1M6UA

Crystal structure of a novel dna-binding domain from ndt80, a transcriptional activator required for meiosis in yeast
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
265
structure length
265
Chain Sequence
FKVGPPFELVRDYCPVVESHTGRTLDLRIIPRIDRGFDHIDEEWVGYKRNYFTLVSTFETANCDLDTFLKSSFDLLVEDSSVESRLRVQYFAIKIKAKNDDDDTEINLVQHTAKRDKGPQFCPSVCPLVPSPLPKHQIIREASNVRNITKTKKYDSTFYLHRNHVNYEEYGVDSLLFSYPEDSIQKVARYERVQFASSISVKKPFQQNKHFSLHVILGAVVDPDTFHGENPGIPYDELALKNGSKGMFVYLQEMKTPPLIIRGRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ndt80 protein
publication title Crystal structure of the DNA-binding domain from Ndt80, a transcriptional activator required for meiosis in yeast
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription activator
total genus 55
structure length 265
sequence length 265
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-07-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1390 Mainly Beta Sandwich Immunoglobulin-like NDT80 DNA-binding domain 1m6uA00
1M6UA 2EUWA 1MN4A 2ETWA 1MNNA 2EVJA 2EVHA 2EUXA 2EVIA 2EUVA 2EVFA 1M7UA 2EUZA 2EVGA
chains in the Genus database with same CATH superfamily
3MBWA 2BSBA 4YSRA 3F5WA 1YNKH 3BPCA 2IQAA 2K9UA 2W92A 3QJVB 5ENWA 4JRYB 1VFOA 3ESPA 3QUMH 4P5KA 2XU9A 3MJWA 1WPCA 1EXHA 2VDOB 4XBEH 1X44A 4LAQL 1XBDA 4IRZL 4MZ3A 4RMQA 1MFEL 4KXAA 1EHAA 4RZCA 5DEZA 1BXUA 1VGEL 4YS4A 4YQXL 4BGDA 4FQXD 1MWAH 3WTTA 2EDBA 3KJ6H 5GPRA 2C7UA 4HJJL 2AJ3A 1PPIA 4AIZA 5H4ZA 4Q52A 3VXRE 3CAFA 1FO0L 3CUPB 3DJ9A 3U7WL 1RZ7H 1KXTB 1MEXH 4WTQA 2BVPB 1F2XK 3GXNA 2EDXA 2Z7WA 4HJ0D 4ANWA 3KYMA 5FO7B 5AOKA 3JTBA 5GGRB 5GGVH 4MS8C 3ABGA 3RIAK 4LHJB 4PJCB 4HC1L 2WNKA 3I6KA 4WO4A 3T3PF 1YO4A 3QR1A 4UINL 3O4LD 3LYRA 5I24A 3BQUD 1F4HA 4BA0A 3RIAF 3EXJA 4Q4IA 5FO2A 3Q01A 2YSTA 2HWZL 5A3IC 1CFVH 1N67A 4KKLD 1O5PA 1D5MA 1DBAH 1OALA 1VSCA 2FWSA 2PTTB 3FSAA 5L0QB 3BH9A 3QHTC 4CU8A 3T0DA 1JHLH 4PJFF 2VABA 3B2XA 1MLCA 3TV8A 2GJZB 2NY0B 3BRFA 2XV3A 4OZGF 3LIZH 1MWAB 5MENA 3Q3GB 3FN9A 5CXPA 4G9FA 5I8KH 3CIAA 1KTLA 5DO2C 1P4BL 1OTTD 4H5SA 4JUTA 5EBMA 2HZHA 1DBMH 4X6EA 2W80C 2D3NA 4XB3A 3PFUA 3Q6FB 1V10A 1GJIA 2HXAA 5D5MF 2A9AA 5I8EA 4AXWB 5I1KL 4OQTH 1TQCB 1L7IH 1NGPH 1T83A 3ZXAC 3HG4A 4H88H 2Q8AL 4XVUC 4S1RH 3I6SA 1FFOA 3N85L 5FM4A 5GZOC 4UQDA 4NERA 4OIFA 2WB7A 3KPNB 1JZ7A 3SOTA 2CRYA 3GRBA 3ULVC 2R29A 4G1EB 4F5CE 1A14L 3FB8B 1AZVA 2FEDC 2G9HB 3VNZA 4X6DB 5E9DD 3PJSA 2G3XA 1SMAA 2L3BA 4OCWH 4XMKL 5BMFL 1Z5HA 2XICA 3DK2A 2VDML 1N8ZB 1JV2B 4HUUA 4G8IA 4F7CB 5I0ZA 2W65B 4LF3B 3VGHA 2ZX7A 4UBDD 5IW1B 2XV6B 3BLBA 4CBZA 3GIVA 4M5YH 4JRXE 2PYEE 2WBJA 5K39B 4KHTH 5EZOL 2NCEA 5GJSL 1ZLWK 5BJTB 4PRHE 4XX1G 4FQ1L 1IGJB 3WI9A 3L7EB 1KT2A 3R06B 1EDHA 2BP3A 4FYSA 2WLJA 1AP2B 3Q5OA 3QXUA 1NLDH 2OTUA 1VFUA 1PDKB 2DQDL 3T4YA 5KVGL 2ENJA 4QTIH 4WFHD 5FW8A 4RGND 4Z7NB 4NQDD 4ODVH 2E7BA 1A3RL 1U8LA 4CC0A 5F7HA 5DDHB 3A6OA 3NG5A 5AYUH 3VFNB 4AEHH 1FA4A 3T2NH 4Z1PA 4P06A 4N8VA 1G0YR 3KW7A 4H26A 4HUWA 2RJMA 2NY1B 4NDMB 2WOYA 3RIFK 3HMWL 5IMOB 3CFKB 2EH7H 2J4WL 4F9PA 4TRPH 1UJ3B 2EE6A 3CQPA 4RQQA 4ABQA 1XGUA 4X9FA 3BGMA 4WI9A 5C0FA 3IPFA 4AUUA 1WO2A 2YD7A 4RGMB 4X4ME 5I76B 3S8WA 3O2DH 3ISRA 4GI8A 3RWIA 5C3IA 2X05A 1J9SA 4L9DA 5D2LA 4F57L 4PRHB 5FLUA 2BC4B 4HA1A 5DQ9A 3VQLA 4AM0A 5AW7B 1EJOH 4K3JH 3WENA 4OQ1A 1BZ8A 2EDYA 4NCC2 1KGYE 1QZNA 1XFPA 4N2MA 2FZ3A 3RPBA 2KUTA 1SYSB 2FNBA 4KKAC 3WMQA 2B8OT 2VDRB 3DV6A 4JB9L 2R7EA 5B7MA 3QWOB 1G4MA 3KBEA 5GGTL 1D3CA 2OK0L 2CBQA 2YA0A 5FAAA 5K5YA 2JIXA 4Y5YA 2C34A 4G8FA 4BJLA 2XKSA 3P77B 4WI0A 2JB5L 3H9ZA 4JHWH 4NQXB 3DBXA 1Q9WA 1IZKA 3V6OC 5ITFB 3DYPA 4YGAB 1NAKH 5I0YA 1FRGH 2GTZB 3UTZB 1D9KC 1CO1A 4DP8X 3TPUA 4I8DA 3T0BA 2OL3L 1M6UA 4RSYA 1N0XH 5DEFB 1N7MH 1R1CA 1TENA 3JVFC 3QIUC 3WJJC 1I1AD 3M7OA 2CLZA 1FHGA 3CXFA 3MRGA 4XCNA 3CBRA 4Z3GA 3W5NA 1SLWA 3PWVA 5ICYA 4P05A 3ML8A 4JJOA 3SN6N 3G9AB 3PE9A 2HT4C 3N9GH 4XBGB 3ZTJG 1ZGLA 3HW7A 3SDAD 2R2HA 4JVWA 4Y19A 5GSVA 3TJHD 3HAEA 1SEQH 2R2BA 3IFLL 1K2DA 5T5NG 2DI9A 3DIFA 3SBRA 5IFJB 1SHMA 1AS7A 1B0RA 4M43H 4P4KA 2W1NA 4ISVB 4WI2A 4R90H 1HH9B 1MAJA 1WFIA 3MRDA 4ZFZA 1NBQA 3ULAB 3C5JB 2H2PC 3N1FC 1NDMB 1KCRL 2A74B 1CDIA 3DX1A 5IEKA 2V5TA 2A77L 2XY2A 2QVMA 4UANA 3V0AC 3MROB 3ARDD 2VO8A 5ACZB 1OF2B 2Y2YA 4J3XA 1UD6A 3DHPA 3MGOA 4GXVH 4U6YA 1JVKA 3S3SA 4D7PA 3SCMD 2F8IA 4EQ3A 3EYQD 4ANUA 2OQJA 4PY8I 1JD9A 3RWFA 4CSSA 4KKRA 3F62A 4A2FA 1GH7A 1AD0B 3FONB 4GIAA 3OG6B 3V9EA 35C8H 1IKNA 2P8PB 2IDSA 3OKDA 1YY9D 2FR4A 1EVUA 2DQEL 1F18A 2AK4B 2E9WA 1ZVYA 4U1KA 5AL8A 5GSRB 4P57A 5IMKB 1HEJC 2O61A 2GKIA 2V5SA 2BRRH 1GW6A 3EFOA 3VI3F 1VJSA 1IJ9A 4MJ4A 5ID1A 2I9LB 1G9NC 2KS0A 3P73B 2CIKA 4FQXC 2ROXA 2ITCB 4X4ZA 4CVXB 1J5OH 3BE1L 4WAFA 1BGXH 3MA7A 5K9KA 1A7QL 1U2HA 3ZN6A 4J4PA 3HC0A 1OW0A 4KVNL 5JYLA 2CDEA 3IJYB 3U0PA 4I3GA 3VSQA 2CDGA 3TBSA 5LN8A 2QBWA 5LWYH 4OW6A 5HI3D 3IVKA 2CKNA 1L9RA 4HJ0C 1KLUA 2UV3A 1IAII 2EECA 4RAUA 5FGCE 2VDPL 2NY3C 3VM5A 3QH3A 5FF6A 4UIKL 4UM9D 4YOKA 4UQ3B 4PRNB 3RVUD 3BQUC 5JIDA 1V7MH 3BSZA 3KDMA 4NXKA 1WS8A 3DROB 4MNGB 2ICWB 5D1QA 5HGAA 2EDKA 4R7VA 5JORB 2CJTA 1VCAA 5D6DA 4KKLC 3T2OA 2NXYB 4X6CA 5C0GA 2HUEA 2ADIA 2XRAH 5CP7A 3ZDZE 1G6RB 4LCVA 3TESA 1UFGA 3K6SA 4ACPA 3SDCA 2AQ3A 4PJ6A 1S7RB 4S0SD 1HINH 1AXIB 3AXLB 5IHBA 1Q38A 1ZT4A 1UD3A 3VCLA 5E99H 2XN9D 4P2QD 5C97A 1VF5C 3QUXA 4GAFB 2JK5B 3CHXA 4X7SH 4CILA 4IBLT 4GMTH 3UGEA 1XXFC 1OTTC 2BOLA 1YQ2A 4WWKA 5C6TH 2YR3A 3S97C 5IB2B 5FGCB 5ALBH 3S3DB 1CFNB 5I71B 1X4YA 4MA7H 1QFWI 4PJXE 1B4JH 5JUEL 4B96A 5DHYA 3QCTH 2ZAGA 4N2BA 3RRQA 1WBYA 1U8IB 1USZA 1UOKA 4MQ7B 2F7IA 1P6AB 3EZJB 3FUJA 3HRPA 1QSZA 2QVIA 3MRHA 4BUGA 2X1QA 4P5MB 1FUNA 3AMKA 3OAWA 4PWHA 1P7QA 2VDQL 3MRMB 4UOZA 1TJHL 2F15A 3NCBB 1RZ8B 4HOXA 5TE6H 4ZS7H 1OHZA 3VXPB 3W56A 3NK4A 2ADJA 4UBDC 5J1TC 1A7RH 2B4CC 4HIHB 2WCGA 4HH8A 1TZAA 3MLYH 2VDOL 2C9SA 1Z0NA 3JV0A 4X6FB 3ETBJ 5JPMA 1OD9A 5DK0A 1AQHA 4M8QA 3LRGA 1A4CA 4N68A 1LE5B 1E4KA 2Y72A 4MYPA 5FUOL 5IK3B 1DBJL 4JHAH 3VI4F 1UYWL 4H20L 2BFVL 2YD6A 3L45A 4MAUL 1K5WA 3BGAA 1NGQL 4PJXB 5AWNH 3HNVL 4RGNC 5A7EA 3BDXA 2B1AH 2QQNH 1VLXA 3KEHA 1AGBA 3LQZA 1VZGA 4MDJB 4N2NA 2CRZA 4GSUA 2PCPB 1LK3L 3ECVA 5E8DH 2P3YA 1U8CA 1N26A 3L1OH 3PWPE 4JLRB 2HFFA 1IQDB 3QJHA 3IE9A 5KSBE 3KAAA 2IQ9H 3TGXA 5HI5D 1YA5A 1HNYA 1DJIA 2D0GA 3JWDH 5I8OH 4F7PA 4K3HA 3GRWA 3NPSC 3SE6A 4LIQE 2WO3B 3GT6A 5FOBB 4CC1A 2WW8A 2DQGL 2W8CA 4O4YH 3U4BH 3FQ1A 4DWHA 2EH8L 4ETYA 4WCYH 4HK3J 3SDXE 5JLZB 3SJVD 2R0LL 4XVSH 1YYMH 1H8SA 5F1IB 2VLKE 3WSQH 4DVBA 4UT9H 2H0PA 2YSSB 1YNKL 3BC9A 1S7XA 2WWOA 2C4FU 5LAXB 5JHBA 3QUML 4FFYA 5EU6A 3FF7A 1S7UA 1CYXA 1FCGA 4XBEL 4U4IA 3WFHA 3PAVA 4OCYH 4F9LC 1JAEA 1B9ZA 5EEYA 3RGHA 4PQXA 4YDJA 4I87A 2WLIB 4MHHI 3WNMA 4JRYD 3KPOA 3GFUA 1E27B 1SEBB 1T6VN 1MWAL 3K72B 5ACMA 5IVXE 3KJ6L 5AAMC 3PWPB 1Q0XH 4EAEA 2E7HA 3D5OF 1YCSA 1A25A 2X89A 1NOLA 1FSKB 1HOCB 3P69A 3RWCA 3NIFF 4IMKC 1RZ7L 1MEXL 2WLLA 4FQHB 5C7XL 3IDUA 4MKMA 3PXHA 4XE0A 2CBTA 4Y4KA 4BFIA 4OBRA 5GGVL 3ZYOA 3SDXB 2OMZA 1Z5LB 2IH9A 3V9FA 5CMAA 4C54A 1I1AC 4G7VH 4WTZG 3OHXB 1U33A 2JQAA 5CN1A 1ETA1 5E5LA 2H6UA 3EJZD 3EFFA 5C08D 2EE3A 1DDHA 5CN2A 5BCAA 3DX8B 2GIMA 4D9RE 5IR1B 1CFVL 2DM2A 1JTTA 3RWHA 1JFHA 1I7ZA 1DBAL 2Y7OA 3TJHC 2X42A 4N5ED 1OSYA 4TUOA 3WY4A 4R83A 2WQUA 3SKMB 5F7DB 3FCSA 4JFOA 5IVXB 1J9TA 1PYWB 1JHLL 4HZLA 3WE1A 4XAKE 3NABH 4UQIM 5D7IF 3S5LG 1G7HB 2VISA 2NQDA 4NQCA 1MOEA 3LIZL 4G8EA 2X9WA 1A21A 2AJVH 3KWVA 1DO6A 3WTUA 1J86A 1ZIBA 1YPZF 3CN4A 5CSZA 2BNRA 5I8KL 5CJ5A 2VLRE 4IKKA 4N25A 1I7RA 3GLAA 5I0DA 3ARDC 1UATA 5FW6A 4LFHD 3MRIB 4B9KC 3VXRD 4X7FC 1DBML 1KN4H 1KBVA 1KJMA 3NCEB 4W4OA 3SCMC 3EYQC 3RDTA 2OMWA 1J8HE 4OQTL 1TYEB 4JQIA 1L7IL 5IFAH 2X6BA 4DKAA 1NGPL 1CVRA 4QRAA 4H88L 4S1RL 4PJIA 3KVDD 5C2UB 3B43A 5I23A 4TSAH 1NH6A 1YY9C 4DGYH 2W38A 1CL7I 3FUMA 4K23L 2EIKB 5FX3A 2JCCF 5LQBH 4U6VH 4JKKA 1QBAA 4GO9A 4C56A 1VEPA 3UACA 3KPRA 5D2NA 4U0RC 2NYYD 2AQ1A 2A6KA 3GSRB 4KJYB 4OCWL 5SWZE 2K3HA 1QSFE 3EYSH 3KCPA 2DMKA 1PIGA 4XXCA 4WUKH 1W8EA 2WJ7A 3NFPA 4M5YL 5CN3A 1MAKA 1CXKA 4KHTL 1EPFA 4PPTA 5HI3C 1A64A 4PB0L 5E6RB 5L2KE 1A6AB 4YDIH 1RIVH 2CG9X 3GB7A 4FYRA 2ZICA 1FAKT 4R6UA 4ZDHB 1DVXA 3O8XD 1A1OB 2D2CC 4IOIB 1NLDL 4A68A 4LOUD 4F7EB 1J8HB 4FOMA 4QTIL 1TT6A 2A6IA 4XXDB 2YEZB 3E1ZA 4ODVL 3UTSE 4EI5A 3RVUC 5DVOA 1FHNA 3F7KA 4HUXA 2DQCH 3ZU8A 5AYUL 5CGBA 3T4AB 4AEHL 4JGMA 3T2NL 2F54A 4MWFA 2F2HA 3CC1A 1WUNT 2VMJA 4LCWA 4AYGA 4F1SA 5ICZB 1PCXA 4LGRB 3ARPA 4CMMA 2EH7L 3IU3A 1CGUA 1PLBA 4G70B 4TRPL 3TVMA 5ES4B 4Z78B 4XNQB 2NZ9D 1MCEA 2X0UA 3EH2A 5H35A 2QLYA 5SWZB 4JO2H 4D0DB 1E42A 3O2DL 4JZJB 4CC4A 1LTXA 3HFFA 4HIJA 2ZUVA 3IMTA 2NY5H 1B4TA 5DSCB 2WVVB 4RFOH 4LVHB 2WJ5A 2CQVA 4QGTA 4B9GA 4ELDA 1QW9A 5L2KB 2FO4A 1EJOL 4K3JL 4FEMA 5B8CA 3S8FB 3GTVA 3OKNB 4IEFA 4JRXD 2OXHA 2PYED 5F7FA 1ZT1B 4WHYG 4LLAA 3BW9A 3CG8A 3T3MF 3L4CA 4PRHD 3KPQB 4OZIF 4X6BB 1OT1A 2BP8A 4HAGA 1AZRA 4CBPA 2CBMA 4FZ8H 3ZE2F 2GIYA 4B9FA 2AERT 2DKSA 2WNWA 3HUJF 4PS3A 1J5HA 4JHWL 2QADB 4R4ND 5EUOA 3BRDA 3BPCB 2VSKB 5E00B 2ZXQA 4EMZA 4L5FE 3L95B 1NAKL 4MVBD 1FRGL 1EERB 2VXQA 4YZFE 4CVUA 4FKHA 4XZUB 1C7TA 3FFDA 4JQXA 1GKEA 5I17B 1N0XL 1N7ML 4JG0H 3ESOA 4MZ2A 4U1SB 1PY4A 5HHOE 4GKSB 5DGRA 1ED3B 1TJXA 4FL4B 4YLBA 2MRYA 1HSBB 3VG9B 4I77H 1H6TA 2C7UB 4UYQA 1ZDQA 3BUIA 3KL3A 3N9GL 5DJXA 1LE9A 2B2XH 4DP5X 1EHLH 4BWWA 4P9MH 1C08B 4H0LC 4WI5A 1L3NA 3K3QA 4UYPA 1KTKE 2G2NA 4QXTA 2ED8A 2X6MA 4QTHB 1Z6JT 1SEQL 5D7LB 4I18B 2QPDB 3G5ZA 4ETQB 2D31A 1F90H 3FSWA 2AJUH 4GSDH 3BZ4B 4M43L 4NENA 4DT2A 1U8HA 2IEPA 3S5LB 4R90L 1KOAA 2FQDA 3UZVB 3BQVA 2FE0A 2GFBB 4WGKA 2R29H 2X4QB 3VXUE 3NZHH 3WHXA 2B7DT 3QPQD 3FMGH 5T3ZH 3KE0A 4H8QA 5JHLA 5LNGA 5JXEA 1MCBA 4PGBB 5SWQA 3UJJH 4GXVL 4A2MA 4PY7B 2BX5A 2L4OA 4DF9A 1ND0B 1ZS2A 3FULA 2VIRB 4ZX3A 4QJ5B 2BY2A 1S7QB 1AE6H 3LKPA 4U1LA 35C8L 4LCCC 1QPXA 1TQBB 4QIRA 4FQCH 4LMQI 5EZLA 2NDGA 4MXVF 1LMKA 3IF1B 4H1LA 3NSJA 2BRRL 4YGVB 2GJRA 1BMGA 3HA0A 2F7OA 1E4WH 3ZUCA 4JFDB 1BPLB 3BVNA 3WU1A 1SLUA 3LSOB 1TMQA 4KX8A 5DJCA 1BGXL 3VA2C 1C8PA 1LLAA 1ADQA 3FH7A 3L4TA 3VXUB 2J5LB 5CP3H 1U8KA 4WHYH 1FFNA 1X3DA 3QI9A 1FFOB 5DCCA 5LWYL 5BZDA 1TSRA 2CO7B 4LNRA 4NKOA 1G43A 2BIOA 2HJLA 2NLJA 5BNXD 3FYIB 1XF1A 1DZ0A 2V7HB 3S3BB 4F37K 1QSEE 3HG3A 3GINA 4YK4C 4XN4A 3EJZC 2RGSA 5IQ9A 1NFIA 2ENSA 4AENA 1MW3A 4F37F 5L8KB 3ZKND 1DDTA 1F00I 1AZZC 3SGEI 2R2CA 1I1RA 2C3VA 2NT1A 3GHBH 4QPEA 4WI7A 5AKVA 4DO4A 4XPHH 3M86A 5JO5B 1H9VA 1KBGL 4TV3A 2XRAL 3DIDA 1L6ZA 1NBZA 1JGUH 3CC5B 1DE4A 1A0QH 4FTVB 4K15A 3MRKB 9CGTA 4WW1B 1HINL 2NXYD 3I74A 5EZIH 4FFTA 4KXCA 3FOMB 4V11A 5E99L 1JK8A 2OSLB 2VRQA 4DSYA 3L81A 3S8GB 4X7SL 1DJYA 4GMTL 3V4LA 3DTXB 3TA3B 1THAA 5C6TL 1N6VA 4U6HA 5ALBL 1LO4H 1Q4NX 1NDGA 2X40A 3GMOB 3N0AA 5HDBF 1QSEB 2DLEA 2A73A 4MA7L 1B4JL 2EEBA 4AL8H 5EMYA 5KVFH 1U6AH 3QCTL 3GBMH 1RZGB 2XWJB 5KS9F 3HPJB 4NFCA 4PJHE 2GTWB 1PZAA 4TPRH 2E7CA 2KQNA 3ZKXC 1T5KA 5DJ0A 3X2QB 5HYJE 1TQCC 4LSQH 3HAEH 3EKCA 3I9AA 2NYYC 2JB6A 4LRIC 4WHDA 2DPKA 1JXDA 4WJG3 1URIA 5TE6L 4ZS7L 1I8IB 4CW1A 4RVBA 3PWLB 1F1DA 4IK7A 1G7MA 4PMEA 3MV7B 1A7RL 3MLYL 5KG9A 5F0LB 2BZDA 2EYRA 3WNOA 1MHHB 2C8NA 3JTTB 2D4DA 5EUKA 3O81A 3AQDA 2WAQA 3EUUA 2IBBA 4JHAL 2HAZA 2Y23A 4L37B 4PJ9B 3O8XC 4QRPE 4H0HB 1KZQA 3GJFK 4GRWF 4LOUC 5AWNL 5LN4A 1N0LB 2P1YA 3MAWA 2B1AL 2QQNL 4L3CB 4NRXA 3WE6B 4RAVB 4ELMF 1JZGA 3LMJH 4IIZA 5E8DL 1S8DA 2Q86A 2BVOB 3L1OL 3G5VB 4WUUE 4V33A 3EYUH 5HYJB 2VKWA 1A4JA 2IQ9L 3ZQWA 2DM7A 1BVLB 2VN4A 1XR9B 3DX0A 3JWDL 5I8OL 2NZ9C 3SE3C 2DL9A 1I8UA 2DDQH 2YN5A 4HKBA 1IVTA 4LSPL 2A9BA 2VZUA 1WCBB 4FQQA 4O4YL 3U4BL 5HJ3B 4WCYL 2BSSA 1VFBA 4XVSL 1YYML 4P46B 1K2DB 3ZPDA 3WSQL 4RGOH 1KTCA 3ATEA 1R5WA 5DXWA 1RSYA 1IBYA 1NDTA 3IXTA 4S1SH 1SGKA 3QZNA 3GGWA 5I1AB 4WZ9A 3SPIA 4QRPB 4XH2B 3MGAA 5ETUB 3SDYH 4NZDA 4OCYL 1ZLUH 3RZWA 4JO1H 5IJKC 2EEFA 1PZ5B 2H8PB 8PAZA 2XG4A 4MQXD 4XPAH 5GS2H 4YBLB 1UT9A 5T1MB 1KN2H 4KNSA 5CGTA 3X13B 3BSZH 3C5SA 4WUUB 5GRYA 4ZZKA 4LB8A 5DHDA 2MHAB 3CFIC 5F9JA 4HD5A 2EJ1A 2MEJB 4LO9A 1QNZH 4R4NC 3CFJA 2ORBH 2XI9A 4UQBA 2D0HA 3Q48A 4TVSa 4PD4J 4A37A 3I6GA 4MVBC 4NAJA 3ZX1A 3NCCB 5FYLE 3K81A 1H3TA 1WG3A 2TRHA 4MB1A 3PWPD 2HVJB 1CUOA 1ZE3C 5E94A 1XL6A 4JL1A 1L0QA 1WWBX 2H6PB 3EGXA 5DJ6A 4BHUI 2C9XA 4XMLH 1OP3K 1CBJA 5HGDB 2YKKA 1EJ8A 4G7VL 4NQVB 1OAYH 4BIKA 5E1IA 3TF7C 5ABZA 2VXUH 4OI9A 3GBEA 3SGKC 4DUWA 2EZ0D 2Z9TA 3VFTA 1A7NH 4QRTA 3BIKB 4GP5B 4P2CG 1JNJA 5BRQA 5D4IA 2VLKD 2CDEB 1K5NB 2VJ0A 1JGDA 4O5LH 1OWRM 4LSSH 4KNTA 4KTYA 5J56B 3GUTB 3R19A 4R9HA 3IAPA 3LRMA 3F65A 5KJRH 3ZKQD 3S2AA 1VERA 3NABL 2ZT9C 3N42F 3QEUB 5EOQL 1KCKA 2NTFA 2HJFA 2LLLA 3CSGA 4FFZA 1FE8H 4WJKB 4H0IA 4NM8H 5TGBA 2NR6A 2AJVL 3OKKB 4JFHE 5ESVB 1G1KA 3QPQC 1JMZA 3PL6B 2EAEA 2UXGA 2F08A 2VDKB 3VYPA 5AW4B 1YN7B 3QUYD 2OJEA 1GSKA 5EO1A 3NYKA 3QZOA 3MX0B 5I6XC 1KN4L 1QTYT 2OMBA 2NUTA 2VZSA 4Z0XB 1FNGA 1YY8B 4AGLA 3BWSA 1B4LA 2FEEL 4XB7A 1P5UA 2NX5B 1O9VA 3O6LH 5IFAL 1KDIA 2C9AA 3PHOA 2DAVA 2UY6B 2AAVA 2ARWA 4J3TA 5FB8B 4PJDA 5DK2A 1VZHA 3EGSA 4DGYL 2WUBH 4YH6A 2HCZX 2D73A 2P7TA 1X7QA 3MA9H 4PJGF 5GRJH 4M7ZC 43CAB 5LQBL 5JDSB 5HY9A 5CJXA 4U6VL 1OOAA 2CUAA 1ONQB 3A6BH 3KYKH 4OZHA 1MW1A 3BKCH 3FQWA 3HS9A 2VN7A 3RJQB 4F80A 2RIKA 4D9RD 3EYSL 2Z35A 3V0EA 2UZXA 5GQBA 3SZ6A 4HLZH 4WUKL 5TFSH 1RP8A 1UCBH 2DN7A 5L9DH 3K5RA 2WZ6A 3VFOA 1MAMH 1DVSA 3MLWH 4O2CA 1KCSL 3PP4H 4N1CA 4XAKD 5TPWH 4E68A 2CM5A 5DHEA 4FKKA 4YDIL 1RIVL 1L0XA 4PJEA 4KHXH 4EEEA 3CXDH 1YG9A 3G6DH 3CSYB 4W9FC 5HJBA 3D2UB 3BXNA 2NOYA 1FZJB 1EH9A 2VLRD 1YNTF 5A2JH 2P4AB 2GI7A 1BYNA 2DQCL 2DEXX 1Q9OA 3F85A 4WWNA 3NSXA 4BFRA 1ML0A 1QLFB 3O0RH 4Y7MA 4FFYH 3TBTA 4MSWA 2YA1A 5EBWA 2AZUA 2ENQA 4N8UA 3ZKNC 5IQ7H 4UAOC 1J8HD 1TZ8A 2HP4A 4NKDB 4PWGA 5F3HB 1HJBC 5F6HJ 1ZHKA 2IAAC 3W9EA 2J44A 1B2WH 1D7FA 3HG2A 3HG1B 5TK4A 3U0TA 1TVHB 1OK0A 2A38A 4JO5A 2CO4A 5E8OA 1JRHL 3JWNH 4FQPA 4JO2L 3VU1A 2J1WA 5EEVA 1ID2A 4YUEH 5FDWA 3BAEH 4BKTC 2GHZA 2EVIA 2J1ZA 4PRIE 3ZTNH 2NY5L 2NXYC 3R7QA 3VGDA 4RFOL 5K59F 5SWZD 3OKOB 1QSFD 4G5ZH 4EUPG 4FTDA 3FTVA 2EINB 3EDFA 4ONFL 3QDAA 4Z77B 3AFLA 3PJLA 2Y4SA 5KANI 5SX4I 5L2KD 4IGBB 1G9MC 1JUFB 4FZ8L 4GEJA 4OAWA 4WY7L 3UTSD 4AGNA 2PCFA 3EYVB 1FV1B 1Y0LA 1JXFA 4E9LA 1AZNA 3Q05A 4D0BA 1T0MA 3IDJA 1IAMA 4H4NA 2IPKA 1A7PH 3RTQB 4PIBA 1RURH 1NIFA 1T1WB 5EZJB 3L3OA 3Q2CA 1GJWA 2OTWB 3OR7B 4FEIA 4P3DB 1W0WA 4JG0L 4PRIB 5E6UB 3UDWC 4WI8A 4QGYA 3FXIC 5B1KA 3LNDA 4ZI8A 5FC9A 3VXME 1U4EA 3QG6A 1XGQB 2NY6B 4I77L 1LNUA 1FLTX 3UAFA 4YE4H 3V0VA 3QXTA 2W91A 2L04A 2P24B 2B2XL 3TFKD 1EHLL 1MI5E 4P9ML 2CJUH 4ZSOA 4BCXA 2UWEE 5IM7B 5J9PA 1KY7A 2XA3A 1U0QA 2VW7A 3UBXG 3L3DA 5J6GB 3X1GA 4MMZB 2YKLL 3MN8A 4JQIH 4G6KH 5EBLA 1F90L 2AJUL 3VH8G 5D4JA 1R3HB 2YC1A 3MXWH 4GBXA 1B6DA 5AQ0A 3AG4B 3EFFB 4P3WA 2D3JA 4U1NA 5D7LD 3H42H 2FJFA 3QG7H 2R29L 3NZHL 1SOXA 1B0GB 3FMGL 3GSUB 5T3ZL 5AUMB 1SXAA 4U3SB 3UJJL 2I24N 1MCKA 1H3GA 2VGLM 3MV8E 3A21A 2FQGA 4L4TA 1XCXA 3MUGA 4PJFA 5EU5A 5I66A 2YQ3A 2C4FT 4IU2B 3TZVD 4I3RH 4NQCB 4FQCL 1EZVX 1JVOA 3M88A 4K94H 4XN7A 3BPLC 5IV2B 5LKNA 3UZEC 1E9OA 3MCKB 3B7RL 1JI2A 2AMGA 2I69A 3MOAH 3BI9X 3QORB 4W93A 3P2TA 5CSZB 4MQXC 4RA3A 1B6UA 4F8PA 1R75A 5ANHA 1FNEA 1E4WL 4BFEA 4YHNA 1BQRA 1DLHA 3ARUA 3IFNH 3MJ9A 3W39A 2FJHB 5D5MA 2DIBA 1KCVH 3CFBB 3UP6A 3QPXH 3VMOA 1VHPA 5BQDA 1UKQA 3QS3A 5BOJA 3OSVA 5JW3H 2IPTH 3NN8B 4G83A 3HC3H 4R4BB 4IIQA 3UIYA 1OSZB 2FLMA 1OGAE 1RJZA 4A04A 3KYOA 3IPBA 1RMFH 1N2RA 4K07A 1PZ2A 1FSKC 1A5FL 5F7YC 4RMUA 3MV8B 3VXUD 3B3IB 3W9DB 3FN0H 1SMOA 4A67A 3OB0H 3MXVH 5IB3B 2EZ0C 1F42A 4HUNB 2O5YH 2P42B 3QYMA 1IKFL 3R4RA 2YA2A 1JWUB 3V10A 3OC5A 3GHBL 1C12A 2IDQA 4XPHL 5F88A 5C0BA 5KN5A 2BXZA 4E9RA 3B9EA 3ES6B 1JGUL 1A0QL 5GGSA 4GKOA 3G6JE 5IB5A 1KGIA 2Y1YA 3EF7A 1TITA 5EZIL 2YAEA 4QHMB 3T1WA 3VWKA 2VXSH 1YMMA 4QYAA 5D71H 1OGAB 4YHPA 4QRRA 2VXQH 1ROCA 2ZOLB 3M7FB 2YGOA 3P4NA 4JM0A 5IWLC 1MH5A 2OCCB 3QUYC 2WBWB 4TTGA 3IGKA 2H9GB 3ARFD 2P28B 1LO4L 2BHYA 1BAGA 2KYIA 1T7WA 3ZDXF 3WS6C 3P9LB 3N2JA 1RKRA 4QYOA 1J05A 1U6AL 3VA6A 3GBML 3WIAA 1J1PH 5KVFL 3RX7A 2BWIA 3TA3D 1CLOH 3DXAB 5MEPA 3ULUE 4F33B 1KIQA 4TPRL 4O2FB 4UI2A 1QSED 4F8LA 1N12A 1YJDC 5T1LA 3W11D 1BQUA 3IGAA 4LSQL 4WSGA 1HEHC 4GP4B 1T5WB 4F3FA 2GJ6B 4JDZA 2CLRB 2F53A 4GAAA 4ZK8A 3VXOB 5MEOB 4QHUA 5LDSA 3G6JB 4K5LA 3V52H 3C6LB 2ODHA 4OFVA 1QO3B 3OLIA 1CICB 2PPEA 2HVKA 4L23A 1MSPA 2OA9A 2JKWA 1VDGA 3EBGA 5L88H 2NMSA 3DTDA 2MNUA 3H0TB 2P5EA 1MCNA 5DWUH 4RRPA 5JHLH 2JWYA 1A1MA 3MCLH 3HZKA 4W1TA 3U30B 1IFGA 3VFMA 1QLEH 5SV3A 2EEDA 4KDTA 4QF1A 3UBXB 2YAOA 4RMTA 4QRUA 4HKXB 4IBQA 1MCLA 2NW2A 2DQFA 2B16A 3LMJL 2V2XB 3VH8B 4AMXA 1HQRA 4PJ9D 1KPVA 4PS7A 4WK0B 3IS1X 4AQ8C 3CFEB 4HMEA 3E9UA 3EYUL 2APWA 1SHWA 1NEZA 3P0VH 3DX2A 3BZEB 1M1XB 4H1LH 2N0KA 3SKNA 2WQWA 5HVFB 4K7PY 3VXNA 5A2IH 5KYNA 3C8DA 4DP1X 4JVPA 5E03A 5AEAA 3NACH 2DDQL 3K6NA 3NH7H 2LGNA 3O3DA 4Y4HD 2EIBA 1GOFA 3KPMB 1JWMA 3EYOA 5HYJD 1KC5H 3MMEA 2IH8A 3FUHA 4PLKD 3DWTA 4X7TB 4F15B 3ZSTA 4PI2A 2Y25A 4X8XA 5DI8B 3LKQA 4RGOL 2QKIA 2FO8A 1ADQH 4ZOBA 3RQ3A 1KPUB 2GI0A 4XX5A 4ZS6D 4S1SL 5D7SH 4L3AA 2J56A 3AGVA 2FHCA 3BEVA 3PQYA 4N0CD 3LS4L 3VE0A 4YFEA 1D5XB 5CWSA 5DHVA 4UNVA 3N1MC 3SDYL 4NPJA 4JO1L 2BLFA 1DVFB 1U8PB 4LVHC 1EK3A 4U1IA 2BIPA 4XPAL 1AKJD 1F45A 1KN2L 2O26U 2Q1EA 3ZGHA 3BSZL 4N8PA 4X7CC 1S9XA 4QRPD 4KXZH 1PAZA 1BF2A 3U4KA 2FAUA 4WKZA 1QNZL 5DD3H 1AZBA 2ORBL 3C12A 2Q3XA 1RL1A 4N2AA 4QY8A 2CNYA 4OKVB 3FTWA 4UILL 3MFFB 3QXAA 4WUUD 2X4TB 2I07A 2MCAA 4LCYB 3KG5A 3GQFA 4XMLL 3PHQB 2ATKB 3VI3A 1J5CA 4LP4A 1H8OA 2WYZA 3E1F1 3OQ3B 1WAAE 2AQ2A 1KYFA 5LBSA 1J8RA 2JNZA 5DJCB 2X3AA 3MLPA 2VXUL 3RU8L 1S7TB 2AXGA 4HWBA 5ICXA 4HK3N 2BS71 4EQ2A 1A7NL 2R2EB 2WXHA 4FS0A 4RMBA 3EH3B 1NCAH 2ICEA 1JZJA 3PIQB 4YSUA 1U3JA 5JNYA 5F21B 4O5LL 1LEIA 2ZUQC 2UZYA 4LSSL 2B5IB 4LNRB 2GCYA 1B88A 3B9KB 3QDMA 4GIPD 3JV6B 1JGEB 5KJRL 2FBRA 4UQAA 4PTTA 1FE8L 3D85D 4NM8L 1IL1B 4YHYC 1L9NA 3LKNA 1YVLA 2OMXA 4P48A 4QAMB 4B41A 5DHMC 1CD8A 2ZSWA 2P8LB 4GT7A 4RSVA 1BXXA 3TEYA 2BVYA 4ZMAT 1CPUA 3BT0A 4I1RA 4OZ4A 5EU7E 4BELD 3CCHA 3F01A 4L9LB 1E28A 7PAZA 1MCOL 1X5YA 2W0KA 4GKNB 3ZTCC 2ZUXA 4JRFA 4KUZL 1ULVA 5FYLD 3JXAA 3QAZB 5BV7C 4O02B 3O6LL 3APMA 2M26A 4POUB 5DRWB 5F0MB 4XNBA 3TZVC 5HHXH 4POYA 3JSSA 4S1DD 2WUBL 3EO0B 5GRJL 3MA9L 2FTAA 2NUPB 1HH6B 1HN1A 3CHPA 4LSTH 4LLUB 4QRSA 5HHPA 3FT0A 3K4AA 4FADA 3A6BL 3KYKL 4PG2A 4TQIA 5T1KD 3ZL1A 3H6JA 4PLNC 4HKZA 3BKCL 3LS5H 4XO9A 4R97B 1XF3A 1L9OA 4P5TD 4UTAA 5TFSL 3OKEB 1UCBL 5L9DL 3MJ8A 1JGLH 2ZOWA 1MAML 4G8GE 1KJVA 2UXTA 3MLWL 3VRLE 1Z32X 5JTWA 2BCKA 3PP4L 3NJNA 4PFEA 5JW5A 5TPWL 5TF0A 3HBGA 4MDIB 1OV8A 3HZYA 1K4CB 2EEXA 3AG2B 5E5MB 3D3VA 5LB1A 2AS5M 3QJTB 1X5MA 1BZ7A 4KHXL 3CXDL 4PJAE 3NT0A 4IM8A 3G6DL 5CD3A 4WSJA 3ZVVA 2HTKD 2PW2A 1T80A 1OAZH 4HK0B 2E4FA 3HN3A 4JFHD 1AO7A 3EJYD 4JZNB 1ZV2A 3QRFM 1R5VB 3JZYA 1JPFB 1XR8A 2OXGA 2QSVA 4OGQC 1M7DB 2CXKA 2YXVA 2YD0A 4PGCB 5CZXD 5DHXB 4YL9A 2FO1A 4PJCF 1JSYA 5IB1B 1V55B 4FFYL 5CD5D 1XF4B 4JE4B 5IQ7L 4Y1AE 4JPWH 1GJUA 1IC7H 2APTA 2PNDA 2VQTA 3NZSA 3D4CA 3FW6A 1PVHA 3QIBA 4JGUA 5LJYH 1VAHA 4EN3A 5FYKE 1B2WL 1T1ZB 3RUGA 1AXSA 3Q7JA 4XNDA 5A2FA 5C0IA 4M1GH 1QBBA 1ZHNB 2UVEA 5LG1A 1ORQA 3CFDA 3VI4A 4D8PB 3GSWA 4WEMB 4NC1E 3MRNA 4MJ6B 3ZSSA 2ZYIA 2ZOOA 4HJGB 4YUEL 3BAEL 3ARWA 5J6HA 1T6BX 3ZTNL 2JCWA 4PMFA 4GG6E 3FZUD 3KL5A 4IRSD 3W0WA 3I3EA 4G5ZL 3VD7A 4OJAA 4IS6B 5E6ZA 3AITA 1AIFB 2VMEA 5LNDA 1DLFH 3ARFC 2A4ZA 3B2UD 1M05B 4ONOA 4QWWC 2ZTBA 1T6WA 3ME0A 3B56A 4K5PA 5D7HA 2CR0A 4A7TA 3O11A 4CUCA 2JLLA 3LN4A 1VADB 3TA3C 2NY2D 3PDDA 1KFAH 2AFNA 3NJVA 2K8MA 4Y1AB 3HE7D 4Q8BA 2VLLA 1GGIH 1U8NB 3N5AA 4A38A 2WSPA 4WW2B 2VCOA 3HHSA 4IGBD 4NO3B 1NCWH 2AABH 4F7TB 3L9BA 4QTFA 5CEYB 4ERSH 1A7PL 5EU4A 1RURL 2G5BA 2EDLA 1CT8A 3OPUA 5DS2A 2CKBA 4Q97A 5C9JA 4BQ6A 4G11A 2HLEB 4X6DF 5DVPA 1LHZA 2ZKXA 5L8JB 2H32A 3NIDE 2XVBA 3R4DA 3FTGA 2K3TA 4JFWA 3RTQD 4M1DH 1M53A 4YSCA 1KCLA 1WDAA 4YE4L 3STBA 4F8TA 1R3KA 1A7BA 3ZDYF 4PRID 3VD2A 4DGVH 4Q89A 3ARYA 4Z7UE 2CJUL 4K8RH 2PWEA 3VGAB 4OLUH 1LEKA 5I1CL 5DFWH 2NY6D 2P46B 3S35X 1SJHB 1VACB 4JQIL 2WPGA 1A1NA 1R5IB 2CO2A 4G6KL 4W6XB 4PWEA 4YHKH 4KO7A 2YWYA 4PJ9C 1K8DB 2YUWA 3MXWL 3F12A 4Z7NF 1CD1A 5IUCA 5C09B 1Q8MA 5DRZA 2R4SH 2XXMB 1YHPA 3H42L 1RLWA 1AZCA 3QG7L 4NUJB 4NZTH 3H9YA 3CPLA 3S96A 5J3HD 3LXCA 3NJHA 3N1GC 2DIAA 3CN2A 1HCFX 4I5BB 4Y4HC 1AGFB 1RUPH 2IAMA 2ICWJ 4JGJA 2A99A 1CTNA 4N9GA 3HR5B 3D34A 4PLKC 1T89C 4ES8A 3NIDB 4ODWA 2VERN 2XQ0A 1G9HA 4R7DB 2C9PA 3EJTA 4AQAB 5D7IA 1UXLA 4I3RL 4N0CC 3TN0D 4K94L 4L8CA 3KXFA 3HIZA 3VXMD 3LVEA 3MOAL 3U48A 1YPZA 2IC2A 3HCVA 1ZLVH 2J88H 1HYRC 2G2RA 5KVEH 5HHNA 1NGZA 3QUKA 1MI5D 1F3DH 2WBKA 3EXLA 5IG7A 4HWZB 2CUIA 3IFNL 5FW7A 5JIKA 1KCVL 4HV8B 4HX1A 3DSNB 1VGKA 5C9KA 1CE6A 2NXZB 3QPXL 1CI3M 3UJTH 1WT5C 4WLCA 3LRHA 3Q43A 3HRZB 3U4EB 2IPTL 4KMTH 3HC3L 3MACH 4HULB 1GAFH 1BBDH 2RQ8A 1JXGA 1IGMH 1ET7A 1B2YA 4K3DH 2JCCA 1RMFL 4MMXB 2J8UE 5ESAA 4WDIB 4OLYH 4Y16A 2Z92B 2UUDH 1TTRA 1U41A 2WNGA 2ZSVA 3UYOD 2C1PA 1WBZB 3QFDA 3ARGA 3FN0L 3KLKA 2IJ0C 3ARBD 2A1WH 3MXVL 2BSDA 1TZHB 3CVIH 3B7TA 1OGSA 5D96B 2O5YL 5DYFA 1RK0A 3MV8D 2CU9A 4ZUSB 1PD1A 5LBGA 4LLQA 5CEZH 1H6FA 1G0XA 4M62H 5C07B 3OAYH 3VVWA 4UWQB 2YEVB 3APCA 2GJJA 3O3AA 1PQZA 4LCUB 4YPGB 5EO0B 3I3DA 5IVZB 2EE2A 1NUGA 3NSYA 4GUPB 1G7QA 1R46A 2D4FA 2R0ZH 4JKPH 1ZXQA 4WV1C 4A55A 3REVA 1DN0A 3B1UA 2XVLA 2KL6A 5A2AA 2WO2B 1BPVA 4W70A 2VXSL 1ZVSB 1E9QA 3X14A 4QHPA 5D71L 2KERA 2VXQL 3O3BB 3D39B 4Y5VB 2J8UB 3WKQA 1N5YH 2Z31D 1BOGA 2ATPA 1LO2H 2OMYA 4ZMLA 2XACC 4YO0B 5SWSE 1O0VA 1OGAD 1R33A 4M3KB 4Y89A 2APBA 3H8NA 1J1PL 1BREA 1CYGA 3C60A 4LGPB 3QFJB 4PJAF 1CLOL 1HTYA 5FV2A 5IHHA 2IH3A 2HMID 3DVGA 4H25A 4BK5A 2G9KA 1SXSA 4HGMA 1F3JA 4YXKH 1EANA 4GP8B 2APVA 4FHBD 2RFXA 4LLDA 5B1BB 5FO9B 4JFYA 3ZYZA 4AV4A 1IM3D 1Y18A 4P5TC 2W9EH 3MC0A 3RFZA 3V52L 5CHNA 4WO0A 5IF0A 2IO5A 1WIUA 3QJFA 3K91A 4C55A 1U58B 4Z7WB 2EXYD 4Z7VA 2WLNA 4N0FA 1S9WB 5L88L 4JANA 2G0KA 3RA7H 1JBJA 1NBYB 2BXYA 1K3ZA 1HL9A 2CBOA 3GSNA 3HUJA 5EF1A 3CVCA 3HS0C 3C6LD 1NC4D 2HKHH 5DWUL 2ARJA 2PYFA 3MCLL 1CICD 3MBEB 4H44C 3T9WA 2A83B 2E8ZA 2ZYSA 4ALAC 5ID0A 1T0MB 2BOBA 2HTKC 2Q3ZA 4OUOA 1QLEL 1YUHB 4XT1C 5SWSB 3EJYC 3S35H 1KIUA 3RI5F 3BHBB 4OZFA 3S0PA 4XNYH 4OIBA 2DQJH 4PGEB 2MOQA 5CZXC 4NO5B 3W1ZA 4FZEH 2EDMA 3PCYA 3VFRA 3DIVA 5EWIH 5CD5C 2QGDA 4BD4A 4HPYH 2HTLD 3P0VL 3U1PA 3U9WA 5T33H 3CZKA 2RA1A 3K8LA 2PUQT 2WYIA 3TH3T 4XOEA 5T3XH 5EOCJ 1DEDA 3PAYA 1QQDB 5ADOH 3ULUD 5GGUB 2WN3A 1DEEB 3NACL 4J39A 3NH7L 4ZPTB 5J9PB 2J5WA 2H47C 3MYJB 3SD5A 3B9DA 4FXTA 1KC5L 3MJ9H 5AALA 2C4XA 2PCYA 2HLAB 2Y9RT 2Z91A 2OYMA 4HETA 1JZ8A 2NYKA 4IRSC 3IBOA 5L8LB 3AU1B 4BXVA 1ADQL 1HILB 3WJMB 2RQEA 4Y8DC 1M71A 4MNQE 4JJ5A 4UNIA 5D7SL 4K5OA 3VTAA 2W0FA 3CWGA 1SN2A 2VZ3A 1XGTB 4ZW7A 4PJ7E 3AACA 3ZMEA 1P2CB 2BZCA 4L8SC 3OX8B 3FU6A 5D7JB 5FO8B 3KJ4B 5KWYC 4E42A 1F0LA 1S4IA 4UOW0 5I75B 2NY2C 4HEMA 1IB5A 1KXVA 1R3IH 3HE7C 5E4AA 3IDIA 3FCBA 4GY4A 3UTQB 1DVFD 1RULH 5DD3L 3P2BA 3FQXA 4PG9A 1LD9A 3DK0A 5FUCE 1IBGH 4U3CA 4ZO6A 4L05A 1ZTXE 3MUY1 3GNMH 1FZOA 4OLZH 2W88A 2ZXCA 5CZKA 4LDOB 2BZ7A 2DYPA 2YMTA 5K1VA 4BK8A 4EOWH 2E47A 1HYSC 4XNMB 2IDCA 1RUKH 1QKZH 1KB3A 1T04B 4Z95H 3O41A 3RGVA 4YSSA 1NCBH 5HVWA 3J7HA 3LNIA 4EO5A 1UZ6F 3LXBA 4GW4A 4KH2A 4HU8A 1GS6X 3IPEA 1MFCH 4MNQB 2Y07H 3IYLW 1ASQA 4JM2B 4X80H 3RTQC 1I9JH 1NWOA 2IANE 5F7AA 5GS1A 4PJ7B 1NCAL 1U8QB 4WJ5B 5DZAA 3FO2B 1NFDE 3MRLA 2KZ1B 2W60A 4L3EE 4LSVH 4D0CB 3SY6A 2XG5A 4AV5A 5CLYA 1RPKA 1HQ4A 3BH8A 5IB4B 1CBVH 5HBBA 3RWEA 4KRNA 2XXGA 5I1GL 1UXMA 2X1OA 3FU5A 3VXQA 2YAFA 3GSXA 4QEGA 1QBMH 3U9UB 4N1HB 4UNTA 4BQCA 3B9KD 4Y2DD 3MLTB 1OF0A 4U1GC 1BX2B 4NN5B 2BFGA 1KB9K 1OT4A 2X9ZA 4PGDB 2X88A 3FU9A 3EGDB 1Q94A 1U3HA 4QOKA 1YEDB 4UQEA 2YOAA 1OGPA 1XTMA 4UDTB 1BZ9B 5J0BA 2B15A 3P3TA 3U25A 1UGNA 3FSVA 4JREC 3H1ZA 4P23B 1LMIA 1U36A 3RLSA 5F72S 5ALCH 5HHXL 4QT5A 1A2YB 3AB0B 1BVKA 2WK2A 3TN0C 1UD5A 4LSTL 2GSGB 4Y5XC 4XMTA 3I2CH 4A6YB 1D5ZB 3TIDA 3V6ZB 1TZOA 2XPGB 4UM8A 4QRQA 1A6VL 1MELA 3LS5L 5GRVK 5ITBH 4LKXA 4ZAKA 3WTYA 4DAGH 2OI9B 5C6WH 2O72A 3ARVA 1MFAH 3OMZA 4E36A 2WXMA 3ARQA 3RIKA 1F6AA 2DL2A 2V5YA 1RVFH 2ADGB 2HPTA 5HGHA 3AC0A 4FG2A 5KS9A 3BUTA 1INQA 4KV5E 4Z3JA 1MCWM 4YNYB 2ZWKA 3JT2A 5I15H 4Y2OA 5IESH 3LHAA 4JPIB 1OAZL 1UWYA 4OFYA 1E6JH 1KB5A 3REWA 5BVJB 3ARBC 2V9RA 3ECUA 2FVNA 3HN5A 3LDBB 3PYCA 1BV8A 5B3SB 3F3HA 3HC2A 3Q5YA 3MLZH 4JPWL 3ZHNA 5I30H 4TVPE 1IC7L 5DHVH 1RJYB 2VZVA 3MLVH 1FH2A 4FERA 5DZPA 1RIHL 5K9QG 3X3FH 3IXAA 3MR9B 1J5DA 2AGJH 4M1GL 3ATAA 4NN7B 3IMBA 1SN5A 1W72H 2HFGH 2XZAH 2JQZA 3VFSB 5AL0A 2BSRA 2VJ8A 2MKWA 2YIHA 5E56A 1PJ9A 3PV6B 2XQYA 4TNVF 4UDUA 1IGFH 1T4WA 5C71A 4YHML 1FH5H 2IALA 1J7VR 1S3RA 2X6UA 2YK1H 2FJGA 1UA7A 15C8H 3IMRA 2WXJA 3AJ7A 5DC2A 3RG1C 4FFWD 2X4NB 4UTBH 5C0RH 4OFQA 3T6QC 2Z31C 1DLFL 4G8GD 2E56A 3QQ9D 2VLJA 1ZPUA 4LEOB 4Q6IA 5DJZA 5A2CA 3ZKMD 4X5LA 3O3UN 4QJ3B 5HDLA 3CFUA 4F8QA 3AWFA 5KJ7E 3HI1B 2H26A 5LBSH 5HHMB 4OFPA 4QXGH 4JPVH 3VQ2C 3D0LA 1KFAL 4HWBH 3ZE1F 1GGIL 1LDSA 2DM4A 2HFTA 3D48R 3QQDA 5M94B 2HMIC 4WNQA 1JJUA 1U8OA 1L9QA 2J8HA 4IOFD 1NCWL 1SDDB 2AABL 2UXFA 2NW3A 4QHKJ 4JHBA 4N0RA 1S9YA 2C7FA 4ERSL 5F7MC 4Y1AD 3G5XA 3BRGC 4NNPH 1CGTA 4DERA 3FRUB 1I7TB 5FYKD 1W72B 2E6QA 3SPVB 2EXYC 1XIWD 1YQVH 4X2UA 4Z7QB 1KV3A 2WV3A 4XHJD 3VD9A 3M1OA 4M1DL 3IDYC 1AR1B 3QQ4A 5DZVA 2PO6C 2HT3D 2N01B 1GZQB 1PTZA 3C6LC 3TYFA 3H4FA 1TEYA 3LXAA 4HIIA 5LGKA 3O9WD 4EZMA 4DGVL 3G9VA 1JYXA 5HPOA 4K8RL 2CRIA 4OLUL 1HZHH 4PH8A 1I9IH 7PCYA 2XFXB 2H41A 1V5JA 1AG0A 1QHQA 5JOEA 2I07B 2AVGA 1AC0A 4YHKL 2CD0A 3QIUA 3WHE0 6FABH 5MEQB 1AOHA 3U30C 5JQHC 3QK0A 3T0EA 4DIXA 5I19H 2R4SL 4PJBB 2E7DA 3ILDA 4GI6A 1U91A 4NZTL 3AM8C 3P9MB 4HGWB 3ULUC 2ZNWA 2B14A 4OCRH 4HZ1A 3OC8A 4HDIA 3I9IA 1YMHA 3MJ6A 4HS3B 2YPVA 4LHUG 2GITB 4MJ5B 5ECJE 1OE1A 4HU2A 1KIPB 5FKPA 4OI7A 4NRYA 1E5BA 4R7NA 2CGRH 1EFXA 1EZUA 2Y7SA 1AI1H 4GUQA 1H5BA 3BSGA 1YDPB 1XH2A 2J43A 4XNZB 3EOAA 5J12C 1P5VA 4L0PB 4F15C 1OP5H 3VXSB 2J88L 3CCHB 2G3MA 4OUUB 3LX9A 2V2WA 3HE6B 3NA4A 1F3RB 2ICCA 3L1EA 5E6ID 5FFGA 4FJYA 3TTYA 5ICUA 1HCYA 1DJSA 1NCUA 3ULSA 4XC3H 1B4RA 3SPGA 4BZ2A 3UJTL 4EJ1C 5ACLA 4PI0A 5DZ9A 3FOLB 5CINH 4HAFA 4KMTL 3MACL 3SBWC 1WWWX 5SX5K 2QQQA 1GAFL 1BBDL 1TG8A 4J3OH 3G7TA 4GW5A 1IGML 4Y19E 1MCRA 4K3DL 4PJGA 1CCZA 5FA4A 3TP4A 3EFDH 4OLYL 3VM7A 3DJZA 5JHDA 2NXZD 5HVHC 4OLWH 5J6SA 2PXYD 2XWDA 1SLXA 4FQXA 1SNRA 5TD4A 2X4PA 4JFSA 5F9WB 1S3KH 5CIPA 2A1WL 2JTDA 1A4AA 4UUJA 3CVIL 4AKPA 5I2IA 2HG5A 1K4DA 4AEFA 1IBFA 4K7FA 4N2FA 2EICA 1UM5H 5CEZL 5D1ZI 2B1HH 4GAGH 3ZT7A 2DKMA 3QDGB 1JHTB 3TV3H 1PIFA 2G75B 3GD1C 5LVEA 2C1OB 1WSST 2C5DC 2ZXEB 3NFNB 3X11B 3QEQA 1PKQE 5DJ2A 3LOWA 3UTTE 3U36A 4JKPL 4FXGB 4AEIH 3D06A 1F02I 2DLHA 5G5DB 1NMCB 3B9KC 4Y2DC 4G1MB 1WGVA 4HUCA 5DU7A 3KYNA 4MD0B 1U8MA 4V1DE 4LL9A 4B97A 1KJ2A 3APDA 2JJVA 2AI0H 1FC2D 2CKBH 3F6IA 4KKBD 3T65B 8FABA 3SYPA 4IHBA 3MV11 5C0AE 1LO2L 4PWFA 3ZE0B 4G43A 3LN5A 4ONGH 1MNUH 4PJ5E 4XO3A 4Z3TA 2H32H 2EILB 5I9QB 3CVHB 2JI3A 4C83B 3ABKB 1WFMA 4CGUB 3PWNB 3K5SA 3ALXA 4IRZA 3J27A 2UY7A 1AOZA 4YXKL 3NJKA 3V5DB 1T3FA 1X4ZA 2AK1H 1LEGA 3AQYA 2ZXBA 4WFGE 4B27A 1I75A 4HUVB 4WWPA 3LH2H 5DMGD 1PKQB 1CLZH 2VRKA 2W9EL 2X7LA 4J8RA 5E8PB 3FO1B 1I9EA 1YC8A 1NJ9B 1KY6A 1OD7A 3OF6A 5E08H 3QUZA 1BWMA 5D1QE 2N59A 3RA7L 4R97C 2NNRA 4V1DB 4LGSB 2HN7A 2OV0A 2HKHL 5GRXG 4OFKA 3CZNA 5C0AB 3H54A 4Y1SA 4PJ5B 1SBBA 3S35L 2GEEA 1MFMA 5EU7C 5GS3A 4XNYL 2G5BB 2GQHA 2DQJL 3K74B 2Z93A 4FZEL 4ANXA 2CMRH 1CXFA 4ZZFA 3ZBMA 2PMZA 5JXAH 4W9JC 1CG9B 4HPYL 5SWSD 4WU7B 1S9VA 4D94A 3H7BB 5D7KE 5T33L 5GZND 1I3RA 5BS0E 3ARED 2GT9A 2Y36H 4C47A 1Y6KR 2FWOB 1TCRB 4MAYB 1NAMA 3UX9B 3P40A 4XCYB 3SQRA 5ADOL 4GKLA 1FYTA 3A24A 4Z76B 1QA9A 3W57A 4ESKA 1WQVT 3L16A 3HHRB 3ZHKA 1U95B 4NQDA 3TU6A 5A7BA 2EDDA 2YRPA 5HYSG 3MJ9L 1S7VB 4YBQD 4LHUB 5C0JA 4BEIA 3L08A 4IKJA 4CU7A 5J1AB 3DPBA 1RJCA 3Q2NA 4GI9A 4Z5RB 4FHJA 3T2LA 6CGTA 2EQDA 2ZONA 3DUUB 1Z9SB 5E5UB 1UT2A 3QQ9C 4R0LC 4AVJA 1O7DE 2VWEE 1JF6A 1XF5A 1E5UI 1BVNP 4H13C 4ZNCD 1XCQA 4LQFH 5FK9B 3WN6A 3T6VA 2ZCKH 4R5XA 5AVRB 2B39A 1MJJA 3BKMH 2F1BA 1R3IL 1T7YA 3MJGX 2YO3A 1JWSB 3DGDA 1RULL 4FE9A 4AYFA 1P7KB 5BS0B 5D7JD 1IBGL 2BP5M 1BEXA 2X28A 2ZKWA 3GRGA 3GNML 4YSQA 3T5WA 1FL6A 5D2LF 4EOWL 1GGCH 4F9LA 5J13C 1KUMA 5DS8A 3TBVB 1RUKL 3SKJH 1QKZL 5D96C 3OAZH 4Z95L 5F1NA 5FGSA 5JIQA 3GMMB 5LNEA 1NCBL 3MOQA 5I26A 3WUWA 1XIWC 1M6OA 5DRXA 4XHJC 1MFCL 3QNXA 4JFXA 4X80L 3CV5A 4NC1C 1I9JL 1YZZA 3HI6H 3F04A 1EO5A 4JFZH 5C0EB 1PMYA 2HT3C 4HUMB 5HYIA 4XVOA 5C2BH 1CE6B 1T20B 1WYJA 3BUYB 3O9WC 4IMKA 2XN0A 4B60A 1PX8A 1ZA3A 1C16A 3LXUX 3VB8A 1JNHB 2X2HA 3BPNB 4MNQD 4JM2D 1P1ZA 4AH2A 1E8XA 1PZ3A 4ODTL 5BZWA 1I8KA 1CBVL 1DUYB 2YWZA 3FB7B 1G1OA 3AY4A 2EDRA 3HTLX 3Q8FA 5AW5B 5C1MB 3JVGA 5D1XE 3TWYA 3FRPG 1X5GA 1SXCA 2CR6A 4IRJB 1QBML 4R7LA 3V4UH 5EU6E 2WP3T 1QR1B 3FF8A 3SDAA 2CA3A 5BUPA 5BXFA 1J0YA 3OJMB 5IW3A 3H55A 2FSDA 4HSQA 5AVXB 1KNOB 1WGOA 1LILA 2ED7A 3NCFB 2Y0SA 3X3GL 2CHWA 4OR1A 3WTXA 2CA4A 3D0VB 1TZIA 4XMWA 1EFQA 2A9ML 2E27H 2GW5A 3K4DA 5ALCL 1DQJB 2KQMA 5ABAA 4TOYH 4I89A 1J48A 1TJIH 2QGCA 3GSNH 4JFEE 1X9QA 2A6DB 1FZKB 5KSVA 5ILTH 1P6WA 1BVNT 4X5WB 3ARDA 2FYVA 1CU4H 2WZAA 3D69B 3DPDA 3HVNA 3I2CL 3L4UA 3MV9A 4P23D 3ZLQC 5KYWB 1AC6A 4OZFH 2IAND 2N7AA 5E6IC 5ITBL 4DAGL 4DUVA 2XTJE 4WHTA 2QPSA 5H2BA 2AXFB 3CHRA 5D1XB 3H53A 4Y4FB 5HGBB 1ZWIA 4L3ED 1MFAL 4FXKA 2PP9A 1OAKH 1KIRB 1QLRA 1RVFL 3IJHA 3B2VH 4NSKB 5CBAB 1AHMA 2OL3A 1BLNB 2L7UA 4G8AC 3MKKA 5I15L 1CLYH 2YD1A 5IESL 1SZNA 3RHWF 2XQBH 5AVSB 4BQBA 2PXYC 4ADJA 3QE5A 1E6JL 4L8BB 3QDJB 3ZGIA 3RFZB 3LRSA 5GS0H 4MXWL 2EE0A 5DD6B 1JRHI 3KGTA 3MLZL 5EF0A 5I30L 4OJYA 1ZA6A 1NINA 1RERA 2YAHA 3MLVL 3UZQA 3PFQA 2DWEB 2V8LA 3ILPB 3QNZA 3X3FL 5DMKA 2AGJL 5F6IB 1JCKA 3BP7A 2BP0B 3INUH 1W72L 1ETZA 1SN0A 2HFGL 2XZAL 3L5XH 2XTJB 4HJSA 4MJIE 1ZLUK 4LLMB 1AD9B 3P3YA 3RPIA 1NLBH 4X9BA 1FGNH 2CK0H 5HYSB 1JMXA 3MVSA 1IGFL 2BNUB 2N56A 2FECL 1CFQA 1YN6B 1L5GB 4HUKB 1FH5L 2YK1L 1OVZA 15C8L 4UTBL 4C56E 4QO1A 5C0RL 3N41B 3QEGH 3FCUB 3KPRE 5D2NE 1GTFA 2FNWA 5LXVA 1II4E 5E2VH 4GAYA 5LBSL 3WKYA 3EUDA 1NC2A 1NPNA 4X6CF 4QXGL 4Y5VC 4JPVL 3QC6X 4HWBL 4OV5A 2ERJC 5FHAH 1NA8A 4LDEB 4P2QA 1F8TH 1B0WA 1NPJA 4URTB 1VKXA 4HCGA 1OPGH 1HI6A 4EPSA 5ESQA 4AQEB 2ZOTA 1IM9B 2KT6A 3FQUB 1OGTB 2OMTB 1HHGA 3JQOB 3F7PC 1J12A 3LEVH 4FLOA 5IROD 4KZDH 1A9BB 1QOKA 4GXUM 4MJIB 5DMGC 3PDOB 4IK6A 3N06B 4TVPD 4PRPA 3ZY7A 3U2JA 3LQAC 4NNPL 3X17A 1HZKA 3KH3A 4NUPA 1XZ0B 3FFOA 3DURA 2D7NA 5DUPH 5LAPA 5EZOH 4P99A 1XV8A 4B3VA 1U93B 2F54E 5B38A 1YQVL 1BCIA 2WGXA 4JFPA 3TNNA 2YBRA 5F96H 4HIEA 2ATAA 2OR9H 2XCMC 5EC1A 4JG1H 2OAAA 2H4EA 1FPTH 3MFGB 4LL4A 4ZT1A 1HZHL 2OX5B 1I9IL 1WIOA 1XVSA 3HZVA 1NKRA 3EOTH 1YUKB 1E30A 1E3FA 4DGIH 4DOHE 4Q2ZB 1QTSA 1UB6B 2E74C 2XWTB 5D9SB 4IBZA 4K73A 6FABL 1QD0A 4N6RB 3RAJH 2YMXH 3BWAB 3WLBB 1TLKA 4NQSA 3KNBB 2ZWYA 1KLFB 3FRPB 5I19L 5IHLB 3BP5B 5GZNC 3IDMB 3ZMRA 3AREC 4YDMA 2E3VA 3F7VA 2F68X 2J7LA 3SE9H 3VD3A 5I1LA 3NCYP 2WBJD 3PREA 4OCRL 3FU0A 5CGMA 1H19A 1UWEH 1ORSB 2R9HD 3I3BA 3PWUA 4YBQC 1G7IB 4KXDA 2FT6A 2BY3A 2Y6SC 4O51A 1M7UA 2CGRL 1AGDB 5EUOE 1TEGA 2BO0A 4Z7OB 1BFOA 4OD1H 5FUZH 2FT8A 3L7FB 5FM5M 4BV1A 4PV8A 5A6IA 1I4FA 5CSBA 3ROLB 1UWGH 4AY0A 1G1YA 3GLEA 1XGPB 3QW9A 4OCXL 3EJCA 5C0CA 2FWLB 4TUJB 1MHCB 2I26N 5C3LD 4NQEA 4ZYKB 1KB5H 4ZMWA 5F0PB 4NQQA 3PNWA 5AW2B 3ULVE 4LPCA 2ZUSA 3HLKA 4QNPE 1QATA 4KXBA 2Y5QA 5DC9B 1S7SB 1XAUA 4G42B 4XC3L 1XGZA 4I4WA 3OR6A 4ENED 3E6FA 4WK4B 3AWEA 4LCCA 1G7JA 3KJ4C 1ZPLA 3N55A 5CINL 5I0WA 5DQDH 2LAGB 5I75C 1IKOP 3U46B 1T7XA 2QKSA 4AG4H 1T1YB 4F7MB 2PP7A 3EFDL 2XXFA 4JRYA 4GRWH 4OLWL 1U21A 5LLIC 4FMFA 3TCLB 4OBSA 4JPKH 5B1JC 1S3KL 3FH8A 4JKWA 3UTOA 4AC2A 3GXUB 4Y9FA 1OE2A 3KM1A 1F6AB 5IJVB 1D5BB 1QSVA 1UM5L 4YSPA 2JIXD 2ZJSH 2WQAA 1IFRA 1T4KB 2B1HL 2EYSB 4GAGL 3F2LA 3TV3L 3FPYA 1IUZA 2WKGA 4JM2C 1QNIA 3T2QA 3WAJA 2LE9A 4JN2B 3CLEH 3UFIA 4DPCX 3CUPA 1SVBA 4JHZA 3LEYH 5E4IA 4WWOA 3GTTA 4X4KA 1KXTA 3KZ8A 2BVPA 1KLGB 2J1XA 4J6IA 5JPNC 2ZIDA 4AEIL 4IBTA 4WGWB 5FO7A 5GGRA 3UCRA 4PJCA 4TSBH 1LWJA 2DI8A 1Z3GH 2H0EA 4HHAB 2AI0L 4U7KA 1A3LH 4FNRA 5FUCC 2CKBL 4LLWB 4PBXA 3V8OA 4ONGL 1MNUL 1BQKA 4NN5C 3BKJH 4Y19D 2OW7A 3FB5A 4P2OB 4NBZB 2PTTA 3IFPB 1AHWC 1BQSA 4KGLA 4MB4A 4AM0Q 4JDVB 4P4RB 4C8XA 1NUDA 3MGTB 4KKCD 5ADPH 4P4KD 2GJZA 3GK8H 3WEBA 4JUSA 4MJJA 5GGQH 2AK1L 3Q6GH 4Q74A 4U1MB 4KTDH 3LH2L 2ZKMX 4BBWA 1CLZL 3Q3GA 3X1BA 3TPKA 1I31A 2GUOA 1UT1A 5ECGA 3D4YA 3IJSB 5E08L 2BVUA 3Q6FA 4GSQA 2K7QA 1S78C 2OMUB 3A67H 4AXWA 4FABL 3UTTD 1HL8A 1FJ1B 3KBHE 1LP9E 2ADFH 4PJIF 2V3EA 1E8YA 2AMUA 2JJTA 2YPVH 2QFRA 1SHSA 3SD2A 4OF8A 2FL5B 3LY6A 3KPNA 2MOGA 4V1DD 3NEOA 2CMRL 4G1EA 1BYOA 4JL2A 3FB8A 3Q06A 2G9HA 4EI6B 5JXAL 1FVCB 3B8YA 4X6DA 5E70A 5C0AD 1INEH 3IMVA 4G9DB 4PJ5D 1K85A 1N8ZA 3FFCB 4F7CA 3FTSA 1RQ5A 2NY5C 2W65A 3MRQB 4LF3A 2Y36L 5E6YA 1M9SA 1SJVA 5JHMA 4X4XB 1QR4A 5K39A 3TA4D 4F8OA 1D9KB 5B4MD 3WNNA 2QDVA 5BJTA 1GOHA 3L7EA 3R06A 1IE5A 3CMOH 4HOWA 3QUHA 2E75C 4WFGD 5KOMC 3GEFA 4BZ2H 2FGZA 1AP2A 1CC3A 4FX5A 4WO4C 4G6JH 1PDKA 5CNHA 1V05A 1MRCH 2MPAH 3QARA 1G7LB 1LP9B 2WKOA 2DICA 5DDHA 4ELKB 2EDEA 3VFNA 2H6OA 5D1QD 5I16B 4J3UA 4NDMA 1X5XA 4XXWC 3A6CL 4LQFL 2XSKA 1HIMH 1FFQA 3CZFB 5IMOA 2V9TA 3CFKA 2ZCKL 5CIPH 1UJ3A 3BKML 4CSZA 2XZCH 5FKPB 5AAWC 1SFHA 4Z7AA 2GIXA 2VXVH 3OB0K 3NSDA 4HH9B 3SDCD 4YSAA 5CR1A 1EFXB 2AXJA 5I76A 4M9OA 5I74C 2AAAA 2D7TH 2QELA 3V8CA 1PD0A 5IROC 3CGTA 2DWSA 5F97E 1ZD6A 1GGCL 1INDH 4PRHA 4JE0A 5DRNB 1JF1B 3SKJL 2BC4A 3FKUS 4V2CB 5D7KD 3FO9A 2X4SB 1S7WB 4DP7X 4N26A 5BS0D 4DGUA 4WWKD 2FH6A 4HFWB 4ATWA 1YYLH 4Z23A 1TUPA 1SYSA 5KUMA 4HFUH 5DTFB 3HI6L 4JFZL 2UYLB 2IFFH 5KAQG 3QWOA 5C2BL 1T83C 1JCVA 3P4OB 1KJ2H 3NCJH 2DH2A 5HHVL 4XMXA 1ZXKA 4AGOA 1AMYA 2H0JA 3KPSE 1X5JA 3QA3B 3EBAA 3U0WH 4MCZB 4XBPB 1AYRA 1R47A 2EC8A 3P77A 3Q1SH 4MX7B 2BVEA 4K7PX 4P2YA 4NQXA 5ERWB 3GMQB 1G5AA 1Z9PA 3E2HC 5ITFA 1P7QD 1KYDA 2GTZA 4FQXB 3UTZA 3ISWA 4LAQH 5AVTB 2W07B 3SGKA 3MLUH 3V4UL 3U2SB 1MCQA 5DEFA 5EA0H 2E7LA 4FG0A 2WBJC 4POZD 2VMCA 2YUVA 4PVMA 5D7EA 4ZBJA 4HSCX 3DUSB 1T66D 3OLGA 1P4IL 2R9HC 2O6DA 3PY9A 5IMLB 2GUYA 2V0AA 4XBGA 3QS2A 2NY3B 3U7WH 2QR0B 4J2XA 4KY1H 2E27L 3O4LB 3BQUB 4TOYL 1TJIL 3GSNL 4M9PA 1WC7B 1I1FB 3O0LA 2EUXA 1X5AA 3KPSB 3VGEA 1D2PA 5ILTL 5IFJA 4KQ3H 4YWGL 4ISVA 1CURA 1CU4L 1HH9A 4N2EA 4F9PC 2R56H 3C5JA 1NDMA 2A74A 2ZF9A 4JCWA 2BS9A 4U2YA 3BO8B 4ENEC 2MQCA 3MROA 3N50A 2K4WA 3A4FA 5ACZA 1YEEH 1OAKL 1OF2A 5EIIG 3BAXA 1WZMA 1F41A 4X9YA 4N2CA 3ROOB 1NIBA 1EEZB 3B2VL 4M5ZH 4PS4H 1L0YA 1XD0A 1NAMH 4OIIL 2FCBA 2FIRT 5BOPA 5D1XD 3FONA 1CLYL 3LEXB 3D07A 5EU6D 2XQBL 2ZG2A 4QKXB 2X44D 1GA2A 1SYVB 2AK4A 5GSRA 5IMKA 2IMNA 2XWZA 4LOVA 4N2KA 2FYYB 5GS0L 4F20A 5TK2A 1W6WA 2F0CA 2I9LA 3P73A 4G71B 5DZJA 2EDHA 4Y5YC 2ITCA 4ZTEA 4CVXA 1FGVH 2XKNB 4J1UB 5I1KH 2X89D 1UQSB 4LARH 1E6OH 2E4TA 3OKLA 5TH2B 4PVLA 3INUL 4JFED 3L5XL 2EIEA 1OAQH 3IJYA 5E9DB 3GLDA 3RVTD 2WCPA 1H3UA 1KULA 1NLBL 2CK0L 1O75A 4Y4KD 4PHZA 4RNRB 3GMPB 3D0AA 3GSOB 5KSAD 3WEXB 3RL1B 4OCLC 3W81A 3QJXA 1BHGA 4DK3A 4ZMOA 4EIGB 2XTJD 3DHUA 4JZOB 1ZHLB 4AL8C 5KYUB 3VFUB 3B5GA 4UQ3A 5BQ7B 2EIJB 4PRNA 4R2GB 3QEGL 4YLCA 4OZHE 2C26A 4ZMZA 3DROA 4I1NB 2ICWA 4MNGA 1QUNB 2FUTA 2BM3A 5HYEA 2NSXA 5JORA 2GBAA 2WWKO 2VW4A 2QLVB 4RGNB 2BINA 4BFNA 4U31A 4KI5F 1KACB 3C09B 2DEYX 4M7KH 5FHAL 5C0JB 1F8TL 4NAMA 3NOIA 1BZEA 2IG2H 1G6RA 3HHMA 5HDOA 4KKCC 3IDGB 4P4KC 3U6XS 1S7RA 2JVUA 1O6TA 1C5DB 2IWGA 4PJEE 3LEVL 4EIUA 2NQ3A 3AXLA 4KZDL 4F27A 5EIVA 3NCMA 1SMDA 1NMAL 3NPSB 3EHBD 3PRZA 5KVEE 5J4MA 2JK5A 4BA8A 5DUPL 1ZT7B 2J4WH 3MRJB 1YAIA 2WYHA 3PV7A 1DANU 2WINB 3V9CA 5IB2A 1RK1B 2BWQA 4MJID 1EBPA 5F96L 1CFNA 3KLHD 2W9DH 1DR9A 4AJYV 5E1GA 2OR9L 3QZLA 4JG1L 4L1HA 1NFKA 1IKNC 4LCIH 4RBPH 1FPTL 1U8IA 5T8IA 3AAZB 4MQ7A 4XRCB 3Q9QA 4K7PH 3BP6B 1GOGA 1HXYB 2VDLH 2ZOKB 3EOTL 4HISA 4F57H 2I5YH 4AVHA 4UZGA 4P5MA 4C56D 3A47A 3RAJL 2YMXL 1BIHA 2XZQH 3MRMA 3WS3B 2GBVA 2DWXA 1RZ8A 4D3CH 1I53A 1QPPA 3VXPA 3FH5A 3SE9L 4J4PC 4HIHA 5F71A 4HBQA 1AGCB 5B4MC 1Q9LB 4AGPA 4H2CA 4X6FA 1UWEL 1LE5A 4XVJH 1DP0A 2GB2A 5IK3A 2HUHA 2XA8H 1I1AB 2YPLE 4PR5B 2AQQA 1KBPA 2ZP9A 4PJXA 1BVZA 1A6UH 1BM3H 4EI5D 4ZD3H 2FJUB 4OD1L 4XMZA 2OL3H 2G30A 3K6DA 3A4DA 5FUZL 4MDJA 3NBNA 4CADB 1UWGL 2F54D 2PCPA 3DUHA 4NUMA 5D1QC 1BG9A 1QFWM 3VTTA 3CDGA 1SRDA 1F1AA 1KB5L 4JLRA 3APNA 1KB9J 3TVMD 4AYBA 1O6SB 1TQTA 2Y7LA 2FX8H 3IJ7A 2VDLB 2EADA 2PPAA 3NRPA 3SDCC 1IC0A 4OLEA 5EIIB 1M2VB 1WBXB 5FS5A 3P3UA 3FQ4A 5JLZA 3L9YA 5DQDL 5G4MA 1ROWA 3UC0H 4I2XE 5F1IA 4AG4L 3L4VA 4OU3A 3QUXC 4B0MB 4OTXH 3KVPA 2YSSA 3R1GH 4OCNC 4WW2F 4FA8A 4Z8FH 1XB8A 5LAXA 5DS1A 4Z18A 4WWKC 4ABWA 4JPKL 2YPLB 5G4OA 1WIPA 3SCMB 4B9IA 3C75A 4YXLH 3T3PE 1NKOA 2A77H 5ANMB 4AIOA 2V9QA 1TFHA 4WI6A 2XBDA 1YEGH 1NPUA 2WLIA 3BWUF 4M4RB 3T8XB 3GTNA 2IGFH 1QLRB 1U30A 3H2WA 1E27A 1K9TA 5JMOC 2F8XC 1SEBA 2ZJSL 3K72A 3DDFA 3C2SA 3M8OH 3PWPA 4W81A 2ZXAA 3S5ZA 2V3FA 3CLEL 1HOCA 3MTRA 4FI8A 1LL1A 4MHHG 4F2FA 4U0RB 3LEYL 1IBHA 3KCWA 4N6QA 4WGVB 1U92B 1O7DC 4ZNEE 4FQHA 2VWEC 3UBXI 3ZR5A 3UO1H 3LPGA 4KI1A 3DX7B 4PJFE 3B37A 3BPNC 3F7YB 3DI3B 1J0KA 3ULVD 5F1OB 2DB8A 5LCVA 3SDXA 1SQ2N 1Z5LA 4I2XB 4POZC 1S5IH 4TSBL 2JXMB 2NNAB 4AGQA 3OHXA 5E7FA 2P80A 1Z3GL 2HX8A 1M2OA 1QEWA 5T3XE 5JPMC 3EJJX 5EHFA 1A3LL 1PLGH 2QVFB 4K71C 4LKCB 4APXB 1QRKA 3P02A 5BW7A 3DX8A 5IR1A 1KGUA 4G2AA 3NA9H 4TULH 3P4LA 3BKJL 3SPJA 3UYRH 5D5ME 4UM9B 1A02N 1RHFA 2XDHA 1A8JH 1E67A 2R0WH 3AUWB 5I6PA 1UVQB 4XI5C 2JKRM 3SKMA 4GLRH 5F7DA 5IVXA 1PYWA 4TN9A 5ADPL 2CGYA 2VN6A 3GK8L 1G7HA 1HL4A 5GGQL 4P2OD 3Q6GL 4YEEA 4KTDL 2MJWA 1BW8A 3N44B 3UTPE 3WN5B 4RRPM 4NQTA 2F8VA 4HXBH 1OAXL 2VE6B 4KO6A 3TH2T 3MRIA 4X8JB 3C6SB 4OZGB 5CILH 3ZYJA 1JYWA 3UG4A 1A9EB 4YIQB 2XN9B 2D7OA 2OCFD 4U1HB 3A67L 1ZLWH 1KEGL 4PYGA 2CLVB 5D1XC 3T77B 3MI6A 2ADFL 1ITCA 5T5FH 4PJDF 1BJ1H 5C0BE 5DVKA 2YPVL 3NMEA 1BXAA 3B5TA 3V0IA 1RZQA 1J0ZA 2AW2A 3M46A 2NT0A 3V0FA 3II3A 1IE4A 5I8CB 4NHUB 3IGLA 1H6EA 2XJKA 1S46A 2V2TB 4R84A 1TU2B 2DKUA 1IJNA 1INEL 1I3GH 3GSRA 1V3LA 4KJYA 4QRRE 1NBVH 3DJTA 5MERA 1G9EA 4ZFGH 4LOEA 3AS3A 3QO0B 3DGCR 1ZK5A 5F0JB 3WAKA 5L2JB 3RVTC 3AT8A 1Q72H 1ZLVK 4YHIB 2WTRB 4L2LA 4Y4KC 1A6AA 3EJUA 4OFIA 5KSAC 4X8GA 4KMQA 4BZ2L 2VL5B 3O2WH 2M2DA 5F6IC 4ZDHA 1A1OA 2QTEA 4IOIA 4F7EA 4G6JL 1J8HA 1MIEH 2XTJC 4OJDH 1UB5B 1MRCL 2MPAL 4XXDA 2YEZA 3WIHH 4A7SA 1H0DB 5AW6B 2BY0A 1JZHA 4KXZI 3C2AH 4NBYB 4GH7B 3GZKA 3T4AA 2OJZH 5HDQH 2F1AA 5FIEA 5IIEB 1FL3B 1G9NL 3T04D 2F53E 1J88A 1UOWA 1N3NB 2JTYA 2YJQA 2UXVA 1C5CH 4DEWA 2XZCL 3FHEA 3LQMA 2R1YB 3ABLB 4XNQA 5SWZA 1T2QH 2VXVL 1F6LL 2P5EE 3F05A 4JZJA 2D7TL 1M3JA 5AW8B 3GM0A 5A1AA 2O6PA 4PV8B 4DCQB 4NP9A 1TYRA 1G94A 3ELQA 3GZPA 2WVVA 2Z4QB 5DSCA 1INDL 4F93B 3EHBC 1MCJA 1F1GA 5L2KA 3QXVA 4FDWA 1RZJC 2Q76B 1N59B 3I84A 2H2PD 3OKNA 3HEIB 1ZT1A 1YYLL 3SJVB 1N6QL 4W4OC 2CUMA 2NNFA 4HFUL 4QUOA 3KLHC 3C8KB 3UTSA 1X6NA 2IFFL 3KPQA 3Q13A 4YDNA 4X6BA 4NT6B 5J7CC 4Z7WF 2IGTA 5TDNB 1KJ2L 3NCJL 3OD3A 4PCKA 3RWGB 4ZPVB 2MTAA 4DFHA 3U0WL 1WP6A 4N2IA 1O6VA 3Q1SL 3GZOA 3IU4H 3L1GA 3MRRB 5E00A 4F8NA 3TLRA 1TNMA 2X09A 3L95A 5D2NC 5TF1H 2R51A 1W0VB 4HAKA 4XZUA 2OMVB 3MLUL 5I17A 2AKRB 4PBDA 3RVXD 4XXCC 4IHOB 4WF7A 5L4JA 2ZXWB 4LHQB 5E7BA 5EA0L 4LEXH 3X12B 4U1SA 3QULB 4AT6B 1K8IB 4GKSA 3CLWA 1ED3A 1JDCA 4WTZA 2X6CA 3BUBA 1HSBA 2GEQA 5F9AC 1F11B 4K94C 5F9OH 4X5RA 4CAGA 4YE0A 1CFSB 2ZP8A 1C08A 2O5NA 3PGDB 4YK4B 4KY1L 5C7XH 4QTHA 4E5XG 4EI5C 3IJ8A 2C9VA 1LXMA 4G5AA 5D7LA 5C08B 4I18A 3PPSA 3IAQA 3OMIB 1SDYA 4ETQA 4X99B 2JE8A 4GYBA 3BOVA 1QI4A 4KQ3L 3BZ4A 2NY3D 3S5LA 1SDAB 3R18A 5GIRA 1RZFH 3UZVA 2R56L 4JO3H 3TVMC 1DUZB 2E9IA 3OAUH 3OGCB 3VI3E 5DD0H 1Y6NR 1KBKA 2GFBA 2WMPB 3MRFB 2X4QA 1A22B 3KPSD 2J6WA 4ODHH 4E41E 4BH8B 1QFHA 1YEEL 4PGBA 4CC4C 3FB5B 3OZ9H 3CVDA 3P9WB 1RPQA 5TQ0H 4JY6B 4U6TA 3IDNB 4PY7A 4M5ZL 3Q8CA 4PS4L 1ND0A 1NAML 1V3MA 1XGYL 2VIRA 1X4XA 3LZNA 4GOSA 3L3KB 3RY5A 1S7QA 3VU2A 2EVFA 2Z64C 3VXRB 5B8CC 3BZ5A 3QDME 2GY5A 2JKLA 4RH4A 4XN9A 3VMNA 1T21B 5LBVA 3G04B 3IF1A 2GUOB 1WZKA 4YGVA 2EDQA 2FIKB 4NZJA 2B3RA 3UP1A 2SEBB 1UD8A 4JFDA 2X3CA 3QHZH 3NTCH 3LSOA 3ZKXB 1FGVL 3VGGA 3K1KC 2Q9OA 5DFAA 4LARL 1E6OL 1XH0A 2ITEA 1XXDC 3FUFA 3HMXA 3VXUA 12E8H 1OAQL 5I73B 4RIRB 1XWVA 4HQQH 4YVUA 4E41B 1BYPA 1NCHA 3KPLB 5D70H 1NCIA 4K23H 5EV7A 1G7PB 1MQ8A 2CO7A 1G84A 4C57C 3T1FB 2CPCA 3S9DB 4RMWA 3KW8A 2V7HA 4UQ2B 2DEWX 1I1YB 5C3TA 3KGUA 2JI1A 5G2NA 3UEZA 2M1KA 4NKQB 5TDPA 2B59B 3O8XB 1P1VA 1YAZA 5KBKA 1FLRH 2N7SA 2XNAB 1EEUA 2ILLA 2XFGB 4WEBH 5EULV 1UFUA 3IMUA 2EO1A 4PB0H 4R2GD 4IBYA 4JDEB 2VDRH 4M7KL 1KXQE 2LABA 5AB1A 5JO5A 5CM1A 2IG2L 1IBDA 4YN3A 1BIIB 3LZQA 1BFVH 3WIFB 4FTVA 3CC5A 4YJZL 2X5PA 3MRKA 4IMLB 4KRPD 3S98A 3L3JB 4QR7A 4N20A 4WW1A 4HBCH 4P2OC 3VFWB 4JJHA 5B3JF 3FOMA 3KPPB 1AO7E 2K4AA 2OSLA 5E95B 4KJWD 3D25B 1J0HA 1XBRA 1GSMA 1B9KA 2HFEA 3DTXA 3MNVB 3TA3A 5CP3A 1RPUA 1JV5B 4E9VA 2L0DA 3MBXH 5D8JH 4LPWA 2P5PA 4NBXB 1EAJA 3ET9F 5H94B 2ZX5A 3GMOA 2W9DL 1QSEA 1A4KB 5EDSA 4KQ0A 1RD6A 1XD1A 3VW3H 3FCTB 4LCIL 4XO8A 4JRXB 1DQQB 1RZGA 2PYEB 2XWJA 3VI4E 3HPJA 4K7PL 5EFIB 2GTWA 3TEZA 2VDLL 2J25A 1HHKA 1XB6A 5EEUA 2I5YL 3HPLB 5HVGB 4ANVA 3VMPA 3FO9B 4PBVC 2XZQL 1QHOA 5AYTA 5DF0A 3W0WE 3QBTB 4D3CL 3WY2A 1I8IA 3VTMA 2VN3A 5MI0C 1KGCE 4JFQB 1ZAGA 1ZS8B 3BAJA 3PWLA 3MV7A 3FTYA 3RKPA 1GY1A 1TLMA 1CFMA 1OP4A 4FMKA 3QI9C 1MHHA 3JTTA 3MO1B <