2AQRA

Cu/zn superoxide dismutase from neisseria meningitidis k91q mutant
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
155
structure length
155
Chain Sequence
ASIEVKVQQLDPVNGNKDVGTVTITESNYGLVFTPDLQGLSEGLHGFHIHENPSCEPKEQEGKLTAGLGAGGHWDPKGAKQHGYPWQDDAHLGDLPALTVLHDGTATNPVLAPRLKHLDDVRGHSIMIHTGGDNHSDHPAPLGGGGPRMACGVIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superoxide dismutase [Cu-Zn]
publication title CU/ZN superoxide dismutase from neisseria meningitidis K91Q mutant
rcsb
source organism Neisseria meningitidis
molecule tags Oxidoreductase
total genus 34
structure length 155
sequence length 155
chains with identical sequence B, C
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2005-08-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 2aqrA00
1SOSA 3L9YA 4FF9A 3KH4A 3LTVA 1JCVA 1COBA 3F7LA 1SXSA 2C9VA 1IBBA 2ZKYA 1Z9NA 4A7QA 2ZKXA 1XSOA 1BZOA 4B3EA 1PZSA 1U3NA 4BCYA 2R27A 1IB5A 1N18A 1Z9PA 2Q2LA 1Q0EA 3GQFA 2Z7UA 4A7GF 3SODB 1ESOA 4L05A 4A7SA 2GBTA 1JK9A 1F1AA 1OEZW 3CQQA 4A7GA 1SDAB 4BCZA 3GZPA 1YAIA 3KM2A 4N3TA 1DO5A 1JK9B 2VR8A 4OH2A 3MKGA 2NNXA 1OAJA 1TO4A 1AZVA 2AQPA 2V0AA 1QUPA 2XJLA 2Z7ZA 3KBEA 2VR7A 1MFMA 3ECWA 1DSWA 3KBFA 3QQDA 3KM1A 2Z7WA 1TO5A 2ZKWA 4U4IA 1SXBA 3GTVA 5KBLA 1SXAA 2LU5A 1SDYA 3CE1A 3F7KA 2Z7YA 2AQTA 2ZOWA 1F18A 1IBHA 2WYZA 5CU9A 3PU7A 3H2PA 1SRDA 1OZUA 2WZ5A 1F1GA 4A7VA 3S0PA 2AQQA 1SXCA 2JCWA 1P1VA 4MCNA 1HL5A 1FUNA 1L3NA 3GTTA 3L9EA 4OJAA 5KBMA 3KH3A 1SXZA 3ECUA 1XTLA 1OZTG 3MNDA 2WWOA 4A7UA 4MCMA 1EJ8A 1YSOA 1KMGA 1XTMA 2WYTA 3GZOA 2AQRA 2E46A 2C9SA 3QQDB 1S4IA 1RK7A 4A7TA 1PU0A 2VR6A 2AQNA 2XJKA 2AEOA 1SXNA 1UXMA 2AQSA 2WWNA 1E9PA 1F1DA 1BA9A 2WZ0A 3RE0A 2AF2A 3H2QA 2K4WA 1PTZA 4N3UA 1N19A 1E9OA 1CBJA 1E9QA 1EQWA 5KBKA 3GZQA 3HFFA 3HOGA 1E9PB 1OALA 3K91A 2SODB 4BD4A 3ECVA 1IBDA 2JLPA 1E9OB 1SPDA 2APSA 2WKOF 2GBUA 1E9QB 1IBFA 1B4LA 1UXLA 2WZ6A 1YAZA 3T5WA 3CQPA 1CB4A 2GBVA 2WKOA 1HL4A 3HW7A 2C9UA 2E47A 1B4TA
chains in the Genus database with same CATH superfamily
1L0PA 7PAZA 2CGRH 4IBLT 1ASQA 5D1ZI 5E0FA 1YJDL 4JO3L 5KW9L 1W91A 1IGMH 4E9SA 4PRIB 2CDGA 3BQUB 3ISYA 3UJIL 4PSPA 4AG4L 5I2IB 1QR4A 3B2XA 3MUZ1 1UA6H 4ZUUA 3FFCA 1FIGL 1JWMB 3IWVA 4RDQF 3V9EA 3FBQA 4IGBB 4EI5B 5E5LA 4P5TB 1MRDH 1QLRA 3WIIH 1HXMA 5KYWB 3JWDC 3IJ7A 3RGVB 2K6ZA 4L1HA 4N1CA 4ANUA 2ZE0A 4KTDH 5B1JC 5DRWA 2WAHA 3PHQA 3BPNC 2G75A 3QXVA 2BIMA 4Z0BH 1OAUH 2XN9E 4AK1A 2WWKO 4HUNB 3UG4A 3V4LA 4IRZA 2X88A 1M71B 5K59E 1A1NA 4QD2E 1F41A 4TQEL 3HE7A 2NXZB 2QEJA 4WFEE 5FYLE 3ZL2A 1EAJA 3TESA 3SJVA 4XMLL 1GZQB 3FO1A 2J2ZB 5DUBB 2F74A 2QQLH 3RDTB 1G7PA 4GO9A 2AJUL 2GCYA 3GF8A 3EJZC 2F61A 4BK5C 5T5NF 1VFAB 4MRBA 4Q14A 1HCFX 3PU7A 2BX5A 3IDGB 5L2JA 1AO7B 3O4LB 1ETZB 1IM3A 1U8JA 2D7MA 3FZUD 1ADWA 3OF6A 4ZUVA 3EG9A 1T3FA 3ULVD 5DURD 3VWKA 4IRSD 3P3UA 3N42F 4KO9A 4WEEA 2P5WE 1Y1DA 3IFOB 3JSSA 4HK3N 2WUCL 4YHLH 1XO8A 1G7LA 3VGFA 3FQWB 4WU5B 3BYTA 3IYLW 3L4CA 3Q2CA 1RJYB 2PPEA 4MAYA 4OFQA 1EBPA 5HD8C 4GSUA 2EE9A 3DGGB 3D3VA 4JPVH 1HWGB 4FI7A 1EJFA 2KDGA 3GMPA 4EZKA 4UT6A 4BUGA 2V5YA 4XCNA 3ZKSD 3CPUA 3ZTJH 2E7HA 1JD7A 1HHGB 4E5XG 1WC7A 3CXFA 4QIRA 2WZ0A 4O02L 1MJJA 4YHZH 1G84A 5LGJA 2VR4A 2GJJA 2XV2A 4PHZA 3WUWB 3VO0A 1XGQA 4UAOB 2CHXA 2A74B 1H8OA 3AM8A 2WTRB 4FQCL 4PBXA 5IQMA 5D2NE 5KVEE 2JIXB 2OP4L 2V7HB 5IW6B 4M4RA 5MEND 2BHUA 3CC1A 1DBKH 2A6DA 4M5ZH 3V6OC 5I30L 4M7JL 4Y2DB 1XGTB 3I84A 4X8CA 4GH7B 2E9WA 3DMMC 4AKOA 1YNKL 4ZMAT 3BVNA 2YUZA 3B7RL 4X99A 1G7QB 5CLXA 5AVTB 4IEFA 1RI8A 4ODVH 2UYLA 1U8LA 4OZGA 5F96L 2VO5A 2WNXA 4OGXL 1I8IA 5D1QA 1Q9WA 5EBGA 3VDAA 4FXKB 3KWUA 2X44D 5GQBA 5F8RC 5GPRA 4IYKA 5KANI 4NC2B 2W80C 4JO1H 1OGTB 3FT2A 4TSAL 5EUKB 2Y2WA 3DVIA 1U92B 2WBKA 2JCCA 2X9XA 4EVNA 1BBDH 1ZHLA 5ADPH 4JHVA 5AAMC 4Y0GA 4WK4B 1SDAB 1LO3H 4KDVA 1CDYA 3GZPA 1GZPA 4NN6B 4JN1L 3UMTA 4NKIH 5E95B 4OLZH 3HFMH 4YBQD 3BH8A 4ZD3L 3C6SB 1UWXK 3F00A 4X8JB 1A4BA 3OG4B 1U0QA 3U4AA 5JO5A 1AKJD 1MJ7L 2QL1A 3KLHD 1CDCA 4GEJA 4L0PB 1XSIA 4BXSV 2WB1A 5CEXA 4JO4L 2DZEA 5HHPB 1U42A 5ALCH 2E6JA 3GHEH 5SV3A 4K71B 2AJXH 2NT1A 3MV7D 3MOQA 3AC0A 4FYQA 3PWVA 4DW2H 3BD4A 3DX7B 3OB0H 2FIRT 4JQVC 2IGFL 3ULVE 3F7QA 3NVQA 1HH9B 3QWRD 4QTHA 1O7VA 4I0CC 4PP1C 3ERXA 1ASPA 3BAIA 5ISZD 3PJSB 4KXDA 3U4EA 1EZVX 4NO5B 4JAMB 5LQBH 4U1JB 2WYTA 3F7PC 4HIIB 3VXQB 1JUFA 1Z66A 1A6PA 1CMOA 3V0WH 1FAKT 1LWHA 3W0WB 1ZEAH 1TVDA 5FHBH 3F12A 2FJUB 3UCRA 4M1CC 2C7UB 3FQRB 1T2XA 3ARVA 1JGVL 3VFSA 1IQDB 4PLOB 4LNRA 3UO1L 2EE2A 2XV0A 1FNFA 2YD5A 3AXLB 3D48R 3HCVA 3HBPA 2DOCA 3QZMA 4OQ1A 5CFHA 1PTZA 4OCLC 4QO1B 4ANKA 3QYNA 5MENE 3BC9A 2O5XL 1PAMA 2EDYA 3QJSB 4LPUA 2K7PA 5F7YC 3MJ6A 4TTDD 2UZIH 2ED9A 3T0EA 2XKNA 4LVHC 3RKDC 3T0WA 4QAMB 1QPKA 1S3RA 4PGEA 4BH7B 1G1KA 2V9RA 4XNQA 1FO0A 4JFHD 4LHQB 3VGEA 3FT4A 4EE2A 5I6NA 2GQHA 5E2TH 1XF2B 3C8KA 4XNZC 1V3LA 3V95A 3ZYIA 3GMLA 3KJ6H 4GKNB 1G87A 1TYRA 4Q89A 1JTOA 5AVUB 4JZOA 5EC1B 1MCNA 1PSKH 5IQ7H 3KE0A 3OXSA 3APCA 4DOHE 4H8UA 5HJ3A 2OSWA 2V5RA 3MLSL 5K9OA 1NAMA 1I1CA 2VMEA 3NSJA 4XRCA 4POZD 5FO9B 2CWRA 1CTOA 3E8UL 5HYSG 1HXYA 4I13B 3KEHA 3AWEA 4GKLA 1MFBL 1BF2A 3IJYA 4QF1B 1EH9A 3MLRH 5DA0B 3RI5F 1VA9A 1V7ML 4P2QE 3OQ3B 3QRFM 3D85D 1D5BA 1GAFH 1S5IH 3NSYA 4LLWB 3IU4H 3KDMA 2YBRB 4OGAC 1Z5HA 2CRZA 2V5MA 2H8PA 4TSBH 4XP1L 1DLFH 1X4ZA 2LR4A 4ZUUB 1SBBA 4LARL 1NCBL 3HG3A 3IE4A 1HXMB 3PIQB 2IG2H 3KVDD 4M1GH 2JJSA 2XCMC 4PJBE 4YDLC 5D2LF 3R7RA 3ZXAC 1A6ZB 2D03L 2IPTH 1DVQA 1VGKA 3BIKA 3FTUA 3GK8H 3DDGA 4QRUA 4DGYL 5KBMA 5HYFA 1OV8A 3MCG1 1P2CA 1I8LC 3DUUB 4P0DA 1J18A 5HGBA 5FYKE 3KZ8A 4FG2A 4DN3L 1U95A 1QOKA 1TEFA 4E9VA 2XZZA 4GUPA 3P0GB 1D5MA 5D9SA 3TFKC 2EDHA 3FUHA 4N9GB 2X4SA 4EN3B 4PBVC 4X4ME 2CMRL 4AITA 1QTSA 5JXAL 3FO1B 5CJXA 5HI3D 4I48B 3V0HA 5DVMA 5I76B 1A3LH 4X5WB 1MI5B 1J48A 5L0QC 1NH6A 1VPOH 3D18A 3D2UD 3GJFB 4WSKA 3TYFA 2TSAA 1MJ8H 4LAQL 2UY7A 3ZT5A 3EYOB 4DZBA 3LVTA 4TVPL 2CHDA 1AKPA 4PJCE 1GGBL 1J9QA 3WEAA 1QLFB 1JZ8A 2CA3A 1KSRA 4IMLB 1KBPA 1IM3B 3LOWA 4JFHE 1XR8A 2VDRB 1K9TA 2ZX8A 2NY2B 1VDGA 4OJYA 4WY7H 1T3FB 4XE0A 3TCLA 8PAZA 3MLUH 4S1RH 3QFJE 4W68A 4KZCA 3S98A 4NLHA 3FHAA 4IS6A 2PYEB 4E9WA 4MS8D 5EU6A 4IHOA 1D6VH 1MY5A 2Q86B 2KHAA 1MHEA 1T7ZA 3SE6A 3KWXA 4MAZA 1JXKA 1RY7B 2R0WL 3Q43A 2JI3A 4ONHA 1VF5C 3GGWA 4GKSB 1A9EA 2Q8BH 4H25A 1MCJA 3L3OA 1OM3L 5E6UB 3GMPB 3L08A 4NJAL 2N7AA 4XCNB 3WJLC 5DWUL 2B2XH 3FQNB 2F19L 1TITA 3QCTH 4HKZA 1F6AB 5HPMB 1CDUA 4I3SH 4LLDA 4KQ3H 5G2NA 3BX7C 4TSCH 1P4UA 4Q52A 1ACXA 4HPYL 1KGIA 1PQZA 1HL8A 5BJTA 2WN3A 2D9QB 4UQAA 4G6FB 2X2HA 4CKVX 3DHUA 1KT2A 2ATKB 1AD9B 2FK9A 3MNMA 1SJXA 1V55B 3FUFA 1FNEB 1AMYA 3PE9A 3WNMA 1W8OA 5I19H 3B9KD 2WKLA 3DX2A 1LO2L 1OAJA 1JGVH 4LMQE 3ZLQC 4JY4B 5DMKB 4LP5A 3UZQB 1ZD6A 4XP5H 4P4KD 1GIGH 2X6VA 3DSNB 2EDOA 4EI5D 4BFJA 4Q9QH 1JIBA 4FE9A 1U8LB 4P5TD 1CF1A 1RZJC 3QI9C 2G2RA 3BUQA 1I8IB 3DVNA 3FONA 4X4XB 5D1QB 3RGVD 1Q9WB 1QBML 5I8OH 2GT9B 3MV01 1FH5L 4FN0A 3TU6A 5IB2B 4EQ2A 2ZOKB 3HN5A 3GBNH 1DJYA 2WM0A 2V8MA 3MUHL 2YGPA 5AEAA 1AZUA 1NCNA 1FFOA 4UAHA 3S96B 2ZYRA 4G80B 1XXDC 5IKCA 2NXZD 3BQVA 1OPGL 1S2EA 2XTSA 3ABMB 1GZPB 4NKQB 4KK6C 1HJCA 3PHAA 3RDTD 1I9IH 3T3PE 2J88L 3WIHL 1EZVY 3BPCA 4Z76A 4DEPB 2VDNB 2EDFA 4AC4A 4ZG1A 1NICA 5F1KC 5CEXB 2C1PA 1CLVA 1HEZA 1JPSH 1AO7D 1UXMA 2EKJA 4LSVH 3O4LD 4RA3A 5C0DA 1JHKH 1Z0MA 4FRWA 1NCDL 4MSWB 4U1IB 2Z31A 4G8AC 5KOVC 4O2CA 4CSSA 2BHYA 1XT5A 3K4DA 5EC2A 4EDXA 2VLKB 2DTML 5C6TH 3MRMB 2BCMA 4JW3A 2A6JA 5BXFA 3JWNG 4MRCA 1J9SA 1MCOH 2ZOLB 2ICWB 4M7LT 2C3VB 4NQDA 2JJTA 2NSMA 2P80A 1TYJA 4JHWL 2HRPH 5E6IB 1MG3C 4M29A 2TRYA 4FMKA 5FYJD 5ICUA 1NGQH 2CKBA 4JVPA 3GLDA 5C6WH 3OHXC 2EINB 2EADA 4BGDA 1X5MA 2FZ3B 3FUDA 5CGYD 3K2IA 4XZUA 3KMDA 3NIDB 3QYCA 4OGZA 4ZFQA 2BP8A 1JZ4A 1PF3A 1MW3A 1ETJA 1J7VR 4IK7A 1FZOB 3O9WB 4Y2DD 3HCVB 4DGYH 3L3KB 3WJMA 2NQCA 1WDAA 1RZ8B 1H6TA 3JWOC 1EX0A 1SYVA 1U8OB 2ZUQB 3FL7A 4G8GA 2R2HB 1CJYA 2EIJB 1D9KA 3O3EA 5JOPE 4JPQA 3V0GA 1R33A 5K33A 2G4GA 5JORB 2E0PA 1DVTA 1KTRL 4B3VA 1MHCB 1JZ6A 3HN8A 5D72H 2OTUA 2AJYH 2YMOA 3C8KB 1KJVB 5I5JA 3UAAA 3BZEB 4TUJA 2DQJL 1FFRA 2AJZB 3GMLB 2P45B 1UASA 3BFWA 3SDYL 4NQVB 5E1GA 4LAQH 1SY6H 3UGUA 4TVPH 2KC0A 3HE6B 3LEVH 3GSXA 1ZIBA 4P2RA 4X7SL 2P3YA 1F45A 2FWOA 3FRUA 1Q0XL 1KN4L 3RX9A 4DIXA 4RMTA 4D3CL 1RZFH 3MNZA 1AD0A 3WGVB 4ODTL 5DHXB 1NAMB 1Y18B 1NUNB 1G9EA 5CWSB 4M61A 5FOJA 5F7HA 1R47A 2AGJL 1BAFH 3PWPB 1PEWA 5EZJA 2JQMA 2ADIA 2AITA 2VIRB 3MLXL 4YR6A 5F7UA 4X4YA 1ES0A 2F8XC 4IOSD 4MCMA 2IV8A 5IVXF 1N0XL 5AW7B 2CKNA 4V1DA 4HWNA 4Q6IB 4FYTA 5AVVB 3DRQB 1DBMH 1S7SB 4N5ED 4OZIB 1BVNT 1AO7E 1G9NC 3LKRA 2NY0D 3HMXH 1D5BB 3IJEA 2B4CH 1W0VA 3DBXA 5AKRA 3HJEA 3HHMA 4LF3A 4ALAC 4AUUA 4WKZA 4I5BB 5D70H 4ZW8A 1IJNA 2H8PB 5KWYC 1AFVH 2EH8L 4F8OA 5C0CB 2KPWA 5K1VA 4P23A 4HJJL 5CCKH 3SB3A 3JTBA 4JM2B 1MUJB 1DLHA 2E3VA 4QY8B 1XL4A 1CG9A 1VGKB 1R24B 4PI2A 4QRUB 3W0WD 4BKTC 3D25A 3I6SA 5FYJE 1LO5B 3T5WA 3CFEB 3Q5YA 1VKXA 4WSJA 1EFQA 3L5WA 4KX7A 5EU3A 4KX8A 3FB7A 4POYA 3R06A 1KFAL 4BSVA 4GUPB 5JYMA 1C9SA 1A0QL 1N0LA 3ZHKA 5IFHH 3FFDB 4PG9B 3NDZE 3RZWA 4WW2B 3HAEA 4ZPVB 5IVOA 4G7YH 1MLBA 1NDTA 1DR9A 1IBBA 3BYYA 5GRWA 3K6SB 1LEGA 5BOJA 1N59A 3CLFL 4ICWA 1UXWB 3ULSB 5K9KB 3D18B 3FMGH 4LIQE 4BYHA 2Q2LA 4I9WD 3RX7A 3TP4A 1OPGH 3U2SA 3DOHA 1YY9C 1KY6A 4Y9GA 1TJGL 4DZBB 2BNRA 3PXLA 4OQTL 3L13A 3Q2WA 1FNHA 4ELME 1H3XA 3OAUH 1FVCA 1IC5H 4MBRA 3CC5A 4RA0C 2HH0L 4Z3GA 4I89A 1XR8B 4FAAB 4G43A 3BN3B 3BCFA 1AYOA 1HHKB 3UTSD 4YXLH 4WO0A 2XG5B 5EU6B 1AAJA 4ZXBC 1HU8A 4IHOB 2WZPA 2DYPA 1MRCL 3DX0A 3WD5L 3LS4L 1MHEB 1QVOA 5DJ8B 3ARBA 5ALBL 4LPVA 5BZZA 2OCCB 3EFDL 3L3OB 3QORC 4LESA 2YPLA 2OR9L 2APVA 2GFBA 5AAWC 4U7MA 1PW3A 3G9VA 2ORBL 2JJUA 4YHYC 1FGVL 1JVOA 5DWPA 3SGJC 2QV2A 4NC0B 1MF2H 1UFUA 4XO4A 3TN0B 2Y24A 3D0LA 4LLDB 2R2CA 1SJVA 3O8XB 5L8LB 4KKAC 1E8WA 2NXYB 1M56B 3OD3A 2ZKHH 2G60H 4WSGA 4WI0B 5CMAB 4C4UA 4PJAE 3W57A 1VIWA 5IB4A 4UM8A 2XTLA 5D2LA 3TJPA 3I3EA 2QR0B 3PV7A 4H8WH 3SE8L 5FM5M 6FABL 4FABL 1WEJL 3FQUB 1W8EA 2KBGA 3FFCD 4F7TA 4YSQA 3ARDC 4XN8A 4QR7A 4XTRD 3MJGX 1S9WA 2R51A 1CTNA 3FONB 2AS5M 1G6RL 3EGDB 1WZAA 1XZWA 3DVGB 4NN7C 2BVEA 4WDIB 1IILE 3ATAA 4C59B 3QDMA 3WLWD 2K4AA 3LXAA 5CEZD 3QXWA 1MCRA 2EVJA 3VVVA 1FFOB 4BZ1H 4AI7A 1FLRL 4YN3A 2YD7A 4IHBA 2B3IA 4NXSA 5IKCB 3RY6C 4S1QH 3S5ZA 3B7SA 3BGFC 3HE7D 3DGCR 5CZRA 2AJ3A 1F90L 4G8IB 3W9EA 1W72H 2XIBA 5I75C 3EO9L 4UZSA 4XB7A 2RTTA 5DMGD 4ENED 1MI5D 2ROYA 2YD2A 1KACB 1TTCA 3N42B 1ZLSL 4QTIL 5KG9B 2B9BA 2H9GA 4UIKL 3MRIA 1PX8A 2ADFL 1UWXH 1UH2A 3APFA 3T9WA 1YEKL 1RU9H 4I9WE 5I26A 2BDNH 5LB1A 3KPRB 5E6YA 2OMYA 1IM3D 5FK9A 3OF6D 5EIIB 5ETUA 4RMRA 4R90L 3QK0A 5KBPA 5HHMB 1ESOA 1D2OA 2HLEB 4OLWH 1R4XA 3TJEL 5AAPA 2C1OA 5EC2B 2APFA 3O6KL 1XMWA 1ID5I 4MAYD 4MZ3A 3UTSE 3X13A 1KXHA 1XHHA 2NY4B 5B1JA 3ZIMA 3CZSA 3R1GL 1DVUA 3PGDB 4BGLA 1HCVA 2FX9L 5IT2H 4JL1A 4ORZC 2ICEB 1IGIH 4BFEA 1GL4B 5I8EB 3E9TA 5G4MA 4I0KA 1TO5A 4ABUA 5T1DH 3VDBA 2PO6B 4AJYV 3BH9B 1AR1B 1QSZA 3FXIC 4G6FD 4J3OD 3AG2B 4RDQG 3G6JF 2RGSA 2CO2A 3IAPA 2IBBA 5EORL 1P7QB 5CILH 1WIUA 5AUMB 4MHHI 4XMKL 1A4CA 2FNWA 4OTXL 4XB8A 4BK5A 1SXCA 4H40A 4GP8B 3MYZA 1TKWB 3KG5A 1FL3B 1R34A 1Q9OB 4OIAA 2Y6TE 3WFDL 3QIWB 1XB8A 2EXSA 2LLNA 3M8OH 4IU3A 3L7FB 3FFCE 4ZQKA 5TDNA 4RAUA 2RH0A 4E0RA 5D1QD 3CLFH 2A83B 1ZHNA 4C56A 1ORQA 4TUJB 4F33A 2GJ6A 4OCSL 3MBWA 2EQDA 2GUOA 1DL7L 3BE1L 1ML0A 2VN3A 3FUNA 3CUPA 3BDXA 2EC8A 3GDCA 4LSQL 4JPSA 4DQOH 3GSXB 3HI5L 3RWJA 2YPVH 4P2RB 3FRUB 4X80H 5PAZA 2HH0H 3ZZQA 2BFGA 4FDWA 4P48A 3MNZB 5T5NG 3UFIA 2IDTA 3LQZA 5F1OB 5E8OB 1H3UA 4ZDHB 1TQTA 1RLBA 2YO3A 1QKZH 3IXTA 2CPCA 3SJVE 1MZZA 2CLZA 3M17A 4K5NA 3QCVH 1IJ9A 2CJUH 4QGTA 1IGYB 5CIPA 1MRCH 4HKJB 4XCFH 4A55A 1KCWA 2E7BA 2NY6C 1EEZA 1R3LB 1YAZA 3QXDA 4PQXA 5JR1H 3V6OA 5GJTL 3O3AA 1MCBA 1ZVNA 1BZOA 3REVA 5ALBH 3CVHL 5C0ND 3DMMA 3WHE0 1PZ5A 4N2NA 5J6GB 4MJ6A 1IO4C 2Z91B 5ESVA 5EBLB 1SLWA 3LKRB 5LWYH 3LH8A 4BFKA 2YGQA 3DBXB 4S0SD 4W6WB 2HLFC 1XSOA 4WKZB 2VLKD 4DNLA 2F5AL 4DERA 1RPKA 2GG1A 4Y7OC 3JWNE 1G7HB 3V4PA 1CR9L 1F8TH 1KY7A 5JA9A 2OL3B 3CX2A 4UOJA 3MA9L 1QR1A 4MWFB 4UMSA 5E9NA 1ACCA 2J1WA 5AZEL 1MHPL 5E6ID 1GHFH 2HWZL 3BZ5A 3EGSA 1KV3A 2A4EA 2FBJL 1S7UA 3CU7A 3H9HB 1DBAL 1UKQA 3D3VE 3PDGA 1FH2A 5ERWA 4KKBC 4QRSB 3MSPA 5JOFA 1OSEA 1P69B 1A7RH 1F6FB 1J5OL 3MCYA 4DKDC 4TKWA 2YWZA 5EU3B 2J6EL 3FB7B 2XJLA 4K3GA 1PIGA 4RISH 2FVNA 1XGUA 3O9WD 1GCFA 2QPSA 4YDNA 3N55A 3MR9A 3NA9L 4J3WA 3II2A 5KVEH 3ZU8A 3KD4A 4EZLA 3G3LA 4Q9RL 3MJ7A 5JW4M 2LU4A 3IBEA 2HTKD 5I5MA 2Z92B 4IM8A 3UO8B 4OSUL 5CZXC 1HEHC 3EOTL 1I9EA 3P9MB 1U9KA 2BNRB 4E9YA 5B8CB 1BLNA 1P1VA 2JCWA 3WEOA 4HAGA 3WOVA 1I31A 2XWTA 1JPEA 4OZGE 1S7VA 2X4OA 4JQVA 5B39B 3ECUA 4QTIH 2FJGA 3NCXA 4PVMA 1U4FA 2DH2A 5D1QE 4UIKH 3IDMA 1U8CA 1YZZA 1P4IH 4A6YL 2J1YA 3HE6D 1KEGH 1X5LA 2Y7NA 4K8RD 5B3JE 2EDNA 2B77A 2RHEA 5IVXA 4FTVA 1I3RB 2IALA 3BKCL 3RNKB 3OPZL 4M62H 4PRNB 4Z7QF 2HFGH 4K7PH 2JCCE 1JMXA 2VZOA 4NJ9H 5D7LA 5L4JA 1A5FL 2OULB 3PY9A 4NZRL 3UERA 4KKNA 4CILA 3CZGA 4UDTA 3ARBB 1LDPH 3MV9B 3O0RH 1O7DC 3FJTA 2XZAL 3DUSA 3PWPD 2YD9A 2YPLB 3O6KH 1A6UL 2GFBB 4OCYH 1OB0A 2C9XA 1ET7A 4KJYB 4QLWA 1F4WH 4QNPE 4PTUB 1EA9C 2CUIA 3HB3B 4M03A 4NZUL 4QOKA 2OXHB 3VFPB 4APXB 4K9EL 2ZXCA 4P9MH 4KK5C 5EZLA 2BOBB 5DD5L 4DP2X 5L6YH 1GJIA 1UYWL 4H8QA 3I6KB 4BJLA 4OI7A 2W60B 1EXHA 5IESH 3BSZH 3GIVA 4MJIE 4OI8A 1WH0A 2G4EA 2DMHA 5IB4B 2AXGB 4XVJL 2OMVA 3CSFA 4AJVA 5DFVD 2ZUTA 5I1CH 2CCVA 5EIQA 2AXHA 1ILSA 2CHWA 3CAFA 4GT7A 2YAFA 2YQ3A 4O00A 3ILPA 3KBPA 3RIFF 2AQ2A 4F7TB 2FX7L 1SXSA 1ND0A 4HIEB 5C0CD 2NR6D 1S9WB 4KQ4L 4JM2D 4XP9L 4OLEA 3IPBA 2GSIB 4Z0XA 5CU5A 1DFBH 1REIA 5C09A 4UI2A 1X9LA 3QDMB 2RB8A 3ZMNA 3W81A 3PLYA 3WS6C 2XU9A 4P2OC 1SQ2N 5EO1A 1PKQA 3TBSB 2X4NA 1HC1A 4KQ0A 4P46C 4NKDA 1CLYH 3SD5A 1P53A 3W38A 3RGBA 3W9EB 4FQXB 5I16B 1TZ8A 2AZAA 5F8QC 1CQKA 2NNAB 4KGJA 2VKWA 3HPJA 3T6WA 1OAQH 2YXFA 4AQAA 3HAEG 4JKLA 3KM1A 4BHUI 4YSRA 4JRYB 2NZ9C 1BP3B 4G1MB 2ZX7A 3T0EE 2I25N 4YFLI 4Y5XB 4B5ZA 5C7ZA 2WQUA 1HWHB 2OYLA 4PCTA 1INQA 3QJFA 4KFMA 4RBPK 5FK9B 1YLBB 1IL1A 2HFEA 2IAAC 2DLFL 3NSXA 4BFFA 1HSBA 1YN6B 3N1MC 2NOYA 5EU6D 3EBIA 1X4XA 4PLKC 2C1OB 2PXYB 3N04A 4WENB 3WDJA 4J3VA 5TH2A 4Z7OF 1H3PL 1CK0H 3US9A 1M7UA 5IVNA 3VQ1C 4GAJH 4M6NH 1BYPA 1I8LA 3EYUH 3F7RA 4HUMB 3MODL 4N8CL 4MXVF 2Y5TA 4JKMA 4MZRA 1SHXA 3RWDB 5HDBF 5ABZA 4DUXA 2WWNA 4PGBA 3PJNA 3VNZA 1D7FA 3DIVA 3O8XD 1MHPH 2ARWA 2NXYD 3U1QA 3ZKMC 3QG7H 5IGXL 3TURA 3GPEA 3H9YA 4GMSL 1DBAH 3WN5B 2ITDB 3NFNA 4FZ8H 2MWCA 5KVDE 4ZOEA 1KJ3L 5BRPA 2KZBA 1J5OH 4QI3A 3RFRA 4EQ3A 3CXHJ 1AJ7L 3L5IA 5D96C 5IHLB 3AGVA 5I0DA 2C9RA 3V5KA 1F56A 2OXGB 2VDLH 4OFDA 4XCYA 1LWJA 5IMMB 4R7VA 5ICYB 1BQ5A 1OK8A 3FO0H 4HALA 4MXQD 4IU3B 5HDOA 4R97C 4AIZB 4ZQKB 1TENA 4NQSB 5AYUH 4E0RB 1JDCA 3D4GA 3H3PL 3POHA 4WO4C 5FF6B 4C56B 2D7TL 1NGZA 4R26L 1J0HA 2GJ6B 1N4XH 5E7FA 3VXOA 2GUOB 4HIJA 1A7NH 1T1XA 3CUPB 4JM0A 5D4HA 3WXWH 3I3DA 1GH7A 5IFJA 1WA0X 3RWJB 1T66D 3DOSB 3FK3A 5FYKH 1EO8H 3QUYB 2AK4B 1PZCA 2DQHL 1C5DB 3S4SA 2CBOA 3WJLA 4TPRH 3HHSB 3GMNB 4LO9A 1ZANL 3M1BA 4CSZA 1MVYA 2B0SH 2ID5A 3U0WH 3WNKA 4HXAH 1PNCA 2GVYA 3GLAA 3TC9A 3IXTB 3BKCH 5DJ6A 3TEZA 3M17B 3KPQA 1S46A 1NBZB 5FW6A 1OP5H 3QVAA 1KULA 1NCAH 4KC3B 4B9CA 1TTAA 3GSVA 3LPGA 3VFWB 5A7EA 3REVB 4F20A 1BJ1H 3QRLA 1FIEA 4LOFA 5IMLB 1WD8A 1I4FA 3CN4A 4LEXH 1NMBH 3O11B 2WINB 3K8LA 1IM9A 5CJBA 2CUMA 4HETA 4BFGA 3QI9A 3F7YB 4JFPB 3TBVB 1NIEA 3ABZA 4XBPA 5IB1A 2EXTA 4HA1A 4X6CB 5EU6E 4ZJ9A 2NSQA 1P7HL 3STZA 2NY4D 2BCKA 3BH4A 4G2AA 1TQUA 1M9SA 4XVJH 4HC1L 5CJQL 3KPLA 3AW5A 4UOW1 2ESVE 2P1YA 2P80D 1WCBB 3TT1H 4ZMVA 3BT2L 2KZKA 4KNUA 4CVZB 1KXVC 4NZ8A 2W8CA 5H94B 2D3LA 4ZODA 5AW9B 5JOFB 4HQQL 2J56A 5C6PB 3B2VL 1JYWA 1KYOJ 3U7WL 5I1DA 5DQ9A 1HEJC 3ROLA 2DBLL 4XP9H 2JKRM 1XGUB 1INEH 2YN5A 1UOVA 1J5HA 3MR9B 3KLAA 3O41B 3UEZA 4XPHH 2QSVA 3TYGL 3G6DL 1F1DA 4EBQH 4HOMA 1RK1A 2F8IA 3T08A 1C5CH 5EZOL 1NGPL 4G8GD 1ZT1A 2DQIH 2PKDA 4FFYH 1U8PA 4MJ5A 4B0MM 4DEWA 3SQOL 1D9KD 4PGCA 2IAMC 1KIPA 3OJ2C 1U91A 2EYTA 3QIWD 4KK8D 2FAUA 4QRQB 2SODB 1BMGA 1KBGH 3TT3L 1CFTB 4YSUA 3SKOB 5GGSB 5CLZA 3I2CH 2G5BB 4JX0A 3CZFB 4KNSA 4XCCL 5AQ0A 1MWAL 3BVUA 4KAQH 3KR3H 4OLYH 4WUUA 5DS8B 3ZY7A 1CXKA 4L3AA 4IRJC 5IROC 5JLZB 4U1NA 2UUDK 1TYEB 1BFVH 3LZRA 4P2RD 2NDFA 5GZND 5IVXB 4JHZA 5F1IB 5D1ZA 5J6SA 5CD3B 1JHTA 2VR5A 2YAQA 2OCJA 3OAZK 4QRRA 4I18B 3GLZA 1JWUB 1LMKA 2FL5B 4FQJL 4PGDB 2Y1VA 3QH3A 4WHCA 7FABH 5B7EA 2DLFH 2MNUA 1Q0YH 2BC4A 5BPPA 1IZKA 5CS7A 4GXUN 1KPVB 2RCSL 4F7EB 3B7TA 2VWEC 4LXFA 2ZG2A 3Q8CA 3SODB 5I1GL 4NC1C 3V0IA 2DL2A 1H3PH 3P9WB 2IIJA 2UXTA 1KB5A 5CF3A 3GXTA 2V2XA 3I9GH 1EEQA 3MCLL 1BYOA 3P2TA 4AUYA 2BVQB 3MRGB 3ZDWA 3MODH 4K7PY 5KUKA 3BP4B 5CSZA 5CP7B 2DDQL 2YGVA 4LVHB 4ZMQA 3L1OL 4XNAA 1E42A 2VZUA 3CSTA 3U2IA 3UBGA 3B43A 4QTFA 4JLRB 4CDGC 2WXQA 5I23A 3FF8A 4J3SA 1NCWH 5GIRA 4AY0A 5AVQB 5KVMC 1OP9A 3GTVA 3ILPB 4V2BA 3DNKA 5LCVA 4ETYA 1I9RL 4X50A 1NGYA 4N2HA 1ND0B 5BW7C 2YJLA 1S78D 3BZ4A 1FL6A 1K72A 2QPEB 4Z7VB 1Q4NX 2E7DA 5CU9A 4YK4C 4NQDE 3VG0H 3LKSB 4AW7A 1SOXA 1JS4A 2V9UA 5IG7A 5C09B 1XWVA 3FTYA 1LK3L 3APNA 3MXWL 4IMKC 4L8BA 1I7TA 5F7DA 4ORGB 1HI6A 5G55A 5EO1B 5IB5B 3W2DL 1TEYA 1IC7L 2QFRA 4QRBA 2X4NB 2X38A 3BDYL 3T4YB 4G7VH 3VI4B 3MRLB 1N3NA 2DRUA 2IJ0C 2XPYA 1GRWA 3I02B 2LU7A 5D7IB 2BS8A 2ZAGA 4M48L 1CXFA 3SPJA 1E4JA 2I9TA 1PDKB 4R4BB 4GG6B 3PPEA 3E80A 3HPJB 4MASA 5A6MA 4AQAB 4IJ3C 1K4DA 4P49A 4G8GE 4ONFH 2XQBL 3MMEA 1T03H 3F84A 2BNRD 1JGEA 4UWQB 1ZA3B 1BBJA 5LNGA 1NGXB 2N4IA 3SDCB 1M1XA 3QHZH 2DH3A 1VADB 3OKEA 1E4XL 4M3JA 1IL1B 1II4E 2BSEA 1BG1A 1DQVA 1HSBB 1B3JA 3EDKA 4M6MH 4YLCA 4X0KA 1FFQA 1FAIL 4QHLA 2YJQA 3ARBD 1GXEA 4CW1A 1CFQB 3RB7A 2ZQKA 4RMVA 2HFFA 2VO8A 2YPLD 2WYHA 2EIBA 3Q5TA 4NNXA 5I5IA 3FTWA 3HB3D 2ZCZA 1AZZC 3C2AH 5CJQH 5E1HB 4XBGA 2NMSA 3EYQC 4U7KA 3D5OF 4L3EA 4NGHH 5HHQA 4V1DE 1UWEH 5HHXL 3KYKL 2MSPA 5L0QB 1WWCA 3S5YA 5AENA 2AANA 5KJRL 2QQKH 2KQNA 3IS1X 4GW5A 1EDYA 1NUDA 1GS8A 2ITFA 1E4WH 1ZKAA 4OLXH 3MVSA 4AENA 1LK2B 3D05A 4OLUL 5HDWA 1HKLL 5TE7H 5I0VA 3IGAB 2OMWB 1B2WL 1SBSL 3P73B 4JFTA 3ZDXF 1CLCA 5EU7C 3T4AC 4HK0A 1OWWA 1GGYA 5ENWA 4DVRL 4F27A 4DGVL 3DJZA 2HXAA 1NGZB 4ZXBA 4HSAC 1TZIB 4WI2A 5EDXA 3QDMD 1EGJH 4MQXC 1T1XB 3BP7B 4GSRA 4ABWA 1U30A 2WV3A 5DJYB 1O0VA 2DWXA 4U1HB 3U46B 1MNUL 4NI3A 5CKGA 4TTGA 1Z3GH 3QORA 3R8BB 5CBEA 5IQNA 3VX0A 5AAWA 1F00I 3KPOB 3BZFB 5T33H 2ZG1A 2V8LA 4UQIM 3SGJA 4DN4H 2ARJA 4F15C 4JRYD 2GPZA 4R4FL 2VZVA 2HT2D 4FNUA 4KY1H 1QG3A 1ZS2A 3N0AA 5C86A 2VXVH 3NESA 3GSVB 4HJTA 2XG4B 4IKIA 4LIQH 5AKTA 1J10A 1XFPA 4MQTB 3VB9A 5I1KL 3IDXL 2BNRE 4ETQB 4NBZB 1I4FB 4U3SA 4PJEB 1X5HA 3EO1A 2Z4QA 4N2BA 2W9EH 5LNEA 3ARDA 4LGPB 1PD1A 3OKMB 1IM9B 1KZYA 3MCLH 2DWDA 1KPUA 3H9SA 1NBVL 5FO8B 3QI9B 3GNML 2DDQH 2IH1A 2MCG1 4LLQA 2DQDH 2X41A 4UQ9A 4XBPB 4X8XA 5M7QA 1X5AA 2BCKB 3G6JB 4LOUC 4CBZA 3QEHB 1DQTA 2ENPA 1CGYA 3WKYA 1FZMA 3JT0A 1ECZA 4NPYB 4JDZA 4OUOA 3FCSA 3RY6A 1CDJA 1I9RH 2XXGA 2YPLE 3FUMA 2BWDA 5JUEL 4B9JA 3D0VB 3GBML 1LE5A 4R8WH 1SEQL 4EIZC 2LFEA 1DQJB 1A7OH 3ZW3A 3SDDB 2BVUA 4OD3L 2PR4H 3KLAB 2ZX5A 4TNVF 4P9HL 3KYAA 3W2DH 4NBYB 3SOBL 5E2UL 2JV6A 5D2LE 4AEIH 2NX5B 3VD2A 1KJ2H 1UWFA 1DSFH 1IKNC 1KIPB 3BUIA 4PCSA 1QFOA 1UD6A 1NKOA 1LP9B 4TQHA 2GTZA 3U0TB 3ARGC 4C56D 15C8H 4NDMB 2GJ6D 1HYSC 2EVHA 2B4CC 4OZFA 1BXXA 1T1ZA 2H3NA 4FTDA 1TO4A 4K3JH 3L8QA 4XC1H 2Z64C 5FUOH 3G5YA 4U1NB 3RWHB 1MCPH 2JK5B 4M7LH 2NYZA 5HD8D 3S6CA 4BE5A 3ASWA 1GOHA 1KF9B 3VM7A 4BM7A 4EMZA 3WMSA 4M8UA 2AHIA 2AK4D 4KHXH 1WAEA 1QSFA 1E4XH 1OLLA 4QRRB 3OKKB 3HNTH 1CQYA 3OHXB 5T3ZD 2NYYC 2C4FT 4YZWA 3SPHA 1IGCL 3B7YA 4HP5A 3S4SG 3S5LA 4LLUA 4LCYB 3BKJH 2PW1A 1SQMA 4PB0L 3QG6A 4RGOL 4O51B 2O5YH 3Q48A 5J57B 1HL5A 4LHUA 2LTQC 3E3QE 4HIHA 4ODSL 3DMMD 4FEIA 4CU8A 3GM0A 4DP0X 3OLIA 5J1SC 2W95A 5C8JA 5D7KD 2NY7H 5CSZB 1ODAA 5E8EB 5F7NC 3HLAB 5E2VH 4RH4A 3VSTA 2GIMA 1JRHH 5EWIH 3MCKB 1E6JH 1SNRA 1I9JH 1QX1A 5AG8A 1YN7A 3IJSB 4PRDA 3O3UN 4Y19B 5FOBB 1HX0A 1KJMB 3CHPA 1VFUA 2YOAA 4UDUB 1U8NB 4FMFA 1BA9A 3UJJL 2OMTB 1FL6B 2P5EA 4FJYA 4DP9X 1OTSD 4NNYA 4HS6B 4M5YH 4G9FB 1E3ZA 3FPYA 4U1KB 3ZHLA 4Y4HB 2DJMA 4BD4A 1B2WH 1IBGL 2XFGB 4WQOA 1OAYL 1MVFA 3VFNA 3S3PA 1OK0A 1HHIA 4HS3A 4RQQB 4KZEH 1RHHB 3DSFH 4L8BB 2XWCA 5JHLL 1DO6A 4MCYA 2PCXA 4NWTH 1UM6H 1I7ZA 4DGVH 1X5GA 3MRFB 4PREA 4YXHH 1N6UA 1XDTT 2FJHA 3Q8BA 2ZP8A 3P11H 4GI8A 5DFAA 1S9VB 3MGTA 2X89D 2N0MA 3LKOA 3ZE2F 2UZXA 4EOWL 1WRFA 2V3DA 5INCB 3VXRB 4BWWA 3KVPA 5EFIA 2GYSA 3B83A 3VMOA 1J1XL 3WXVH 3FN9A 2WNKA 1FC1A 2DQCH 5HJGA 4Z7QB 5L7XL 1U8KA 2ZXAA 4RIRA 2PCYA 4LPWA 3M45A 5I1IL 3PQYB 3D34A 1JF1B 5BV7L 2HVJB 1X9UA 4H8WC 1QHPA 2EJ1A 4PP1D 2GJ6E 5JMRA 4H0GA 4BCZA 1KWGA 1UWGL 4LDEB 1NCIA 3VU2A 2YMXH 1A4JB 2PCFB 2EXYD 3ZE1F 1XF5B 3GI8L 4X0KB 3T77A 5E7BA 3WKNA 2Q7YA 1AGCA 3HNVL 1KXTB 2F6AA 4HH9B 5D7LD 1R75A 2APWA 4QHLB 4WAFA 1YUHA 1C7SA 2FECL 2X9WA 5LBSA 4CW1B 4FZEL 4JQXC 4M1CD 1JAEA 5T3ZE 3ULUL 2YN3A 3LQAH 1CI3M 5DO8A 4L29A 4I8DA 1F02I 4YHKL 3UZVA 3LHPH 5TPWH 3U36B 5JPMC 3UBFA 4QOKD 5DVNA 5C08A 4F7CB 2EYSB 2VXQA 2F8OA 1GMIA 3LB6C 3V9CA 3IPEA 2Y23A 1NBYA 2VH5L 4L3EB 3LD8C 1J8SA 3POCA 4S2SA 3RKDD 1NKGA 1INDL 1EUUA 1HH6B 2GEEA 4AM0A 4C83A 4OFIA 2CM5A 1PLGL 3P4NA 4NT6A 3RPIB 4MA8H 3GBLA 4OF8A 1XSJA 1MAJA 2FD6H 3DPDA 5GRUL 1HHJB 4FQHB 3RVVD 4FCAA 4D0CA 3WE1A 1QAWA 2ZOUA 2HT4C 2AV7A 3IFLH 4RZKA 1MSPA 3JWNH 1P7BA 5F7BA 2H1PL 2ZCKH 4ZZFA 3C9NB 4JFEE 4WHDA 4XE5B 1N5YL 2HUHA 1NFDF 2XJKA 2XYCA 3UX9B 5C09D 4YX2H 3V4VL 1MH5B 1HILA 3QDGB 2CHZA 4UU9A 4JNXA 1BZ8A 4NEHB 2UX7A 4UUJA 1X5YA 1KB3A 2VZ3A 3Q0HA 2HMIC 1EK3A 2DBJA 3EYFA 4JRWA 4YHPB 3EFOB 3T1FA 4BRVA 2ZYSA 4JVUA 4YJZL 1IZJA 1MPAH 1SN2A 4DGWC 1F4AA 3E1F1 2Y7LA 2X6AA 4PJFB 1XEUA 2ZUXA 4GQZA 1RFDL 5JHDA 3OSVA 5BCAA 2ARJB 5EH1A 3LQMA 1CFMA 5EUOF 3QNZA 4ODHH 1QFWH 3SKJL 1WJ3A 3CVHB 1G1CA 5DFTA 3KYOA 3PGFL 5TGBB 4OUUB 1G0YR 1IV8A 5K39A 1P5VA 5I17A 4OGAD 1AS8A 3QEQB 1QQDA 1ORSA 4WUKL 4U3SB 5FA4B 5C0BB 5DZJA 4A7QA 4BFIA 2MOGA 2FATL 5LBVA 3TNMB 4B3EA 1XF4A 5HDBB 1FSKB 4KHTL 5KS9E 5DJXB 1AE6L 1NBQA 2OYPA 1KPUB 4HEPA 3VFVB 1NSNH 4ZUTA 4Z7IA 4FTVE 4MB5A 4XHJC 4NN7B 1CF8H 4HU2A 1UJ3B 1XGRA 3WS6A 5D7LE 2QTVA 1P5UB 4P2OA 1E0OB 1MFAL 1HFUA 3BW9A 4U6YB 5F7WC 3FN0L 1RKRA 2VRKA 4ONGL 4L0ZA 1FZMB 1RZKL 5EOCH 1E5UI 2EIKB 2IFGA 2L4OA 2Z34A 4P46A 1IARB 3TFKD 5JPNC 4BDVA 2CQVA 3M07A 1LE5B 3DV6A 2YSSA 1BJ8A 4DGIL 5I75B 2PCPA 1TQCB 2J73A 4PWJA 4F2MB 2VDKH 1QNZL 4QOKE 3S97C 1EVUA 1OF0A 2BM3A 4DP5X 1C5BL 3P2BA 2AW2A 5DDHB 2APBA 4U6TA 1QTPA 5KANG 2B15A 5L9DH 1J8HA 1WLHA 2R7EB 3A4AA 5B22A 1ZCRA 4FQLH 5M95B 4KROB 4MQSB 4ZFZB 3IMBA 4YVNA 4N2AA 3NYKA 2VLRB 4HOWA 5HI5C 4EOWH 3ARQA 1KDIA 4NYLB 1JFQH 2PP9A 1XH3A 2EO9A 4ZMPA 3FYIB 2CU9A 1J1XH 1DVFB 4Y4FC 3INUH 1P4LB 1FNGA 1EXUB 3AG4B 3K6DA 4FCHA 5C09E 5ICZB 3NEOA 3B1UA 4KUZH 1XCQB 5D7EA 5EO9A 1U8HA 3SBPA 1L9TA 3T1WA 2Q7AA 5BV7H 1DQML 1UB6B 1WISA 1JV5B 5IR1A 3CN0A 1PKQE 5GGRY 1E90A 1IAKA 3CMOL 3QWQB 1EEYB 4FQIL 2I07A 5BZXA 3OAZH 2E9BA 4LLYB 4HF5L 4CN4A 1CGVA 1OGSA 2XC8A 1RP8A 2BLFA 1XH0A 3NN8B 3HKFA 4K3EH 3D51A 4DSYA 1CD8A 4TOYL 3C5SA 4FQPA 1QLEB 5HYEA 4K55A 1DCEA 1FE8H 4PJDF 3RL1B 5ABDE 4FG6D 3MA7B 4HJUA 3HS0C 5C8JB 4LB8A 1ROWA 35C8H 1CE6B 2W07A 1J05A 4KXZH 2FRGP 1BEXA 1NC2A 4YXKH 3RWCB 5IW1A 1IM9D 1FO0H 3NJLA 3V4UL 5C0AA 5DRXA 2NQ3A 3QI9D 1GY1A 6PCYA 4KJWC 4ZFOL 2B8OT 4WO4A 1FHGA 2VAAA 1JNHB 3CTTA 4JFQA 3QQ3A 1TUPA 2I9LB 5BO1L 3GQFA 2A99A 4FA7B 1PLGH 2V17L 3X1FA 5IY5B 2Q2EB 3WUZA 4P5KA 1RZIA 1OE2A 4XMUA 5GRUH 2EC9U 1BX2A 1ZHBB 3VFNB 2D0FA 2HAZA 3D39A 1HHIB 4HS3B 2IH3A 2L04A 4RAVB 3VGHA 1AI1H 1CUOA 3MNVA 3GFUA 3LSOA 2AEWA 1WPCA 2FJHB 3VG9C 2MNWA 3P4OA 2FEDC 3DOIA 2BFVL 4L2YA 4MD5B 4JPKL 5C9JB 2KQMA 1CFSA 1FNSH 2EIZB 2V4LA 4AQ1B 5I1HL 5K69A 4TL5A 4Y4KC 4MD4B 4CNIB 4OZ4B 2YLKA 3BO8A 3CHRA 1P4BL 3VA6A 1UH4A 4RIRB 3I75A 5B7MA 5DD1L 3KPSA 1RFDH 3WKML 3KS0H 3FUEA 4MJHA 4FXGB 5T1LA 1OW0C 1R3IH 4PLJC 1OT2A 3VB8A 3OR6B 5DD3H 4G6AC 1LEIA 4O2FA 4M7ZC 1Z32X 4OZFG 3CVDA 3Q1SL 4GRLC 4M7KL 1CLZL 3TASA 1UB5A 3QYMA 2F7RA 3I9AA 2APXA 3NZHH 4QRRD 1DQDH 4F5CA 3WL9A 3FW6A 3GSNL 1KXVA 2ITEA 1Q38A 4YQXH 1A4KA 1FORL 1R3JA 2Y4SA 1WYJA 3BAEH 5AYQA 2VDQL 4XAKE 3WN6A 5JXEA 2PPDA 2DQGL 3EDJA 3A3YB 2Q5BA 5SWQA 4TULH 5EOQL 2XBTA 2YHGA 4HWEL 2ZD0A 3S5LG 4LDCA 1F58L 5DEJA 2GJZA 2HTLC 1FVEA 3UYRL 5FYLL 1ZHKA 2FB4L 3QUML 4HZAA 4K9JA 1YC7A 1QI5A 4O5LL 2C3XA 1NBYB 1CGSL 1PD6A 4XVOA 4OV6F 5BQDA 1HE8A 4DVBB 2IAMA 3WEMA 1S9YB 1ZJBA 3Q2LA 4AM0B 4C83B 4Y19D 2WIIB 4NT6B 1J0IA 1RUQH 3P77B 2O72A 1AXSA 1IKOP 1GSKA 1ACYH 4P2CG 4ZOBA 2E7LC 1EMTL 1E4XI 4LT7A 2LLLA 1AY1L 1MFNA 1PX4A 2W0KA 1WO2A 4GKZA 4IRJA 1FFNA 3T0VA 2PN5A 5IROA 3HA0A 1TOXA 3MREA 4G9FD 2RIKA 4KO6A 3UPRA 4Y4HD 2ADJA 4FNLH 4AVKA 3OBAA 3U7YH 1TJIH 1OOAA 2XTJB 1P6AB 4R5VA 1ZPLA 4G5ZH 4OIFA 3RVWC 4FHKA 2JKNA 1ODUA 4UUJB 4UV4L 1JN6B 5CCJA 1H15A 1BQHA 4N87A 4EDWH 2E8ZA 4KDTC 3FT9A 1M7IA 4TRPL 4HHAB 2CO7B 2FIKA 3PABB 1Y6MR 1JRHI 1KBKA 2XA8H 3UH8A 2G3NA 2YAMA 1GYAA 2XKUA 3ARFB 2NW3A 3MUY1 2ENQA 2P48B 4M8QB 4JVWA 3MLTA 3S35L 3G08B 3JV5A 4PWEA 1ZT4B 4PS4H 3TA4D 1ID2A 3PQYD 5F3BB 4MQ7A 5KBLA 1DBBH 4ZFFB 3EBHA 5AW0B 5K39B 2AI0H 1P5VB 4WI6A 4M9PA 3P0YL 1M4KA 4BFIB 4A39A 1LL1A 2BSED 4K5MA 4WUUE 3BUPA 4MB3A 3BPLC 3UOAB 1XV8A 1I85C 5BW7A 1MIEL 4K2UL 3HC4H 2AAAA 3BLKA 3EYSH 3S37L 3UC0L 5C3TA 4BBWA 3BGMB 1MXGA 2WO4A 5JIKA 2BXZA 1RIUH 2WZAA 3MO1A 4K5OA 3H8NA 4H1LB 3AVEA 1LD9A 1VCBC 3QUZB 4KXAA 3O3BA 2GY5A 3RZCB 3LEYH 1N6VA 2CO6B 3W9DA 4Z77B 2QGEA 4AEFA 4F9LA 3BWAA 3BMWA 1DUYB 1RULH 3JV6A 2MMXA 1D5IL 2V17H 4L3ED 2Q7NA 5J1AB 5HYJA 1I8KA 3WLBA 3HPLA 2R0LL 1NFDA 4TUOB 2OW7A 3PL6C 5F9OL 1BV8A 1QFUL 1K6QL 3S48A 4JPIA 1YY9D 1FNLA 1NC4B 4FKHA 4OCNC 1IQWH 1L7TL 2WXGA 1AZBA 5IVZB 1BQRA 4BQBA 2Y5EA 4GO8A 4LEOA 5LXGH 4GUOA 4KTYA 5A2AA 3NK3A 3QNXB 4XXWC 1UD3A 4FFZL 3DV4B 4MMZC 1E9QB 2WAQA 4WTWA 2M8XA 5IWLA 1DVZA 1PFCA 5CM1A 5D7JC 4PB9H 2H6PA 1KENH 3QQ9C 4WW1B 1C08B 1X44A 5EIVA 4WHTA 4LBEB 4BUQA 3CBKB 1Q9LB 4AYGA 3QR2A 3U6XA 4KITB 5ID1B 5EO0B 3ULVL 1AC6A 4A1RA 3RWFA 5EUOA 4O4YL 5DJZB 3QIUC 3FTGA 2CKBH 1ZTXL 3QORD 1UUNA 4HUVB 3FSVA 5TD4A 5E5MB 1R5IB 3LRGA 1FYTA 5T3XD 3VXUA 1IAKB 2GSMB 1MIMH 3KGTA 5SWZB 1B4JL 5KVGE 4QRPA 1K4CB 1OSYA 3CHSA 3GJEB 3MBXL 4XVSL 4KK9C 4KKAD 3NMEA 3VRIB 4AYBA 3ZDZE 3EFFA 4HFWA 1BGXL 4M6OL 4B27A 3SCMB 3UDWC 4AQEA 5I1AA 4Z7QE 4HIXH 2CBPA 5D96B 3N50A 3I6LE 4W1TA 1HOEA 2GC7C 3S34H 3ZUNC 2H2PC 4GO6B 5FGCB 1J05B 3QW9A 4JGMA 2CR0A 5FKAA 3CFKA 4GSDH 4ZX3A 1DUZB 2IOMA 5IW1B 2G9KA 3FB5B 4TNWK 4BFRA 3T4AA 4JREC 1OVZA 4R97B 5I15L 3FOMA 5J1TC 1MCEA 3CH1A 2OSLB 5F9JA 3VFUB 3VCLB 2TAAA 4YSEA 2O6PA 4U6VL 2VB5A 4HEPG 4LCUB 5DJAA 1U58A 3PAVA 9PCYA 2PWFA 5D4QA 3ARPA 2YRBA 4XPAL 3ARUA 3BP5B 1JOIA 4YLQT 1UENA 3VYNA 4NNPH 3FQXB 4NSKA 1UACL 2WKGA 1MCQA 4YSDA 2ZCLH 3MC0A 1D7BA 1EJ8A 2VLLA 1CCZA 1LXMA 2XETA 3GMRA 1SOKA 1WT5A 2JJVA 2A9AA 3KXFA 3VXTA 3LSOB 4Q74A 4XI5C 4UBDC 3P4OB 2IFFH 1SJHA 3ZTJG 4A7TA 2ZWYA 1SM3L 2F5BH 4Y9CA 1IAIH 3TO4C 3B3BA 4EO5A 5DZOA 1CYWA 2FQEA 2Z35A 1CFSB 3MGOA 5C0IB 2QADC 5DU7A 2VLRD 4H20L 2IADB 1EZLA 4U1GB 2ZICA 3NCJL 4LSDA 3FCTB 3C5JB 3LMJL 2D31B 4BA0A 5MEOA 2FT8A 2BWIA 3EF4A 3GT6A 3TGXA 4ANVA 5KTEL 25C8H 2X2UA 1A7QH 5CUSL 5B1BB 4G6ML 1SPDA 5T1LB 4OCWL 1CFNB 5K9QI 2F58H 3PNWB 4RMQA 3NPSC 3PWUB 1WGVA 1YQVH 5I6KA 1ZVSA 4KKQA 1GA2A 1SHMA 4O2EB 3QDAA 3CCHA 4PJDA 2EKSA 4D8PB 3KPMA 4LLVA 3MOBH 3BAJA 1SY6A 4B41A 4RSYA 3WL9B 5A6IA 4R0LA 2JH2A 1R3JB 3QWOA 1AVAA 2OZ4L 1T4WA 2QPDB 1WIPA 1ZWIA 4K2UH 4KI5C 4NWUH 2Q8AL 5T3XE 3G6AA 4FFTA 3ZT7A 1T5WB 2B1AL 1N10A 3MRKA 4JPWH 3UC0H 1YECL 5AB1A 1BD2A 4O9HL 1ZDSA 2K9UA 3HAEH 2GJZB 2WXPA 2XRAL 3IJHB 2VXUL 2AEQL 5FCSH 1JYNA 1C1EL 4DF9A 2D7OA 4Z7OE 5AD0B 4A2LA 1FVDB 4D9RD 1OT4A 1IKNA 2IAMB 4GG8B 4AL8L 4UQEA 1LO0H 5D6CA 3GLEA 5I8CA 5ID0A 2HJLA 2X3BA 3GB7A 4ERSH 4MXVE 5I6XC 3MLZH 4LDOB 3CVCA 2ZOTA 3GRGA 4I3RL 4WJG3 4WU7A 3ARGA 1AXSB 3C08H 4JG1H 3MRQA 1JI1A 2R0LH 3FTSA 3H9SE 3HMXA 4J4PC 2WQXA 1JV2A 2X0VA 4GKZB 1QFHA 4BQ6A 3AQDA 1J1OL 4MBOA 4ATWA 4ZMNA 3S35X 1T89A 2VN4A 4BHUA 3MREB 5FUZL 3RGHA 5HYQA 1MJUH 4Y5VB 3VRJA 2C34A 3MJ8B 2WD0A 2N1TE 1DDTA 3SQBB 3DURA 4HKXA 1YO4A 2AK1H 1OAKL 5AZUA 2DM7A 2FECI 4HKBA 3DETC 5JW5A 2Q3AA 3FT1A 2D7QA 4KFZC 5FXCH 1M7IB 5HHNA 2V2WA 4ABVA 2F7IA 3P3RA 4LCWA 1BZ9A 5I6LA 2F53A 3LRMA 3CGTA 2NY6D 3CZNA 3NGBB 2UXVA 3S37X 1RIVL 4MVBD 4O4YH 2GJRA 2G5RA 4P5RA 5I1EH 1MFVA 4WFFD 4A37A 2NW3B 4AUJA 2GHZA 2YXVA 4KRNA 1QABA 3SPVA 4F8PA 3V52L 5J5EA 3MLTB 5IW3A 1PU0A 3QO1A 1KC5L 3AY2A 1A22B 1GPOL 1A1OB 3ZL4H 1QFPA 1R3HA 1WWBX 3CXDH 4XVSH 3S3BB 4YIQB 1SF3A 3GEFA 4DCQA 3C60C 3EJTA 5C0RH 5J11B 4DUVA 4Z5RB 2R69L 5E0QA 2FO4A 2CRMA 1KNOA 5F89A 2AERT 3UAEA 4YDVB 1B4RA 3RA7H 3WIHA 2KS0A 3STLA 2H32H 1V7NH 4DKFL 1L7IH 3QZBA 3WY1A 3UAJC 1KCRH 1AP2A 2CBQA 3KL3A 4GQPH 4KKBD 3D9AL 3MROB 4YH6A 1R6VA 1QSFE 1EO7A 3PV6A 2Q87A 3L3DB 1LD9B 3CBJB 4PRPA 1SOSA 2CJTA 3VI3B 1AIZA 5ILTL 3QDHA 1KTLB 3PGCA 4TNEA 1V8HA 2HX8A 2J44A 1T2QH 1B0GA 1QW9A 2P26A 3QO0B 2HKFL 5GGTL 4WI4A 2QQNL 5EF0A 2W0LA 4AV0A 4FLRA 4NKOA 3N85L 3WU1A 4WTXA 2HT3C 2G9HB 1MZYA 5DEFB 2UY6B 2OMXB 3HPLB 4QCIA 4R5TA 1DQKA 1AIFA 3KPPA 1JGLL 5DVOA 1IBYA 5CZXD 3O45B 4QHUA 1RUMH 2NUTB 2Y9RT 5H37H 2VDOB 5AFAA 7CGTA 4ZUWA 3V5HB 5J12C 2WLIB 2IDFA 1AGFA 1YEEH 5A2CA 1JK9B 3GJFK 2NNXA 1GR7A 3K0WA 4G8EA 2XKSA 1U8MA 4ZW3A 1KCVL 2P5EE 3JWDH 2EDRA 4H20H 2E6QA 1UM5H 4K07A 4NO0B 4XPBH 4WF7A 4E41A 4MD0B 3RWFB 4PRHA 1L0YA 1X7QB 3LMJH 4HUUA 3LZPA 5HGDA 1L4IA 4JQXA 3RUGF 3WS3A 3VXSA 3ISWA 5CUSH 3G04A 1UCBH 1FFPB 1BQHG 1NM4A 3ATDA 3FQ4A 3FU5A 1TQBB 2WZ5A 4N0RA 3RVXC 5JPMA 5F7AA 1NIBA 2O5ZH 4XCEB 1ZPUA 2Y6SC 3A6BL 3H3BC 1S3KL 3FU3A 3ARFD 3IXAA 2IVFC 1BQLL 3C09C 3LKNB 3MLVH 4KK5D 5E6RB 4AX3A 4OM1L 4BEIA 2VLMD 2VLJA 2X28A 3ZN6A 5I71B 2WWOA 1XH2A 5FFGA 5KSUA 2D2CC 4WFFE 1Z0NA 2DJUA 3A4DA 2P44B 3QXUA 1UM4H 1I8UA 5D71L 5K1NA 4N0YH 3MLYH 3DX8A 1AHWB 2QMKA 2J25A 1YECH 1OE1A 5FKAB 3NH7H 4RFOL 3OMNB 5GS0L 4FFWC 2AEQH 4OIIL 3OKDA 4XNDA 2X4UB 1QFWM 2G5UA 3C2SA 3PUCA 4AIXA 4DP7X 1UURA 2B7DT 5TF1L 1HT6A 3KVQA 5ELIA 3LEXB 4HAFA 1FG2B 1U58B 4LU5L 3VD9A 2IH8A 3MXVL 3VH8B 2DI8A 4P2OD 2X4QA 4XNMB 3B8SA 1XGYL 5DSCB 1ZE3H 3QPXH 2FWLB 3OWEA 3CN1A 3B2DC 4WV1B 1YNTF 2P4AB 2WLLA 3TBCA 4EAEA 2WIMA 3TM6A 5CIPH 2ROXA 4EXPX 5C08E 3VFGL 1XCWA 2QPUA 3VXTB 4N4YB 4LSSL 4B9GA 1CL7L 4WEBL 2R1YB 5EU5B 4B0MB 1KLUB 7TAAA 4U4BA 4R7XA 3H2WA 1NC4D 1IKFL 1AH1A 1M2OA 1NJ9A 4I77L 2VC2B 1UJTA 1CDBA 4TMPA 2YD1A 3ZKXC 2EDBA 5I6PA 2PF6A 3VXNB 2XOTA 5E8DL 4LNVA 3C87A 4XC3L 3NIFF 5C3IA 3UTQA 2HA1A 2I26N 2J12B 4HPHA 2ATPB 2CDEB 4NM4L 3OGCA 4N85A 2AJSL 4BFBD 5KSBB 1JERA 3K46A 4PLKD 1S7XA 3V4PH 3VGGA 1UWYA 1E8YA 1X5FA 4MCZB 1RUPL 1DVXA 4PJ7E 1KGWA 5LBGA 1ZVSB 5C0EA 1KYFA 1HINL 1E4HA 1ZA6B 1QUPA 4NAJA 2YD6A 3DI3B 4J6RL 3VFMB 3ECWA 2C5DC 3KPMB 2R69H 5SWZD 1RH8A 3SKNB 1O7DE 3I50H 3N9GL 3QWOB 3UBXB 5JPNA 2L8AA 5J6HA 2YPVA 1GYVA 3D1MC 5DYFA 4PV1C 5FYJL 3MBEB 1DJXA 5DUPH 3HC3H 1PG7H 1UC6A 1U6AH 3NZSA 5JHDE 1EFXB 3LN5B 2WQAA 3SCMD 4CMHC 3QJZA 3L5XL 3D9AH 2F54A 4M43H 5E08L 2J4WL 2HKHH 5DK3A 3CH8A 3GSUA 5E00B 4K94H 5D7SH 5TE6L 3VD7A 4Q58C 5HGAB 1TQWA 3FCBA 4GAYA 2E56A 2XICA 1F0LA 4ZK8A 1EAPB 1AS7A 3BXNB 5E94B 5F3HA 4U33A 1E67A 3P1VA 5C0AD 3GB7B 5GGTH 2R4SL 2QVFB 4ES8A 3U48A 3V0VB 4RWYH 1L9QA 1L9MA 3ARGB 4U2YA 4N6RA 4WO4D 4P5MB 4DP8X 3MRQB 5L2KB 3DTXA 1DQLL 3CVIL 3CZUB 1JV2B 3EDFA 1YEDA 4Y4FA 1ZS8A 2X0WA 1YEFL 1OSPH 2VXTL 4DP1X 1ETB1 2MOVA 2PWGA 1G4RA 1EDHA 4HHWA 2M1KA 5IJVA 3U6RB 3VRJB 1A14L 1OARH 4JGJA 4YHMH 1KELL 2N7SA 5IHWA 3DURB 1DQQA 4BZ2L 4FP8L 1PD0A 1T4KA 4PY7A 2ZWLT 4TUKL 4PRAA 3ZDXE 3UJTL 2JNZA 4PJ8C 2APSA 1RZ7H 5LN4A 2C9QA 4LCWB 2WZ6A 4I0PC 1HHHA 1N64L 2F53B 2FEEL 1QWUA 3CDZA 3MACL 5DI8A 2WLNA 4B53A 3QZOA 3RU8H 5BVPH 4MDIA 3LQAC 3UPAA 4X6BA 2EABA 5DMIL 4IKJA 4JRXB 1U36A 1DHKA 2LTQB 3C5XA 3K2UH 3NZUA 1T1YA 4JDEA 4JFFA 3SDAC 3T2LA 3O6FB 1Z7JA 4DAGL 1IC4H 3PP3H 1J8HE 1W16A 3HS0A 4I2XE 1MAMH 1CBVH 5J9PA 4MS6A 1EHLH 4JGNA 3MJ9L 4CAGA 4KI5F 3KPSD 4JFVA 1S3KH 3HKZA 2DQUH 5JDSA 4XPFH 2RACA 3GMQA 5T1LD 5TDPA 2UXFA 2WSKA 5HGHA 1U41A 2BZDA 4DKTA 1KNOB 2YA1A 5L8KB 5HVFB 4JO2L 1RPQA 5ANMB 5BUGA 4J7RA 2XY1A 3VWKC 4L9DA 4YUEH 3U0PA 1EBAA 1J11A 5G4OA 5T5FL 1AP2B 1XGPB 4Q7DA 2YQGA 4FQQA 4HZLB 4B97A 1TJHH 4PRPB 3LX9A 4P57A 5E4OA 5MI0C 1MW0A 1ZLEA 5KYNA 2BRRL 3CWGA 4LU5H 1WBYB 2H0JA 2K3HA 3B2MA 3EOBA 1DCLA 1QBLL 1LM8V 4NKOB 2UX6A 1LO4H 2I7OA 4S1SL 1SDDA 4HMCA 5KYXA 3IDIB 1L0QA 2IAMD 1TQSA 1AIFB 3R0NA 5DJDA 1H8SA 3VSVA 4IIQA 2W0FA 4QHUB 4DKEL 1CLOH 4OZHF 4FQ1L 5C0AE 3NJIA 5JA8B 2ZCHL 2R1XA 3AB0C 1OW0A 3BKML 2EEBA 4NHCL 1QPPA 5IM7A 5IROD 2VDMH 4U1SB 3NIGF 3O4OB 1CE1L 4XNXL 5BQ7B 4GRLA 2X7LA 3TH3T 2OR8A 2ARJQ 4N2MA 4E41B 2M83A 1L0XA 3ZE0F 4NM4H 4ZW5A 3HZYB 3CU1A 3NTCH 4UINH 4N2LA 3D39E 3E0GA 5L4FA 5HGDB 1R46A 3WO4C 1DJHA 1TFHA 3VXSB 5C7XH 1R19A 2WWKT 4XGZB 1RUPH 2K78A 3G5VA 1AANA 2A6KB 2YR3A 4RGMC 3WSQH 4Q0XL 4W9CC 2WKOF 2EDEA 1U8QB 4AVHA 1D6EB 3CLEL 1ERNA 1W72B 2I85A 2XQYA 4H5SA 4QUOA 3V6FB 1ZLDA 2J8UF 1W6WA 2HJKA 4DHLA 2X1QA 1RMFH 4NQUA 4YSPA 3TZVC 1FCCA 3MYJA 3KPSE 2D0GA 2E7LA 3ZJAA 1VFBB 1PAZA 1UGNA 3LRSB 3ARYA 3LPPA 4S10A 5ESAA 3QIBC 1WZ1H 4LKXB 1YYLH 5LAXB 5DJ2A 1NL0L 3S88H 3QQ4A 2KKQA 4JK0D 3NEEA 1F86A 1HCZA 3KBHE 4F5CE 4PJXB 2IQAB 1XR9A 5IIEB 1NGWA 2MPAH 3THML 1DQLH 4EI6A 2NY1C 2Y7SA 1YEJH 5CEZL 5BV7C 2EICA 2NW2A 4IRZL 5F88B 3KDPB 4QLRA 3X1NA 4HDIA 2D7NA 3I6GA 1DSWA 4NZTL 5HYJD 3ZTNH 5GJSH 5KAQF 1KELH 3TNNB 4LPTA 1XIWB 2A1WH 4QMEA 3F7KA 3CE1A 1FZKA 4HXBL 4X6FB 4TUKH 2F2HA 4CN6A 4E9LA 2W91A 4AK2A 5E4AA 1NJ9B 2WBJB 4DPCX 3AU1A 4OCMC 1HOCA 4W9HC 3G9AB 4AQ8C 3EJPA 3X17A 5F97E 3RUGA 1QBBA 1SRDA 1G1OA 4ACPA 1GW0A 2F7OA 4OLVH 3RTQB 3D8MA 1FHNA 3A67L 1I85A 3K71A 2VDRL 2NYKA 2C3WA 4HUWB 3ZE2E 4HT1H 1I7RB 4JJ5B 5DGRA 1XTMA 1PJWA 1PZAA 3T8XA 3MRBB 4GAFB 4N0FA 2B08A 2B9AA 5C0EB 2YKLL 2H3KA 3WE6A 3T8VA 3LNFA 4NBXB 3VD4A 4L0YA 3KNBA 4KOBA 1WCQA 4OJCA 3VXUD 4G6JH 4X6DE 1XSKA 5I1JL 3RX8A 4RFEB 1S6NA 4QRPD 3ZTCC 4JKPL 4UT6L 4NC1E 1JNNH 4PMFA 4UM9B 3ROOB 4KV5F 3QC5X 1D2PA 4TVSa 1MFDH 3WHXA 2XACC 4ZO8A 3WO3B 1KWKA 2HG5B 2PW2A 3TBWA 3NG5A 2EDKA 3NQKA 3ZE1E 3AREB 1KGCD 3KHOA 3M1CA 3QUKA 4FNSA 4CU7A 3IKCB 5AVRB 2F7QA 4XMTA 4GAYB 2XXCB 3S2AA 3H53A 1Z3RA 1A9BA 4OD1L 4XXWA 4ISVB 5F3HB 3ALWA 4YS4A 4MMZA 2ZJSL 3LXBA 5D7JA 4Z78A 1YNTA 4ZSOA 4N6RB 1QWHA 3ZRSA 3SE4C 5I8KL 4Y5YA 2JKXA 3QDJA 3MV8A 4JRLA 4KTGA 2CJSA 1YMHA 4PS8A 5JW3L 4OFKA 4QT5B 5ANHA 2Q6WB 1PBYA 4YDKH 3QFJA 3QIUA 4L8SA 2P5WB 1NFKA 1F4HA 4JFYA 1P1ZA 5DHYB 1PCSA 4KKCC 2Z8RA 5H35A 2JJSC 2VISA 3EYVB 1T4KB 4QWWC 2CBTA 4LOEA 1TZAA 4PRAB 3C8HA 2HSIA 2EH7H 1WICA 1JNLL 1RZGB 3HMWH 3CFDB 1DYZA 5BRZA 1HHHB 1M7DB 2FUQA 3GI9L 1OO2A 4R4NC 3WDIA 1KB5H 3IDNB 5HYJE 4YDIL 4MDIB 2H2SD 4Z3TA 4IQHA 1NFDE 3UDWA 5ADOL 1W0WA 3GMOB 1CICC 1A66A 4MXWL 1JGDB 3X3FL 3OSKA 1T1YB 1IT9L 3IMVA 5GISH 5CJXC 3HG0A 3G5XA 4A2GA 4PJ5A 4RZCB 2YUWA 5E99L 5D2NB 2VDNL 4NS0A 3MX0B 4FFYA 1HDMB 1RZKC 2IGLA 3A0OA 1UA3A 2R1WA 2AJVH 1MAKA 3AJ7A 4WCYH 1IAIM 1B6UA 3GMQB 3OMAB 4HEMA 5TFSL 2GAZB 5LCVH 4APQC 5CD5C 1NLDH 3BKYH 4PCYA 5HGHB 4MAUL 2IDSA 3N6YA 2NDGA 5HBBA 4DKAA 4LOUD 3IF1A 3V8OA 2V37A 1YNLL 5I74C 3VE0A 2IGTA 2W88A 5EUOE 2YEZB 1V3MA 3VFOA 1S7TA 2IO5A 4TVPD 5EOTA 1E2VA 3UTPD 3UGXA 1FYTE 3ENEA 3VXUE 4LL4A 3WY3A 1GGIH 3RY5A 4AM0Q 4QRPE 3NPZB 5KVGH 1BPVA 1BD2D 1EFXD 3INOA 3VG9B 4FD0A 5IMKB 3QE5A 1EAOA 2Y36H 1WITA 3DX9A 3TO4A 3VM5A 2X3CA 3HFFA 5E4EC 1ECYA 2X4PB 4MX7B 3DPBA 4Y4KB 4OI9A 5ITFB 2UXGA 2LV4A 3MUGB 2WVVA 1H8LA 4ALAH 3ARGD 3IGUA 4EXKA 4RSVA 5EU7E 3SZKC 5MEQA 2HVKA 2CLRB 3ETBJ 1CDGA 1D5RA 3CQPA 1PYWA 1HYSD 4S1DC 3L1GA 3ECBA 2D3NA 4IDJL 2ENSA 5EV7A 3ZDYF 4ZS6C 1WS8A 5IK3B 1OCRB 1IGJA 4M7ZB 5IHHA 3FCGA 4J28A 5LJYH 2G0KA 4GRLB 3UCQA 1GC1L 2X7LB 4GW4B 5GSVB 3WDHA 1FCGA 4IRSB 1OCZB 1NMAH 1SGKA 2YC1B 5JQ6H 3QNYA 3EJYC 4QXUL 3NK4A 4K8RL 1FN4B 1T20A 4KRPC 2GSGA 1L5GA 1MCWM 4XNUL 5EU4A 2MCPL 4BQ8A 5JQIB 5BVJB 1B0RA 1I1AA 4L3CB 4LCWD 4P4RB 2F53D 1B2YA 4L1LA 3T2NH 3ZQXA 3KXFE 1NAML 3QULB 1GTNA 1EJOH 1N68A 1BHGA 1G1YA 1SLUA 3TBYB 1YAIA 4M9OA 2DICA 3GS4A 5B21A 3WELA 3RVTC 3KPNB 4YBHA 2C26A 4JB9L 5CBAA 2WC7A 2FBOJ 5C70A 4YPGB 5KVDL 3RWIA 2RJMA 5A2IH 5MENB 1XZ0A 4L37A 4D94A 1A7PL 3HC0A 5EPMA 1F11A 3GSQA 3BFQG 2VSDA 4J4PA 4E68A 1QD0A 4HJGA 1A6VH 4YNYB 1BREA 1NOFA 2ZUWA 4M93C 3SO3C 1T21A 3D08A 3OB8A 5ESAB 3WKQA 4KMTH 1QHQA 3NAAL 2JELH 2WQ8A 4HGWA 2Z31C 5FA3B 3NZ8A 4GAAA 4PJDE 5K93A 1TLKA 2OSYA 3DXAA 1YDPB 1FDLH 2J71A 3O6ML 5E8NA 5AOJA 1RIHH 4AEEA 4PRPD 1NEUA 1G7JA 4TVPE 1OZTG 2YZ8A 1XR9B 2A9ML 3WFEH 2Y3NA 2PYFB 2JJTC 1QRNA 5A2BA 4QHNA 1LNUB 4OZHA 5I8KH 5L88H 2VRAA 4JO5A 2DLHA 2NSXA 4DOHB 3GRWL 1K3ZA 4PGZA 1BD2E 1A6WL 3O2VL 3KL0A 1AXTH 5KVFL 1A9VA 1ICTA 5E9AA 3B3IB 3I6GB 4MZIA 4X98A 4Y16C 2C9SA 4TYUA 5T1MA 1RUAL 4DO5A 2A73A 4FX5A 3DK2A 2ADGB 2WQWA 1MG2C 1SHWA 3X11A 1OB1A 3SDXF 5DT1L 1FZKB 3KGRA 1AQDB 4DUWA 2CNYA 3OKNA 2ZSWB 1AHKA 3QCUL 3FHQA 4Y9EA 4JZJB 4WNQA 4TNFA 1FZJA 3C60A 5IEKB 1T80A 2QQQA 3ZYZA 5EA0L 4PWKA 4P2QB 3HZKA 1W9XA 2LOEA 1CXHA 5C2UB 3EJJX 1HAUA 3BPLB 3F6IA 2VDLB 3LZOA 3RP1A 1YMMA 4WEMB 2B1HL 1KB9K 3L6FA 2F08A 4J12A 1IFHL 2WKOA 3PDOA 3AUVA 4E41D 3UAJA 4NO2A 4XN4A 3T8XB 4PRHD 4N0FB 4XP6H 2J8UA 2BVTA 2XSKA 3TCTA 1Z9SB 3WEXA 2XFXB 2DIJA 2QMJA 3FB8A 3VXSD 2VCOA 4AJWA 4DJMA 3WTUA 4JM4H 3ZTDC 3A4EA 4LSPH 4MAUH 3I9IA 4PJBB 4MNHA 3VQMA 3P40A 5KYYB 3GDBA 4KH9A 1MWAA 4LCWE 4K4KA 2ZUUA 3DJTA 4MKMA 1YNLH 5D4JA 1NEZA 4NLAA 4L3FA 3RIAK 2Z7UA 3LB6D 1QW8A 1VGEL 1T04B 5AZ2L 2ZXEB 2VLJD 5CJOH 5TQ2H 1DDHB 1WTGT 3KLQA 4XOAA 3PL6B 4LPYA 1L9OA 3AROA 3QUKB 4P2YA 1XXFC 2P28B 3FN3A 3LIUA 1S5HB 3QZWA 3RILA 3G5WA 4U6XB 5FB8B 2NLJA 1ZLWH 4B9IA 3F5WB 1JGUH 2V2TA 1VZIA 3QGVA 4OT1L 2B16A 1NUFA 1R3KA 4JUTA 2XPGA 3BOVA 1VEMA 2HT4D 1MFMA 3HZMA 4XBEL 2KLTA 1QMUA 2GJPA 4OZFH 4PJCB 3CFCH 1KCSH 3SYCA 2RFXB 1BLIA 2V7NA 3HI1A 3AT0A 3JBG7 1S8DA 4PEEA 4Q8BA 5IBUG 3VGAB 3F58L 1EHAA 3NCFB 5JW4Q 1YMHB 1V10A 2EXWC 3V6ZB 2JFCA 2R0KL 4AMKL 3QFJB 4W9ZA 4KY2A 4R96A 1OLZA 2DQEL 2X9ZA 3E6HB 4PRPE 4FYRA 5B1CA 1UT2A 1YEIL 4OV5B 5F9DC 1L3NA 2AAVA 1P7KB 1PLBA 5IB3A 1U3HA 4LQFL 4A7UA 1OGAA 1NM9A 4I1RA 3EGXB 1JZ2A 4HJ0D 1JL8A 4K3DH 2P8PA 5IHBA 3D52A 4KVNL 2IXQA 4QXUH 4XHQA 2ZTBA 4XNUH 4G7RB 2BNUB 3U30B 2WBJD 1UVQA 3CX5K 2E46A 3ZR6A 1KBWA 2OJZH 3HNSH 2ZX6A 4GQ9L 4NCC2 3AWGA 2WVTA 5TE4H 4A38A 1MQKH 2FJFA 4HX1A 3TH4T 1BVNP 4L48A 4H44C 1KLGB 4X6EA 3SIKA 3NCBB 4H4NA 4JE0A 5JIPA 4AT6A 4J39A 1BM3H 2J5LB 1BYNA 4LCCC 3MRNA 5GGRA 4JB9H 3BI9X 4XHJD 1UADC 3SYPA 2JMRA 1QI4A 3IF1B 4F37K 5BOZG 4AXWB 3VE0B 4NHUB 4PRHE 2HPOA 4XXCA 3EXJA 3QXAA 3FOLA 4K5LA 4FERA 4FQ2H 4ZS7H 2CAKA 3LV3A 4N22A 3L4VA 1UOKA 4K23L 4GXUM 1CGWA 4E42B 5I0ZA 1IAOA 2XNAB 1CU4L 2YWYA 5G5DB 4F24A 4FOMA 1NAKH 4JFOB 3CFJA 4WFED 2FEEI 2CK0H 5CXPA 1OAZH 2VLJE 1NCTA 1H6EA 3NABH 5ACLA 4N0UE 1K85A 3Q01A 5EEVA 2ZONA 3IDJA 2WLYA 3M1OA 3VW3L 1N7MH 3EDDA 3T3PB 2BS9A 2E74C 2WUBL 3LZFH 1IIIA 2OYKA 1JVLA 3N40P 2AVGA 1QEWB 5EB9A 3QFDA 4AZ8B 2VKXA 1TVBB 2FCBA 3P30L 4F7MB 4XOEA 3EH3B 3S8WA 2XWDA 5C0FB 3ARZA 3ORJA 3DO7B 2EE6A 4FL4C 5MEQB 1DO5A 2A4CA 3A21A 3RWEB 3O6LH 1K5NA 4UCFA 5GRJH 3HC2A 3UTTA 5A40E 1JDAA 3DX6A 3LY6A 5A2JH 1UA7A 3QB7C 4GW1A 4QDGA 2Y06H 2QSCH 2P5WD 2VM3A 4UV7L 1G4MA 1CXIA 5FDWB 1EEUA 5FKPB 3MV11 1PFOA 4CL7A 2Z7YA 3CQFA 5KJ4A 3LIZL 5JHMA 3BEVB 3QNYB 1O9WA 5DR5L 4NO3B 4XX1G 3V5DA 1T20B 1E5CA 4JHAL 3H2PA 2I60L 1IGTA 1JXDA 5KBNC 5DVKA 2I32A 2VABB 3QJHA 5EULV 1DANT 2IV9A 2VXQH 1FBIL 4OW6A 4YGVB 2FQFA 3OG6B 4CSTA 5A7BA 4XO3A 3ZKNC 3BWUC 4F7KA 4RGNC 4ZOAA 1BZ7A 1O5PA 5FM8A 3MRDB 3D2TA 2R4RL 2YEVB 4M3KB 4DZ8A 4L37B 4OF0A 4HOXA 4JDVB 5I6XB 2Q10A 2CUHA 3ABLB 3HC0B 3K2KA 1FYHB 2VXSL 4PD4J 4OJFH 2FSEA 1Q9KA 3B9KB 1A8ZA 5E51A 3BZDA 4D0BB 1MCCA 2WXOA 3TEYA 3QAZC 1T5KA 4P4KB 3QC6X 1X7SA 5DLMH 3T2QA 4B96A 2VSCA 1JPTH 2OL3L 1T0OA 3WCYA 3AXHA 3DXAB 4FJ6A 4ZFGL 1KIRB 4ADJA 4FG4A 2CDFA 1J5DA 2YARA 4F57L 4X7CC 4JFXB 2AEIT 2GBVA 4PJ8A 1PZ2A 1WBXA 4JHBA 4XAWL 4QHNB 2J7LA 5DEGA 1KLFA 2CG9X 4I0PA 1J5IA 2FEDD 2EZ0C 2W9DL 1JF6A 1CFVL 2YXWA 4OCXL 4PWFA 5D1XA 3SHSA 4H88H 5HI4C 2F54E 4L4TE 2OK0L 2I5YH 4FNPA 1CFBA 1ED3A 3RBSA 4L9LC 3SDAA 3NIGB 1AXIB 4WI8A 5T1MB 2XN0A 3N41F 2R29H 3DRTB 2A73B 4GUQA 1T22A 4Y4KD 5C9KA 2V9TA 2VQ1A 4XN2A 1OB1B 1PZSA 5ES4B 1JPGB 2R27A 4ZUSA 3WFBH 1LJMA 2P43B 4LL9A 4W4OC 1JZ7A 1LE9B 3DROB 4TLUA 3TVMC 4UT7H 4YL9A 1ZMYA 2C9PA 3AAZA 5FO7B 3FH5A 1T5XA 3C60B 4PLJD 4GAGL 4XNYL 3DBSA 4G6AD 3GSOA 3F83A 4AYFB 1KEML 3MRJA 5DF0A 1H3WM 3MRPB 1BJ1J 4GRLD 2DPKA 4UANA 3BHBB 4FHJA 4ZAKB 5BMFH 3NACL 4AC2A 1IUZA 2ALAA 4CGTA 2Z7ZA 4M00A 4Y2OA 1MHHB 5TQ0L 2QV4A 3HG1A 1FJ1A 5HDRA 5IJDC 3IFPA 3KLKA 3FB8B 2Q3XA 4AL8C 5IOPA 2WQSA 1SFDA 4MA3B 1MFEH 1IBHA 4Z7NF 4LVNC 3GIZH 2PPFA 2HTLD 4QYOA 2X70A 1ZE3C 5HHOA 2G3ZA 1D5ZA 1NEZB 4R3SA 1GGCH 2KPNA 2OMUA 4FMVA 5IP4A 3NT0A 4JFFE 5LNDA 3L3JA 3JTSA 4PVLA 1TCRA 4URTB 1TEGA 4S0HA 2BNQA 5DYOA 3L5JA 2BSTA 3T2OA 1A2YB 3QZWB 2R59A 4Z7WF 3CHXA 4JKKA 4FYSA 5E6SB 4U1LA 4G9DB 4PV8A 1R3KB 2XPGB 3OLDA 4B6ZA 4GP5B 1S4IA 5DUJA 1BAGA 1EUTA 4K5PA 2BSSB 1ZV2A 3BEWA 3ABKB 3U1SH 5FECB 2VERA 4ELMB 5AWNH 2WUBH 4OAWB 1BSIA 1A8JH 1NCCL 3CVBA 5CGTA 5E1IA 3RVWD 2G2NA