTA 3EYFB 4B41A 4MDIA 5IB4A 4JKPH 2IALB 1TJGH 2OTWA 1R3HB 5ECJE 4MMZC 4KKNA 2CGRH 4PGJA 4NJAH 5EO9B 2Z8SA 2APWA 4P5MA 4WWKD 3LB6D 4PJGA 3OTTA 2OZ4H 5L9DL 3IJYB 1U6AL 1J8HE 4NZTH 4P2QD 2CK0L 2GQHA 3EFDH 4HK0A 4FS0A 4MJ6A 3HPLB 4TUOA 4BA8A 1FFPB 2YHGA 2EDDA 5C0AE 3SKNB 4YBHA 4MHHG 4ZXBD 1BJ1H 2EDJA 4JPIA 1AE6L 2GIYA 3NACL 4MQTB 1L6XA 2OJZL 1QBBA 3BWUC 4LHUA 3EO9H 1DVFD 4Y5YA 4NUJA 1UJ3A 1ZT4B 4U7SA 4WHTA 1B4RA 3WIIH 1I1FB 5EN2A 3EO0B 4Z7OF 1MCEA 3KVQA 1TZHA 1NBYB 2XRAL 5CD5D 4ONHA 4EIZC 4LPCA 4AL8H 1EMTH 5FDWB 1TPXB 1RJYA 5EOTB 3MRMA 3KDMA 3TO2A 4AT6A 1NCWL 4Y4KA 4BFIB 5LWYH 4QWWD 5FO7B 5D96C 3LAFA 2YD4A 4UTAL 4O5LH 3HS0A 1BOGB 3UTTD 4WHYH 4HUWA 3MLYL 2H8PB 2G5RA 1NUDA 4MSWA 3F6LA 2NY5C 3P77A 5HGAB 3QUYB 5KVGL 5MP6L 3FQUA 4MQXC 1PLGH 2R23A 3VXOB 3K2MC 4XCNB 3S97C 1QTYT 3MACL 1ZA3A 1GZPA 5TE6L 3U1SH 2B0SH 3GHEH 5D6CA 1MFCH 3KDMB 4O51A 3TO2B 4X7TB 4WI6A 3M17A 4LIQE 2NY0B 3CXDL 4MD5A 2ZSWA 3W0WA 3U30B 2EE2A 3DMMB 5CCKL 1QACA 5I1GH 2OL3A 4PRIE 3LKNA 2VLMD 2APTA 1BGXH 1ERNA 1Y6KR 1FDLH 1KB5A 2IQ9L 4WTWA 2WLZA 3P4MA 2XNAA 1R6VA 2YEZB 2LAGB 4JO4H 5ESVA 1QQDA 3TYFB 4KI5F 1SBSH 2VQ1B 3SBWC 4YC2B 3GSVA 2FB4L 4TVSa 3DVFA 1YEDB 2KUTA 3QQ9C 3TJEL 2NTSP 3U9PL 1DBAH 1B0GB 3MLXL 3UBXB 4X7CC 3EOBB 2YD3A 1HI6B 1H5BC 4X80L 3WFCH 4HZAA 1VEMA 3TM6A 1WBXA 4LDLB 1UM5L 1SJHB 2EO9A 3BSZL 3RVVC 2EKJA 4TUKL 2X41A 4P57A 3W0WD 1G7IB 2E7CA 4Z76B 1IM3B 1F58H 1I4FA 3VMOA 4GRWB 4LRIA 4LRIC 4NO2B 4N1HB 5DMJB 4OZFB 2KKQA 4P59L 4PJEA 4HK3J 3QIBC 2GK0A 3PABB 3QB7C 4OJFH 5IB3B 5L0QC 5E9DB 1F90L 2D0HA 1N8ZB 1CYGA 2G75B 3TNMA 1CXHA 4W4OC 3CMOL 4QGTA 5E2VH 4WEBH 2YN5A 4XZUB 1FVDB 1GOGA 1TVDA 2XA3A 3PWPB 4HS6B 4X5WB 1J0ZA 5AZ2H 3H9HA 3X13B 4PGEB 2PTTB 3HZKB 3LMJH 4UBDD 3MJGX 3T65A 3S98A 1P6AB 3EYUH 3IF1A 1EO7A 1CFTA 1FNAA 4YPJA 4RX4D 3H9YA 4NWUH 1CLYL 5DJXB 5DTFA 4KUZH 2G75A 3TNMB 4HJ0D 3AREB 3QPQD 5J4MA 3L3OA 4GRLA 5EB9A 4OSUH 4GRMB 4PGEA 4OT1L 5B4MC 4RBPK 5DRZA 1L9MA 1FIGL 1DVFC 2F53A 3L5XL 4FQ1H 4X7DC 5CIPH 1ZEAL 4QTIL 4A2MA 4YR6B 1HILB 1JK8B 3F8UB 4JRXE 1PZ5A 3NGBC 3CU7A 5DJ8B 5CZVH 1OTTD 4ODWB 1KOAA 2WSKA 3DXAD 4GW5A 4XPGL 2AJVH 4FQ2L 2C3GA 1N26A 4S11A 1JGEA 5EC2B 5C0AA 3SY0A 1NLDL 3T3MF 1S9WB 5DR5H 3WBDA 2V9QA 4CN6A 4K94H 3KR3L 1E27A 3GBML 1I4FB 3BPNB 1GIGH 3EUUA 4APQC 3OR7B 1HCVA 2ARWA 2JELL 5FF6B 3SDAD 2WP3O 4JFHD 2NXZD 3PQYD 4GRLC 3CX5J 4W4OA 1V3MA 2VDKL 1XGPB 1HILA 4OCSH 5IQ7H 3WCYA 3KWWB 4J4PC 5D2NA 5IWLC 2PO6B 4I48A 2WBJB 3VFSB 4Q74A 4JFQB 2AJVL 4NQCA 3W2DL 4NHUA 1ZT1B 3SCMB 1BIHA 3PHQB 3QHFH 4TSAL 4UT9H 3F7RA 3QNYA 1TZGH 4HKJB 4YLQT 3WLWD 4BM7A 4HX1A 1T0PB 3BUYB 4M1CC 5CGMA 2FX7L 3G5ZB 1LEGA 2J6EL 1JUFA 4F3FB 3PGFH 4Z7VE 4Z9KB 2A9NH 1LP9E 4GAGH 4XNQA 1WVZA 1D5ZA 4HULB 1A6VH 4Q0XH 4YHYB 1IBGL 5JQHC 1VDGA 3MREA 5HI5D 1OGAA 3ISWA 4JFHE 5D2NB 4X6FB 5MP6H 1RK0A 1HINH 4UT6L 1TTFA 1CFVH 1HQ4B 3D2UB 1U92A 3T09A 4NHCL 4U0RB 1OP5H 3QP3A 3BEVA 3TESA 1A6ZA 4D2NA 3AMKA 3REVA 1Z3GL 1P7KB 1OAZL 5I17B 3RIFF 3Q5OA 1KEMH 1EBPA 4G6JH 1NGYB 5EOCL 3EBAA 2WBWB 3KYMB 4OM1L 35C8L 5A16B 4TNVK 5I8CB 3LS5H 1PY9A 1GGYA 5C0AD 5BMFH 2XWTA 1XIWD 5BRZA 2IWGA 3E3QC 1IC4L 2VC2H 4MA1C 1D7FA 3HG1D 1MJUL 4FXKB 1IE5A 3ARRA 4RMUA 1KJ3H 5IEKB 4ZQKA 3EOBA 3O45B 2Q8AL 2NZ9C 3WNOA 1DQML 5DK0B 1JZ3A 4RZCA 4OFDA 4XWOD 1D6VH 3NA9L 1RZFH 4S0TD 4UNVA 2DTSA 4FQQA 5C0GA 3GO1L 2P8LB 3QQNA 3VFSA 5IUSA 4UIKH 4GKOA 3D5OF 5I19H 2FATH 2BC4A 3GGWA 1NCAL 2WBJC 1J1OH 4GXUM 4N90D 2H6PB 4R3SB 3PWVB 5IB4B 5BO1L 4QCIA 2QBWA 3SDDA 4EI5D 5J13B 1QFPA 1BLNA 1Y0LB 1YY9C 2QKIA 3FCTA 4G9DB 4TSAH 4UT9L 3P0VL 5DJ0A 1YEHL 2YR3A 3H9SB 3WFDH 2I07B 3IS1X 1INDH 1X5AA 1FO0H 4J23A 4YXLH 1SEBA 3K74B 4DUVA 1JPGA 1YN6A 4UIMA 5EBWB 3DOSA 3LN4A 1R3IH 5ICYA 3DIFA 2V5RA 5C2UB 3VGHA 1QFHA 4OAWB 3WNLA 3RU8H 2NXYB 2FATL 4PIRF 4S2SB 3HI1B 3T04D 1FAKT 4GBXA 1FYTB 3K1DA 3OXSB 2IGFH 3ULUL 4Y4KC 4WV1B 1T3FB 4WO4B 1RIVH 4AH2B 5E2TH 5K59F 4U1JB 3C6LD 3PGDB 1S7UA 1MVUB 3IJSA 3LS5L 4JHAL 4AEIH 5EU4A 5E03A 5FO7A 1FFNA 4M5YL 3PUCA 4PGCA 1NPUA 5HYJE 4G6JL 3D9AH 1H3GA 4Y5VC 4ZSOA 4QGYA 3VFMB 5ABDE 3QUYC 5DJAA 3TBSB 1WZLA 3V2AR 3MRFB 3ABZA 2BOBA 4ISVB 1X5ZA 2DQDH 4KTYA 4L8SB 4EN3B 3I9GH 3HUJE 2VLJA 3KNBB 4UOW0 3UJIH 1ROWA 2WBKA 5DHYA 2JJWA 3OAZK 3SKJH 3OZ9H 1JZ8A 4H26B 2CH8A 3FN9A 3TO4B 3IS0X 5DFVC 4LGRB 3L5WB 5GS1B 3JWOL 4M6OL 3CLEL 3ZDXF 3RI5K 5D93C 3UTQB 4OZHE 2PTUA 5FYJL 5K33A 4PJAA 1EHNA 3MUZ1 4JG0L 5INDB 2H3NB 5T3ZE 3BYTA 1BZ9A 3UPAA 3PV7A 4HQQH 3HPJB 2CSPA 1DL7H 4TTDD 5E94A 4QRSB 1UKTA 4M1DH 4HW6A 1EHLL 3ARTA 3UROR 4MSWB 3L95B 5CJOH 5EU3B 3AGVA 4DGYH 1RUPL 2H2PC 3RWGA 2ZG3A 3PIQB 1KEGH 5JORA 3KLAA 1JHKL 4XNQB 3L3KB 1HYRC 1UZ6E 1SY6H 5BVPH 3SKUD 3MLZL 1V7MH 3NABL 5TH2B 1CD9B 4WW2A 3OB0K 3F7VA 1KLGB 1OP9A 3IETA 1NGPH 3VI3E 5DUMH 2DMKA 3RVXD 1L7TL 1ACYH 3ECBB 2Z92B 1DVFB 1HQ4A 1Z9LA 3R8BB 4OCSL 4YJZL 4WHTB 1KB5B 2ADGB 4XVTH 5TF1L 2KBGA 1X5XA 1QVOA 3UJJL 3FO0H 5CGYC 5C0CB 1PDKA 4NKMA 3SO5A 5IHLB 2AXJA 4KKLC 3QWRD 4A6YH 3O41A 5GGRY 3HE6D 3FN0L 5FXCH 5D7LB 2MHAA 2VQUA 3E6FB 1JGDB 1EGJL 3TO4C 1S7QA 3GSVB 2CLVA 4YHPB 4YDKL 5BVJA 4PRNB 5SWQB 4YHKH 4MNQA 4RAVB 5E00B 4CN1A 2GI7A 2RFXA 5T3XH 2GCYB 3OJDA 1FVEA 3STZA 2P5ED 4XP1H 4YEFA 3LEYH 2GFBB 3V0VA 1JRHH 2BVYA 2P8PB 1HQRA 3T0EE 3WJJA 1IM9A 4CVUA 3GRWL 3VXMD 1SBSL 2DDQH 4V1DD 4LSUH 5L0QB 3X17A 4MD5B 3PHOA 2BERA 3WFEH 2R9HD 4MA3A 2AJUL 4X7TA 1HH6B 3TO4D 1L7IH 3E6HA 4ONGH 1FH5L 5HGBB 1K4DA 4FP8H 1UH2A 3LKPB 2QKIB 3T4YA 1UG9A 5ISZD 4XX1G 3V5KB 1CD0A 5LJYH 2J12B 4IOIA 5BOPA 1I7UA 4WFFE 3S6CA 1FVDA 4FG6C 2W65A 1NDGA 4JANB 4OGZA 5FA4B 1TMCB 4DOHE 3QI9C 4IMLA 3QFJA 2HKFL 2Y36L 4JRYD 4EIGB 3HNSL 1YC7A 5I1KH 3MRDB 2NX5D 4MJ5B 2GY5A 1YQ2A 1DBBL 2VKWA 3QUKB 3V5KA 5CKAA 5D7SL 2NY6C 2HJFA 4ZFOL 1MFBH 1YJDC 5DMKB 1RUML 3SGKC 4JZOB 4RAHA 2P5EB 1HIMH 3MJ9L 5FCUH 3BKJH 3NZHL 4ORGB 1U3HD 1KB9J 1JN6B 5E9DE 5DQJA 4O2FB 3B3IA 3VJ6B 1X5KA 3ZE0F 3VD5A 1T7VA 1KCKA 3I3EA 2NY7H 4PJEB 4PS4H 3KPOA 3DX8A 3FQRA 3HC3L 4M93B 1Z0MA 2HFEB 4MB3A 3LVEA 1OT1A 3RIAK 1TTUA 4AEHL 1UZ8A 3RX7A 4OLYH 5K9QI 2MPAH 5FDWA 4H25B 4TVPL 3JV0A 4YFEA 4DZBA 2GK0B 1QSFE 1XF2A 1UXSA 3BQUB 1ZVSB 2A1WL 3L3DA 4HC1H 2W0FA 2D7PA 1T89A 1MJ7H 3T65B 3KPQB 3ES6A 3QDGA 3JTSA 4IIQA 2LU4A 2PTVA 4MCYA 4K94C 3I50L 5L8LB 2B4CL 1C7TA 1KYOJ 5EWIL 1FPTL 3MUHL 4K3DL 2EZ0C 3VDAA 1XF5A 2FECL 3RX8A 5INCA 2NY1D 1GZQA 4CADB 1I85C 2X70A 4HKJA 4MAYD 2VJXA 5MEND 4ZNEE 1LP9F 2X1PA 1FCGA 1C5CL 2FIKB 1QSFD 3WHXB 4FQJL 4K7FB 3MNWA 4Z0BL 1BQLH 1T2JA 3EOTH 4JFOA 4FXKA 3S37X 1P69B 2DQEL 5HPMB 4GW1A 1TQBC 5E8OA 4FN0A 5F9AC 1JYVA 1XF4A 1KCSL 1UEMA 1VEPA 2DTML 1XIWC 1Y18B 1X4ZA 1WIPA 2CKBL 1NEUA 1KLGA 1PYWA 3O2WH 2XWBB 4LHUG 5BMFL 2GKIA 2VXUL 4G43B 1NJ9B 4R7NA 4OB5L 3SGEH 3FOMA 5KSAB 4HBQA 1H15A 1LDPH 1A6UH 2VN7A 3D0VA 2J7LA 4MLIA 4FABH 2Q86A 2ITDB 1BFSA 1QSEA 3UPCA 1BQSA 4JQVA 3EO9L 2JLLA 1NC2B 4ZPVA 1TQCB 1HXYA 5CD3B 2NW2B 1MQ8A 2MQ0A 1VADB 4GXUN 3MROA 2DD8H 2XZAL 4Z8FL 5IJVA 1WQVT 4LSTL 5ETUA 1JTPA 4UIMB 4EVNB 4CDGC 5EZIL 4UT7L 1H0DB 4OZFG 3BP6A 3Q3GA 5E8NA 5AEAA 2MOVA 3E1F1 4WGVB 3IXAB 5C8JA 3KPPA 1KV3A 3O6FC 5E5MB 5HSFA 5EOCJ 3MBXH 4C83A 5GRXG 4M61B 4F57H 4PV8B 2QL1A 3TZVB 2DMCA 5C07B 4FFYL 1WZ1H 3GBNL 3VXSD 1CLCA 4XXDA 1MFAL 4FZ8L 1RZJH 2J6EA 3HZYA 4S1DC 1F3JA 1DUZA 3QDGE 3C5ZB 3FO0L 4XAWL 4HPYH 3MNZA 4HZLB 5E1AA 1M7IB 4NZJA 2P8MA 5KANG 5I6XC 2A1WH 3O3EB 1ZHNA 2CRYA 3QQ4A 5I0ZA 2WWMC 2FJHA 1CZ8H 3GJFA 1RZ8B 1KJ2A 5GS0L 1FNLA 1TVBB 2BVTA 4E42B 4OD2B 3TN0C 1RJYB 5EOTA 4WNQB 1DBKH 12E8L 3MXVH 5JW3L 3GIZL 1W2KT 5DR5L 4ZS7H 5T3XD 2ORBL 1M1SA 1OTUD 4URTB 5HVGB 4PGBB 4AMKL 2HJKB 2R0KL 5I1HL 4D9QE 2DI7A 1WLHA 3UTSB 5TDNB 3S36H 4Q9RL 3QDAA 2VMFA 2AQ3A 4XB8A 3O3BA 1G0DA 1MNUH 3T1FA 1BIIA 4HQQL 4K2UL 4YO0A 2F8XC 4WHDA 5HVWA 4FQ1L 3MGTA 3RY6A 1UH3A 1G7PB 3QZWG 4IIQC 5T1KB 4U1GC 4JO2H 3GSUB 3DJ9A 5HI4C 3TBWA 5SWSD 5L6YL 3QEQE 1Q9KA 2W91A 4FOMA 1K5NA 4IDLA 3V7AG 4IRJC 3BPCA 4Z7UE 2Y06L 3OBAA 3G6JE 3HRZB 3MYZA 4N0UE 1R3LB 4LLUA 2I9TB 3MGTB 1WBZB 5F6IB 4WWID 2JJTA 5J9PA 3KPRE 4NC1E 5GGSY 4MGXA 1TFHA 1MFAH 5TQ2H 4ZUUA 5FYLH 3MLTB 2BCKA 3VXRD 1D6EB 4BQBA 4EOWH 5JA9A 2ZOLB 1RMFH 1N2RA 4OIBA 3SGKA 5EU5B 2EDLA 4KGJA 2DM7A 3UTZA 4PJ9D 5HGAA 1GPOL 3OX8B 1J86A 5ISZE 2B1AL 3WS3A 1FG2B 4DW2L 5JDSB 2A6JB 5T1DH 3SGJC 4YNYA 1LO0H 4PRHE 5SWZA 5A2FA 5JW5B 4XT1C 2D7OA 3C8HA 5KW9H 1KCVL 1YEIL 2YD8A 2WIIB 4OKVB 1WAAE 4WUUD 4JRYE 5D1ZD 3BE1L 4HLZH 3CU1A 2IAMB 3QIWA 1WCBA 3HAEG 3ILQC 3ZMRA 2QQQA 4G8GE 5DUPL 2A0LD 3MRIB 4G6FB 1FG2A 1KCRL 3RWDA 2BY2A 1OW0C 5GS2H 3F6IA 4DGVH 3O6LH 4P2QB 1RIHL 2GSGA 4XBPB 1KFAH 5MEQA 4R97C 3RVTC 1V5JA 1S5HB 1LE9A 2Q76A 4TYUA 3FAXA 4P3CL 5HHNA 4PREB 4L5FH 4CKVX 3GMMB 4H88L 3QYCA 5FO8B 3MLZH 4Y8DC 1YMMD 1EMTL 1NC2A 4OD1L 2NXYD 1KIQB 1MIEH 4U3CA 2BSSB 1BVKA 3AFLA 1NAMB 3ZYOA 1Q9WB 1GZPB 4PJ5D 4Z0BH 3C6LA 3BIKA 5K93A 2IEPA 3ZKMD 3P4LA 2E7MA 3BPLC 5ICZA 1PSKH 2V2TB 1KCSH 1RIUH 2JB5L 2V5YA 3GSNA 4MNHB 3OKNA 2YS4A 3R0MA 5KSBA 5MEOB 3BZFA 4PTTB 5B3NA 5HBBA 1IGFH 4XVUD 4I2XB 3RFZC 3C6SB 4L9LB 4RFNB 4JHZA 1EX0A 3PIQA 3T2QA 1VPOL 1NMBL 1A6WL 1NGYA 2AERT 2CLRB 5E2WL 4GXVH 1UWXK 4XMPH 2X4SB 3RZCA 5ADPH 1GGUA 4CNIA 1KTLA 5EC2A 1IT9H 3DSFH 4GS7C 1SY6A 1FNSH 3N0PB 1MCJA 2XQYG 4TSBL 4YK4B 4OLYL 1CR9L 2OX5A 4GRWH 4R96A 4I3SH 4LFHD 1W0VA 2A6IB 4XC3H 4M9OA 5DSCB 3MJ9A 3TWCH 3BN9D 2ZJSL 4Y19A 4MJID 2OTUA 5IW6B 2HT4D 1BD2A 3U83A 1FGVL 1A3LL 4V2CB 4OF3A 2B1HL 3G6JA 4Y4HA 7FABH 2BXYA 4ODHH 5FCUL 1FGNH 2VDML 1XCQB 1VACB 3RA7L 4XP9H 1N6QH 2FYYA 2X4OB 4ZFZA 3GMNB 3BGAA 3FT2A 3U0TA 4KROC 1G7MA 4UQ3A 4AM0A 4PS4L 2IPTL 3HC3H 1YZZA 4HPOL 5BS0A 3VH8A 2F54A 2ICWJ 5I1EH 2OL3L 5D7IE 1BFOA 3VFVA 4DAGL 5KS9F 1XIWB 4U1SB 1F4HA 5LGKA 4G9FA 3MJ9H 1AIFB 1CDCA 1NFIB 1S9YA 1KPVB 2P44B 4F58H 4OGXL 3SDCC 3MOBH 2LTQC 1P4BH 2IFGA 3E6HB 4HMCA 4O58L 5HHQA 5ILTL 2L7UA 4MYWB 3MGOB 2NXZC 5H35A 5FA3B 5DC0A 1BVLB 2B8OT 4KTDL 5EPMA 4U1NB 4HIJA 4PJIE 5KOMC 1XZ0B 2O61A 2IH3B 3IAPA 5TF0A 4ORZC 3QULA 1A21A 4G6MH 4NUGH 1OGAD 1WBXB 3QFJD 2BDNH 3SDCA 5CFHA 1EUUA 3EDFA 5F89B 1N0XH 2VLRB 4RMSA 4E5XA 2VDQL 1K8DB 1FIGH 4JN1L 5HHNB 4YHML 2FLBT 4HJGB 1LMKA 5I18L 3MRGA 2OCFD 5GRZA 2XNAB 1GGTA 4Y5VB 1A3QA 1QNZH 1WK0A 1XH3B 5JOEA 5B39A 3IXTA 3BD5A 2XN9E 3HE7C 3W11C 2O5XH 5KSUA 2JF1A 4DN3L 5FOBA 1FNGA 2QR0B 3LSOB 5GGQL 4A6YL 3MLRH 3RVWD 4J3TA 2J8HA 2JJTC 4Z7NF 4ZFGH 3L7EA 4LCUA 4OGAD 3HE7B 1EJ6A 5C0CD 4OLWH 4PJXA 2Q7YA 1CD1A 4HWZB 4HWBL 1OAKL 1D5BB 1CDUA 3CDYA 2X1QA 3GSWB 4NQEE 3SDXA 3MLWH 4OCRL 4Y16C 1TZGL 4JZJC 4XHJD 5EC1B 3O6FD 1MCHA 2NZIA 2VDRH 3V7AE 1XFPA 4KPHH 3EJYD 3I2CL 1U42A 1CD1B 2FJGA 2COQA 2P4AB 3REWA 4F57L 1X7QA 3K8LA 4IRSC 4PP1C 3SDYH 1K9TA 3VFOA 3CC5B 2BSTB 1RZJL 1GIGL 3LH2L 3B3IB 4WDIB 4UT7H 3NCYS 1YMMB 3MRPB 3THML 3RL1B 2DM3A 3PE9A 4CUCA 1F3DJ 3WO4C 4GW1B 4WO4C 1CE1H 1CFSA 3CSBA 1DN0A 1E4XI 2BOBB 1K4CB 5D71H 3HR6A 3MV9D 4MXVE 3S37H 4MX7B 4NO3B 3WLBA 3QIUD 3QUXA 5T33L 3MRJB 1TXKA 4ZFFA 1GAFH 1KJMB 3WNPA 3MJ7A 1C5DB 1FZKB 2BSTA 4ZD3L 1IMHC 5LGJA 1T5XB 1BBDL 1QKZH 5I1LA 1TJHL 1ZHKA 4XMKL 3WIHH 1QLFB 3CFKA 5GGVY 4HZLA 3MNZB 5J7CC 3IDXH 4U1IA 4XPTL 1ZLSL 1OL0A 1QSEB 3WDHA 1MQKH 1CL7H 4HLZG 3M45A 1M71B 4KRPB 2Q7NA 2BNQD 5KJRL 3PGCB 2FJFB 3DURB 1FO0B 3WO3B 4CADA 1JHTB 4OD2A 5D5MF 4YGVB 2RBLA 2BOCA 4U49A 1X5GA 4F7CB 3MV9E 1CN4A 3MNVA 5I16B 3IVKB 5F1NA 3QUZC 4JPKH 4KKLD 2VQTA 4QRUA 4KUCD 4HMEA 3GSQB 3OAYH 1ORSA 2OR8A 4ALAL 3FCTB 3AAZB 5DRNA 5FHBH 2FEEI 1T1YA 2V17L 4H20L 1Q38A 4Y1AA 4L8DB 4X80H 5DD1H 2CXGA 5JNYB 1P9MC 3D3VB 2EDXA 3L7FA 3ARDA 4NJAL 3VFTB 1BAFH 5TE4H 4IMLB 3S5LB 4PG2A 2YPLB 4OKDA 2PYFA 3EO1B 4LASL 4HX1B 3TBTB 1LEKB 1IZJA 1WC7B 5H37G 3WLBB 4MDJB 3IJYA 4N8VA 3EDEA 4P59H 4Y88A 4Z7QF 3ETBF 3RWIB 2C7UB 4XPHH 5I75B 3D3VA 43C9A 4EXKA 1MWAA 3MRKA 2W0LA 1FAIH 1IJ9A 4JO1L 5FF6A 1EUTA 1U8JA 2YC1A 1R0AL 4LMQI 3FFCE 4L3EE 3GJEB 4QHUA 5F9OL 1A02N 4BK4A 2C1PA 4BFBD 4LKCA 3A6CL 3IKKA 5KS9A 4P2OB 5D7JB 3VFPA 3ARVA 3Q6GH 1NUNB 3BGMB 2VAAA 2VLRD 1DBAL 2EDNA 5L2KA 1T22A 3HAEB 1R3JA 3UTPE 1X44A 4JQIL 3CUPA 5BO1H 1FFQA 1HEZA 5D8JL 1ULVA 2DQFA 4HIEA 1CVRA 1U2CA 1RI8A 3MRHA 4GBXB 1J0JA 2XV6B 3K0WA 5F9JA 5IFJA 5BV7L 5GJSH 2BY3A 1TQCC 2HFGL 2YPVH 4F8QA 5IHZA 3BRGC 4LDOB 1OP3H 3MACH 5TE6H 3D3VD 3NCBB 1D5ZB 4JPVH 4LGSB 5TPWL 3V6OE 3ZKMC 4K8RH 4NM4L 4JDTL 1XF5B 4ZFOB 3P30H 4QRTA 3D1MC 5HYIA 3SKJL 4JVPA 1C5DA 2ADIA 3IFLL 2OP4H 2QSTA 4N0FB 3W0WE 5IIEB 5I1JL 4MA8L 1QFOA 3VWJD 4PLKD 2BVEA 2R4RL 4IDJL 2XXMB 3BIAX 4KQ3H 3GIVB 2VYRE 5DSCA 1C16A 3VRIB 3OGCA 3WL9A 1REIA 4LOUC 5D7IA 2HJFB 4EDXB 3T0EA 2P24B 2ATPA 1MCLA 3CPLA 4M5YH 5DQ9A 5D9SA 1BVKB 1RULH 4PJ5A 1Q9LB 1Z3GH 4OM0L 4XI5C 4OKVA 3SEPA 4GKSA 1SJEA 5DWUL 2IAMC 4OUUB 2CGRL 4L9LA 4PRPB 3VD7A 2UY6A 3JVGC 3T3PF 3ZSTA 4Z18A 3TIDA 3D39D 3W39A 2C1OB 1FAIL 3GNML 2BNQA 2I24N 1FL5A 2X7LA 2P5WB 1N6UA 4YC2C 3VRJA 2QQNH 4WIQA 3SJVE 3GM8A 5CJOL 5EDXA 3E8UL 4M7JH 1QLEH 1RZGB 3BI9X 4ODVH 4PRPA 4F9PC 4I18B 4Z78A 5IK3A 1I1AB 5EU6A 3F65A 2ADJB 2VLJB 2NY3B 3KNBA 3ULSB 5IVZA 4ELMF 3PJSB 4YNYB 4H1LH 1T80A 1S9XB 1V8HA 4YDLB 4YHOH 1CLZL 5T1KD 5AD0B 5IM7A 5D2NE 3LRGA 3IFPA 2XZCH 3TPUA 5IF0A 4JKMA 4PJ9A 2ADFL 4I18A 4JY5L 4DVBB 3CZFA 4E41E 3TYGH 3IDIB 3VXUE 1OLLA 5J12C 1A6PA 1K8IA 3HZVB 5D6CB 1MCWM 4FMKA 4HCRL 2R29L 4RFOH 1SVZA 4KGLA 4UNTA 1G0XA 4K2UH 2OK0L 4ZS6D 4NKOB 4LEXL 4OLUH 5J1AB 2LQRA 5K9JH 4UQ2B 1TLKA 3BUTA 4POZD 2AXFB 2X4PA 3STZB 5LQBH 1RZIB 3T0WA 5JIIA 4H0GA 3WFZA 1WBYA 5JHLL 1GOHA 1JV5B 2C3WA 3ZL4L 2OR7A 1AY1L 1QFUH 4LVHC 4PD4J 5FUZH 5FYKE 4KRLB 4RX4A 4NHCH 1TZIB 1K3ZA 2I07A 2PYEE 2VZVA 4LLAA 5T3ZL 5IFAH 3RGVA 5GRUL 1UWEL 4LLWB 4DGVL 5C09B 1MCSA 4HBCL 3OAUL 4XP6L 1KXVC 4HDIA 4NQSB 5AZEL 5BJTB 1EBAA 2ESVA 1BFVH 2QQNL 3DTXA 4RFNC 4JRYB 1MCBA 3ZTNL 4JY4B 3OR6B 1FHGA 5GRJH 1RZ7H 3ULUH 5DVLA 1HYSD 4LAQH 1S3KH 2GSGB 3ZKSD 3K81A 4X4MA 4DW2H 3L5JA 2CJUL 4GW4A 3QHTC 3M17B 3QDMD 3WO4B 3DVNA 4M8QB 3GRWA 4XTRD 5DJZB 1MF2L 4Y19B 4HEPG 4KI5D 4PRHA 5SWZE 4NZRL 4PJCE 3VE0A 5FDYA 5IVXB 4WU7B 3OKLB 2XA8H 2GTWB 4KJPD 5HHPA 3H0TB 4HH9A 1BZQK 4I8DA 3MRBA 1YEDA 2QSCH 8CGTA 5L2JA 5M94B 2CKBB 5KSAC 3O2DL 3NAAH 3TA3D 2GJZA 4HKBA 4D0DA 3BRDA 4G7VH 3REVB 1C16B 3VRIA 3FQUB 1G9NH 3GKWL 3MYJA 3U6RB 3O41B 3DI2B 5TDOB 3WKMH 3SCMD 1KB5L 2VDLL 3LRHA 4KQ3L 4GRWE 4ONFH 4LPWA 4ODHL 3EYVB 1AFVH 2HFGH 4Z7UA 5DJ6B 1GXEA 2Q20A 1MOEA 1MI5E 4K3EH 1S7WA 2EEAA 1T83A 1OM3L 3MRDA 2UWEB 5KSAA 1XR8B 3WUWG 4KUCF 1IAOA 5IEKA 4MX7A 3LN9A 5D1XB 3QDMB 1DN0B 3MJ8A 4U6YA 1KJMA 1YPZE 2AK4E 1BP3B 1IAII 5DJCA 4G8IB 5CLWA 4KV5F 3UYPA 5I1JH 4XNUH 1QPXA 4F58L 2R1YA 3ECBA 3ZT6A 1GJIA 4L4TB 3DGCR 2YZ8A 1YQVL 1WZKA 4YBLB 1FLRL 4CMHB 3O6LL 3STLA 5T5FL 4K7FA 1MQKL 1ZE3C 3BH9B 1X7QB 5IG7A 4C4KT 5FUOH 3KJ4B 1UZ8B 2DQEH 3R0NA 2F5AL 2D03H 1C5BH 3SE9H 2NR6D 1Z5LB 2OSLA 3GDBA 2CIKB 3VGDA 4WJ5A 5MEPB 4YDLC 3QQ3B 4GAJH 5BRZB 3VFUB 2VLKB 4R0LA 1YJDL 4GMSL 4MXVF 1X4XA 5E99L 3N1GC 2SEBB 4GAGL 2DLGA 3MYJB 1QPPA 4U1MB 4PJXB 4M1CD 1DLHA 4Z7VF 3GMQA 3B4NA 1J0KA 1NEZG 1D5BA 3FQWB 4KZEH 3QSKB 2BNUB 5INCB 4LGPB 4Y1AB 4LCCA 3T2OA 4NZUH 5I75C 4OF8A 1N3NA 2DQUL 3DSNA 4ZSOE 1QEWB 3QRGH 1U3HB 3DO7A 4NO5A 2NY2C 1FYHB 2IC2A 5HYJA 3ULVE 4Y5VA 5K9KA 4TOYL 5IQ9A 1CFQB 2YRLA 5A16A 1CU4L 4K3JH 2WBJD 3ZDZF 5GGUB 3WEXA 1D5XA 4XI5D 1EJOL 1NLDH 2DKMA 4YGVA 3BVNA 3SGJA 3CLFH 4JM4L 1IQWL 2HAZA 2NXZB 3QNYB 4IOFD 4MXWL 3B2UC 5FK9B 3CCHB 5DLML 1R3HA 4NO0B 1AGFB 4HGMA 4J6RL 2GJ6E 4JRYA 3IAGC 1IEHA 4K3EL 4U1HB 1I7RA 2P43B 2OK0H 5F93C 1MPAL 1ORSB 5EO0B 4LCIL 2CIIB 4PY7B 3ZYZA 4M3KB 1Z5LA 2O93L 3CSPA 1CFVL 5T5FH 3IKCA 3C5SA 3QUXD 4NDMA 1KIRA 4LNRA 1JWMB 5EU7C 1CLYH 1U8OB 2XWJA 3UBXI 3I6GB 3FQRB 2AK1L 5D1QD 5IB5B 4IOSD 1MHHB 5JDJA 4LSRL 2YBRA 4G6AD 4ZS7L 1CXFA 4GAFB 1TETL 3Q1SL 4FP8L 5IGXL 4C56E 4OQ1A 1T1XB 4PRIA 5JQ6L 1CE1L 4KWUA 3RWIA 4ZD3H 4JHBA 4YE4L 5JW4Q 1TJIH 3CFCH 3VXNB 4KI5C 5D70H 4U31A 2XKSA 2DQUH 5EUOF 4WHCA 4LKXA 5DK0A 5IV2B 3M07A 4N5EC 4EQ2A 4JFDE 4PJCA 3ARYA 3OHXA 4YHOL 3WN5A 2EYTB 4PRAA 1A8JH 2GTZA 3VGAC 3IJHB 2CDGA 5FV1L 5C0AB 4L4VA 2ESVE 2MHAB 3LPFA 4G7VL 4KJPC 4N68A 3ZKNC 2UVEA 1EDQA 2Z8WC 2V7NA 4JGMA 4MNQE 4OV5A 4XVJH 5SWSA 4PJCF 4X5WA 1JPFB 1JZ5A 3S34H 4P3WA 2A74A 1QRNA 3KPMA 1DQDH 5CGYD 2NX5E 5FYKL 5D70L 3P0YH 3DHJA 3RBGA 3ULVF 5IB1B 4GSDL 4U3HA 2UVFA 2PW2B 4L4VB 3FT4B 2YXMA 4FABL 3HUJF 5E70A 3MX0A 2GTZB 4IHOB 4KY1L 4X7SL 2A6JA 2QADB 1NMAH 1CLOL 4Y4KB 4K7PY 5E9DD 5JHDA 3A6BH 5LAXA 4I18C 4LNRB 5DF0A 3QDME 2NY1C 1ZGLB 4FHBD 4PJ7F 5L88L 3H9SE 5EIVA 2HYMA 4S1QL 4F7MB 3V8CA 4LSQH 1OPGL 2D2OA 5E6ZA 3UDWC 5C7XL 1YQVH 4OFKA 1KCUL 4TNWK 1NQBA 1RUQH 1U9KA 1W72L 5E95B 2CKNA 2F54E 2C3XA 3QZWA 3RKDC 4G9FB 5C08E 2PO6D 5KTEL 5C09A 5CP3A 3JWOH 4M6OH 4MJ6B 1A7NL 5CEYA 3SBWA 4G6AC 4O51B 2R8SL 3NCEB 1U8MA 2YA2A 2YUWA 1LO3L 4PREA 3VI4F 4PV9A 2V6HA 5DRXA 1F6LL 3KJ6L 2E27H 4ZOEA 3KLSA 1HCFX 4Y5YB 3MJ6A 1IGIL 5JIPA 1KJ2H 5CMAA 3O4LB 4NZTL 4QRRE 3BKYH 4HFUL 4CJ0A 2CIIA 4HS3B 4PY7A 4L8BB 4YHYC 1C1EL 4CN4A 2ADIB 5ALBH 4NBYB 4N9GA 3DVGA 3CVHB 4M7LL 3HMWH 1HH6A 4QOKD 2F54D 5B39G 4HJJH 1JV5A 4I2XA 2ORBH 5EUOE 4LQFL 1FNHA 2M8XA 1TZIA 3WNMA 5HGHA 1OTTC 1AGBA 2FSEA 3FO2B 1BJ1J 3VXOA 5EH1A 3E3QE 3PGDA 4HIXH 3LQAL 3RVUD 1OGAB 4B50A 4OLXH 2EYSA 4JPIB 4X0KA 1P4BL 5AYUH 5EIQA 3QXWA 4WI5A 3KLHD 3QJHB 4WU5A 1S7XB 1GCFA 1WFTA 1IKNA 1WCQA 4H1LA 1OAQL 1FNSL 5MENA 4MD0A 5FUCC 3KPNB 1YEEH 3O11B 4LAJH 4MWFA 1YYLH 3Q48A 1I7TA 3L1OL 3L7EB 5IBLC 2P7TA 4P4KD 3HZVA 1FN4B 1EVTC 4K8RD 3G5VB 5TJWK 4NQDD 4GRWF 3U4EB 4D94A 5CSBA 1UJ3C 3UTTE 1E28B 4QHMB 2AQ2A 3PDOB 4U6TA 4P2OC 5D7JC 1A4KB 3TYFA 3QIUB 4LRNL 3GMNA 5CLTA 5CJ5A 7FABL 1T7ZA 1PFCA 3RWCA 1AKJA 1ZHKB 3PHSA 3GIVA 3VFUA 5CEXB 2DIJA 1JNJA 2RGSA 2YN3A 4EI5A 1LGVA 1FYTA 1BX2B 3GUTB 1YDPA 1J1OL 4RRPA 5GRVK 2ADJA 3L6FB 4I0PC 3P9LB 4HFUH 1DSFL 4M1GH 4HH8A 1NGQL 4KMQA 1JZ2A 3H0TA 5DDHA 3BJ91 1MLBB 4E41D 5E94B 5AG9A 8FABB 2Z31D 5IR1A 2D0GA 4YQXL 3MLSL 5JHDE 2ZCHH 1H15B 2ZPKL 1A7NH 4LCYA 4W6XB 5EPMB 3PQYB 2P8PA 4Y16B 3MRLA 5CKGA 5GSVA 3F12A 2G9HB 4OLVH 5KS9E 2E7HA 4FA8A 1DDHB 1SEBB 3IDYB 1NFDF 1EEZB 1OP3K 5KVDL 1W0WA 4C55A 1T21B 5C86A 4RMTA 1KB9K 2G5BA 2NY5L 4FZEL 2XKNA 5DVOA 2A9NL 1I9JL 4V2BA 4YDKH 1P53A 1OM3H 2WINA 3EW3B 4XNZB 3TNNA 4P9HH 4CDHA 4EQ3A 1M05B 1P9MA 3CFBA 4Z0XA 4XMLH 2J88L 2AABL 1JGLH 4LVHB 5C2BL 4ZUSB 1U2HA 1WFOA 4G80B 5KG9B 4KVNH 5D1XA 4JJHA 5E08L 5A2IH 4E9LA 5LXGH 4MQ7B 1T21A 3OG6B 1GSMA 3U36A 1EXUB 4PRHD 1CICD 1DDHA 3MBEC 1M7DB 1P1ZB 1QRNE 3QIBD 5TQ0H 2ARJA 3DXAB 2HG5A 3B9KB 3ZYIA 1BM3H 1NGXB 5GS0H 3I6GA 1J8KA 3BPNC 3TBVA 1T1ZB 2APVA 1T83C 3CDCA 3ILQD 2BNRB 3KYOA 4P23A 4I3RH 4N0YL 2LU7A 2NY7L 2IPKB 3IB4A 4NNXA 4ODWA 1RMFL 4PJAF 3DYPA 1ORQA 5JR1L 4RISH 2VLME 4NQCD 4DEPB 1U8QB 4UBDC 1OQOA 5TE7H 4HBCH 3AM8A 5I8OL 2Y5EA 5BOZG 4LLDB 3QWOB 2LVCA 4ZFGL 4QTHB 1PX3A 4OGAC 3ALXA 3KPOB 2QQLH 5CSZB 5FYLE 2VL4A 1RJCA 3OR7A 5DUBB 1FNEA 4NNYB 4DGIH 2LE9A 3NIFF 3MTRA 4W6YB 2JIXB 2DKSA 3JWNC 5DS8A 4IS6A 1G7JB 1UC6A 3O9WA 3KJ6H 1GGCL 1T5WA 3BQUD 3QH3B 4MB5A 4EKXA 2V9RA 3DURA 4ZPTA 1BVZA 1A6TB 1S3KL 3FZUC 4HT1L 1IGCL 1RUKH 4L4VD 2AK1H 5EULV 4ZUVA 2NY2B 4XNXL 5C71A 3WXWL 2GY7B 4QXTB 1HWGB 3EJJX 3RI5F 1TTGA 5DRWB 1N3NB 2XTJB 2D7QA 3RNQB 3FQNA 5HHOD 4G8GD 4L4JA 4L8SC 1MJ8H 4PD4K 2YD6A 4OD3H 4NZDA 5LQBL 4XC1L 3J7HA 3QBTB 1K8IB 4ALAH 5HJ3B 3CIQA 1L7IL 5C0DA 3QULB 3OL2A 2VXUH 1A7QH 1LO3H 4JREC 5IJVB 1A14L 4NWUL 1I7ZA 2NTFA 3SY0B 3IDNB 1A2YB 2ZKHL 5HHXL 4KQ4H 3ZDYF 1EGJA 1I1RA 4JM4H 1L6ZA 3D6GA 1IGCH 2HVKB 4LSSH 4J4PD 3QI9D 4QRPD 3WXWH 2AJSH 2W59A 3MV8A 1ZA6B 2BDNL 2H1PH 5IMOA 4RIRB 1J5OL 4FQXA 1OF2B 4HG4J 4P2RE 3CC5A 4M5ZH 4QT5A 3A0OA 1OTUC 1AIFA 1EO8L 5EU6D 3U46A 5M7QA 5I1EL 2VAJA 5JW5A 3IDXL 1CDHA 4I3RL 5E0QA 1A3RH 3D87B 4NWTL 2PN5A 5ANMA 3F7QA 4OV5B 3V0AC 5BZDB 3L3GA 2GCYA 5FO9A 3VMPA 3VXPA 4KZDH 3U7YL 1IGMH 5A2JH 4W6WB 3ZHDA 4X8JA 3GBNH 3P4MB 1JGUL 3BZDA 4P5TB 5DXWA 5JW4M 5T1MA 3PJSA 5HHVH 3V0WL 1AP2B 4J8RA 5C08A 3WJLC 3QA3B 3RZCC 3VXQB 1JPST 4LCWE 5D93B 4BSVA 1JNNL 5D2LB 5I1LB 2MFNA 2YUZA 1FZKA 3TPUB 4Z6AT 1MFDL 1N7ML 3QCVH 1K2DA 2Y6SC 3DRQB 5EU6E 5I8OH 5DGRA 3MBXL 5C0BA 1BFTA 4LU5H 5I15L 3C2AH 1DQQB 4OF6A 1RSFA 5IHZB 5HDLA 4P4RA 3CSGA 3UTTB 1YNKL 3KWWA 4MAUL 4R7DA 5BQ7A 3WS6C 1WTGT 4RAUB 5A40E 1XH3A 3FRUA 4DEPC 3WMSA 5FM8A 4U6XA 3U4AA 1OARH 1MHEA 4YZFE 5IOPA 1PQZB 4R4BA 1HHJA 4OLVL 4HUVB 3RVTD 3OKMA 3C5SB 3MRNB 4XVUC 4JVUA 4PJAE 4DUXA 5HDQH 1MRCH 3U1SL 3QXDA 4NFDA 3CFDB 1A1MA 3Q6FA 4RIRA 1T4KA 2XT1B 5IG7B 5HYSA 4XAKE 4PJBB 1HXYB 1VHPA 3DSFL 4PJFA 1HYSC 1EEUA 4GG8B 1G9ML 2PXYC 3PF2A 2DOCA 4NYLA 1PG7X 4EI6B 3NA9H 1GVIA 2Q1EA 1KLUA 1UM4L 4LEOB 3DRTA 3FHQA 5SWQA 2OXHA 3BP4A 5F7MC 3B9KA 3OGOE 3A6CH 4DKEL 5IFHL 2Q76B 3ZE0E 2VLKD 4PG9B 3CDGA 5JOFA 2GSIB 3CZFB 4RGNC 3IDUA 3IJHA 2VABB 5IW6A 3TFKC 2DI9A 2FDBP 1JRHI 3D18B 25C8L 3M8OH 5I18H 5K59E 4PFEA 4OM1H 5DK2B 1ZT1A 1JNHA 2ZP0T 4JDTH 4I0CC 4HK3N 1YYLL 3FB5A 4UILH 2Z92A 3BPCB 3BE1H 1MSPA 1G7MB 4K3JL 2P1YA 4TSCL 2HFTA 3MV7D 5I73C 1K4DB 1HKLH 1YEKH 1WAAF 1KJVA 3GKZA 3DX6A 5J9PB 3RKDD 1LO0L 1N59B 3LZFH 5DK3A 1FE8H 4JDZA 4ZXBA 1S7UB 1WBZA 4GG6A 1N4XH 2ID5A 1I7UB 5T1LD 1LEIB 1KPVA 1F11B 4QF1A 1NGZB 4YDJA 1X5LA 1BJ8A 4XRCA 4P2QA 3MRBB 5EZOL 1SEQL 4FFWC 3QPQC 3TLRA 4OZGF 4JCLA 5GS1C 1RU9L 1AGBB 5F96L 3TIDB 4CW1B 3FJTA 1OLZA 1NANI 5MI0B 1TQBB 3GB7B 2W60B 5HJ3A 4JQXA 4ENEC 4BH8A 4O4YH 1CFNB 5J8OA 4P2CG 3OKEB 1F11A 3N9GL 1P4IL 3NCMA 4RCAA 4BZ2L 5L8KB 4BK5A 3T0AA 3MNVB 2BVOB 4H26A 5DO2C 5FB8B 4QXUH 5HHME 4NRXB 1ZANL 4Z7UF 4G6FD 5CD5C 5T3ZD 2KZ1B 3OGCB 3WL9B 3BEWA 3CSYA 1YUHA 4OQTH 2L4OA 2YUXA 5F7HA 4R7DB 1OW0A 3B2VH 1UXWA 4XBGB 1B2WL 2BVPB 4AQOA 1X5HA 4D9LH 2EO1A 4MVBC 4HKXB 1JPSL 3FL7A 1J1PL 1I1YB 2EIDA 2GK2A 1EHXA 1U8IA 5IMKA 3PDDA 2ADFH 4X7EC 3D69A 5FA4A 5I8KL 4X4YB 1JHLH 2JCCA 1MFNA 1W0VB 2A6IA 1ZHLA 4LPUA 4X4XB 3U79A 3EKCA 1A14H 3SE8L 1FORL 2VDPL 2R1WB 4H8WL 3WS3B 5CILL 5BV7B 1YA5A 2DQJH 4PV8A 2EDHA 2R0WH 2X7LB 1FZJB 2OQJB 3SKOB 4KY1H 1F58L 1DP0A 3QRFM 4PJXE 4RFOL 1H3WM 5J1AA 3SE3A 3C8KA 2QV2A 4MA3B 4NCDA 4PGZA 2IAMA 4YHLH 1HZHL 3O3EA 5L88H 4N8PA 4UAOC 4X7SH 4APQA 3TBVB 5JR1H 3ULUE 3GSNB 3KJ4C 4GRLD 5KSBB 4XVJL 2C1PB 4HSQA 4PJGF 3MUY1 2BMKA 1XGTB 5E2UL 1N7MH 3QCVL 3QXAA 3C6SA 4ZS6C 3ARQA 1IARB 5DQ9B 2QHLA 3FZUD 4JLRA 5E6IB 1HKLL 1ORQB 4Q9QH 4RGNB 1MREH 3HNTH 4TUOB 3MODH 4P2RA 4HIIA 2DAVA 2G5BB 1HNGA 1RZKC 4D9QD 3NPSC 3TBSA 1IC5H 4K23H 5IV2A 4U3XA 3TF7C 5IKCB 1XGTA 4KXZI 1KCLA 1YDPB 1PKQB 5GRYA 4BSWB 3I02B 3O4OC 3NCJH 4JY4A 3P40A 1VGEL 4K94L 4IRSB 3C08H 2X9YA 1SM3L 3U30C 1E4KA 4YXHL 2D9CA 1XGUA 3ZKND 4D9RD 1NUGA 5GSRB 3MR9A 2X1OA 4I77L 1KN2L 3O8XB 1WFUA 1INDL 3LEVH 3QCUL 4YXLL 5DJ6A 5I8KH 2AKRB 2R0LH 4IRZL 5JQ6H 1T7YA 5IBTL 3T4AA 5T5NG 1FN4A 3CVHL 5C8JB 1FORH 2VDPH 5HD8C 1YECL 1NEZB 1XF3A 4HUNB 4OT1H 3ROLA 1U3JA 3REWB 1CICC 4KQ4L 1CIDA 1XGUB 1IGYB 3INUH 3QNXB 4IRSA 4Y2DD 2VLJD 1G84A 1KELL 4FXGA 2F5BH 3UO1L 1NCBH 1JPSH 4RMWA 1BX2A 3QO1A 3GUTA 2AV7A 3V4UL 5SV3A 2AKRA 4D9RE 3VG9C 1TZHB 3OAYK 2RAMA 4JG1H 4ETQA 4AIZB 4GG6E 4HWZA 3VWKB 1EEQA 3LQMA 1HSBB 4O2CA 5GJTL 2KZWA 4RA0C 2IF7A 3QEGL 2NY0C 4LHQB 3MJ7B 3GMPB 5C0CE 1I3RB 3AUVA 4X6BB 1CZ8L 3QUZD 4Y2DA 1UQSA 4V1DE 3H9HB 5TDNA 2I60H 3RNQA 3T77A 4G9FD 3LV3A 3BN9C 3CVIH 2C4FT 2D7NA 5EO1B 2R69H 4ODXA 1OSZA 5C07A 4KZEL 1G7PA 1T03H 3S3PA 4WGWB 1N5AA 3IRZA 3PL6C 5D96B 4ODUB 2JJVA 1AO7B 5I74B 3TBWB 4YX2H 4NNPH 3QEQA 4OZFA 4H5SB 5GGRA 1AXSB 1U8OA 2XWJB 4GMSH 2EDWA 3BSZH 5I16A 3IVKA 1MY5A 1IM3A 2IANE 5FGBA 3KLAB 3SDDD 4PG9A 5E4IA 3GO1H 2E8YA 2XG4A 5KS9B 4XP9L 1B90A 1B0RB 1N6QL 2UZXB 3MUJA 5B4MD 4F7EA 4Z7VA 4E0RA 1I1YA 5DQDL 4Y19D 2OSLB 3HKFA 3Q0HA 2HVJB 2AJZB 4EN3D 4NZUL 3VXMB 1BF8A 3AU1A 2XTJC 4UQ3B 4AM0B 3R8QA 4ZNCD 4N5ED 1YEHH 5HHOA 5A43C 5JLZA 2WNGA 1R5WA 4UIKL 3MXWL 3BESR 4JDVB 4N5UA 5CJQL 3OAZH 1Q9OB 2CRMA 2HLFD 2DICA 2APFA 5D7LA 1A3RL 4NWTH 5I76A 4NHUB 4WI2A 3SJVD 1NBVL 1UB6A 4I48B 3IFOA 4JM2A 1KG0A 1IFHL 2W0FB 4FQ2H 3ZE2F 4LSPH 1J1XL 5IP4A 1RZFL 1MFEL 4R96B 1D5MB 2DM2A 1I8LA 2ITDA 3QO0A 4FTVE 1S9KC 5DS8B 3FFCB 3G9VA 4L3EB 5DRNB 3FKUS 5HYFA 2GSIA 5K9OB 4RSVA 1B6UA 1KIUA 3MROB 1GGBH 4KTEL 4MA1B 4ZUTA 4PJ5E 4Y1AD 2J5LB 4IHOA 5M95B 3C87A 1AO7E 1JGEB 5I1AB 4QXWA 1ZLUH 2M2DA 2W0PA 1DZBA 2C5DC 3BMWA 1CE6A 2OZ4L 5ACLA 1CWVA 4P23D 3UJTH 3MV7B 5F88A 5ICXB 4WI8A 5HPMA 2D4FA 4Y16A 2W07A 2OJEB 3S7GA 4WCYL 3EYSL 4FFVD 1I8KB 4OI8A 2AXHA 2VDKH 6CGTA 1UZ6F 1A5FL 5JW3H 4GG6B 3LKSA 3L3OB 3UYRL 3QNZB 3D0LA 1NLBL 1UWGL 3EJZC 3WKML 5BZWB 1NJ9A 5DEFB 3G5YB 2O5ZH 4ODSL 2BJMH 2XA8L 4YXHH 1T1WB 5JOFB 3O2VH 5DQDH 3RTQD 1GOFA 1JZ7A 3HG1B 3LEVL 2VIRB 1T6VN 2ZUSA 4O2EA 1TITA 4NO5B 3IU4L 4U6XB 5KVEL 2E9IA 4QXGL 5GISL 4LPXA 1F4AA 5BQ7B 1T6WA 4HD9A 2EECA 5DUPH 2AEQL 1UYWH 2BXZA 2HTLC 3P11H 1MFBL 5ANMB 1RUAL 2X4RB 4RISL 2DLHA 5GGSB 4XPHL 3L7FB 4YAQB 4PJBE 3VXRA 5T1LA 4RGND 5EU3A 5FYKH 1WEJL 4QYOB 3VRLF 2E7LC 2BFVL 1ED3A 2LFGA 2P5WD 4O00A 2FECI 3ZKXC 4PJ8D 3JWOC 5D5MB 2FHFA 3WFHA 4OI7A 2OM5A 5J13C 4N0RA 1B0WA 2BNRE 4L8SA 1N6VA 3W39B 2IADB 4JB9L 1TPXC 4W70A 1UKSA 1UXSB 3BP7B 4OD3L 3P9WB 1SJHA 3O4OB 2R2CA 3P9MA 3JV5A 1Q9KB 5DD1L 3P73A 1MHCA 4HWBH 4R7NB 5JIKA 3V6OA 5HPOA 3RWFA 3W82A 5HYQA 5I1CH 4U4BA 4HWUA 1ZHNB 4Q2ZA 3T2NH 3OF6A 3LY6A 4GW5B 5IJKA 3CPLB 3FOLA 4JVWA 4NFCA 3A6BL 2I60L 4XC1H 4L1DA 4BKLB 1J87A 4FG6D 3O3UN 2AP2A 4JB9H 4XAKD 2X89A 2YPVL 3EYSH 3AREC 4R3SA 4IRJB 1YEJH 2CUMA 4GQ9H 2XZQL 5DFTA 1F4XH 2MKLC 1FSKB 1UACL 5GJTH 2DDQL 3GJFH 3EOAB 4ODTL 1C5CH 5F7NC 2V5MA 1CGYA 5BXFB 2AVGA 5C0DB 4PJIA 2A73B 1AP2A 4C56B 3IU3B 2ZCKL 4UOJA 5D7KE 5BV7C 1GGIH 2X6MA 3ZO0A 4ELKA 5TFSH 3ILPB 3IU4H 5CJBA 1DBJH 4GAYA 43CAA 4NKQB 1FGNL 4QRUB 2AXGB 3WIIL 1LO5A 3C08L 1UWXH 4R90L 2PYEA 4JAMA 3AAZA 3VXSA 3T4YB 5GZNC 4XPBH 4YUEL 1RJZB 1I1AD 3U46B 4B5EA 2AAVA 2FB4H 5C0BD 4EN3C 3PWLA 2HRLA 3O81A 3IJSB 1C7SA 4QLRA 1CG9B 3ARGB 5I6XB 3VMNA 2ITCA 5ALBL 1LO5B 1JZ6A 2HWZH 2XI9A 1WT5C 1RUAH 2NMSA 4JFZH 1MFCL 4M7JL 5BCAA 3P4NB 3VDBA 1JFQL 2AJXL 4G9FE 4F7TB 3ARBA 2R0ZL 2PUQT 1U91B 3BO8A 1CGTA 4U7KA 1ZLUK 3JV6B 4ZYKA 3LN5A 1FDLL 5EBWA 4G42A 1VKXB 1ZLVK 1I1AC 4GUPB 1UVQB 1QG3A 4LCIH 2WAHA 5EZJA 1JJUA 2HG5B 1UH4A 4ACPA 2NXYC 3M8OL 2CKBH 3MRCA 3TWCL 3SCMC 3RIAF 2X4QA 2BVQA 5EA0H 4EXPX 3AMLA 4YFDB 4I0PA 2VXSL 4MD4B 3VD3A 4P5KB 5F1KC 3LIZH 1R3KB 3MV8D 1T1YB 4FMFA 1FFPA 2PCPB 2CD0A 4PYGA 5IVZB 5J1SC 1A4KA 1U41A 2BC4B 2N7BA 4EBQL 3KPSA 1W0WB 5EZJB 2EDRA 2JK5A 4JPVL 1HHGA 4KFZC 1FSKC 2NYYD 1TIUA 4NSKA 4KJWC 1W0YT 1VPOH 5CSZA 2IANA 1KC5L 5CJXA 3RPIA 3L95A 2ZUVA 4P23C 5B8CB 3A67H 3D85A 3EDJA 5FGBC 3DTXB 1WTLA 3O4LE 3CZJA 1IGYA 2W9DL 4R2GC 4OZIE 3SDXE 3QDJB 4PJ7A 4J3UA 3U7WH 2EXYC 5FKPB 4C56D 4WENB 2V7NB 4PUBL 4AY0A 2FH6A 1NH6A 2MKWA 1YMME 3D25A 3EOTL 4J3OC 5CHNA 5ICZB 3RZCD 4KVCH 4YH6A 4NKOA 2D7MA 2DBLH 5F3HA 2M26A 3FQXA 3CFKB 3WHXA 3BHBA 4U6HB 3GMOB 5E8EB 4JFFB 4UV4H 4BSWA 3LQAC 2IANB 3G5VA 2CO7B 3HA0A 1JYWA 2YPLD 5K9OA 1BWMA 4KK8C 4DQOL 1MJ7L 2IPTH 5JMRA 4ZYKB 2ATPB 3GMQB 5DTFB 2OLDA 3RVVD 5IVXA 1YPZB 2AK4B 3BOVA 5I0DA 4QKXB 3I2CH 3IXTB 3FO1A 3ARFD 3O4LD 3ARWA 4D0BB 3QRGL 3PDOA 4LHJB 1G9NC 5EWIH 1SYVA 4NN7C 3OKDA 5DURB 5FOBB 4L4TE 4XWGH 1HDMB 3TNNB 4XVTL 1SJXA 1JI1A 1U3HA 1W72A 3MOAL 2OI9B 4UTBL 2CDFB 2EE6A 4XXCA 4GKZB 3FO2A 4G3YL 3KYNA 1B3JA 1WWWX 4JLRB 4CMMA 2KQNA 1AJ7H 4R26L 2ATKA 5ALCL 3W9EA 4HS8H 1RZKL 4YDIH 1KNOB 1X3DA 2OR9H 5EORL 1S7WB 3QIBA 2KDGA 2W9EH 4HGWA 4DWHA 4AENA 2AV7B 3G04B 2FD6L 4OCMC 4HIXL 5EC1A 3VJ6A 2XN9B 4F2MB 3OJMB 2XN9D 4JFDD 3RRQA 3I6LD 3VFNA 2H8PA 3JSSA 2A2QT 5E2JA 3KXFE 5DJCB 3GSXB 2A73A 5KBNC 2DWDB 3MJ8B 2GJ6A 2NY6B 2GYSA 1KJ2L 2K7PA 4Q9QL 4RMRA 1ZXQA 3LB6C 3MRQB 4LVOC 2YMXH 3WIFB 1E4WL 3MLUH 1INEL 2XWBA 4NQDB 4FFZH 4O02H 3CXHK 1FLRH 4J2XA 3UC0H 3RWEB 4E41B 3X12B 5EN2B 1LO2H 2VXTH 1GHFH 3VI3F 4WW1A 4JO3L 3V6ZA 3M1BA 4G80A 5KG9A 3RNKB 5D5MA 5CWSA 5D2NC 1DUYB 5JO5A 3S88L 2V2WA 4AJ0A 4JPKL 3S4SA 1XCQA 2R0WL 4S1SH 4ZUWB 1B9ZA 3RHWK 5ESAA 1MHPL 3QCUH 4KJQC 2A6KA 1FVCA 3S35L 3TJHC 4MCZA 3FONB 2AV1A 1JI2A 4XNXH 1GGCH 2QLVB 5GZND 2UWEA 4Z5RA 12E8H 3MXVL 2SEBA 4JR9L 1A47A 4O2EB 5CUSL 4HG4K 2V2WB 3BD4A 1A6AB 2HWZL 3UPRB 1D3CA 3W9DA 3NCYP 2VOTA 2ILLA 2R4SH 1M7XA 3D25B 1WEJH 3QUMA 3ARDC 3E0GA 3QIUC 2QHRL 2BJML 2C4XA 2GUOB 4NC1C 1G6VK 4S10A 2PXYA 4YAQA 3NCFB 1U95A 2H9GA 4YGAB 3BH9A 4DVBA 5AAMA 4LLVB 2OR9L 1Q8MA 3HHRB 5ITFA 1JGUH 3O3DB 3FQTB 1IC7L 2IPUK 3VD9A 3HNVH 5F8RC 4NQXB 3FT4A 2PCPA 1XGRA 3HFMH 2A9MH 3H7LA 5ADOH 1GC1L 1DANU 1VGEH 4HS6A 4QRRA 4UQ2A 5T3ZH 5IFAL 5DMIL 1JCKA 3MLWL 4PJ7E 1D5IH 2HH0L 3L3HA 4U1IB 1ZSDB 2K3TA 4JHWH 4OUUA 3NN8A 4LQ1A 5LXGL 4KXZH 4Y5XB 2B39A 5DJAB 2Y4SA 4NO0A 2JCCE 1AD0B 3O6KL 1FJ1B 2CXKA 2VZTA 4HFWB 2VXQH 5DD3H 2JCCF 1DLHB 1YEJL 3UBXG 5D2LA 5DJXA 3PQYE 4NP4H 5C07D 1CTOA 3HZMB 3QA3A 5SV4A 4D0CB 3L3HB 1CXEA 5B21A 1PKQE 4P57B 5DC4B 5C9KA 3V5DA 3SCMA 1FL3B 3B5GA 5SX5K 4LCWB 3P30L 2HJLB 5IFHH 2IBBA 1ETZA 4F2MA 5IHBA 1ADQA 3MZGB 1I9JH 4NQVB 1MCPH 1H3UA 2F53B 4XBEH 5H8DA 4S1SL 3OB8A 3DECA 2OP4L 1F8TH 1OAXH 1I1AA 5EU6B 3GSQA 4P2QE 3LHPH 1A0QH 1H5BA 2KQMA 2YBRB 1AD9A 3N50A 1XGQB 3ARDB 4IEFB 3QPXH 1Q9LA 3RBSA 4I5BA 4L5FL 2MWCA 4IMKC 4PJDE 2BRRL 1FFNB 4LPTA 3GI8L 2BHUA 5E2VL 5J0BA 1EAPA 2MTPA 3IDMA 3FAWA 3IF1B 2Y25A 3V52L 1I7RB 5D72H 5F7WC 2PYED 4Q6IA 4DTGL 2EDBA 3BKMH 2RIKA 1MH5A 3AREA 2YK1H 3JWDL 5DD0L 3V4VH 3R06B 5A2KH 1NBVH 5ESQA 4WTXA 5DI8A 5EZOH 4PJHE 3GJEA 4QHUB 3MCLH 1RJLB 4XCFH 5GGSA 5JW4N 4HT1H 2X89D 4QHKJ 2ESVD 3O45A 2E6QA 1CXKA 3BPLB 2WMPA 4JJ5B 3TFKD 5JA8B 4DVRL 2V2XB 1NGWB 2PXYD 3TZVD 4U7MA 3MOBL 1WAAA 3B9KC 3QH3A 3GSRB 5ENWA 3U9PH 4OBSA 4RQQB 1E6OH 1UB6B 5FKPA 2B2XL 5FM5O 4ZO7A 1G7LA 3C5ZC 3RHWF 3G6AA 1R0AH 3PWPA 2R2EA 5LAXB 5IB2B 4H5SA 2IQAA 2UUDK 1UB5A 4NIKB 1LE5B 4MVBD 4U1MA 4JO1H 5GRUH 5JORB 3V95A 3QDGD 1S9VA 1F4YH 3OF6D 3PGCA 3RQ3A 1UENA 3BN3B 3N85H 1JBJA 4O9HH 2XY1A 4MXQD 1NCUA 3H9SD 4GG8A 4I3SL 1QQDB 2E9JA 4FQIH 2HFFA 2P5WA 2R2EB 3HNSH 5I1KL 1JPFA 2HT2C 2AQ1A 4L4TA 1NMBH 1G7LB 3A67L 1A7OL 2VXVH 3OKDB 4BFGA 3TCLA 5D7SH 3QG7L 4M8QA 5GRJL 1CG9A 3ARGA 3UAJC 2VL5A 2JCCB 3BW9A 2IAMD 1NSNH 4MZ2A 5C0RH 4DTGH 4PYHA 3WEXB 3AROA 4G42B 4CGTA 4AIOA 5D1QB 35C8H 3JWDH 4L8DA 3HE7D 4OBRA 3LN5B 4U0QB 5D9SB 5DI8B 4U2ZA 2VH5H 3NCCB 3FB5B 4DCQA 1RVFH 2BSED 5F3BB 1IBGH 1OPGH 2IMNA 4JKKA 1JNHB 1Z2KA 4FQXC 2YD5A 3QJFA 1PW3A 5IMLA 1FZOB 1OARL 5DJ2A 1HE7A 3AXLA 3IXAA 4XPFL 1U8KB 3MRFA 5IEHB 3UTPD 1W72H 2Z8VC 3CFBB 3T3ME 2FBJH 4YDVA 1QFWL 2E6PA 2X4QB 4R0LC 3SPVA 2X5PA 3DXAE 1X6NA 3KYMA 2ZUYA 2HA1A 2VWEE 3FQWA 2IBGA 2VISA 3ARFB 4AT6B 1BZ7A 4I5BB 2DLFH 2MSPA 4Y16D 4Z7UB 4PR5B 3EZ8A 3IFNL 1OCWL 2AXFA 4JPWL 4DKFL 2Q86B 4XP1L 1ND0B 1AGCA 3OXRA 3B9DA 1CQKA 4OLZH 1RQ5A 3OKOB 5EUKB 3NCJL 1KTLB 1I3GL 1BZ9B 3TBYA 1QBMH 3ARFA 5IBUG 2D31A 2EEDA 4D3CL 2GTWA 3C8KB 4PJ5B 3BVNB 1BZ7B 5F1IA 2CLVB 2YPLA 1LQSR 3L5IA 5HVHC 3MCG1 2X44D 3LEXB 3K4DA 1AKJB 3O9WC 5C0EB 2XG5A 3STLB 3GMRB 4R97B 3VXSB 4DKAA 1S5IH 1RPQA 3C9NB 3DX7B 3QUKA 4KK9C 1AR1D 3F5WB 1R5IB 5T1DL 3OMZA 2ZCKH 4LSRH 3SOBL 4LNVA 1GZQB 4Z95L 1YPZA 2AK4A 3TT3H 5IROC 1H8SA 4X4YA 1UA6L 3QEUB 1A0QL 3VXRB 2EIZB 4YFLI 5EO9A 4WU5B 3AY4A 3S8WA 5IKCA 5IB5A 1C08B 2UZIL 5ACMA 4ZQKB 1AGEA 1OAKH 3KPNA 3O11A 1DBBH 4DGYL 2H26B 4U1GB 4BH8B 3TV3H 4NN5C 4DJMA 4ZNEA 5I30H 4GQPH 4XNMA 1ZV5A 3PWUA 2RR3A 4NKDA 5L2KD 1KPRA 4NJ9H 5B38B 2ICCA 2JJSA 2HVJA 2QTEA 5D5ME 1CT8A 2XZCL 1WWBX 1AXTL 4I0PD 5F8QC 5FAAA 4PRBB 2VH5L 3HTLX 1RAMA 4OQTA 4ZO8A 2ZUTA 1VFBB 3S3JA 1P4IH 3O3BB 4OZ4B 1NFDA 5IT2L 3CAFA 5IMOB 1A64A 1HQRB 4LLMA 5JW4R 3W11D 4NO3A 2CLZA 4RQQA 2E27L 1D5XB 3CMOH 1Q1JH 2E7BA 3E2HB 2VERN 3L3JB 4FQCH 3BISA 1N5AB 2X4OA 2ICES 3UXFA 3UC0L 4IRJA 3F58L 5DZNA 5AZ2L 2J8UE 4HC1A 1O7SA 4PV9B 4OGXH 1P7HL 5ID1B 3O0RH 3T0BA 1RV6X 3BT2L 4HJGA 3IDGA 3ZE1E 2YD1A 4LPVA 4WW1B 5BXFA 2ZG2A 1F2QA 4MQSB 1CFNA 1NFIA 1E4WH 3RWHA 3I02A 2W65B 3GI9L 3S35X 3VGAB 3JUYA 5FYKD 4QY8A 2AJZA 5ID1A 5KSUB 1NDGB 3RX5A 1ADQH 1Q72L 5C2BH 2XACC 4WFFD 1FIEA 2WINB 4BQ8A 2WP3T 1V7NH 4N1CA 1BM3L 3K3QA 2DD8L 2XZAH 1N8ZA 3BP5B 4RWHA 3RUGA 3U6RA 5BW7A 2WUBH 2EC9T 5CEZD 1ZGLP 1IGTB 4MS8C 4X6EA 3TN0B 2LVEA 1CS6A 5A3ID 1N64L 2R4SL 5C08D 1FBIL 1OP5K 4G5ZH 1S9WA 4FQLH 5DD5H 5BZWA 4PJDA 3QNXA 1MHCB 2NY5H 3MMEA 4X9GA 4NPYA 3DUUB 4C54A 4U0RC 4YZFF 4TNWF 1QSVA 5AUMA 3KYNB 4M7LH 2IPKA 5CMAB 3F7YA 1AGDB 4F7EB 1NAKL 1QFWM 2XQBH 4CNIB 1S9XA 5JPNA 2F19L 4NUGL 4CVWA 1I3RA 1BQHG 4KK5D 5HI3C 1MPAH 5I1AA 3NIFE 3MV9A 5ANME 1PLGL 3G08A 4PJHA 5GS2D 2OL3B 5CEZE 3BP4B 4LARL 4NM8L 3BUYA 4I1NB 5GZOD 3IDGB 1FJ1A 3KPLA 1A1OB 1J11A 4Q0XL 1SJVA 1VA9A 2IJ0C 1NAMA 4OTXL 1P2CA 4PG2C 3IETB 1OAZH 2DBJA 4XZUA 3QPXL 3DARA 4KK6D 1T1XA 2MQ3A 1C8PA 4YEEA 3CUPB 1DVFA 1YEGH 3IFOB 1NANH 4PGCB 4KHTL 1U3HC 4HUWB 4U6VH 1J1PH 1ZKAA 4PJHB 3BJLA 2GEEA 4NQEB 3W5MA 3LPGA 5HYQB 3ULUD 4M4PA 1NFDB 3FQTA 5DD3L 4UB0L 1WITA 3O6FA 4I9WE 3OX8A 1S8DA 1XIWA 3PP3H 1QSEE 2WUBL 1FPTH 3QCTH 2Z9TA 2YZ1A 3OKKB 4DZ8B 1V7NL 3BQUA 3LIZL 5LGHH 1MWAB 2HVKA 4LLYB 4QOKE 5C0BB 4D8PA 5L7XH 3NMEA 3QG6B 5C7XH 5C70A 4PBWD 5DFVD 4WW2F 3N85L 1BVLA 5CJ8A 4LCUB 1G7HA 1OB1B 2ARJQ 1JWSB 5F7UA 4G5ZL 3P9LA 3V0WH 1JF6A 3DUSB 4PJAB 1JGVH 3BFOA 2IG2H 3BGMA 2P45B 3QXTA 5DA0B 3T0EB 4OFPA 3RU8L 1C5BL 1RZ7L 1SYSB 3A6OA 4NN6B 4JFXA 2R39A 3FO9A 1I9RL 4J3VA 5KAQF 4X4ZA 5H94A 3K1KC 5FO9B 1FFOA 1HHKA 2Z4QA 1YN7A 3NZHH 5KN5B 1Z0NA 1OHQA 2FIKA 4KPHL 3VFMA 1HHHA 2A6DA 3NZ8B 2AJSL 1YUHB 3PP3K 2JELH 1A1MB 3Q6FB 5CP7A 4KH2A 5CUSH 3KYKL 1KCVH 3ROOB 1DANT 1EEYA 1GL4B 3MRRA 4PJ8C 3QFDB 5F1OB 5SWZB 1KIRB 4J8RB 5C08B 4BFEA 3ARBC 1TCMA 2B1AH 2B5IB 3IKCB 4WFGD 5SX4I 1CGUA 1PG7H 1F97A 1UFUA 4BUHA 4PBXA 3VXSE 1IZKA 1JWMA 3MLUL 1F4XL 4HAGA 2YC1B 1I8MB 3GMRA 1EAPB 4GO6B 2X1WL 5ICXA 3RDTC 3KHQA 2IADA 1E6JH 5EO1A 1MRCL 3WFBL 5INDA 4P99A 4G8GB 2CMRL 4HXBL 5ERWB 4WFED 3SJVA 4WI9A 2VLKE 5ETUB 3MRRB 1IGJA 1L0YA 1T5XA 1J05B 3D2UA 5D7LD 3S88H 1JRHL 2ARJB 3DXAA 4POYA 3UTSA 1CGWA 3D9AL 4N0UA 3ARUA 4N8CH 3INUL 1LEKA 1Y0LA 2P5EE 4YDIL 3FFCA 4L3EA 3EJZD 2PYFB 5GRVL 4HEME 3SDDB 4ELMA 1A1NA 3H9SA 4M61A 4I4WA 3ORJA 5HI4D 4P2OD 5D7JD 2FX8H 4EN3A 3ZDZE 5IHUL 4N1EA 4X99B 2CDGB 1SYSA 1CLOH 4MZ3A 2R1YB 1Q9WA 4Z7NE 2FH8A 3DROA 3G5XB 3MV7E 4XNYH 3IGAB 3WFBH 4LCCB 2FR4B 4JN2A 5HI5C 4N0UB 3QXUA 5TDPB 1KXQE 5I1DB 3FFDB 5JPMA 1YNLL 2WIIA 1XR9A 1FV1B 4YDVB 4Y5XA 2P8MB 4MD0B 5KZCD 5DJ2B 3QEQD 3PABA 1NGPL 3AS1A 1I9RH 3JUZA 4LLUB 2I9TA 1OAUH 5F70A 3MRJA 2UZYB 4X6CA 1QBML 2XFXA 3JV6A 2FX7H 1VADA 5ACZA 5JUEH 5J6HB 3B9KD 3O2DH 4XC3L 1IEAB 4HIEB 2X05A 2C26A 2XKNB 1YMHB 5JHDB 3IFNH 1D6EA 1RUPH 4R90H 1A5FH 2Y6SD 4TPRH 5GGVL 4P46C 5HYSB 2EDOA 3IT8D 5GIRB 3RWGB 1N59A 1NC4D 1ACYL 3RTQC 4OLZL 2EZ0D 3CJJA 2EYRB 2Y5TB 2N4IA 1JHTA 5EUKA 5DJ0B 5TFSL 2L0DA 1PYWB 1IEAA 2VR4A 5ACZB 1ZHBA 3C6LB 4HWBA 3L9RB 3GSOB 4GRMA 5B3JE 3FB7B 2J8UA 1OGTB 1E6JL 1TCRA 3QXVA 5IMLB 3ZE2E 1EK3A 3FT2B 4HXBH 3PWNB 4CVXB 5CBAA 4Q9RH 5IVXE 2B0SL 3GHEL 5E5UB 4ZG1A 4PTUA 3O6FB 4QOKA 1TVBA 4YIQA 4WW2C 3EOAA 5DMYA 1PKQA 4UDUB 4HFWA 5GHWL 4WUUE 3IU3A 2R9HC 2VR9A 5KSBF 3L5XH 1QRKA 3QFDA 5F97E 1Q0XL 3G5XA 4XBPA 2DB8A 4BZ1H 4PUBH 3QEUA 1N5YH 3ZYJA 5DEFA 1PG7W 1VEOA 1VERA 1UJTA 5DJDB 1CU4H 4PJFF 4O5LL 3QG6A 5E6IC 4XB7A 5JXEA 2VL5B 2B20A 2J8UB 2CO6B 4F37F 3SO3B 4D9LL 2ESVB 1FC1A 4P49A 4OI9A 4LLQB 4ZSOB 3EFDL 1J1XH 4C83B 4U1NA 2HKHH 4K55A 5IB3A 1ZT7A 3VG0H 3SE8H 1IL1A 2R15A 2YSSB 3O3AB 4PJGE 3BIBX 3EYOB 4FFVC 1RJZA 3X14A 1JHLL 1LILA 4LCWD 4NDMB 2IFFL 4LIQL 5F6HI 4WI7A 2VRAA 3GKWH 4ZTOL 2VZ3A 4E5XB 4OIIL 2VXSH 5AYUL 2XRAH 2EDTA 5EIIB 4AK1A 2ICEA 3DO3A 1TDQA 3QHFL 4LCYB 3LKRA 2W60A 2KL6A 5I30L 3BZEA 3LKPA 3UTTA 3H8NA 1R3IL 5E4EB 5LBSL 1F13A 4HS3A 3KXFB 4P2RD 3VU2A 3ZDXE 3VE0B 5FECA 5FYKU 5F7YC 1XF2B 1QYGH 4TN9A 1S7VA 4KJYA 3HCVB 4LK4A 3FB6B 3P0VH 2YPKA 4F33B 1KB5H 5FUCE 4WTZA 3SKNA 4JANA 1CGXA 3FFDA 3MXWH 4KMTH 1LE9B 3TBTA 4DQOH 3HN3A 4CRPA 4G3YH 4HUKB 4B7IA 1X6LA 4JM2C 3VWJB 5J57B 3PWJB 3AS2A 2JE8A 4G8GA 4XHJC 1Y6NR 4ODTH 3K4ZA 4KK9D 1YJDH 5C92A 8FABA 3E8UH 3K46A 4YUEH 3V6OC 3DPBA 3MFFB 2NCMA 1I7TB 1HHIB 2AI0L 2RQ8A 2UWEF 4ZO9A 4UILL 3DX8B 5J3HD 3RGVB 3QUYA 1YEGL 4CU7A 1KJ3L 4NCC1 4PRID 1C12B 5F6IC 1DQMH 3KS0H 4Z76A 2Y36H 1A2YA 3L3JA 4F8TA 3PWPE 1ZVYA 3S5LG 5BVJB 3V4PH 4JG1L 3QAZB 4N90E 1FLTX 4KMLB 3ULUF 4UINL 3DUUA 3LV3B 4CU6A 3C5JB 4LVOB 4NC0B 4OZIB 3RWHB 3WDJA 2X4UA 4S1QH 5DJYA 4P3CH 2APXA 4MQ7A 4GBXC 3JVGA 3U9UB 4FQLL 5DD5L 1CDBA 1FL6B 1UWEH 1P1ZA 2DMBA 5T3XE 1IC1A 4X6FA 4NRZB 5D4QA 1CT8B 4ZAKC 1WF5A 2VSCA 4O2FA 5F1SA 5HXMA 4YXKH 2QQKH 4JFEA 1KN2H 1HDMA 2PTTA 1JN6A 2VQ1A 2R56L 1U8NA 1G6RB 5BS0E 4NZRH 3WFEL 4AEHH 1QVOB 1AQKL 2OBGA 2CR6A 4ZFZB 4KJWD 4BQ9A 3RNKA 4X98B 4JFOB 4ETQB 1OTSC 3H42L 5IK3B 1DLFH 2G2RB 4WUKL 3DLQR 1UA6H 2CPCA 2PO6C 5I1IH 2D7TH 4MQXD 3DMMC 2DL9A 2FL5B 5GJSL 3U9UA 4HAFA 1S7TB 5D1ZB 3S4SB 4OFYD 2WBJA 3NAAL 3GMLA 5E2UH 3HMXL 5E6ID 5HYJD 4EUPA 1HOCA 5DHVB 4PGDB 1OAUL 2HTKD 2Z8RA 1HNFA 3CDFA 3HC4L 2H32A 2DI8A 3MV7A 5F88B 3ME0A 1EGJH 4Y2DC 5IGXH 2XTJD 1XZ0A 5TE7L 4YHKL 4P9HC 3PL6D 5BS0D 4KKCC 4E42A 4PY8J 5DMGD 4EOWL 2DJ4A 5I15H 3RWJB 1H3PH 5B3JF 1R3JB 4K23L 1KYOK 1OQXA 4BELD 4OZHF 4XCEA 3GJFK 2UY7A 1NMCC 2GUOA 4Z7WA 1FP5A 5GGQH 4BH7B 4XPGH 3HNVL 4RNRA 4UDTA 3UTZB 2D4DA 4LSVH 5IQ7L 1AXTH 4TVPE 1KIPA 1NCCL 1OSPH 3F58H 1XGYL 3LS4L 4B7LA 4N8VB 4MAYA 4NNXB 1MRDL 2RHEA 1KNOA 2FGWH 4P4KA 4KRPC 4JFXB 4PJ8B 1X5FA 2D3VA 3QEHB 4HV8B 2FGZA 3KG5A 3IRPX 3QQ4B 4RFEA 1CFQA 1G1CA 4MCYB 1SHMA 1BD2B 1FH5H 1DQLL 5HYJB 1AQDB 1E4KC 1FCCA 1KIPB 1QNZL 3AS0A 4S1RL 3EGSB 2DQGH 5IT2H 1MH5B 2DQIL 2DWEA 2UYLA 1XGYH 4HF5H 4LSSL 4KAQL 4JM2F 5IR1B 2AEWA 2D9QB 1EFXD 3T0EC 2R0KH 5I1HH 5HVHB 1ZVHA 3B6SB 1MAML 4J3WA 5IWLA 1MEXL 2I5YH 1RUQL 1N2RB 5KSAD 4O4YL 3T8XB 5ITFB 2CDEA 1INEH 1BQLL 1WZ1L 1YNTB 2FLRT 4OJFL 3AB0C 2BY0A 4HXAH 4M9PA 4JRXA 1DQDL 1FZMB 4OFYA 2BNQB 3ARBD 1EHAA 1H5BB 1CDYA 3BKCL 2W38A 4Y0GA 5E1HB 2PKDA 1T20B 3DV6A 3O8XA 5TPWH 43C9B 3LZFL 2NW3B 4BZYA 4TTDC 3C8DA 2WUCH 1U8HB 1RZKH 1UM5H 2DM4A 3QR2A 2NX5A 2VDRL 3LD8C 3S96A 5J11B 1EVUA 1BJMA 5HY9B 4Y4FC 3VA6A 5FUOL 3EDKA 4ZFFB 1GC1C 3WHE0 4WWKB 4PRDB 3H7BA 5EBMA 3WXVH 1VKXA 1CTNA 1NCAH 4LQFH 1QA9A 5MEQB 3EO1A 1PZUB 3FB7A 5DD0H 3V4VL 5C09D 3U82B 5E56A 5CILH 2J3SA 2Y7QB 2ZSVB 5LKNA 1RULL 1KPUB 5KVEH 5E5MA 3MRCB 5TQ0L 1WZMA 3QDMA 3HR5A 4JY6B 2V2XA 4LP4A 5DT1L 1G0YR 3HG1E 1JPGB 4PJEE 2BNUA 2MCPL 3MZTA 4CAGA 3PHQA 3QCTL 2CK2A 3X11A 4G43A 3ULVD 4P46B 4QTHA 2BOCB 1IGJB 5L2JB 3PV6B 5F1NB 1IM9D 2MNUA 1I85A 5DWUH 5F1IB 5GS1A 4H1LB 2HRPL 1PKOA 1QRNB 2ICWB 3WN5C 1H8NA 1WBYB 3WV0A 3LDBB 2R1WA 3LKOB 4UU9B 3FRUB 1CBVL 3O6ML 3QDJA 4JZOA 3CMGA 3CX2A 2O26U 4F9LA 4RDQF 4JHAH 4QEGA 1PVHA 2DS4A 3JTTB 5I1DA 4OTXH 3MLTA 1R5VA 3VG9B 1F4YL 3QEHA 4HV8A 1UM4H 3C60B 5D7KD 1G9MC 2BZDA 4PJCB 5E8OB 1CXIA 5HGDB 2DQCL 2HRPH 4HWEH 1HK6A 2BHZA 2UV3A 5T1MB 2EXYD 1Y18A 3FTGA 1R3KA 3BYYA 4XNZC 1S7SB 5AYQA 1QO3A 3B9VA 3TBYB 1NSNL 4CVZA 3ALPA 1KLUB 5TF1H 5D1QA 4ENED 4N0FA 1HH9B 1QUNA 3FO1B 1CCZA 4PPTA 1N4XL 3U0PB 4NYLB 1F8TL 1OAXL 2JB6B 3GSUA 3RL1A 2NY4B 2VDLH 1JUFB 4W4NA 3EJYC 3RJDA 3D0VB 1KXTB 5CEZH 3TCXA 1VGKA 1HIML 2N1KA 4LRNH 4TSCH 2WUCL 2P7TB 1DEEA 5BVPL 1NFDE 3DX9B 1MRFL 2MCPH 4M8VA 3SKOA 1V05A 4U1JA 4KDTA 2DQFB 4MJ2A 2H2SC 4M5ZL 4WUUB 2OJZH 2V5SA 5JOPE 2H6PA 1I9EA 5EFIB 5FK9A 1H8OA 1A9BA 3ARXA 1DEDA 2EDKA 1AHWC 3OB0H 4HKBB 1NGWA 3BPOB 4LVNC 3GK8H 4U1HA 3DX6B 4LAQL 2K7QA 2EYTA 4PRAB 3WJJC 1U6AH 2KH2B 3L6FA 3OPZL 2P48B 1D9KB 1K6QL 3V52H 4PBVC 4ZOCA 1EFXB 1J0HA 3K4AA 1FC2D 4IJ3B 4ZAKB 1KF9B 1IC7H 5E1AB 4BJLA 3ZHKA 1WFNA 3DV4B 4AIXA 4F7PB 3P4OB 3RL2A 1BQHB 3MO1A 2E7LA 1L0XA 1IAMA 3HUJB 2RCSL 4QRQA 3C9NA 3WD5L 2VABA 3GBMH 3W5NA 1MJUH 2K9UA