2AQRA

Cu/zn superoxide dismutase from neisseria meningitidis k91q mutant
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
155
structure length
155
Chain Sequence
ASIEVKVQQLDPVNGNKDVGTVTITESNYGLVFTPDLQGLSEGLHGFHIHENPSCEPKEQEGKLTAGLGAGGHWDPKGAKQHGYPWQDDAHLGDLPALTVLHDGTATNPVLAPRLKHLDDVRGHSIMIHTGGDNHSDHPAPLGGGGPRMACGVIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title CU/ZN superoxide dismutase from neisseria meningitidis K91Q mutant
rcsb
source organism Neisseria meningitidis
molecule tags Oxidoreductase
molecule keywords Superoxide dismutase [Cu-Zn]
total genus 34
structure length 155
sequence length 155
chains with identical sequence B, C
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2005-08-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 2aqrA00
2WYTA 1E9OA 1OZUA 3HFFA 1SXSA 1SDAB 2XJKA 2V0AA 1EQWA 1EJ8A 3KH3A 4N3UA 1N19A 1BZOA 3CE1A 1HL4A 1SXNA 4A7GA 1Z9PA 3T5WA 1N18A 4N3TA 4B3EA 1TO5A 4OH2A 2WZ5A 2AQNA 2AQRA 3KM2A 1Z9NA 1E9QB 1YAZA 1SDYA 3KBFA 3KH4A 3GZQA 2APSA 4A7UA 3CQPA 2ZOWA 2Q2LA 2GBUA 1TO4A 1OZTG 1SPDA 1SXCA 2WWOA 1FUNA 1HL5A 1YAIA 1XTLA 2E47A 2VR7A 4MCMA 1UXLA 2JCWA 4L05A 2K4WA 2Z7ZA 2C9SA 4OJAA 1SXAA 2GBTA 2VR8A 3F7LA 4BD4A 1F18A 3GQFA 3K91A 5KBLA 2WZ0A 2ZKXA 1PTZA 1IBBA 5KBKA 2R27A 1IBHA 3PU7A 1IB5A 1DSWA 3F7KA 1L3NA 1COBA 3GZOA 1XTMA 1MFMA 1IBFA 1BA9A 1B4LA 1DO5A 4FF9A 2JLPA 2Z7UA 1S4IA 1E9QA 3MNDA 1B4TA 1E9PA 1JK9A 3L9YA 1AZVA 1UXMA 4MCNA 3LTVA 3HOGA 1JCVA 3QQDB 1QUPA 1E9PB 1YSOA 2AQSA 2GBVA 2WYZA 3H2PA 4A7VA 3MKGA 1PZSA 3RE0A 1PU0A 1IBDA 3KM1A 2AEOA 1SRDA 2Z7YA 1JK9B 3CQQA 2C9UA 5KBMA 4A7GF 1ESOA 1F1DA 4A7SA 2E46A 3SODB 4U4IA 3ECUA 2WKOF 1OALA 1U3NA 3ECVA 3GTVA 2NNXA 2LU5A 3GTTA 3S0PA 4BCYA 5CU9A 4A7QA 1P1VA 4A7TA 3HW7A 1CBJA 4BCZA 1E9OB 2VR6A 2ZKYA 2C9VA 1SOSA 2AQPA 2WWNA 2Z7WA 1OEZW 1RK7A 1XSOA 2ZKWA 2WKOA 2AF2A 2AQQA 2SODB 2XJLA 1KMGA 1F1AA 3L9EA 2WZ6A 1SXZA 1F1GA 1SXBA 3QQDA 3H2QA 1Q0EA 1CB4A 3KBEA 3GZPA 2AQTA 3ECWA 1OAJA
chains in the Genus database with same CATH superfamily
4LLVB 5F1NA 3SD2A 2NY2C 2BVUA 3A3YB 3HG1A 1AZNA 4JJHA 4NQCA 3LS5H 3VFNB 5I6XC 3IVKB 2DI7A 3V9CA 2KC0A 1E40A 3D85D 4RFOL 1M2VB 5DUML 5KAQF 4KY1L 3VRLE 4Z8FH 1JDDA 2B3RA 3FT4A 4MX7B 3AG3B 3Q8CA 4M7ZB 5C6WH 1HYSD 2MJWA 2HYMA 1FH2A 4N20A 5G55A 3HC4H 1YG9A 2NY6B 2G0LA 4GI8A 3GRBA 4YDIH 3TNNA 4OZFB 4TPRH 2VDOL 4AYBA 4Z78B 3N91A 1L6ZA 3O4LE 5KW9L 2NY6D 2CO6B 2CIIA 3DJ9A 3EOAB 1JPFA 2LTQB 3HRZB 4W4NA 3HKZA 1EIBA 4KV5E 4F8PA 5HDBE 1OTSC 3AXIA 4FG6C 5C09D 4PP2B 4IS6B 2EYSB 3UJIH 5B3JF 2WB7A 4RETB 2WUBH 4HKXA 3MLYL 5MEPB 1OAXH 4AYEC 2ZG2A 1BM3L 1D3CA 3MSPA 2R8SL 1CTOA 2APWA 5DO2D 2LTQC 3HRZC 4L18A 4MJ6B 3PL6D 2RCSH 2TAAA 3SDYH 3HMXH 1UA6L 3EO0A 3MQIA 4DQOL 4JRWA 1F2XK 3BLPX 3Q2WA 4NBZB 3E3QC 1JXDA 3WD5L 3FTGB 4XX1E 3S4SG 2ADFL 2GQHA 4OIBA 1N26A 1ZSHA 3I3DA 1BLNB 2C3WA 4UDTA 2PO6B 4QXGH 2DWSA 3KDMA 1K6QL 2X89A 4TNFA 4LCIH 5TTRA 5KN5B 2V4LA 1E7VA 4Y5YC 1BCIA 4X80L 2LE9A 2DM2A 5JIHA 1NJ9B 5SWQA 5IVNA 4UINH 3UTSE 4P2RA 2FQEA 3LHPL 3S98A 1A6PA 1QFUH 2HUHA 2Z92A 3WUWG 1LWRA 3QJUB 1CMOA 5AVQB 3EJSA 4ONHA 3RWIA 4WGVB 1JZEA 1ZA6B 3VFRA 4LSSH 3TBTB 6PAZA 4U6TA 1O5DT 1VKXB 3ARUA 4PWJA 5T5FH 3DJSA 5GSRA 3ZKNC 1OO2A 4TL5A 5ICUA 1X5XA 1Y1DA 2MKLC 2CXGA 1C5DB 1ED3B 1P6FA 1E4XI 5LNDA 1N59B 2F8XC 3BE1L 4N0CC 1L3WA 3IPEA 1MAML 4MTMA 3ARBB 4XCNA 3BWUF 3FRPB 4Z18A 2AJYH 3D2UD 3PGFL 5F1IB 5IB1A 4WV1B 1OL0A 4OZGF 4WFGE 2R0ZL 2XWBB 4O2FA 1TSHA 3OPUA 5DUPL 5INDA 2HLAA 3UC2A 3EGXB 5GGQH 4FTVE 4FQ1H 2ZP8A 2BVPB 2YN3A 5FOJA 1IJNA 1TZIA 4YDKH 4GRLC 3C5SB 3HI5H 1K4CB 2QVIA 4F91B 1ZLVH 4N0UA 3IDGA 2ARJB 2MPAH 3CQPA 2Y7QB 4I88A 5AVTB 2WMPA 1U2YA 5K9KB 1J0IA 1KDIA 5KYWA 2WWOA 1NMAH 2GY5A 1KFAH 1PVHA 2L7JA 4CSTA 2J1ZA 2XBTA 2XIBA 3MO1A 1UZ6F 5T1LD 5ECGA 1RIVL 3MV9E 2PWHA 4KXZI 1BQLH 5EU5A 1IIIA 2UWEA 2QZQA 3ARFD 4LNRB 4TUKH 3EJYC 3DI2B 4YO0A 2Y7OA 5E5UB 4DKAA 3Q1SL 2BVEA 1WA1X 2WBWB 3BPNC 3IBOA 4ZMLA 2NTFB 3VCLA 3RP1A 2IIJA 1YC7A 5FUOH 5E9DE 4L2LA 5DJDA 1I3UA 1IEBB 4KQ4H 4AK2A 3KPQB 3QI9D 4HSQA 3TP4A 3I02B 3BFOA 1UACH 4BK4A 3UDWC 3L9YA 4UT6H 3BVXA 4N8CL 1KYOJ 3OKDA 1RUMH 3I6LE 2W65B 5DJAB 3DVGA 2NXZC 5L0QC 5T1KD 3PP4H 3D0AA 4QRUA 1R47A 3NZ8B 4F2FA 1S5HB 4WJKB 5D6DA 1CIDA 2Y6SC 1WWBX 1UEYA 3HE7C 2VB5A 3ZHKA 3LKNB 3SKNB 1RZIB 3NN8B 3OC8A 1AD9A 5HDBB 3CQQA 4Z7NF 1KGJA 4IKLA 4KKBD 1T6WA 5DRXB 2OK0L 1QA9A 3QJRB 3AQYA 1WC7B 3BH8B 3NCFB 2VL4A 2OZNA 3F04A 3NT0A 3DPDA 5BZDA 1QOKA 4FJYA 4NQDB 2WN2A 1U8NB 4FHKA 4F1SA 1N0LA 1Q9OA 3SPVA 4B0MM 2GEEA 5CUSH 4J3TA 4FG4A 2ZXDA 4ZDHA 2DEXX 2GCYA 3HI1B 4WW1A 3MRCA 3K6NA 1RULL 4IMLA 4XB3A 5KVFE 1FDLH 1JGDA 3M8OH 2VDPL 4GKSA 4NKIH 2HRPH 3QEGL 5FS5A 5E94B 5HYJD 3ZPDA 1FFTB 3O9WA 3RDTA 1U91A 3EOBA 5JIKA 2DOCA 2W88A 5JHMA 5FGBA 3NJNA 2IG2L 4DKEL 3VXNA 3GSOA 4JFZH 4YC2C 5HP5A 5IHWA 1BBJB 3LIZA 2AJXH 4E9QA 4Y8DC 4HPYH 2I5YH 5HDRA 1OAUL 3ZZSA 1R3KB 2YEQA 1PG7L 3QG6A 3B2UD 1KFGA 4HU8A 2DQ6A 3QXAA 4YNYB 5DYOB 1YEGL 2BERA 2X9ZA 3I6GA 4JRXA 2C3VA 4X6BB 1FV1B 2F53E 4PP2A 4WWKD 1TZ8A 3GSXA 3RWDB 1HZHH 4HISA 4AXWB 5HHOE 4LIQH 4HPOL 4JCMA 1X4YA 4YHML 1SDYA 4JDVB 4JFUA 1KGYE 3H54A 3OAZH 2L7UA 2FWLB 1SJEB 3NIDF 2QFRA 4AMXA 2WLLB 4X4ME 1ZLWH 4F58L 4WHYG 1FZJA 3S8GB 3T9WA 2KDGA 2XVLA 1YUKB 2B1AL 3R0NA 1G6RA 2LGNA 4IDJH 5IHZA 1TZOA 1QTYT 5D2LA 2G9KA 4PLJC 1UM4L 4BFGA 5EN2A 2WWKT 3VCLB 3AJ7A 2WXNA 4JM2F 5A2BA 5BW7A 2PTTB 4R97C 5CJXC 5DFTA 1ZV5A 1FPTL 4OZGB 3B2DC 5A6LA 1FNEA 5JXAL 4IS6A 3QUKB 1NEZA 5GGVH 5JHDD 2Q9OA 3GBMH 1KJ2B 4FF9A 1F6LL 3QORB 4MJIB 2DD8L 4NO5B 5TQ2H 3V5KB 3ULVH 3MFGB 5E6IC 1OGPA 1XAUA 1T89C 3O2VL 1KPUA 3SCMC 3OPZH 4LDCA 1ZMYA 2OMWB 3TVMD 1H8OA 5GGRY 1FH5H 4CSPA 1QBMH 1JERA 5E5RB 2A0LD 3V79C 3DO7A 2DQDH 1EMTL 4QO1B 5DVPA 3FMGH 3W0WA 2DJUA 1UJ3C 3ARDC 5C0JB 4YDJB 2C7FA 1CZ8L 1GAFH 3UC0H 1RIUH 4Z3HA 5DD0L 3OSKA 2P48B 5ETUA 2VLKA 3HR5A 1RMFH 6FABL 5I73C 1HH9B 2X2JA 3K2UL 4P0DA 3FFCE 2HFGL 1T66D 1C9SA 2Y36H 3PFUA 4Y5VB 3P4MA 1CGTA 3KCPB 1NLBH 3UDWA 3WS6A 2HX9A 3MRGA 3EJTA 5HI3C 2BWIA 4HLEA 4JFOB 1PCSA 4ZFQA 3CZGA 1S9WB 1IGCH 1OCWL 4KTDH 1FVEB 4XP4H 4UT6A 3OQRA 2Y5EA 3SQBB 1DVSA 3UYOD 4CJ0A 2GC4C 1P53A 3QJFB 3UAFA 2DW5A 5DD6A 2WHVA 2ZD0A 1A22B 2FWSA 4R7DB 4NC2B 2E7DA 1EX0A 2MHAA 4Y1AD 5MHSD 3FB5B 2Y06H 2PCFB 3P9MB 4M7ZC 2GTWA 1AO7D 4N2LA 4ZX6A 2AJ3A 4D0BB 3RZCD 2ZCZA 3O8XD 5JPNC 1ZV9A 2YA1A 3VH8A 1PQZB 3L1OL 2O5XH 3CFBA 4MDJB 3AITA 3AU1B 5DHDA 2CIKB 1SF3A 2F68X 2J8UE 3WU1A 1M7UA 2PWFA 2J5LB 4QMEA 4XCEB 4FXKB 3LPFA 2V3DA 2A9DA 3R7QA 3NTCH 1WPCA 2PW1B 4Z76B 1BLNA 2DQJL 1QP1A 2J1KA 4N9GB 1M1XB 1WFUA 2WGNB 2X41A 4BZ1H 3B3BA 3GXIA 5J12C 2IXQA 4WUUB 4RFEB 2AVGA 2V2XB 2GUOA 3CLEH 3LNDA 3NCJH 3NIDB 5DTFA 2XBDA 4Y1AB 1TQCB 4DPCX 2DYPD 1FQ9C 2Z0BA 5IVXF 1CVRA 2OI9C 4OB5L 1VA9A 3FKUS 5HJ3A 2WVSA 5F3BA 1T6VN 2ZYHA 1I3RA 5MENB 5I1IL 4ZRGA 4CVXA 4OCWH 3SDAC 4NSKA 1A7PL 2EZ0D 2APTA 4O5LL 5AVUB 4YSDA 5JHDA 2H0PA 1B4TA 1LM8V 2XVBA 4JO8A 2OPCA 2IDCA 3QUZC 2F7IA 2EACA 1DJYA 4GW1B 15C8L 1WT5C 3CFDA 4Y9CA 1IVTA 1OCRB 2JJWA 4OAWA 2B0SL 4OQTL 1JWUB 5E6RB 3HUJB 1OSYA 5BS0E 4JPQA 1JSYA 1P7QB 1AC6A 5CBAA 4OD2A 5IIEA 4QKXB 4XVUC 1IGIH 3AQXA 3CUPB 4R8WH 4LOUC 3T0AA 4KY1H 4HYTB 3T2PA 1O6TA 2JIXD 2FT6A 2Y2YA 5B38B 4ABUA 1NCDL 2X0UA 2WVTA 3D12B 3NJKA 4NHCH 4MJID 1F0LA 1PGRB 3HMXA 4E9TA 3APNA 4YHOH 1YN6B 3AXHA 3LKOB 3ETTA 2VN5A 2BP5M 2VDRL 3BI9X 5IB4A 4ELKA 5KW9H 4G6MH 3FTUA 1E6OL 2VDKB 3FRPG 2JCCB 4JFED 4AM0B 3FO9B 3HPLB 5FA4A 2UWEB 1NUGA 4XXDA 3MRRA 4KDTC 3ZTDC 2F8OA 5HPOA 3HIZA 4AV4A 4RA0C 2A74B 5TDOB 4JDZA 1L0YA 2NR6C 5AOMA 1ADQH 1U8HA 5B1CA 3I9IA 1OE3A 1QQDB 5IW6A 4FQCL 2WUBL 1AIFA 4X6CB 4W9CC 1XXDC 1SJMA 2I7OA 2VQ1B 3ISYA 1Z6JT 3MLYH 4NWTL 4PB0L 5AVVB 1H9DA 2OSXA 2R8SH 2Y1VA 1FNAA 3O4LB 3PXJA 1AGCB 3RGVA 2Y5TB 5DQDL 5LAXB 3ZDZB 1BECA 3PRZA 3UZEC 3QP3A 4RESB 3Q8EA 1A2YA 4JFEB 4M29A 3MRMA 3NJIA 4ZYKA 1LMKA 5ANME 1CUOA 4OJFL 4A2GA 5F88A 3HG3A 1P5UC 2W92A 2Q7YA 2FB4H 2O6EA 3KPMB 4PJ5A 5FA3A 4JY5L 2XXCB 1XGUA 4PJ5D 1ZVYA 3OHXB 5H94B 4HG4K 1F8TL 1G9NL 3K6DA 4IU3B 1NBYA 5LNGA 3VE0B 3VI4B 4JHUA 1TJGH 3F64A 4WFHD 5JW5B 1L6PA 4NRXA 1NEUA 1QRNE 4YDJA 2IJ0C 5ISZD 4PJHB 4RWHA 3HNSH 4G1MA 4DK3A 1AGFB 1DL7H 3O3DB 4XVTL 4XN4A 3MV7E 4BQ8A 1NUNB 2YPVH 1DQDH 1FZOA 1NGWA 4YBLB 1MRFL 1ZTXE 3AREB 1KTKE 4NZUL 2CDEB 2CO1A 3H3KA 3PWLA 3ULUC 1ETB1 1V54B 5DURB 5EZLB 2XSKA 2XZAL 3QRGL 4JFYA 4LCCC 4J3XA 4XO4A 4QTFA 3BE1H 4PWEA 1YEIL 3VFMA 2XDHA 5AWNL 1SF5A 3LXUX 3O4LD 4F8LA 1MVUB 5FYKD 4LDLB 4NEHB 2P5WB 2X3CA 1ZLSH 4C54A 3BPNB 3GMQA 3NYKA 2FZ3A 4JFDA 1WP6A 1N6VA 1OAKL 4GKNB 1T0MA 3LYRA 2NUTA 4X6DE 5DSCA 5LBSA 2DYPB 2D3NA 2FQFA 2Z31C 5IFJB 1D7CA 2YMTA 1P7HL 2E46A 3R1GL 2VLRD 1BBDL 1UC6A 1U8LB 5ABZA 4KRNA 5E1HB 5DS8A 3RVVC 1Q1JH 4PHXA 5F44A 1A0QH 5F7FA 5BO1H 1BZ8A 2QSQA 2JK5B 3AG1B 4BUGA 2IBGA 3EGSA 4OZIA 1NMAL 3UTPD 1A5FL 4K94C 4ZW6A 3MBXH 1IE4A 3VGHA 5GZOD 2FLMA 1YN7A 1OEZW 1PNCA 1PX3A 4PJGA 2P5EE 1F41A 5GGUA 1A6AB 2FEDD 1PZBA 3P3SA 1MXGA 1S9WA 1JHKL 1I8KA 4JDZB 4ATWA 5ESVA 3PWUB 5KOVC 2G4GA 3GXFA 4MQSB 1HXYB 3A4AA 5FUOL 2KQMA 3UBXB 3FF8A 1NPUA 1YCSA 3QO0B 2WXRA 4B96A 3OKEA 1C16B 4PG2A 4M9PA 1NDMA 1GA2A 4IEFA 4TLUA 1FIEA 1Z0NA 3AS2A 3EJPA 1RZKH 2FIRT 5F0JB 4D8OA 5IKCB 1CFSA 2QLYA 5I71B 2C1PB 1KB9K 3KJ4C 3L5WA 1XCXA 4X8JB 5KSUA 3H0TB 4M8VA 1NC4D 4RAHA 4JHWL 2Q7YB 4LCYB 3VSTA 1IIKA 3UBFA 4APQA 2XYCA 4XN5A 3HEIB 4MXWH 3RY4A 2GK0A 2OQJA 3HHRB 2EDOA 1FL5B 5FK9A 2ZICA 4YHLH 2XC8A 4J2QA 4MD0B 4RMUA 5CUSL 2CQVA 1W0VA 2GB2A 2Q87A 5ISZA 5T8IA 3VWJB 1OP3K 4N2EA 1NGWB 1IBBA 4N68A 5DQ9A 1HAWA 1FDLL 3EFDH 5DJ2B 1F45A 2BVPA 4FI7A 3UP1A 1OCCB 3BAEH 5EZLA 1HYRC 5DURD 2AV7A 2H32H 1I7ZA 2NY1C 2PWGA 4O2CB 4FA7B 3Q43A 3D05A 4KK9C 1EJFA 5CMAA 2DM4A 2XZZA 4KI5D 4M4RA 3D2TA 4ZS7L 5FUZL 3NH7H 4XP6H 5FW8A 1HC1A 1QSEB 2I5YL 3DGCR 4PJDE 1S7WA 3VJ6B 3VD3A 3WTWA 3MO1B 4WZ9A 3WFHB 1CF8H 3VMOA 4NM8L 2WVVB 3ARFA 4ELMF 1M7XA 1VFMA 4GRWF 4WY7H 5EHFA 4HIIA 4R96A 3ULVC 4HUUB 3B2VH 4DN4L 4JN2B 1MJ8H 3TV8A 3KNBB 1UM6L 2YOCA 4KOBA 1NLDH 2J56A 4YHMH 4Y9BA 4Z7OF 3IJEA 3CC5A 3I75A 1Q0YL 2X6MA 5EFIA 2HMIC 3QBTB 3ARGC 4LSDA 5D5MF 4YEFA 1GPOH 2OMVB 4POUB 1OY3B 2QGEA 3N9GL 3EFOA 2YKLH 1M1XA 4KZDH 4GT7A 3CFTA 4UQIM 2B1AH 3DOIA 2OYKA 5B4MD 3UG5A 5IJDC 2EDBA 4DFHA 2QVKA 1NFDE 4N2IA 3MRBB 2ITDA 3WAJA 2PYEE 4EI5C 4P2CG 1YEHL 2YWZA 1R34A 3KYKL 5FV2A 3E38A 5EZJB 4LDOB 1IT9H 3KGTA 5LAPA 2PF6A 3U4AA 3IWUA 4H5SA 1JF1B 3MV8A 2KZKA 4QHNA 3ULAB 4AZ8A 4WTZA 2UZIL 1EO5A 2N7AA 2X4TA 2HT3D 2XTJC 4OCLC 1I8IA 3QFDB 1OZUA 4F92B 1KSRA 1T83A 2IALB 3D5OF 1L9SA 1QO3A 1YNLL 2Y6TE 3IFOB 4B7IA 5T5FA 3HLKA 3OPZL 1D9KA 4ZW8A 3TJEH 3U46B 4M02A 5I19H 4KTEH 2ILLA 3QORD 1PY4A 2LAGB 5EO9A 5H2BB 3L4CA 3QQ4B 5CKGA 2Y24A 3F00A 4OAWB 3V4VA 2ICEC 4G6FD 2DMBA 1MJUH 2XN1A 3D0LA 4LLDB 4NT6B 5G4MA 4CBZA 2LR4A 5DD0H 2JKLA 3QAZC 4PUBL 3FHQA 4YHYB 4LRIA 3L3DB 5DJZB 4TTDC 3S48A 1BZQK 2K45A 3F7RA 5E4IA 1PKQE 3DX8A 1JI2A 4Y9FA 2HFGH 3CD4A 3QEHB 5C0AB 4Z7UB 3B9VA 4BBWA 4JY6B 1CI3M 1PZAA 1KY6A 2IAMD 1KZYA 3HZVB 3S3BB 2DH2A 2F54D 1NBYB 4G72B 3V10A 1ASQA 3BXNA 4P48A 4GO9A 4X7EC 5JW4Q 1OCWH 4XP4L 1AZRA 3LJ3A 4IOIA 4JX0A 5GGRB 4G8IB 3TF4A 4WEEA 1JHLL 3GS7A 3WHE0 2DQHH 4WENB 4FFVC 5AEAA 5LUMA 3IAQA 3PNWA 4L8CB 2BNQD 4F8OA 4UCFA 3BLBA 4EQ3A 2R2EA 1RUKH 2Y07L 2Y06L 4GI9A 4XT1C 1IKOP 1KUMA 5IW6B 1EH9A 3EIFA 4L23A 3DNKA 4UOQA 4MZRA 2UY7B 4N8VB 1TJHH 1YMHA 3BVTA 4S2SB 5C3TA 3T4YB 4JG9A 1TQWA 5SX5H 4GQPH 1G9ML 3VI3B 1N4XH 2V7HA 1DBAL 4EUPH 1KJVA 4MJ5B 2HVKA 3T1FA 4FJZA 5EUOA 3LNEA 4RDBA 2DKSA 5AAWC 2FJSA 4PBDA 1N6UA 3BQUD 5AOKA 2W94A 1A14H 3VQLA 3B37A 3D3VA 4KKQA 1K5NB 3VACA 5D7SH 3TVMA 4XX5A 2P43B 2X4RA 1ZRUA 4LLMB 4DZ8B 3NCJL 4QTIH 1CFTA 1TZGH 2ZOOA 1H3XA 3OBAA 3TCLA 5JLZB 1VESA 5C0BE 3MRJA 3RNKA 4D9QE 3WFBH 3AGWA 2O1AA 4GUCA 4OCXL 3GMLA 4LRNH 1N8ZB 1F2QA 3TH2T 1HHGA 1V7NL 1WZ1L 2CO7B 1CBVH 4JDTL 1M05A 3MACH 4I2XB 5HY9A 4TNVK 4MD0A 3WFZA 25C8H 3P4OB 1WAEA 4ACPA 4P5TD 3D0VA 4GFXA 2EDMA 4PP1D 2FO1A 3A23A 1HIMH 3S8WA 2C9RA 2V33A 2OS7A 2LVCA 5CGBA 5JR1H 4GSUA 4RDQG 5E2VH 1MNNA 2NT1A 3S88L 3FQRA 2Y72A 2Z92B 3CE1A 4WJG3 3AZUA 3HI6L 2D31B 2F2HA 3QQ4A 3V4VB 1IGFL 3OMAB 3IE4A 3VG0L 4NQEB 1NAKH 5DJYB 2BWQA 1TZAA 1KJ2A 3WKNA 3RDTC 1NIAA 3LKQB 3CVBA 1XCTA 2BOBB 3FQUB 3QXUA 1PYWA 4I2XE 2NYYC 4XVUD 3ZE0F 5BRZE 2KT6A 3CN0A 1BGXL 2J1XA 4JO3H 5CBEB 3O6KH 1UOVA 5B39B 3FSOA 3U79A 3ARFB 2C3HA 1JVLA 4KKCD 2J1WA 2QJDA 5CGYD 4ZS6C 2IQAB 5FK9B 3H3PL 1NCDH 2VSKB 1W80A 5EU4B 1D6VH 3BP4A 4K3EL 3SQRA 3MV01 3SJVE 1UJ3A 3ARDA 3N3EA 4GMSL 4RAVB 1JDAA 4QRTA 5IEKB 4R5TA 2XWBA 4O2FB 2WV3A 3CSBA 3F3HA 3MXVL 1OB1A 3LS4L 4L8CA 1KXHA 3MROA 2F5BL 3FUJA 4R3SB 4NCC2 1ZS2A 4BFNA 2AV1B 3ZXAC 4WO4C 1R5VA 4K2UH 1BQRA 4PJGF 2VN3A 1SMAA 5D1QA 3KAAA 4M43L 4P9HC 5AVYB 3TA4D 1PEZA 2QADD 4DJMA 1GZHA 3PL6A 1HSAB 3D2UB 4NJAL 5C0AE 3RPIB 5FW7A 2H2PC 4E9WA 1SVCP 4NNYB 2EAEA 4PD4J 3IMBA 1WWWX 3P11H 3SDCC 5HDQH 3IS1X 3Q01A 1YPZE 3KPSB 2AEWA 4HSCX 2EVGA 3P9MA 2EYRB 1WD8A 1SHMA 2AZUA 2C34A 1EAPA 2EINB 1RIHH 4XNAA 3LZFL 2VDLB 3M1BB 4UUJA 4AI7A 1A8ZA 1LK3H 2FH8A 4BK5A 3QZMA 1U3HD 2IGFH 3APMA 4RGMC 4BCYA 2FB4L 1OM3L 3NJVA 3I3BA 1WK0A 3LMJH 2GK0B 4LSVL 4PJ7F 1INQB 4LVEA 4G8GD 4FCAA 2NXZD 3CFUA 1DDTA 4JQXC 2D0GA 5FYLE 1TF4A 3DPBA 1ZHKA 2VN6A 3DVGB 3GMNB 4KHXH 4KV5F 4Y5XC 2AXJA 4JFTA 2ZP0T 5ISZB 4OFDA 4HDIB 2G5RA 3L3DA 3TA3A 4CC4C 1H3PL 3V6FB 3W2DH 2YPVL 1TTRA 1KIUA 3IDMB 2D0FA 3WEOA 2AKRA 2E7MA 4N2CA 2EVIA 1SLXA 3FAWA 5GRVL 4PVMA 4RX4D 3MOAH 2HKHH 2VXTH 4MJIA 4PJCF 2SEBB 5IBTL 2A9ML 3S2AA 1CK0L 2DMGA 3KYMB 1YUHA 4RMRA 1WGOA 2GCYB 1UWGH 3HI1A 4DW2L 3LEYL 1QSVA 4EXPX 3N42B 4U7KA 1G7HB 3ZQXA 3RA7L 5F7UA 5D70L 4HIXL 5E1IA 3EO9L 1BOYA 3QI9C 4IJ3C 1EDYA 2A74A 2C8NA 1GVIA 3L3OB 4OGYL 5D9SB 1QLFA 1WBYB 3B6SA 1PLBA 1L0XA 3O11B 4PR5A 3L54A 1G5AA 3CZUB 4WNQB 4CILA 4J3OF 4HJJL 4N5EC 4WO4B 1S9XB 1NAML 4L5FH 1NFDB 1OPGL 5GGSY 4DPRA 1X7QB 1AI1H 3X14B 1MF2H 1EA9C 2B14A 4BDVB 2OMVA 3OD3A 1ND0A 4OM1H 5JUEH 1A6TB 5AVWB 2YIHA 3F01A 2OMZB 4Y19D 2AV1A 3LRLA 3U30B 3KBPA 2GKIA 4JB9H 1Y6KR 1M7DB 5CD5D 2VSMB 2H7WA 4QLRA 4NQQA 1UWXK 3OKOB 1PIFA 4X8GA 3UX9B 1EFXD 2ZWSA 5KYWB 3QDJE 1PX4A 2CRYA 4WI5A 5GRUL 4TVPL 1JXGA 3TBSB 4BE6A 2X7LA 1OTSD 3WS3B 4FQQA 1IBDA 3RB5A 1J8HD 1YNTB 1DCLA 1RZKL 3GDCA 1S6NA 4GRMA 3KWVA 3FU8A 2QPSA 4O2EB 5JHBA 3ECUA 4D9RE 2DLFL 2X2HA 1MJJA 3GJFH 1BQHA 4JZJB 2IPKA 3F6JA 3SSGA 3DHUA 3VXSD 1ROCA 3HS0B 4MQXD 4ZYKB 3SOTA 3FT9A 1RZIA 4F7PB 1KB5H 4UM8B 4XBEL 1WWAX 4YDZA 5DLMH 4R7NA 5L7XL 4YE4H 4F7CB 3TCLB 1WFJA 2TRHA 4AIEA 2HT4C 1MRCH 5GRJL 5D96C 3ZIYA 4JRXE 3RUGA 1JFQL 3U6XA 3WGVB 3OHXA 4OCMC 4QNPE 2H9GB 3OXRA 2FO4B 1KBKA 1QFWM 1JVKA 3IKKA 1UA6H 4ZS7H 5FUZH 3ZW3A 2ESVB 2NTSP 3WD5H 4AJVA 5TPWL 5C3LD 2ADFH 1U92A 4ZAKD 1BV8A 4OZFA 4I18A 1CF8L 5MERB 2C4FT 1HH6B 3FUFA 4F1ZA 1TO5A 3EYSL 4OH2A 3TN0B 5FUCE 4ABQA 2IADA 4L4TE 3EO1B 3WL9A 4X80H 4AL8C 2CUMA 3K1DA 4MAYB 4DP7X 2F74A 3ATDA 3C75A 5L4MA 1E8WA 4MA3B 3OM3B 4XO3A 3B4NA 2WAHA 3RZCB 3FUNA 1ONQA 1F4XL 1K5WA 2RALA 3RURA 2HMID 2PCFA 4A63A 4DO6A 3NESA 4KOCA 5CIPB 3QAQA 3PWPA 2FSEA 2WPGA 2YKLL 1XFPA 1KTJA 3C60A 3VNZA 3S3PA 5IVXB 3V4UH 1T1XB 4AH2A 3VFGH 3IJSB 4BQ6A 1MFNA 4KRPB 1MFMA 5I1JL 1A9BB 5E5MB 2UXGA 3TO2A 5JPNA 2EE0A 4GH7B 1FJ1A 1YEHH 3FSAA 3WXVH 4GLRI 4YSUA 2BHZA 1BAFH 5CGTA 4CUCA 4ZD3H 5J6HB 3KPOB 3IGUA 1M05B 1BW8A 3H4HA 4X6DB 2XIIA 2WTPA 2R0ZH 4XWGL 1HEJC 1MFDL 4ELMA 2UZIH 1SYSB 1UXWB 2Q1EA 1JCKA 4RFEA 1MLBA 3EJYD 4FQ1L 3L7FB 3SE8L 3WLBA 2F7RA 4UTBL 4AE1A 4ZOBA 2QPFA 5C0BB 5JPMB 4QDGA 4EZKA 3L5JA 3RFZC 1P5VB 4A2MA 5FDWA 1MPAH 3LZLA 1IGTB 5LG1A 2ZG3A 1A1NB 5LHDA 3MV9A 1ZA6A 3KPSA 4P8QA 4EAEA 4I85A 4LCVA 3TESA 5A2IH 4QRQB 2FBJH 4V2CB 2LU5A 1PY9A 3V5KA 3V0VB 2E27H 4L9LC 3SKUD 2QKIB 2DEYX 1U6AH 5JHDB 1HN1A 3JYCA 5CHNA 3VFUA 2JI1A 4X4YA 1UM5H 1HHIA 2X53A 2UZPA 2X70B 5A43C 3IXAB 2EUVA 4H1LG 4APQB 3N06B 5D1XE 3LKSA 1SHWA 3S3SA 4D0CB 3AMKA 3FUMA 5DT1L 4BQCA 1KEMH 2CU9A 3EFFA 4I0PB 4D8PA 1DQTA 1LO4H 5I18L 4Y5YB 5I5JA 3CBKB 5AUMA 4XBPA 3VFTB 2PPCA 1S9XA 3SDXF 3T77B 2BHYA 4PJ5E 1B3IA 1QW8A 2AI0H 4ZZFA 4NBXB 3CFEA 2ZWNA 2XG4A 4HAFA 5DK2B 4TXVB 2BNQB 3MRGB 2PR9A 3QFJB 3BP5A 3QUGA 2XZCH 5KYUA 2YPLE 3KPRE 3QXVA 2NW3A 3D9AH 2DQTL 2AQ1A 5EEXA 4M7JH 2JQMA 3BHBB 4LBEB 3UO8B 3EKCA 2EZ0C 3K5RA 2GSGA 2XPGB 1WUNT 3W5MA 4TF4A 3MRRB 1S7WB 1FYTA 4I0PD 1G9MC 1IC7L 1MLCA 5DVOA 5AZEH 3UTSA 1HL5A 1NEPA 3SGEH 2IV9A 4HIJB 4WNQA 5DS8B 4N5ED 3QQXA 3CHRA 4YGVA 4OJAA 2ODIA 2FX8H 3MLUL 2EDWA 3IDIA 3EYFA 3IRZA 5CSZA 3BVWA 4FS0A 1RK0B 5D1XA 2F9BT 3JBG7 2HX7A 4M3KB 3N0PB 3TBCA 3BZ5A 5ITFA 3QYCA 3MC0A 1OLLA 1DANU 3C6EA 4N0YL 4GEIA 4PS7A 3UAJA 3DURA 1B4LA 2B4CL 2OMZA 3LQMA 4A1RA 2DLIA 4LRNL 1PG7H 5TF1L 1JZDC 3TWCL 4M6MH 2BHFA 1K8DB 3F65A 1BVLB 3MDJA 1ACZA 3P02A 3QIUC 4N2FA 5C0CD 5IFHL 2CALA 4Q74A 4LIQL 4MDIB 4PJXF 5AOZA 5AW1B 2P80A 4JLRA 1M4KA 3S88H 2IFGA 1AMXA 2Q5BA 2E7CA 4B9CA 1UH4A 5D1ZD 2PTVA 4AQEB 3PWNB 4OGQC 4ELME 4B53A 4LLWB 1NAKL 5DC0A 4LEXH 4GJTB 5F93C 1DFBL 2XY2A 1N6QL 5I6OA 3KLQA 4YHIA 3FQ2A 4HKZB 4A7QA 3QDMB 1WBYA 1OGTA 4UIKH 4U1JB 5JW3H 3EDJA 2R1YA 1E4JA 2VZ3A 2PPFA 3H3PH 2W0FA 4OV6F 3S5LG 4YUEL 2HTKD 4XI5C 3TNMA 1ZXKA 3IPBA 3OTTA 4CVZB 5JXAH 2WKGA 4BDVA 5GIRA 3Q2NA 3NN8A 4YNYA 1C08A 3SBRA 1CIUA 4K7PL 2DD8H 4MNHA 2GYSA 5H4YA 5TQ2L 2G3MA 1PLGH 3L16A 3LS4H 3GIZL 1Z5LB 1AS7A 4P4KB 4GB9A 2BOCB 3LQAC 2DI8A 3DX0A 1OE2A 5B8CA 4P3CH 1EHKB 4XB8A 3C09B 1SJEA 2PNDA 2CUAA 3QUYA 4I9WE 1IC5H 1A9VA 3WBDA 1P2CA 1GAFL 1MCWM 1T2QH 1QKZH 1NAMA 2VITA 5LXVA 3HPLA 5FA4B 4A55A 4D9QD 1ITBB 3P11L 4R2GD 1HILA 1RMFL 4ZXBC 1RSFA 1ZHLB 3ABGA 4X8CA 3WS3A 6FABH 5HDQL 1BVOA 5D5MA 1XB3A 1SEBB 3I9GH 5A40E 1GKEA 2Y36L 4WNJA 4HUXB 3PS6A 4ODXA 1NLBL 3LZFH 3KGRA 3WDIA 4NO0B 4P3DA 4AQAA 1J9QA 2WNWA 5KVMC 3O4LA 3RGVB 2BS71 4E36A 1EGJA 1MQKH 4WWKA 3CFMA 2IH1A 1HI6A 4Z3JA 1U33A 3F12A 2WP3O 3IRCA 3P69A 5JHDE 2GK2A 5E8PA 2YPLB 3KPRB 5GRVK 2ZXAA 4RCAA 4KHXL 1H5BA 5J89A 5EWIL 2M83A 4X98B 2BIQA 3BSZL 1Y0LA 3CLFL 1JZ5A 4YFEA 1DEEB 4WTXA 2CGZA 1H3PH 2E4TA 5B39G 4K55A 1GIGH 3FFCA 1UFGA 3OHXC 5F8RC 3VU2A 5FA3B 5TJWK 4AK1A 2OSLB 4LEOB 5EF2A 4OLUL 1H15B 4QUOA 4L3ED 1LE5A 5JW5A 1LTXA 3VSQA 3MOAL 2NUPB 2H3XC 5IBTH 1HINH 3GMLB 1CK0H 5AENA 2XPYA 3QDGD 3HC3L 1D5ZB 2JB5H 1WFOA 4NN7B 4PY7A 2Z35A 2Z8VC 2B77A 3IU3B 1NBZA 4BZ1L 3QH3A 5LWYH 1OALA 2GSIB 3ECVA 4GQ9L 5DK2A 4MMZA 4ZQKB 1Z9MA 4LL4A 2Z8WC 1RKRA 3WOVA 2DV6A 2EKSB 3ERXA 4LPXA 2ED7A 3FQRB 4DPAX 2CHNA 2Z64C 1FGNL 2H5UA 2FH6A 2WXIA 1JPFB 3HRZA 4ZMPA 3OR6A 3JV4B 3PPSA 1J1XL 3HS8A 4YPGB 1U4FA 5DJYA 2X05A 2ZG1A 4PS4L 1ZXQA 1OPGH 1CXFA 3MJ7A 2ODHA 2OZ4H 4ZX4A 1MF2L 3REVA 4RRPG 3V6ZB 2XV6B 3GEFA 1JXJA 4PLNC 5IM7B 2Q2EB 2VDNH 4X0NA 3AU1A 2VCOA 2QMJA 3K0WA 1O6SB 5ICXB 3R19A 4HIHB 4JB9L 3WELA 4XXCC 3MRLA 4P2YA 3VXMB 3N04A 5ADOL 4L37B 1IM9B 4YBQD 1A21A 4R90H 1W72A 3WNKA 1TUPA 5AZUA 4N3UA 2B08A 1N19A 3CVIL 5E4OA 2J25A 32C2B 5ITFB 2VDOB 3K71A 4A66A 4LVHC 4OV5B 1DE4B 5KSBB 4XMLH 3OGOE 4KX9A 2BJMH 4ONGL 3KWXA 3ZZQA 4OGXH 4OLZL 3LV3A 4MBRA 2BSEA 2VH5H 2AEQL 4WI7A 3WI9A 1L7TH 4QTHA 1Q94A 4JMXA 3NIGB 3RNQB 1CXEA 2P42B 2OMTB 1U0QA 2FJUB 1JYNA 4OUOA 1PEWA 3US9A 4XR8C 2WQWA 4MDRA 4DKFH 3RU8H 4NSKB 1E6OH 2IO5A 3F7LA 4PRPB 5FGRA 4EIZC 3KXFD 5BV7B 2B20A 2B5IB 4MQXC 4AGLA 1Z32X 5HGDB 5I26A 3MRHA 4BZ1A 4YPJA 1AGEB 4HUWA 4U31A 2RFXA 3HUJF 3O0RH 5KWYC 4HS6B 3K74B 5DLML 4F7MB 1XB8A 5MEOB 2E9BA 4YAQB 5F89B 4ZFOL 1MREL 1B9ZA 2NR6A 4TRPH 3SPGA 3QSKB 3V0AC 3T8XA 3LQZB 5DD5H 3S5LB 3TASA 3X13B 3VFTA 4N9GA 2W0FB 4XGZA 2ADGA 2KPNA 4V2BA 1WYJA 3R06A 4WI6A 4XRCB 4J3SA 5JOFB 4XMTA 3DX8B 3C60D 2V2XA 4FXKC 3RIAK 3H55A 1MI5A 5A7EA 2ZX8A 3TCTA 4B97A 4HKJB 5E8DH 3F7YB 4EI5D 2EO1A 3HZVA 1Z7JA 5T5NF 1T22B 1VACA 4QHMB 3AB0C 4LHJB 5HHNB 1LEKB 1BXVA 5SV4A 3D52A 4HK0A 3ETSA 3OMIB 3PWNA 3CH1A 4RGMB 4K07A 3TBWB 5HHQA 5D7IE 1HE7A 1A7QL 4BKSC 4X5QA 4XPAL 4G5ZL 2NY0B 2VSDA 4L0PB 2H6OA 5H37G 4A7TA 4K5OA 1NGXB 1MNUH 1RP8A 2AMGA 3FOLA 4FG2A 4J6RH 3TBSA 1N59A 3HJ0A 3DUHA 3IKCB 3L6FA 4TLTA 3UTTA 5JHAA 3M46A 5E2WL 5AW7B 1MH5A 3J2PA 2AQQA 4MQ7A 5IVZB 3DIVA 2VDQB 1CU4H 2KS0A 4FNUA 2FCBA 1IILE 2N56A 1P84K 4HUXA 4WI4A 3QUXB 5FF6A 5ADPH 3P2TA 1MUJB 2R69L 4NQXA 2N01B 5AW8B 4IIQA 1N0XL 4OD1L 1SXBA 5DR5L 1T20A 3SE4A 1HCYA 1JIBA 2EEBA 4DO4A 1PJWA 2O5YH 3MCKB 4YBHA 3WNLA 5JNYA 2IPKB 3Q2CA 4JFSA 3T8VA 3LNHA 3N0AA 3LKRA 2NX5B 4OZHF 2BNUB 1ETJA 2P46B 2JSFA 2VR3A 3G5YA 4PIBA 4YWGL 1A64A 5EA0L 1RJYA 4RAUA 4PJ5B 4X98A 2EXSA 4FTVA 2NY0D 1XGUB 2ZX5A 2HG5A 4A04A 3R1GH 1G9HA 3TO4D 1P2CB 1F90L 1FFRA 4LPWA 2H1PL 3MX0A 3TFKD 4BRVA 2V2TB 3QARA 4H88H 3VMPA 2P24A 3GXTA 4JZNB 4LLQA 2OX5A 1JF1A 1VERA 3RAJL 1KIPB 1QQDA 4NRZA 4DSYA 3MBXL 5TK2A 3UZQB 4UF7C 4G9DA 1ICTA 4WF7A 1PF3A 1X4XA 2E27L 2DMCA 3GIVA 4ERSH 2JXMB 2ZOKA 4BD4A 1DJGA 3WO4C 4A6YL 1OGTB 1AGEA 4HUWB 2LU4A 5E6ZA 5IF0B 2IDSA 5KSBE 1NCAL 2VGLM 1SOQA 3IN0A 2ARJQ 2N4IA 3SE6A 4QT5A 5DJXA 3BQUC 4JUTA 3V4VL 2F74B 4RGNC 4U0QB 3QDHA 4PJ8C 2Y1ZA 4OVUA 4EOWL 1MWAB 4TQHA 2NUTB 3W9DB 5C3IA 5KVGH 2A99A 4H1LB 1ETZA 3D8MA 5BOPA 2A83B 1AO7B 1U8JA 5J5EA 1F97A 3BP6A 3OB0H 3GLEA 2YJQA 4HUNB 4PVLA 1X5LA 1Q90A 3ZVVA 5ITBL 3PWPD 4YSRA 1ODUA 5HJGA 3FFOA 3GSNL 5JPMC 5IVXA 1GH7A 3TH3T 1R24B 1UD2A 3P9WB 5DRZA 1IFGA 2XZCL 3MJ8A 4C56A 4MXWL 3H7LA 1A47A 4RAVA 1T04B 4EKJA 3A6OA 4M7JL 2WLIA 3ES6B 4LRIC 4B9ZA 4B95C 5HYFA 1SEQL 2NNAB 3O3AB 1QSZA 4PRHA 1LL1A 1KBVA 3HMWH 1Q72L 4JO1H 3U2IA 2FECI 1CGSL 1E30A 2VDNB 3TN0A 3UTTD 3C5ZC 3FZUC 4K71B 1CO1A 3BAKA 1AH1A 3MLUH 1DJZA 2VM9A 1S7UA 4HZLA 3EBHA 2XETA 1KCWA 3WIHA 1T0MB 2C7UA 1TQBC 4NN6B 2NXYB 5LJYH 1M56B 4XP6L 3A67L 5IB1B 1G0XA 5I1LB 5IMOA 1ZWIB 5CR1A 2YSSA 3DO3A 5BUAA 1I85A 3MU3A 3PWPB 2HG0A 1FC1A 3GBEA 3NP4A 2JI2A 5LO7A 1AR1D 2QV4A 4RGNE 4XB7A 3VWKB 3S34H 1KB5A 3H8NA 2FJFB 1W72B 1T80A 1XR8A 3N1FC 1VIWA 3B2VL 4AE0A 4HS8H 1UWYA 4DN4H 3P30L 3SJVB 1IUZA 2WBJC 2ENPA 3KL3A 4L29A 1ECZA 2Q6WB 3BUTA 3HE7B 2EIZA 1AJ7L 1Q0YH 4ODUA 1G7JB 4ANVA 1HSBB 3L3GA 5J6GB 3H7BB 3DTUB 4WUKL 5EU7C 4IIQC 4KZDL 1DFBH 4G8EB 1N6QH 1XMWA 3L8QA 5BRZB 3B9KA 1KJ3L 1MCDA 5BXFB 3BKCH 4P4KD 4PRBA 4PCYA 3MR9B 5HTSA 4GBXD 1N5AA 3UPRB 3F7PC 1FFPA 3IFLL 3K91A 3REWA 5JW3L 3CDFA 2R27A 4S1RL 1EVTC 1LNUA 4GW5A 4NFDA 3PLYA 1EEZB 1QNIA 1QFWI 3ZRSA 3RG1C 3UP6A 4OCRH 4Z3GA 5GS2H 1RHHA 5FC9A 1LE9B 3NZSA 4EPSA 3MUHL 4OZHB 3NQKA 5A2JH 4ZMWA 1DO5A 5CHNB 2ZOTA 5I17A 4K7PH 1FNGB 4WU7A 4J5VA 2QTEA 5DRWA 2HT2D 1YNLH 5IUCA 1T21A 1NCBL 4C8XA 4Q6IB 5ETUB 1JRHH 2ZUYA 2WK2A 4JANA 4P3CL 5DRNB 4BH7A 5TH2A 1J8HA 3KM1A 1ZT7A 5LDSA 4LPYA 3S9DB 1KLFB 1I1YA 5G5DA 3U4EA 3STLB 1AOZA 4PUBH 1UZ6E 3ARXA 5MI0C 3SODB 1LEGA 4UNVA 4DGUA 3ZDXF 2QSCH 4R2GB 3I9GL 4ZMXA 3VRJA 3PE9A 3OX8A 5ACZB 3U4BH 2R9HC 3EOBB 5IWLC 2Q3XA 4NQVA 1JD9A 2I7SA 5ECJE 4YDVB 2MH4A 1VCBC 5KJ4A 2VZUA 2PETA 5CZXC 7TAAA 1MFCL 3E8VA 3FSVA 1NGXA 5HGBB 3LH9A 4Y4HA 1WT5A 4KJWC 4PGEA 5GSVB 1HOCA 2DQEH 1J1OL 5ENWA 2VJXA 1K3IA 1JGLH 1MY7A 4XHJC 5IHUL 2AFNA 5EWIH 4M1GL 3WNMA 3G5ZB 3CIQA 4P23D 1DBKH 2W0LA 3D1MC 3DROA 1I9RL 4BWTA 4EMZA 4HOXA 1SHSA 3UACA 2R1YB 4GY4A 1EJ8A 3RWFB 4PTUA 4G6KL 4A2HA 2LHAA 3NSXA 3OKNA 3KHOA 4HS3A 1M57B 5DJZA 1ZLEA 1YDPA 1KN2L 4U2ZA 3HPJA 1MXDA 3GMPB 4KVCL 1UFUA 2WZ5A 1N5YH 2PKDA 2O5ZH 1M42A 2ZCHH 5J6GA 2YUVA 1DR9A 3GNML 2EXTA 2X89D 1AFVH 4XO5A 4ECNA 7FABH 1E27A 3UGEA 2F58H 2A2QT 1W0YT 3FQ1A 4MDIA 3D39E 1WSST 1CDJA 5ALBL 2SEBA 4HLJA 1I85C 3G08B 4XCYB 5HYEA 2X44D 1G43A 2E76C 3KJ4B 4JKKA 4PJAB 3NFNB 5K9OA 2EH7L 5M95B 4PLOB 4AJWA 1JDCA 1NGYB 3EHBC 1TCRB 1V7NH 3VYOA 2Q3AA 1TVDA 2QPUA 3WY4A 2H6PB 3POHA 1HQ4B 3UJTL 2DLHA 4KKZA 3VFOB 1AY1L 3T3ME 4L1HA 1J9RA 2GAZB 3PHQA 4XP1H 3F8UB 1S4IA 4XXCA 2G3NA 5D6CB 5SWSE 1IL1A 2DLEA 5LQBH 2G75A 3BWAB 2IDQA 2Y4SA 1BD2E 2VXSH 3BPOB 5B7EA 3ZZLA 5K9QI 3KMDA 5E2VL 4G3YL 5DRNA 1UA7A 3CDCA 4KJPD 1UUSA 1H3WM 3FT0A 5CLTA 1A7OL 4WV1A 4GXUM 5FYKL 3VFPA 4ZUWB 5DD3H 4R90L 3VXMD 4X7CC 2NX5A 1ROWA 3VD7A 1IFHH 2JCCE 2CCLA 3MRQB 2YQ3A 3ASNB 2B4CC 4F7EA 1LYQA 1UENA 1BGXH 3TC9A 4DIXA 1UZ8B 4LLMA 5EIIA 4ZUVB 3O6KL 1JPST 3G6JB 4K8RL 2WUCH 5IJCC 2QADC 3C2AL 5D4HA 5TDPB 1D6VL 2NCEA 5CJ8A 4L8BB 4K3EH 4QOKE 1D5RA 4Y4FC 3LB6D 1L9QA 5TDOA 4K15A 3I3EA 4J28A 1B0GB 3QA3B 5JO5A 3FU9A 3T4AC 4F80A 1ILUA 3MXVH 3EXLA 1QAWA 1GCFA 1UQSB 4TULH 3VQMA 5AL8A 1JZ3A 1MG2C 1CFQB 2J73A 4IKJA 1F1AA 3H7BA 4I48A 5DZVA 5BJTB 4PY7B 4NYLB 5JZ7D 1F1GA 1QABA 2CNYA 3O0RL 5F9OL 4M43H 5ERWB 4JR9L 4X6FA 4JE0A 4OFPA 1FLRH 4NQEE 1GMEA 3OMNB 4QRQA 3TIDB 3L9RA 5DD5L 1XCTB 2BOBA 4FXKA 2DMKA 1KPVA 2L4OA 5CEYB 3MA7A 2YOAA 4F7PA 1CF1A 4QRBA 2VC2H 3IM1A 2WBJB 4AGNA 5C09B 4Z77B 2HAZA 5B39A 4GYBA 4DZ8A 4R7NB 2X4UA 2ISDA 5GRZA 5PAZA 3GTNA 1O7DE 3VE0A 3W81A 1FGVH 1V55B 1XGPB 4PGBB 3KH4A 2EDDA 5LNEA 5EDXA 4TM9A 4LSVH 1BVKA 4L1TA 4ZFOB 1U3HB 4PJ7E 2A73B 1A6UH 3CZFB 4LMQI 1NDTA 1CDIA 5ID0A 3N1QC 2YMOA 1TFHA 4JM4L 3E7JA 3L7EB 4G71B 3O3BA 4H26B 4NN6C 4J6RL 3QB7C 4PRHB 3HHSA 1KCLA 1MFVA 3MJGX 4KKAC 1U91B 1YPZA 2AABH 4Z7VB 4DAGL 3BD3A 3C5ZB 1CU4L 1QRKA 2NZ9C 4CVZA 1GOGA 3A6CH 1AR2A 1OK0A 2R69H 3VXQB 3BAJA 2J8UF 3HOGA 1G7LB 5DMKA 1WJ3A 1F4HA 4NM4H 1M9SA 1UWGL 4FYTA 3ARVA 1C16A 2FT7A 5CIPA 1J8RA 5KYYB 4WCYL 4AGQA 3B7UX 5D70H 1F4AA 3WSQH 5IM7A 3GXNA 4X8XA 3L5WB 4F9PC 4RNRB 3VW3L 3P4NB 4OGYH 2F7PA 2BVQB 2PXYA 3FB7A 1RK0A 2Q0ZX 4PJAF 5F6HI 4JDVA 4EN3D 4G8GE 3MLZH 4BK8A 2IGLA 3SJVA 3AT9A 2AERT 1AXSA 3G3LA 5C9JB 3WEAA 1ZDQA 4L5FL 5AW6B 5C0ND 3UFIA 2CBOA 4XPTH 1CGUA 4N0FB 4OM1L 1CLCA 2H0EA 3FAXA 1EV2E 2O6PA 3NCEB 1CYXA 1XSOA 1CLZL 2PTTA 3IDJA 3GHEH 4JO2H 4FMVA 3TGXA 3BUIA 1PAZA 4YDNA 2ICCA 3L9EA 4HC1A 4LSUH 5D2NB 4HG4J 3K3QA 2FNWA 1YNKL 2WCPA 3S96B 4I8DA 5I30H 1MEXH 4GSRA 4JN1L 1ZGLB 5GRUH 5SWZE 1SJXA 2B1HL 2RTTA 3SDAB 4P9ML 2RACA 3ECWA 1S3KL 5FGSA 2EIMB 1VFAA 2ENSA 1ZPLA 1EQWA 1T4WA 4G8FA 1UYWH 3W0WB 5FO2A 3I85A 4HQQL 3EFFB 5I15L 4PJ9B 3BUYA 2Q76B 1IZJA 2K3HA 1XF3B 4OJEH 2D03H 3RVVD 2XVKA 2BSBA 4J39A 4HIEB 4FQHA 1IO4C 2PUQT 2O4EA 3LVEA 4YR6B 1O0VA 1RJLA 2WANA 4N87A 3RDJA 2Z7ZA 3MRKA 3UCRA 5I1AB 5DD1H 3PWLB 4OGAC 2HA1A 5D7JC 2WZ0A 1KCUH 3OLGA 1W72L 3FB6A 4YX2L 5F9WC 5C9KA 4JFEE 1CLYL 1MFBH 3ZDZF 5CCJA 1TJXA 3KLDA 3A6BL 1IBFA 4DUWA 2CKBA 1BXXA 4PCKA 2IDUA 5J9PA 1WRFA 3GMMA 5KYXB 4F7KA 4NDMB 1E7UA 1VZHA 2NW2A 5FM5M 4I3SL 2GTWB 4GQZA 1QHOA 2KLSA 1MLCB 3MOBH 4PV1C 1G94A 3WENA 3O11A 4LBAA 4PR5B 2BIOA 1IL1B 3RL2B 5DHVB 3BPOC 3ULUE 4L3EA 3NZUA 2XN0A 3U0PA 3ZHFA 2CO3A 3BKYH 3OF6A 3OF6D 2PXYB 5EFIB 3QUXA 2XA8H 5HSFA 2W9EL 2HCZX 5FO7A 3ROLB 2X6CA 3QJXA 5C1MB 1F3DH 3BKMH 1I9EA 1A4CA 1V3MA 2NQCA 2JK5A 3P30H 3JQOB 3L5IA 3KWTA 1HHJA 4Z7AA 2IXQB 3LPOA 1PKQA 3PHOA 4O58H 4OIFA 4PRIE 4DN3L 3GSRB 3MLVH 4JFPA 1A8JH 1EHAA 3GSOB 3KE0A 3NACL 3TU6A 3SD5A 5KUKA 4H25B 5MHSE 4LGPB 4GBXC 3RY5A 4JLRB 2A6KA 2XFGB 3BXNB 2VNCA 1PAMA 4N6QA 2YPKA 3FOMA 4WI2A 4EUPG 4YXKH 3EOYG 3JWOL 3KYOB 5IJBC 2MCG1 3SDAA 1YEFH 3IDNB 3VXPB 3HRPA 5EO9B 2X87A 3O3AA 2W0PA 4H0IA 5ESQB 2G5BB 3RUGF 2YBRA 4PJCE 4PS3A 5CEXB 2NY5C 1S7QB 1GJWA 4FI8A 3DXAD 2DLGA 2V3EA 1NCBH 5KVGE 2JTDA 1YHPA 3WKYA 4HWEH 4F9PA 1UEMA 1RVFL 5I0DA 2Y6SD 4NQED 4PJXE 1JPTH 5CCKH 4L5FE 2VR5A 1II4E 5D7EA 3D48R 4XNXL 1DVFA 2MIZA 2OMYA 1K85A 1HYSC 1ZDSA 3L4ZA 1NJ9A 4ZW5A 4M48H 1MJ7H 3RX8A 4U6XB 1JYWA 2QSCL 1X9UA 4E41B 3CIAA 2NPLX 1CYWA 1KACB 4FNQA 4KDWA 4GW4A 3U9WA 7PAZA 2QELA 3F85A 4XPGL 2XZQL 1KEML 2BDNH 5LKNA 1ZGLM 1MFCH 5FUCC 5T3ZL 3NOIA 5K69A 4PWIA 5IOPB 4OV5A 1F56A 2VLME 3AY4C 4FZEL 4NQDD 4PIRF 1Z9SB 1TQSA 4ZXBA 3AT0A 2IADB 5I66A 4PBVC 3DX4A 2NZ9D 3PFQA 4Q6IC 1X9RA 3I6KB 4NENA 4MA3A 4PJDA 4UM9A 5CINH 5IFAH 4BHUI 1E2ZA 1QTPA 2AK1H 1NEZB 3KNBA 1TMCB 1H3VA 4YSEA 3GLDA 3DMMD 3QHZH 5E8NB 4JHAH 5C0BD 2Y1YA 1YY9D 4JPWL 2BIHA 1T5XA 2OW6A 1LNUB 4GW5B 3V9EA 1SQMA 2YQBA 3GSVB 3H9SD 3QC5X 3U82B 4A7GF 1F1DA 1TEFA 4FRWA 5G4OA 3DVNB 4KVCH 2JTYA 4QHPA 3VM7A 3QQNA 3LRMA 4N2KA 4I0PA 4YSOA 3RI5F 4D8PB 1TNMA 1LLAA 5DWPA 4HWZB 1YMMB 4QYOB 5D1QC 3T2NH 1Y6MR 3AREC 4R7DA 1SOSA 1QASA 2AQ3A 3BP4B 3DHJA 3JXAA 4MHHG 5DMJB 4UYPA 3QJHB 2YEVB 5BRQA 4G9DB 3ZKQD 2F1AA 2VWEC 3O3DA 4N0YH 1XGYL 1RAMA 1KZQA 2K4AA 4HIEA 3BLKA 4S11A 4NFBA 4QJ4B 3CVDA 4MNQD 1I8IB 5TF1H 5J3HD 3ELQA 3QFGA 4M6ML 2OKMA 5JIPA 3QFJE 2VDLL 4PJCB 1DFXA 4UU9B 3W1ZA 1BMWA 3T6QC 5CEXA 3VRJB 1ZTXL 4XXWA 2X3BA 3A24A 4U6VL 4DH2A 3HFFA 3S3DB 2P45B 4O51B 4HBQA 1GOHA 4G3YH 3FOLB 2UYLA 2P44B 1VFAB 2YD6A 2JJVA 3SOBH 1QFHA 3R18A 2Q86A 4CMHC 4ALAH 2V9UA 5EOQH 4ZMQA 4DT2A 4HUCA 4YL9A 5TGBA 1TO4A 2UZXA 1T5WB 3QRFM 3MN8A 2J88H 3U0PB 4J3OG 2DM3A 4K8RH 3T77A 2GJPA 1HS6A 4JFFA 5DHEA 2YLHA 4R4BB 3HHMA 5HHOB 2XA3A 1GC1L 2IV8A 4UBDC 1K9TA 2CDFB 1BVZA 2R2EB 1R5WA 5IROA 3V95A 1VZGA 1SBSH 1W6LA 3FTWA 4MS8D 1AQKH 4PJFE 3NDZE 3V4PL 1SLVA 2P26A 5F3HB 3FU0A 4JFXA 1BOGA 2I85A 3VVWA 2OMTA 5EBWB 2APBA 4U7SA 3DA0A 5E9DD 4JR9H 1IVLA 1OHQA 2F54B 2ZOLB 4H8WH 4WTWA 2HZHA 1J88A 1J0ZA 1JV5B 1XIWB 4A7VA 1PU0A 5DVKA 4MZ2A 5DVNA 1I8MB 1PPIA 1G7HA 5H4ZA 5D1ZI 3QDME 4F2MB 2MKWA 1WE5A 4OLWH 4U3CA 1N10A 4L4VD 4YOKA 1NCTA 3II3A 1JJUA 5F89A 2VDMH 3MBED 4KNSA 3M7FB 4PJ9A 4UYQA 4Z7UF 2YBRB 4OIIL 2X1WL 1OGAD 5KVEH 1P7QA 3S0PA 1N3NB 1KTBA 2BNRD 3MLRL 4H8QA 4XBGB 3T0EE 3U7YH 4I9XA 2PPEA 3P2BA 3SE9H 1NOFA 4DVBB 4I3RL 1OD9A 4LL1A 4N22A 3HLAB 1X9QA 4NGHH 2BOCA 4TKWA 4XN7A 1VB9A 3TZVD 3CSGA 4JM4H 1D2OA 1I1AD 1YQVL 4M56A 3TO4A 2RAMA 3BMWA 3UL4A 2HLFD 1GIGL 3PV6B 3CN1A 4H8HA 2ADYA 1CWVA 5T3ZD 3C5JB 4XN1A 3TEYA 2ED6A 5AW2B 5I0VA 2FL5A 1QYGH 2YFOA 4X9IA 3SO5A 1A6VH 3KBHE 4GS7B 1CC3A 4N25A 5EOCJ 2BM3A 3GRWL 2R2BB 3VFWA 4HHGA 3QRLA 2VZSA 1R17A 3UYPA 3CV5A 3FQTA 4GT0A 5HHMD 2XWRA 3ZL2A 2AAVA 1JFHA 1KENL 1NC2D 4KK6D 3QUXC 1HJBC 4Z7WA 4X5XB 2AGJL 2OMBA 4LHUA 2YS4A 2WLYA 1MCPH 3U6RA 2BP0A 2PPDA 6CGTA 2AEPH 2C4XA 1XF2A 4W6YB 4DVRL 3QDJD 4IOSD 5E51A 4FYSA 5CCHE 1TVBB 1CVSC 1I75A 1KGWA 2BNUA 2EJ1A 3GSNA 4XVJH 3K6SB 3CAFA 1UGKA 1F18A 4LCWA 4NZRL 1JN6A 3HC0A 3ME0A 3APDA 2FHFA 2XKSA 5CJQL 4NWUH 4XOBA 4LVOB 4LEBA 1BX2B 1XR8B 5E5LA 5I28A 3E6HB 5DD6B 1U36A 5I1CL 2V9QA 2DJMA 1DBJL 4QHUA 3QO1B 4G1MB 1OAZL 4H5SB 2EDTA 5JTWA 3QUZD 5BV7L 1IC4H 5I73B 2W81C 1WFIA 2N59A 5HI4D 4O2EA 1ZOXA 3GSQA 5LGHH 1OP4A 3BGMB 3SO3C 1I1AA 2IH3B 1E5YA 4Y1SA 3O0LA 5E2UH 4KK5D 1TOXA 3GYRA 3MLXH 4UU9A 2EIEA 3UTOA 1ZA3A 5I15H 2WIIA 3UIZA 1GGUA 3PWPE 1U3NA 4LLUB 4NIYE 4E0RB 2XI9A 1QZNA 4JKPH 4H1LA 4RMSA 2VDPB 1X5KA 2XG5B 3CK0L 2FYYA 3DO4A 5L4IA 4ZO6A 3OJ2C 4K7PY 5BMFL 4K9JA 2X4UB 2P80D 5IMMA 3QK0A 2D4DA 3RVTD 5I74B 4KKRA 2X12A 2AK4E 3EUUA 2NUPA 4QIRA 1KCUL 4QHLA 4ZFFA 4AKPA 4YX2H 2ZUWA 3GWJA 4PJAA 5D1ZA 5KSBF 4IOIB 5GGRA 4NXSA 1CLYH 1KXTA 1EEYA 4QRPA 2W07B 4PJ8A 2KH2B 2PW2A 3DUUB 2J57A 3OB0K 4HUMB 4YN3A 4GMTL 1XQ4A 2X38A 4Y2DA 4A2LA 4Z7WF 4Z5RA 4X8JA 2WJ7A 1BXAA 4AQ1A 3KXFB 3RZCC 1ES0B 1UT2A 5KSUB 3OJMB 1RZGB 3VXNB 1JF5A 1SDAB 1RLBA 2UZYB 3BFWA 3GSUA 4WJ5B 1OTUD 4Y0GA 5I8KH 4CC0A 3L3KB 1LEIA 4DGVL 1PIGA 3N85H 5AW0B 3V4LA 3TN0C 5EORL 5I5MA 4PJXA 2EUXA 5DMYA 2DQFB 2DY2A 3ZMEA 3CUPA 4JRXB 3BD5A 2DKUA 2FSEB 4DESA 2YRLA 3O6LH 5FGCE 5ENWB 1A7QH 5L2KB 1FYTD 4G5ZH 2WOBA 2OXGA 4Q9QL 4B50A 3NSCA 2GC7C 2DQUL 2CMRH 4U33A 5F7HA 5KS9E 5DEGA 2B59B 4LLYA 3D69A 5F70A 1HVXA 1OLZA 5GJTH 5MEOA 4I4WB 3VWKA 4WKZA 1TEYA 5D7HA 4AYMC 5KVDE 4F2MA 3P77A 1WTGT 5D96B 2CLRA 5ANMB 4HGWB 2FO8A 5ABDE 3SGDH 1LHZA 3SYCA 3OZKA 5FGBC 4PRAB 3TBYA 2NSQA 1NC4A 3MUY1 4IU2A 4NJ9L 4ELMB 1NMBH 4H8PA 3H85A 2XQYG 4HK3J 4YXKL 3O45A 1P6AB 2EILB 2G9HB 4RZCB 1LP9B 1RFDH 3DV6A 5F72S 4NZDA 3T71A 1JXFA 4KRLB 1ZVNA 4PRIB 3U9PL 4QRPE 4DEUA 3S35X 2WXGA 1F90H 1JGVL 2WNXA 5TQ0H 3D33A 2V8MA 4TQEL 4Z0XA 1JZJA 3ZYZA 1AGBA 4UNUA 1MCEA 2NY3C 4A7SA 5E56A 4M6AA 3KYNA 4PJ8D 2OL3L 4F15C 1BZ7B 3SKJL 3ECBA 4XNXH 2WMPB 4RBPH 1JTTA 5HPMA 3NJLA 4RWYH 1BWMA 4ERSL 3K80A 1E4WL 3QG7H 4OD3L 4Q0XH 4I18C 2VT0A 3RKDD 1HHKA 1XGRA 1NCAH 3D50A 4PG9A 3A4EA 2H9GA 4QRTB 3JUYA 3DIFB 3AM8A 3EBIA 5B21A 3T4AB 1XF2B 1DSFL 2VLJE 4A37A 5EBMA 2IDFA 2ESVA 3ZTNH 3K4AA 5KVGL 3O41A 2QADB 3LRHA 1XGZA 5EC2A 3V6OE 4Y7MA 4KI5C 3W9EA 3BHBA 5I9QC 4X6CF 2MMXA 1F6FB 3G6JA 2M8XA 1QI4A 4NRYB 5ITBH 4YDVA 4AYSA 1PG7W 4KI1A 1B4JL 4PRID 3DYMA 5MP6H 3UERA 5INCA 2UV3A 2XXMB 2UY6B 1BYOA 4L8DB 2HUEA 4M8RA 3WKMH 4P04A 4NDMA 4KVNL 3MOQA 2GT9B 4LFHG 2VDMB 3FCSB 2NXYD 3MUJA 4XN8A 1HOEA 2H32A 4A7UA 4FKHA 2E9GA 5JZ7C 4FQXA 4UB0L 4E9RA 4F7TA 3QPXH 3HMWL 5I5RA 1GZPA 5EB9A 1IARB 4MCMA 3U7AA 2YKKA 1AOHA 4GSDH 3OJVC 1MHEB 3QQ3B 2MEJB 2Y23A 3DXAA 5FM4A 5HXMA 1ZHKB 3GMNA 1HDMB 4XBGA 4M5ZL 5CP3H 4OZFH 3TBYB 1RZ7H 3T2NL 4EN2A 5JYLA 4EO5A 3Q44A 2RD0A 2GJZB 1P7KA 1IB5A 3US0A 3OVUB 1I8AA 3JWNC 2LAAA 2CLZB 3FT3B 4KMQA 2VDKL 3EF4A 2LLNA 5IBLC 3UTQB 1GGCL 2OMYB 4W4OA 3BEVB 3GMOB 5MEND 3S37H 4AEEA 2VLLA 3C6LA 1HWGB 1KCSH 2EP6A 3MJ8B 3NAAL 3I50H 4K3GA 1DBML 3GC3A 3CFQA 4BFOA 3VXOB 4M6OL 4G8IA 4AIOA 3SGJC 1SYVA 2WSKA 2W5PA 3G08A 5L88L 3FCTB 1TU2A 1A3RH 2ICWA 2UWEF 3ZT6A 3EZ8A 1DQLL 4MKMA 1YECL 1RZJC 3NFSH 5JIIA 4CGUB 2C1PA 4HBCL 5IT2H 2WINB 3ETBJ 3DUUA 3SDCB 2CKBL 1ET8A 5I1DA 5TE6H 3FHAA 4KK5C 4GG8B 3FUIA 3ELAT 1OIOA 2IGTA 4XAWL 1DUZA 1KJ3H 3K1KC 4WEBH 1BFOB 1O6VA 2BP0B 1OHZA 4K5LA 4M7LH 3P0VH 4WFEE 1LEIB 4HJEA 4S1SL 4MFHA 4Z9KB 3IFLH 4M61A 3B9KC 3LSOB 5F7EH 3ECQA 4MNHB 3BGAA 4HEPG 1I1FA 4S1RH 4WFGD 2BCMA 3CBRA 3ATEA 2DIBA 4RIRA 3WE6A 2CRZA 2YXWA 1A4JA 4OCRL 4WI0A 5D72L 2X4OA 1QR1B 1G0YR 1KLUA 2VMFA 3ET9F 3PUUA 4N2HA 3RJQB 4BFIA 1BQUA 2VXQL 1FO0B 1AR1B 2O5NA 4XO9A 3UXFA 1RSYA 5LN4A 4B9YA 3QFJA 3IFPA 5D71H 4FTDA 2QVTA 1ZTMA 2FHCA 2ED8A 4MJ2A 5IV2A 2GJRA 4M93B 1ETA1 1KTDA 4LQFL 3QIUD 4LEOA 2NY6C 2VOTA 2JKIS 2A1WL 1T89A 3WEBA 1SEBA 1DN0A 1WAAA 1KGXA 3K7UA 2EDEA 2XN9B 1FIGL 3MA9L 3WY1A 1Q0XL 3CHOA 2FQDA 4ES9A 5DHVA 1OTUC 2K6ZA 1IAII 5I6LA 4PJHE 3FCSA 3KM2A 3CFJA 1RU9L 4AEIL 3C5XA 4UMGA 4I87A 2ZSVB 1JZ2A 2Q10A 4OLYH 2IH1B 3P73A 1AQDB 4H0LC 5ELIA 4P23C 4J4PC 3UROR 2YC1A 2W60A 2R0LH 3T0VA 4NZFA 4N86A 3NGBC 1H5BB 3EH4B 5ES4B 5LBSL 3SDDA 1ZGLA 2DDQH 4GAJH 1HDMA 4PQXA 1XCQB 3D25B 4OZHA 2H2SD 1FZKB 4I5BB 1TQVA 3RVWD 3K4ZA 5KBLA 3DUSB 2TSBA 1J1OH 4ZUUB 1E28B 4YE0A 5DRWB 3V6ZA 1SBBA 1WA2X 2DWDA 2HH0L 3OWRA 1CGVA 1L3NA 1E2WA 3BIBX 4NGHL 1KXQA 3L13A 4H25A 5IHUH 3NRQA 3VQ2C 3FT2B 3FU6A 2IANA 3PDDA 4BFBD 4NRXB 4NOBA 1OT2A 3ISRA 1DBKL 5KVDH 3ZR5A 5C08B 2BP8B 4OBSA 4ZMZA 3FQ4A 2YARA 1DVFC 3BVDB 3EUDA 2HVJB 4G2AA 1I1YB 5C09E 1L4IA 4CDHA 3MLWL 3TT1H 4FP8H 5CZVL 3EYQD 4F5CA 2G9HA 2J20A 4OZIF 4JFFB 2PP7A 1QYGL 2H45A 3G6DL 2WM0A 3VGGA 1XHHA 5F0MB 4E42A 1EEQA 3BPCA 5E2JA 1NM9A 4AIZB 4MB4A 2FLRT 4TNEA 5D7JD 3LS5L 1R5WB 1AFVL 5JA9A 5L8KB 2F53B 1LDPH 2Y3AA 4N0CD 3UIYA 3VI4E 2EIBA 3ESNA 5DUMH 5CKAA 5EZPA 3ZLQC 2JKRM 4F20A 5I76A 4NKDB 3IGKA 2EE2A 3LPWA 5E8OB 4LVNC 3U25A 1JWUA 1XR9B 3C08H 3VXQA 4MNGA 4J3OH 3HC4L 4FFYA 3PHSA 4KVPA 2NW2B 3HW7A 4UT7L 2VDOH 5GXBB 1IE5A 1EDQA 1IEAB 2HXAA 3V6FA 3JV6A 4IDLA 3RL2A 4MVBD 4XVJL 1OSZA 4JPIB 2IAAC 1RI8A 4BH7B 4K71C 2J5WA 3ZK0A 1AY1H 3CFNA 3HTLX 3SPCA 1ASOA 1TXKA 3H9SA 4UAHA 2YD9A 3CFKB 4MNQA 4WWOA 3TO2B 1I3RB 1CE6A 4KKBC 4PVBA 5LQBL 1X4ZA 3VGAB 2GUYA 1FSKC 1QSFA 4LCCA 3WUZA 1DN2A 3UJIL 4IU2B 3VDCA 4KI5E 1ZSDB 2VUYA 2M26A 3W5NA 4JRFA 5I1CH 1Q9LA 3ZYIA 2QSVA 4AYDC 2AXWA 1OAXL 2DN7A 4ENZA 5DJ8B 1JTPA 5BV7H 4KXCA 1SYSA 3CFDB 4OF0A 1VGEL 4LCUB 1GCYA 3WDHA 1CFNB 3RHWF 4W68A 4F37K 3MJ9A 3SDYL 2GPZA 3HMXL 4ZW3A 4EIBA 5J11C 1E50A 3HUJA 2J12B 3IDXH 3QDGE 4JKLA 3VGDA 2E6JA 5JPMA 2Z31A 3AG4B 1M6UA 4BA8A 3GLZA 4OJDH 2R2HB 3AWGA 3LH2H 2YFNA 1AQ8A 3RI5K 1BQKA 1QZ1A 3H9HB 3MGOB 1OV8A 4LCIL 1OZTG 1XXFC 1SXCA 3D09A 5IQ9B 5H35B 5ALCL 1FA4A 3NGBB 3SPIA 3NCBB 4PS8A 3ZMRA 1AHWC 1U8OA 1QFUL 1FL3A 1UVQA 5IVOA 2NNRA 1DQJA 1R3HA 1GY1A 4ONFL 2E4FA 4ORGB 1ACYH 4H20L 1XT5A 4F93B 5JOFA 4Z7QB 1IGJB 4U3XA 3G6AA 5DFVC 3H42H 2CLZA 2EVJA 2HFTA 1YYLL 1NH6A 3H1ZA 3G5VB 3FDWA 4GPVA 3BAXA 1SMOA 4FNLL 3W57A 3G7TA 3QQDB 1C8QA 1DSYA 4QKTA 4ELDA 1E9PB 3AWEA 4HMEA 1INDH 5EIIB 1VADB 5TE7L 3THMH 3EJZD 2WBXA 2CDGB 3OKLA 4EN3B 1T03H 3QNZB 5FOBA 1M7IB 3S7GA 1FGVL 3QCVL 4P9HH 1AE6L 2MQ3A 3FBQA 3NSYA 1ZVSB 2UYLB 2MNWA 3N85L 3IGAB 4Q4EA 2WVVA 2CKBB 1AP2B 2V2TA 4X83A 4D0DB 1AS8A 3ZE1B 2ZWKA 5I1DB 1DDHA 4V1DD 3BQUA 3BAWA 3SQOL 6TAAA 1ZS8A 4N85A 3GXDA 2BIPA 4M5YL 3JWNG 3K8MA 3MYJA 4J23A 5T1DL 3T65A 3BVVA 1OK8A 5CS7A 5F1NB 4NQXB 5GS1B 2DQUH 2ENYA 1FO0H 2JXMA 2ZOKB 4Z7VF 2Z93A 5HDBF 4Z7NB 1WZMA 3VXTB 4KTGA 2J8OA 1HNFA 1AGFA 3ZT5A 3KR3H 4EZLA 3CPLB 2OBGA 2W60B 5B3JE 3PP3K 2NT0A 4PBWD 2WIIB 3VXUB 1UADC 3TURA 1NCHA 2HVBA 2N1KA 5DZ9A 1MWAA 3W9DA 3HBPA 5DJ8A 1S5IH 2OW7A 4KQ4L 5AYUH 2M1KA 5CD5C 3EJQA 2X4SB 2XWXA 2HJKA 3ILPB 4LSRH 5EU6A 3GHPA 4JY4B 4NQSB 5EZJA 1P1ZA 1RFDL 4P2QE 4H0GA 4AYFB 1TPXC 5IJVB 4N2GA 3U1QA 1CQYA 1E4XL 4WRLA 4HX1B 5HI3D 2F54A 2AS5M 4LSTH 2EH8L 5F6IC 4WIQA 5K59F 4LB8A 5GGTL 4QHUB 3F7VA 3FQXA 3ENEA 1I8LA 1S7SB 2OV0A 3GZQA 2ENQA 3I84A 2PR4H 4NC0B 5DHMC 4UT9L 1T6BX 3FQWB 1THAA 3ARPA 5DC9B 4P2OC 1TPXB 5KTEL 2Z8RA 3SKJH 3Q9QA 4E42B 3GFUA 1JPGA 1FL3B 4U1MA 2ZZUT 3E6FA 3DV4A 4U1NB 3D08A 2XWTB 4X7TA 2A0LC 3Q48A 3FF7A 1NICA 3WMSA 1YY9C 3L9RB 2J55A 4D9LL 3HN8A 4M61B 2A6IB 3P0YL 2NQ3A 4FFYH 2B5IC 4IBSA 3G9AB 1YRKA 5GS3A 5IQOA 4W9HC 5EC1A 4JN1H 2LFEA 3LXBA 1GGTA 1NSNH 3ZTNL 1FLTX 5K1NA 2NY7H 4AGPA 5FW6A 5D1QD 4XMZA 5E1AB 4HPHA 3BVUA 2HWZL 4FHJA 1S7XB 4XVSL 5IESL 3G04A 5FKPB 1P4BL 3FTXA 1KXVC 5AAMA 4HQQH 2CR3A 4N2DA 3N43F 1BIIA 2VSCA 1GGIL 5MP6L 5F97E 4FX5A 2CE6A 1SQ2N 1N9PA 4R26L 1S46A 1UXWA 3EJUA 5C2BH 4YHPA 4Z7VA 3ALXA 4J4PA 1USZA 1CS6A 3DJRA 1LP9A 1XF5A 3SDDD 4KUZH 2XN9E 3QIBC 4UB0H 4HKBB 3GSWB 4GQQA 4G11A 3SBWC 1W72H 3X1FA 1JK8A 4JG0H 5IK3B 1MFBL 3K72B 2ERJB 2NY3B 1WCBB 4JM2B 1A6TA 3EXJA 2QQNL 1EXGA 4M5ZH 1RZ7L 2IOOA 4KQ3L 3W39A 1MIEH 3MOBL 1X6NA 3MV7B 2IWFA 4EZJA 4MNQB 2B59A 3FFDB 4LLYB 2VDKH 5E4EC 3UG4A 4P99A 3IMTA 5ID1A 3SHSA 5KSAB 1UJTA 1Q38A 4R9HA 3T08A 4Z7QF 1CD1A 4X5RA 1E9OA 4ODUB 3NAAH 5AALA 2WWKO 4I2XA 3ZHLA 3BKML 5T1MA 1J8SA 4HIIB 2OX5B 3ULUH 1QBML 2A6DB 5JIQA 2YPVA 1GYVA 2DQDL 3FQWA 5HD8D 3G5VA 4FCHA 3BVNA 4DF9A 4HBCH 3DXAE 4FXTA 5CN3A 5IT2L 1MSPA 2A4EA 3DTXA 4FQLH 4Z7IA 2ADJA 2YGNA 2OYLA 3UC0L 5HVHC 4YDLB 1FYHB 4H8VA 3KXFE 1WD9A 4R4FH 3E1F1 5H8DA 3T0WA 2XKNB 4XAWH 1ZGLP 1UCTA 2DH3A 3D3VD 4HZ1A 5BZWA 5AQ0A 3UZVA 4TQ8A 1GZQA 3GBDA 3K2UH 3TPUB 4JREC 3U1SH 1P4LA 3ULSA 5T1KA 4JGJA 5D8JH 4QT5B 3OGCB 1K2DA 3TYFB 3BYTA 5IQLA 2PO6A 4UANA 3ZIMA 3D07A 4CRPA 2W80C 4J8RA 5BZZA 1IQWH 1B0RA 2HJFA 4HD9A 4EVNA 1IGCL 4JZOB 4KTDL 4FLQA 2E7BA 3NJJA 4FMFA 4FKEA 1YEFL 5EU4A 1FBIH 3RUGB 1L9RA 5BOZG 5FAAA 2Q76A 2NLJA 4XNQA 5D1XB 4PRNB 3HB3B 1GSMA 3KEHA 5EF1A 1ZIBA 1EZVY 5J1SC 1QSFB 4FQHB 3VUAA 2CJ3A 1XD0A 3SKOB 3ESVF 5LXGH 3O6FD 4HWBA 43C9A 1NKOA 1ZEAL 4ABWA 2OJZL 2Y22A 1T7VA 1ZT1B 1OOWA 2QFPA 5DS2A 3O9WB 2F54E 5BVJB 1FAIH 1YNTF 4FQJH 5E6YA 4R7VA 1Q0XH 2NY1D 1MQ8A 3ILDA 4AL8H 4MSWB 3JV5A 5B3SB 1OP9A 3HAEA 5LGKA 1XF1A 2VM3A 3TX4A 4S0HA 3DOSA 2VLKD 3IGAA 3FRPA 5KZCD 4RQQB 3AADB 3QUZB 4HKBA 1M71B 1BEXA 4MHHI 3JT2A 5EBWA 1TKWA 2WXQA 3FUHA 3FHEA 2R0LL 5INCB 2KL6A 4K3DH 2PCPB 2XZQH 2BDNL 2ALWA 2V6HA 3QUHA 2NY4B 4K73A 4PV9B 4YHYC 3CJJA 4KK6C 5I8OL 5I1GL 5CJOH 1D5BB 1E8XA 1QEWB 5FCUL 1F4YL 1TCRA 4AH2B 4M1DL 4ODSL 4R0LC 3A47A 3EG9A 2PP9A 5B1JA 4HS6A 3SGKC 2LT9A 5IBUB 5A2FA 1DLHA 3DX2A 3O2WL 3SO3B 3TVMB 1CXLA 4AC4A 5FHAH 3MGTB 3GM0A 4HC1L 3LN9A 4L1SA 4WWPA 3KPOA 2XFXB 3C6SA 4NHUB 5BRPA 3D34A 3CZNA 1BEYH 3S35H 3P3TA 4XRCA 2F19H 3HE7A 5D2LB 1LMIA 1ID5I 2FE0A 3BX7C 3ILPA 2NTFA 1DZBA 3T8MA 1QPPA 4NP4H 5JW4M 1MCKA 1G7PA 4OFKA 1H8SA 3TV3H 1YMHB 1G6RL 3F7YA 4S2SA 3T4YA 2H1LM 2CO2A 5L6YL 1X44A 3BEWB 1O7VA 3RX9A 4UI2A 2FGWL 3EOTH 3PJSB 1V7ML 2IFFL 2WQSA 3VXOA 5F96H 3VFMB 3U9UB 3G5WA 1OAYL 1TZHB 2R7EB 1URLA 5TDPA 1R3JB 4QY8B 4J3OD 4CN1A 1YYML 4P2OD 4JQXA 2FZ3B 4JFDB 4TVSa 4FAAB 3F58H 3F84A 4TSCH 2G5BA 3FQUA 4M62H 3MYJB 3T65B 5FEBA 1HWWA 4G42A 4LSQH 3KPNA 3EDKA 4Q9RH 2A77H 3EDEA 1QRNB 2KHAA 3QNXB 1WUZA 2D7QA 2B8OT 4XNQB 4KMLB 3AS3A 1BFVH 3VI4A 3ZE1E 2W59A 3OMZA 1YEEH 1CL7I 2DJ4A 1Z2KA 3MBWB 3SY0A 3RWGB 4Y5VC 4Y16D 2F18A 4AGMA 4Z0BL 4HXBH 2Y5QA 3K72A 1Y1UA 4TLKA 5DEGB 3OL2A 4ZPVB 2EO9A 4U6YB 3MUZ1 4KRMB 3NZHH 4JY4A 1VGEH 2NY1B 3I74A 1FRGH 4IIZA 4IRZA 4KXBA 12E8L 3NABH 4ZQKA 4Z77A 1PD6A 2DWDB 2YA0A 3SQBA 2FR4A 1J7VR 3ZT7A 1NL0H 1REIA 3T0ED 5JIMA 4ODVH 1DJHA 1TJIL 3PL6B 3FU5A 2CBPA 1I8LC 2BCKA 5DVLA 1HU8A 2H41A 3GKWH 5I2IB 1XSJA 3SCMB 4KK9D 3UAJC 4ODHL 5CBEA 2R56H 1A66A 2EYTB 4M3JA 4G7YL 3REVB 2XWDA 4WEUD 4WQOA 4U1SB 3MJWA 3NPZB 1FVDA 5H37A 3SDDC 4HF5H 4QD2E 1PQZA 2VR6A 1QBAA 2EC8A 4KZ0A 3HS9A 1BYNA 2VIRA 4ZO9A 3L7EA 3IDIB 3WTSA 3BP7B 4XI5D 1XGTA 2YD0A 2YUXA 1KYUA 5D7JA 4APQC 1CQKA 4GP8B 4KROB 2ROXA 3N50A 3R4RA 1AQKL 1GHFL 2OP4L 1WQVT 3MCYA 4NUMA 3R7RA 4P5RA 2JJSA 3MNVA 2OFQA 4KMTL 2ZCLH 3MBEC 2NZIA 2BY1A 4XP5L 1AGDA 1J18A 5I71C 4ONFH 4XPBL 1MRFH 2ICES 1KWKA 1J8KA 1R46A 1ZHBB 3B34A 5I0XA 2XZAH 3ECBB 3CXHJ 3DUSA 3GB7B 3LDBB 5CLXA 4XMKL 5K39B 3OHMB 4HWNA 4LOVA 4X7SL 1G0DA 3TYGH 5F1SA 4IMKA 5I6PA 5FYLD 5AKVA 4M6NH 3RWHB 5TE7H 1NA8A 4QGYA 5I8CB 1DUYA 1LGVA 2WLZA 4O9HH 5DU7A 2YGOA 1T03L 5F7KC 5C08A 5ACMA 4AIXA 5CMAB 1KY7A 3JWOC 4N0RA 1FE8H 1BPVA 2JMRA 5HHPB 1V05A 4IBTA 1QSEA 2O30A 4KH9A 1BBDH 5CWSA 4QWWC 2A9BA 3QDMA 4NB7A 2VMEA 1ITCA 1U58A 3WY3A 4BV1A 3ZDZE 1Q94B 5HI4C 2BWDA 4S0SD 3DPBB 5KVEE 1EXUA 4POZD 4BZ2A 3MLSH 2ZKXA 3GSWA 1JGEA 2ZNXA 3FTGA 4P2AA 2G75B 3BWAA 1SGKA 2Z31B