2AQRA

Cu/zn superoxide dismutase from neisseria meningitidis k91q mutant
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
155
structure length
155
Chain Sequence
ASIEVKVQQLDPVNGNKDVGTVTITESNYGLVFTPDLQGLSEGLHGFHIHENPSCEPKEQEGKLTAGLGAGGHWDPKGAKQHGYPWQDDAHLGDLPALTVLHDGTATNPVLAPRLKHLDDVRGHSIMIHTGGDNHSDHPAPLGGGGPRMACGVIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superoxide dismutase [Cu-Zn]
publication title CU/ZN superoxide dismutase from neisseria meningitidis K91Q mutant
rcsb
source organism Neisseria meningitidis
molecule tags Oxidoreductase
total genus 34
structure length 155
sequence length 155
chains with identical sequence B, C
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2005-08-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 2aqrA00
1HL5A 1UXMA 1Z9NA 2WZ6A 2Z7WA 3HOGA 2AQTA 1L3NA 4A7GF 1OEZW 1SXAA 1SXZA 1KMGA 4A7TA 2ZKXA 1DO5A 2WKOF 3MKGA 2GBUA 1SXBA 4OJAA 1ESOA 1SDAB 3HW7A 4B3EA 2LU5A 3LTVA 3ECVA 1BA9A 4OH2A 2VR7A 1OZUA 2VR6A 1QUPA 1U3NA 1MFMA 2AQNA 1YAZA 3KH4A 4BCYA 1IBBA 3GZOA 1FUNA 3H2PA 2WZ5A 3K91A 1N19A 3CQQA 1F1AA 1Q0EA 2JLPA 1E9QA 4BCZA 1SXCA 3GTVA 1N18A 3H2QA 3ECWA 1OALA 2GBTA 3F7KA 3KBEA 1HL4A 4L05A 1EQWA 1IB5A 1IBDA 1IBHA 4A7UA 1SRDA 1B4TA 1SPDA 2Z7YA 4U4IA 2XJLA 3GZQA 2AQSA 1XSOA 1PZSA 3KM2A 1F18A 2AQPA 3ECUA 2JCWA 3L9EA 2E46A 3HFFA 2Z7UA 2XJKA 1F1GA 2VR8A 3SODB 4A7GA 1JCVA 5KBKA 2AQRA 2AEOA 1JK9A 2WKOA 3KBFA 1P1VA 2C9VA 1OZTG 1XTMA 4BD4A 1CB4A 1E9QB 1CBJA 3F7LA 5KBLA 3RE0A 1SOSA 3T5WA 1RK7A 1COBA 4A7SA 1B4LA 1TO5A 2WWOA 1F1DA 1PU0A 1E9OA 3MNDA 4A7QA 3CE1A 2ZOWA 2NNXA 3PU7A 1UXLA 4MCNA 2WWNA 1XTLA 4FF9A 2WYTA 3QQDA 2WYZA 2E47A 2WZ0A 1EJ8A 4MCMA 2ZKWA 3S0PA 1SXSA 1JK9B 4N3UA 1TO4A 2APSA 3CQPA 3KH3A 1YAIA 3GTTA 1SXNA 1AZVA 1IBFA 2AF2A 1SDYA 1E9OB 2C9UA 3GZPA 2V0AA 1OAJA 1PTZA 1S4IA 1YSOA 3GQFA 2SODB 1BZOA 3KM1A 4N3TA 4A7VA 3QQDB 5KBMA 2Q2LA 2C9SA 1Z9PA 1E9PB 5CU9A 2GBVA 1DSWA 2ZKYA 3L9YA 2K4WA 2Z7ZA 2AQQA 1E9PA 2R27A
chains in the Genus database with same CATH superfamily
1KXTA 4UOW0 4Z7UE 4OI9A 4E36A 5K33A 3N41B 2BNRA 3WTSA 3VACA 1M05B 5FOJA 3Q8BA 1E6OH 2VH5H 4HGKC 4AJVA 2XPGA 5DVOA 3ZUNC 3BFOA 2I26N 3TPKA 3ZDXB 3U0WH 4W6YB 4LKXB 3T2OA 3VXUB 3GRWA 2F53D 4HIHA 2BS71 2IPTL 3DJRA 4UM9A 3EO0B 1KJ2A 3BT2H 3QUMB 4I77L 3HJ0A 3R1GH 4ZTEA 5T8IA 1QVOB 3IYLW 4GQ9H 4K5NA 4LPCA 5IJCC 4U7MA 4AYFA 4KKAD 2VDML 1EAPB 4G6KH 3O9WB 4CL7A 1QNZH 2XTJD 4KK6C 1A0QL 4S2SA 5EORH 3RWDB 3DX7B 4QXVA 5F0LB 1LE5B 4G5ZL 4L8DA 1I7RA 1XAUA 2HG0A 3H3KA 1BAFH 3FQUB 3NTCL 4RGNE 4TQHA 3SDXF 3SPIA 1X7TA 4XVTL 4DOHE 4L8BB 2H6OA 4JFDA 4YQXH 1EAOA 3PV6A 5ISZA 2VE6B 3MV8B 3NPZB 2AABL 3ZZLA 3HC4H 1CZ8H 3WFDH 5F3BA 1JV2B 4KKNA 4NQCB 1KEGL 3D50A 2OMWB 1MHHA 2AI0H 1SM3H 1ZGLM 1HSAB 3MGTB 4HGWA 1BV8A 4PGBB 1JHKL 3DYOA 4P46D 4P9ML 5C08D 3UTPD 2X4UB 3CVHH 3DO3A 1DHKA 5CZVL 3WKMH 3B3IB 4ZFOA 1MFEL 2YAHA 2PXYA 3ZHKA 2X1OA 5FHBL 1Z5LA 2RCSH 2OP4L 3H42L 3LXBA 4LSVL 3DECA 4Y4HB 1DQML 2VDPL 5L9DH 3HMXL 3U9UA 2HT2D 4U6VL 1S7SA 4NP4H 1E50A 4NQDA 3REWB 4UZUA 1JGVL 1RY7B 2FX7H 5JR1L 3NIGB 4M6NH 1AANA 1M05A 1SY6L 4HCRL 3WEXB 3HCVA 5AVTB 1I8MB 4L4VD 1K2DB 4ISVB 1UHVA 1FYTE 2F0CA 3LQAH 3QS3A 1UFGA 2W59A 4PRHB 2EDEA 4J5VA 4LKXA 2VXUL 3VXUA 4F8OA 5LVEA 1BQLH 2ZUVA 1RUAH 2KQMA 3EO0A 3QUMA 1OWRM 1E40A 1I9RL 3WI9A 4NZTL 1DBJH 2UXTA 1QVOA 4YDKH 1NIFA 3PUCA 1QSFB 5IHBA 4OLZH 4NM8H 1ZLEA 1EAPA 4V1DD 1H3UA 1MJJB 2D73A 3O9WA 5DMIL 3RWDA 3DX7A 3A23A 3PPSA 1MWAH 4KHXH 1KN2H 3AT8A 2OSYA 4NC1E 4TNEA 4WI4A 4XP4L 3SZ6A 3L4TA 1X5YA 5DLLA 3FQUA 2WXRA 4Y2DC 3FQNA 3T2QA 3R8QA 1DVYA 4L8BA 5C0JB 2R0ZH 2XFXB 4JM2D 1WFMA 2IGLA 1QRNA 3IMSA 1BIIB 1FC2D 3ZKXB 2VE6A 3MV8A 5I76B 1K3ZA 5E1QA 3ZLQC 4I7ZC 1JV2A 4FQIL 1ZVNA 2IOMA 3TM6A 3C2AL 4NQCA 2OMWA 4JHAL 3NACL 2YN3A 1IIIA 1QBLL 1HSAA 3MGTA 2BS8A 1H6TA 4PGBA 1AAJA 2YD9A 1MVUA 4PPTA 4ACPA 2X4UA 1RUKH 2J8HA 3WNLA 4EI5B 1XF5B 4NUJB 3RX7A 3ECUA 4PWKA 1QEWB 4M7KL 4JDTH 3UABA 2NY2B 2EKJA 3CC5B 1T03H 3GJFK 1P1VA 5FUZL 2ZAGA 4Y4HA 5JTWA 2V5YA 2J44A 2F54B 3DYMA 1G87A 4EKXA 3S96B 2I5YH 2BVOB 3I84A 1VCAA 3REWA 5B1KA 4A7SA 3US1A 1I3UA 4H44C 2GUYA 3A4DA 1D5RA 2VH5L 2WKGA 1BMWA 4JHWL 1EAJA 4M7ZC 1K2DA 4ISVA 4LF3B 4PRHA 2E47A 3ZHDA 3U0WL 3GXDA 3T2LA 1YEJH 2CK0H 2BHFA 4FMVA 3V4PH 5AW8B 1IFHH 1RHFA 4M61B 1YMHB 5D55A 1BQHB 3BT2L 4YZWA 4JJHA 4FXGB 3QEGL 3T4AA 3R1GL 4QXTB 4WCYH 1RZKC 2AF2A 2OYKA 4ECNA 2IBGA 4GQ9L 1E3XA 1E28B 3C75A 5KVEE 1HZKA 1QWUA 1QSFA 1BZOA 4JPIB 4UQ9A 2JK5B 4G6KL 4M3JA 2ADYA 2IQAB 2EDKA 1MJJA 4LMQE 4OF0A 3V6ZA 1N6UA 4F93B 1DSWA 1ODAA 1AR1D 1HI6B 2UV3A 5D4HA 4OAWB 3VFRB 4X9BA 1WZMA 4EVNB 2YD5A 4TOYH 1PFOA 2LT9A 5L4IA 4NN6B 3X3FH 4AYID 1BAFL 1XSIA 1B2WH 1NDMB 4HJ0D 4PJFF 4XGZB 5IB5B 5D1XD 2Z35A 3SDYL 4MD0A 4OBRA 4IQHA 4NKOA 4OGXL 2HT4C 2LU3A 3N2JA 4DN4H 1S5HB 3U2JA 5C0JA 2XFXA 4JFQB 2ZXWB 1BIIA 4HSAC 3WFDL 4HHWA 5I76A 2CE6A 5CCKH 1UT9A 3MCLL 2ATPB 3KEDA 1QLRB 1BLIA 4NHCH 5DT1H 2AI0L 5I24A 2QADC 1A7RH 2H1LM 4NUQA 1UTDA 3HW7A 1WWWX 4ODWB 3IDYB 2APTA 1ZV9A 2WYIA 3CVHL 3L4ZA 5C0FA 3G04B 3ZR5A 5HDRA 2HWZL 5KJRH 1MFMA 4J6RL 1JF1B 3CHPA 3QDJE 1XF5A 4MKTA 3RUGE 1QSEE 1QZNA 1NKOA 4NUJA 1JYXA 3EXJA 3AGWA 1QEWA 35C8H 3NABL 2TRHA 3II3A 3CGTA 3DRQA 3QUYB 4F91B 5L9DL 1KSRA 1ASPA 4JW3A 4TUKL 2OMNA 5J6HB 2BH0A 2DIEA 4NP4L 3TIEB 2F54A 2Z0BA 3CX2A 2Z6FA 3ILPB 2F18A 1NWOA 2BVOA 4JG1H 4BINA 2OZ4H 3ROOB 2FX7L 1YQ2A 5BRPA 4CA4A 4M6NL 1JZEA 4ZD3H 1VFAB 5J13C 1NUDA 3JVFC 4HSCX 3GO1L 3GSNB 4L37B 5T1JA 3EF4A 3LQAL 3T8XA 3GXNA 5CILL 3BAWA 4JFWA 4LF3A 3VE0B 1OAZH 3HAEG 3JWNH 4Y16B 2KHAA 4Q8BA 5JW4N 1MIEH 3DC0A 2V5SA 3IDXH 2IAMD 2VLLA 1KTJA 3JTSB 2OFQA 2VISB 1YMHA 4GP8B 4M61A 4NWUH 1BQLL 5A6IA 4M29A 3EHBC 1BQHA 3KYMB 3FTSA 4FXGA 3QORC 4GW5B 4CGUB 1DBJL 4QXTA 4GG6B 3EH5B 4Y0GA 3QEUB 4KJYB 1E28A 3FQWB 3MJ9H 4E68A 5C0IB 4OLZL 4JPIA 4FQCL 3ZK0A 2Y2WA 5E2WH 2JK5A 2VWEE 1U4EA 4E41E 2WJ5A 4LARH 2IQAA 3LPWA 3KXFB 4I9WD 2OSLA 1HI6A 1MWAL 1KN2L 3RGVB 4OAWA 5E51A 3VFRA 5K39B 3MREB 4EVNA 4NUMA 3GEWB 1NDMA 1W8OA 3S36H 4AENB 1IC4L 2BRQA 3JZYA 2IAAC 1S5HA 1MF2L 2NY4C 4JFQA 2AXFB 3NH7H 4PJCB 2NR6C 1KLGB 4WTQA 4N0CC 3PLYA 4E9SA 3RVUC 5LBGA 1FVDB 1IMHC 1YQVH 2ATPA 4HMDA 3WS6A 4A2HA 3WDIA 2OPCA 3QNYB 1IEHA 1KOAA 1BM7A 2HUHA 3ZHLA 3NJMA 1T66D 1TSHA 4ODWA 2R0KL 1OP3H 5E4IA 1ILUA 4B9CA 2MHAA 3BEWB 3QAZC 1RUKL 4WI8A 1FFPB 4FOMA 1DVZA 1JF1A 4LVOB 4OGYH 4JDTL 1J0ZA 1R1CA 1J87A 1UASA 5JIPA 1TQVA 3DNKA 1T03L 1OL0A 3QUYA 3DHJA 3HA0A 4ANVA 2IH3B 2HLAB 4U3HA 2RR3A 3C8HA 1NUGA 3CN2A 3TIEA 2I5YL 5B7MA 3IDNB 4JFVA 1DQLH 4Y1AB 5I0YA 2C3HA 1WV7T 2ZTBA 3ILPA 4X7DC 5FUCC 3ROOA 1IM3B 2JI3A 3U2SB 1VFAA 2V2XB 3FCGA 1EHAA 1ROCA 3BHBB 3GSNA 4L37A 4F20A 2CK0L 3V4PL 1IFHL 1BXVA 1JNNH 4S11A 4HWEH 2VISA 5KTEH 4OFDA 4LEOA 2Y5EA 5D9SB 3S6CA 3TF7C 2EE2A 3IN2A 4PRAA 2YGOA 1ZHNB 4GW5A 5EBWB 5ITFB 4F57H 5MEOB 4GG6A 3CSPA 3RWHB 4BFBD 4DEPB 4KJYA 3FQWA 3AS3A 1A14H 1VZGA 4MWFB 4L0YA 3MRHB 1BD2D 3LS4L 2D0HA 2DLGA 1IVLA 2PPDA 4MXVE 5HY9A 4TOYL 1OT4A 3DX4A 2QVIA 3TWCL 3KXFA 3NESA 3X3FL 3RGVA 3WIHH 5K39A 1B2WL 2FHBA 1U8CB 1KJ3H 3RP1A 2PP7A 1Q90A 3FT0A 5HHXH 4AENA 1ZK5A 5JHDB 4P5TB 3TO2B 4DN4L 5KYNA 1RFDH 4M93C 3D4YA 4MMXC 2OSWA 3B7UX 1KLGA 3GXFA 2DMHA 3DTXB 5CCKL 2WBJB 3BZEB 3TJPA 2XNAB 1OK8A 4WAFA 2QTVA 1Y0LB 3QUHA 4NHCL 5DT1L 2COQA 1QFOA 5I5JA 2JSFA 2HFGL 2DLFH 1F2XK 3IKCB 3QNYA 4WW2B 1P7QB 1YAIA 4OZGF 2N7BA 3O8XB 5TQ0H 2NSQA 1RAMA 2WNKA 1X5FA 3SGEI 3BRGC 2VIRB 1A7OH 1C5DB 1YUHB 2VZUA 4PG2C 5E7FA 3IRCA 4Z7VF 5J9PB 5KJRL 5I1KH 1RCYA 5E1GA 1MELA 4APQB 4IBTA 2B15A 2N1TE 4J3OC 5DEFB 4B27A 4IOFD 5AVWB 2YLHA 3QXVA 4X0KA 3UOAB 4X5RA 5I71B 5C0AD 3ARBC 2IH3A 4JJOA 2HLAA 2VM3A 1V55B 1ZY9A 4G8GD 3CZEA 3IDNA 4JG1L 2OZ4L 4NWTH 4XTRD 2PKDA 3FTYA 4KNTA 3DX6B 3DO7B 4ZD3L 2B4CH 1IM3A 3QIBC 3U2SA 2V2XA 4Y19D 5T5FH 4JFEB 3SDXA 5IZ7A 3N42B 1TZGH 2DBLH 4JE0A 1MHEA 3Q3GB 2YOAA 3GSRB 2CO6B 3KL5A 4NWUL 1HXMB 3HE7A 1AZNA 2YPLB 2VDKB 3CHRA 3EAKA 5D9SA 4RFOH 1T7ZA 1BMGA 2IO5A 1PYWB 1G4MA 4KH2A 3B9DA 4WF7A 1ZHNA 5EBWA 5ITFA 5MEOA 4KVCH 3RWHA 3MJ9L 4XN8A 5T5NG 2BIPA 5L2KE 5BZZA 5E2WL 4N0FA 4OGQC 4MWFA 4LARL 3MRHA 2OM5A 3VJ6B 2BVQA 2EO1A 3K72A 1B3JA 4HMEA 4K8RD 4F7KA 3VWKC 2NCMA 3S36L 2WD0A 3I9GH 1U8CA 2Y69B 4OB5H 1EGJA 4JN1H 2ZP0T 3KHQA 4X7TB 4JE4B 5IVXE 3AREC 5SWSD 5A7BA 2B39A 4P5TA 5AB0A 5JHDA 1BFVH 1I1AB 3TO2A 1KCRH 3NH7L 5EA0H 3PWPD 4YWGH 3L17A 1IKNC 5JPNA 3TURA 2W0FB 2W0LA 4GBXC 3DTXA 2WBJA 3BZEA 3MRKB 2XNAA 1YQVL 3P4MA 2D7MA 2YA1A 1Y0LA 3EYSL 5FYKU 2QEJA 4G8AC 1XTMA 4JGJA 4YR6B 3FB8B 3IKCA 3Q44A 1P7QA 1DBBH 3O8XA 2VLKE 1GPOH 4DEWA 1VRSA 2VIRA 1GGIL 2H9GA 2J8OA 1YUHA 3ZJAA 4N9GB 4F7MB 5BZWB 5J9PA 4NFDA 5PCYA 5DJXA 3QDGE 2RAMA 3DMMB 4KNUA 2NNXA 2BNQE 4OGYL 5FPIA 3CVDA 4APQA 1AXTL 1L6XA 5DEFA 1AO7D 2W65A 4G3YL 3ATEA 1MVFA 1LD9B 1KZQA 1MFAH 5CU5A 1JYNA 2A3TA 4H2CA 1A3QA 1MN4A 1TJMA 2C9RA 1YY9C 5L4JA 4LPWA 1NC2B 5KVGL 2NY1B 4QRRE 4B5EA 3DX6A 2C9UA 3JWDH 5CGMA 4JFEA 3KGRA 4IRSC 1JS4A 3M86A 4QGTA 1L0QA 3Q3GA 2IF7A 4YAQB 2WXGA 2CO6A 1JNNL 4HWEL 1HXMA 1XX9C 3A3YB 3UTZA 4F9PA 5KTEL 1O5DT 4D9LH 4ODSH 1U92B 3O4LD 1PYWA 1HNGA 4RGNC 3DJTA 1ITBB 2ODHA 3TL5A 3PWNB 1IBGL 5HHOE 5B39G 1A14L 4PJBE 3H53A 3MBXH 1IC1A 1WAEA 1NGQH 3CHOA 1MXDA 3TJEH 1A4AA 3OSKA 3VJ6A 1HAWA 4DP2X 2R0WH 5B1JC 1SXZA 4EQ2A 3WIHL 5I1EH 4JKPH 5J6GA 4ZXBB 1NUFA 4HETA 3GDCA 4LLWA 4QRPB 4UNIA 1KJ3L 2Y36L 4X4MA 5HHXL 3RL1B 2CJTA 4PJXB 4YDIH 1TQSA 4A66A 4X7TA 1RFDL 2PWFA 1VADB 1CFMA 1EMTL 1I1AA 3TA3B 1GGUA 5LNGA 3RIFK 2WBKA 3TZVC 3V0HA 5BS0B 3IDIB 4P0DA 4DVBB 3UG3A 3MRKA 1UD6A 2D7TH 5DFTA 1RULH 2FJSA 4HXBH 1N5YH 1A7NH 4PJ9B 4I3RH 2ZWYA 3TBBA 3LV3B 3S3CB 2DLFL 3AG1B 2QSCH 1AMYA 1Q0EA 5TQ0L 3FB8A 2H41A 4HUUB 5GJSH 2OL3L 1A7OL 1JNLL 1OGPA 2X9YA 5D70L 5I1KL 4IKNA 4N9GA 2WXMA 1X6LA 5BZWA 2X2IA 1UWEH 4G6JH 3N9GH 4O00A 4FQ2L 5E1AB 3U6XA 3MRDA 3O45B 3O6MH 4JO3H 3GIZH 1LD9A 5KUMA 2R9HD 2IH9A 4ZUSB 3AVEA 5CJ8A 5GZOC 4JUTA 3BCDA 43C9B 1Y7VA 1P0SE 1NGPH 1NC2A 4GMTL 1L9NA 4FFTA 2JF1A 2PF6A 1QI4A 2Y22A 1RZIB 5KUKA 2HG5B 2UYLB 1YEWA 4QJ4B 2Z4QB 4N2OA 4N8CH 1TZGL 2DBLL 3QJTB 3ARGB 2WQRA 1EEQA 3GRGA 2BZ7A 2WQ8A 5PAZA 4YAQA 1JK9B 3T0EA 1ZSDB 2WLZA 3UPCA 4JZNB 4RFOL 4WO4C 2IALB 1U92A 1T80A 4B0MB 2OI9C 3NIFB 4KVCL 4G8IB 1HS6A 2CKBB 1ECZA 2OJZH 4LRNH 3K6SB 3PWNA 2YN5A 4XE0A 2ZAHA 5GS0D 1S4IA 2CO1A 5LNDA 2E8ZA 1CE6B 3B1TA 4C56B 3P11H 4MYPA 4GT0A 4YFLF 3G5XA 5G4OA 4XN7A 2OLDA 3AU1B 1ETB1 4ZXBA 2ENPA 3I9GL 3KNBB 3QUZC 1TZ8A 2DMBA 4JN1L 4LLDB 4MZ2A 3RL1A 2JV6A 2WB1A 4PJXA 1X3DA 3RY5A 3SGEH 4BZ2A 3S3DB 1BFVL 4GRLC 4QHPA 5EA0L 3LN9A 4YWGL 3MRBA 3TA3A 2H32B 3GMRA 1G94A 3NN8B 4CVZB 2ZWZA 5HYJE 3MSPA 4MNQA 3ESMA 3P69A 5E7BA 5BS0A 3IDIA 4DQOH 1OEZW 3HG1E 4Y4KB 2NXZB 4NYLB 1YN6A 4PJ9A 3DA0A 5T5NF 1JD7A 1USZA 1PS3A 2R4SH 3IAQA 3LV3A 5H35B 1DBBL 2E9WA 2ROXA 2TAAA 1GPOL 4U4BA 4HUUA 5F0JB 2RMNA 3SDDD 4C57C 3CZSA 1NZRA 3K0YA 5IBUB 5DUBA 3SE4C 5J06A 5DXWA 1EO7A 3EJYD 2HT3D 1E4KA 2P5PA 4DETA 2MQCA 3BUYB 4EPSA 3Q5TA 4OCWH 1P5UC 5DWUH 5E1AA 1WT5A 5HSFA 3I9PA 3O45A 3T77B 5FFLA 2EUVA 1NCTA 1JPTH 4HQQH 4ZUSA 2CBQA 5BUGA 4N0UE 4JR9H 3UDWC 1BJMA 2J3SA 4FQXD 43C9A 1WWBX 5SWZE 4IOSA 4NJAL 1RZIA 3JWDL 2HG5A 4HEME 2GJ6D 3SO3B 3FFCB 5KVFH 2FX8H 1FH2A 2Z4QA 3AROA 3H3BC 3H55A 1E3ZA 1HU8A 3ARGA 3EBIA 2VJXA 1H3XA 3RWIB 3FT3B 4F2FA 4D9LL 5ADOL 1JK9A 5A2JH 3U48A 4XX1E 1ZSDA 3OKDA 3MAWA 3M7OA 2HLEB 5F88B 4JZNA 2IALA 4L18A 1WD8A 1CGUA 2PPCA 5GZND 3TT1H 5L7XL 5HVFB 3ZT6A 4RRPA 4G8IA 1XIWB 2CKBA 4PJDE 3TH4T 4OZGB 3QWRA 4X0NA 4RMRA 2XFGB 5CWSB 1CE6A 1L0PA 1SLVA 4ALAL 4AQEB 4C56A 1E8ZA 1HFUA 2MIZA 4B53A 1XGPB 1EFQA 2WQXA 4N2FA 4JKPL 4PIBA 4V11A 4W6WB 3L3IB 5I1EL 3AU1A 3QHFL 1MREH 3KNBA 1LO0H 1ET7A 4LLDA 4U7SA 1AC0A 3S34L 4LSPH 1VSCA 1C9SA 2H32A 1HHJB 3DVNB 4ONHB 4CVZA 1LO3L 5ETUB 4MJ5B 2XOTA 2D7TL 1FNEB 4HXBL 1A7NL 3OM3B 3E9UA 4I3RL 4Y4KA 5D7IF 3NJGA 2GTQA 3NQIA 4NYLA 1N0LB 2QSCL 3S8WA 3D12B 4LOUD 1XZ0B 5H35A 2WZPA 5GJSL 3WEBA 4U6HB 1JZDC 1IL1B 4NGHL 3DV4B 2E74C 2FDBP 4S0SD 1BLNB 2GT9B 2NYKA 4WFFD 4G6JL 1OTTD 1QA9B 3BUYA 2X05A 3U9WA 1HAUA 2BY1A 3GMOB 3KLKA 1PJWA 3O6ML 4JO3L 4MVBD 2JJSC 2RQ8A 3T77A 2Z8WC 2L3BA 2VN5A 2WXLA 5JMOC 4MJ2A 1GOFA 4D9QD 3K8KA 1CLCA 32C2B 5EWIH 2E9IA 4G7QB 4N8CL 2A7BA 2KC0A 3FFCA 1J11A 3QK0A 3SQOH 5IJBC 2VWEC 2HKHH 3AQZA 3KGSA 4MTMA 5C3LD 2YS4A 2CWRA 4M9OA 4U33A 3FT3A 5KVGE 3RWIA 5IHLB 3DURB 2BK8A 4U7KA 2ICEC 1J5HA 5F88A 5E4EC 3KVQA 1JMXA 4A55A 2NX5D 1T1WB 1D6EB 4LRNL 3ZMNA 3KPRB 3PIQB 3UEQA 3KCWA 1XIWA 1SUHA 5IK3B 1MCIA 2MPVA 4OZFG 1SHSA 4OZGA 1DZ0A 2AAVA 3P11L 4H20L 3GINA 4MRBA 3WTXA 2IBZX 1EDHA 3HTLX 2XZQH 5CWSA 4AQEA 1CURA 1XGPA 4JO8A 2XBTA 3ZDYB 3ENEA 3EXLA 5E6SB 3L3IA 3GJEB 5JORB 3F7RA 1E8YA 3K4AA 3OGOE 4YUEH 2VW4A 1O5PA 5FW8A 9CGTA 4AG4H 5LDUA 1QFUH 1U9KA 1GY1A 4KOBA 1PFCA 2YQ3A 4N2IA 5DU7A 3K71B 1GOHA 1HHJA 1QTPA 3KPQB 4HPOH 4ONHA 5ETUA 1E7UA 2VDLB 4M62L 2KQNA 4MJ5A 4UV4H 3VI4B 4AVKA 4DQOL 1HKFA 1FNEA 2ZT9C 5IQMA 4NENB 2WAHA 2JB5L 1N0LA 1SXSA 4Z7WE 5FYLL 4BE6A 3ZGHA 5C0BE 1I7ZB 2APXA 3H7BB 4BKSC 1X9RA 1CLYH 1A6VH 4U6HA 3ZYOA 3WFHB 2ZWLT 2NTFB 4KVNH 5KSBE 2CJUH 4LP5A 1LYQA 1NIAA 4G8EB 4YO0A 2ITFA 5JXED 1BLNA 2GT9A 4R90H 3GQFA 4XN5A 1QA9A 3VXSB 2H3KA 5DWUL 5D2NE 1AQHA 2B20A 4N90D 2G3MA 4JDZB 3CHXA 4JVPA 3QJFA 3WJLA 3OV6A 1TF4A 4DTGL 1MW3A 1JPTL 4HQQL 1U6AH 4Y5VC 4JR9L 2AQQA 2H6UA 1ZXKA 2X10A 2GW5A 1O9ZA 5BV7H 2HFFA 32C2A 3BMVA 3CVIH 1QG3A 2Q1EA 5C09E 3GXUB 5F9OL 4RGMC 1HXYA 3TFKC 5ALCH 3B2UD 2VLJB 4CNIB 4DVBA 4PVBA 1LWJA 1AFVH 1XCXA 2WKOF 1N7ML 2ZKXA 4B9GA 4N28A 3QULB 3ZZQA 1GSMA 1EO5A 1KBBA 4XMXA 3TT1L 4IBUA 4FFZH 4WFGD 1H8SA 2MCMA 2HMIC 1D6EA 3WHE0 1WUZA 2BS9A 3OKMB 3PIQA 1KC5L 1UOWA 3MJ8B 4AWJC 5LGJB 3O3UN 4S1SH 3W0WB 2P5WB 2J4WH 5AOIA 4ZO6A 4OZIE 2P43B 1JOIA 4UNTA 5AALA 2W80C 1RV6X 1MREL 1DSFH 2EYSB 1AIFB 1LO0L 3FF7A 4TM9A 4EN3D 1F11B 5JORA 1XH2A 1CE1H 3BAEL 2CUAA 4HJUA 4EE2A 2RJMA 5GJTH 3C5ZD 4LSPL 4YDMA 3TYGH 1NANH 4M7ZB 4Z8FH 3PNWA 1HL4A 3QJOA 4GKLA 4KI5E 3FSOA 4F80A 3M17A 5HHQA 3EJJX 4ONGH 3FUNA 3K71A 3KPQA 1DVFC 3VI4A 1FG9C 1P2CB 5I0WA 1N5AB 3ATBA 4NENA 2KPWA 2CLRB 3N55A 4NZJA 4WSKA 3UCRA 1J05B 4O02H 4WLCA 1ULVA 2NTSP 3AADB 3BVNA 1I7ZA 2X5PA 3DOSA 2Q5BA 5HD8C 4LLQB 5C92A 4UQCA 5F97E 4MHHG 3WFHA 2NTFA 4L9DA 3WOVA 4G8EA 2VZTA 1KB5H 5FO9B 3D52A 5HJ3B 3THML 1BJ1H 5LNEA 1QBBA 4ZUTB 5TJWK 1QQDA 3WEMA 4IIQB 3VXSA 5TPWH 4Z6AT 1RUPL 3LHPH 4ZNCD 2MNWA 1XEDA 2A4ZA 2DWXA 3SYCA 1DUYB 1RZGB 4DJMA 5HGAB 5BRZD 4K3DH 3I85A 4W9JC 1L7TL 3L3KB 2IDSA 1FO0L 2PYFB 5EU5B 3FH8A 1OD7A 2BHZA 4NN7C 4PIRF 3RIFF 1LK2B 1YSOA 3SQOL 4MNGE 5JQ6L 2QADB 2HKHL 4OF5A 5EH1A 4HJJL 5F9AC 1SEBB 2VLJA 4I2XE 3CTTA 1DQJA 1NAKH 2C9SA 4OD1H 3FUKA 3VU2A 2O93L 1J0JA 5AVYB 3QULA 1CLVA 3KS0H 3MLSH 2IGFL 5CGYC 4OJDH 1T6BX 4RAHA 4N0YH 3K6DA 3V79C 1RU9H 2V4LA 3WMQA 2HN7B 4TNWK 1UATA 2B5IB 5KSAC 2D0FA 4FXLA 4FG6C 3CVCA 4RMBA 5DVLA 3TPUB 4I4WB 3MJ8A 5LGJA 2XZQL 5D7JD 1BAGA 2QMKA 4M48H 5KAQG 5JLZB 1D2PA 4YSCA 2V9TA 2P5WA 3W0WA 1IT9H 1UJ3C 1FGVL 3ARZA 1PW3A 5D7KE 5I6XC 4FYQA 5FFOA 1JSYA 1FRGL 1OGAB 1AIFA 2EYSA 3BI9X 4YUEL 1JYVA 1F11A 2ARJB 4AG4L 1QFUL 1CFVL 4CVXB 4JZJB 1AZZC 4NFBA 2QT6A 4G1MA 1M7DB 4HPOL 4LAQH 1FHNA 3WIAA 5J89A 1E5YA 4UV4L 4H1LG 2WXIA 1P2CA 4N2MA 3PXHA 1FAIH 1N5AA 3EHBB 2CLRA 4IDJL 4RESB 2YZ1A 4P2RE 2V5RA 3QORB 1QWNA 3WUWB 5ESVB 1UWFA 1CLYL 1A6VL 1T22A 4LLQA 3ESPA 2CJUL 3QSKB 2F1AA 3AXHA 4PD4K 5I75C 4XB3A 1G7PB 2XV6B 4WUUB 5FO9A 4ZUTA 5TK2A 5DA4A 3LB6D 4B9IA 4RIRB 5LXGL 3IS1X 4IIQA 1XGZA 2FE0A 3PCYA 1WPCA 1AJ7L 3VTTA 2X4RB 4C47A 1QHPA 4AX3A 1DUYA 1RZGA 1U6AL 2APWA 3BFWA 2Y7OA 5HGAA 2NY4B 3EYUL 2NT1A 1FVEB 3CN1A 1G1OA 1ADQH 3LQAC 3L3KA 2FAUA 2UVFA 4OI8A 3CVIL 5EU5A 2WQSA 3WENA 3MV7A 1LK2A 3UBXI 3E0GA 1TTCA 4UBDC 3GMPB 4FF9A 1SEBA 3SKOB 2Y2YA 3NZHL 3QHZH 3KGTA 2OQJB 3QAZB 5EU6B 4XHJC 2Y1ZA 3CLEH 3ECBB 3PJLA 4NQQA 2HN7A 5EIIG 1S3RA 1IEAB 3VG0H 2J6EH 1XZWA 3TPUA 3VRLF 3GSQB 3MUUA 4I4WA 3GZPA 4S1SL 2VDOH 1DFBH 1GIGH 1MHCB 2J4WL 2YXMA 3IE4A 5JLZA 3GK8H 2VO8A 1F90H 1G84A 2G60L 4QDGA 1GW6A 5GQBA 1DSFL 2VRQA 1QR4A 3PF2A 2X4OB 5DGQA 2E5EA 5F7KC 1OGAA 3SJVA 3ULVD 2PO6D 2ARJA 4NPYB 3UTQA 2UWEE 4Z8FL 4CVXA 2EVFA 4JZJA 2BP5M 4FI7A 4HOWA 1IKFH 3MLVH 1M7DA 4LSQH 3T0VA 4WV1C 3CZUB 4PV1C 4XAKD 3NRFA 1T7XA 5E2TL 3QC5X 4L3FA 3ILQD 2NY3C 5C0DB 1WFOA 5AZUA 4ZOCA 3EDKA 2OMBA 3IS0X 2ERJC 4O02L 4GXUM 5EN2B 3ZZSA 1J9TA 1MCFA 4MYWB 5J1TC 3KPNB 5ESVA 1DJZA 5HHME 5CSBA 3CFKB 2XX0A 1RKRA 1BECA 1KB5L 3FTWA 3AB0C 3BPOC 1SHMA 2N0MA 1G7PA 5FYLE 4URTB 3E38A 1UD5A 4RIRA 5DZJA 3SGDH 3LHPL 5HDBF 4BUHA 5E9DD 3NEOA 5MHSE 3SDCC 3L7FB 4PBVC 4MMZB 2EDLA 5FB8B 2X4RA 1PZCA 3RKDD 5JOPD 4P4KC 4YHKH 3DHMA 4K3DL 4M93B 3PL6D 4MMXB 4QKTA 2EABA 3WN5B 1FVEA 2DYPD 1E0OB 2D7QA 2NR6A 4AE0A 2HYMA 4K7PL 1OVZA 1YN7B 4K07A 3TBTB 1LMKA 2RGSA 1E5ZA 3LN5B 3VSUA 4AUJA 3ZN6A 1QATA 4NRYB 4XHQA 3GMPA 3MGAA 3U0TB 2FD6H 5D1ZD 2Z7UA 4OD1L 3HBQA 4XNUH 3SKOA 4B7IA 2VERN 3N1QC 4HSQA 2D3LA 2BVYA 3CFIC 3MLSL 2OQJA 1HOCB 2XQ0A 1RK1B 3AITA 2G2RB 2PPEA 1GL4B 4N0YL 1C8QA 2XC8A 1RU9L 5ALBH 2UUDH 4PS8A 3ECBA 3O4OC 4JDEB 1IEAA 4EIUA 1U33A 3UJIH 3GSQA 4OCXH 4M48L 1NCIA 4F7TB 1MHCA 1IT9L 3ARBB 4LRIC 5CUSH 1URZA 3MPCA 3I6SA 2UXFA 4P2OD 3UTTB 3SYPA 1G1YA 1UQSB 1P4IH 2WZ0A 3J8F7 2X4OA 2QQLH 3Q2LA 3NT0A 4H4NA 4LHJB 4NPYA 3QIBB 1EXHA 2M8XA 3L54A 3TO4B 3VH8G 2ICWJ 2ZUQC 4H8QA 1W8NA 4RZCB 2EC9T 5I6PA 4NKQB 3L13A 2JELH 1YHPA 5D5MF 1FAIL 3KZ8A 5C0DA 4BGDA 2QV2A 4RMVA 1QKZH 1Z9PA 4RFNB 3I9AA 5EN2A 1N67A 5KAQF 2WXHA 3SDAD 1R5IB 3KPNA 3ZW3A 2FWSA 5BZDB 2YQGA 3CFKA 5I0DA 1G4RA 4EI6B 3JSSA 4QXGH 3M46A 3D18A 5BZXA 1WIUA 4UT6A 2GY5A 4I89A 1U8HB 4FABL 2F6AA 3VWKB 1U30A 3NSFA 4J3VA 1JZ5A 1EUUA 3L7FA 3Q2VA 4MMZA 3V0FA 3TCLB 3AREB 2XETA 1JZ6A 5JIDA 3Q9PA 3ETTA 5KW9H 1E7VA 1ADQL 4HCFA 5JZ7C 3EOBB 3WN5A 2YMXH 1XGYH 3LDBB 4YHIB 4GBXB 4N86A 1JD9A 4DP1X 5GIRB 1YN7A 5C7ZA 3SBPA 2HX9A 5HHPB 3LN5A 4HBCL 5FM4A 1Z0NA 3NJLA 4NRYA 5IFJB 4OSUL 1IBBA 3U0TA 3SY0A 5I66B 3X1FA 1YEHH 1LDPL 1UD3A 3QHZL 4LSUH 4MD4B 5FS5A 5KEZA 2A9BA 5MI0B 5HYFA 1HOCA 4N8VB 4Z7UB 1RK1A 3H56A 4PG2A 2G2RA 3MVSA 3LYRA 4ZX4A 4WKZB 3VG0L 1YEKH 2F53E 2J6EL 5IBLC 3RDTD 3BP5A 4JDEA 3STZB 2QSQA 2VDOL 3MBEC 2EH7H 2HFEB 2IAND 5K1NA 4PI0A 3EUUA 4PCSA 3N06B 1NCWL 4F7TA 1FGNL 2I7SA 3ARBA 1MFBH 2UVEA 2WTPA 3IGUA 4GI6A 4K8RH 1RERA 4PGEB 3UTTA 1P4BH 1VA9A 1UQSA 2BSBA 4KXAA 4QEGA 1WFIA 2P1YA 3GSWB 1KB9K 2VN7A 1UC6A 5B4MD 1R0AH 1Q9OB 2J55A 3QIBA 1FPTH 5HYIA 3TO4A 1VZHA 1EIBA 1IKFL 2AERT 2IBBA 3MLVL 4MRCA 3HUJF 4IRSB 4RAVB 3CPLB 1QTSA 3CU1A 2K78A 4RZCA 3VXRE 3WIIH 3D4CA 1F1DA 4WI9A 2ZCLH 4AM0B 4PGJA 5ID1B 1G5AA 4K5PA 1JGIA 4CSPA 3QARA 1FYHB 4F7PA 1FCCA 1NCJA 1CXHA 4H0GA 3ZDZF 3X1BA 4RGNB 2C9AA 4J6IA 4DOHB 4N87A 1AGDB 1R5IA 4KXZI 4FP8H 5BZDA 3K2IA 3VQMA 4MAYB 4G11A 4PTTB 4PLKC 2BCMA 4KROD 4ZUUB 1AKPA 4GQRA 4EI6A 1X5MA 4MMYB 1TOXA 2WWMD 4TUUA 1U8HA 2J6WA 5C08E 3UTPE 4ZMYA 3VWKA 4G1EB 5HP5A 4RETB 4M1CD 4YHKL 3IMVA 1BIHA 3AREA 3BAXA 1IAIM 3KWUA 5DHVA 3NG5A 1J5OH 4MB4A 4A63A 1OP3K 1E5AA 5E03A 4HLJA 3EOBA 1IKNA 1XQ4A 2ZJSL 3O2DH 4YHIA 3TZVB 4GBXA 5GIRA 1CLZL 2BY0A 3MRNB 5HHPA 3VXME 2BC4B 4MJ4A 1CGVA 2PCXA 5C71A 4PRID 2FD6L 5IFJA 4B95C 4XNUL 2BSRA 4PVMA 5DFAA 3SGJC 5I66A 4Q9QL 1BBDL 4FNLH 4MD4A 4N20A 3RB7A 1KMGA 4D7BA 1WISA 1I8AA 4WWKC 4Z7UA 3N40P 4QHKI 3REVB 1DTUA 4WKZA 3GGWA 5JHLH 1B4JH 2FX9L 5KOVC 3INUH 3QFDB 5F9JB 5E56A 3RILA 3STZA 4FQQB 1Z9LA 2HFEA 3QBTB 4H5SB 5CUSL 6CGTA 4AQ1C 1E2VA 1MSPA 2PWDA 3N91A 3RWGA 1P4IL 4PGEA 3ULUF 4HMCA 3CMOH 4PG9A 1KJ2L 2QQLL 4KDWA 4HXAH 4PD4J 1DQVA 3K91A 3GSWA 3ILDA 4GW1B 2YAFA 1Q9OA 5E8NB 3WL9B 2AXJA 3CSBA 2W91A 1T0PB 4EOWH 3CPLA 3FMGH 2LABA 5ERWB 2JELL 1QFPA 2DQJL 3B9KC 3BD5A 4AM0A 4M7JH 4Q6IC 2B2XH 2HVJB 5D2NC 4WO4B 5IWLA 2FH8A 2XWCA 4LHUB 2OI9B 1NCUA 1PD1A 1S2EA 4IRJA 1HQRB 4XPTH 5K59F 6TAAA 1GR7A 1TKWB 2IOIA 4MAYA 4TNWF 1TYEB 1YEFH 4OW6A 3FUHA 4PTTA 4QXGL 1PX4A 4JVUA 2VJ8A 3FB7B 3QH3B 4ZUUA 4HUVB 4MMYA 4YZFF 2E56A 3ASWA 4NO3B 5B1JA 3Q01A 4P2QD 2AMUA 2H7WA 4MS6A 1O6VA 2P80D 1IQDB 4G1EA 4TSAL 5H37H 5AOMA 3P3TA 5LG6A 2FRGP 4NZFA 4GRLB 4ZS7H 3CDYA 3UAAA 5C70A 2FR4B 5KW9L 5I1AB 1L9OA 4RAUA 2YMXL 1XGYL 4ZFOL 5F7YC 3HI5L 3NA4A 3TZVA 3OKEB 2BP8B 5EPMB 3QJXA 1KV3A 3MRNA 5EF0A 2BC4A 4KJWC 4HIIB 3DXAE 3RPBA 1BZDA 2FQGA 2YEZB 1YEHL 2X2JA 3BX7C 3C2SA 4OZHE 2J72A 2AJZA 4UOW1 4R4ND 3DETC 4RSVA 3QO0A 4CJ1A 4PRPD 5DSCA 4M7LT 2V7HA 5LDSA 4F24A 3REVA 1HJBC 1H3VA 5GS0H 3NFSH 1JXJA 1P5UB 2XN9D 5F9JA 3DX1A 4KI5C 5EMYA 3BT0A 3JV5A 4FQQA 2IDFA 1MFBL 12E8L 4U0QB 4U6XB 5GZOA 5DD5H 2HTKC 4PJ5D 4K5LA 3UERA 4EUPH 4JN2B 2UXGA 4KKZA 6PAZA 3MKGA 3FH7A 4N24A 1MCPH 4KXCA 2A9NH 5EF3A 4W1TA 1FPTL 3JWNG 4GW1A 1TUPA 5E8NA 4GXVH 3WL9A 3K8LA 4G80B 2DLHA 3WIIL 1Z3GH 5I5MA 3BOVA 4CAGA 1E4JA 2F7PA 5KJ7E 5DRZB 4YSOA 4WI5A 3SQBB 1MW1A 4CSTA 2HVJA 4WO4A 2UZXB 4XXWA 1QD0A 3BN9D 4HPHA 1TJIH 3P40A 4IMKC 2GIYA 3MLRH 1BZ7B 5CLTA 5F93C 1U93B 2HH0H 1HQRA 4JQVA 3RTQD 3S3PA 2R83A 3HBGA 5CFHA 2X6CA 3CVBA 4GRWH 3L3JB 1MCOL 5D2LE 4EI5A 1TKWA 3K5RA 3DI2B 1PZ2A 4LKCB 1WCQA 1O9VA 3LD8C 3QH3A 3FB7A 4HUVA 4PUBH 3BQUC 3BUTA 2VKWA 4NO3A 1A7QH 5HI4C 5AAMC 1ZIBA 4ZMZA 1TTFA 1ZV2A 4C8XA 2P5ED 1AZBA 2DQGL 4DGIH 1JPEA 1IQDA 4EEEA 3OHMB 2NQDA 3EO9L 3VD3A 2VAAB 1FA4A 2X7LB 1G6RB 1UACH 2BIOA 2FR4A 4NQEE 4KAQH 5I1AA 3JWDC 2VZOA 2IMMA 4BUQA 1I1RA 1CCZA 1T5WB 1GKEA 1FNLA 3QDJB 3RUGB 2XVGA 1ZHBB 2V9QA 3OKEA 2BP8A 5EPMA 5ILTH 2A4EA 1U8QB 1P9MA 4M9PA 2EDWA 1G9HA 4KKRA 2NLJB 4Y4FC 2VLRD 3DX9B 4HIIA 5TTRA 2YEZA 4PI2A 4QPEA 4Z0XA 4FNLL 4GNKB 4RWYH 1J9RA 2I85A 3L5WB 2AV7B 4IW4C 4KRMB 3VRJB 3SE4A 4Y88A 4ALAC 4QF1B 1F6LL 4F5CE 3VSVA 1B4JL 3INUL 4CU8A 2EDTA 4JKWA 2Y7MA 4PCKA 3K0WA 4X6CF 2GCYB 1SMDA 4JRXD 4BH7B 3MV9D 3BVWA 2WHVA 3WKYA 3RWFB 3PY9A 3T3PF 1RHHB 1D7BA 4MZIA 1YNTB 2SEBB 4QHNA 4U6XA 3UDWA 5CF3A 5CZXD 3MZGB 5D8JH 3Q1EA 1DBAH 4I9WE 2CHZA 4HS8L 3Q5YA 5IVZB 4EOWL 1QHOA 4ZMAT 4G80A 4R2GC 4E41B 1N26A 4LEEA 3TXAA 1GYAA 4M7JL 5DRZA 4PR5B 4YSTA 2B2XL 3A21A 3WY4A 4BFNA 3ARDD 1EBPA 2ICEB 3A6BH 3SQBA 5E99H 2H2PD 2UZXA 5J12C 1DJYA 3RG1C 3MUY1 2VDMB 3B7RL 4GJTB 2OK0H 1BZ7A 3QDMD 5CIPB 2ZKHH 1MAMH 1YEFL 3GTNA 3L3JA 2WJ7A 2ZQKA 2R51A 3U0PB 3D4ZA 2VRKA 4LKCA 4HWZB 1Y1UA 1KXVC 1MFDH 3CSTA 2Y1VA 5E4OA 2EVGA 3QIUD 3JVGA 4WKXA 1MCSA 5E6IB 3FOLA 3O81A 5D4QA 3QRGH 5H2BA 3MA9L 2VAAA 3TWYA 2X7LA 1G6RA 3PYCA 1F8TH 2ICWB 2EEDA 3OLEA 4B9ZA 3T6QC 3DPDA 2OX5A 5SV3A 2HX7A 8FABA 4IGBD 5EO9B 3QDJA 3RUGA 2ZPKH 1ZHBA 4BK8A 4LCCC 4DGVL 4YPJA 1U8QA 1QACA 3M1CA 4NRZB 4XP9H 1A6AA 2E7MA 4UYPA 2NLJA 2ED9A 3BKCH 1KB9J 3DX9A 4Y2NA 3WY3A 4L1SA 1M2VB 3L5WA 2AV7A 1V7NH 1OGTB 1W72H 2IFFH 2ISDA 3SOBH 5I1JH 3VRJA 5D5MA 5GS3A 2XV3A 4HCIA 4QF1A 2K9FB 4J39A 3NFSL 3O11B 2VDPB 3CCHA 4MD5B 2XWZA 4MKMA 4U1JB 5T1KB 5IESH 2ZCKH 1HOEA 4PREB 3UMTA 1XR9B 1XGRB 3QG7H 4JHBA 2GCYA 1HDMB 5AKTA 3DUSB 4BH7A 4FDWA 3RU8L 2JJSA 3VB9A 4DIXA 4Y5VB 1B0GA 1IU1A 2X4NA 1RHHA 3SYOA 3Q7JA 4AIXA 2SEBA 4X5WB 2JH2A 2BY3A 1PIGA 1NUNB 5DEZA 1WEJH 1SBSL 2A9NL 1KIUB 3HFMH 3KPSA 1DUZA 4GXVL 4CC1A 1HYSD 4K94H 5IVZA 1Z3GL 3OJ2C 4N68A 4E41A 4K7PY 4A67A 1UENA 2CCVA 3CAFA 3QEQD 4X80H 1HX0A 3UO8B 4PR5A 2ITEA 4UDTB 2EAEA 2ICEA 3MLPA 3VXUD 1QMUA 3ELQA 4OLWH 5IIEB 1TJIL 3MLRL 1DDHB 1WYJA 2K7QA 3GUFA 5I8EB 4GI8A 3IN0A 4TNFA 3ZUCA 4HAKA 2WVUA 2XWJB 4D0CB 3U0PA 1DSYA 4PUBL 4RWHA 4OLVL 4HWZA 4EO5A 3AT0A 2G0KA 2R1WB 2WXKA 3W11D 5EV7A 4JFDE 1UH2A 1SBBA 3A4AA 3GS4A 5ISZE 2DI7A 1ZLSH 3VQLA 5E6IA 5E0FA 1N10A 4HK3J 1UACL 1XVSA 2NNCA 5TDOB 3ABKB 4C4KT 4HAGA 4KAQL 2NDFA 1ZRUA 1PY9A 2ICWA 3MACH 3DJ9A 4ZX3A 2X3CA 1RMFH 1Z9OA 5C0AE 3QUGA 4P3DB 5L8KB 4HF5H 1DVFB 3O6FD 5EO9A 2X6MA 3OAZK 5ILTL 2PP9A 3PHSA 4G8GE 4X4ZA 3OKLB 2WM0A 4M43H 3HS9A 1SN2A 4NQCD 3UBHA 4NRZA 3G5YB 4X6DE 3UP1A 4BYHA 3IDMB 3HUJA 2CXKA 1U0QA 2DIAA 3TBYB 1KG0A 3D69B 4M00A 4GUOA 4WEBL 1C12A 4H8HA 4ZYKB 1OGTA 4MXQC 1H8OA 4PY7B 1NSNH 3RB5A 4Z9KB 4UDUA 3WFCL 1KLUA 4MD5A 3HMXA 4U1JA 5T1KA 4PREA 4UCFA 1HN1A 1XR9A 25C8H 1XGRA 4NQDE 1HDMA 4OM0H 2Z93B 3O2WH 4FXTA 4HH8A 3FH5A 4LL4A 4Y5VA 4ZAKD 1KJVA 1T20B 1ZJAA 2GFBA 1YC8A 4AQZA 5FDYA 1SY6A 4X5WA 4N5EC 1JCVA 3U7WL 5D7LD 2B1OA 2VTFA 1FNSH 5BOPA 1DBAL 1KIUA 1OE3A 1TLMA 4NN7B 4DUXA 3MLYH 5CZKA 5CD5D 5L2KB 1JPST 3BFQG 2Z1PA 2VRAA 2C5DC 4IK7A 4M6OL 5SWSE 1X5XA 2VUYA 5CXPA 5EEWA 2M26A 4BKTC 2WYHA 3A6BL 4Z95H 4UDTA 1S3KH 3US0A 3PWPE 1AE6H 2HAZA 2PLTA 5F7FA 2WIIA 5IIEA 5IVXB 1DDHA 5I8EA 2ZKHL 1N8ZB 4Y9BA 5KSAB 2H0EA 5DQ9A 1MAML 2YD7A 1B3IA 2MEJB 2FNWA 2DAVA 3WTUA 2XZZA 3LNDA 2XWJA 3EDFA 4KKCD 1NCBH 4D0CA 1WTGT 1OM9A 3T3ME 1UJ3B 1QPXA 4S1DC 2R1WA 5I6XB 1ZVSB 2LFGA 1QRNE 3KM1A 4AGNA 1IE5A 2MQGA 4R97C 2R2CA 3QRGL 5DO2D 4PJHE 3MKKA 1F8TL 2VLKB 4AY0A 3BRFA 3QI9D 4QTFA 4TLSA 1SJHA 1ZE3C 3VDAA 1CUOA 3QDGB 4P3DA 2C3GA 3L3HB 1DVFA 2BNQB 1CC3A 4NUPA 3OKLA 4YBHA 1X9UA 4ELDA 4XP9L 3QRFM 2DQCH 3BKCL 2O30A 4AGPA 3G5YA 3CVHB 3CH8A 3IDMA 3IMRA 1YY8B 4UB0H 2EUWA 1V7NL 3SOBL 3VTAA 2IFFL 2V37A 1EBAA 5I1JL 4KKAC 4ZYKA 1WA2X 5A2KH 3IDGB 4PY7A 4QRRB 4POZC 1Q1JL 3HN8A 4X6EB 5IESL 3WKPA 2ZCKL 4ZMTA 3AS2A 2VITB 3O0LA 3QG7L 3O4LE 5KYWB 4WJ5B 3FUFA 4ZNEE 5C9JB 2Z93A 1IGTB 3Q2WA 3NZ8B 4XNZC 2XYCA 5E1HB 1T20A 3OL2A 3WY2A 2J57A 4N2EA 1WEJL 3TCXA 3PP4H 4MX7B 3CZJA 4XPBH 3VH8A 5HHOB 4XMLH 4K94L 4PJBB 5L2KA 4JY5H 4QXWA 3OJMB 1BEYH 5CFAA 4AYEC 2OTUB 2DD8L 4OCSL 1J0YA 1IB5A 1ACYH 3K2UH 3MRIB 2H8PB 2XJLA 5E8PA 2ZG2A 4P46C 3ARUA 4DPAX 1BQ5A 4JFFB 4OCMC 3ZKND 5IVXA 5D7SH 3D87B 3DDFA 1D6VH 4HUWB 4CMHC 2KERA 1CI3M 1MWAB 2H4EA 2DWTA 1C16A 3X3GH 3CFCH 1NPNA 3O41B 3E1F1 5LGHH 3SKUD 3UGXA 2XX1A 1HL9A 1ZLSL 2F58H 2JFCA 4UTAH 2HZHA 3ARTA 5ICUA 1F3JB 3HHRB 4NQUA 5ACMA 4ADIA 2VLKA 5GHWH 3RWJB 3LZNA 1RMFL 5EDXA 2D7PA 3POHA 4PCYA 3CG8A 3ARRA 2EC8A 2DWEB 4WV1B 1E8XA 3L3HA 2BNQA 1F4HA 3AG3B 3MR9B 1N3NB 4M43L 4O58H 4P23C 5E2VH 3WMPA 4GW4B 3CVHA 4HEPA 5CCGE 4FKEA 3ZRSA 1YY8A 4LGRB 1MDAA 2EXYD 3BPOB 2X4SA 5C07D 3GMNB 4QRRA 3ETBJ 4L3ED 4OTXH 4X6EA 3EFOB 3ZIYA 25C8L 2ED6A 2YA0A 4L1LA 1XDTT 2ILLA 1UXMA 4BA0A 5KYWA 4WJ5A 1A6PA 3KWVA 5C9JA 4P4KB 1FHGA 2YBRB 4JX0A 1CDJA 4AEHH 1SOKA 4JM2C 4X8XA 4ERSH 3ULVH 2KZ1B 4FHJA 1CBVH 3U30C 2NY6C 1JF5A 1NMBH 2GVYA 5D1QD 3V4PB 4XOEA 4MX7A 3MLYL 2CR3A 3CIQA 3DDGA 1AI1H 5A2IH 2PPFA 4PJBA 2FWUA 3Q8CA 4B3EA 4AEIH 2ZOOA 4N2BA 1UZ6F 2OTUA 2XLLA 5CMAB 2IVFC 3MRIA 4Y16D 4Z95L 2H8PA 3UZVB 3J27A 3CWGA 4OU3A 1IFGA 1AE6L 3EJZD 2CUIA 2DQUH 2F9BT 1X4XA 2WZ5A 1HH9B 4YBLC 4JFFA 3W2DH 1KJMB 2D2CC 3BKMH 4BJLA 2G75B 3O4OB 4NEHB 1GA2A 4HUWA 1BFSA 2DLEA 1MWAA 1NCBL 1HC1A 2QGDA 5HYJB 5I8CB 2V5TA 2BXYA 4KMTH 3ARQA 2H0FA 3HG1B 1NC4B 4G59C 3O41A 4I0PD 4BSVA 5DZVA 1J9SA 4EIZC 4GRWE 3KM2A 5AB9A 4X5XB 5ABAA 3EDEA 2H2SC 4X6CA 3VMPA 3HI6H 3WLBB 2AVFA 3U4EB 2OK0L 1OARH 3RWJA 4MJID 2ZUQB 3CIAA 4R7NB 5ICZB 1JGUH 2IDCA 3ERXA 4PB0L 5FAAA 3C12A 3EFDL 1LJMA 4KV5E 4WV1A 2AEQH 5I8KH 2EXTA 3PWLB 1OAXH 1PPIA 3S88H 4JDVA 1N3NA 2DQCL 2ORBH 2O5YL 3ETBF 1GGYA 5FV2A 2YAEA 4PRBB 3V5KB 1NMAL 4XMWA 1XEUA 2E59A 2ZXDA 4GW4A 1CK0H 2V3EA 1MCWM 4UB0L 1ZEAH 1MEXH 3ARYA 4WWID 3IGAA 1EDQA 3BH9A 5JO5B 4N0UB 3B83A 4RDQG 2DQFB 4RMQA 5GS1C 4AT6B 3LX9A 5SWZB 4AJWA 3GMNA 1AR1C 3EFOA 3ZE1E 3B5TA 3O3BB 4GUCA 2NXYD 4P9HH 3ABMB 4HJSA 5DC0A 1TTGA 3HNVH 3N0AA 3PWUA 3B6SB 4QIRA 3EBAA 2XA8L 1WWCA 5F1IB 3EOAB 5FW6A 4KHTH 3QUXD 1IILE 2WP3T 4OIAA 3MRPB 3PP4L 1E4XI 3Q6FB 4M5ZH 4Y1AD 4XPBL 4N1EA 3IWVA 1KPVB 1WFTA 2DOCA 3BAKA 4HU2A 4XMLL 2XWDA 1PAZA 3V4PA 4EDWH 4F2ME 2EXWD 4JY5L 3BLPX 4LBEB 1BEYL 2AC0A 1TMCB 4FNPA 4YNYB 1ACYL 3K2UL 2Q7YB 4AUYA 2GJJA 1ND0A 3MCYA 3UZVA 1FFTB 1W0YT 3QPQD 4N6QA 2YMOA 2FSEA 3BMWA 4DO6A 4NM4H 4UZGA 3US9A 4BZ2L 1HH9A 2DY2A 1D6VL 1KJMA 2VM4A 3VO0A 1P6WA 3LNEA 3MBEB 4HOMA 3TVMD 1T89A 1WF5A 5HYJA 5I8CA 1MW0A 3CFCL 4LRIA 2PR9A 1AMXA 1UGNA 2WCGA 4M5TA 1A6UH 2CD0A 1ODUA 4NIKB 4KUZL 2NY0C 3HG1A 1ZGLP 1D5XB 1NC4A 5G5DA 5CGBA 4GSRA 3SY6A 4MJHA 1Y1DA 3MMEB 1J8SA 2F58L 3G9VA 4X5XA 2ZP9A 1ZD6A 4G7RB 3SBRA 5GHWL 3Q05A 3BZFB 3U4EA 4AV5A 3FL7A 1NKGA 1YNKH 1OO2A 3AM8C 1I85C 4YXLH 5ICZA 4FFWC 1BQKA 3QJRB 3P3RA 1YYLL 4Z23A 2CBTA 5E2VL 3E9TA 5EHFA 1JXKA 2WVVB 4PRBA 4D9QE 3V5KA 4Z7OE 2A9ML 3NA9H 3ROLB 2R8SH 1PZSA 1GY2A 2NRDA 4KZ0A 3VWJD 2GABA 5JO5A 3O8XD 2O6CA 4N0UA 4LU5H 2DQFA 2FSDA 2R15A 4FQ1H 5D7EA 2EZ0C 4AT6A 3N40F 4ODHH 4O5LH 4OTXL 2R4RH 4X99A 2XKNB 1JGDB 3H9ZA 5JIQA 3R8BB 2JKSA 3O3BA 2VXTH 3HAEH 2XPZA 3H7LA 3B6SA 4WU5B 2OZ4A 1UXWB 5F1IA 3EOAA 4ERSL 3LKPB 3ULVL 4L0PB 1CBVL 3OLDA 3SDXE 4UNVA 3MRPA 4AEEA 2Q8BL 2W60B 1KPVA 5HXMA 4HKZB 2BHYA 1MG2C 2JI2A 4LBEA 4W9ZA 3GMMA 4AEIL 2Q7YA 4R4FH 1RIVH 3S35L 4RQQA 8PAZA 2YPLD 4JY4B 3MJ9A 2ZOTA 1PGRB 1WFUA 1WBZA 4WWKB 4ZK8A 4Z78B 3TTYA 4D3CH 3BKML 4FG2A 4H8VA 4RGOH 1TIUA 4LPVA 2WANA 3HVNA 4QAMB 4UU9B 5LBSH 5E5MB 5J8OA 1PD6A 1RZQA 1EHXA 4KMTL 2IV9A 4AQ1B 3LPOA 3VXTB 5DJ0A 5LKNA 3BH4A 1J0KA 3RFRA 2BSDA 5IROC 1D5XA 1KCVH 3ZKMD 4GAGH 4N85A 1G7IB 2BVTA 2WPGA 3MMEA 4Z7WB 4ZMNA 3GKWH 5C0BB 5CEZD 2VMFA 5DJ8B 2JKNA 1II4E 3WNNA 4E9RA 2VSDA 4PJ7E 3BZFA 2YPKB 2QPFA 5KSBB 3D2UB 5JUEH 2R2HA 4PFEA 1CXLA 2WXJA 5T3XD 3O3EB 4FERA 2AEQL 5I8KL 3S88L 3B9KB 5IREA 1HCZA 4Q6IB 2ORBL 3FF8A 3MRMA 5D2NB 3TBWA 3UXFA 5I15H 2OL3B 4A1RA 1CK0L 2WLKA 3FU6A 3ROLA 1WD9A 4AMKH 4ZI8A 2CO2A 1IM9B 3RVWD 3PHOB 4YBQD 3GJFH 5FM5M 3VW3H 3GDBA 5F96H 1W15A 3MDJA 3OC5A 3ULUD 2XKNA 1JGDA 4OFVA 4P9HL 2X89D 3DMMD 5C09B 3IF1B 1PG7X 4H25B 1JZJA 3DSNB 3HNVL 4R7XA 1CFTB 3FBKA 1GYUA 4KHTL 4WU5A 3QR1A 1A9VA 1UXWA 1RIHL 3LKPA 1M71B 4XBEH 2WXQA 1BYPA 1CJYA 1JTPA 3ZHFA 4JKKA 3S3JA 1DJIA 1MY5A 3PGFH 4JRYA 1JZ8A 4HJGB 1E27B 4OVUA 1WK0A 4OJEH 1UFUA 5J4MA 5I6OA 4LLMB 3S4SG 1WVZA 1T2QH 4JRWA 2ZCZA 3KLAB 1JWMB 2MTPA 4OZIB 1B4LA 3PAYA 4F58H 1I8UA 2QBWA 1JZFA 1VFMA 2HA1A 2X28A 4WWKA 4Z78A 4L8CB 3W38A 2I9TB 1AGBB 3CXHK 1U8KB 4UU9A 2W38A 3D39D 5FKAA 3X11B 5E5MA 4DN3H 3WO3B 3WIHA 4RVBA 2O5XL 4J2QA 3KPLB 4XOBA 1EH9A 4NSKB 4AQ1A 3VXTA 3JWOH 1BG9A 3ZE0F 2ED7A 1UM6H 3MX0A 4K9JA 1G7IA 4Z7WA 1HEHC 4QRPD 5IY5B 5FA4B 5DJ8A 3PABB 3RZCD 4JJ5A 3VD5A 4OLUL 2I32A 3IFLH 1X6NA 1YNKL 2YPKA 5CU9A 5KSBA 1U3HD 3D2UA 4YXLL 2CJ3A 2PCYA 3I9IA 3H2WA 3OMAB 1KEMH 4QXUH 3O3EA 4GFTB 3B9KA 4FS0A 4Q6IA 3R4DA 5D2NA 2RTTA 2XZCL 5F7LB 1BAWA 1TEYA 2J1ZA 2R8SL 1Z9NA 3BAJA 3UTOA 1IM9A 4CW1B 4QRAA 4NNPL 4LU5L 2LTQC 3PHOA 4RMUA 1CF1A 4FQ1L 4MB3A 3TNNB 3P9MB 2EDDA 4O5LL 2QLYA 2P26A 3LD8B 1WS7A 5KSUB 3BQUB 4OGZA 3FTVA 1WZ1L 2BMKB 1JDCA 5ADPH 1Z32X 2A6JB 5C09A 2VXTL 3T0AA 3IF1A 3I3EA 4MNGB 2QL1A 4H25A 5DUMH 1JZHA 3NBNA 1CFTA 3HC3H 3HE6D 4HHAA 4I2XB 1Z9SB 4XCFH 1RZPA 3C60D 3T2NH 3WHXA 5TQ2H 5EF2A 3MRLB 5DC9B 1NCGA 1EZVY 1U3NA 2PWEA 3LIZH 2GIXA 3MFFB 3T9WA 4DKAA 4PJFE 1YC7A 1KLFB 3GZOA 3OTTA 3OJVC 2CCWA 4HJGA 1E27A 1NEZB 3QQ9D 4OIFA 3T0EE 4FTVA 2J8UF 3NCFB 4MS8D 4CDGC 3SE8H 4Y4FB 1U8MB 4FNQA 1XHHA 2ZYSA 3FCTB 1CICA 2NZ9C 3KLAA 4LLMA 4R4FL 1OTUD 1JWMA 3U1PA 4OZIA 4A7UA 4AW7A 2F8XC 4XO3A 2EC9U 2Q3AA 3CZGA 3NFPB 1VZIA 4GSDL 4L8CA 4RGOL 5LBSL 4A7GA 4A2EA 1O7SA 1OM3H 2I9TA 3H0TB 1U8KA 5FGCE 3X11A 5H4YA 1CGYA 5C6PB 1XB3A 2DLIA 1HIMH 4XPGL 3KPLA 4NSKA 4PMEA 2OYLA 3NDYE 4PJEF 3N1GC 4GAGL 1G0DA 4P2RB 3GKWL 3UC2A 3OB8A 3STLA 3ZL1A 1A4CA 1X9LA 1I8IB 5EZPA 5FA4A 4DK3A 4BWUA 3FQTB 1XCTB 3MNMA 1FFRA 3PABA 4MNQE 2OYMA 4DWHA 4R2GB 3KW8A 3L1EA 4XC3L 4JANB 5JW3H 2APSA 4YXHH 1EFXB 4JG0L 4ZJ9A 2DF3A 5BOJA 1D9KD 2BFVH 2IADA 2OMZB 1JXGA 5J12B 2LGNA 4YK4B 3KS0J 4AMKL 4HPYH 5ICYB 4AYMC 4IMKA 2X3AA 3WLWC 4CW1A 4XMKH 5DJ2A 3VW3L 4XO4A 4BHUA 2FJHB 3O6KH 3P9MA 5F96L 5BXFB 1EEZA 5KSUA 3ES6A 5EB9A 3BQUA 2BMKA 3FTXA 2A6JA 3MRJB 1GSKA 3QE5A 4MNGA 1E9PA 2Y4SA 2CUMA 4ZUWB 3UZEC 2ZCHL 1CFQB 3T4AC 4I2XA 1Z9SA 2DMCA 3WNJA 3HNSL 3MRLA 5ANME 4YGAB 5IB1B 5I1DB 1HILB 1HHIB 3MFFA 4KK8D 4LLYA 4XBEL 3FSZA 3WHE1 3LY6A 3WY1A 4UQBA 1KLFA 3PGFL 5LXVA 4AJYV 5AG9A 1U41A 5GGVL 2VCOA 4HVBA 3ULVE 4V2BA 1T2QL 2QELA 3BSGA 2HJLB 1ROWA 5FA3B 1U8MA 3FCTA 2YRZA 3LVTA 4F58L 1QBAA 4UM8A 3ZX1A 4YHML 3DRTB 3M6DA 2AEIT 3B2PA 2YXVA 5HPOA 3VYNA 3NFPA 2BP0A 2JCCF 3C09C 5E2JA 2UWEB 5ESAB 5C3IA 2LVCA 2VSMB 3H0TA 5EUOF 5JYMA 1E6JH 2P8LB 5C1MB 3TIDB 3TTSA 3JWOL 5E23A 4Q2ZB 1JF6A 2W81C 3V7MA 4KJQD 5F0MB 1KIRB 1D5MA 1KY6A 4P2RA 3U2IA 1OAYH 4AL8L 1P5VA 1Q0YH 2K9UA 1I8IA 2C7FA 2I24N 5HHMB 1H6FA 3FQTA 1XCTA 5IHWA 3K8MA 3JTBA 4X9GA 1CL7I 2COVD 2F7RA 3MJ6A 3O2VH 1EFXA 1RSFA 3FT9A 4PP1C 4GI9A 3RFZC 3BGFC 2QVKA 4KZDL 1C1EL 4H88H 3O3AB 3B7TA 1ZTXL 5ICYA 4TSCH 3ARXA 1GC1C 1NDGB 1JYWA 4NFCA 4Q9CA 2A9DA 5K9KB 5K5YA 2Y5TB 2FJHA 3QUKB 2Y7SA 3QCTH 5BXFA 1MIML 1KXVA 3BRDA 5ADPL 4KK6D 1Q72H 3MXWH 5DUML 3MRJA 4PRNB 4ZUWA 4WUKH 4XCFL 1CFQA 4BUGA 4F33B 1SDYA 3QIWD 3LKSB 1C08B 1PTZA 4W70A 4WY7H 1HILA 2CMRL 5IB1A 1LO2H 5I1DA 4L5FH 4N3TA 4HWBH 1NPUA 2WV3A 3MJ7B 4PJ8A 3GC3A 4W6XB 1RSYA 5FHAL 4L4TD 4YSRA 4G83A 3RY6C 3UX9B 4N2CA 1DEEB 1ZDSA 4J4PD 2WINB 2Z7ZA 2HJLA 1FFOA 3QJHB 5DHDA 5FA3A 1GGCH 1U8PB 2L4OA 2FQEA 4UUJA 3MCKB 2W9EH 3DRTA 3QZWG 2DQ6A 3VSQA 3EJYC 3U46A 2AHIA 1BREA 3FO2B 3GB7B 1OM3L 1LO4L 1ETZB 2VL4A 3HBZA 2UWEA 3KPRD 4GIAA 5ESAA 4FNSA 4Z7VE 5GSRB 5SX5K 5ELIA 3OKKA 4LCWA 2P8LA 3TIDA 2Q6WB 4BFOA 2OMUB 1JMZA 4JFHD 2X9ZA 1FCGA 2F8VA 1KIRA 2VR6A 1BZQK 3AFLA 4ELMF 1AGFA 2FATL 3D51A 1BA9A 1N12A 3LKOB 4X9IA 5DO8A 1L0YA 3BGAA 4KKLD 1HKLH 3AWEA 3IBEA 4YXHL 2Y7QB 1F6FB 2G0LA 1NAMH 2H47C 1CWVA 1QSZA 3H2QA 4KKBD 2N7AA 4HPYL 3ATDA 2XVKA 3OZ9L 4P2YA 3SHSA 5GZNC 3QXDB 3O3AA 1GTNA 4TLTA 2XIBA 1NDGA 4PWHA 2XN1A 3T6VA 3UBXG 4ZDHB 5EU7E 1KGJA 3L9EA 1DVQA 5K9KA 3V4UH 5KBKA 3Q8EA 1WDAA 2Y5TA 4BA8A 5J56B 3ZZ1A 4JRFA 4LVHB 4N1HB 4JO2H 1JK8B 4DK6A 1S9VB 3M88A 5IVOA 5DFWH 2B59B 1HINL 4ORGB 4R97B 5AW4B 4UQAA 5JXAH 4F1ZA 2AW2A 4F33A 1FO0B 4Y2DD 2VR3A 3WDHA 1C08A 2G5BB 5F0PB 3LXUX 2L7JA 4Q7DA 5D72H 3TASA 3MJ7A 3VGGA 5K1JA 4Y8DC 1A5FH 4I88A 4YE4L 2F53B 2HJKA 2MWCA 1DEEA 3S3SA 4AGQA 1FP5A 4H8WH 5IMOB 4UWQB 5K1VA 5I82A 3QJHA 2AXGB 1U8PA 5F3HA 1ZLWH 4AH2B 3BKJH 3MCKA 2GK0A 1JPGB 1MH5B 4OD3H 3IRPX 3F3HA 3WTYA 2YD6A 2K7PA 3E7JA 2E7LC 3GB7A 1FVCB 2UY7B 5IW6B 1ETZA 2B16A 3D30A 5AKVA 4G6FB 1QYGH 1E6JL 5EBMB 5GSRA 4BSJA 3GIVB 4I0CC 4KUCF 1TZAA 2G30A 4RLDA 3VXRB 1A4JA 5IBTH 2Q6WA 1AG0A 1HK6A 1TT6A 3ISWA 2KYIA 4LOEA 4WHCA 2B77A 1OAYL 3UG5A 5MP6L 2W9LA 4WJKB 1X9QA 5E9AA 4LVOC 4OCYH 4AV0A 4X7SH 4OJFH 1NM4A 3MROB 1F3DJ 2YAQA 1DO5A 2MJWA 1V7ML 2X3BA 3O2VL 2OS7A 1UJTA 1Z9MA 2PTVA 4P46B 5C08B 4G2AA 1MY7A 2XXFA 2EDOA 3F5WA 1PG7H 4H88L 4PP2B 4Q0XH 4XMUA 1R3KB 1JFQH 2XQYG 3QXDA 2XBDA 4CMHB 4NNXB 4F92B 4ZDHA 2AKRB 2K6YA 1VLXA 3QCTL 5HHNB 1UM5H 1G9EA 4Y1SA 5E6UB 5IQ7L 5H37G 3HE7C 3VXMB 1VGEH 1JK8A 3MN8A 4WUKL 4R3SB 5IMLB 4WTXA 1LEGB 2B59A 1NCDL 1M53A 4DK5A 1IAIH 1X5ZA 1XFPA 1QZ1A 4S1RH 4DEPC 4L5FL 2HT4D 4XCNB 2G5BA 3G3LA 4WNSA 1SHWA 2BPBA 1AIZA 4ES8A 4OZFH 3B2VH 2J21A 2F53A 4P23B 5CAYB 4J3BA 4PHZA 1XGTB 5IMOA 1CBJA 1GGCL 3WN6A 1WSST 3UMNA 1HE8A 4FQHB 4YC2C 3AS1A 4LDCA 4P5TC 2W9EL 4Y5XC 2EIZB 4FG4A 1JL8A 1JPGA 1MH5A 3LKQB 4XI5D 4R26H 4BQBA 5JPNC 5K9QG 4OLYH 3W0WE 1FVCA 2JJUA 2UY7A 4NS0A 5IW6A 3VVVA 2HJFA 3QG6B 5EBMA 1D2OA 3GIVA 5D4JA 4CUCA 3VXRA 3SBWC 3F6JA 2VDQL 4LPTA 2DKMA 4BFGA 4JM2B 1T7VA 4ZQKA 3VXOA 1DCLA 1OSYA 5TE6L 3ESOA 1OGAD 3P4NB 3ZT7A 3EGXA 3UJJH 1XH0A 3L1FA 4MLIA 2MCAA 1KXQE 3B2UC 1HKLL 1OY3B 3MROA 3QZOA 4E5XB 5I17B 5KS9F 3GKZA 4O02B 4DNLA 3B3BA 5I71C 2W88A 1NAML 2F8IA 1QNIA 3O3DB 4PLJD 4P46A 4J27A 5C08A 3BH8B 2BINA 3EHBD 4K0OA 2Q8AH 4YBLB 1KB5B 1LEKB 1R3KA 2J8UA 3FYEB 3K2KA 1SUJA 3MLWH 2VMCA 2HTLD 1G43A 3QORD 4BDVB 1KCUL 1A1OB 3ZL4L 4NNXA 3V4UL 5DHYB 4WK4B 2R7EA 5I9QB 2AKRA 1LK3H 3C08H 1PLAA 1RP8A 1Q0XL 1I7TB 3DTUB 3NDZE 3QFJE 4WUUD 3ZQXA 2QZ5A 1ZTXE 2L7UA 2ZIDA 3HG5A 1WFJA 4JO2L 2FH6A 4LVEA 2Q87A 4F9PC 2BVPB 4PRPE 4L23A 1G7MA 3G6AB 1XGQB 3Q6GL 3NCYS 5JXAL 3DXAB 1LEGA 3KLSA 4JB9H 4OZHB 2Z4TA 1G7JB 3C5ZC 4XNDA 2WQVA 1HNYA 5D72L 4L4VA 3MV7E 3EIFA 4XCNA 3WD5H 3MLZH 5F8QC 2NY4D 4HISA 1XSJA 4HIEA 1A5FL 1HTYA 1U36A 3FB6A 1UH4A 3MYJA 2F15A 3WSQH 1IGIH 3D7PA 2FWLB 4P23A 1RJLA 1WJ3A 1QBMH 1XGTA 4PJ5E 2QPEB 4Y9FA 1I4FB 5LCVH 3FRPG 3P2BA 1HQ4B 2F7IA 3K1KC 4FQHA 2M83A 4D8OA 1IBYA 4OD3L 2EIZA 3S3BB 5GS1B 3LKQA 5EU6D 3D48R 5G2NA 1WGOA 3TFBA 2NY7H 4CRPA 1AR1B 1QYGL 4NT6A 3Q06A 4M4RA 3QG6A 5DDHB 4JUSA 2DS4A 5IBTL 3SJVE 4LZKA 4AXWB 2D9QB 4M56A 1LO5B 3UAJD 4JM2A 5DRNB 4YLBA 2BX5A 5KSVA 2QPDB 1C7SA 3P4NA 5DWPA 3F58L 4OCYL 4X7SL 4OJFL 5D2LB 4OF6A 2GIMA 2P5EE 5I19L 3BYTA 1HZHH 5I17A 4XNYH 4O02A 1PD0A 3GMLA 3ZTEA 2WUCH 3VAEA 2I69A 4Q0XL 1INEH 4FLQA 5T33H 4PLNC 1IBFA 4EMZA 1PVHA 4YPGB 1KB5A 4WI7A 4BDVA 2AQ3A 4DGUA 3GPSA 4NQEB 2XT1B 1A1OA 4H40A 1UM5L 2M2DA 2VLRE 4FA6A 3QEHB 2CRYA 5EO0B 1TEFA 4X6FB 2EECA 3F04A 3CFEB 4PV9B 1BBJB 3II1A 1I7TA 1I1CA 3T0EC 3DVFA 2P44B 3G6AA 1XGQA 1IAIL 3A67H 5EUOA 1OLZA 4DP8X 4KFMA 3IMUA 4OZHA 4XVJH 4OKVB 1G7JA 4I48B 5BVJB 4JRXE 1BFTA 4R96B 1CU4H 1HJCA 1BQUA 2I60H 3L2LA 3V4VH 2WO4A 3ARVA 3NGBB 3LPFA 2CU9A 5A6MA 2G5RA 3S4SA 2XN2A 2V3FA 4OJAA 3V9CA 4YHOH 3EOTL 1CT8B 2FQFA 1HQ4A 1JNHB 5D7IE 1KCKA 1MJ7L 1YZZA 2OULB 5DK2B 4R26L 5GS1A 2VDOB 5CKGA 3D05A 2I07B 1FFNB 2IC2A 3N85H 4ODVH 5I6LA 3LB6C 4DEUA 5LQBH 1CYGA 1EXGA 1H8LA 2K8QA 2QKSA 4YHLL 4FC3E 4WGVB 5JHMA 4GEIA 1I1FA 5DDHA 2GUOB 3F65A 3P73B 5F6IC 1PLGL 3NCYP 3CQQA 5D1XA 1UCBL 4H1LH 4AXWA 3QDME 5CR8A 5GGTH 4DZ8B 1WE5A 1S7WB 1LO5A 3P3SA 4XE5B 2WVSA 3VMNA 1SMAA 3NZUA 1R19A 5DRNA 2DJSA 2CDFB 5JIMA 1FWXA 3GSXB 1YPZF 1EGJH 3UJJL 5B38G 1V27A 1A9EA 1BVOA 1BWMA 2V7NB 1UEMA 2RQEA 4JHVA 5D2LA 2X38A 3WE6A 3CDZB 3L7EB 2QKIA 1Y18B 5CLWA 4U1HB 4FNRA 5AVUB 4BD4A 1A9BB 3TEZA 3GT6A 4XB7A 5GGVY 1OF0A 1F13A 2Q8AL 3QQ3B 4LCIH 3VFNB 4LSSH 1ORSB 3MLWL 4I0KA 3L4VA 4YPGA 2WSKA 1VFBA 4JVWA 4LASH 3S5LG 3WKNA 2VQUA 2NW2B 3GHPA 4BH8B 3V95A 4P48A 4AVIA 2AXHA 4LO9A 1LK3L 3JT0A 4F8LA 3C08L 3W9EB 3RGBA 5HBBA 5EEUA 3QEHA 5EO0A 1TCRB 4X6FA 1L9PA 1BBJA 3V5DB 4L1TA 3ARSA 1JPFB 4WFED 3UFIA 3DX0A 4NKIH 2PO6C 3QXUA 1ADQA 1F4XL 4FRWA 4G72B 3BDBA 1ZLUK 1HL8A 4OKVA 5E8DH 2FJGA 2P4AB 4I48A 3WD5L 5BVJA 5L4MA 3FCUB 2NW3B 2IOOA 1DJGA 3MLZL 5SX4I 2DEYX 3AM8A 3I2CH 4R96A 3WSQL 1IGIL 4FQPA 4BFEA 1SJMA 4F5CA 2IAMA 2EQDA 4P3WA 3ILQC 1AY1H 4GBXD 3VGEA 1KBKA 3AU0A 4MA3B 1QBML 3M7FB 3SE3A 2ODIA 2H0PA 4ELMA 3FPYA 4L5FE 5HDQH 3APCA 3N43F 5LCVL 1DQTA 4J3WA 1H5BC 3V0DA 2WUBH 3DARA 2J6EA 1AS6A 2XPGB 2QQKH 2NY7L 3SCMD 5HYSB 3QEQE 2I07A 1FFNA 2HVBA 2Z8SA 2E9BA 3A24A 5CEYA 5MEQB 1N2RB 3F00A 3VGHA 2NXZC 4UM9B 1RP9A 2GUOA 1KJ2B 3P73A 4JMNA 5DZPA 2B9AA 3MXVH 1KY7A 5JOEA 5AAWC 4WWPA 4NX0A 3TEUA 3WJJA 4Q56A 4MA7L 4QMEA 2I27N 3DVIA 3WFEH 3EBHA 4BQ6A 1OP4A 2FEEI 4AYFB 5JIKA 2CDFA 2FZ3B 1YY9D 1B0WA 4QHKJ 5CEZH 1BGXL 5AW3B 4JNXA 2VXQH 3GSXA 1WLHA 4U1LB 4ZFZB 4OT1H 2AQNA 4NIYE 2V7NA 4IBQA 1HSBB 1T1XB 4K55A 5T3XH 4DKTA 1RLBA 4IRSD 5D1ZC 3CDZA 2BNUB 3L7EA 1Y18A 3KPTA 1UYWL 1A9BA 4GIOA 4JFDB 1INEL 2X87A 1XCWA 3ZGIA 5T33L 1Z66A 3R18A 4EJ1C 3VFNA 4ES9A 1ORSA 5KYYB 4RGND 4FE9A 4ZW7A 2P7TB 2NW2A 4BH8A 4P9HC 1SZNA 4DO4A 1FZOB 5C0AB 3W9EA 2YHGA 3TV8A 4CC4C 2BO0A 5DC4B 3IJYB 3ULUH 1TCRA 3LNHA 4G8GB 1NFDF 1MLBB 3VI3F 3V5DA 1X44A 1JPFA 2VL5B 1CB4A 4X6DB 2WKLA 2WWKT 1LGVA 1OXYA 4XVJL 2N0KA 4JPSA 4N1CA 4CN1A 4ZFOB 3P0YL 3LNIA 2EDHA 2VZSA 1Z5LB 1IQWH 2NW3A 1CU4L 4J1UB 4QRUA 1YECL 2I60L 1KULA 5BMFH 4Z0BH 4R9HA 4XC1H 1FZKB 4Q4IA 3BXNB 4MA3A 5HVHB 1IC7H 4NQDB 3FUMA 5D7LE 1R33A 1OCOB 4J8QA 1BVKB 1M2OA 4NZUH 3DIDA 4BRVA 1AZVA 1KN4H 2LTQB 3HCVB 3MV01 1CG9B 3X12A 1AYOA 1MJ8H 2B3IA 2AAAA 4NLAA 1RPQA 2GI7A 4ODVL 3N85L 5DMJB 1U8JB 5AZ2L 4KDTC 5HYSA 1FZMB 3BESR 4XRCB 3K4DA 1DN0B 1WH0A 3FU0A 3DPBB 4KX9A 5JQHC 5LQBL 4Z7OF 5MEQA 1BVNT 5JW4Q 5BO0D 1N2RA 4GKZB 5FV1L 3FQ2A 5AYUH 1FYTD 1VAHA 2J88L 2OJ1A 3L9YA 5SWSB 3OQRA 1TFHA 1UWGH 4MA1C 3BUQA 1SMOA 2RD0A 3MYZA 3PWPB 3E8UH 4ZSOE 2FZ3A 3S5ZA 5CJQL 5G55A 3GNMH 4U1LA 4ZFZA 3PP3H 4BRJA 3H9SD 4DAGH 2Q20A 1HSBA 1IC0A 1T1XA 5EU7C 1XF4B 2PABA 1DN2A 2PNDA 3GBEA 1GHFL 1ZKAA 5FYJL 3T3MB 3L16A 3VD7A 3WJLC 2BNUA 2GK2A 3FQNB 2MCG1 5CJ5A 3FUJA 5FCUL 3DK2A 5FWRA 1QRNB 4LCIL 1I1YA 5F1NA 1KBGH 4JO5A 4LHUD 4PJHB 4LASL 3UBXB 4IBLT 5KYYA 1IJNA 1WZKA 3RDTC 3OMNB 1PDKB 2P7TA 1QAWA 1J1XL 2HRHA 4GP5B 5DI8B 1FZOA 4KY1H 5C0AA 1LP9F 1TVHB 1TXKA 3IJYA 3Q2NA 2CHDA 4G8GA 4CBPA 1MLBA 2WC7A 4JQIH 3B2DC 1TG8A 1MVUB 2VL5A 4X6DA 3QPXL 2OZNA 3Q48A 3V0IA 3LNFA 3QUZD 3KYKH 1HCYA 5E8DL 5FYJU 4GRLD 3MNWB 3A4FA 3OLIA 1NCAH 3I2CL 2AJSH 5I16B 1I9IL 3CSYB 4J1UA 4Q9RH 3IGLA 3IJHB 1YYMH 4AKOA 1AY1L 1FZKA 5JW4M 4N2AA 4BIKA 5DD0L 3BXNA 3O4LB 1H15A 2AVGA 4NQSB 4W4OA 2W5PA 4PJ7F 2OAAA 2BM3A 1BVKA 3QZWA 1ZHLB 4LB8A 3G08B 2WWOA 1CG9A 4KROC 3RAJH 3TX4A 3E1ZA 3L4CA 5K9QI 1U8JA 2Q7NA 1FZMA 4XRCA 1DN0A 2ZUXA 3DPBA 1F41A 4GQZA 1N70A 1AS7A 2X4TB 3OKNB 4CGTA 1JZIA 4GKZA 5ICXB 3RVXD 3T4AB 2ZX6A 4M1CC 5SWSA 1K72A 4RMTA 4UNUA 3GHBH 5IFHL 2DTML 4KY2A 3MLXL 3PWPA 3FQ1A 1T0NB 1CTMA 2Z31D 3IPFA 2VXQL 5D71H 3UTSD 1BCIA 1IC5L 1MFCL 1FH5L 3V6ZB 1W2KT 1EX0A 2XZAH 4N2GA 3TV3L 3FNKA 1XF4A 2CA3A 2OV0A 2ZSWB 4G7VL 3WNIA 4NZRH 3NOIA 2Z35B 4MD0B 1A4KA 3BE1L 4NKOB 1PZUB 4YOKA 4AE1A 2MCPH 3L48A 1T2JA 3ETSA 3HG2A 3SSGA 1J1PH 3C09B 4PJHA 4M03A 5SX4H 3IB4A 3UBXA 2VYRE 2ZWSA 3DGCR 1PDKA 4ZO7A 2EUZA 1R46A 3ULUL 1T7YA 5DI8A 5I23A 1L3NA 1D3CA 5IFAH 1TVHA 3MTRA 1MRCL 3QC6X 2C34A 3VRLE 2GPZA 3K81A 2F1EA 3FZUD 4K3EH 4AEFA 4N9OB 5C07E 1S7QB 2GTZB 1LILA 4U1SB 3FT1A 4XPHH 5C0FB 2X6VA 4NN5B 1MUJB 4L3EE 5FR3A 4CU6A 1MJUH 3ISYA 4N8PA