2AQRA

Cu/zn superoxide dismutase from neisseria meningitidis k91q mutant
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
155
structure length
155
Chain Sequence
ASIEVKVQQLDPVNGNKDVGTVTITESNYGLVFTPDLQGLSEGLHGFHIHENPSCEPKEQEGKLTAGLGAGGHWDPKGAKQHGYPWQDDAHLGDLPALTVLHDGTATNPVLAPRLKHLDDVRGHSIMIHTGGDNHSDHPAPLGGGGPRMACGVIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title CU/ZN superoxide dismutase from neisseria meningitidis K91Q mutant
rcsb
source organism Neisseria meningitidis
molecule tags Oxidoreductase
molecule keywords Superoxide dismutase [Cu-Zn]
total genus 34
structure length 155
sequence length 155
chains with identical sequence B, C
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2005-08-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 2aqrA00
1PTZA 1SXSA 3ECWA 5KBMA 2WWOA 3SODB 1IBDA 1SXCA 1EJ8A 2VR6A 1CB4A 1FUNA 1SXNA 4BD4A 4BCZA 2XJLA 2AEOA 1Q0EA 3CE1A 2ZKWA 1F18A 2VR8A 1EQWA 4N3TA 1OZTG 2SODB 1JK9A 3QQDB 1U3NA 3KBFA 1JK9B 3QQDA 4A7QA 2R27A 3H2PA 3GQFA 2ZKYA 2AQRA 2WWNA 1Z9PA 4B3EA 2WKOA 1XSOA 2Q2LA 3KBEA 2Z7UA 3K91A 3HW7A 2APSA 1JCVA 2AQNA 5KBKA 3T5WA 5KBLA 1E9QB 3CQPA 1DSWA 2Z7ZA 3KH3A 1F1GA 1TO4A 1Z9NA 2WYZA 3ECVA 1ESOA 1N18A 1TO5A 3KM2A 1PZSA 3CQQA 4L05A 2WZ0A 4FF9A 1SXBA 1UXMA 1SPDA 1AZVA 2AQPA 1YSOA 3GTTA 4OJAA 2AF2A 3MKGA 1OEZW 2K4WA 2WYTA 2C9VA 2ZKXA 4A7SA 4A7GA 2GBTA 2WKOF 4BCYA 2WZ5A 2V0AA 3GZPA 4MCMA 1UXLA 3L9YA 1OZUA 1OALA 1SDAB 3L9EA 1KMGA 1BZOA 1HL5A 2AQTA 1P1VA 2VR7A 3GTVA 4A7GF 2JCWA 3S0PA 3KM1A 1SOSA 3MNDA 1BA9A 3HFFA 3ECUA 1IBFA 4OH2A 1F1AA 1XTMA 1N19A 2C9SA 2NNXA 3RE0A 2GBUA 1MFMA 2XJKA 1HL4A 2JLPA 4U4IA 1DO5A 4MCNA 3H2QA 1SDYA 1IBHA 2E47A 3LTVA 5CU9A 1SXZA 1PU0A 4A7UA 3GZQA 1E9QA 1RK7A 1SXAA 2WZ6A 2LU5A 3F7KA 2Z7WA 4N3UA 2Z7YA 4A7VA 1B4TA 3GZOA 1E9PA 1OAJA 1YAIA 2GBVA 1E9PB 1QUPA 1CBJA 2C9UA 3HOGA 2E46A 1B4LA 1L3NA 1IBBA 1SRDA 3F7LA 1IB5A 1E9OA 3KH4A 1COBA 1E9OB 2AQQA 1XTLA 2ZOWA 1S4IA 1YAZA 2AQSA 1F1DA 3PU7A 4A7TA
chains in the Genus database with same CATH superfamily
2Z31A 4YSRA 5GGVH 4JQVA 4JREB 2A9DA 4NO2B 4LCUB 2IAMB 2WB7A 2BSSB 2HTKC 1EEYA 4FJZA 5GXBB 3RYMA 3T2LA 5B39G 2OW7A 3NT0A 3UBXB 2UY6A 4P9HL 2IANE 5GRYA 3CHXA 2APXA 1DQDH 1OTTD 1ZS8A 2H3NB 2AQ2A 2WK2A 1GIGL 3DX6A 2B3IA 5ERWB 1CL7H 1A47A 3X17A 4XXWC 4F2EA 3BKYH 4MJJA 2J6EA 5CEYB 3KYKH 5HDQL 3HI1B 4QRRD 4LLYA 3U9UB 1P84J 1RUQH 4HG4J 5IQNA 1IFHL 1ZJBA 4JHWH 3ZR6A 1CDCA 4PRAA 3SOBL 3ZTDC 4WEBH 3ARFD 2VNCA 3VGAC 3WDHA 1F4HA 3AGVA 4RQQA 1JDDA 2FO4A 2CM5A 4TSAH 2D7TL 4RGOL 4JG0H 3V0WL 3TASA 5JW4R 3DX6B 5I66B 2A9NH 3UTZA 4HS8L 2H3NA 2HKFL 1TLKA 1MW0A 1XT5A 3B7YA 1JV2A 3ARDB 3C8KA 3CFBA 5D1QC 3GBNL 1G6RA 1OP9A 1XZWA 1OCCB 5ITBH 1U8NA 4P23B 4L8BA 3CBKB 2IGFH 4L4TB 3IYLW 4H13C 2X6VA 2AABL 2RGSA 3OQ3B 3SYOA 3OXSB 3TH2T 1RZGA 2PXYA 3TCLB 4ZRGA 4XI5D 4JDZB 1CE1H 2JK5B 3QXWA 3JVGC 1HK6A 2DI9A 1F11A 2OCJA 2O61B 5KJ4A 1WZKA 1QSEB 3GBLA 5GGRB 4FLSA 3T08A 2IH1B 5MENA 2P5ED 4XHQA 1NGQL 4D0CB 1RK0B 3QEQA 3QDJB 2Y2YA 1W6WA 3QORC 1KN4H 3VG9C 1SEBA 3GJFK 3SQBA 4DOHB 3GZQA 4IDLA 5K1VA 3O11B 1PQZB 43CAA 4L3EE 3IMRA 3EYFA 5I18L 3X1EA 3IDGB 2J1ZA 1OAKH 3KS0J 5D4QA 4J8RB 4OFDA 4Z7QF 5L0QB 2LGNA 3S3SA 3SKOB 4N2DA 1PLGL 4DGWC 2PWGA 4X6DB 3QWRA 3BQUB 2HPTA 3RVXC 1KDIA 2E8ZA 3OAUH 4MA8L 1RPKA 4Q8BA 5GS1A 1SYSA 4AYBA 2FUQA 3MMEB 5HJGA 4UU9A 3JQOB 1E4WL 3BVNB 3EJJX 4PIRF 4H8VA 4UT9A 3ZYOA 4HG4K 1OL0A 2BVOA 4OFPA 3NJIA 5FOBB 2IH3B 4HW6A 4JO1H 4NOBA 5DD3L 4AI7A 2O5XH 4QY8A 3K46A 1UXWA 4ANVA 1T0MB 1CLCA 4MA3B 1R33A 1MY7A 5C07B 3UJJH 2J88H 3CN1A 5JHDE 3ARQA 4PRIA 1IEBB 2COVD 5DHYA 1B3JA 1ITBB 5EZIH 4N6RB 2Z91A 3DVNB 2NY5L 3OKLA 1L9RA 5JO5A 1C5CH 2EE9A 3VXSD 3I6GA 3TBYB 4D9RE 4AGOA 1FV1B 5E9DD 3E1F1 2ADIB 3D5OF 3FFCE 3GGWB 3U9PL 3UZQB 3ZKQD 5KVFL 5TF1H 3NPSC 3KNBB 1OP3K 4GAJH 3RRQA 4KV5F 5DI8A 3F83A 4AQAB 1IGIL 1BIIB 1Q9KA 3MYZA 4TOYL 2KKQA 4NDMA 4L4VD 4JKPH 3L8QA 1Y0LA 3IMUA 2X6AA 2PP8A 1CGSL 1NMCB 5D71H 4YSTA 1E50A 2PO6D 5KVDH 3EDDA 1K8DA 2WXJA 3JZYA 4JHVA 4TTDC 1J9CT 2ATKA 3HHRB 4Y7OC 1KPVB 4ZPTB 1XSKA 2H0PA 3L3GA 5JLZA 5DQDH 3WKML 1I1FB 3BP5A 1V3LA 3H54A 1CG9B 1BFTA 2ZX9A 3EOAA 3SGKC 3K6DA 3QUZD 2EJ1A 5D6DC 2F19H 1XCQB 1BFOA 5KJRL 4PRID 2IV8A 2VKXA 5T1MA 3OKNA 4UMSA 3G9AB 4HZAA 4K5LA 1JPEA 1M6OA 5BXFA 1F3JB 4HUMB 4Z7UE 4W81A 4L5FL 1L5GA 3LQAC 4LSTL 2OQJB 2CLRB 4PGEB 1IGML 5DR5L 5E6IC 4LCIH 3VUAA 3R8BB 1P9MC 3VTTA 5B1JC 1HZKA 2GY7B 3PLYA 4KJYB 4XBEH 2R2BB 2AQ3A 3AFLA 4XVSL 5AL0A 5PCYA 2F8IA 2WXFA 4FQCL 4ZD3L 3T4YB 3P9WB 4DFHA 5CEZE 4YXKL 4HC1H 4GP5B 5I19L 2AXFB 3L48A 4IHOB 5KYXA 3ULVF 4KO7A 3BGMB 2F1EA 3PXHA 1M9WA 1HEZB 4HAGA 3VXUB 3QWNA 2AZAA 3AAZB 3MLTA 4FFZH 4NM8H 4CSTA 4WI3A 1Q9KB 1FL3A 2VB5A 3VRIB 3SD5A 4GOSA 3X12A 1D7DA 4MXQD 1WTLA 2LVEA 3U1SH 5IFHH 2GHZA 2YXVA 1OE1A 4M3JA 4X6CF 2VJXA 3WL9A 2WWOA 1R5IB 2UX6A 4LQFL 4AYSA 1BGXH 1UA6H 4RAVA 4X7SH 4HK0A 3SJVD 2DMGA 4KKNA 4OW6A 3V5KB 3QDMD 3OKMB 4PVBA 5J11B 2VSMB 2NYYD 4XPAH 2J8UE 2DZEA 3EHBD 1QSFA 4MMYA 1X5FA 5AZUA 4RFOL 5ADPH 5F71A 1JHKL 3FPXA 4NNYB 3DX7B 1J1OL 1I9RL 2VLKD 2YN5A 5IVXE 3GQFA 4X6FB 5J3HD 2X88A 2GSMB 2X53A 2OYLA 1EEZB 1UWXH 2LLLA 2Q2LA 4Z95H 3GSQB 5I1IH 5DJDB 3LZNA 4XVUC 3LS4L 4CAGA 2QSCH 2WIIB 1KGJA 2W0PA 4HBCL 1V5JA 1ZRUA 4JEGB 2APBA 2JI1A 2EO7A 3IGFA 1QLEL 3ARBC 2RB8A 3H3PH 2QL1A 4PRDA 2OW6A 1J05B 3DV4B 4XCYA 3BH8B 2ICES 3NABL 3WO3B 1YEFH 5D1ZD 4MXQC 3W1ZA 2WC7A 2DQCH 1JNJA 1F90L 5ETUB 1KB5B 5HYSA 3HMXH 1JNLL 2JJSA 4M5TA 2G9HA 4QO1B 4R26H 3T1FA 1FPTL 5I1GL 5IT2H 1BOYA 2HN7A 4QHUB 4WO4A 3EOBA 3VG0H 1XAUA 3BWZA 1RU9H 1HZLA 4WFFD 4YDVB 2WHVA 4HUCA 1TQBC 3T0XA 1KJ2A 5EBWB 4WW2F 5ESVA 1KLFB 3H85A 5GS2H 3D0VA 4NBZB 3L4XA 1WRFA 1SJHA 4A2MA 5K9OA 2DI7A 4EN3B 1NAMB 2VDOB 4N9OB 1NDGA 3V6FA 3LQZA 3GXFA 4AEHH 4U1SA 4KRMB 3ZMNA 2N3JA 2Z6FA 5T3ZH 3BUQA 4FERA 1LHZA 3U9WA 2QMKA 1GJIA 4MDRA 3FQYA 4ZMAT 4XPTL 4LT7A 3MFFB 4MFHA 1QUPA 2C9UA 3QZWG 3V4UH 4ANUA 1FH2A 3GSRB 2LQRA 5C2BH 4X42A 2GJRA 4YPJA 2NUPB 2FIKA 3H1ZA 4PBVC 3D50A 3A22A 1MHPL 4J4PC 3FQTB 4ZUVB 1ULVA 2AQSA 2E74C 3C60D 2BNRA 1ZLDA 5AWNH 5DQ9B 1Q1PA 5IMKB 4H1LG 4NUMA 4PWGA 1FSKC 3O4LD 1ITCA 1Q90A 3J27A 3KWUA 3RU8H 4ZW5A 1IC0A 3HS0A 1RP9A 1I7ZB 4DP6X 2UVFA 4WJ5A 4FC3E 1CUOA 3RWIA 3T6XA 1SQMA 4BFOA 4TLKA 5BS0A 1GMEA 2QPDB 1OGTB 5BPPA 1WISA 1I3GH 1BZ9B 1U95A 5C0FB 5F44A 1MQKH 1A4JB 3JWOH 2OXHB 4B9FA 2NSQA 1PZBA 3WIIH 3UTQB 4HPHA 3UTSB 4HIXH 1F4AA 2NUPA 4AYID 4CVXA 2XQYG 4PRHD 2VDML 2QFPA 3V0IA 4U6YA 5F1KC 3MRCB 4EZJA 1UQSA 3KBEA 3EBHA 5D2LE 3MROB 2X4SA 3UG3A 1YEDA 4G9FE 1KC5H 1K72A 2ADJA 1PNCA 2EUZA 4L0YA 4UM9D 4CC4A 5CBEB 1BVLB 4D0DB 2CBQA 4ODUA 1NWOA 1Q9WB 2YAEA 3D05A 2YPVA 3VACA 1P6AB 3TCTA 3V0EA 3ALWA 5MEPB 3R06A 3VXNB 4ZTOL 1WBYB 4JO2H 1MJJA 1MCJA 1ZKAA 5JOFA 3T8VA 4J3XA 3LXUX 4DVBA 3D85D 1NCUA 3IE9A 4FQXC 5E8DH 2EECA 4ZO7A 2IMMA 4LO9A 4M5SA 5C08E 5INCA 1CR9L 1NL0H 2H2PD 1EZSA 3W0WE 4MAYA 1DDHA 3TPUB 2ENSA 1W0WA 3OLDA 4WWKB 4R7LA 5E00B 1ETJA 1R3IL 4NXSA 4G83A 5E4AA 3I6KA 3S3PA 1BECA 5AW8B 1PIGA 1G7JB 3ZL2A 4HEPG 3CMOH 3PWJB 4Y1TA 4FQ1L 1CXHA 1WCBA 1BSIA 5LGKA 1WC7B 3F5WA 4OQTA 4KQ4H 4PJCA 1PS3A 3FO0L 1NANI 2DQFA 5EUKA 5IMLB 3AM8A 1NCOA 5D8JL 2VDQB 4NO0B 4Q9QL 4KZEH 1AC0A 5EOCL 4YSAA 4I89A 2EYTB 2FQFA 3NCCB 2ENYA 3BZ4A 1KG0A 2QTEA 2RCSH 5IOKA 5DRNB 1VRSA 4U6VL 2DBLH 5AVVB 2OTUB 1VFAB 1NCGA 4ODWB 1OARH 3PFUA 4PJFB 5SV3A 2E4TA 2OMWB 2OJZH 2PYEE 2OMTB 1QSFB 5TDPA 1BAFH 4GW5A 3V52H 4PJEB 2PTTB 4AW4A 2E9GA 2VITA 2VLRE 5FDYA 2OZ4H 5JMOC 4R7XA 3VXTA 5F7EH 4KUZH 1I8KA 4XP6L 1H5BC 3TBTA 3BZFA 3FUIA 1BQSA 2Q6WB 5JXAH 4FFYH 1LO3H 1PJ9A 4WWOA 3WJMB 1KUMA 1R3LA 2R8SH 4Y4HD 2AITA 2D0HA 1FO0H 2V3EA 4HUKB 4HT1L 4X98B 4JGNA 1HH6B 4KFZC 4X98A 2O1AA 3MRLA 4G7VL 2DIJA 3CSTA 3QAZC 3CC5B 5ACLA 2D73A 3KXFB 2WUBH 4XP5L 3UJTL 2XPGB 2OL3H 4O02A 3D08A 1RUAL 3BP7A 1JD7A 1OTUD 3NTCL 4NM8L 1KN4L 3FSAA 5E00A 4H2CA 4PG9B 2V4LA 4EIUA 4Y4KA 4N6RA 1Q72L 4ACPA 2YGVA 1OP5H 1VFMA 4W93A 1E67A 4FEMA 3GMLB 4Y9CA 1UCBL 3B1TA 1DVFD 3CDFA 3TBVA 3RTQC 3RVVC 2HT3D 4WWID 5C0DB 2OMWA 2Y9RT 3MV7B 1UM6H 5DD1H 3BN3B 3ESOA 4KRNA 1HT6A 3WD5H 2DEWX 4BZ2A 4QTIL 3MOBH 4W9HC 1P4LB 3PWLA 2P42B 5L2JB 3T9WA 2XV0A 4WY7L 1XBDA 3C08L 1QI4A 2CK0H 3PJSA 2V3DA 3WHXB 1LP9B 2H0JA 2BVEA 2BSCA 3L3DA 35C8H 1N6UA 3QR1A 2VRQA 3QULA 2PCPA 4OF7A 5IROD 3Q06A 4CNIB 1CO1A 4XMUA 2IH8A 1GPOH 4AV4A 4YSOA 4CVXB 3MNWA 3MXVL 4BRVA 5LWYH 4MA7L 3CFIC 2AJ3A 4RWHA 5AOZA 1SXAA 3S35H 4G82A 5EZIL 2YAPA 1LK3H 1BOGB 3VMOA 1XSIA 1ZXKA 2YSSA 4E0RB 4BFIB 1OV8A 3BAEH 1U9KA 3L7EB 2F7PA 5BS0B 3JYBA 4LARH 3VXRB 2AJXL 2ATAA 3RWIB 5E6SB 3IKCA 4JRYA 2LLGA 5DRXB 1FNHA 1XEDA 2WY3B 3DRQB 5CZVL 4V2BA 5H37A 3TBWB 5KYNA 3GJFB 1RZKL 1QNIA 2JJUA 1IBZA 4LLUA 1SJVA 2J43A 2P47B 4DERA 4C54A 2OBGA 5C07A 4Q6KA 3DIVA 5DJCA 3VYPA 1H19A 4GFXA 1AD0A 3R06B 3VXNA 3TF4A 3QIBD 2FSEA 2Q2EB 1ZLVH 2Q8AH 3BRDA 3BVNA 5GJTH 3ZSSA 1RCYA 3LIZL 1AG6A 4XAKD 3ZRCC 1D5BB 1DVQA 4KQ3H 5HGAA 5D1QE 3PGDA 3B9KC 4YHZL 1OZTG 3KW7A 2F7OA 2EIBA 5HDLA 3ZQWA 4PUBH 3TWYA 4I2XE 3CFBB 4GXVL 4FZEL 4MVBC 2OTWB 5GS0L 1NC2A 4I0PD 1G0DA 2XG5B 2CDGA 2CXKA 1FAIL 1HHJB 2XWJA 5LG6A 1DN0B 3ESVF 1N5AA 3L6FA 1HEJC 3HNVL 4LZKA 5LXGL 5DQJB 2A6JB 1MRFH 1OGTA 5DK2A 4TQHA 3WKPA 1USZA 1LEIA 2G4EA 2WYZA 3EOBB 2ROXA 5DK2B 2YHGA 2DMCA 4NGHL 4B5ZA 4PJBB 5KSAA 4HH9B 2OJ1A 1I3RA 4HJGB 4EAEA 3FT4A 3RG1C 1S9WB 5IBTH 4DKFH 1IC7L 1A7RL 1EIBA 1QFWL 3AQDA 4P2QE 1P1ZA 2GUOB 3RL2B 2XG5A 3FAWA 3GIZH 4HXAH 1JF6A 2OMXB 3QH3B 2WCPA 2WXQA 2YRPA 5AW4B 4XO9A 4UAHA 4I4WA 1KOAA 3ZW3A 1P4BL 5D6CA 4M56A 4OSUH 5CHNB 2GBTA 5IV2A 1GAFH 4MNGE 3ROOA 3RURA 1A9BB 2D7NA 3EJQA 4NO2A 4JPIA 5D4HA 5TQ2H 4L1HA 1F13A 1P2CA 1GYVA 4AV0A 5T3ZD 3QEGL 4CADB 5CEXA 1MW1A 2VR3A 3V10A 3FPYA 1RQ5A 3FTZA 1F2QA 3OZLA 1CDUA 3LQZB 3L3JA 4PV9B 3DX8A 5B7FA 2GSIA 3L4YA 1SHXA 3LTVA 2XY1A 1HWGB 1MRCL 5EOQH 3DLQR 3PWUB 1CE6A 3QUMA 4Z7OE 3EBGA 3OSKA 4ZNEE 1N67A 1FC2D 2MHAB 4FA6A 5HYSG 3EGDB 4BGLA 3LPWA 4MLIA 5DMIL 3WI9A 1N12A 1MCIA 3MLUL 3TV8A 2BZDA 4KKBC 1G9NL 1J8KA 5IK3B 4F9PA 1XIWB 5C0IA 3F7LA 3VD2A 5DHMC 5A6IA 2G9HB 2JQZA 3US0A 3WJJA 4CN4A 3K6OA 1EO8L 3H55A 4HCFA 3EJYD 3BVXA 4FJYA 3Q48A 3U0WL 5I6XC 4J3SA 1S9VA 3RY6C 3V0FA 3UBXA 5EFIA 4U1JB 3RX5A 4AGMA 1KSRA 2E5EA 4P2OC 4Z7WA 4LHUA 5GRZA 4HCRL 3JTSB 4FLHA 3WSQL 4OF6A 5MERA 4QHMB 5BV7C 2BIMA 1XSJA 3SDXA 3UAEA 4HCIA 1ECZA 4NJ9H 4UT7L 1OSYA 5BXFB 3EAKA 2Z7UA 1N0XL 4U6VH 3NVQA 2EEXA 1JGEA 2F7QA 4ADJA 1CPUA 4HHGA 5D7JD 5I1EL 5EZOH 1LILA 4RZKA 3MUGA 4TNWF 3EOAB 4KX9A 4YHMH 1GC1C 1IC5H 3K0YA 5E2UL 4YDZA 1N18A 3V52L 3DOSB 3TZVB 2FH8A 4YGVB 2AV1B 3MGOA 3LKRA 4XOAA 2P8MA 4JRXD 5F6IC 2C3VA 3GI8L 4KUZL 4XP6H 3DGGA 4MHHI 3IGAA 4LKCA 1QQDA 4DUVA 4YQXH 5LO7A 5EO9A 4FXKC 5T5FL 4XP5H 3L3IA 2NQDA 3ELAT 1FIGL 3UJTH 2FIRT 2QHRL 1FNGB 3QNZB 4PVNA 2KLTA 4NNXB 4LVNC 3A21A 3OKDB 2EIMB 3Q1SL 3HR5B 1R3LB 2CWRA 1C7TA 1T6BX 3EFDL 4N1EA 2DI8A 3RUGB 2F5AH 4U6XB 2QADB 2QQNH 2K3TA 2P8MB 1FN4A 4KVNH 5DHVA 2R1WB 3RGVA 3HCVA 4PB0H 4YBQD 3MJ9H 3FHQA 1CICA 3H6JA 3MRPA 4IJ3C 4U3SB 3G6JF 5D72L 4EZLA 3CDZA 4KROD 3N50A 4MNQE 4FMKA 5DJ8B 5EIQA 1MFDH 5I0YA 2M83A 1Z6JT 1ZIBA 3KLAB 4YMPA 3I6SA 1PJWA 1YEGL 4XAWL 1E43A 3TVMB 3T0EC 1R24B 1NCWL 2UWEF 2ZNXA 5AB9A 1PAZA 1GOFA 1YEIL 3B3BA 4OI9A 5E08H 1LTXA 2IH3A 4F1ZA 3VD3A 2Z1KA 4NN7B 4O58L 3WEAA 3RZCA 4FI8A 1D5RA 5BMFL 2UZIH 3BVTA 5I9QB 2CJUH 4DW2H 4PJ7B 1JZ7A 5DTFA 2BFVH 4AGLA 4EQ2A 3MNVB 2JQAA 1SJMA 5AW6B 3D39E 4EI5C 3L2MA 4M3HA 4GRLA 3WFHA 4W6XB 3K72B 4ODVH 1J0YA 1OPOA 1T1WB 1UKTA 3OF6D 4PJ7E 1QWUA 3WGVB 1IGFH 2WOBA 1Y6NR 2VT0A 4QIRA 3D48R 2MOGA 4KKAD 3EYFB 3T77B 3VFWA 1NEZG 1ZA6B 4OKVB 1S9XB 2MNUA 3ULVD 5BRZA 1R46A 2ITEA 3LVTA 3TPUA 4AITA 2SODB 1DL7H 1T66C 2D7PA 2VDKL 1SVZA 2BSED 3NN8A 4H8HA 3S36L 3V5DB 2XRAL 3OKLB 1GGTA 5JO5B 3MV8B 3V5HB 5HVHC 5JMRA 3VFPA 3SZKC 2AAAA 4Y4HC 2Q8AL 4JHUA 2QPSA 4FQ1H 4HX1A 1IT9L 5GZOD 4XOCA 1LO4L 1XGQA 1IAKA 1QACA 3N04A 4GW1A 4YXHH 3TFKD 1HIML 5SWZD 3CDYA 3ETSA 4M61B 3KPNA 3ORJA 5I1HL 2XXGA 2H3KA 1BZ7A 1MJ8H 5LNEA 3PV6A 3U46B 1E3XA 5EOCH 4PGJA 1JZ5A 2E9IA 1C8PA 1S7QA 4NZDA 3MRNA 4AV5A 4JHAH 4NUJB 3LH9A 2X4RB 2VDLB 3BAYA 5DVMA 2AQPA 1NTDA 2FGWL 3BSHA 3HBGA 4R5XA 5F8RC 1T03H 3MRCA 4LAQL 3DHJA 5HHNB 2X4OA 1R3KB 1I9IL 4PTUB 4G8IA 1RH8A 4KVPA 5F97E 5IV2B 4NKIL 1MCHA 5IMMA 4JRYD 4HJUA 3EW3B 2WTPA 4J4PA 4L0PB 4P2RB 3WJJC 3VM5A 2IPKA 1HHGA 4RVBA 2C5DC 1NCJA 3QFJA 4HPYH 4QMEA 4FFYA 1JXGA 4I9XA 4LEOB 2Q9OA 3SOTA 1J0IA 3TYFA 2EVHA 1QATA 5I8KH 1ZGLM 1AFVH 1RVFH 4NBXB 1O7SA 3UAJD 2BNQB 3NA4A 4ZMNA 3VFUB 3DTXA 5HVFB 1MAML 2DQDL 3C5SA 2G5UA 3LB6C 3DTXB 2Q87A 2BSTA 4F57H 2EDDA 1T7WA 5F93C 2D3NA 4BSVB 4CVWA 5AAMA 1BBDH 3R1GH 3KGUA 1E3ZA 1K5NB 3CU1A 5DO2C 3QYMA 2FLBT 2GFBA 1N8ZA 3L3HB 3M1BA 3HLKA 1PY9A 4HJSA 5I6KA 2CKBB 1Z66A 2ZAGA 2DOCA 3VGAB 2W88A 4L1DA 4PV1C 1G7QB 3ZHDA 5EIIG 3C5ZA 4FQJL 2KMWA 4LB8A 3II3A 5CN2A 3UROR 2PPFA 1TZOA 2XUWA 5AW1B 3S48A 2ZIDA 2K6WA 2J6EL 4LLVB 4U1SB 3B2XA 2VQ1A 4DOHE 2ZAHA 1U8CB 4NKDA 2ZYIA 4OFKA 4YHLL 3OGCB 3PYCA 2C7FA 5FGCB 5AVYB 5FUCE 3LRMA 4BK4A 4PJHE 5C70A 4LVEA 4P23A 1MIML 2AEIT 4OD2B 2B59A 5M95B 7PCYA 1ET8A 1T2QL 2V8LA 3RWJA 4BFRA 4GMSH 3T0WA 4IMLB 3MV01 3F6LA 4KXDA 4WEMB 1AS8A 4XAKE 3MOBL 4RFNC 8FABA 3QG7H 1KXQE 1SBBA 4FTDA 1MWAB 2XFXA 3RY4A 3S8FB 4KTGA 4NIYE 1P7QD 2ZWNA 3U9UA 5HYSB 5DUPL 3IN0A 5DC9B 4GEJA 1G9MH 2VO8A 4OLWL 1F58L 3KPOB 5L9DL 3FB8B 4ZTPH 1U3HA 4TVUA 5EDSA 3HE6D 3NSDA 1E9QB 1GPOL 1U8OA 3E8UH 3QRLA 3EKCA 1CFSB 3NGBC 4OZHB 3VMNA 1U58A 5F8QC 4ANKA 1KTJA 2CR3A 5HVHB 4XPHH 5FUCC 4JVWA 2P48B 5DQDL 4NRYB 4NPKA 4DKEL 1DJIA 5I30H 3L3DB 3V55A 4RDQG 2N01B 2Z64C 3LV3B 4HXBL 4PJGE 2AKRB 1D9KB 4K2UH 4PWHA 1L0YA 3ECQA 3O0RL 3D2UD 5D4JA 5EC2A 1AGDA 2QQKL 1XAKA 1JNNH 2YUWA 2C9VA 2NT0A 2AFNA 3MNVA 1DQML 3ZYZA 3AADB 3HVDA 4OTXH 2VXQH 1BF8A 1O6SA 1TQVA 4FG0A 1JN6B 2BXYA 1ZLUK 1W16A 4BQBA 4MNQA 3PP3K 1PZDA 3P4NB 2V7NA 3ZBMA 4NENA 4WFGE 4HK0B 3INUL 2FAUA 4GKNA 4WFFE 5IB3B 2IQAA 4P07A 4WW1B 4GAYB 3IGUA 3HN8A 5DZJA 4JW3A 4Q9CA 3B43A 5HJ3A 2PTUA 3IETB 4NHCL 5I1EH 4PJCE 1IQWH 3LQMA 5J6GA 1A66A 3CDZB 2A3TA 4I8DA 5C9KA 2EUWA 4KOBA 1X5LA 4AQ1A 4KVCH 1CLYL 5K9JL 4PJGF 1FL6A 2XBDA 4QI3A 1WBXB 4PPTA 1J5OH 2FX9L 1A3LL 1R0AH 1QLEB 3RWDB 4QAMB 4TMPA 2NRDA 4GI8A 5EBMB 2ORBL 1LD9B 1TVHB 3BQUD 1S9YB 3Q8FA 4HWNA 2O4EA 2X4QA 3FB5A 4Z7AA 4LCYA 5HPMB 3S88L 2EDJA 1AQDB 4RBPK 1INQB 3FFDA 4QRSA 4EN2A 5AOJA 3D12B 4M00A 1JJUA 2X2JA 3LKQB 2FNWA 4ELKB 3FN9A 3QNZA 2P5WB 3IFNL 3QXUA 4S1DD 3V9EA 1K3ZA 1X4ZA 2VZOA 4K71C 3LN5B 4RFOH 4PJ9A 1Y18B 1WG3A 5ADPL 1D5IH 2GJ6A 3F6JA 4JKWA 3MLYH 3RVWC 3TA3D 3VXQB 5B8CA 1AGBB 1G7IA 4LQ1A 4WU5B 4QCIB 4LU5L 3MYJA 3O6KL 2DJSA 2XU9A 1PSKL 2DLTA 4DAGH 1CD9B 3FRPB 4MQXD 5CWSA 4QT5B 4N6QA 4Y5XC 3S36X 4MJIA 3QQXA 4APQC 4OI7A 2KBGA 2P80D 2CJUL 1JS4A 4M02A 2H47C 3A6BL 2VM3A 3TEYA 2Y5TB 1A7NH 1NAML 2G75A 2IXQB 3V4PH 4H8UA 2H1PL 5HGBB 4LCWD 4XMLH 5I8EB 3DX4A 2F1AA 2OAAA 3QEGH 4ZW8A 2F54A 1BYPA 2V3FA 3S37X 2HJLA 3ZIYA 3CX5J 3RL1B 1UZ6F 2X4NB 3D18B 1BWMA 4MNGA 3P9LA 3OKYA 1AI1H 2ZCLH 3ATEA 1CD1A 5E5UB 2F68X 4UNTA 3DECA 4W70A 2HKHH 4JRXE 2DBJA 3G5XB 4UAOB 2DPKA 3E2HC 1G7HA 3PWJA 3MODH 4HPOL 2BP8A 5F9JB 1G7JA 3NP3A 3QO0A 4H0IA 2P8LB 3L54A 3QCUH 4F33B 1FVEA 1KJVA 1GGCH 4OJAA 4GLRI 5IMOA 2CU9A 5DDHB 1RUPH 4OCXH 3S2AA 5INCB 3CSGA 5GZNA 1QFUH 5DUBA 2DQUH 4JKNA 3FU9A 5IJKC 3VGBA 3IXTA 5IIEB 2V9RA 3BYTA 3ZTCC 4HA1A 5D7JB 1CDGA 2UXVA 4G8GE 3WIHH 4BA8A 5EOTB 3SJVE 1Q9WA 1FGVL 1K4DB 4FTVA 5D5ME 1KGXA 1SLXA 5K9QI 3IDMB 4OCRH 4JGUA 3LEXB 1SDDA 1I9IH 1I1RA 4QR7A 4X5QA 4P9MH 4BIKA 1OWWA 1GSMA 5FB8B 3IBEA 2VLLB 2XTSA 4RWYH 4FFZA 4K73A 2ESVD 1UQSB 1IGTB 5FA3B 3VXUD 1X5XA 1QBAA 4FFVC 4UTAL 3DWTA 5DEFB 4OAWB 3LNIA 3P4OA 4BUHA 4KXBA 1CFVL 1ZTXL 4TNFA 3ZN6A 1TTUA 3QFDA 1A6ZB 1A22B 5ICUA 3FB6B 3J7HA 4LASH 1EHXA 2YS4A 3OL2A 2NNFA 3UTSA 1NBYA 3DUHA 4YEFA 4CW1A 2DYSB 1SVBA 1SQ2N 1T2XA 2WBJB 1GC1H 5AL8A 2MNWA 3BSZL 4YE4L 4B6ZA 3OJVC 2VMCA 4QRQB 4FLOA 5EUOB 5GRWA 3EGSA 4W4OA 1FZOA 5CP7B 5CFAA 4HS3B 2ADGA 4HK3J 3SODB 1GS7A 2UVEA 4GBXA 4UV4L 1QSEA 1RIVL 3LN4B 2ZOKB 1FZKA 2QVMA 5DZNA 1S78C 2F61A 3CTTA 4NZRH 1XXDC 3C6EA 2Y1VA 2XWDA 1ZVNA 1OT1A 1W72A 3HI6L 4X50A 4JFPB 4YL9A 2BJML 4CKQA 4RBPH 3GUTA 4P57B 3ZXAC 3ARGA 1MIMH 4YHOH 4M62L 5E94B 4L4TA 3FO9A 2OR7A 3I3EA 3CVIL 4IKKA 4R2GD 4MXVE 3GMMB 4G71B 2EYRB 3WXWL 2VXVL 3MRFA 2XWBA 5FB8A 1URLA 5E56A 2C4FU 3SO5A 5KTEL 1J1PL 1U8HB 3UTZB 5I6NA 4KNUA 1HQ4B 4JFDB 1DBKH 5FR3A 1QPKA 2YA1A 3OAYK 1T04A 1DBJH 5IWLA 2CE6A 2BS8A 3MJ8A 5EOTA 3H9HA 5C0GB 5J13C 4QXVA 3REVB 1A4KA 2EYSA 2J2ZA 4LPVA 4LPCA 4Q6IB 4JRYE 1KDJA 4J1UA 1S8DB 2ZUWA 3W5MA 2IH9A 3MV8D 3BUBA 2RFXB 1PCSA 4B9JA 2EUXA 1KTLA 1QHPA 2E9BA 5ERWA 2YD0A 5CP7A 2ZE0A 3U83A 3CQFA 3QNYB 1G9EA 2ZUXA 3FN0H 3U1PA 3BH4A 1FNFA 2FEJA 1AD9A 4XB3A 3WHE0 2JTDA 1CGWA 1YEFL 5B7MA 3ENEA 5KJ7E 2BP8B 2NUTA 1F90H 4QYAA 3PL6B 1MCOH 1CGYA 2ODIA 3K5SA 4KJWD 4PBDA 1QRNE 3GMQB 3GXMA 4ZODA 4Y5XB 2FYYB 4N0CC 4N1HB 5CIPH 4XGZB 2MTPA 1JI1A 3FULA 2FQEA 4F7CB 3LSOA 4B9CA 3CHOA 4XC3L 4K23H 4N0UA 1ZVSA 3BPNC 2G3NA 3K4ZA 1YN7B 3Q1EA 4HMCA 2B1AH 3ESMA 3L4UA 4OCYL 4PTTB 3WENA 3W9EB 1KN2L 1U3YA 3VH8B 2W0FA 2UV3A 2ZUSA 1AO7B 1B9ZA 1MELA 1KTRL 2VLJE 4KGLA 4E41D 1PBYA 1E4KA 5LG1A 3GSUB 2GB2A 1TUPA 1UEMA 2IGLA 4ODXA 4GUPA 2WBKA 4LPTA 3Q2WA 3UPAA 4EPSA 1OKEA 2VLJA 5DLML 3V4VL 3GMPB 4DQAA 4N0CD 4WCYL 3DUUB 2R2HB 4BZYA 1G7IB 1ZVHA 4PY8I 4F15B 5AVXB 3ZKND 2DWEB 1S7SA 1MH5A 4TVPL 2B20A 4YUEH 3FN3A 3WTYA 4IQHA 2D9QB 4RSYA 1S2EA 5K93A 2IADA 1H3UA 3O81A 2ARJB 4MRCA 2PTVA 5IGXL 3BGMA 2D31A 2B4CL 1INQA 2DJUA 4KOCA 5F9JA 2Q8BL 1QSED 4PJ5E 3QUGA 2LHAA 1MFEL 5HY9B 1ACYH 2K78A 4HF5L 4K9JA 2WVVA 3LEVL 3CBRA 2P3YA 4O9HH 5T3XE 2LFEA 3H8NA 3KEDA 1JXFA 4PREA 4OZIE 2VXTL 3VFGH 4I18C 3OC5A 3QIWC 1T22A 1H3VA 2OMVB 4TXVB 5DUJA 1ROWA 3MA7A 1DANT 2V5TA 3OJMB 4OGZA 5JW5A 3WJMA 3IFNH 1F1GA 1QOKA 3X3GH 5FLVA 3T3MF 1DQQB 5T1MB 5CJXA 5KYYA 4XN7A 1GTNA 1XCQA 2XTJE 4GKNB 2VR4A 1TVBA 4DVRL 1XCXA 3LKNA 3M7FB 4FI7A 2B2XH 4TQEH 3P9MB 4NQEB 4MYPA 2R7EA 4ONGH 5HJDA 1T1YB 5EC1A 3T2NH 1OOWA 3JSSA 4BUGA 1S5HB 2MH4A 1AYOA 1JAEA 2ED6A 1TMQA 2EKSB 4KFMA 4WDIA 2F6AA 1UG9A 4FTVD 3FOMB 4XT1C 4HEPA 3FUMA 4TYUA 3LQAH 1LO5B 5DRZB 4AIEA 5D9SB 3N9GL 5DMJB 3E38A 2DM4A 5TTRA 2IWEA 2X5PA 1KGCD 1F4XL 3AXLB 5TH2B 4CGTA 2XWTB 2GW5A 1J8HB 1N7ML 5FGBA 3OJDB 4Z76B 2R56L 2FEDD 1SDYA 1NAKH 3PQYB 2P5EA 4TVSa 4GKOA 4N2CA 3PABB 4AVIA 4MS8C 1AHWA 2WBXA 3DUSA 5GRUH 3CFKA 4R97B 5F7KC 2HJFB 5A2LH 5D4IA 3O2VH 1TYEB 1S7SB 1GGCL 4PAZA 1N26A 1IC4L 4N9GA 1RJZA 2Q76A 2J5WA 4JQXC 2NX5D 5D7SL 2PXYC 4XVUD 4WKZB 1G1YA 4HUVA 1W80A 2GPZA 2AEQL 1IGYA 3GRBA 5C6TH 2BXZA 1FRGL 3BE1H 4Q58C 4Y1AD 1T83C 3ZDYF 3IS1X 2AK4B 4FZEH 1Y6KR 3D07A 1S7RA 3JV4A 3NIDE 5IB5B 2EIZA 3FH5A 3H4FA 2YC1A 4M7ZC 1R1CA 1KIUB 1SYVA 4Y4HB 1MFBH 2X1OA 5I5IA 1T20B 5DFTA 4NPYA 5E4OA 1DJWA 1QMUA 1T6VN 1FO0A 1OARL 1Z7JA 4LOUD 3V9CA 4AEEA 1JZ3A 4MD5B 4MHHG 1UVQA 3UX9B 4JN2B 2IPUG 2FZ3B 2KHAA 4NWTH 4XGZA 5I26A 5KUMA 1ORSB 3OSVA 4PS3A 2GTWA 5AOIA 2XXMB 3T09A 1I7UA 3I9GH 4XVJH 5J89A 2AERT 2DIBA 4U6YB 3FOLA 3M1BB 5DO2D 5JHMA 4UV4H 3OR6B 3PL6C 5JNYB 3B9KB 3II2A 1NC2D 3IDUA 4NT6A 4R5TA 2OZ4A 3S96A 3MX0B 2EIKB 3HMWL 3VWKA 3W11C 2IDCA 2R4RL 4ABUA 4YE4H 5AVSB 2Y1YA 4U05A 3DHPA 2AS5M 2IH1A 4P5TA 1M05A 2O61A 3HE7A 4LGSB 4ZUWA 3ULAB 3N1FC 4PRPE 1ADQA 25C8L 2J2ZB 5C0CE 4GAFB 2I9TB 1CCZA 4H26A 3QQ9C 4EE2A 1T7YA 2FR4B 4OD1H 4PW3A 2ZXWB 1NIBA 5FYKE 4B7LA 4F1SA 1EGJA 4RDBA 3WKQA 1TJGL 1PDKA 3N44F 5D70L 1HSBB 4Y19A 1WHOA 3E6FA 4IRJA 4JGMA 3EJPA 1XGRA 4TNEA 1NGYA 4IEFA 4P46B 5HYFA 3AWFA 3ILQC 5FUOH 2OA9A 3K2UH 1MXDA 4OM0L 3RUGF 1CE1L 4BQ8A 4A63A 3L4WA 1L9NA 1A2YA 2WJ5A 3CCHB 4PJ5B 4U1MA 3SO3B 5DVKA 1AKPA 2P7TB 2FR4A 1ND0B 3CVHH 4M29A 1FI8C 4R96B 4JFPA 4MQ7B 4M61A 2EKJA 3QJFB 1BW8A 1WS7A 2W81C 3J07A 1J5CA 3PXJA 1VZGA 1OAQH 4ZAKC 3APMA 5FXCH 1PAMA 3D33A 1UATA 3V0DA 1E3FA 1QAWA 2KZKA 3CXFA 2Z35A 3S96B 3KAAA 5AW3B 3D69A 4JO3H 5TDOB 3T65A 3F7VA 2PPAA 1AGFB 2QGDA 3QARA 2NY1C 1QBMH 4NEHB 1MVUB 3T1FB 1YPZA 4PHXA 2AXWA 4F7MB 4MQ7A 2Y2WA 1YN6A 1ND0A 4AMXA 1TZGH 3O3BB 4Y2NA 32C2B 4LF3A 5ANHA 2E76C 2MRYA 3PWNB 3WE1A 2UUDH 4UT9L 3MLWL 2CO4A 5EU5A 1NKOA 3MJWA 4OAWA 1UJ3B 3BUYA 3TIEA 1WVZA 1ETA1 1KV7A 3FRUB 4JY5L 3E6FB 4IRJB 4JFED 2DYPA 4G3YL 2XYCA 3TEUA 1E5UI 2Y4SA 4ELME 4NUJA 3AW5A 2FQDA 5C0EB 4DWHA 3GZKA 1FG9C 1EEZA 1HAWA 1PPIA 4XBEL 3X11A 5BW7C 3SBQA 3DX2A 1ILSA 2I9TA 3WG7B 1QVOA 5J3HC 3HG2A 2BDNH 4LLAA 3QE5A 1XGQB 4AQEA 3ULUC 2A7BA 3OKKB 2IGTA 2X4PB 2ZKMX 3EH3B 4PYGA 4HLJA 3CK0L 1YMHB 1MOEA 2W9EH 4K3HA 5D7IA 2UYLA 2P4AB 1XGTB 3KVDD 2O93L 4TTGA 1GZQB 1FHGA 2QELA 1HKLH 1TCMA 1EJ6A 1DCEA 2X4UA 2R1WA 3RGVB 3U1SL 1JGVL 3KVPA 4QKXB 3S35X 2W5PA 3FOLB 1QKZL 1TKWA 5IJDC 2XKNB 2NY6C 1G7MB 2ZNWA 3DA0A 2QGBA 3FS9A 2WLLB 4ICWA 2UXFA 4IU3B 1KIQA 2HT4C 3O4LB 3G6JB 1BM7A 4AEIH 3K72A 5CLWA 1HDMB 5CLTA 5CKAA 3IMTA 3ARSA 1PNDA 1NCTA 5EU6B 2QGEA 2IAMC 2A6IB 3FTGB 2HVBA 1UUSA 3ABGA 2A0LC 1Z9SB 3SZ6A 3Q7JA 1FL5B 4M4RA 4CSPA 1KJ2H 3BYYA 1NGZB 2QR0A 1BQUA 2CUMA 3MRJA 1OP5K 3T8XB 4A7UA 4UIKL 2HFGL 4BFEA 1UT2A 5F2FA 3L3OA 2VDRL 2XWCA 3EJCA 1IKFH 3OHMB 1HYSC 2XWZA 4E5XG 5FO9A 2ZG1A 3L08A 4E36A 2BIIA 4Z1PA 3MYJB 4JBSA 3L1FA 2X4TB 2FRGP 3JT0A 4G6AD 4GQZA 4QOKD 1UB6B 4H2AA 3THMH 4TUOA 3ZTJH 4TUKL 2A38A 3HCVB 2HRHA 4AQ8C 4ZJ9A 1OAZL 3OPZH 1JWMB 2G30A 2JE8A 2ZSWB 3VB9A 3NZSA 4G72B 4PWFA 3H2WA 5LGJA 4RFEA 5L8LB 4KQ0A 3PQYA 5JHLH 1MXGA 3LQAL 3NIGE 1EAJA 1ACCA 4CDGC 5HHME 5AB1A 1MLCA 1G7MA 3NCJL 5EN2A 2BSEA 1LD9A 1CB4A 2GT9B 3HNSL 5K33A 4BCZA 2J71A 4DCQA 2YBRA 4NKOB 2BW5A 4S11A 3UERA 3TJEL 3VXPA 3BGAA 1F2XK 1GS6X 1KBBA 1OAYL 3IDIB 4JPSA 3QJZA 5HHQB 4PGDA 4ZXBD 3RB5A 1X7QB 3PFQA 1XB8A 1EO8H 3A6CH 4QF1A 3L5WA 5AEAA 3Q01A 3I6GB 5ANMB 1XSOA 2P80A 4OUUB 4TNGA 4UTBA 4CDHA 1TTCA 3CZNA 2HKAA 2OK0H 1VLXA 1TQUA 2F53E 2NZ9C 2V17H 5T5NG 1XGPB 4NQSA 1KJ3H 1BLNA 1UXWB 1NPNA 4OF8A 2Z31C 4MD0B 4KRPB 5T1DH 4JHZA 4UILL 5CJ8A 1OF2B 1R5VB 3AT9A 4QHMA 3WYRA 3QCVH 4IKJA 5SWSE 5T1KA 4UT7H 2R0WH 3GHBH 3MMEA 4XP1H 3ZUNC 1RD6A 4G9DB 4HIJA 4OCYH 2VSCA 1LEKA 3A4FA 4ZO9A 1PMYA 2FX8H 2NY3C 3O41B 1LO2L 1U4FA 5IQLA 1GGBH 3VSQA 2R2EB 4X6DA 3JWDC 1QI5A 1QBBA 2DDQL 2DQGH 3C87A 4Y16A 3ROOB 2CKNA 1MUJA 4XO8A 3ZHKA 2WNXA 1U58B 2YGPA 3L9EA 2XA8L 3WIAA 1HHHB 3BUPA 3UYPA 2H2PC 1YCSA 4S1SH 4YSDA 3LNFA 5DHEA 3SGJA 1PZ5A 2PF6A 4D2NA 3FT4B 4NRZA 2CBMA 4W9ZA 4JO1L 4C56B 4NFBA 4M6OH 5C0IB 4G7YL 2VUKA 5D7LB 1SBSH 3SQBB 4FL4B 2HP4A 3QUXB 2R39A 2ZXCA 2PPDA 5DQJA 2ED8A 4ODTH 4DP9X 2WTOA 1RLWA 1GR7A 1T1XB 1A6WL 3AREB 1Q9LB 2WBJC 1MFNA 3ZE2B 2KH2B 4FHJA 5CIPA 5A43C 2NY5H 4L9LC 3DHUA 3FO1B 1OAJA 4F7EA 4PTTA 3ZE2F 3BH9A 1X6NA 2A73A 3OB0H 5B39B 4MVBD 5KW9H 2XZAL 4TL5A 2ZXBA 3MR9B 1H3PH 5CNHA 2MWCA 1MZYA 5IB2B 3P4MA 1T1ZA 5F3BA 3QZPA 3GXDA 2WUCL 4L8CA 2UXTA 2VDOL 3EYUL 1EXUA 3BMWA 5SX5H 4R8WH 2YO3A 1OW0A 3OLGA 4OM0H 5IVXF 3ZIMA 1L6PA 3O2DL 4YX2H 1M2VA 5F9AC 2F53B 4U7KA 3QIUD 4KY1L 3BZEA 2A4EA 4DKTA 4FQ2L 2IAND 4DPCX 4KJQD 5DMKA 5I66A 1A6VH 2IPTH 3WN5A 3BCFA 4GMTL 1MEXH 4UB0L 1IX2A 1YY8B 3KBFA 4OV6F 1LE9A 3AT0A 4OLVL 5KSAB 1PF3A 2XG4B 4XN8A 3BPNB 5FYLL 3P73A 4IS6A 5F7WC 5SWZB 1CIDA 4ADGA 4Q6IA 2W9DL 4X9HA 1AXTH 2EC9U 3JTBA 1QFPA 4GT7A 1M2VB 4L1TA 3RTLA 4PRHA 1N7MH 2J1XA 4G6JH 5BS0E 1T3FA 1FPTH 1KJMB 1QUNB 3MFGB 3QNFA 4I9WD 4PGBB 3S98A 5LUMA 4JN2A 1INDH 5BS0D 4TVPE 4PLOB 3OZ9L 3VX0A 2DWDA 4BH8A 3GBDA 1EJOH 4TVPD 1RK1A 4FP8H 1D7FA 1NOAA 1BFVL 1TOXA 3WKNA 1E8WA 5IFJA 1MNUL 3C60A 2A5UA 3LEXA 1VKXA 4WJG3 4XVTL 1AQKL 5EO1A 3BN9D 3KLKA 4A6YL 3HHSA 3P0YL 1DVSA 2NSXA 1BZ7B 4JPQA 3MBWB 2E27H 1ZXQA 2FJUB 5ICXB 2R8SL 2ZCKH 1O7DE 3FRPG 3ECUA 2WVTA 2Z9TA 3M07A 1FZKB 2ZOKA 3GMLA 1LNUB 1P53A 2XJKA 4HWEL 3RHWF 1JYNA 5HD8D 4U2YA 1IGCL 1S3RA 2JCCA 1S7XA 2R29L 3GSXB 4F20A 5KYUB 5A3ID 2NXZD 2YLKA 4WFEE 3MOAH 2N0KA 5ANME 5AVRB 4RFNB 3OHXB 2Z8WC 3WTXA 4FGMA 1J1OH 1BOGA 1YC8A 5IHZA 4LDCA 4GXUN 1XH2A 4K3JH 3KDPB 3P4OB 4FNLH 1TEGA 2ICWJ 3FSZA 4Y4FB 4DZ8B 5MI0C 3QUXC 2ZF8A 4MXVF 4NN6C 2RCSL 3CDGB 1BQHB 1YRKA 2DQDH 5C3TA 4IU2A 3RA7L 1EBAA 4PHZA 4L0ZA 3BESR 6CGTA 2QGCA 3H3PL 3EBAA 1O9VA 3VI3E 2VDKB 3P3TA 3QI9A 3PJSB 4Y0GA 3MV9B 1I8KB 5JXEA 2HRPH 4YSEA 1JXJA 2H41A 5T1LD 1YLBB 3EJTA 4PS8A 4BJLA 1Y1DA 4POYA 3BWAA 3MLZL 1DE4A 3G9VA 2F74A 4JJOA 5FM8A 4FAAB 4OGYL 5CWSB 2IQ9L 1AGCB 4L4VA 1D3CA 5IG7A 5IB4A 4H20H 1C12B 3LZRA 4XOBA 2AK1H 3LDBC 1FBIH 2Q76B 4OLUH 4ODWA 3ULVC 1HXMA 1P7KB 1ZT1B 1ZSDA 3HAEB 4I5BB 5CCKH 3FT1A 2J20A 5D2LA 4MS8D 3B6SA 3SGJC 4POUB 5IMOB 3NACH 1ZANH 1KJVB 3H42H 5HI5D 2GJPA 2D3LA 4G8GA 4WI5A 2XPGA 3PABA 4LCYB 3I3DA 4XNXL 2QKIC 3MSPA 4QUOA 2WZPA 5KVDE 1Q8MA 2FK9A 2A6DA 1S78D 1OHQA 2OL3L 4XCCH 1IZKA 5T1KD 1FFTB 4FF9A 4I77H 4RDQF 1UD5A 5D2NB 1JPSL 1NEZA 2APTA 4M7ZB 4PBXA 3C9NA 2J1YA 5KN5B 1A14H 2J3SA 5EG6C 3T0ED 3RPIA 2C9XA 4M8VA 4LLWB 4L1BA 5E7BA 1S5HA 3ECBB 3PWVB 1BXVA 1YNKL 4ODXB 4TUUA 2EDHA 3LZQA 3P4NA 4CC1A 1LDPL 5FFOA 1T0OA 2HTLD 4R4ND 1S7TB 2FD6L 4NQXA 3ABLB 5E5RB 3O2WH 2BIHA 3QDGD 5TJWK 5ALBH 4N2AA 5E5MA 4JY6B 2LU4A 4J3UA 4AW7A 4FQIH 2I5YL 5EBLB 3RGVD 4FABL 2GJZB 2X2YA 4NQCD 3STBA 4K5OA 3L1EA 2EXWD 5ISZB 2TRYA 2NYZA 3WNNA 5KSAC 2A6DB 1N59B 1H15B 1B9KA 1FLRH 3U4BH 1OP3H 3ZTNH 1PD6A 5I6XB 1T66D 3LX9A 3INUH 3NSYA 4EI6A 3L5IA 4I1NB 2FWLB 3PL6A 4PRPD 4PIBA 5AZ2H 2D31B 1BD2D 1HXYB 2H7WA 2IADB 1MFAH 1EERB 3UTQA 1QABA 2HTKD 2JCCB 4AQ1B 4WEBL 1AP2B 1I1AC 3FFOA 4WHYG 2ZP9A 3IFOB 2QADC 2VXQA 3E2HB 2YUVA 3NJNA 2WAQA 3E9TA 2XZCH 5DWUL 1JYXA 2X38A 5ALCH 1CF8H 1KPRA 2R23A 4M48L 5HI3D 5DK3A 4DZBA 2Y07H 2DD8H 3GLEA 3VVWA 5HHPB 1E4WH 5I2IB 3WFDH 1P5UC 3MGTB 1OO2A 2XTLA 3JZ7A 2ZQKA 3UEZA 3RDTC 4OZGB 4PP1C 1CGVA 3KZ8A 1CR9H 2QVFB 1NBVH 1OD9A 3ZHFA 2DEXX 5C09D 1CXIA 3OWRA 4JFDA 1VGEH 4J6RH 5I23A 2XSKA 5DJ2A 1S46A 4RMUA 3CIAA 4F58H 4ETQA 4X9FA 3OGCA 4JJHA 5E4EC 3ASNB 3UAAA 1AIZA 1EUTA 1VEPA 4HGMA 5F6IB 4RRPG 2XZAH 4MKMA 2X1WL 5FUZL 3QUZC 2MCPL 2XA3A 3EHBB 1UWYA 5DC2A 1ZK5A 5B4MD 4IJTA 3TVMD 2G2NA 4PVLA 2ADFH 3AG2B 5JIKA 1JYWA 1DJXA 1QWNA 1W72B 5FYKH 4KK5D 1N8ZB 1TO5A 1KENH 5F1SA 1K9TA 1LP9F 1YEKL 2VDNB 3HS0C 1Q0XL 4ZMOA 1MRFL 1XWVA 4Z7OF 1K4CA 4KKRA 1T5WB 2IV9A 4BQ9A 4Y16D 4NGHH 4CN1A 5I1CL 3ZHNA 5GHWL 2GAZA 4F8TA 3L1OL 2E7MA 4P9HH 3TN0C 4EO5A 1KTLB 4UQAA 4KZ0A 4B53A 1NFDB 4XBPB 1S7VB 5DEGA 5DFWH 3UJIH 2J6WA 5IEHA 3V0GA 3TLRA 3I2CH 5EZJA 1IAIH 4JFEE 3NCYP 5ICXA 1S7WB 4U1IA 5E0FA 3X3FL 4Z9KB 4Z7UA 4XI5C 1Q1JL 3MODL 4HPOH 2QPUA 2WXLA 4FTVE 5C09A 3NQKA 1UKSA 5LBSA 3O45A 1B2WL 5PAZA 1RUQL 5SX4H 4CA4A 2UY7A 4OCWL 4N8CH 1B4JH 3TJPA 3V79C 1X7TA 2KQNA 2HMIC 1JK8B 1FYTA 3D87B 5F3BB 4W4NA 1XQ4A 2CRIA 2PW1A 2Y22A 4YDMA 1Q0YH 2VDQH 4CC4C 4DP8X 5ICYB 4WO0A 2BSDA 2NY1B 3I50H 3GKWH 5B4MC 1B6DA 1PDKB 1EHLH 1WFJA 4I1RA 4LK4A 4PJBE 5E94A 1TDQA 3UGEA 5DJDA 4F7EB 3VXMB 1HOCB 1IBGL 5IKCB 3D25A 4LOUC 4POZC 1A7OH 3HC4L 2WBJD 2X3AA 3H9YA 2Q5BA 2N1KA 1D6VL 5K9OB 3NIDB 1KGIA 2J72A 1WZMA 4QRUA 2Y7NA 3I6LD 4OKDA 4CBPA 2LVCA 1LO0H 4FHKA 4BKLA 3B5HA 3DETC 3I6LE 1LK2A 3N1MC 4HS3A 3MKKA 4KI5F 3FK3A 3IKCB 4JRYB 4ZFQA 2FATL 1A7QL 3BZEB 2RMNA 1V10A 3ALXA 4OM1L 4P2RD 1ZWIB 4NRXA 3VXRA 4FXGA 2ZKWA 5BO1L 5E6IB 1HYSD 4PJXE 1MVYA 3DVFA 2A74C 4LVHB 2QTVA 4P05A 2XIIA 4MD5A 3SPJA 3EJUA 2VM4A 2DIEA 4ZQKA 3UG5A 5AYTA 1EXUB 4BK5A 3IJEB 4YO0A 1KFGA 4WTQA 3CZJA 4PJBF 3W3BA 3SKMB 1NCWH 4ZQTA 4NYLB 4F8NA 3RPBA 1V55B 3JV4B 5A1AA 3D9AH 4XNQA 1F4WH 3RZCC 5IBLD 5DK0A 4TRPL 5J57B 1AYRA 1RHHA 2W38A 4J3VA 2RHEA 5I73C 5AD0A 3TS8A 3WHXA 3PV6B 2DQMA 4RSVA 4B0MB 3QYNA 2JKXA 3BDBA 3S35L 2Y5TA 4Y5VA 4F8QA 3RILA 4NNYA 1CT8A 3QCTL 5E99H 4Z77A 3ERXA 3VWJC 1SEQH 2B3RA 1TTGA 4N9GB 3KPPA 3U6XS 3EHBC 2H3XC 1U93A 1XCWA 4QCIA 4XCNA 2FB4H 2Q1EA 3PRZA 3FT3B 5CKGA 4U1GC 3RP1A 5LGHL 1J8RA 5DT1H 3MCG1 3V4PA 1PG7H 3NFPA 4HQQL 1EX0A 2XTJB 4PJ9B 2WQUA 4JM2B 4H8WL 2Q20A 3WL9B 4LSPH 4YQXL 4KK8C 1P4IL 2DLGA 3L9BA 5C6PB 2QHRH 2WQ8A 5ILTH 4NC0B 4P3WA 3TO2B 1U8QA 3QS3A 4YFLI 2W91A 4K9EC 5KBDA 3VFRB 3AAZA 3MLTB 4RMBA 3H9SD 3QGVA 5EBGA 1SHWA 1F56A 4L4JA 1KTCA 1TJHL 5F72S 4WSKA 4MJ6A 4Z18A 2EADA 1VA9A 2IOOA 4R3SA 1I7RB 2AGJL 3WNOA 3ZZ1A 3UBHA 4IK7A 3W9DA 1ZV2A 3NESA 1JUFA 4KNQA 4OZIB 4ELMA 1ERNA 2J44A 4Z0BH 2EDRA 3W11D 2H2SD 3QFJE 4XWOC 4YGVA 4P8QA 4AGPA 1MWOA 1ZPLA 5FO9B 1XH3A 3MJ9A 4K7PX 1DDTA 2AANA 4YZWA 3LKNB 1QEWB 2IQAB 1DBMH 4G5AA 2C9RA 4K8RL 3X14A 5T3XL 1LLAA 3LPFA 2H6OA 3GRWL 2PTTA 1NGZA 2O5ZL 4LGPB 1LWHA 5DJ8A 1XMWA 4FD0A 2YD9A 1OGPA 1ZDQA 2Z0UA 2TSBA 1G43A 4JQIH 4QXUL 4PI2A 3RB7A 3U1QA 4NQCA 1YHPA 2FD6H 4JG5A 4MB5A 1ZHNA 1EJ8A 3KMDA 1Z9OA 3EDEA 4ANWA 2BMKA 5LCVH 5JW4M 1N0XH 1Z5HA 1YYCA 5DRNA 3X1FA 4DEUA 2F7IA 5MEQA 1CQYA 2QZ5A 2WBWB 3WAJA 4FYQA 1HFUA 4O2FA 1MHCB 4YDIH 3MI6A 5AAMC 3LMJL 3HC3L 3RWEA 2J55A 3CFJA 4K3DL 3WIIL 2O5XL 1U0QA 1Z9PA 3WNIA 3QHZL 1L9PA 4LPUA 4H44C 4L9LB 4XN1A 1HQRB 3WBDA 5CO1A 4GH7B 5CJOH 2P8PB 4GXFA 3U4KA 4UOW0 3BT2L 2XCMC 3DUUA 1KCSH 1D9KC 2ADIA 2XHNA 2YUZA 3IK2A 3AWGA 1YY9C 1YMHA 5D7IB 4JKMA 3BD3A 1I9EA 3OKKA 1JMXA 5T1LB 3I02B 5FAAA 5CBAA 4HJEA 3VD4A 5D70H 3FSVA 3U82B 5C1MB 1EV2E 1UFUA 2Z91B 4JS7A 3UTTB 2OMBA 3HBQA 5C92A 4D0CA 3ARBD 1WWBX 2FEDC 2WLYA 5MENB 3AXHA 3X11B 3C6SB 2VMFA 2BNRD 1HNFA 4Y19D 2LTQC 4UQ2A 1EHKB 3HNTL 3I9AA 1QWHA 4IK6A 1FL5A 4ZTOH 4PJ8A 3VVVA 2DJ4A 1R5WA 1XIWC 5FOBA 1RMFH 4A7SA 1IKNC 3TH3T 1FLTX 1RZGB 2D03H 2PXYB 3TCLA 2F5BL 3CVHL 2P43B 4JAMA 4PQXA 4M7JL 3ZQXA 1TNMA 3CVHA 4TOYH 1P1VA 4QTHB 4ZUTB 2WWMC 3PWNA 4JG1L 1ZHLB 3IBOA 5GRJH 2X89D 2DWYA 3ZE1F 4Z7WB 1GYWA 3HG3A 4ZUUA 3MV7D 4WV1A 4ZW7A 5B1AB 4U1GB 4UV7H 4TQEL 1DQDL 1P6WA 3ZTJG 3SGDH 4F7MA 1TKWB 1CDJA 5CD3B 4LCWB 2CGZA 3MRIA 4P46C 4U0QB 5K9QG 1G6VK 1OANA 5MENE 2X6BA 2BIOA 5IB1B 2DTSA 1UD6A 5JR1L 4XPHL 1J10A 3K2MC 1RIHH 2EXWC 2J12B 1CU4L 3GI9L 3ET9F 2OMZA 4G80A 4F24A 4HIXL 1XO8A 1RY7B 1UYWH 3R1GL 4UT9H 1VPOL 1RK0A 3SCMD 4TNVK 2VLRA 1KBVA 5CEYA 3DXAA 2BCMA 3TM6A 4MYWB 3QRGH 4U2ZA 1TSRA 4XNMB 5IT2L 1M42A 2C9AA 2R9HC 3UTSD 3X3FH 1MJ7H 5C0EA 2JELL 4LCCA 2GTZA 1JGLH 3O8XB 1I3VA 4UM9A 4OD2A 4M6NL 3HPLA 1EEYB 2X4OB 2EH8H 4XNBA 3V7AG 3WEXA 3MNZB 4N2BA 3IB4A 3KHQA 1YJDC 4L1SA 5BVJB 1Q0EA 4Z78A 4PJGB 2WQVA 2YAFA 4GSXA 4BCXA 3MOQA 2VC2L 4FFVD 4LVNB 4WO4C 4UNUA 2GEEA 4XXDA 3GKWL 3QQ9D 3O3BA 3GRWA 4HEME 1NJ9A 3G6DL 4PH8A 2UWEE 2WNGA 3ZRSA 2OSLA 4EN3A 1P1ZB 1SJEA 4L8SC 4F9PC 5KBKA 5DGRA 2ARJQ 2BSTB 4IJ3B 4J39A 3LCYA 5E6ZA 3LIUA 1QP1A 1X3DA 4PCTA 4XPAL 3N55A 4A6YB 1LEIB 2Y7OA 4GG6B 3MJ6A 3VGFA 2VH5H 3HIZA 1YZZA 3QJQB 1JHLH 3HI1A 4JZOA 3D8MA 1NCDH 3EYOB 4YHNA 5B8CC 2VL5A 2AJUL 3GO1H 4FHBD 3FB6A 4Y1SA 2D2CC 5ETUA 1A4CA 4PJHB 3LKPA 5I8KL 4A7GA 4UTCA 5C9JB 5IMMB 1ZGLB 1JMZA 2AI0L 4GRLB 4UUJB 4DKDC 4Q9RL 1BZOA 4WNSA 5F7HA 3A23A 2I24N 3RKDD 3IFPA 1FCCA 1LP9A 5I1GH 3ME0B 5IZ7A 4KHTH 4EBQH 1RKRA 3L5XL 4D0BB 2H1LM 1CYGA 25C8H 2Z8SA 3VG0L 2KZWA 4U4IA 5B38A 1UT9A 1AZZC 4R4BB 2WM0A 2ZXQA 3M86A 3P3SA 3GC3A 1GA2A 3ZGIA 4GJTB 1XD1A 2VMEA 3IFLH 4J6RL 3KYOB 2ZOLA 5DUBB 4ZFOB 3EG9A 5HGGS 3IXAB 1DHKA 1WAEA 5I5RA 3F58H 5E8PA 3UZVA 2G5BB 3CFKB 5I16A 2X7LA 1DSYA 4H1LB 2NX5E 2IAAC 5I24A 2GJ6D 3QCUL 2A6KA 2JJTC 4X8GA 4YVNA 5T3ZL 4ANXA 3FH8A 4Y2DB 2NR6D 2O6CA 4YR6A 2QKIA 1YECH 1TCRB 2WWKT 3OJDA 4Z76A 4L18A 3WEBA 4JLRB 1HQRA 2E7BA 5JA9A 2XNAB 3VGEA 1KENL 4IRSB 1AS7A 3MXWL 4R0LC 2CLVA 5ITFA 1N3NB 3QEHB 2WJ7A 4F80A 3O4LE 1XIWD 1CQKA 2D3JA 4HDIB 2JQMA 3SY0B 2WIMA 2XX1A 4WEUD 4PJ8C 4S0HA 4RMVA 2OK0L 3CZSA 5EORH 4K0OA 4RGNE 4NKMB 3LKRB 2B5IB 2G75B 3ILDA 4UOZA 4U6HB 4XRCB 1CXLA 3TONA 4QWWC 2H6UA 3SE3A 3FCSB 1FIEA 5FWRA 1EHAA 1N6QH 3APFA 4NJAH 2IVFC 1TVBB 3RBGA 2VIRA 2K9UA 1F6AA 3DMMA 4IGBA 5J13B 4P3CH 3BKCL 4WU5A 2H1PH 4AGQA 4L5FH 3WE6B 4HH8A 2HLFC 2BP5M 2WWKO 3WXVL 3GRWH 1I1FA 3BP5B 5LQBH 1F97A 1D7BA 2E7DA 3MRDB 5KBPA 5DHVB 1JVLA 4DTGL 3D2UA 3MRHA 4JM0A 5IHUL 2AJYL 3MREB 4W9EC 5IW1B 1UM5L 4DN3H 5KVEH 3MRLB 2MIZA 1YMMA 2DQFB 2RTTA 4XH2A 1FNEA 4KMTL 1FL6B 4NERA 5HHOE 1RXLA 3UTSE 2XNAA 3CLFH 5HDBF 3VFVB 2Y1AA 3QWOA 4LNRB 3PDGA 4XHJC 5D9SA 4XOEA 4BELD 3SPHA 2HLAA 2NMSA 4KGJA 5E8DL 3LPPA 1ZSDB 1JP5A 1JV5A 3WLWC 1UA6L 1QLRA 4MJ2A 1H5BA 2MKWA 4WW1A 2AAVA 3N42F 2YBGA 3SDCA 3P02A 5I6LA 1JPGB 4M62H 2HX7A 1X5KA 1GKEA 3G04A 3A0OA 1WZ1L 1OT4A 4QRBA 2J8UB 1NCBH 2H2SC 1I8UA 3HZKA 1IGJA 3U36A 2EE0A 3ZKMD 3IDYB 2ZYHA 4KQ4L 3C6LD 4BWUA 5KG9B 1OAUH 1AMYA 1M71B 1RZFL 4Y5VB 5C09E 1U8MB 2ZONA 2XTJD 4PJ9D 5ESAB 4KKCD 3WFBL 1QR1A 2ADJB 3HFML 4D0BA 3ARXA 2K4AA 1DBAH 1XL4A 2YMXH 2RALA 4FQ2H 5I5MA 4N8PA 3VCLB 3UACA 1U2YA 4LP4A 3BQUA 4JPVL 4U1NA 3A6BH 1A9BA 4BINA 3QK0A 4OBRA 2NY2D 1AMXA 5KBMA 5EFIB 7CGTA 4NI6A 3GTNA 3D51A 3VGDA 4M1GL 1AD9B 3T3MB 3QH3A 3LKPB 2VR6A 5I17B 1MPAH 3VYNA 4CVZB 3GXTA 5BQ7A 3W39B 1I85C 2YXFA 4WNQA 4KHXL 3DRTB 3RX9A 3SQOH 4NRXB 4FXLA 2CDEB 5AW0B 2ROYA 4XN9A 2WXRA 1C5DB 3KGSA 2FWOB 4FCHA 4PJBA 5KANI 3NUKA 4GG6A 4AH2B 1N5YL 2VQTA 3BXNB 1CL7L 2BHYA 1NFDF 1JHTA 1HI6B 1YYML 1N8OE 5DQ9A 2BHZA 3H9HB 1J8HD 3QS2A 2MPAH 4LDOB 2DQEH 2OR9L 2WLJA 4JHBA 2EH8L 3CZFB 5IEKA 3ZTEA 3ZMEA 3ZZQA 1EXGA 3C5ZC 4DP0X 4NIKB 3VH8G 2ED9A 3HZMA 4KXAA 3MV9E 5EO0A 5C0AB 5SX4I 3SPVB 1E4KC 5CBEA 2CO6A 2DQUL 4LSUL 4XXDB 4EEEA 2DWDB 4BH8B 5GGSY 2FJSA 4N0YL 5SWQA 1CDYA 4TV3A 4CADA 2NYYC 1RERA 2V7HA 4AQOA 5ISZE 1A4BA 3SSGA 4OCLC 3UPCA 2QHLA 5LCVA 3ZK0A 2Q3AA 3KD4A 3WEXB 2NXYC 3LS5L 1RI8A 2AABH 4AUUA 4JQIA 3CH1B 4Y5YA 1NWPA 4J3OD 1GZPB 4ERSH 5BJTB 3DVGA 1NCAH 2WO3B 3TBWA 4OLZH 1EK3A 4PJIA 3FQNB 3KLLA 5LLIC 3U6RB 4X8JB 3WIHA 2ZUYA 2WB1A 4ONHA 5MEND 2DLFH 4B9ZA 5HI3C 4HBQA 4X6EB 1GZPA 4PJIE 4NQCE 3EO0B 3GFUA 4P2RA 4JFDE 3CH1A 1BREA 4FRWA 5GSRB 3B2UD 3FQWA 1HQ4A 4XPBL 4MQXC 1R3JB 3NG5A 5H37H 1H8NA 4ZMVA 4PWEA 3B9KD 1C9SA 3EGXB 1ZS8B 3BKYL 4LCVA 3RJQB 1ZLSH 3E3QC 4ATWA 4F3FA 4BQCA 2JJVA 2K7PA 5DU7A 5IVOA 5HYQB 1TZAA 4JM2C 5J6HB 4FQLL 5JHLA 4ZOCA 1H0DB 3LZLA 1ASPA 3T2NL 1RJYA 4Y5VC 4PJ7F 2VMJA 4X6BB 4N5ED 1AZNA 4JFUA 4NSKA 2O72A 3CWGA 5D7EA 1SOKA 3LH2L 1KYAA 3SOBH 3OKOA 1UH2A 3D0VB 4K7FA 1NGWA 4X8CA 4BFFA 2IBZX 5KW9L 1RFDH 2BWQA 3NZ8A 3QBTB 1RULH 4X7CC 3SD2A 1YNLL 3G04B 1JPTL 4M5YH 7FABH 3GJFA 2LU3A 4BFGA 2RH0A 4MASA 5HYJD 1AS6A 4Z7VA 1J0KA 2X9XA 1H8OA 3KPTA 4H7VA 1OM3L 4OT1L 4E9VA 5ITBL 3MCKB 3DJZA 3IWVA 2G0KA 2IFFH 1A6ZA 1PD0A 3MNWB 3RVWD 3CSFA 1NH6A 2FEEI 1JNHA 5JZ7C 4L9DA 3UGUA 3RFZA 3A4EA 5D7SH 1IGTA 3RUGE 3TCXA 2XTJC 3CN3A 4PJ9C 3Q2NA 5CAYB 2K8QA 5I8OL 2R29A 3GI9H 4BSJA 3P69A 3WFEH 3N85L 5I0WA 3VI4F 1IAMA 1MZZA 2ATPA 4DETA 2RR3A 4GSRA 1AVAA 1N6VA 1F4YH 3SJVB 1T0NB 2WKOF 3K80A 4MZ3A 4QNPF 5F70A 1K3IA 5TQ0H 1BVNP 5D7JA 4FLQA 3Q2LA 3ZKXB 5IIEA 4DK6A 4J3OG 4X4XB 4ENZA 1KPUB 3TVMC 4R7DB 3IJSA 5AW7B 4K94H 1QEWA 1QLEH 2VR5A 4ODHH 4X7TB 3OWEA 1EDYA 2NQ3A 4YPGA 1IM9B 1MCSA 3VXRE 3FFCD 1PFOA 2I25N 1ICTA 3LKQA 4Z7QB 2C1PA 1ES0B 4YDLB 3X12B 3CUPB 1RUKH 1D2OA 2FJFA 1UZ6E 2FHCA 1GRWA 1XDTT 5IQ7H 3OKDA 1EA9C 1N3NA 3QEHA 5FLUA 3UBXG 3FW6A 4YDJB 4G6MH 2APWA 4PCYA 4XMXA 2KPNA 5D93C 5C0BE 1EAOA 3VTAA 3ULVL 2CGYA 4HK3N 2GJ6E 3MACL 2GK0B 2QSVA 4RESB 1UM5H 5KVEL 1I8MB 2EVGA 3DGGB 3VW3H 1ZE3C 2DQIH 1PX4A 5DEJA 1XF5A 3CX2A 5LBSH 1RUAH 4OUOA 3G5YB 1HHKB 3MV9D 3VA2C 5DHXB 3N91A 1MF2H 2C1PB 1ACXA 1GKOA 2CPCA 2WLIB 2Y6SD 2N4IA 5ADOH 4IRJC 1VCBC 3SDYL 3C5XA 2WLMA 3NIDF 1L0QA 5FK9A 4HP5A 3EG9B 3MAWA 4JDTH 2QJDA 4OQTH 5J1TC 3KYOA 5FV1L 4ZFOA 3PHQB 4JMXA 1JGEB 3NCWA 4Z3IA 4KI1A 4NKQB 5IHWA 2GK2A 4BZ1L 1G9NH 3N43B 1ML0A 3ASWA 1GW0A 3MTRA 2A0LD 1VSCA 2F0CA 4IBSA 5B38B 4PJFA 4JUTA 2CALA 4L3ED 4GI9A 4MCYA 4OJDH 3RIKA 1U3NA 3A67H 3SDAB 4GAGL 4U6HA 3NQIA 1OB1A 2R27A 5CSZA 3TT1L 2F9BT 1H0DA 3HG0A 4DUWA 5AG9A 4AM0Q 5KSBE 4XX1G 2BIQA 1R75A 1WHPA 1MKFA 3RGVC 3MBEA 1HVXA 3BP4A 2EXYD 3FCUB 1JGUL 2CM6A 3PAUA 3WTVA 2LTQB 4OJCA 2YPVH 2X4QB 3FB5B 3D39D 1JTOA 5GS3A 1HCVA 2JKLA 1CFSA 4P5MA 4Y4FA 4KZDH 2YQGA 4HLZG 4PYHA 3ARFB 3OAYH 1BIIA 3B2UC 3BDYL 5CN3A 1YEEH 5A40E 2DJMA 3T0EA 1JYVA 2Y7SA 5D8JH 3NJHA 2BWIA 2DW5A 3X13B 4GBXC 3PHSA 4GFTB 1AR1B 4Z7VB 3ARDD 3D34A 4WTZA 3TC9A 3U6RA 1ADQH 3S9DB 1IUZA 1U36A 2ZOLB 4FQHB 4L4TD 4MCMA 1HHIB 5C0JA 1MI5D 2BFGA 5D7IE 4G8GD 5BJTA 1KMGA 3HAEH 1Q0YL 2NPLX 1U8JB 1E4XI 4E9TA 4LSVH 5IM7A 1P5VA 3FFCA 1DO6A 1A5FH 1IBFA 4WCYH 4UZGA 4N2NA 5D7IF 5KEZA 3T3PF 5TE4H 3DJ9A 1HL4A 1OGSA 3BUYB 1Q94A 3CG8A 2F08A 3TIEB 1AGDB 3PNRB 1GGUA 1KULA 3F65A 3OXSA 3WGUB 1VKXB 2VQ1B 2OP4H 2IDQA 3D30A 2B77A 5EORL 5HYQA 1R6VA 5TE6L 4GBXD 1CK0H 1BJ1J 5JQHC 15C8H 4YSQA 3CFQA 4D3CL 2HPOA 4UM9B 4HAFA 1YEJH 3DBSA 4H40A 4A7VA 3TPKA 5CINH 4A2EA 5J12C 5HPOA 4TPRH 1E6OH 4FYRA 1A3RL 3QI9D 4L8SA 4PWJA 5TE7L 2JB5L 2UY7B 3F7VB 4GRWB 4XNZC 3D2TA 3L3KB 4A39A 4YDLC 4LHQB 5L4JA 5D7KD 5E6UB 4RIRB 3C5SB 1UEYA 1NSNL 1XR8A 3U7YL 5LXVA 2CQVA 4Y4KC 1XR8B 1SXSA 4LLYB 3DSNB 3JV0A 3Q5TA 4ODBD 4ZW3A 2UZIL 3FUJA 4WJ5B 5IB1A 1MCBA 3HS0B 1HU8A 4ACTA 4DKFL 1VENA 2D7MA 3V7AE 1P84K 5L4FA 4GG6F 1WFIA 5FM4A 2J7LA 3R4DA 4CU7A 3QA3A 4KK5C 4YWGL 4YC2C 3RWHB 5FHBH 4CVZA 1AHKA 5BQ7B 4GY4A 4HBCH 4OB5H 2VAAA 4O4YH 5E1IA 4OU3A 3HC2A 3TURA 1FFRA 2E0PA 2HT2C 3MLWH 1IIIA 3L16A 4NI3A 1A6UH 3H9ZA 4C56E 2R0LH 5E1GA 3NH7H 1JNLH 5FIEA 5T3ZE 4P3DA 5B21A 2X1QA 4NM4H 4OQ1A 5L6YH 2O5YL 2Z31B 4M1CC 3CX5K 5C0CB 1C08B 2J5LB 1J86A 5HHMB 5C86A 3F84A 2DM2A 2ITCB 1AZCA 5F7FA 1VAHA 3HPLB 1SOQA 3P0VL 5HHOA 1QR1B 3WFDL 3WNLA 1TEYA 1WZ1H 35C8L 4PMEA 4Z7QE 2IJ0C 3K4DA 3PWPD 3CGTA 5EO0B 1TETL 3ARED 3KPNB 3NCFB 3HZMB 4D9LH 2AJSL 3K74B 5BRQA 3EYSL 2ENJA 4N2MA 4A38A 2J6EH 3QRBA 2YD2A 4MMYB 2HT3C 4KNSA 3MLSL 2PYEA 1HOEA 1YNTF 1KLFA 3UTTA 3JWDH 3VFPB 5H35A 3MV8A 1VB9A 1YSOA 1HI6A 3RVUD 4PRAB 1W0YT 2Y72A 2WXIA 2HVKA 3SE9H 2YMTA 3MLRH 2HN7B 4DJMA 5FS5A 5H2BB 3FZUD 1BF5A 4B7IA 3DXAE 1A21A 4YN3A 4CKVX 2CDEA 3IFOA 1A3QA 3O9WD 4TSAL 4KMLB 3QWOB 5MEOB 3DPBA 3LNHA 4N26A 1DSFH 4LLQA 2OMNA 1TEFA 4AVJA 3MRQA 5C0AD 1ONQB 4OY9A 4Z7IA 4PGCA 3IE4A 2AXFA 3QZWB 4IHOA 4ZUUB 5B3JE 1DEEA 2AK4E 4I18A 3MBEB 3QSKB 5HHNA 4LVOB 4B5EA 1HKFA 4N25A 4NHUB 5IW1A 3UBXI 5FECA 3O41A 4GIPD 3Q8BA 2ODHA 4ALAH 3BT0A 2AK4A 3FSWA 4NWTL 4O2EA 2BERA 1P4LA 3PWLB 3E9UA 1BYNA 5C3IA 5CJXC 1RZ8A 2NOYA 5ESAA 1NDTA 4NZTH 2DKMA 1S9KC 3GS0A 1G94A 3NIGB 1M6OB 1WWWX 3OG4B 4YZFF 4UQ2B 1SRDA 1A6TA 1YPZE 1CLOH 2A77H 4XN4A 4S1RH 3X14B 1FAIH 1RJZB 4HKXB 1NCIA 3IM1A 2F2HA 3STLB 1RIUL 1ZS2A 3FHAA 3UIYA 5F89A 1B0WA 2EH7H 3HC0A 1T5KA 3S4SA 5F9OL 5IBUB 4LPYA 5LVEA 1TZHB 1Z9MA 4RAVB 3DUSB 1M57B 4I0KA 4ELMB 4O02B 2LFGA 2BOBA 4W9DC 4G9FA 4GQRA 3RPIB 3OC8A 4UT6L 3QC5X 4F7KA 1GSKA 4OKVA 2JKSA 2XJLA 4GP8B 4X5XA 5LAXB 3V0AC 1FE8H 4AEHL 1TYRA 2PNDA 2YBRB 4L23A 3VXPB 1JOIA 3UBGA 2JWYA 1I7TB 2AXJA 3VXUA 4HFWB 3X1NA 2HJKA 5BV7H 2NZIA 5GJSL 3QJXA 5F1IB 3RDJA 1NMAL 4JLRA 4ORGA 3VSTA 2PLTA 3LRKA 3TO2A 1T21A 2CR0A 2GCYB 4NNPH 1RZKH 3OR7A 3PHOB 1UHVA 1CZ8H 2BOBB 4M8UA 5JQ6L 2XETA 4LOVA 2NXZB 1T1YA 5MI0B 3WMPA 4XP4H 1THCA 2KYIA 2ZOTA 2P45B 3V6ZA 1UB6A 5CR8A 3GNML 1WFMA 5I71C 4U0RC 3RQ3A 12E8L 4AZ8A 2YKLH 3BIKA 1IEBA 4PM1A 5DHYB 1HXMB 1ZT1A 3BOVA 4I5BA 5KYYB 1MREL 3W38A 3OKNB 3HBPA 1I1YB 1U8KA 1CVSC 4LDLB 3CDCA 1E65A 3BUDA 1ZOXA 4JRFA 4P2QA 4OLXL 1M6UA 4X8XA 4ZFZB 1FGNH 3TJHD 1GGIL 4HV8A 5I30L 4HD5A 3L3GB 4N68A 4IM8A 3B8YA 3LDBB 1KPVA 2EYTA 3TNNB 2YR3A 2BFVL 2XACC 4AT6B 4KDTA 3BQUC 4Q9QH 3C5JA 3L7FB 1BQRA 2JCWA 1CTOA 4MBOA 4U1JA 4PLJD 4U3HA 2Q0ZX 4JZNA 1ONQA 5CCJA 1F1AA 2ESVB 1UD8A 3BD4A 1KEML 4N1CA 4YHKL 4J8RA 3U0WH 1PZUB 4NQQA 3U4EA 1VFUA 4LRNL 4OIFA 2FB4L 2N56A 4XN2A 1TCRA 1N64H 4LAJH 3JT2A 1BEYL 1L6ZA 1YUHB 3KBPA 3HKFA 2EXSA 1TZHA 3J2PA 2UZPA 4BYHA 1SM3H 3DOSA 5D2NC 3M88A 5G55A 1E5AA 3TBYA 3TZVA 4JR9H 4U33A 3WSQH 2B14A 2ZXEB 4MJID 1RURH 3FTVA 2ZJSH 2GBVA 3NZ8B 3Q6GL 1SMOA 3KPPB 2WSDA 1UB5B 2HFFB 3PQYD 1LNUA 3CZLA 3QNXA 1DUZB 2W9EL 4N20A 6FABH 5IESL 1NJ9B 2Z92A 4YVUA 1CBVH 3GRGA 3B2DC 2JK5A 5D55A 4IRZA 4MB3A 3VFNA 3MLVH 4O2EB 2HG5A 4RAUB 1XR9B 4JDVB 1WBZA 2FBRA 2YEQA 4J3OF 4XNQB 2EIDA 2BRRL 2X4SB 3C60B 1NMCC 4NYLA 1XGUA 1MG2C 1X5MA 5IW3A 6PAZA 4RMRA 1G9MC 4OBSA 3FB7A 1O5PA 1AACA 1DJZA 4R8WL 1T4KA 1DR9A 2ZT9C 4P2RE 1AIFA 2ESVE 2YIHA 2WQAA 2JMRA 4EQ3A 4NAJA 3CN2A 1IGCH 3H7LA 4XCFL 1JV2B 3KWVA 4LLQB 4YSPA 2R1YA 5JIPA 4XNMA 32C2A 4JFDD 4HKBA 2MPVA 1S9WA 4GMTH 3O9WC 3AUVA 5TF1L 3EUDA 1F3RB 4I3RL 3LEYH 4LSQL 1DVUA 1SMDA 4UTBH 3GXPA 3N40F 5DEGB 3FKUS 5TDOA 5GISL 3NZHH 4M6ML 1J48A 1GOHA 1PGRB 1PKQA 3DVGB 2CA3A 2ILLA 3GBMH 2UWEB 1L0XA 3QO1A 4YBLC 2MHAA 1BQLL 2IEPA 3LHPH 4I9WE 1ZV9A 2YXWA 3E3QE 3IDNB 3JWNC 5GGRA 1NMBH 3BVUA 4L8SB 5CMAB 3BAXA 1OLLA 3GT6A 5GGRY 4AWJC 1HE7A 2BS71 1INDL 5CGYD 5FHBL 3EO1B 1A7RH 5HHOB 5JQIB 1RIVH 3DK2A 3G7TA 5HTSA 1KYDA 1MCRA 3B2VL 2B1AL 5BMFH 3EYSH 4V33A 5C0AA 4MZIA 5HDQH 2RA1A 4OF3A 4H88L 1NGYB 4IEFB 3UTOA 1QHQA 3OAZH 3OQRA 2D7TH 2FLRT 5IROC 4M7KH 1T2QH 4RISH 1XTMA 4LMQE 3RFRA 5F0LB 4WUUB 3TWCH 3MR9A 3FH7A 3BVDB 4WLCA 2OMXA 3B7TA 3EOYG 2H8PB 3EYQD 3U79A 1INEH 1SUJA 5I15H 1K8IB 2AJSH 3BXNA 3HMXL 4WO4B 2GKIA 2QPFA 2AXGB 4PY7A 5EF0A 2ID5A 2R23B 1RJCA 2D2OA 2VDOH 4OCRL 3U25A 3JWNE 3KL5A 1ORQB 5ENWB 2FECL 1KGWA 4NO0D 1QSEE 4PJ5D 2WXOA 1N9PA 4J3OH 4G42A 1XBRA 4JZJB 1BPLB 1NZRA 2V5RA 2ZUVA 4V2CB 5GS0C 5HYJE 5FYJD 1GCFA 4WHYH 4F15C 4B50A 3PIQA 4JFTA 3MJ7B 3N06B 4KRLB 4RGNB 1P5UB 4YS4A 1X9RA 1CFTB 3MHZA 1T80A 3BDYH 4CNIA 2GI7A 4G5ZH 4U1NB 2CIIB 3BUTA 5A2AA 3RWEB 4LASL 2ZP8A 1UXSA 5JIQA 4KRPC 2BX5A 3RLSA 5TGBA 3T2OA 3UTPE 2A83A 1FNSL 2VLLA 5A3IC 4DP2X 5E03A 2IAMA 2NZ1A