2AQRA

Cu/zn superoxide dismutase from neisseria meningitidis k91q mutant
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
155
structure length
155
Chain Sequence
b'ASIEVKVQQLDPVNGNKDVGTVTITESNYGLVFTPDLQGLSEGLHGFHIHENPSCEPKEQEGKLTAGLGAGGHWDPKGAKQHGYPWQDDAHLGDLPALTVLHDGTATNPVLAPRLKHLDDVRGHSIMIHTGGDNHSDHPAPLGGGGPRMACGVIK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superoxide dismutase [Cu-Zn]
publication title CU/ZN superoxide dismutase from neisseria meningitidis K91Q mutant
rcsb
source organism Neisseria meningitidis
molecule tags Oxidoreductase
total genus 34
structure length 155
sequence length 155
chains with identical sequence B, C
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2005-08-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 2aqrA00
4A7GA 2GBTA 1XTMA 2XJLA 3MKGA 2JLPA 4FF9A 3QQDB 1KMGA 2Z7WA 1HL5A 1UXMA 1DSWA 3GZQA 3F7KA 2AQRA 1IBHA 1XTLA 1OZTG 3KM2A 3LTVA 3T5WA 1SXZA 3KH3A 4OH2A 1B4TA 4MCNA 4B3EA 1S4IA 1EQWA 1BA9A 1N18A 3GTVA 1Q0EA 1SOSA 3H2QA 2WKOA 1ESOA 3SODB 3H2PA 3HFFA 2VR6A 2Q2LA 3CQQA 1CB4A 4MCMA 1E9QB 4A7VA 2AQNA 1B4LA 1U3NA 2WYTA 1F1GA 2Z7UA 1IBBA 1SRDA 2AF2A 2VR7A 4OJAA 1XSOA 1UXLA 1EJ8A 1BZOA 1PU0A 1JK9A 2AQQA 2WYZA 3KBEA 1E9OB 1SXNA 2LU5A 2WZ5A 2XJKA 2ZOWA 3ECVA 2JCWA 1SXSA 2APSA 1F1AA 1P1VA 3GZPA 1CBJA 1YAIA 1MFMA 3ECWA 3GTTA 3PU7A 2K4WA 3QQDA 2WZ0A 2V0AA 1SDYA 3CQPA 1COBA 2WWNA 5CU9A 3KH4A 3K91A 1HL4A 2R27A 3HOGA 2GBVA 1L3NA 2E46A 2ZKXA 1TO5A 4U4IA 1OEZW 2VR8A 3GQFA 1QUPA 4BCZA 1JCVA 3RE0A 2ZKWA 1E9PB 2C9VA 3KBFA 1N19A 1IBDA 1E9QA 3CE1A 3L9EA 4A7GF 3GZOA 2SODB 2E47A 1JK9B 3MNDA 2NNXA 2Z7YA 4N3UA 5KBKA 2Z7ZA 1SXAA 1Z9PA 3HW7A 2AQPA 2AEOA 2AQTA 1YSOA 4A7QA 1IB5A 5KBLA 2WZ6A 2ZKYA 2WWOA 1SXBA 1OZUA 1PTZA 3S0PA 5KBMA 4BD4A 1SXCA 2C9UA 1OAJA 2WKOF 1SDAB 1YAZA 3F7LA 3KM1A 1OALA 3L9YA 4N3TA 1F1DA 1SPDA 2GBUA 1Z9NA 2C9SA 1RK7A 4L05A 3ECUA 1E9PA 1PZSA 2AQSA 1DO5A 1F18A 4BCYA 1IBFA 1FUNA 4A7TA 4A7SA 1E9OA 4A7UA 1AZVA 1TO4A
chains in the Genus database with same CATH superfamily
3NA4A 4ZX4A 2NY5L 1HEJC 3OKYA 2XBDA 3GSNL 2WBKA 1FV1B 4B6ZA 4TVUA 5LXGL 3FHQA 1RQ5A 3K5SA 3DJRA 3FCBA 3RTQD 4FA8A 3HRPA 3N42B 5AFAA 2G2NA 2EABA 5BOPA 1JG9A 1EJOH 2R2CA 4U1IA 3SGDI 2ADJA 1FLRL 1FNHA 4G9FD 1OQOA 2H0PA 3FS9A 5AEAA 1HDMB 1E2VA 3WYRA 5LBGA 3O11B 1F4YH 1X5IA 1CE1H 3HUJA 4IDJH 3B3BA 2MNWA 4MJ6A 4YPJA 5LAPA 4JBSA 5CBAB 4Y2NA 4M7ZC 3HAEB 4KROB 1V7NH 5I1DA 3HBGA 5KN5A 5CSZB 2KDGA 3BSHA 5MENE 3VXOA 4HH9A 3IETB 4PPTA 4Z78A 3FUEA 1FI8C 3KBEA 1E9OB 2NPLX 2VISB 2P49B 3VGEA 3L3GB 3ZMNA 4E2OA 2WKGA 3U2SB 5DUBB 1KB3A 3V0VA 3BZEA 3GXIA 4A2GA 4X6FA 4JO1L 1Q4NX 3HLAA 4UB0L 1OLLA 3DHPA 2BOBB 4PP2A 4QHMB 2Z1KA 1KCLA 4XCCL 2C3HA 4AQ1C 2NUPA 4KTYA 3RDTB 3QGVA 2AEPH 2X87A 2XG4A 1TPXC 4PP1D 3ZU8A 1F2QA 4AH2A 3NPSB 4QHLB 4LEEA 4YZFE 3V0EA 5BQ7A 2Q0ZX 2GAZB 3CH1B 2BOCA 1OTUC 5C0ND 4LOVA 1BAFL 2PW2B 1I8LC 1XF3A 5DVOA 1S5IH 3D0AA 3HG1A 4NRXA 1IIKA 4KXAA 3EOBA 5DWUL 2MTAA 2JTDA 1SBBA 3TCLB 4Z7NE 4FQ1H 5DJYA 1NC4D 2EKJA 4ODTL 4U1SB 4PN6A 3D39A 1V3LA 4MNHB 4L4VB 3OV6A 4Y4FB 4HOZA 5IESL 2NY3D 1A1MB 1P2CB 5KVEE 1UXWB 4LDLB 3AY2A 3UPCA 1TQCB 3CNKA 3DPBA 3UXFA 3ECQA 4RDQF 1X7QA 3SOTA 2K9FB 3WEBA 3B43A 4XP9L 4N0RA 5ALCL 1ZLUH 3BX7C 2G3XA 4JM4H 3SO3B 3CC5B 4RFEB 5CEZD 4AG4L 4TF4A 4PUBH 5E6YA 4MYWB 2V3EA 2BXZA 4WSGA 4RZCB 2IADB 1HE8A 2OR7A 3MRFA 3F65A 2GBUA 5SWQA 3EF7A 4FNSA 5DD5H 2DQCH 3R06B 4MA3A 4K7FA 3ARWA 4LP8A 5F9DC 3D18A 5HHME 2ICEC 5ICUA 3D34A 1QEWA 4NC1C 1Z3RA 4KI1A 1K72A 2A6DB 1RJLA 2N1KA 4TL4A 4W93A 5DR5L 5FW7A 1TVHB 2YPLD 4F1ZA 1Y6KR 1SN0A 3VYPA 3FQWB 2COQA 3SBRA 1T83C 2B0SH 3KM2A 3TIDB 4A38A 3OQ3B 1J8RA 4WFHE 4Q2ZA 2XZCL 2H45A 4GRLD 4ZMAT 3HMWH 5FUCE 3NCMA 4EUPB 5FECB 3CV5A 2H6PA 3BGMA 4OZHF 2VXTL 2Z3FA 4A39A 1P6AB 4NQSB 3VXTB 4G5AA 1ACZA 2UWEB 5KJ4A 3TPKA 4J3BA 1K6QH 1FVCA 4N2KA 2AQNA 1EJ6A 5IW1A 1NUNB 4KRPB 1RURL 1QLFB 2Y5QA 4YDMA 1M1SA 1H15A 2AXHA 2YD4A 3DX3A 4I0PC 2NY1D 1ZD6A 3WIHH 3DTXA 1CF1A 5CWSB 2WYZA 1MCCA 4FG4A 2BXYA 2WUCL 3CSFA 1SXSA 4KTEL 3V4PB 4GIAA 3HZYB 1BAGA 5C9KA 1KGCD 1XH1A 2DH3A 3HIZA 3T4AB 1U8PB 2NY4D 2A6KB 5I1CH 2CXGA 4DPAX 1NAKH 2NDGA 3IMSA 4DCQA 2G9KA 1RUPL 1U3HC 2UXVA 3K6IA 4QXUL 3VMPA 2WVUA 2BIIA 2W59A 3T0WA 5KS9F 3ES6A 3U0TA 3KPLB 2GSGA 2PYEA 3MFFB 4S1QH 4NP9A 3DO7B 3MJ9A 3SJVE 4HBCH 3CLEH 1KXQE 4UILL 2TRYA 1QUNB 4ODHL 4X9HA 1G9ML 3HLKA 4KI5D 3UJTL 4XNQB 3TWCH 5KZCD 3EUDA 3QORA 1BM7A 4FL4C 3WUWG 3B37A 1U58B 2OMXA 2HJKB 1K4CB 5C0AD 3RB5A 5CIPB 5AALA 3MBED 1REIA 2B1HL 1A1NB 1JF5A 5EZIH 3N1QC 3Q5OA 4JN1H 4P49A 1IC0A 2P7TA 1B2WH 1QFWM 4NHUB 5HHOE 3RWFB 5B1BB 1QNIA 5JW4N 4KITB 3AUWB 3O9WD 4H2CA 4WFED 2DLFH 4HKBA 1NFDF 4MWFB 4NJAH 3L3HB 3WS6A 1QOKA 1QLEB 5D7IA 1RVFH 1WF5A 4GSDL 1HHHA 3BUQA 4IJ3B 1VGEH 5DHDA 5HJ3A 4OFYA 4P2QB 1G6VK 3JZ7A 4PB0L 5F89A 4PWHA 3WN6A 2ED7A 1JXDA 1TJIL 1QFUH 2VDOH 3VGAC 4J28A 2ESVA 4FQCH 4QTFA 3T0EC 5IB3A 3STZB 1TFHA 5HBBA 2CHNA 3MRCA 1FDLH 4G7YH 3WE1A 5GS2H 2XWEA 1CVRA 1MJUL 1QBLL 1YNKH 5AVVB 4AQEA 3HUJF 2YD5A 1J0IA 2FWUA 1NC2A 1RZGA 1OSZB 35C8L 3KPNA 4JHBA 5DJDA 3NUKA 2X6AA 3B7YA 4LIQH 3SQRA 2UZYA 4MQXD 3AG4B 5DT1H 3SKJL 4G1EA 5HPOA 3T3PF 4OSUL 4JQVA 5E00B 4BFKA 4BZ1A 2YWYA 3W56A 3KPSA 2NNAA 4GW1B 4OBRA 5FKAA 1JMZA 2YXVA 2FIKB 1DL7L 3LN4A 4IRSC 1RCYA 3RVWC 5DVPA 1T04A 2HX8A 3GUTA 2PWHA 3ARBB 4XNAA 3QDMD 3BOVA 1JWSB 1IKNC 1X9RA 2HT2C 1IQDA 1X7TA 5E2UL 3HJEA 1ZLWK 2YPKB 3QFJD 3K46A 2ZUWA 3OKNA 5D70H 7FABH 4BBWA 4MHHI 3WHXB 3AACA 1L5GA 3ATAA 4LKXB 2WXPA 5I5JA 3V4LA 4YAQA 2FECI 3D85A 1INDL 1N8ZA 2JQZA 4P9HL 5BZWB 43C9A 1OD9A 5G5DB 4L29B 4LLYA 1C5DA 1GZQA 4HK0A 3MREB 3UGEA 3O45A 5IHUL 5KSAC 2RQ8A 4LMQE 2CG9X 2OSYA 3JVGA 1WC7B 3U6RB 3OSVA 4ODSH 2P5WB 5LUMA 1AC0A 1MCOH 3I74A 1ZXKA 2HLFC 2R1XA 3KL0A 5FF6B 5ETUB 2YOAA 3N3EA 1CDYA 5DLML 3WFHB 2IOIA 4F7TA 4M00A 3RVXD 2KERA 4HF5H 4NO2B 4WNJA 4EOWL 1LO2L 4CVUA 1RZJC 5TDNB 4LNRA 5D93C 1BBDH 3CPLB 3PP3K 1EZLA 1WD9A 3L4ZA 2E47A 3SEPA 3WU1A 5KVEH 2EACA 3CMOH 4DTGH 4XB3A 2IJ0C 1WJ3A 3KAAA 43CAA 2Z7ZA 3HS0A 1LK3H 3HBPA 1T20B 3SGKA 2J21A 3TXAA 3ZTDC 3BVNB 1SN5A 1G7IA 2HJFB 1JXFA 4KXCA 2ZKYA 3QDGA 2WB1A 1LO4H 2FHCA 3G9AB 3WD5H 5IQ9B 1B0GA 4NOFA 4ZS6C 2XV6B 3FRPG 1G9EA 2IPKA 1X5MA 1EPFA 5J4MA 1TSRA 4U1KB 3D25A 3FTVA 4J3XA 3B2UC 3W37A 1SLXA 5HDBE 2GT9A 6FABL 1UH4A 1RJZB 1ZWIA 1ZPLA 4M4PA 3G08B 3RJDA 1R5WA 1PY9A 2LHAA 2V3DA 1R3IL 4RWYL 1U33A 3ULVD 5D7HA 2I9TA 4X99A 4YHLL 4Z7NF 2C34A 1FUNA 2Y07H 2EICA 3ZR6A 5HYQB 1JPST 3GMLA 4JO2H 1U8IA 4HIIA 1LEKA 1A9EA 3U1PA 3MRGB 2E9GA 2NXZB 5CAYB 2AZAA 4JRXE 3SD5A 3PJSA 4G6ML 2WP3O 3TURA 3BH8A 1B4TA 3HHSA 5T5FH 4NPJA 3NJLA 1ZHLB 2HRGA 3OMAB 4F57H 1A6WH 3SY0B 4ZTPL 1CR9H 4P57A 1YY9C 4PCKA 2HWZH 2BCKB 5JHBA 1XCTB 3ALPA 3RURA 3FOLB 5TH2A 3FYEB 4U2YA 2F2HA 3HC3H 4KOBA 1MG2C 4U7MA 3MXVH 4YXKL 3OXSA 3VXSE 1B4JL 4OJAA 5H37G 4OLVL 4DJMA 3W9DB 2FBJH 3MN8A 4G11A 1T0NB 2X4QA 1EAJA 4BUHA 5FO9B 2ZOWA 3Q8BA 1DSFL 1S9KC 3MU3A 4CUCA 4PY7B 2YGNA 3VRJB 3CHSA 4BA0A 2Q7YA 2TAAA 3N2JA 4QD2E 4QRPD 4GUPB 4MD0B 4MVBD 3LRMA 1VERA 4Z0BH 3TZVD 1FZKA 3FRUA 1LNUB 2A9NL 4UT6H 5E2VH 4JKWA 3ZL1A 2O61A 4NZRH 5I5MA 1A7QH 2XRAH 1O9ZA 1UUNA 4JO4L 5DHMC 2GHZA 3D87B 4JPKH 3WS3B 1DBKL 5AZ2L 2BSTB 3KYAA 1VEPA 4CL7A 3QZNA 5D5MB 5L88L 4UYPA 2BY3A 3QIWA 2ZG2A 3GD1C 4X9BA 4TULH 1BG9A 3MRNA 2ZX9A 2EYTB 5B1AB 4KKBD 2J88H 3GRBA 2CA4A 2XWJB 3TFBA 4Z3GA 3QI9B 5IUCA 4DQAA 1CXIA 1F3RB 4M43H 2AK4E 2LGNA 3D3VD 2XQYA 4W9ZA 1YEDA 4OLXH 2FE0A 1PMYA 1WBZA 2Y5TB 3H2WA 4D7PA 4UZGA 1IMHC 2VLKD 5E9DE 2F19L 3PNWB 4UTBA 3EUUA 4IU2A 4IYKA 3VFTB 1E40A 4YHIB 3NT0A 2Y22A 5JPNA 2F53A 3IMWA 4OGAD 1KCRL 1XR8A 1XGZA 4OBSA 2QTVA 5I1IH 4KMQA 3CZLA 5I71B 4N2IA 3HC0A 5IT2H 2W65B 3K80A 2OK0L 3NSJA 4N8UA 1CG9B 2IQ9L 4K3JL 4BZ2L 4X6CB 3ZE1B 2EZ0C 4YE0A 3UROR 4KY1H 3CXFA 4OI7A 1J1PH 2VDML 3AU1B 3NJXA 5CUSL 1ZHBB 5FYLD 4YSCA 2KZ1B 4TOYH 1IZKA 5DD3H 1OANA 4K2UL 1DN0B 1YYMH 2PWFA 2YEZB 4XMUA 4ESKA 2HPTA 1IM3B 2C9RA 5DSCA 3WN5C 2KDYA 3P4NB 4XAKE 2FO8A 4MDRA 4S1DD 1BECA 2WLIA 2W94A 2HFGH 4FTVB 3T6XA 2VERA 5IQOA 4P8QA 4E9XA 4B9ZA 4B9KC 4YBLB 1U8OA 2W0PA 4NRYB 4APXA 4DGVL 2JKJA 4O9HL 4WWKC 4NGHH 3VFVA 2V5RA 1CGVA 4BH7B 4JY4A 5IP4A 1T5KA 4M7LH 3SE6A 1DJXA 1A4AA 4AQZA 5FOBA 2MH4A 4OT1H 4UM9A 2X0VA 3FMGH 3TM6A 4HFWA 1DQQB 1SF3A 2MCG1 1PFCA 3ZK0A 4WI6A 4GB9A 4Y9GA 3I2CL 4P2OA 2CGRL 3UC2A 2YAHA 5D1XA 3MV8E 5MI0B 4MAYB 1M53A 4EI5C 1UVQB 3C75A 1MJ8H 1Q72H 5DZPA 2A6IA 3ZY7A 5B38G 4R96B 4JPWL 2OL3B 2CO7A 2BW5A 1HSBA 4PTTA 1XQ4A 1J0KA 5KSUB 5D2LE 1ET8A 4HUNB 1YYLH 1KG0B 2Y5EA 5ACMA 4UYQA 1D5BB 2VIRB 4X7SL 4CA4A 2LOEA 1M2OA 3HZVA 1SEQH 2NLJA 5H4ZA 5HI4C 1B0RB 4OGYH 4LAQL 3CE1A 3UMTA 1CLYH 3OR7A 3IJ8A 2PUQT 1G7HB 3MV7D 3QJRB 4N2FA 5DUPH 2AJYL 4LLQB 1QAWA 4ZAKD 4W70A 3ZN6A 4LPVA 1J0JA 2X2UA 4HJGB 5C08D 1KEMH 3MO1A 3WTYA 3D06A 4PJAB 2D9CA 4WUKL 5ID0A 5CLZA 4APQC 1DJHA 2R0LL 3MUJA 3NZ8A 4H88H 4LRIA 4R3SA 4E42A 2AV7B 4JFOA 4P23A 3VD9A 3B83A 1NUDA 4O51A 5ICZB 3L6FA 2NX5B 1JDAA 4YXHH 1JPSL 1TJGH 3ARFD 3W0WE 3LX9A 4FFZA 1N70A 3IXTA 4JDTL 4ZFFA 4Q9RL 2F54A 1SJHA 4P4RA 2MQGA 1AHWB 4QO1B 5FDWB 2P8MB 1QSFB 1FORL 2DWDA 2X3CA 3NCJL 3GMPA 1UA7A 3ESUF 2GUOA 1NCNA 4Z3EA 2K9UA 1UGKA 4B96A 4BCYA 3KPQA 2NDFA 4AENA 3B2PA 1CD9B 1IBFA 3QRLA 1H8NA 3GO1H 3SGDH 4ANVA 2ZXAA 2AJXL 2W81C 2BERA 3LH2L 2FEJA 2O6DA 4WEUD 1RZQA 4BQ9A 2I07B 3QXVA 3LD8C 5LNGA 5JHMA 3MNWA 1E0OB 5C0CB 2IALB 1KULA 4XN2A 2VW6A 1KV3A 2EILB 2YXWA 1GS6X 3MV11 4MS8D 4YDNA 3VX1A 2RH0A 5CJOL 4LLUB 4G71B 4WV1A 3THMH 4YQXH 2V2WB 3MNZB 4NYLB 4IMKA 4U6HB 5HDBF 1UB5B 1LGVA 1KBWA 3DX9A 1OGAD 3QEQA 4NO5B 4E0RB 1UZ8A 1P7KB 5FKPB 1NL0L 2ODHA 3I6LD 1CWVA 5ESQB 3WY3A 3QE5A 1SOXA 4I3SH 4QT5A 3NJHA 2FJFA 2FRGP 1PU0A 5LAXB 5JMOC 2LFEA 4GXUM 3ZDYB 4GFXA 2LU5A 2WZ5A 5I16B 1U6AL 5EU7C 5KAQG 1HE7A 2DLEA 5BZDA 3OJDB 4WRLA 3PU7A 2X3AA 3HR6A 3GGWB 4J8RB 4M7ZB 4DOHE 1E30A 2FX7H 3UYRL 2BPBA 2R7EA 3N43B 4K5PA 4XAWH 3F00A 4JFSA 5CGMA 2E46A 1OARH 3GLZA 2F9BT 2JB5H 2ZF9A 3KPRA 4JGMA 5E8NB 2EO7A 2GIYA 1J48A 2X89D 4LHUB 2ARJB 4FTDA 4OGZA 4JX0A 3MJ7A 5B8CC 1OVZA 3I84A 2CK0L 4U1NA 2PKDA 3MRDB 2FNBA 3SGJC 1JV2A 3UAEA 2DM3A 1TZHA 1KV7A 4OLZH 4AQ1B 2QHLA 2A74C 2GJJA 1PLBA 2H2PD 1RUQH 1RIUL 5HPMA 3HR5A 3IRZA 2XKUA 5K9QG 4L23A 3X1FA 4G6FB 5IB2B 1V5JA 2Z91B 2B59B 1CK0H 4J3OF 1HKLH 5EU6A 1CDCA 3ZSTA 4JQIL 4HKZB 4J1UB 2PCYA 1ASOA 4AX3A 2R9HD 3T4YB 3IDYB 5MHSE 2QQNH 1L6XA 1V3KA 1G9NC 4BSWB 3MA7A 4FG6D 1KNOA 2OR8A 4WGWB 2DY2A 1C5CH 3L13A 3SDDD 1EAOA 2F5AH 2UX6A 4KPHL 3U7YL 5IJCC 1KTLB 2C3GA 4XP6H 5L4FA 1CMOA 4EZMA 4JO5A 1JN6A 1HC1A 5FXCH 1MEXL 3T1WA 3H3BC 3FF7A 3R1GH 3L1FA 4QTIH 1U0QA 3JTSA 1MJJA 1RIVH 5C0BA 1OTSC 3WFCL 4PRDA 1CDGA 3RWDB 4AUUA 1RZJH 3AG1B 4ZO9A 1G7PB 1TJMA 2ICEB 5CHNB 3BP5A 5EU5A 2VR6A 2WQAA 4OKVA 2ZYIA 1XH3B 1J9SA 1B6UA 3BPLB 3HMXH 2BH0A 5LLIC 4N0CD 4EI6B 3VDAA 4UDUB 3RA7L 3UTSE 1J5OL 3UTTA 2FSDA 3IBOA 5T1MB 1BF2A 1JZ5A 3KW8A 1LO5A 3NABH 1OP3K 1JGIA 2EYSA 4HZLB 3EYQD 3QZMA 3TJPA 3NFSL 2KHAA 4EDXA 5E0QA 3GMMA 2NY2C 4HSCX 4J3SA 4QI3A 3WKML 3O4LD 4JCMA 4ZD3H 1L3NA 2P48B 4N0UE 3H0TB 5DJZA 1E7VA 1LVEA 4OZFA 2DEYX 3VH8A 4UQBA 2X4TB 1NC4B 5I30L 1XR9B 3IU4H 2P24B 1RHHB 4TUJA 3TEUA 2C4XA 4J2XA 1JZDC 1Z5YD 1P7QB 4JFYA 2CO4A 1RKRA 2CUAA 2YD2A 4PB9H 5FK9B 3OKEA 4XVSH 4Z5RA 5EBMB 3QYNA 1CS6A 1Q9KB 3U4EB 4OGXL 4F7PA 3UZVB 1A4CA 1U3HB 2OMUA 1R0AH 4FLOA 2F18A 2P47B 4I0CC 4IU3B 2WNKA 2HFTA 4JVUA 5GIRA 1R9FA 2WXQA 2R56H 3DNKA 4OCYL 1YCSA 1A7OH 4R26H 1IQWH 3Q43A 1YMME 5HHPA 3EH4B 4Y5YB 5D4QA 1WBYA 4KX9A 1JNHB 2XQYG 5BJTB 5BRQA 3NSCA 2F7RA 1BLIA 1XGYL 5D2LF 1IFGA 2BHZA 2G60H 3OHXB 4H20L 5CJQH 5E8OB 3UGXA 1H3XA 3TVMC 4TPRH 4C83A 1XCQB 1OAXH 4OJYA 3S96B 5E7FA 1OGSA 4HV8B 4DKEH 4JMNA 4H25A 3JWOC 4ANUA 1SVZA 5DJAA 4UIMA 1QBAA 5F1NB 2QHRL 2QMJA 1E28A 3ABKB 1BFSA 3FXIC 3Q01A 4PJ9A 3ZT7A 2PO6D 3DGCR 5I1LB 3RZCA 4GSRA 2Y3NA 1OCWH 1T2JA 4R2GD 4AYEC 1BDYA 1PJ9A 3Q3GA 2GTWB 3HNTH 5EZOL 3TC9A 4Y2OA 3L5JA 4FI6A 4I0KA 4O02H 1LMKA 2AI0L 2VC2B 4LCVA 1FL5B 1Y07A 2NY1B 3BDXA 3MR9B 2RFXA 1V55B 1KPVA 2FD6H 3VGAB 1S3KH 5M7QA 4GW5B 3VFUA 3FAXA 3T0EB 2GITA 4WHTA 5BV7C 2DWSA 1XCWA 1C8QA 3T2PA 1OW0C 4JDEA 1B4LA 4N85A 2HLAA 5IB1B 5IR1A 1FFNA 2NY4B 5KSBA 3UBXI 5ITBH 1Q90A 5CU5A 1LDSA 3QPQC 3TL5A 3NSXA 3BQUB 1KTDA 4QOKB 3QUXA 5DS1A 1ITBB 2PR4L 2P8PB 4V33A 4FG0A 1MCJA 2AQ2A 3MX0B 1K85A 1WGVA 2WQVA 1USQA 4S2SB 4OM0L 4M29A 4HBQA 4RAVB 2YUWA 4UTAA 5FDYA 2CJTA 4H2AA 5KZCB 1J18A 2HKFL 4IRSB 5K39A 3UJIH 1ZLDA 2H3XC 1NCAH 4XP4H 2NMSA 2Q6WA 3F7VA 1NSNL 2FSEA 1AGCB 5J06A 4AZUA 3FPXA 5DEZA 2CE6A 5IM7A 2X4RA 4FMVA 4FLSA 5BXFB 1TTAA 3O11A 1DSYA 1PNCA 4PJEB 1UGNA 1U8QA 1W0WA 3DO4A 4KUCD 1BXUA 4NQDA 5L7XL 2YRPA 1XSIA 2ILLA 5I1KL 5DZLA 4ELDA 1A14L 2WYIA 3C87A 4HHAA 4JZJB 5CJBA 1TTRA 2PP7A 2BW4A 3MPCA 5CSZA 4PRPD 3IS0X 3QPXH 3VXQB 4L4VE 5JORB 3KVDD 3TO4C 1W16A 3GHEL 1KJ2A 1U8HA 4UDTB 4UCFA 5E6UB 1AOZA 2G5RA 1ZHNB 2VAAB 3J27A 3DETD 3L3GA 4QJ3B 2BSEA 3H9YA 2Y7SA 1E3ZA 1BWWA 2VXQA 3R7RA 2BIHA 1KJVB 3GXPA 2HJLA 2XPYA 3DTUB 4QRRE 3T0AA 4QHMA 5AB1A 3ILPB 3JWDH 4JQXC 3P30L 4HOMA 5LKNA 1LD9B 4MJID 2C8NA 2GBAA 3CC1A 1ODAA 2D4DA 4GI8A 4BK4A 2GAZA 4W9DC 3U9UA 1U3JA 2DLHA 1M2VB 3QEUB 1W9XA 1WWAX 5JHDA 5GZOC 1TQVA 3AG3B 3A6BL 3M45A 4TYUA 5D7JD 4KRNA 4M5YL 1QSEA 4DPBX 5FR3A 1JZ4A 2ITCA 4D8OA 4M7JH 4N8CL 1ZTXH 1HL5A 3BPCB 4UM8B 3UZEC 2UY6A 1VGKB 1KDIA 3ZKMC 3B6SA 5F8RC 1U92A 1T6WA 4XWOD 3TIEB 5C0JB 4XXWC 2DLTA 1P2CA 1EVUA 1FO0B 2VDRH 2K78A 1MCDA 3D51A 2GJZB 2Y7OA 2UWEE 4KXZI 5DVNA 1W72L 3CFIC 3PYCA 4M1CD 3W81A 4DKFL 4ZMVA 1PG7H 1A6VH 1KIUB 3UZQA 4BQ8A 1SVCP 1MW1A 3GSRB 3P0YL 3IFLL 4AJVA 4RFEA 1LYQA 3O6FC 1DBBH 2C1PA 3PCYA 2IADA 3RU8L 4IJTA 3VI3A 1MNUH 2AJSH 3HFML 5EWIH 3R06A 4GBXC 3NRFA 1J7VR 1MSPA 3GNMH 4OCNC 4PRNA 4MCYB 3VRLF 4OLWL 2A6DA 1OWWA 2GJ6B 1TVHA 5CD5D 4F8PA 5EDXA 4WFGE 3TIDA 4ZMNA 1D9KC 4LRNH 2C9QA 2HMID 1RERA 1XF4B 5LCVA 5LWYL 3QNZA 4X42A 2B4CC 2AGJH 3JQOB 1WIPA 3P2TA 5FECA 2EDKA 5KYNA 4Y2DA 2JB6B 2ZAGA 1JCVA 5FA4B 3UG5A 1CDIA 4GYBA 4KQ3L 4AT6B 4ELMA 2JI3A 2UWEA 1C1EL 2XXCB 1BQHG 1GMIA 2YA1A 4ZTEA 1T7VA 3U46B 2CKBL 3TYFA 1EFXB 1BXXA 3KWVA 1AR2A 3LKSA 3BPOB 3MJ6A 4I2XA 4LCYB 5KSVA 3QXWA 3RUGA 2PWGA 4A6YB 1JDDA 5CWSA 3PHAA 3DSFH 5CP3H 3WEMA 4JANB 4N5EC 1BHGA 2FGWH 3V4PA 1S7XB 1BMGA 1X7SA 1S6NA 4Y5VA 2YC1B 2OSWA 5AOJA 2QBWA 3NJNA 3GSQB 3T4AA 5KBDA 4NLHA 1EO7A 1U8PA 4OIIL 2A6KA 2VDPB 3M6DA 5EBLA 4QHNB 3NBNA 3SDCB 2DEXX 4D8PB 2E7LC 2PPEA 5IW3A 5F6HJ 4TLSA 3RVUD 4PVMA 2G5BA 2QADC 2H3KA 2V2TB 3ULUC 5E94B 1ZVSB 3V0WH 4KFMA 4K94L 4PRIA 4P2QE 2BY2A 5I6XC 2G0KA 3BD4A 3DRQB 1PYWB 5E9NA 4YGVB 3SE4A 1MRFL 3APCA 4GKSA 4QRTA 3IJSA 3P4OB 3VD3A 3ZDWA 3UO8B 2NY5C 1P0SE 3KL3A 2E3VA 1U58A 3N1GC 2HJKA 4F9LA 5DVMA 2NYKA 3INUL 1Z5HA 4KRMB 3X3GL 3F7KA 1DN2A 2FWOB 3QK0A 4K7PX 2WLMA 4IGBC 3SE3C 5LHDA 2WW8A 4PJ7E 3D09A 4JFFD 2OA9A 4NHUA 3UPRB 2FGZA 4G7VH 1C5BL 4IK6A 4LLMB 1I3GH 4OZIA 2BK8A 3KR3H 3FUNA 1Q9WA 5KSBF 3WY1A 3OKKB 2WIMA 4JZOA 4WY7L 4G6AC 4HIJB 3TJHC 4BFIB 5DQDL 3L3HA 3VWJB 1EHXA 2OCJA 5F3FA 2FYYB 3LPPA 2G75A 3RWIB 5D7EA 3FTGB 4IM8A 4JDVB 3U25A 3LKOB 5FGSA 4JO3H 5SWZD 5KVDE 5AUMB 3OGOE 3EGXB 4M7KH 1AO7B 2AAVA 1IIIA 4WWKB 2A0LD 1SXNA 1CGUA 4PV9B 1PBYA 2MCPL 3DUSA 4C47A 1DQLH 4JRYB 1CBJA 3KPOA 3N42F 5HDWA 4H7VA 5E03A 4FP8L 1T2QL 5AWNL 2DWEA 3RZWA 4JR9L 3FCSA 3NCCB 3L3OA 3W3BA 3S88L 2XY2A 4JE4B 3WNNA 5K9JL 3KXFD 4L8SC 2OJZL 5I8CB 1HEZB 1OSZA 5JPMB 3VD4A 2G3MA 2P5WE 4H8HA 1U2CA 2YEQA 1CL7I 3PQYD 1J1OH 2HB0A 1HWGB 4JKPH 1KJ3H 3IPFA 5JIQA 5KYUB 4JL1A 1AP2A 5D6CB 2BFVL 2RA1A 3DV4A 4Q74A 4XI5C 2MHAB 2BVPA 2GB2A 1OO2A 3JWNE 3RG1C 1AMXA 5GGSB 2JE8A 4AMKH 3HHMA 3EFFB 4IRZA 3GSWB 3HW7A 2BINA 1DQML 3IMUA 4G7SB 4GQ9H 1NCJA 4LKXA 4MB3A 4MB5A 2HKAA 3CHXA 1M7IB 3HN5A 4FJ6A 4EEEA 5T3XE 3X14A 2V7HA 3WJJC 2FBOJ 2CBQA 2EE6A 2FWSA 4GMSH 4OM1L 1VEOA 3WMPA 4FXGB 1QEXA 3MREA 1M6UA 3VFOB 3L9YA 2KPWA 1EMTH 1UZ6E 2GY7B 1PY4A 4JE0A 4ERSL 4EQ3A 1MFBL 5IBTL 1BJMA 1WC7A 1TYRA 3D9AH 3U1SH 1L9OA 1JD7A 2X53A 4EZJA 4YE4H 5TE4H 4Z7QB 3F5WA 4APQB 5ADPL 2VUOA 4RGOH 1NEZB 3E7JA 1SLVA 1DO5A 1LWJA 3OJVC 4G3YL 4NO2A 1A3LL 1IC4H 2HT3D 4M5TA 2G3ZA 1QFWI 3CPLA 4YHYC 2NT0A 5K9OB 4HLEA 1UYWH 3QIUA 3N91A 4YVUA 4EUPH 4P99A 1EXGA 1UXMA 1XAKA 5KANI 4Y9EA 4Y4HC 4FFZL 3EBHA 4MAUH 5CGTA 5KVGE 5J1AB 4G8IA 3AM8A 4ZO7A 5T1LD 1PX4A 4WO4A 4KTGA 4LVOC 3MA9L 3U7AA 4FNRA 1XX9C 5JUEL 4DGIL 1CD1B 5DMIL 2HTKC 2MIZA 2ZX6A 4Z7AA 1N2RA 3IKCB 1A5FH 3N41B 5IQ9A 3K7UA 3PWJB 4RX4A 3K72B 3CTTA 4WK0B 5B1JA 2XQBL 3VXNB 1GAFH 4ZFZB 3JTTB 1MVUA 4WNQA 5AYUL 2WYTA 2XWTB 4PAZA 3FONB 1N10A 5E70A 4YK4B 4YMPA 4ZFOA 3VFGL 2LAGB 2ODIA 3G08A 3GF8A 4L8BA 1X4ZA 3D69A 3F2LA 2J20A 3LS5H 1SHMA 4GS7C 3WIHA 5J6GB 2X9YA 1BYNA 3GI8H 4G8EB 4YX2H 1ZTMA 1EDHA 3HBZA 5HYQA 2CSPA 4U3SB 3TT1L 1URZA 2GI0A 2XN1A 3ECWA 4C56B 1UWGL 1TSHA 1TKWA 5F9WC 3NCBB 3QS2A 2AKRA 5T3ZD 4D3CL 4X5PA 1IGCH 3NJMA 2WLLB 2UWEF 3WEXB 5MEPB 1KCVL 1FN4B 1S7SA 2BHFA 3MV7B 1YN6B 5C9JB 4OD3H 1WLHA 4U4IA 2MPAH 1M42A 4MBOA 1CICC 1ZHLA 4ZAKB 5D5ME 4QXGH 1G9MC 5AAMC 1OCOB 2HUEA 4LU5H 1DEEB 1X5XA 2ZOLB 3HNVL 1G43A 3E2HB 5T1DL 1KFAH 3MRMB 4Q7DA 2BCKA 3BZDA 4UINL 1XCTA 5HYSB 3OBAA 1THCA 2ZYRA 3LZFH 3QUZD 4NFBA 5EFIB 4O2CA 3UCQA 3QG6A 4N4YB 5JZ7D 3OZ9L 4MSWB 2ENQA 4ZX3A 4L2YA 3S37H 1T0NA 1G4RA 5ITFB 4AEHH 4LSDA 4UZUA 4PY7A 3KJ6H 3VRJA 3CGTA 5BV7H 5B8CB 1U8JA 1M7DB 2H0EA 4QDGA 5DHVH 4Q6IB 1R5IB 5BQDA 2C9UA 1FYTA 1M05B 2N7AA 1AE6H 4G6KL 2VWEE 4W4NA 2VQ4A 1G7MB 5D71H 4AEIL 5AG8A 5D1QC 2CIKA 2WLYA 4X6CE 3D7PA 3ZE1E 3DOIA 1IAKB 3WS3A 3IXAB 3ZQWA 1PEZA 3DMMC 2BSTA 1IGFL 2F8VA 2J56A 3FB5B 2JIXA 4Y16C 1AGFA 2K70A 1RPQA 1DBAL 4X80H 1TNNA 5DFVD 4F9PA 4OKDA 2EYTA 2ATPB 3IJYB 2VRQA 4EN2A 2XIBA 2WK2A 3MUY1 5L8KB 4PW3A 3TNMB 3CSGA 4JGJA 3ESOA 4F8TA 5C2UB 4FTVE 1RUML 1YA5A 2YZ8A 4K8RH 1SMAA 5CEYB 3T5WA 1GY2A 1OE3A 3PNWA 3S34H 2I26N 1FPTH 3VFTA 4B95C 2F74B 1WAAE 4YHIA 4XNZC 4L37A 1G0DA 2FX8H 3IDJA 3MYZA 2BIPA 2AXFB 3EW3B 1MCQA 5J7CC 3HE6D 3AS3A 5D72H 3VWKC 5J6HA 4X6DB 1IVLA 4M48H 1E8WA 2XPZA 4U0QB 3V6ZA 2W65A 3VJ6A 4AJWA 4FZEL 1X5JA 2JELH 4P5KB 3MROA 1BYOA 3QXAB 5FYKD 2G30A 2WXFA 1XGPB 4WQOA 1T21B 4YNYA 1YO4A 5D7LD 1S9YB 4WZ9A 1ZHBA 1YEEL 4P0DA 4PWJA 2CHDA 3AAZA 2H0FA 4P9HC 2VO5A 3U36A 1DN0A 4UQIM 1JI1A 4K7PL 3MLVH 1IM3A 4XN8A 1JRHL 3P4NA 2DM7A 2VLJD 2VXSL 1NJ9A 5C7XH 3VD7A 3V6OA 2ZP0T 3TBWB 4XVTH 5ICXA 5D55A 5IEKB 1KELL 4G42A 3MLPA 1E7UA 2C7UA 2BWQA 4FI8A 4X7CC 4F80A 4BFGA 4BH7A 3LXAA 1QI3A 3BMWA 15C8H 4AKQA 1NCWH 3HE7D 3PXHA 1C16B 5E4EC 2DB8A 1HHJB 2VJ0A 1D5XB 1MCSA 4KKRA 3FQUA 1YEHL 2NZ9D 1XF5B 2Y06H 4X7TA 4PJAE 4MMXA 3DUUB 4JKLA 2B1OA 2WQUA 4Y88A 3S8GB 1PCSA 2GCYB 2OP4L 1H9VA 3B9DA 3QJSB 2HVBA 5AOIA 1IEAB 3JVFC 5C09D 3KJ4B 2VT0A 1D7CA 4PJDA 1C8PA 1EEYB 3STLB 4MAYA 1PZAA 1MWAH 1UVQA 4LZKA 4QNPF 1A9BB 4ZSOA 2NX5E 3BKCH 3SDDB 4OQ1A 2CLVA 2H4EA 3EOTH 4HQQH 2EC9T 1QSFE 3EOAB 2D7TL 4L3AA 4WTWA 4F58H 4CGTA 1F1DA 3CXDL 1GOFA 4ZNEE 1FIEA 5DMKA 4WSJA 2K1MA 2VIRA 3IJHB 5HHVH 4NCC2 5KVGH 4NENB 1FFPB 4NZTL 1AKJB 2GABA 5IHWA 1DBML 3V7AG 4BKSC 2WO4A 2X70B 3NIDB 4GQZA 4LLQA 4Q9QL 2EDLA 3VFSB 2AEIT 5C0CE 1KGJA 1WT5A 3UPAA 3TVMB 3EF4A 4ODWA 4MZRA 1NIBA 2PCPB 3HKFA 3A4DA 2QELA 1IZJA 2OXHA 1PAZA 1ZCRA 3QUYC 3VSVA 1EZVY 1UZ6F 1VZGA 3S35L 3IU3A 5I0WA 2MCAA 3CVHB 3L48A 3DIFB 4GG8B 3FZUC 2VSKB 4XPGH 4QO1A 2GFBB 3CLFH 1AHWA 5FDWA 1GYAA 2VL5B 4Z3FA 1QSFA 4GRLC 3O4LB 3ZDYE 4DUVA 3BAEL 1U8LA 4L3ED 4LSUL 1HNFA 3NOIA 4YEFA 4YO0B 4YDKH 4HXAH 2Y72A 2JFCA 4XBPB 3DLQR 1G6RL 4RWHA 3MRPA 4B0MM 2X05A 3ULUH 1F6FB 4G8FA 2Y1VA 3GHBH 5GXBB 3OF6A 4TKWA 3OAZK 2FB4H 4B60A 1ACYH 5IJKC 5C0CA 5F70A 1VA9A 2XA8H 3FQ4A 4KVNH 3ZIYA 5INDA 3T08A 2JXMB 3BHBB 4U6YA 2HG5A 3VGDA 3PXJA 5MEOB 1RIHH 3LQAH 2X4OB 4QRQA 4H1LH 1KCKA 3QJHA 4U6HA 2WLHA 1Q9OB 4NO5A 5HTSA 3MUGA 5FKPA 4HYTB 3CBJB 4H8VA 1BD2D 1KPRB 2IAND 3QZWB 1FLRH 4OF7A 4Y8AA 5ESQA 1UM5L 3K4DA 4XBEH 1WTGT 4HT1L 2ZCLL 4EZLA 4ZTOL 1DVFB 2K7QA 4ODVL 1EAPB 4RQQA 4RFNB 5LAXA 4BFBD 1JIBA 4HS3A 1NFIA 3MNMA 1QRNB 2BFGA 1DFBH 5FA3B 4P46C 5EMYA 5I82A 3OJDA 4DEPB 5JOPE 2J5LC 2BDNL 2R0KL 1IV8A 2E76C 1W91A 4FMFA 2ITFA 3TFKC 4AQ8C 4J8RA 1MLCA 2D3NA 1Z9MA 3C5SB 3F62A 5AW8B 3MBEC 5D5MF 4TVSa 3MYJB 3SQOH 2B3IA 2HPOA 3VXMB 2APTA 4PW4A 1UA6L 2D7PA 5E8NA 5MERB 1A6PA 2OCFD 4R2GB 3SE8L 5IROD 3WXVL 3VG0L 3FN9A 3WE6A 2ARJA 2YSSB 5ESAA 5F7EL 1OCZB 2YOCA 4ONFH 3MRDA 5E1QA 1OPOA 4RSVA 3ZZSA 3PLYA 4FZ8L 4KXZH 1T1YB 3OC5A 3WNPA 4AQ1A 4RGMC 3U9WA 2G2RB 2WXHA 1SEBA 3PAYA 4H44C 2I5YH 4ENEC 2WANA 4GUOA 3PFUA 4C4UA 1A9VA 3M86A 3LKNA 2W95A 4X6CF 4JG5A 3NCEB 2B59A 3SPCA 2XN0A 2FEDC 4X4ME 4MYPA 4HKZA 4J1UA 3T4YA 2NR6D 2YK1H 2ZYHA 3B3IB 3I6GB 1A6ZB 3X11B 4OUUB 4LCWB 4PWKA 5I26A 4OLYL 4ABWA 3LB6C 4GPVA 3SDYL 2GQHA 5JQIB 2NTFA 5I75C 4HWEH 1JL8A 3ZE0E 5HHQB 4PLJD 4Z3JA 3S5LB 5KUKA 1OAYL 1RXLA 3FTUA 3O6FB 2XFXA 1PZCA 1WAAF 5DC2A 5DUJA 2CDEB 5D1ZI 4HJJH 1UWEH 2YAMA 7TAAA 4L8CA 5EC1B 4GBXB 4FNTA 4PJHB 1YJDL 1W8OA 2VN4A 1LP9E 2N3JA 4KZDL 5DYOA 1I3UA 1MOEA 3IFOB 3U4BL 2R0ZL 2ICEA 4EPSA 2O6FA 5CHNA 1H0DB 1XL6A 3DPDA 5EF2A 1TQSA 4S1SH 3TLRA 4AL8L 3NEOA 4R7VA 4CW1B 2CD0A 3ROLB 3GSOB 4FFVD 4GRMA 2DWXA 1E4WL 1D9KB 1T83A 4UDUA 3KE0A 4PJDF 4DGWC 1ET5A 4F15B 5CEZE 4N9OB 4NAQA 5C6PB 4PJIA 4PJBB 5LNEA 5KBKA 1G9HA 2D7NA 2XN9A 2EXYD 3JTBA 5B39A 1BPVA 3BEVB 3LSOA 4MJIB 3WENA 2YZ1A 4HZLA 5A7EA 1YMHB 4WFFD 4HLJA 1KTJA 1WYJA 1O7DC 4BFJA 1EDQA 1ZVYA 1CGSH 2Y7MA 3CFKA 3ARVA 4TVPD 2XACC 4FOMA 4XB7A 2VDQB 1AHMA 2YPLE 1L9NA 4QWWC 3ARGC 4I0PA 1Y0LB 1UT2A 3V4VH 1R3JA 3X1NA 1BF5A 2ZUXA 4IKIA 2LAAA 3MGTA 4YFEA 2E8ZA 2OX5B 3H9HB 4EXPX 1Z9SB 1MAJA 4W9IC 1R3HA 1P7QA 4PJAF 5FK9A 1YQVL 4ZMYA 4R4ND 5EBMA 3VCLA 1DCEA 4WW1B 4Z7UA 5D96C 3PAVA 1EEZB 2IMNA 2QADB 1U3HA 4KK9D 5FW6A 3UZVA 3GKWH 3H54A 4CNIA 2Z1PA 5FO7B 5HJGA 4HW6A 2ZIDA 1SM3L 3CDYA 2WMPA 3O3UN 4OIBA 5E0FA 1NOFA 3HG1D 5TE7L 1DUYB 1U8CA 1QFOA 4QYAA 4AK1A 2ZKMX 3OVUB 3P73A 5L8JB 2B1HH 3GSNB 2HP4A 4FABL 4JY5L 5DD6B 3D39D 4DUWA 5MEQA 1KGCE 1G7LB 1ZSDB 3CVBA 3E6FA 1TTCA 3QZBA 1EANA 2FL5B 3FT3B 1CDHA 3WFEH 2O26U 5E8OA 2EUZA 3DC0A 4QRAA 1XCQA 1CYXA 2PCFB 3KYNB 4QOKE 1UWFA 1P1ZB 1VFBB 1QACA 2PPFA 4R4FL 4B7LA 5K33A 1EJOL 3SKOA 3II2A 1S7UB 3CFEB 4JPQA 3ZQ9A 4AKOA 5IMMA 3EAKA 4FLQA 3JSSA 1CL7H 2I9LB 4QRBA 5J3HC 3MMEB 1F4YL 1Q8MA 1CE1L 3HB3D 4IDJL 4KI5E 1OCRB 5BRZB 5I1LA 2FHFA 4JPIB 4N2OA 4FA6A 4XMZA 5C0AE 4DVBA 5IGXH 3HI1B 4JLRA 2AEQH 3S8FB 2AK1H 2GTWA 4H8UA 5EULV 1V7NL 1T66C 3RVVC 1MCPL 4LB8A 3V9FA 3ZMRA 2OI9C 1FL5A 4WI0B 2ITDB 4PJEE 4NAMA 1EAQA 4M02A 3T0EA 3M07A 4RLDA 4MVBC 4QKTA 2VMDA 4NKDB 1CGWA 3QJTB 3TZVC 4WFEE 3ZDYF 3K71A 2AQ3A 2NYZA 1JGDB 3MV9A 3O3AB 2SEBA 2ZYSA 3WFBH 5SWSA 1FQ9C 1HNYA 5EORH 1F02I 1MCWW 1KCSH 4FYRA 1VCAA 1N8OE 1HCZA 2AEPL 2H1PH 3FB8B 4E5XG 1WWWX 5D1ZC 1GCFA 2ZOUA 1DL7H 1G1YA 2OW6A 3MRLB 1DLHB 1NGPH 5AW4B 1W2KT 5J1SC 5I23A 2BZDA 3GXUB 1SYSB 1S5IL 2BVOB 3F8UB 4IRSA 4GSUA 4BDVB 1QFWH 1XSJA 4ES9A 1S9XA 5AVXB 1AGCA 1IKNA 3TEYA 3NJVA 2H6UA 5ERWA 1INDH 5E1IA 1GC1H 4FNLH 1BM3L 5I17B 4MKTA 2VKXA 5F0LB 4ZQKB 3A67H 2ZCHH 5IQ7H 1Z2KA 3TO2B 3QJUB 2FATH 2YN5A 2PYED 4FCHA 3GS7A 2HYMA 4RDBA 4ZUTA 1K8DA 5KSAA 5ID1B 3OAYH 1VAHA 4JM4L 4CVZB 2XT1B 4JY6B 1KLUA 1JZFA 4EOWH 3VXRB 1UFUA 4YDVB 4F2MB 1NOLA 1SJEB 1Z6JT 5DD5L 3DV6A 2DQCL 3FUKA 4UV4L 1R1CA 3MCKA 3QFJE 1PKQB 1UG9A 3DWTA 1M1XA 2UV3A 1CB4A 1R75A 3RY6C 1BMZA 2EXSA 2WXRA 2F15A 5I74C 2Z7UA 5A1AA 5CSGA 3QJXA 2PWDA 5A7BA 2B0SL 3KXFB 4PJ5B 3QNYA 2XBTA 1ZGLB 3HMWL 3K6NA 3FUIA 3QEUA 2FJSA 4H8QA 3SPJA 3ABGA 2J2ZB 4MQSB 4GI6A 4F7MA 3AT8A 2GJ6E 3PQYB 3T71A 4OFYD 4OF6A 1AXSB 5GJSH 4IEFB 1K6QL 3BPCA 3IFPB 3PWUB 4GKZA 4UM8A 1VGKA 3SJVD 1A7PH 3PL6C 4UNUA 3TIEA 5K9QI 2CGZA 5C0JA 2YAPA 5EA0H 2ESVD 5I8OL 3FB6B 4WJG3 4RMQA 1B2YA 3UGUA 3QWOB 4ONHA 3WELA 1SJMA 3E8UH 1WWBX 1OAZH 2J43A 3HEIB 1KIUA 4FN0A 1NC2D 3GSRA 5F9WB 2BZ7A 4D94A 3FN3A 2WVVB 1Q0XH 2YS4A 2H32H 5I1CL 4ZODA 3FTWA 1NAKL 4ZTPH 3T8VA 3T2LA 5LGKA 5FM8A 1CICB 4L4TA 1Q9LB 4YSOA 1KBKA 1VENA 3ZZLA 3KPSD 1D5IL 2KLTA 1NANI 4MCYA 4S1QL 4PVBA 3FSVA 4RIRA 3VA6A 4HBCL 5EO1A 4YXKH 1C08B 7CGTA 3ULVE 1DQTA 3OWRA 2LT9A 3A24A 4M3KB 1D6VH 4M62H 3TWCL 4EKJA 1GJWA 4ODTH 1DDHB 3SGEI 5JHLH 1I7ZA 2GC4C 2WXKA 5GGSY 4P5RA 5EZIL 3DBXB 4J3WA 4BFEA 2JB6A 4JN1L 4C58B 4JFZH 2A5UA 3GRGA 5FA4A 3KNBB 4AT6A 1B2WL 4Q4IA 5DJXB 2IFGA 3ML9A 1HAUA 1ORQA 1OV8A 3N85H 4XHJD 5I0ZA 1RZ7H 3S5ZA 1EFXA 2DLFL 4XN5A 4GLRI 4QRSA 4LCYA 5D1QB 1ROCA 4NJAL 3INOA 1VGEL 1K4DB 2GSIB 5HGBB 5KJRH 1S7XA 2I24N 4M4RA 2ZSVB 1JYVA 2DPKA 4FJZA 1P4IL 3DIVA 3UH8A 2V33A 3PHOB 5BZXA 4LLDB 4QHNA 3SYCA 1QFUL 2VDOL 2XYCA 4QRPE 1UJ3B 4UTCA 4XCEB 4FQCL 1EZVX 1T7WA 4W81A 5E94A 2J8UB 1ZVSA 2WXMA 3B8SA 3QDGD 3ZMEA 4HETA 4AOFA 1FDLL 2ZUQB 1F8TH 4G7YL 3C8KB 4N24A 4AJ0A 4UQ2B 1AO7E 1YNKL 2NQ3A 3HCVB 4YGVA 4CSPA 3I9AA 3K0WA 5AG9A 2ADGA 2A4ZA 1PF3A 4LIQL 4DHLA 2E9BA 4WF7A 4AV4A 1LO3L 2D2CC 3Q6GH 1RZFH 3KPMA 1N0LA 1AQDB 3ETTA 5DT1L 3VWKB 4BZ2H 4NQVB 1RHFA 1ETB1 2VDMH 3QUZB 5GSRB 3D3VE 4LDEB 2YQBA 4OF3A 2Y1ZA 3UPRA 1BGXH 4W6YB 2QLVB 2EEFA 4GG6B 4ZUWB 3T0BA 1NWOA 3DYMA 2ZKWA 4I8DA 5C6TH 1V3JA 1QRKA 3VUAA 3RNQB 3WN5A 5D70L 1EERB 1WZMA 7FABL 2JJVA 4WUUB 4ABUA 5AKRA 1DO6A 3FTGA 4JDVA 4O9HH 4K71C 1FG2B 3ZHNA 3IDIB 5AUMA 5I6LA 4DP0X 1VB9A 3CCHB 3E38A 4WWKA 1F3DH 4LF3B 3U9PH 4ODSL 3BPNC 4NQCA 5DD1H 3N0AA 1MCOL 3LXCA 4JRYA 5FYLE 3S0PA 3M46A 3KGUA 4ZG1A 2OZ4H 2NT1A 4HF5L 1I75A 4HJUA 1AS6A 1BBDL 4QGTA 2AS5M 3QHTC 4PJEF 1CD0A 4Q14A 3ESVF 3NIGE 5B39G 1XIWC 2IBZY 4ZPTB 4UU9A 5KVEL 4Z7QE 5J8OA 4DTGL 4YHNB 4LPTA 3BSZA 4W68A 3IDGB 1Z0MA 3Q8EA 1LK3L 1MH5B 4MQTB 2NXYD 3GS0A 1W8EA 3LY6A 4B53A 4EI5A 1ANUA 3LRKA 2ZOOA 1XTMA 4RA0C 3WD5L 5C0FB 3BKJH 3OTTA 4XO8A 3GMNB 4HS6B 5GGSA 5LGYA 1SHSA 4BXSV 2PPDA 2YMXH 3QIWD 3PF2A 3M1OA 3GLEA 4FG6C 2V7NA 1WUZA 3DVGB 3KLAA 3OAUH 4LAQH 1EQWA 1QMUA 1MF2L 3P9LB 2VAJA 4D0DB 2AJYH 3C60C 4LCCC 3RNKA 1M7IA 3WTTA 5AL0A 2WKOA 2EUWA 1T03H 3K6FA 1OM3H 4TNVK 2Y07L 5KOVC 3RX5A 3VB8A 2CWRA 4X50A 3DARA 4WUKH 2R2EB 2QL1A 3EYUH 5J1TC 3VFOA 4YBQC 2W0KA 1OM9A 4X0KB 3BT2H 1DVSA 2F53D 3LN5B 4PG2C 3MRBB 1JHKL 4PBXA 4GAYB 1OAQL 5A6MA 1EJ8A 4O2FA 4APQA 4JFQA 1HH9A 2QQLH 1SLUA 3QO0A 5IVXA 3L9RB 4ZW5A 4NT6A 3QUYB 5T5FL 3RWEA 1JPSH 3SHSA 1KF9B 2ADIB 2YUVA 4A2EA 2EYRB 4F57L 4Y9FA 4C56E 4PYGA 1A6WL 5K9OA 3BWAA 3BUDA 2K4WA 3S3JA 4J3OD 4NQTA 1VDGA 3HE7B 1A6AB 1CDUA 5GHWH 3MV7E 3HC3L 4CDHA 2AMGA 4JGNA 3U6XS 4LFHD 3MXVL 3QQ4B 1KB5H 3DJ9A 4JS7A 3WDIA 1XGQB 5EU7E 2QKSA 2PCXA 3WAJA 4LKCA 2BC4A 2FBJL 2YD7A 4K55A 3PWJA 2AK4D 3K72A 4GAGL 1KBBA 4P59H 3BRFA 2EVJA 3Q44A 1G5GA 2F8IA 2JH2A 3SY6A 2MKLC 1XF2A 4I13B 3NJIA 3N40F 4ZFZA 4Z0BL 2CO6B 1M9SA 3BAKA 2XWTA 5CJOH 4M61B 3FH8A 2CXKA 4PS4H 4X8JB 4UT6L 4BGLA 3ARDD 3WNIA 3ILEA 4NZRL 3ULVH 1A7QL 2XRAL 3WDHA 5J6GA 1JPEA 4PLKD 1WRFA 1T3FB 2R1YA 5BO1H 3V5DB 3RJQB 4AYMC 4XN1A 4L4JA 4UM9D 1DQIA 4YDLC 2DQFB 4C56A 3QH3B 1K8IB 2IBGA 4N22A 2ZWKA 1NDTA 3WUWB 5BZZA 2ZXBA 1T4KB 1BOGA 2E56A 2RGSA 4K94C 4KZEH 2J88L 2BMKB 5H37H 1U6AH 2H9GB 4P2OD 3WEXA 5MEPA 5CEXB 4M43L 3CPUA 4MA8H 5D1XD 5EN2B 5HHNA 5C9JA 4WNSA 2IWFA 5AOMA 3TBYB 3VFWB 5ICYA 4JFDB 1FZMA 5FGBC 1DEEA 4XAKD 3D4YA 3CZUB 2E74C 1I8IA 5E6RB 4J3UA 9CGTA 4XMKH 5ISZB 1U30A 2CRIA 4H26B 4A7UA 5E5LA 3GDCA 5FEBA 4PCSA 4ZUUB 2N7BA 2ICWB 4OCRL 1CGTA 2D0GA 4MSWA 4XXCC 1U3ZA 3X17A 3FB7A 2YARA 3D4GA 5DGRA 1O5PA 1JZJA 2B8OT 2Y25A 4LAJH 4MCNA 4Y1TA 4EN3B 5C2BH 4NKIH 1J1PL 4OJFH 3SKMB 3TPUB 1M7DA 5B8CA 3P9MB 4H5SA 3RWGB 3UIYA 1MELA 1R3LB 1R5IA 2L4OA 4TOYL 1JGLH 5DD3L 4X6DE 3SGJA 2PO6C 1YYML 3N44B 2MNUA 4K15A 4ALAL 4UIKH 3W2DH 4LHJB 4RGMB 2A74A 3MV01 2JF1A 3W11C 4Z7OF 1ZV5A 3B5TA 1PD0A 3MBWB 5AW2B 5AW5B 4FQ2H 4P23D 1VFAB 1JZ2A 1WA2X 5ABZA 3S8WA 1EXUB 1N64L 3BWUF 1Z1WA 1IILE 3NTCH 4JFWA 1YDPB 3IJYA 4U2ZA 2F54D 2QSCH 3BVWA 3BAWA 4NGHL 4ZXBC 5I24A 4YL9A 3EXLA 2FJGA 2E7HA 5E5UB 1DJWA 4FGMA 3J07A 1OY3B 4M7LL 4FFWC 4BUGA 2JJSC 3NAAL 1BQSA 1R24B 4HUWA 2CDFA 1B3IA 3O2VH 5F6IC 3MNVB 5FHBH 5IF0B 5CEYA 1BD2B 4J27A 3FMGL 1JXKA 1GYVA 4PGDB 4H0LC 1U8NA 2XYBA 3NCXA 2BVEA 3FFCB 3TBVB 2K0RA 2AXFA 3SBWC 5BS0B 3F7QA 1MEXH 2Q86A 4QUOA 3VMNA 4IBUA 4GXUN 1VZIA 5FFLA 1IE5A 5CMAB 2ZSWB 3C2SA 4UAOC 2V5TA 3BUBA 1OKEA 4P5KA 1PQZA 1MJ8L 3DX8B 1Q72L 3DIDA 5CZRA 4GQPH 1AMYA 1V7MH 3QJOA 5FYLH 5E56A 3OX8B 3G5VB 1S9YA 5KYYB 3QEQD 5JW4Q 4B9YA 2QPUA 2D31B 1AJ7H 3DOSA 3KGSA 3IJEA 4G9DB 1YYLL 4IOIB 1I1YB 3RA7H 1ZT4A 5DRXA 4LBAA 2E6JA 3PWLA 4AM0A 1SEQL 1JXJA 4OFKA 1T22B 1AR1D 1CTNA 2UY7B 2VR9A 4TQIA 4OGYL 5IEKA 2ENSA 4EO5A 3HG2A 3KGTA 2NRDA 1TJXA 4HGKC 1LDPH 3NFSH 4F8OA 2E9IA 4U0RC 2F61A 5LBSH 4UOZA 2AJ3B 4JFPB 1KEML 3MRKB 4NM8H 4GO8A 3FO1A 1HWHB 2CDGB 1FSKC 4X0NA 5I18L 1BVZA 3E9TA 4KRLB 3SDAC 3C08H 4H88L 3I9GH 4I9XA 3MRIA 4IK7A 3FRPB 2N4IA 3KPRD 3NIDE 1EXHA 1D5XA 4HUCA 3U0WH 3NFPB 1CFTB 5JNYB 1JRHI 5EOQL 4CVXB 1DVYA 4G70B 4YXHL 1TJGL 4N6QA 4U1HA 5HD8D 1RZ8B 3QQXA 2Y6TE 4EIBA 3WIAA 1VRSA 1D3CA 5ACZB 2XX0A 1CZ8H 3K2KA 3MVSA 1T6VN 2VQUA 2W60A 4W1TA 4N20A 1WO2A 2VZTA 5DJ2B 3FCGA 4KMTH 2EQDA 1A9BA 3I02B 5EZLB 4Z7QF 5EIVA 3T6VA 3WKNA 3G6AB 2X3BA 5IVXF 3VFNB 4U6TA 3ILQC 2WBXA 4OB5H 4UQDA 2DYSB 3O4LE 4LL1A 1TTBA 4MLIA 1BZ8A 1E90A 5B1KA 2TRHA 4MNQB 5EU6D 1MIML 3APNA 1DQJA 4K23L 3GXNA 3IJHA 3LEXB 5IVZA 2IXQB 4PS7A 1VLXA 1WUNT 2APSA 1U41A 1FFPA 1CTOA 5GZND 2CBTA 5BCAA 5JW3L 3THML 1PNDA 5L0QC 2B20A 4YQXL 2I32A 3LKPA 4MHHG 4Q97A 2ZAHA 3PHSA 3EJYD 4CC1A 3VFSA 4BUQA 1JTPA 1KEGH 1M71B 3TVMA 2XDHA 4U1IB 1OL0A 2ADJB 5DURB 1EUTA 4Q6KA 2EDJA 1UTDA 4ZK8A 1FGNH 4MNGA 4I3SL 1NCGA 5F2FA 2X9ZA 3GQFA 4MJ6B 3ZHDA 4KQ0A 4TV3A 5BUPA 4X4KA 2BNRA 5I1DB 5CD5C 5C0BD 3TP4A 4X83A 1KN4L 5KN5B 5DQ9A 2BCMA 2AI0H 2XC8A 4R0LC 2BP3A 4FNUA 4HH9B 3VXOB 2VL5A 2Z4TA 2FX7L 5AW9B 3MNDA 3U1QA 2X12A 4JJHA 4XAWL 1TZ8A 1OARL 2PYFA 3ZJAA 2OI9B 4ZZFA 1JHTA 2HA1A 2JB5L 2J7LA 4FRWA 5ILTH 3IGAA 3V0VB 4XBPA 1MW0A 3TA4D 4X6FB 4YWGL 5DHVA 1W0VB 1OW0A 3UTTD 2X0WA 2I7SA 1OT1A 4PP2B 3LZPA 2ZJSH 2NUPB 4WDIB 1NGXB 2BS9A 4ODUB 1L4IA 2XG4B 4AH2B 1JZEA 1QI4A 5BQ7B 4OLZL 2O6EA 2JXMA 4MGXA 3QPKA 5MEOA 3H42L 4OM0H 3UX9B 5KJ7E 1RUQL 2GIXA 2Z64C 2X4OA 3QUKA 1XF3B 1NBZB 3DXAB 4WHDA 2BY0A 2DKUA 4NRXB 1WIUA 4N8VA 2E8YA 1NSNH 4LVNC 4RFOH 5CCKH 3FQXA 1KPRA 3PGFL 4JJOA 5DJYB 1CK0L 3WNLA 1HKLL 3C6LC 4PGJA 2Y2WA 3APFA 3HI6H 1PCXA 4XPAH 4AEEA 5KVFH 5J12B 1C7SA 3SPVB 1QRNA 4PJCB 1FFQA 3DPBB 3WTSA 5LJYH 5JIDA 1A22B 3U82B 2EE3A 4NNXB 4BK8A 1H8OA 3C5SA 1C5CL 1JFQH 1HCFX 1VJSA 2F5AL 3QRFM 1S78D 3MRFB 4XP6L 4Y4KD 1S3RA 1KYAA 2C9XA 1T5WA 3CD4A 3VXMA 3WNOA 1I9RH 4EKXA 4OR1A 4LCWE 3TO4A 4K7FB 4YXLH 5SV3A 1X5HA 1RJCA 3R1GL 3MDJA 4QTIL 1Z7JA 1RIVL 1QEWB 4LSPH 4NCC1 4HMEA 1RJLB 1RL1A 2OQJA 4RBPH 1RZJL 1UA3A 4N1EA 3OKMB 3IWVA 2HTLD 4BSJA 1FIGH 1ZANH 1E8YA 3ZKND 2WGNB 4PHZA 2G2RA 5I74B 4JQXA 3HMXL 1ZMYA 2ZUSA 5E8EA 4DGYH 1M4KA 2ZUYA 4JM2C 1GYCA 3BGMB 1NLDH 4PRPE 3QSKB 4I1NB 4X6DF 2EUXA 1AQKH 1TEGA 4HEPG 4BCZA 4GRWB 5A6LA 3RZCD 1ILSA 2W9EL 1KGIA 5GZOA 2UXTA 1FVCB 3OMIB 3GFUA 1A2YA 1A3RH 4S10A 1BSIA 4XTRC 4DK3A 3UZEA 3OPZH 3EBGA 5GRVK 3BFOA 4B50A 4YSRA 2W0FA 1EVTC 3B3IA 3I6GA 5B38B 2EVGA 1A6ZA 1CDJA 4OZ4A 4PJBE 4WCYH 4RMUA 4Z95H 3X11A 4F20A 2NNXA 4XXWA 2G4GA 5IREA 4ZD3L 4MJIE 4IMLA 4PW9A 3SGEH 1ACXA 2A6JA 3LXUX 5GGRY 3RGVC 2WY3B 3QUML 4FQQB 4TNFA 3IU4L 3TCTA 3RAJH 3BUTA 3HFMH 2D3LA 3S5LA 1EGJL 4DZBB 3O6FA 4ZOAA 3FTSA 3QCTH 2CDEA 4XP1L 3QUXD 4EIUA 2H26A 4PB9L 4XVSL 2YR3A 5A2CA 2GSGB 1N68A 2PYEB 4GBXA 4PJHA 1R0AL 4GLRH 3X12A 1FH5H 4BSVB 4L05A 2R56L 4PCTA 3IVKB 4FQXC 1H0DA 1PJWA 1A7OL 2PABA 3QORB 4I18C 3ENEA 4R26L 1IQWL 4HH8A 5DYFA 2GK0A 2VW7A 3U4KA 1TLKA 3GJFH 4XODA 4ZJ9A 4J7RA 5F7BA 3DJTA 3ROLA 2Q76A 5GSVA 2XTJC 4JFEA 2CALA 1D9KA 4HGWB 1RULH 3WMQA 2P7TB 5GGUA 2G60L 4RRPA 4LE8A 4HC1L 1N59A 3V6FA 1QTYT 1BZDA 5K59F 4NQDD 1SXZA 3KH3A 3MRQA 5CJQL 2CKBH 3OB0H 5DZAA 3BIKA 4TPRL 2IH1A 1OAXL 1YMHA 4KROD 4B7IA 3FHAA 3UBXA 3HNSH 3WHE0 1H9DA 4HAFA 1YNLH 1Q0YH 1ESOA 2F0CA 5KG9A 1D2PA 1F90H 2PF6A 1DFXA 2X6BA 1QKZH 5D7IB 1HHHB 3VD2A 3ZHFA 3D1MC 4TUOB 2MQ0A 1OCWL 1Y0LA 3NCWA 3K8KA 5F89B 3NIDF 1WFUA 5ANMA 1NGYA 2ESVB 3MXWH 4O02L 1ZLVH 2V37A 1MFVA 1O9VA 5AAWC 4G83A 1U91B 3A0OA 2QPSA 4YDIH 5BRZE 3MRCB 2FD6L 5C0RH 3IGFA 1S3KL 2E7LA 4V2CB 4WW1A 1OHQA 1EEZA 4OCSH 4DN3H 1YNTA 2XV0A 4R90H 5D7KE 2DQUH 3QQ9D 1QO3A 4OTXL 1NC2B 1RZGB 3OR6A 4X9IA 5DJDB 1J8HB 1TZAA 5FO7A 2P5EB 1F6AB 3ZQXA 4Z3IA 5JHDD 3L1GA 1JP5A 1UWXK 3FU0A 3QFDA 5F1KC 2NW2B 1KXVC 4LL4A 4NWTH 4QJ5B 1DUYA 4PRHB 4V2BA 4B3VA 2QVTA 3PV6A 4ZMWA 3GSNA 3LIZH 4GQRA 3KPSB 2NNAB 5E8DH 2QEJA 5FFOA 3T65B 3WI9A 4AE1A 5FKAB 1SN2A 3MLRH 3LN4B 1T04B 1NFKA 3GUTB 5FB8B 4IGBA 1SJVA 3SE3A 1INQA 1IQDB 5J9PA 1D7BA 4Z7WA 3MZGB 2PCFA 3KYNA 2WXOA 4NLAA 3UJIL 4XP4L 1MHPH 3EDKA 1A1OA 3NH7L 4LVHB 4E9LA 3UAJC 2R2BA 3EJUA 2BSDA 2AEOA 1U2YA 3D85B 3CFEA 3IAQA 5FIEA 3UABA 43C9B 2FLMA 4YSQA 4FADA 4L5FE 2Q3XA 1AZNA 3MMEA 3P0VH 4G6JL 4LLYB 4FYTA 1MHCA 1C5DB 1GZQB 2GUYA 4KU1A 2WO2B 1P84K 3CDCA 3L1EA 4KH2A 3GJFK 5CF3A 2MCMA 4F92B 3V5KA 3TN0C 4W9LC 3S2AA 1RZIB 2R59A 2D0HA 4CU6A 2R1XB 1DVQA 3QPXL 1CXHA 4FP8H 4WI0A 4F7TB 2ITDA 1Q94A 4JR9H 1QR1A 3S88H 3OB0K 1CFQB 4LNRB 3H85A 3SO5A 2P5PA 2Y24A 9PCYA 1J12A 2Z0BA 2GHWB 3D2UA 4HUXA 4WENB 4DEUA 1R47A 3BE1L 2Z8VC 4L0YA 3VE0B 2E7CA 5CP7B 1L9TA 4L18A 4RZKA 4Y2DD 5C8JB 4L8SA 43CAB 5FV1L 2MPVA 4YJZL 3HS0B 1XIWB 4DERA 3KLHC 4HSQA 1G7IB 3JWDL 3QDGB 2VH5H 4FX5A 1B0GB 1HESA 4KRPD 4S1RH 1Q0EA 2IPKB 2LTQB 2XVGA 2CJ3A 1DLHA 4EUPG 5H8DA 3D25B 4UQ3B 4BELD 2ZE0A 2VE6A 4DP8X 5I5RA 1KIQA 1TENA 4M7JL 5CINH 1XB6A 3OXRB 1RUAH 1R5WB 3C9NB 3EJTA 3KXFE 5C7ZA 1SQMA 1NEPA 5B3JE 2VLRA 1I7TB 1SUHA 2JLLA 2OV0A 3DYOA 4WEBL 1W72B 5FYJD 4OM1H 2JKWA 3BVXA 2VDRL 3GMLB 4XHQA 3PQYE 2Z8SA 1U8IB 3HE6C 1LEKB 1T1XB 5IBTH 3TO2A 1AHKA 3WJJA 1A9EB 4FA7B 1F13A 3J2PA 3O6MH 1OP5K 5DI8B 2IAMC 3L1OH 4UBDD 3NP3A 4AIOA 1Z3GH 4GNKB 1PG7L 4JRFA 1MI5A 1A6VL 2M8XA 3ZRSA 1OK8A 4CVZA 2Z0UA 2WIIA 3BH8B 1UZGA 4WWOA 4E9VA 1DBBL 2ZF8A 5IV2A 3MRHA 4J3VA 3VXRA 4YDVA 4F2MA 1GSKA 1MNUL 5IB4B 2JK5A 1LL1A 4H0GA 4P57B 5EWIL 2DQJH 4HKJA 3VQMA 4AL8C 1PKQA 1ZLEA 1JNJA 4R7DA 1N67A 1HTYA 1UD4A 2Z8RA 4YHMH 5TH2B 3NIFE 1IBDA 3N6YA 2NYYD 1HZLA 3P4MA 3OXSB 2R8SH 3QCVL 2YPVH 4Y4HA 3ZKXC 5JUEH 3UG4A 2P43B 4ZUVA 2X4QB 4X4XA 3GZKA 3DO3A 4KJQD 4NSKA 2FZ3A 1PZBA 2XXGA 4PJ5A 2WAQA 2Y1YA 2VQTA 4JKNA 4LRNL 2I25N 1ZGLA 5IMKA 1KYOK 2Q7YB 2AGJL 3QISA 3FRUB 2CBPA 1J87A 3JYCA 4RMVA 1VESA 4PJHF 1AXSA 2NXYB 3QCUL 4P2QD 2O61B 4JG9A 3QIBC 4H0HB 3MRRA 4L3CA 4X8XA 4HWBH 4E9RA 2COVD 4HPYH 4DVRH 3IDMB 5D2NE 3NJJA 2XG5B 3IJ7A 3V4VA 3QIWB 3IMVA 3MRNB 1JHLH 3DSFL 2VNCA 4CN4A 4LOUC 1S9VA 3LH8A 4PJBF 5T5NF 1F00I 1FCGA 1UOLA 2FGWL 1KCVH 4J6RL 3EDFA 5GRJH 5TQ2H 5FS5A 1YEDB 3JUYA 1MIEH 5K1VA 5D1QE 3G5ZA 1WBZB 3KBPA 5CILH 3QHZH 3HNVH 4MQ7B 1J11A 4IU2B 1ASQA 3B4NA 5IQLA 3UOAB 3GB7A 4HZ1A 5AAMA 4K5OA 1CICA 1J5IA 1NCBH 2GK2A 5JPNB 2F53B 3TU6A 1XR8B 4N8VG 3J7HA 2RIKA 2FUQA 5AKSA 1OF2B 3T2NL 5L6YH 3EH3B 4POUB 2Z92B 3HC0B 1G94A 4P2RB 2QV4A 3CU1A 1FGVL 5HVGB 4PY8J 1DDHA 2C9PA 2DL2A 2EVFA 4F37F 1DLFL 4L0ZA 1ECZA 2GG1A 2EP6A 1BZ7B 3KNBA 4TSCL 3EDJA 4U1GC 1UOKA 3AXHA 4AEIH 4G7VL 4N0YH 1SF5A 5J11C 2VR4A 2WLIB 3KLLA 4X9GA 2XKNA 1LQBC 1ORSB 1JCKA 2P5WD 1IGFH 4BFRA 3ZHLA 3BZFB 3QAZB 5IOPB 4ZOEA 2VDLH 1ZA3A 2KH2B 3DMMA 5D8JH 4GG6E 1K4DA 2LU3A 4Y16A 2BVYA 4JO3L 1I1FA 3QIUD 2WZPA 1FNGB 3VFVB 1GGYA 4PV1C 4M7KL 1KY6A 1JD9A 3PHOA 4ZXBB 4CU8A 4WUUE 5L2JB 1DQLL 4XCEA 1WISA 4UM9B 4WO4D 2J8UA 4MMZC 4IRJC 3RWJA 1ZHKA 4HJ0C 5F6IB 1EHLH 5GS3A 1GJIA 1RSYA 3B9KC 3N9GH 4F37K 5A2KH 4P2OB 5D4IA 5T3XD 2H1LM 2DW5A 3EBIA 5D1XB 5ECJE 4YGAB 1QWHA 3O4OC 4OZGA 4MXWH 1J1OL 3VWKA 4CC4C 1KJ3L 5DO2D 3AGVA 1IGIL 4HIHA 3RTQA 2CO7B 1HSBB 1AI1H 3FUMA 1OOAA 3EYOA 4GG6A 5EO0A 3GS4A 4AMKL 1NPJA 4ZUWA 4N2HA 5IB5B 4LSSH 2NXZD 4AYFA 4NCDA 3IGUA 1QWUA 3IDXH 4GQ9L 3OR7B 3GSVA 1WWCA 3UO1H 4PGCA 4UI2A 1U4EA 1HH6A 1CT8A 3QQDB 1UH2A 3MO1B 4GMSL 1FG2A 3US1A 2LVEA 3U0PA 1EMTL 1H5BC 3CCHA 3NZ8B 4E42B 4R3SB 2VUKA 3D9AL 3U1SL 4JFOB 5F7LB 5TE4L 1FSKB 2FQDA 1GGCL 2O6PA 2A1WH 4ZNCD 3L6FB 3SPHA 5GS1C 3IXTB 4M8VA 1IC4L 4RRPG 4ZFFB 2BP8A 1SJHB 2F54B 5EOCJ 2VLJE 4AUJA 1UYWL 2XWRA 1NMCC 5EUOE 3GMPB 3O3DB 4ZPTA 3WXWH 2GUOB 5DK2B 4YHNA 3V5HA 4MAUL 5FCUH 1HHKA 5DS2A 3UBXG 1FYTD 1HJCA 3IDGA 3KPQB 2J57A 1YPZB 2EDOA 4AENB 2ED6A 1MH5A 1TZOA 2QT6A 1ZAGA 2KUTA 3SKUD 3S3DB 1FNFA 2DI7A 2D7TH 1F4XH 4ZOBA 1JZ6A 1CXLA 4HS6A 4MS6A 1I8UA 1GAFL 2JIXD 2YXMA 5HYJA 2FEEL 4WU7A 3K91A 4GAFB 4PJFB 3FK3A 4LGPB 4PIRF 1GKOA 5F6HI 1EIBA 4WV1B 4XB8A 4MMYA 2ETWA 5B21A 4IBSA 3PGCB 2KS0A 3FO2A 4HCIA 3MRJA 3LS5L 3DX9B 3FL7A 5C09E 3QEQB 3G5WA 3OHMB 1KSRA 1UZ8B 5EU3A 5L0QB 3GI8L 4YX2L 3L7FA 2QGEA 3ESMA 5JA8B 3L9BA 2E6PA 2X2YA 2R2EA 4HIXH 4UQAA 5B3JF 1JZHA 4ECNA 4X0KA 4A2DA 5DJ0B 1WK0A 2H32A 3AY4C 3LQZA 1IE4A 3MRBA 3ML8A 1AR1B 5EPMA 1EZUA 1KPUA 3H8NA 2AJUL 1IGCL 4TM9A 5IJVA 3S9DB 4W6WB 4HUKB 3UIZA 5BZDB 3QUYA 4OD3L 4H1LG 3TA3C 4AZ8B 2MPAL 2DI8A 3AQYA 4P2CG 4I85A 1IL1A 1CGXA 5I9QC 4I87A 1KFAL 3QEGH 5AVUB 3UAFA 5GS0D 1VIWA 4R0LB 5GISL 4WTZA 5DQJA 2XHNA 4GRLA 4MCZB 3KWUA 3V0DA 5ANHA 5JHLA 1O5DT 4JFDE 2IDQA 1IM3D 1G6RH 1MPAH 1SPDA 1T5XA 3T9WA 5B4MC 3MLSH 1ETA1 2L7QA 3ZT6A 3S37L 8FABA 4R97C 5ISZE 5AVWB 2EIBA 4U1NB 4AEHL 1I3RB 2E75C 4NN6C 3KJ6L 3CZSA 3G5YB 4FF9A 2J6EH 4X8JA 5IJKA 4MX7B 4B9IA 1XH2A 2XZQH 5J57B 1KTRL 3OZLA 1I85C 5HPMB 4FHBD 1HCVA 3MGOB 1UC6A 3CHQA 3AJ7A 1KJMA 4NDMB 4G8GA 1OSEA 4YIQA 1URIA 5JIIA 2QGDA 4P5MA 2DTMH 2R23A 4L3EE 4DSYA 2X4SA 1UM5H 5T3ZH 3AQDA 2CAKA 5EU6B 2ZXWB 3QH3A 5B7FA 2OTWA 1PAMA 2NY6D 1RK0B 3KG5A 4X80L 5K9KA 2CO3A 4J23A 1IBZA 1KCBA 4KKPA 4QY8A 2K3TA 2BVUA 2VMEA 4A2MA 1L0PA 1LK2B 4I88A 3MLZH 3DHJA 3MSPA 3ZW3A 1YLBB 4MAYD 2BDNH 1SMOA 1TMCB 1KNOB 2R0KH 2DLGA 3VFWA 4K8RL 4QAWA 5ESVB 1GY1A 3BKYH 2QFRA 1J8SA 4P46A 4HALA 3S34L 2WQ8A 1FPTL 5BUGA 2B2XL 4AQ8A 1JN6B 4MDIA 3MBEA 3SE8H 5C6WH 4BZ2A 5D72L 1ZT1B 5KVDL 4ACTA 3AT9A 4M48L 3JTSB 1MJJB 5C0BB 1BD2E 1HL4A 5F7EH 1NINA 3LDBC 3OC8A 2JELL 2VDKB 1W15A 2PETA 4PRDB 4UOJA 1N9PA 4EVNB 2PXYC 1PSKL 4X5WA 2QLYA 3SDXA 3L4TA 3BP5B 2J8UF 1I82A 3RWGA 4OKVB 5BS0E 4LP5A 1HZKA 1NICA 1TTUA 3IF1A 3B9EA 4QRFA 2WOBA 3RKDD 4C59B 4Z7VA 1J86A 1U95A 5EZPA 5C7XL 2JNZA 3UTTB 1HYSD 3O3BB 2HCZX 1MRDL 5AW1B 1VFAA 4JM2B 4XVTL 2Q3ZA 1FYHB 5A2FA 1EXUA 2EYSB 1CCZA 2NX5D 2AQPA 4KVCH 3FULA 3IT8D 2Y23A 4LHQB 3GMMB 5B3SB 1QSFD 3AW5A 15C8L 4GG6F 1NCWL 3HRZC 4TSBH 1AKPA 1XCXA 4Y7MA 2IPUK 1R24A 2F7QA 4XPFH 1NGZA 3WIIL 3CU7A 5F7UA 1TZGL 4ICXA 2YQ3A 1DANU 1PLGH 5FO8A 2Y06L 1E27A 3F83A 4TUJB 4O5LH 5BW7A 3FFCA 3OF6D 2AVFA 4JFYB 3M8OH 3LEYH 5C0CD 1ONQA 1R46A 1IVTA 1BBJB 4LO9A 4NKQB 2GC7C 4F7PB 2OMUB 1MWAL 4QJ4B 5FYKH 3GTNA 5AVZB 4P05A 2XI9A 3A6OA 5GIRB 5AD0A 3ALWA 3ELAT 3QDMA 3BKCL 4HD9A 4A68A 4OCMC 3U4BH 1R34A 2FO4B 1CXKA 3ZZQA 2ENPA 4HQQL 3LVTA 3EOTL 4XMWA 4F58L 3NGBC 1NDGA 1KLFA 5HHPB 2D31A 4LBEB 1D5MB 4BFFA 3S2CA 4FQXB 4G9DA 3KDMB 4I18B 1E4WH 3PE9A 4N8PA 5HHVL 1I1AC 3RX9A 2IGLA 5KVGL 5FUCC 2N59A 2XTJB 2D8KA 5E4IA 4BV1A 5KYXA 1THAA 4N2DA 2JKSA 3PDDA 3PDGA 1AQMA 1D5RA 4C83B 4LMQI 2GYSA 2PN5A 3WDJA 3W5NA 5CLTA 4LEXL 5DUMH 2BIQA 2RJMA 2EXWC 4H25B 4DP6X 2CDGA 1KLGB 4UIMB 1CO1A 1E28B 4Y19B 4PJ9B 2DM4A 3QZOA 1FG9C 4DPCX 3X2QB 3GTTA 5CN2A 1WVZA 2NY7H 2W38A 4LHUD 4TSAL 5DWPA 3CBRA 1CFTA 3FQ1A 4UQEA 2J4WH 3ARGA 2PTTB 5IIEA 4Y2OB 2OXGA 5H2BA 4PSRA 1RZ8A 4XPGL 1JMXA 3NFNA 3NYKA 4NS0A 2OPCA 3GSUA 3HUJE 2VLLB 3CN1A 4N26A 3C09B 2GITB 3I3EA 2BO0A 4WHTB 3HN8A 2XBZA 2A3TA 1CD8A 4JDEB 4J4PC 4YDKL 4HXAL 4WFFE 5L8LB 2HLAB 4D0CB 5KVMC 3G6AA 5F0JB 1FFNB 1XDTT 5HDLA 3K2UH 3ALXA 4GFTB 5TE7H 3ULUL 4KVPA 4ZX6A 1N5YL 1MFEH 3GHBL 1Q1JH 1CIUA 2LLNA 1KTDB 1ACYL 3QUXB 3TEXA 1UB6A 4EE2A 1MJ7H 4MNQA 2C3WA 2XA8L 3WIFA 4KVNL 2IGTA 4LDOB 2IG2H 2IXQA 2DQDH 2DMGA 2IF7A 5K69A 5E1HB 1ODUA 3SQBB 1RIHL 3QB7C 5AW6B 3LQAL 4XNMB 3ZUNC 5K39B 4N2BA 1YAZA 2XWBA 2Q6WB 1B88A 1XWVA 3F7VB 2P80A 2FSEB 4DP1X 4P5TC 4R4FH 1ZVHA 1M71A 2J1YA 2EDQA 5H37A 4NUPA 2X4RB 5IM7B 4R9HA 3CUPA 1IGYA 4XBEL 4AM0Q 4I3GA 1HOCA 3RFZC 3P3TA 2R1WB 1BCIA 3K1DA 3ULSA 2FH6A 1U8QB 1W0WB 3DXAE 4NQDB 3WAKA 2X10A 3HG1E 1CYGA 1L6PA 1DFBL 3DGDA 5CKAA 4HHAB 1JVOA 4P9MH 5TF0A 1MCPH 5ENWA 1F5WA 3D39E 2AANA 2EXTA 2DKMA 2JQAA 3PPEA 8PAZA 4UQCA 4FXLA 1KJ2B 1U8HB 3CAFA 5KANG 3SQOL 4Y1AB 3FU7A 4HWZB 3QQ3A 3WLWC 4WKXA 3C5ZC 1HXMB 1MFUA 1XGTB 4J39A 2Z31C 1FNEB 4XHJC 2HJLB 2ZNWA 2CHZA 1P4LA 3TZVA 4F3FB 4ALAC 2J5WA 2OMVA 3W38A 1W0VA 2BHYA 4ELKA 4ONFL 5DZOA 5JDJA 4NEHB 1P84J 3LKQA 4WDIA 1NGXA 3VTTA 2ZCZA 4ODUA 3DKHA 3R18A 4JUTA 3EOYG 3BAJA 1J9QA 3U9UB 5IEHB 1HILA 2O5XH 5EU4A 4E9TA 2Q8BH 3D08A 5JHDB 1FE8H 1ND0B 1NBZA 5D1ZA 4PGEA 5INCB 2I5YL 3DXAA 4S11A 1QSEB 4JQIA 2ITCB 2RACA 2V5SA 2YGQA 1L9QA 3L3JB 1H3VA 2JI2A 3AZUA 3TBCA 2DBLH 2UY6B 3L3DB 1IT9H 4XR8C 1AZUA 1BYPA 3GDBA 3B6SB 1U92B 1FVEA 3L08A 3K3QA 5HHXH 1BM3H 1PVHA 2HX7A 1JGEA 2VLKA 4JMXA 4XRCA 2YK1L 2ZONA 5LG1A 1P7QD 3HVNA 2IC2A 3SPVA 3VD0A 1MAKA 3N44F 2YHGA 4PJCA 4GRWE 5FM5M 4HLZH 5AZEH 4KNSA 1RZKH 2YKLH 4MD4B 2APWA 1U3HD 3V0HA 4RGNC 3WTUA 4NNXA 3UZQB 1CFBA 5LGHH 2YFOA 4OUOA 1HX0A 4AV5A 2IAMB 5E08L 2OL3L 3QBTB 2C1PB 4HWEL 3VI3B 2WVTA 4XMXA 4XO9A 3VXUB 2I7OA 3BAIA 4JN2A 4IKJA 4UV4H 2AMUA 4HJJL 1UWEL 3N50A 3V95A 3WJLC 3BJ91 4PRNB 1Z9PA 2OJEB 2CHXA 3VI4A 4HCRH 5C07B 2CR0A 2DQ6A 1FP5A 2QSTA 1YSOA 4QLWA 1SXBA 1UT1A