1M6UA

Crystal structure of a novel dna-binding domain from ndt80, a transcriptional activator required for meiosis in yeast
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
265
structure length
265
Chain Sequence
b'FKVGPPFELVRDYCPVVESHTGRTLDLRIIPRIDRGFDHIDEEWVGYKRNYFTLVSTFETANCDLDTFLKSSFDLLVEDSSVESRLRVQYFAIKIKAKNDDDDTEINLVQHTAKRDKGPQFCPSVCPLVPSPLPKHQIIREASNVRNITKTKKYDSTFYLHRNHVNYEEYGVDSLLFSYPEDSIQKVARYERVQFASSISVKKPFQQNKHFSLHVILGAVVDPDTFHGENPGIPYDELALKNGSKGMFVYLQEMKTPPLIIRGRS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ndt80 protein
publication title Crystal structure of the DNA-binding domain from Ndt80, a transcriptional activator required for meiosis in yeast
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription activator
total genus 55
structure length 265
sequence length 265
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-07-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1390 Mainly Beta Sandwich Immunoglobulin-like NDT80 DNA-binding domain 1m6uA00
2EVJA 1MNNA 2EVIA 2EVHA 1M7UA 2EUXA 2EVGA 1MN4A 2EVFA 2ETWA 2EUVA 2EUZA 2EUWA 1M6UA
chains in the Genus database with same CATH superfamily
4ZW5A 2V17L 4NQEE 2W60B 4Y9BA 1D6VH 3P3RA 3GSNL 4NXKA 5HHMD 2OV0A 1WFOA 3EJTA 4GXUN 4RMRA 2FB4H 3FH8A 2D7QA 4JJ5A 3ULUC 4WUUB 5DMKB 2Y1ZA 4LU5L 1L0XA 5FWQA 5B3SB 1OAQL 1YDPA 2XQBH 3GXUB 3WMQA 3BDBA 4N28A 5JDSA 4Y2DA 1I1FB 1G7HB 2Q86A 1EBAA 3HZYB 1HN1A 2LT9A 3AM8A 4D8PB 1A0QL 3RZCC 1YQ2A 3NCJH 3PXJA 5GS0C 1WT5C 5F89A 3OLGA 5KUKA 5IJBC 4BCXA 4X99A 4X80H 2XZQL 4YFDB 4DVBB 1LE5A 4Y9CA 5L0QC 1DQMH 3TYGH 2PW1B 4NUPA 4FMKA 2NY6B 1H5BA 3OF6D 3DRQB 5I5IA 2E6JA 3L17A 1T7WA 1OTUC 1H6TA 2JKIS 5E1HB 1RIVH 3VRIA 1OQOA 2DDQL 2VISA 3GTVA 3MLSH 1A6VH 2J6EH 3PIQB 2O61B 3NA9L 1OP9A 2B1HH 1T21B 3FCTB 2BRRL 1I9JL 1F8TH 4LPCA 4FXLA 3CXDH 5EC2B 3TN0D 1G9EA 3ESNA 2BVOB 1BF2A 4EUPA 4NRYA 3CN4A 3NSCA 4RNRB 2DWSA 3SYAA 2P5WD 2I9TA 3HHSA 3A6CH 2OMZA 4TKWA 4TSCL 2MCMA 1H3PL 1MUJB 2HRPL 2ICEB 4N5EC 4P8QA 5L88L 1IGCL 5CCKL 2E76C 4G8GE 5ESQB 1IBZA 1UOLA 1E50A 3KH3A 3TA3A 1AIFB 3MTXA 4ZMNA 2VZ3A 4JLRB 3ZT6A 2QFPA 5BQ7A 1ACYL 3PDDA 3PNWA 3FXIC 2G9KA 3J07A 2ZQKA 1VPOH 3PWLA 2Z0UA 4RMUA 3FQYA 1S5IL 3LXUX 2C9RA 2OSLB 4GSRA 1OGAD 4M3HA 2WLLA 4XNZC 3W5MA 4GQZA 4LB8A 2D7NA 1DBAH 1F6FB 1PKQA 1XF3A 3KS0H 4JM2A 2LQRA 3WENA 4ZS6C 1AGCB 3R0NA 3D6GA 1G9NC 3U7WL 4RFEB 4IBUA 3GS4A 3CFQA 4S2SB 4Q4EA 4LNRA 3EBHA 3ZO9A 3C6LD 1HYSC 4M4RB 4OGYH 2BHZA 2W1NA 3CMOH 5I1CH 2TSAA 1M42A 2EXWC 4OSUH 2GJ6B 5I0XA 4OJDH 3ZBMA 1PZCA 5BVPH 1LMIA 5DMGC 2EDEA 1ZV9A 2OTUA 2VDQB 3KPOA 2QELA 3L1OH 5D2LF 4F57H 1TKWA 2Y06H 1FFNA 1J5IA 3NA4A 1Q72L 1X7SA 2Y7QA 5H35A 3TWCH 2XYBA 4FYSA 3ELAT 2Q7AA 1DQDL 3BISA 2RB8A 2HX8A 4MNQB 4FI7A 4WW2C 1Q0YL 2XNAA 2Z34A 4QF1A 3K46A 4KTEH 3ULVH 1JFHA 2F5AH 1G6RB 2CRIA 2VQTA 1FJ1A 2YLKA 3I3EA 2QADC 4O4YH 2CGRH 2OS7A 1KPUB 2X7LB 2XX1A 4LARL 2BOLA 5F89B 5FYKU 1NANH 4X99B 2NY2B 1M4KA 1XB8A 5F7FA 3RVWC 1KNOB 5GGTH 1LE5B 1X5ZA 3GKWH 2ZCLL 3IS1X 5I6OA 2V5YA 3BKJL 3GS7A 4H25B 3ZKXC 4UAOC 4GT7A 4AW4A 3QUZD 4ZMQA 1P7BA 1E40A 15C8H 1A6ZA 2KQNA 3CSYA 3KVDD 2L0DA 3HVNA 1OD9A 2FJGA 5KVEH 2A99A 1GR7A 4EUPB 1TJGH 4NRYB 1JHTA 1XV8A 3D85A 2I9TB 2AJUL 3HHSB 3OWRA 2FBRA 2PR4H 5I30L 3D2UA 3G5WA 4PJBE 4AVIA 4FG6C 4MS6A 4X4XA 4YWGH 4NBXB 2Y07L 4Z7QB 4Y1AA 3TA3B 3T3PE 1NCDL 4IS6A 5F7YC 2VC2B 5AW4B 3SDAA 5BQ7B 3GXTA 4NWTH 3NT0A 4YGAB 3PNWB 5JHDA 2XVKA 3W5NA 2AQNA 4PJGF 1F4WL 4HD9A 1OAKL 3CFJA 3PWLB 3RTQC 5D6CA 2DLFL 1ZXQA 4P05A 2WLLB 4XZUA 4JREC 1XTLA 3MYJB 1BLNA 4QJ5B 4X6BA 5GZOD 5IQMA 2YJLA 1PKQB 1XF3B 4JM2B 5AOIA 1BWMA 3UIZA 4RGNC 3G9VA 4POUB 4GMTH 1NCGA 4F9PA 2C9UA 4LNRB 3LNGA 4YX2L 3CC5A 4YDMA 2UY7B 3WN5C 4H8WL 3L3HA 2DIAA 2YD4A 3V4VH 4RETB 3GSUB 2ZZUT 4KZEL 1L9RA 3QIBC 4Z1PA 2IALB 2BS71 5D8JH 1JPGA 4TNGA 3QDJE 2VDRL 1XF5A 4HJIA 3T65B 4NN7C 5JUEH 5C0EB 3KPOB 4FKHA 1TKWB 1FFNB 5HYSG 3ASOB 3FF7A 2BIMA 1CPUA 1TCRA 3UGXA 2Y7QB 5T1MA 4AZ8A 5H35B 4FN0A 5CR8A 4P2RD 3JXAA 4FFYA 4U6TA 1FH2A 3L4XA 5F3FA 2DOCA 1W91A 2QQQA 4Q9QH 4E5XA 1CLVA 1QTPA 4IGBB 5E8NB 5B38G 4XN5A 1MW2A 2WGXA 2XNAB 3HHMA 4QCIA 1MVFA 3JSSA 1JZ5A 5JO5B 1FJ1B 1UWXH 1MFAL 1A7PL 4GEJA 2VWEC 1XGYL 4G6KH 2OYMA 1R33A 1RUPH 1I1AD 3OSKA 4YC2B 4YHPA 4KPHH 2CHZA 4TOYL 1ZWIB 2VN7A 1T89C 4MXWH 3GLZA 4UZUA 5JIDA 1T2QL 3SE4A 4DZ8A 5IKCB 5IGXH 3MLTB 5D5ME 2DEWX 5LGYA 3UC2A 2AXGB 4Z7OE 3OAZH 3KW8A 4WUUD 3KGUA 2LGNA 2B5IC 4HPYH 3BKCL 1G7JA 4H8UA 3RAJL 3MRKA 3BUDA 5C2BL 3ARGC 2V5RA 3BRGC 1AHMA 5D2NA 2VLMD 1KENH 4JAMA 4TNVK 5K69A 3LJ3A 5E6SB 5B39G 1PG7X 4M48H 3UTSD 1JHTB 1X5IA 1BWWA 1SOQA 3D85B 3UTSE 4PGJA 1I7UA 2H47C 1TPXC 4KK6D 1MVYA 4GP8B 2NY6D 4MB4A 3REVA 3D2UB 4Y5XC 2JKSA 4H1LB 2ATPA 3BSZA 4LGSB 4RBPK 4X4XB 3G5YA 3TH3T 4Y1AB 3DUHA 3LZRA 5E4AA 5G4OA 4IS6B 1I9RL 1L0PA 1XAUA 3SDAB 3T2NL 4DIXA 1T03L 4JFZH 1NBQA 4PRDA 1K8IA 2P8PA 2X4SA 2DLTA 3Q8CA 3B7TA 2Q20A 4ZFZA 3MUGA 4R7VA 2OL3H 3CFJB 3FTZA 5CFHA 1JHKL 4M00A 3ZOAA 4XE5B 1QBMH 4XZUB 3S8WA 4HGWA 4FQ2H 1EHAA 4Z7UE 1BLNB 4X6BB 1SHMA 1J9SA 1ASPA 1MW3A 4GKNA 4PGCB 4IM8A 1ZLSH 2PTVA 3L9EA 4YJZL 4AMKH 5CN3A 5GRUH 2AV7A 2ICWA 4GP5B 2OR8A 1CDUA 3CC5B 2X3CA 1B4RA 2DMBA 1Q9WA 3GO1H 4O2FA 4ZTPH 3AROA 2PPFA 3OHMB 5K9OA 1XGQB 2MHAA 4QHPA 3WSQL 2MJWA 3DJRA 1YCSA 1UD4A 1FC1A 1JPGB 4WJKB 2CQVA 4ANWA 3EH2A 4ONGH 4U4IA 1IBGL 5IB1B 2JELL 4HUXA 4P3DB 3QJXA 4ORZC 2X0WA 3H42H 3PJSB 4NWUL 5DUPL 4LAJH 1NWOA 1QNZL 1TCRB 4DKDC 2DJ4A 5IT2L 2GJPA 4JCWA 4AZ8B 3EOAA 2A6KA 5D96B 4AV5A 2KZ1B 3B2MA 3S35H 1J1PL 3CFDA 3OKKA 1NEUA 5E8PA 4YHOH 3B7RL 2WK2A 5FYLD 5GZND 3LN5A 5FYLE 1WWBX 1Z2KA 4QCIB 1ZXKA 3ML8A 2C3GA 3ZRCC 5CXPA 3AC0A 1GYWA 1U2HA 2EIJB 4K3HA 5FKPA 2R29H 2BW5A 1A5FH 2J72A 3AXLB 5JW4N 4F3FA 3OPZL 3O11A 4M7KH 4JFDA 2XACC 1ZD6A 5E4EC 3UPAA 4DZ8B 4HCRA 4J3BA 5E2VH 32C2A 5AW7B 1U3HC 4AVHA 1WG3A 1QSVA 3NFNA 4OT1H 1V7NL 2BMKA 2BHUA 5C0ND 1U8JA 4Y2DD 4Z7QF 1EHNA 4CDHA 4PSRA 5D2NB 3TF7C 2VABB 2C9VA 4K3EH 5DGRA 3W39A 3B7YA 3IDYB 1UEYA 1I7UB 4XHJD 1Y7VA 1FE8L 5D7IE 1E5YA 3DWTA 3REVB 5HVHB 3N40P 2ATPB 5DUMH 4JM2F 1RIHL 3HZVA 3SGKA 2XI9A 3UXFA 2HKHH 1F3JA 1JF5A 1BFSA 2BSSB 4PRDB 1K8IB 5F0PB 2TAAA 1E42A 1I8KB 1KZQA 1A4KA 4WNQB 4ZFZB 3MUGB 1AXTH 4XBEL 5A7EA 4JVUA 5C0AE 3S6CA 3Q2CA 4MA1C 2AS5M 2CO1A 1SHXA 3NRFA 2P24A 4PVLA 3FHEA 5IJKA 2FX8H 3MTRA 4HGWB 4OF5A 4F1ZA 4PY8J 4BHUA 1YN7A 2K7PA 5EU6E 5DC4B 1JGVH 3WLBB 3F64A 2BX5A 1KB5B 4JDTL 2ICWJ 2YN5A 4RESB 2AV7B 3BKYH 3TA3D 1DSFL 5FYJD 4ELDA 4U7KA 3ULVC 1Q9WB 4LE8A 1EDYA 3IJSA 2MHAB 1FG2A 1Q1JL 2UY6A 3K72A 4WHTA 3WUWA 4PW9A 3BT2L 1WWWX 3QA3B 1NCTA 4BZ1L 3WFDL 2P7TB 1HOEA 3IETB 5CINH 3Q6GL 4PJ7B 4JM2D 3BVNA 2FCBA 3NIFE 4OFYA 4A6YB 5LNGA 1K4CA 3VFWB 4KROC 2J43A 2DQFA 4UINL 4JPKL 3CFDB 1CFQA 3EJQA 5E8PB 5KANI 3IAGC 4RQQA 4PJDA 3IN2A 1Z3GH 1VERA 2IAMA 3LN5B 2VH5L 4J7RA 5I75C 2AJSH 4IRJC 2WN2A 1IMHC 1YC8A 5CU9A 1KIQA 3D25A 2NUTA 4Q6KA 4GG6E 3O3DA 4F3FB 3O11B 2VT0A 2E7HA 3L7EA 4NP4H 3STBA 5IHBA 32C2B 5HDQL 3AT8A 2BY3A 1S46A 3BP4A 3H9ZA 3LIZL 4QXGH 3QEHB 1JERA 2V4LA 3GSVA 2DW5A 3NFNB 1T0NA 2XXGA 4L8SA 1KXQE 3FQXA 4Y88A 2BMKB 4NP9A 5DT1H 4DEPB 3QUGA 5IR1A 2QPUA 2EC8A 4HFUL 2EP6A 1U8JB 3K0YA 3DTXA 5AL0A 5A43C 4QRSB 2EKJA 3VGBA 4CBZA 4O58H 4AH2A 3O6LH 3AZUA 4JO4L 2BFVL 1EV2E 1PEWA 2IDCA 4RMVA 4OKDA 1KIPA 4ECNA 3ZXAC 1X5JA 1KJMB 2CLZA 2X2IA 3S97C 1I7RA 1AC6A 1NBYA 3PHSA 4R26L 4R3SA 4AJ0A 3QYCA 2FEJA 4BD4A 1WCBA 3A4DA 1OSPL 3KLHC 1TTGA 1KTDA 2IQ9H 2WNWA 3KYOA 4LLWA 4TTDD 4RWYH 5GSVA 3RY6A 5IUSA 2A0LD 1F00I 4X5WB 3R7QA 3E3QC 4JFWA 4C4UA 4F93B 1PPIA 3RL1B 1VFAA 4HWZA 4EE2A 1Z0MA 2WKLA 4LSQL 2W88A 1ODAA 2YK1H 4M6AA 4TUJA 4YZWA 2BP5M 1AGDA 2YWZA 5HI3D 5EF3A 3MV9E 2P24B 2VAAA 4JDEA 1QYGL 2F2HA 2VLKA 4I2XA 4O02L 1HL5A 3D85D 1YN7B 3DJZA 2AEQL 5FCSH 2FQDA 1NGQL 3QSKB 3GJEA 1RK0B 2FVNA 2OTPA 2X4TA 2R4RL 4ZK8A 3D2UD 4G1EA 5KSBA 4JFEA 2B7DT 5LG6A 2QV2A 1FA4A 1EAOA 4Y1AD 1NMAL 4HALA 1ZHKB 4FZEH 1YEDA 3SDAD 2ARJQ 3V5DA 5BV7H 4IQHA 3TT1L 3H9SE 5JHDD 2A6IA 4KO9A 1DQQA 3IJSB 3A0OA 4UAHA 5HDBB 3VRLE 1FG2B 4AYID 5JHDE 2FATH 1YECH 2UY6B 3K72B 2HLEB 4WHTB 3WUWB 3CVIH 4U3XA 1Z9LA 1J0JA 1QLEL 4WFEE 1SHSA 4G9FA 1HNFA 4J12A 1A3QA 3CNKA 3OMNB 3EOYG 1XGPA 5L4JA 5DLMH 4C56E 1AZVA 4LSPH 1TQBB 2Q6WA 3BVNB 3HBQA 1K4CB 5CZRA 3O41B 1QSZA 1R4XA 2ZCKH 1B2WL 3JYCA 4OB5H 2DQFB 1F58L 2B2XL 1X5XA 4QOKA 3ZMEA 1U8IA 1CFQB 2HVKA 2IOIA 2VRAA 1BBJB 3NQKA 1WBZA 5I6PA 3OWEA 5EZOH 1Q0XL 2R2EA 3NIDB 1CS6A 1ADQH 1CXHA 4PYHA 1KIQB 1AXSA 1MFBH 3D25B 3T2LA 4PJ9C 3O3DB 5EOTB 1TDQA 3O2DA 2FHFA 1SXSA 4AT6A 3P9MB 5I1HH 3EDFA 2J55A 4F58L 1L5GB 3L7EB 1A14H 2VDLL 3B9KC 3BP4B 3HNSL 3QULA 1LO5A 1QKZL 2F0CA 2YLHA 3GSVB 4XP5L 4M8VA 1OAZH 3FQXB 4S1RL 4E9WA 1BCIA 1CD1B 4P46A 4LVOB 3DTXB 4UU9A 2X05A 2WD0A 2Q1EA 4FL4B 1N0LA 4MMXC 1QHOA 5J1AA 4PGZA 3NDYE 3K71A 3D2TA 1P6WA 2Z35A 4PTUA 3L4ZA 4WU5A 1KIPB 4JM4H 1RJYA 5LBSA 3WKQA 2E47A 2CLZB 4R3SB 2UXGA 2W9EL 4ZW8A 4M5YH 4JEGB 2HTLC 1BZQK 3HBGA 3LHPH 4JDVA 1PLGH 3SKJL 3PU7A 5GSVB 4ONHB 1CU4H 1ZT1A 3X14B 3OC8A 1N64H 2FBOJ 2DBLL 2WXGA 3BAXA 2Z8SA 5DMIL 1BEYH 2N59A 4M93B 2M1KA 3ATFA 3R18A 4XI5C 3I2CL 3KJ6L 4L18A 1VFAB 4YK4C 2WQVA 4IK7A 3IF1A 2X70A 1GCYA 4A7VA 1TCMA 3CN0A 1G7QA 5FYKE 3O0LA 3QCVL 4P5TC 2R56H 5K5YA 3RGVC 4NZUH 3O6KH 3FRPA 5E6YA 1HS6A 1KJ2A 1AGDB 2ADFL 1Z9OA 2W8CA 1CLOL 4M9PA 1A3LH 4JDEB 1RSFA 1VADA 4NAJA 1AYOA 2VLKB 1ZVHA 4LBAA 3KBFA 4UNIA 1M1XA 2A3TA 2Z7YA 4L1SA 4NOFA 4CSSA 3GJEB 2HG5B 4Y4HA 5AB1A 3PUCA 2I7OA 4G5ZH 5GQBA 4TQPA 4H26A 3VG0L 4BUHA 4K15A 5KZCB 1GPOL 3EADA 4B6ZA 5KSBB 3CBJB 5FLUA 3DNKA 4Q6YA 4PJ7F 1ZEAH 3TP4A 2OPCA 3S37H 1YEDB 1XF2A 4U49A 4N90E 1O75A 4K7PH 2A6IB 4BSVA 1DQQB 4CMMA 1IU1A 2YUWA 3I3BA 1SBSL 3T4YB 1TZ8A 1A22B 3ZIMA 4ZFOL 3P9LA 1WHOA 2Z0BA 4XVUC 1EZVY 1S5HA 5FLVA 5IJDC 1RZPA 2P80A 1SBBA 2G75A 2JCCB 3FB8A 4G9FB 2NW3A 3DIFA 4DKTA 4QRPA 3D1MC 2HA1A 1R17A 2Q6WB 1O6VA 3UAJC 4HIIB 2D7OA 5DD1L 5E8OA 1RVFH 4KZDL 4ZDHA 3SO3B 4KXAA 3GRWL 2R4SL 3TJHD 4UT7L 4KQ3L 4I18A 4QOKB 4S1SH 1U8IB 5CS7A 1KJ3L 3BP5B 2QSCL 4H8VA 1OZUA 2WQ8A 4UT6H 3GXFA 5L9DH 1FORH 2A9ML 1K2DB 4PSPA 3ZE0E 1WBZB 4L8BB 3DGCR 1NMBH 2CKBL 2ICEC 1O5DT 2R2EB 4XXWA 2PP9A 4QXTA 1AXSB 1CTOA 3TPUA 2CKNA 2DB8A 4TVPE 3IU4L 4ODTL 2KS0A 1ZS8A 3NAAL 3WV0A 3KXFE 2A74A 3F12A 4AT6B 4NKIL 1P6AB 1E8XA 4JB9H 3GC3A 4W6YB 1N3NA 4UQIM 3ZT5A 1SVBA 2IDFA 5GRZA 4JS7A 1BYPA 4XOAA 4B9KC 3CXFA 4P46B 4JGNA 4OR1A 3SY0A 4ONFH 5J1AB 1A9BA 2E3VA 2YEQA 4G7YH 4D94A 3K71B 1OLLA 2Z35B 6PAZA 4PTUB 5DC0A 4JY5H 1Z6JT 4K9JA 1BZ9A 1P69B 2X1QA 4JFDD 5I6XB 2WXNA 4KO6A 2H6OA 4JDVB 4JFDE 3CZSA 4Q14A 3RDJA 1OV8A 3Q8FA 3VXRA 5EBLA 2EUWA 2ZWYA 1IFGA 2J3SA 4OCYH 4AVKA 3VXSA 3H8NA 3T8VA 4BCZA 4OBSA 1XO8A 1OSZA 2XWCA 2X70B 3IF1B 4FHJA 5EORL 2QQLL 1A6UH 1G7QB 2TRYA 4NFDA 5E4IA 4JJOA 1VSCA 3FRPB 1KJ2B 1RZQA 1I3UA 5E5MA 1KJVA 1NDGA 4GAJH 1FVCA 5HDBF 4J5VA 5EEYA 1YUHA 2OYPA 2VO5A 1VADB 3ZL4L 4X5XA 1UD5A 2MEJB 4WHCA 1M1XB 1QI3A 1D6EB 4TLUA 2XZCL 1CXFA 2P44B 1ZT4B 1XIWC 4BZYA 3GZKA 4G3YH 5KSVA 1VKXA 4H26B 5IROA 3BLPX 4IRSC 4PV8A 3SCMA 1EGJH 4OLXL 2Y72A 1DQLL 3DTUB 1EAJA 2A4ZA 4PG2A 2WB1A 3D50A 1FYTA 2K8QA 3ETBJ 3AITA 4BSVB 4CMMB 1J88A 3MJGX 4G6MH 2NY2C 4M6NH 5IBLD 1JVKA 3P9LB 4BH8A 2Z91A 3G5VA 2FJSA 1UXLA 2G75B 3FB8B 2ATAA 2CRYA 3FFCA 1CBJA 2Q9OA 3FQRA 3QZWB 2WXFA 3NIDF 4WHDA 2DIBA 4OBRA 1PZAA 4FKKA 1AQKL 3HPJA 5E8OB 3BGMB 3RIAF 1UZ8B 2K6WA 1JPSL 2ZNWA 5IV2A 4UQEA 2ZP0T 3L95A 3FU8A 3GF8A 1NDTA 1R47A 2YZ8A 2JKJA 5ICZB 4NI6A 3BDXA 4LDOB 4BFOA 2BSTA 1F6LL 1E6JL 4X4ZA 2QMKA 3UZVB 1TZHA 3KPLB 3V0WH 1N5YL 3OM3B 3F7PC 3TPUB 3VMOA 2Y9RT 1CLYH 1ESOA 3P4OA 1P4LA 1K3ZA 4JG5A 5DJ8B 4BQBA 2A74B 2NTFA 3H3BC 4OFYD 2QQNL 1WBXB 2H2PD 1AFVH 3WIIL 1N3NB 5IEKB 3DMMA 1XH1A 2QT6A 4N2CA 4YSTA 3FUFA 1LEKA 2W5PA 3UX9B 1HWGB 2Q76A 4YHYB 1ILSA 2P3YA 3HCVA 5GGSY 1U3NA 2IAMD 3SYCA 1JNHA 2BDNH 2Q10A 4PJDE 3SY0B 4U6HA 4HK3J 5A2BA 2YKLH 3PS6A 4JMXA 4K4KA 2A77L 1WD8A 4J6RL 3QAZB 3V5HA 3D0AA 1QUNA 3TX4A 2ZOOA 2VQ4A 3GMNA 3O4LA 1FGNL 5CEZL 4LEXL 4E5XG 2A9NL 4R5XA 3UYRH 4YHLL 5BV7C 1ORQA 3OG4B 3GZQA 3TO4A 4W4OA 4L4VB 2OP4L 3WY2A 3VXRB 3QHFL 1AE6H 5EBLB 3EDDA 4DP8X 2YMOA 4XGZA 35C8L 2EH7H 5KSBF 4Z0BL 1A9VA 1JMXA 1OSZB 3RFZC 1FGVH 2AK1H 3ARBC 1V5JA 3OKDA 5MEOA 5IESL 2KT6A 3IFOA 1P53A 5L4FA 1KJVB 5I1LA 1FVCB 2IGFL 3LEXA 2VSMB 1YUHB 4RAHA 4U2YA 3V5KA 3Q2LA 1NSNH 2C9XA 1NCJA 4LQ1A 4A2MA 5JQ6H 4CUCA 1EEZA 3C8KA 3V0HA 1VKXB 2PYFA 2IGLA 2JCCF 4IGBC 4TUOA 4XN2A 5BRPA 5KSVB 4J8QA 5DHYA 4PV8B 3SCMB 5GGTA 4HWNA 4LVNC 3VFMA 1MHHA 5I1KL 1S78D 4DGIL 1FYTB 3GLDA 1A25A 3CFIC 3CUPA 2FX7L 2XT1B 1YMMA 1BREA 3FU5A 4CL7A 4M5ZH 2VDOB 3MRQA 5CZXD 1OAYL 4BH8B 1WZAA 1UA7A 4ZODA 4DP0X 1ZVSA 5CAYB 3B56A 8CGTA 3VXTA 5E00B 2VLKD 1G7IA 4HIEA 4HWEL 4NRZA 3LKNB 2PYEA 4I2XE 2Z4QB 1MRFH 3N1FC 3H7LA 2HH0L 5T5NG 4YSUA 4KDTC 5KZCD 2HVJA 2I69A 4DVRL 4PVBA 5IV2B 4JFED 4MA3A 2OX5A 3L95B 2FR4A 8PAZA 3EJZC 4JFFB 4L5FE 1W8EA 4JFEE 4NC1C 4R97B 2J2ZB 2LTQC 1AOHA 5I82A 4J3WA 5F6HJ 3BPNC 4M7LL 2ALWA 2BSTB 2NYYD 4UBDC 1TZHB 3FF8A 3CZUB 4WI6A 1IBBA 3ZZQA 4NNXB 1NBVH 1SJHA 1AJ7L 3O9WC 3M1OA 1TIUA 2YPVL 4G9FD 3RDTA 1NAMH 3INUH 4B97A 3NFSH 3P4OB 1KBGL 1P4LB 1UJ3C 2YGPA 4ZT1A 2HTKD 3ML9A 1N8OE 2NTFB 4G7VH 3KS0J 1D9KA 4IOFC 3WFCH 1HQ4A 1TJIH 3P0YL 2AQTA 3WIHL 5C08A 3ZKMC 3DV4B 1DFXA 3N1GC 2DJUA 1MJUL 4XP9L 3SKOA 3DMMB 3RIFK 1LEKB 3RVTC 2CHNA 1G0YR 3II2A 3QYNA 4QOKD 2VXSH 5I17A 2Q76B 2ZP9A 3HCVB 2GI7A 4QOKE 1OM3L 1JNHB 1TR7A 4U6HB 1GJIA 1RZIA 1BIHA 1NJ9A 3H4FA 4HETA 1X5MA 3V4VA 4H0LC 5HHXH 1DQKA 2QDWA 3V5HB 4L9LB 1QUNB 5JIMA 1HXYA 3BGAA 1EDHA 3GMNB 5A3ID 4MZ2A 2WUBL 1QUPA 4CVWA 3LKPB 5D55A 4ODUB 3MGAA 3MJ9L 1R3KB 1IL1A 4NERA 1J12A 4DN3L 1PAMA 2UZYA 4RRPA 4KK5C 3SDYL 2P5EB 1X5HA 1WLHA 3LZNA 3PGCA 4XGZB 4EN2A 3IWUA 5D72L 3G6AA 4P46D 4WTXA 5I23A 3C8DA 4G6FB 3LKOB 3E2HC 4BKLA 3OKDB 2YD7A 2WN3A 3LS4H 1JXKA 2NYKA 2VM9A 3V52L 1NCCH 3IFOB 3MLZH 3NJMA 2XLLA 3LEXB 3KNBA 1D7DA 3POHA 3V5KB 3G08B 1F3RB 3RKPA 4X4ME 1XH2A 4LAQH 3PPEA 3FZUD 3C8KB 3ASWA 2PYFB 1IBYA 4TUOB 3WNOA 1AO7B 3ISRA 5DHYB 1R9FA 1CK0L 1I1CA 4NIYE 2FJFA 5LKNA 4MJIE 3U4BL 2E7BA 4N25A 4JO2H 4Y4FC 3CUPB 1AR1D 5BS0A 3BKML 1YMMB 3X17A 2CPUA 3MRQB 4QY8A 1IAKA 1N2RB 4GMSL 4WO4A 1XXFC 1QEXA 2W9DH 1ZVSB 2AMUA 4R4FL 4BINA 5ABZA 5EEXA 1G7IB 4HIEB 4NX0A 4PJHB 1ZV5A 4MTMA 3VNYA 2X2HA 4Y4HD 5IFHL 4WI0A 3LNIA 2HVJB 4FFWC 3ZDYB 1GZPA 4WSKA 2UVFA 2OX5B 4MA3B 4NYLB 2FR4B 3OL2A 2WNKA 3UCQA 1KEGL 4FS0A 5I0VA 3RNQB 3BPLB 5DVOA 1FH5L 2WB7A 4GQQA 3MOBH 4U1SA 1VB9A 2CMRL 4JHUA 2VR7A 2RIKA 3ZRSA 3RVVD 5HVHC 4JHBA 2H6UA 2P80D 4EMZA 4DOHB 3VD7A 3RDTB 2OL3A 4ZJ9A 4QRPD 3S9DB 1BM7A 4QRPE 1D9KB 4OIBA 5AL8A 2WVUA 2QL1A 4JQXC 4HOMA 2YXVA 2GG1A 3SKOB 2D0FA 4B7IA 3WUWG 5I17B 4OGAD 2MNUA 2G5RA 3VSUA 5E9AA 4EI6A 2VWEE 5I18L 1DFBL 2AI0L 4W6WB 1RZIB 1E4JA 2D7TH 2FYYB 2NNCA 1IGTA 4IKIA 3UP1A 3V4VB 1W8OA 3P9WB 3CK0H 5CEXA 3C6SA 1IM3A 2BOCB 1TZIB 2JLLA 4C47A 1OTTD 3JT0A 4BA8A 3T3MB 4FXGC 3ZZSA 4DGVH 2WC7A 1IL1B 2ZWLT 3ZHFA 5F7UA 2UZYB 1XBRA 3RGVA 1CFNA 4AEIL 5CBEB 3DARA 4FLRA 2R0KH 1S9KC 1Y0LA 3PGCB 5K1JA 5F2FA 4XVJH 2NY0C 5FS5A 2OYLA 2ZUYA 4E2OA 2KZWA 4G11A 4BKLB 3PWJB 4GW4B 1ML0A 3UJJL 3RBGA 3QUXC 5ILTL 3FT9A 4A2DA 1J8HE 1MI5E 2FQFA 1P4UA 2W92A 3GZPA 3WG7B 2DTSA 1KWGA 1WZLA 3ZW3A 4ACTA 3C75A 2WLKA 4JZJA 2R29A 2C7UA 3QQNA 1BZOA 2EDXA 1BJ1J 1G1YA 3JBG7 5SWSA 3WGUB 1C5CL 2FJFB 2NX5A 1CIUA 3VXRD 3US1A 2PR9A 2EZ0D 2N0KA 4I0PA 3O6MH 3VXSD 2HG0A 4HEME 4DZBA 3VXSE 3W82A 4DK3A 4N8PA 4M7JH 4PB0L 4QY8B 4IJTA 1IAKB 1QPPA 2E46A 4F5CA 1M05B 1ZA6A 4ZXBA 2XPYA 2CJUH 3CQFA 2CA4A 2MNJB 1INQA 2ZXCA 5D1QA 1UHVA 1S9VA 3RWDA 5I1IH 4PUBL 3FT0A 3BEVB 3T04D 1YY8A 4M6OL 4WI0B 4Y19B 1ZDSA 3VD9A 3II3A 3SCMD 3BHBA 5KAQF 1GZPB 1MRCH 3K4AA 1BMWA 5E6IC 4XNBA 1RMFL 2IVFC 4P99A 1FYTD 4FG0A 4YDKL 2B77A 3TFBA 2IXQA 3AQXA 3KHQA 1EX0A 1UH3A 3IPEA 4KK8C 2WXIA 4UQDA 5KOMC 4U1SB 2F9BT 3RGBA 2B9AA 4FNLH 1UQSA 2VDML 4XNQA 4PLKD 5CLXA 1RZJL 4QNPE 3QEUA 3TESA 4FXTA 4NQVA 3BRFA 2DN7A 1JL8A 3RU8L 4U1GB 4FLHA 1IE5A 3EFDL 3FFCD 4LMQI 5TE7L 3U48A 3X1FA 1R5VA 1N0XL 4LKCA 3FFCE 4CRPA 3VYNA 4B50A 4TLKA 4DKFH 5ALBH 1T83C 4YXLH 4KJPC 1KGJA 4G43A 2DMKA 3HNVL 2VR4A 4C58B 5F6IC 4EI6B 4F1SA 2ED8A 1BYNA 1PG7H 1EZVX 3GPEA 5JLZA 2AABH 4J23A 3SD5A 3MRFA 4Y2NA 1YEGL 4PRHA 4U3CA 2APVA 2ZAHA 3NDZE 5CEXB 2VZSA 1DCLA 3SOBH 4JE0A 3HVDA 5EO0A 1X6NA 1X7QA 4K94C 1BGXL 1ZJAA 4P59H 3A6OA 5HHOA 2NY7H 4HAGA 4KKLD 2IJ0C 4MWFA 3DMMD 3VU2A 5GGVL 1OGTA 1YYLH 5E2WL 3V0FA 4G6AD 4WV1C 3BMWA 1IZJA 4Z3HA 4HIPA 5E6RB 3GRGA 3MMEA 4XN1A 1OP3K 2GBUA 4EZJA 2R9HD 1EXHA 1U8HA 2WP3O 3CPLA 2HCZX 5SWZA 1GY1A 5CILL 4NNPL 3CX5J 3QAQA 3IE9A 4HP5A 2K9UA 3O4LD 4OFKA 1DBMH 3QHZH 3RJDA 4JZJB 3NGBC 1FCGA 3O4LE 2VR3A 4WI5A 1EFXB 4HQQL 4MVBC 5SWSB 3TO4D 4HUWA 3M8OH 4PJHF 2ID5A 2RACA 4LF3A 1WC7A 4I0PB 3GI8H 5IMMA 1WEJL 5HGDA 1FNAA 3ZDYF 1H3UA 1KGIA 3UGUA 3D18A 3PPSA 3ZTNL 3ETTA 3UH8A 1ZIAA 4G6FD 3L4WA 3UAAA 3Q5OA 1WVZA 4YIQB 4ZXBB 1MWOA 3H7BA 3NP3A 4U1KA 5D1QB 5MERB 1S9VB 2B1AH 5D7KE 3VD3A 2VXQL 4S11A 1I1YA 5L8KB 3ULVE 1UGNA 5JZ7C 1YY8B 3HBZA 4PBDA 4QKTA 3ALXA 3BHBB 4FL4C 3B2DC 2BIPA 5FKAA 1EDQA 4OLWH 2G2PA 1B4JL 3CSGA 4KUZL 1DHKA 1MFVA 3W9EA 3PDOA 2QPFA 1QFOA 1YMMD 2C9PA 4GINA 4MNHB 4JO5A 3UO1L 3GXPA 2WLJA 5KTEL 5DDHB 1MDTA 4HMDA 5AZEH 1MFCL 1UQSB 4XNQB 4LBEB 1JYXA 3GHEL 3H56A 2BVYA 1VDGA 4NQVB 1CFBA 4PBVC 4GSDH 5ALCH 4IDLA 1QSFA 2CO6A 3VD2A 3E8UL 4XHQA 2VXVL 4TNWK 1R5VB 4LKCB 3TCLA 2PYED 3B7UX 1IC4H 4WDIA 1FZOB 5HGBB 5KVEE 3C9NA 2PYEE 2WYTA 5DURB 3T3MF 3TZVA 4FFVD 4C59B 2P45B 1W72H 4LRIC 3ZDYE 4CU7A 4G43B 5F8QC 2XA8H 3S34H 1MRDH 4BQ8A 2VSCA 1ZGLP 5JLZB 1J0ZA 1DJGA 4PRIA 2DQIH 4IBSA 4W9EC 3IU3A 4PRHB 1BDYA 1E67A 5F9AC 1HJBC 3S3JA 3V9EA 3RDTD 3E1F1 3QUHA 4PI2A 4HJUA 1MFMA 4P23A 3IJEA 3NG5A 1X7QB 1EJ8A 1N6VA 1D9KD 2EKSA 4UV4H 4YBQC 3BPOB 5HHOB 5C08D 1Z5HA 2YQBA 3P3TA 3DV6B 3R1GH 3ZL1A 1YNKL 2BK8A 2EDOA 2ZXAA 5C08E 2MCAA 3TEZA 3DBXA 4ERSL 1AHWB 1OGTB 3OKYA 2IH8A 2Y36H 3OKOA 1BFOA 3D33A 4I77L 2EXYC 1NKGA 3AFLA 4KY2A 3LRSA 4QR7A 4X6CA 4G83A 3PE9A 1U8HB 1VZGA 3CPLB 3SO3C 2BSBA 2NPLX 2Y3AA 1J86A 4FQCL 4XPAH 3AQZA 1ADQA 3MRMA 5IJVB 2C7FA 3FO9A 4KHTH 1ZT7A 2G2RA 5AYUH 4NEHB 1HZLA 5T3XL 5IW6B 3D8MA 4BE5A 2FSDA 2YEZA 1EWHA 4HUWB 4LF3B 3DX8A 1WC7B 2XVGA 4HD5A 2ADIA 3VJ6A 4QHUA 1TMQA 5IMMB 5HGDB 1LO4L 1IX2A 3PHQA 1NLDL 3D39A 1A7QL 4RZKA 3Q9QA 1TF4A 1UOKA 3K6OA 1QSEE 4K3DH 1QEWA 3I6SA 3N85H 3H7BB 4PP2B 3ARXA 3B2UD 3HJEA 5I1GL 2ATKB 1GMEA 4HVBA 5J6HB 1S7TA 1I1YB 5JPNB 2DL2A 3FQ2A 3MV11 5EA0L 4QO1A 4RDBA 2G60H 5E6ZA 4QRUB 1DQJA 4OUUA 2X3AA 2EECA 2UYLA 4GQ9L 1WD9A 3KCPA 3WKNA 2GSIA 4G8EB 3PDOB 3W9EB 1YZZA 4PJIE 3IVKA 4WFHE 1KCRL 3FU7B 4B95C 4CA4A 4J3SA 4QRRE 5BS0E 3DUUA 2V17H 4LPWA 3CAFA 2PWHA 2FUQA 4WO4D 2EE6A 1BX2A 3JWDL 3I74A 2X2YA 2R83A 1QSFB 2CO6B 3AY2A 3VFTA 4AGOA 4JRXA 5ANHA 4HU2A 3TF4A 3PGFL 5IF0B 4ZAKC 2O6CA 3QDHA 4Z7IA 3L5XL 3TCLB 1HNGA 1OTSC 1BZ7B 2BIHA 1OAQH 4N86A 4X4KA 5AOLA 4WDIB 1YEJH 1EK3A 2GT9A 4WFGD 5DEGA 1G7PA 3C9NB 2K45A 2OKMA 3TZVB 4PS3A 4GW5B 5CJ5A 1J5OH 5E94B 5EC1A 3K81A 1U8PA 5HHQB 3DX4A 2GSMB 3I9PA 5T1KA 3HFFA 1NOAA 1QAWA 2JK5A 3O8XA 5E99L 2EVIA 3KVPA 3B3IA 3JTBA 2ADGA 3APDA 4ZFFA 4PEEA 4P23B 5AZUA 3IJEB 2GVYA 3NEEA 4HMCA 5AVVB 4Y5VC 4GQPH 2CDEA 4BGDA 4QTHA 5FUZH 1OHQA 1UZGA 4JKPH 5DFTA 4BQCA 5E56A 1WIOA 4AG4H 3OKOB 1BFOB 2JQZA 4Z7NB 1RHFA 3Q48A 2LLLA 4X6DA 2J71A 4GKZA 3AADB 3B5TA 2HRPH 1FLRH 1RUQL 1VF5C 1IGCH 2VZ1A 2XPGA 1FC2D 5FA4A 1IM3D 3MA9L 4W6XB 5G5DA 5FR3A 2HYMA 1CXEA 5ITFA 1QFUL 3MRMB 1OAXH 2B14A 2SEBA 3FO9B 2G2RB 1C1EH 3BUPA 1E6OH 3QW9A 1NCIA 4Q74A 1QLFA 3GSOA 3L2LA 1P7KA 3ZKND 4AEEA 2HT2D 2YEZB 3VXUE 3NEOA 4FKEA 2YD1A 3NBNA 3DX8B 4BYHA 1NM9A 4QHUB 1LXMA 3PHQB 1PNDA 5D6DC 5J9PB 3D39B 3PF2A 1KBBA 2C1PA 2OR7A 3GUTA 1CICA 4UMSA 2XV0A 2AVFA 3QK0A 4HSCX 1G6VK 3WIFA 2ZCZA 4WCYH 2AJVL 1QEWB 5CGTA 5DO2D 2V3FA 4L8DA 4KVPA 4OD3L 1UENA 2FL5A 1Q9KA 2V9UA 4AXWA 4DO4A 5HP5A 1S7TB 2KL6A 1DEEA 4QO1B 3FQNA 1RPQA 4YHYC 3AAZB 2XWJA 1DQJB 4OUUB 3ECQA 1ZAGA 4BZ2L 2UYLB 3SOTA 5EUOA 5SWSD 3QIUB 2XKUA 2VERN 1S9XB 2AJYL 1QRNA 3GI9L 5E51A 2NX5D 4AQZA 1PZ2A 3K2KA 4I0PD 4K07A 3KCPB 2NX5E 3U36B 3QAZC 3W3BA 3G6DH 1Y18A 3IVKB 3M07A 2BY0A 2HP4A 3DUUB 4AUJA 1Q72H 2NR6A 2OMNA 3CSFA 5EDXA 4ZXBD 2W07B 3RPIA 1QTYT 1L7TL 3VFTB 4JRXB 1JUFA 5D1QD 5JA8B 1K6QH 4PP1C 4TSAH 1WGOA 4ZRGA 3WXWL 1DQDH 4KO5A 4ELMA 5L2KA 4GFTB 3O2VH 1JSYA 1KB3A 2GT9B 4AQ1C 5DEGB 2W80C 2O5XL 1SJEA 3QB7C 1CGTA 2BWIA 4ABVA 4HDIB 4K23L 1AR2A 1RUML 1EGJA 1U8PB 2H3XC 2OJEA 2DD8L 4NJ9L 3SE3A 4Q4IA 5LAXA 4FOMA 3O8XB 4GQRA 2HB0A 3NYKA 1VCBC 3A22A 3B3IB 3DJSA 3NCXA 2ADGB 3HC4H 2VXUH 4IW4C 4ZFFB 2RH0A 4J3OF 3UTQA 5E5UB 2CDEB 1UZ6E 2ARJA 3VU1A 5I8OH 2COVD 3MKKA 3ZU8A 1J8RA 5DURD 5JW4R 5FOBA 2I27N 3BSGA 4OVUA 3BDYL 3K6DA 3GIZL 4U4BA 3SE9L 4K3JL 2CRZA 1UCBL 3WGVB 1IZKA 3SDCB 4HJEA 4S1QL 4H7VA 2AJUH 4GKZB 3DX1A 1V7MH 3UZQA 4PRHD 2BINA 3C2SA 2XPGB 5K9QG 4DERA 3C60A 2YSSB 1WFUA 3GBNL 5FA4B 3UBXA 4DN4H 5G5DB 1HOCA 5CLYA 3LRLA 3MNZA 1NCDH 3IMRA 2XG5B 5DZNA 4R97C 4ZUWA 3NCBB 1QLFB 3GSOB 3V0VB 4KTDH 5HHOD 1V3KA 5FFLA 5FM5M 5HYEA 1RL1A 1RUAH 1R3IH 5HHOE 5C6PB 3GMOA 2YMTA 3D08A 5IB5A 1P5UA 3FH7A 1GGTA 3HG1E 2C1PB 1RJZA 1NCUA 4ES8A 1U36A 4O02B 4PJ8A 3TTYA 1S7RB 3GDCA 4M1DL 2AGJH 4J3OD 2WOBA 4L8DB 2WBWB 2GC4C 1WAAE 2FL5B 3U6XA 1Q9KB 2AJXH 3PCYA 4OIAA 2EIBA 5SWZE 3V2AR 4AXWB 4ZMXA 1IBDA 1DEEB 3QCUH 5D4HA 1EERB 2O30A 3FQNB 3MV8B 4QXUH 4UQBA 2XWJB 2WXPA 3IE4A 3LN4A 3EH5B 4LCCC 5EUOB 3TOPA 3AT0A 1QRNB 4TQ8A 4J6IA 3UTPE 4L9LC 1Y18B 4NC0B 5GXBB 3KYKL 4QYAA 3MCKB 4RMWA 4NQCA 3LZFH 5I73C 1EVTC 1HHGA 3RPIB 1S7QA 3BN9D 4R4ND 2DQTH 1JUFB 1JS4A 4I1PA 4ELMB 3H4HA 3KBPA 1UM4H 5F7MC 4CN1A 3TFKC 2ENJA 1SJEB 4ZTOL 1T0OA 3LEVH 1KELL 2BZDA 3KHOA 4HG4K 1GW6A 3BO8A 5B1CA 3TH4T 2OJEB 1M2VA 4F2EA 1AMYA 1WBYB 3ARWA 5LAXB 3QUKA 1J9RA 4Z7NF 3T1WA 1X6LA 1QSFD 4LZKA 4WNJA 4GKLA 4ABUA 1PEZA 2LOEA 2OTWA 4JFTA 3BKCH 3UTQB 4XNXH 2AZUA 5EEZA 2ARJB 1CURA 1IE4A 1KTJA 3N42F 4B9IA 5G2NA 3TZVD 5FOBB 5HI5D 1FHNA 4Y8DC 4XPTL 4YSOA 2AVGA 3Q0HA 1N6QL 4NKOA 3IFLL 2XIDA 1QFWH 2I25N 2HJFA 2BSRA 3GMMA 3X1GA 2HFGH 4PRID 5DF0A 3UZQB 2APFA 4OD1L 3UTTB 2L7UA 4LSTL 4PRIE 5DC2A 4PJ5A 3ZSTA 3C60B 3UBXB 3WKMH 4ZMPA 5EEWA 4MS8D 4P5KA 5KS9A 1HKLL 1FI8C 5GGRA 2LV4A 3MNZB 5ICYB 4P23D 3SPJA 1I9RH 1MCQA 3IFNH 4Z7WE 4FXKA 1NAMA 3VG9B 3FT2A 2D31B 3BN3B 3HRZB 2WQSA 1JJUA 4LL1A 3MFFB 1BBDL 3DX2A 1RIUH 3QDAA 3MDJA 4KJWD 4WWNA 4AE1A 2D73A 1ADWA 4JQIL 3GMOB 1URLA 4EQ2A 3PJLA 5IB5B 1P5UB 1R24A 1WFTA 1DJZA 3U0PA 4HKBA 4XN9A 4PJ8B 1F4XL 5AKSA 5FX3A 3WCYA 1UM6L 1KN4H 4AK2A 2Z8RA 2J21A 4X6CE 3KPSA 1RU9H 4P04A 3KDMA 3BUYB 1KCKA 1AY1L 5AVYB 3LKSB 4JFYB 1MEXH 4HKZA 3LN4B 2BO0A 4U1LA 1HWHB 1MIEH 2VM4A 1H3TA 4XCCH 2R51A 4ZFOB 1KIUA 1J05A 4GFXA 3OKNB 3MLUL 3D39D 2ENPA 3ZTCC 1BSIA 2IBBA 2FX9L 5DUPH 2F7QA 1L9NA 5H94A 4NQCB 1QNZH 5F7HA 5B3NA 1HHGB 4L2LA 1KPRA 1S7QB 4PWGA 3RX7A 1JZJA 2LVEA 2YZ1A 5T5FL 3DVNA 1I9IH 3QORA 2BERA 4OZHA 3Q3GB 5IMLA 4FQXA 4MNGA 2XZAL 4NC1E 5T3ZH 3UL4A 4AYEC 4PBXA 4XNMA 3T6VA 4MD0A 4FJYA 3X3GL 5DWUL 2J8UA 4JPWH 4MMZA 4FABH 5DJAA 1EO8L 3BO8B 3TEYA 1FQ9C 1H6FA 2ZPKL 4HUVA 3FMGL 1V8HA 2H3KA 2ZUTA 2V7HA 2ZICA 4XPFL 4UOQA 1MCIA 3QUKB 4PWKA 4CNIB 3CFEB 2WWMD 2GFBA 3HG3A 2BY2A 1EUUA 3WFEH 2WCGA 1FNSL 1FV1B 5LGHH 4QJ3B 4EBQL 3C08L 4JRXD 1SEBB 3IWVA 4V33A 5B1JA 4TRPH 3QH3B 2OTWB 1I8LA 2XBZA 3A67H 5FDYA 4I87A 4YO0A 5CP3H 5C07E 3GBMH 1DLFL 2ZSVA 3KYAA 2JB5H 1J1XL 1S3KL 2WZ6A 4FI6A 1A6PA 4NKOB 2RQ8A 3U1SL 2HJFB 5T1KD 2BSRB 3GMMB 4N0YL 1HAUA 2ZF9A 1IT9L 3O8XD 4JR9L 4PRPE 5I71C 5FO8A 4PJ5B 4D0CB 4P5KB 5DFWH 1J9QA 3V0GA 1ND0B 5KS9B 5GGRB 1A6AA 4RLDA 4WIQA 2C4FT 3EOTH 4IKKA 4FXKB 1NAMB 2B08A 3BIBX 3WJMA 5AW3B 3RKDC 5KVMC 1EXUA 5TK4A 4MD4A 1NGYB 3BQUA 3I6GB 4URTB 3BH8A 3WXVL 4R2GB 4I1RA 1RURH 2WMPA 4K5NA 3P11H 5EUOF 4JG0H 1SDDA 1JF1A 2DQEL 1R24B 4LIQH 4U1GC 3U0PB 4AEHH 4HKBB 1BQUA 1NOFA 1VFBA 3FU9A 4OM1H 1FZKA 3E6FA 4KAQL 4F8PA 1L6ZA 4P5MA 4HF5L 1QZ1A 4X6DE 3KPSB 4DCQA 3RI5F 4MAYC 3KDMB 1KXVC 2CO2A 2MTPA 4ENEC 2OLDA 4J28A 1DUZA 2F7PA 4QXWA 4HKZB 3F83A 1G7MB 4Z78A 3U1PA 4UQ2A 4XMVA 4U1LB 4ELMF 3GMQB 4BFIB 1Q1JH 1BEXA 1M9SA 1KIUB 3IYLW 4MD5A 1BLIA 3OTTA 4Y16A 3S96A 2HFEA 5GJTL 1CICD 3P02A 3UABA 1HTYA 5H94B 4H40A 3O0RH 3KJ4B 1CE1H 4AUYA 3FH5A 3WTYA 2HLFC 3NN8A 5JW3H 3WDJA 3WD5L 3UG3A 3DVNB 4EXKA 3P40A 3MZGB 4OZHB 4DAGH 3ZTJH 4P2CG 5IMLB 3K6FA 4FQXB 4AOFA 1SF3A 1AS8A 1NFDE 3MV8D 4XB8A 3H3PL 4XNMB 3TBWA 5KW9H 4MD0B 1BXXA 1FO0H 2J8UB 2CLVA 4G9DB 1B0GA 4MMZB 3B8YA 1QRND 3ZYIA 2BS9A 4Q89A 3QXUA 5I66B 2VLRE 4Q58C 4C8XA 3LQMA 4HS8H 4HUVB 3CQPA 3K5RA 3HNTL 3IMSA 3M88A 2V7HB 2DS4A 4IIQC 2NR6D 3BIKB 2PPAA 5I8KH 1B6UA 4P9HH 2WPGA 4WGVB 3D9AL 4WW1A 1UVQA 4QT5A 2MQ3A 1N19A 1SNRA 3GSQA 1YJDL 4IMKC 2B4CL 4JPVL 5CD3B 4NZJA 4YO0B 5KWYC 5L2KE 2NXZB 1MHPH 3ZDZB 2PO6C 5CM1A 5DHEA 3ZGIA 5M95B 4UILH 3A23A 5C3LD 3S8GB 4Y1TA 5TE6L 5IVXB 1P2CA 4ODXA 2R2HA 2Y2YA 5C8JA 2MPAL 2NY1C 4L29A 3FCBA 4NCDA 1D7BA 3DO3A 2DWDA 4R26H 3PXHA 4MZRA 2ZXWB 3QNFA 3FB5A 4H8WC 4YSRA 3MJ9A 4X7FC 4AUUA 5FO8B 1OSPH 1QX1A 3RJOA 2M2DA 1FVDA 2FO1A 1A6AB 1K5NA 3HPLA 2ZAGA 1TLMA 1IGIH 1KBWA 2E9JA 1N18A 4FLSA 4X98B 4POYA 1EXUB 4MD4B 5KN5A 1BQSA 4X5QA 4LSQH 3BH8B 4MQXD 1IGJA 5C3IA 2RFXA 3VH8B 1SDDB 1JF1B 1FRGH 2KZBA 5E5LA 3OKEA 1TO5A 8FABA 1VFBB 3E6FB 1IC7L 1E4WL 4PJCA 3WFZA 1IGMH 1MQKH 4EZKA 4XCYA 3H1ZA 4LEBA 2B3RA 4Q2ZA 4M5TA 4NN6C 3C60D 4DCQB 4B9JA 5LGJA 2NY3B 1BIIA 5D1XA 4XWGL 1OM9A 2Q7YA 2K0RA 3FOLA 4DGYL 1DUZB 4KVCH 4R96B 5FB8A 1JVLA 3QDGA 4R8WH 4L37A 3LVTA 3PWPA 3TT1H 2NZ9D 4UQ2B 4KX8A 2H4EA 1KYFA 3BJLA 5TE4L 5MENB 1A02N 3AUWB 3ROLA 5LWYL 3H0TA 1CXIA 3SN6N 3MOQA 1QLEH 4OFIA 4Y16B 3IRCA 3QR2A 2HFEB 2ZYSA 1VRSA 3QC5X 4PJ8D 2CAKA 1A7RL 4XNUL 1E30A 3NN8B 1CGWA 3DETC 3I6LD 3MRCA 1RUKH 1B2WH 1U6AH 4Z7VE 4JHAL 4XXCC 1AHWC 1E2WA 5AW5B 3CTTA 3EO9L 1JZIA 2H45A 5IQ9A 4WY7H 3TBWB 3QUMH 4HGKC 3MJ7A 1B0GB 4W9CC 4NM4H 2NSQA 2ETWA 1IV8A 1JCKA 1ETZB 5I0DA 5CZVL 4A7SA 2N01B 4LCUA 3PP3K 4CDGC 5I0WA 1EHLH 1P4IH 3L4TA 4NQCD 5CCGE 4N2FA 2BVPA 1GH7A 4LFHD 5ERWB 4F58H 3VWJC 1F90L 5AOJA 2O5YH 3TURA 4OGXH 2K78A 2FEDD 1QKZH 2PMZA 1UVQB 4QT5B 4WW1B 1NANI 3C87A 4O5LL 5TQ0L 3B6SA 3W11C 3QJFA 3GMPA 2FGWH 5KS9F 4AC2A 5JXAH 4PM1A 3VNZA 5IHUL 2F54A 3QP3A 5FOJA 3UERA 4OH2A 4L4TA 1P2CB 3HUJE 3MRJA 2F53B 4XTRD 3EYVA 3UYOD 2CJ3A 4L29B 5C8JB 5JPNC 4FNQA 5L6YL 3H2WA 2VDPH 2DWDB 3FOMB 1G4MA 3MLXH 3FB5B 3TVMA 4ODVL 1LO3L 3BH9A 4HWBL 2NLJA 2DBLH 1FVDB 5IWLA 3T0EC 3HPLB 3FSOA 4R7NA 2D8KA 5FUOH 5CCHE 3VXPB 4HZ1A 2AEIT 2VN4A 1MFUA 1X5AA 1BQ5A 5KN5B 4U1MA 2DL9A 3BPCA 3OAZK 3QCVH 1YEKH 5C0FA 1IGJB 2EIEA 2VR5A 5AOMA 4BJLA 2RFXB 2ZWZA 3NOIA 4YDLB 1LP9E 3U7AA 1HHIA 1YAIA 1W72A 2A9AA 2WYHA 4WQOA 3OKEB 2XQYG 1N70A 8FABB 4PJCB 4XPHL 3NCFB 4NM8L 2J73A 3VG0H 4Q2ZB 2DQJH 3ESPA 4OW6A 2QHRH 1CYGA 4PJ5D 4AKQA 4QIRA 4HIXL 3MXVL 1TG8A 1YYMH 1BIIB 5D1XB 1DN0A 5EOQL 5ECJE 4L0ZA 3QIWB 4HC1L 3FOLB 4P4RA 5FB8B 3QDGB 3JZYA 2QLYA 3PWPB 4OZHF 3VWKA 2JI3A 1E4KC 2UX6A 1HDMA 1HT6A 1EPFA 1PZ5A 2HKAA 4P9MH 4YSEA 3BD4A 5I8EA 4R2GD 3ROLB 2BHFA 3DRTA 1F4HA 1KYUA 2J8UF 7FABL 3HB3C 1TTRA 3WEMA 2R27A 4LOUD 3LH2H 4JVWA 1WP6A 5C6WH 1Z9SA 5DD1H 3E6HA 1KCSL 2D7PA 3KPSD 5F7EL 3U9WA 2E7LA 3K0WA 4E36A 2CE6A 4L3AA 4S0SD 5F44A 4S1DC 5CUSL 4EIZC 5E08L 2W65B 1KJ3H 1QHPA 2QSCH 5D7HA 5IQ9B 4OZFB 2ZD0A 2AJ3A 3MJ7B 2R59A 5BO1L 3BAYA 1P9MC 2V33A 2WQAA 2CKBH 3MLVL 3ZDZF 4U1HB 4GRWH 3KEHA 3TBBA 4TPRL 5IK3A 1GGIL 3K7UA 3OHXC 4LCUB 3NAAH 1TVHA 2BNQA 5DJ0A 3IN0A 2BVPB 5FYLL 4YUEL 3US0A 3QORD 4UM8A 5BQDA 4CGUB 3S8FB 4FQXD 1C08A 3GINA 3MUZ1 3B6SB 2OSXA 4OCMC 3MREA 1VGKA 3GMPB 4LHUG 4MNGE 12E8L 3SEPA 3RIKA 1BQHG 4U7MA 4D0DA 1SN2A 5DK2A 4N2AA 3D3VA 3LB6C 1E4XL 2W81C 3N0AA 2UZXA 5CLTA 4OF0A 4L4TB 5I1EL 4M03A 3MYZA 3S2CA 3GPSA 3MRJB 3ZHDA 4N8VG 1IVTA 3EYVB 1LE9A 1ZTXH 2ORBL 5DJXA 4OZIA 2EC9U 2Q8BH 1E2ZA 3G6JA 3QCTH 4HJ0D 1JWSB 3CX5K 5DJDA 3TVMB 2LAGB 3U0TA 2BVTA 3BH9B 3QIUC 4PGEB 2NLJB 1G5GA 3BP6A 2DWTA 3QEGL 3MROA 5IBUB 4YQXH 2WXQA 1UXWB 3WDIA 3EHBB 3EYSH 3HS0C 2GI0A 4R7NB 1EMTH 1DCEA 1B4LA 5FFGA 3ZQXA 5J89A 1MJJA 5I6LA 2NXZD 4R0LA 4R7DA 1H8LA 3SE8H 3IGAA 5E5RB 3BPCB 3OGOE 5C0FB 3IGUA 5I26A 4KV5E 5K9KA 3STLA 1PTZA 3ZQ9A 3LAFA 4PRAA 1HHIB 2Z3FA 3ZL4H 1JZFA 2KUTA 1JPTH 1XCTA 3L3OC 4YE0A 1DBJL 5I24A 2XZCH 4CMHB 4U0RB 1P7HL 2JIXB 2VTFA 1JZ2A 4OLXH 1DQLH 2QVMA 3HJ0A 3LSOA 3BC9A 5KBPA 2VLJB 1T1ZB 4P4RB 2AEPL 5HVWA 2BXYA 4AVJA 3NPSB 1DP0A 3U4EA 5GSRA 3LKQA 2CCWA 2XTJC 3BQUD 1PZ5B 1LLAA 2VR6A 3QPKA 4PJEA 5I8EB 4FQ1L 3RB7A 4XP4L 1GYCA 3PREA 4IMLA 4YLCA 3CFCH 3DRTB 4ALAH 4ZMWA 4LLMA 3U83A 4DT2A 5H37G 4XBGA 4FZ8L 5FYJL 2ZKWA 5SX4H 3EDEA 4I3RH 4I9XA 3E6HB 5DJCA 3ARFB 4JGUA 4AIOA 1CWVA 2NY3D 5ACZB 2HRGA 3GB7A 4RFNB 2A1WL 3FN0L 3TL5A 1NEZA 1PBYA 5TPWH 3SDCC 1B88A 1MNNA 5BOPA 4I0CC 1D5RA 2Z65C 2HUHA 3HN5A 4H88H 2N7SA 2J5LC 3ARUA 3X12A 4ADJA 2OMTA 4Y16D 1VEPA 5IK3B 1UOVA 4P4KA 1U8NA 2BY1A 4L1TA 3N50A 3C12A 2HKFH 1J87A 1OKEA 4Z76A 1KTBA 1TVHB 1QNIA 2BNQB 5DJ0B 3FUNA 5BRZA 3U1QA 3CXHJ 5DRWA 1R5IA 1PYWA 1B9KA 2H1XA 5B7MA 4UM8B 5E2UH 1XGUA 2B1OA 1N8ZA 2WBJB 4GXVH 4IOIA 4N85A 3MREB 1GC1L 3KH4A 1VGKB 4DO5A 5A6IA 3QZPA 3QYMA 2GTWB 2EYRA 1EA9C 1HWWA 3SJVA 1N4XL 4BCYA 2JJTC 3D3VB 3GXMA 3VGFA 5TD4A 1A7BA 2UZXB 1CBVH 3UBHA 1XHHA 5DUBB 1ES0B 1YAZA 2HSIA 5CKGA 1FAKT 4M8UA 5BZWA 3IFPA 4F37F 2XJLA 3ISYA 3F58L 1LE9B 4JK0D 5DJXB 3O2WH 5CEZH 5EPMA 5IVZA 1SJXA 2A9NH 2YD0A 4EN3C 2NQ3A 3Q05A 3U0TB 1MCOH 1JDAA 2LU7A 4PJCF 1JGLH 3MROB 3ZE2E 2X1PA 3LS5L 4LPTA 3OB8A 1KCBA 3T0AA 3SQBB 1MJJB 2B59B 4R0LB 3F7YA 4R7DB 4ES9A 4UMGA 3IGAB 2OJZL 3RUGE 5EOCL 3STLB 3HE7B 1DVFC 4GRLC 2GCYB 5F7WC 1NFKA 3VA2C 4HULB 4DPBX 1XCTB 2FTAA 2KKQA 1T66C 1YEEH 4C4KT 4DGWC 2BM3A 4W93A 2BNRE 4QHKJ 4APXA 1J8SA 3SDDC 4AIXA 3MFGB 3W56A 1F6AA 3M46A 4CSPA 1IFHL 2K6ZA 1MCJA 3LSOB 2XHNA 1ECYA 3OB0H 4G70B 1MELA 3APFA 5D7LB 4YHIA 4QRBA 2FX7H 5HPMA 4OJYA 3VDBA 3U4EB 4G2AA 4YDJB 3LKQB 2EO9A 1NFIA 1A8ZA 1TQSA 3TS8A 3ZUCA 1FCCA 3KPRA 4PJEB 2H2SD 5KVDH 3W57A 4JHVA 3X1EA 4AQ8C 3M6DA 4IJ3B 4J8RA 3L5JA 4KTYA 4LLMB 3TTSA 1UTDA 4HWEH 4KXZH 4GSXA 1E7UA 1R0AH 4J1UA 1FG9C 1WFMA 1CLZH 2F1BA 3JWOH 1UA6H 4OCSL 3DIDA 5DJCB 3PAUA 2E7MA 4O2EA 5D1XD 4P3CH 3DYMA 3UJTL 1E2VA 3GB7B 4K7PY 2CG9X 3FSWA 3QDGD 4NO2A 3IT8D 3TIEA 3PWPD 5EBGA 4DP2X 4K7FB 2OXGA 1QQDA 3CDGB 3FUJA 1OAUH 1I85A 4AI7A 3PY9A 5DEJA 5FGBC 3LRHA 2CNYA 1GHFH 5E8DH 1BVNT 2B8OT 2OMTB 2YPVH 3P77A 3S5LA 3WUZA 2X4NB 4P4KB 2ZG3A 1U8NB 3U2IA 3KR3L 3VI4E 5KJRL 5C0IA 4Z76B 4KVNH 3LNFA 4GBXB 3P0YH 5IFJB 4BK5A 5DRWB 1R5IB 3HI6L 2EDQA 3AW5A 4NNYA 1XGUB 1D5XA 1MFEH 1N8ZB 4NDMB 1YNLL 2YRLA 2A7BA 3VD1A 2EYRB 4UDTA 4W1TA 4E9TA 4U6VL 1TQVA 2E0PA 1BQLH 2X9XA 3VGHA 5CD5C 1O6SB 1NQBA 5BZWB 1DQVA 2X5PA 1MJ8H 3IFPB 5LJYH 4I48B 1A6WL 4FFYL 1JFQH 3PFUA 3JVGC 3IDJA 5EPMB 3D4YA 5IVZB 3OJDA 2VDKH 1ACCA 4QXVA 3EF4A 4I1NB 3FYEB 1GJWA 3ARVA 1P1ZB 2CM6A 3BAJA 3SKMA 1MOEA 4ODSL 2VGLM 1QWHA 4KNSA 1AP2A 2R1YA 1EJOL 1FN4A 4H20H 1C8QA 2GHWB 1DTUA 2Z64C 1PAZA 3DLQR 3G9AB 2F54D 4DKEH 5TDPA 2CNZA 3FFDB 4JKMA 2F54E 1NOLA 3LNHA 4L4TD 4M62L 4N2MA 5AVUB 4UYQA 1FAIH 4L4TE 3KLAA 2MNWA 4PJXE 2I9LB 3RWHA 4Y7OC 1JNNH 4APXB 1HEJC 2G30A 5C0CB 3RFRA 3UTZA 3TVMD 1E5CA 3EKCA 4J3UA 1YC7A 4QAWA 1MCWM 5FYKL 2AKRA 3WAJA 3NQIA 3EHBD 2CSPA 5ABAA 1AACA 1KF9B 4JHZA 3N3EA 3BKMH 4A38A 4AEFA 1IKFL 1NFIB 2N4IA 2JTYA 1X4YA 5B3JE 2EH8H 3LOWA 4PV1C 2YC1A 3KPRB 4LSRH 1A4JA 1SDYA 3WHXA 1O9ZA 2R0WL 3K8LA 4GMSH 4N0RA 4Z9KB 4S0HA 4ICXA 4J8RB 5EEUA 2MCPL 4C83A 3BSZL 3E7JA 2BC4A 5AAMA 2HT3D 2ZXQA 4LOFA 5DFVD 4F2MA 3NSDA 1IQDA 1JZ6A 2PCXA 4PV9A 1TETL 2NRDA 1DBKH 1MIML 1YN6A 1MFDL 1ZANL 5D71L 5AW1B 5HYJB 4OY9A 3TIEB 2FZ3A 3PQYA 3VWKD 4MA7L 5EZIH 1E0OB 2EDLA 2PWFA 1KSRA 4KMTH 1GGCH 3EDJA 3Q8BA 4LEOA 4NZTL 2NQDA 3P69A 1SOSA 3W9DA 1CGVA 1DL7L 1KGXA 2K4AA 3B2XA 3P77B 3S5LB 4ZW3A 2WVTA 2VL4A 1KDIA 2Q87A 1NICA 2R0ZL 2XQYK 1T7ZA 1UKQA 2LHAA 2CJSA 4XMLH 4KGLA 4YXHL 2UV3A 3ARFD 3D0VB 1UWGL 4TSBL 5GRYA 5C09E 4CILA 2EVFA 4RMSA 2H1LM 4NNYB 1D5XB 3CDZA 1F1GA 3GGWB 1DJHA 5I18H 4OZGA 3GSWB 4I5BA 1S8DA 3ATAA 3QGVA 3WFHA 4UDTB 1SXNA 2Z93A 4AW7A 3F00A 5E8EA 3HC3L 1ECZA 4PQXA 3QXVA 3OJDB 2BNQD 1RXLA 2EIZA 5CN1A 2NSMA 3GXNA 2P28B 5FGCB 2AQ3A 2WQUA 4XWOC 5KBNC 2BLFA 3UIYA 3ZTDC 3QEQE 3HI5H 1H3XA 3EDKA 3EH1A 1JAEA 2XN9A 1ZK9A 3MRRA 4NN5C 2L7EA 2NY4B 3ZR6A 2WBJD 1W0YT 1AP2B 1DVSA 2F1AA 2R1YB 2UX7A 2YGNA 5L4IA 4N8CL 2EJ1A 3A47A 1H3VA 2J1WA 5FM5O 5DJYA 5B8CA 3KJ4C 4WWKC 3UJJH 1WE5A 3D3VD 4GI6A 2OCFD 3ZKSD 3L13A 4EOWL 1CL7L 1CR9H 2ICCA 2UZIH 4HCRL 2EVHA 4YHNA 4PJEF 3GFUA 1OALA 2YPLB 5CGYC 5G4NA 4LDCA 4HPHA 2QHLA 4K71C 1JGEA 4OZIE 1GAFH 3LPFA 1JV2A 3G6JE 1C5CH 4LVHB 3HE6C 5I76A 2AKRB 2XCMC 1TJMA 1DO6A 3QUYA 3DDGA 1KY6A 3DC0A 2VAJA 3AXHA 3PV6B 3DVFA 5IW3A 4PCKA 2IWFA 4U1NB 4BKTC 4LPUA 2YC1B 3GNMH 1A4JB 4WKZB 5CP3A 3RI5K 1SYVA 1USQA 5TDOA 4K8RH 4Z0XA 4NQDA 2ITCA 4E41B 4C83B 3T5WA 2BC4B 4MCZB 4F2MB 3QPQC 2GUYA 2F5BH 1IQDB 4BSWA 4N5UA 4J27A 4PV9B 3ZL2A 2AK4A 1CIDA 4W9DC 4UQ9A 4N2OA 1OCCB 4HS3B 1HHHB 3OHXA 2FZ3B 3PQYB 3V6FA 1SLVA 1FYHB 5GHWL 3CHRA 4TLTA 4BXVA 2FLMA 4M1CD 2PPEA 1KLFB 4LEOB 2ERJB 4CGTA 5D70H 5DU7A 2JF1A 2WKOA 2OSWA 2KDGA 4JDZA 5EB9A 1JHLH 1N0XH 5E0FA 4OI9A 1LEGB 2W38A 1M71A 1BMGA 2Z31A 4AE0A 3V8CA 2NY5H 3C5JA 2FECL 4ZFGL 5F9JB 2EIMB 4OCWL 5DD5L 3QHTC 4RISH 5D7EA 5KSAA 1CDHA 4P0DA 3NTCH 3Q1SL 5ID0A 4L3EA 5ICXB 4I5BB 3ZYOA 1S8DB 2VMJA 3WFHB 2JKNA 2Z93B 1YEGH 5BPPA 2Y4SA 3DX9A 3VXOA 4HMEA 3JWNC 1R3JA 1YHPA 3NACH 3QFJA 5E8EB 3VQ2C 4BFNA 3OX8A 4L0YA 4P4KD 4M8QB 3L9YA 1RZKL 1RZFL 3S5YA 2EIZB 5BRZD 2XOTA 2W95A 5CJXA 3IBOA 3DO4A 1S7SA 2F8XC 5BRZE 4ZNCD 1MN4A 3P3SA 3WJJA 4TULL 1J0HA 2J4WL 3K2UH 4ZUUA 1AQDA 4HJJH 1KYAA 3U6XS 3MRRB 1KCVL 4E9RA 3L9RB 2DQDL 3VX0A 3LQAH 4HKXA 4IBTA 5L7XH 2E4TA 2H26A 2QQKH 4P48A 5DJYB 1KTKE 4XP1L 3SJVD 4AYFA 5ANMA 2ZKMX 1FO0A 2QFRA 3SJVE 4D9QD 1QI4A 4NNPH 1YEHL 3ESOA 4HHAA 4YHNB 3QNYA 3VFVA 5FECA 4JN1H 1JGEB 2BSDA 5D7JB 2K1MA 4K9EL 2I32A 5DK0A 3CIQA 4ZTEA 3D4ZA 1QBLL 1GTFA 3HBPA 3ZHKA 4R4BA 4OGQC 3QUYB 4UB0L 2XTSA 2BWDA 4PR5A 5DVLA 2G4GA 2GTZA 4A39A 1FNEA 3KYMA 3ZTNH 4PS4H 3OJVC 3T4AC 5IHZA 1K8DB 4TNVF 5JOFA 1BQKA 3DO7B 3DPBA 5TDOB 3D5OF 3VMNA 3U30C 1TEYA 4Z0XB 2DLGA 2R15A 2PN5A 3ECWA 3DXAA 2OMXA 3JV4A 1FPTH 3O3AB 3B2VL 4AJVA 5AWNL 2VXQH 4PGBA 4G7SB 3L54A 4J4PC 1GZQA 4ZPVA 4U3SB 5C0CD 4BSWB 2JI1A 3N0PB 2XFXA 1M7IB 3KM2A 4I3SL 1NH6A 2AK4B 1AHKA 5JXEA 4HLEA 4D9RD 1OW0C 4KUZH 3ARQA 4UQCA 2FHBA 2BP8A 2H0FA 3NH7H 4D9RE 1NFAA 4X7CC 4ZS7H 4F92B 5KTEH 3FYIB 2YD6A 3QDME 1X3DA 3KPRD 3DX0A 3GHEH 5CSZB 2H3NA 4L23A 4XPGH 2FUTA 3SGEI 4FQJL 2ZX5A 3U46A 4FQLL 3LXBA 2EE9A 2VXVH 2DJMA 3NK3A 4HUCA 3FUDA 4JDZB 4AIEA 1JZ7A 3W37A 1KCUH 3UBXI 4A66A 3GBEA 3EAKA 1HE7A 2Z31B 3VMPA 4AL8L 1MCPL 3L3KB 2QZ5A 4BE6A 4C57C 3NABL 5B38A 1SOXA 4NQEA 2ZX9A 5F3BA 2P8LA 3MV7E 1A6TA 3CZKA 3EF7A 1YEFH 5ID0B 4JZNA 1TZOA 4L3EB 1NCHA 5AOZA 4EN3A 1CFSA 5CJQH 1TNMA 4LLQA 3UGEA 4UTAH 3DX9B 1FSKB 2FWOA 3VXOB 3QFJB 1R3JB 1XMEB 3FO0L 3OX8B 1TZGL 3RVXD 5KYWA 2WSDA 4FEIA 1DVXA 1BMZA 1TXKA 1HILB 3QIWC 3BUTA 4H0GA 5E2TH 4B9FA 3HMXH 4L2YA 4LLUB 4FFZH 3BWUC 4NQSA 3WEBA 1S7SB 4TS6A 3FQ4A 5JOPD 2APWA 1QABA 1YNKH 3DECA 4MA8L 4X5PA 1AQDB 4ZUUB 3UG5A 5TGBA 4CC4C 1AG0A 2ADYA 4XC3H 2Y5EA 2VZUA 4I77H 3NPZB 5E24E 1CFMA 2H26B 5J12C 3UAFA 3QUMA 4OTXL 4KNTA 5ANMB 1FO0B 1UGKA 4KKAD 2FD6H 5AKTA 5T8IA 4N2NA 1ZE3C 4F8OA 3VFVB 2FWSA 2VN6A 2X53A 5FECB 4XMUA 4RFOL 2BJML 25C8H 3OAUL 4Z23A 4Z95H 2DZEA 1E9OA 4M7LT 5K1NA 1PSKH 1S9WA 3EYOA 3T0XA 1ZGLM 1CMOA 4R4BB 3SBWC 3NZSA 1JRHL 5TK2A 4PR5B 2NY4D 2GTZB 3E9UA 1FNEB 4G8GA 2IADA 3KYMB 4XP6L 4YNYA 1WUNT 1F2XK 5LBSL 1R1CA 3C5ZA 3CN1A 3DPBB 2DKUA 4KK9C 3DXAB 2OMXB 3UADA 3ZY7A 5I1GH 4ZI8A 4PGBB 1MG2C 3SYPA 3ULUH 4XOCA 2ZKYA 4ZPVB 5DZPA 4QHLA 3DSNA 3VQMA 1KLUA 2XFXB 4ZD3L 1OF0A 4YXKL 2Z6FA 2DQGL 3S36X 3E1ZA 2BP8B 3OC5A 3RA7L 1KJ2L 2QSVA 2GBAA 1BYOA 4ADIA 4PREA 4R6UA 4H2AA 2Q3ZA 3FK3A 1OARL 4M7ZB 2H3NB 5HYSB 1HHKB 4EIGB 1T80A 4WI7A 1TEGA 3KLLA 3PGFH 5AW6B 4E41D 3ECBA 1HIML 4UNTA 1IIIA 4M6ML 3L5XH 4ODWB 4JHWL 4U1JB 5FAAA 4UOW1 4JG9A 4Y4KB 4QRAA 4DEWA 1JGIA 4YLQT 5AYQA 3RURA 3BWZA 4JRWA 5B38B 4NQEB 3AWFA 3UTOA 3CZNA 2P8LB 1A6TB 4GKSA 1E3XA 4AITA 1U8QA 4DQOL 3MBEA 4E42A 4HEPG 4NZ8A 2I85A 2VIRA 3NCCB 3PQYD 2X41A 2OSYA 3EO0A 4NC2B 3FTYA 5A6LA 3GRBA 1MY5A 2FT6A 2AJZB 3BUIA 1RZGA 2C3HA 4F7KA 1ZV2A 3EBGA 5DD3H 1MLCA 4PWFA 1NEZG 4K2UH 4IKNA 5EG6C 1N59A 2D3VA 1PLAA 4K7PX 2KPWA 3MRDB 5GRXG 5HDLA 3SZ6A 43C9A 4QRQA 4JY4A 3THML 4ZYKB 1Z3RA 3QVAA 5TGBB 5TQ2H 1BAFL 1AI1H 3OSVA 5ID1A 2LFEA 4OZGE 2QBWA 1EJFA 3T2QA 3QUMB 4ZW6A 2X2JA 3ARDA 1M6UA 3BE1H 4WENB 5DJ6A 3ARFC 5EU4A 5EO9A 3L3IB 2Y7SA 3MA9H 5AVQB 4AM0Q 4OLZH 3T0EE 1U58A 2Z4TA 4RFNC 1CD9B 3FQ1A 2IH1B 3KYNA 3HMWH 2J44A 4FG2A 3KPPA 4DKAA 2XN9D 4FI8A 4PVMA 1DO5A 4A63A 1RZJC 4NHCH 4L5FH 3V6ZA 5IMOB 2OCCB 2XN9E 3C09C 3GWJA 2IFFH 4G8GB 4KHXL 4PJBA 5BXFA 5KVGH 4FG4A 3UZEC 1J0YA 1N26A 4U33A 4HPOL 1JTPA 5T3ZE 2B20A 4FMVA 2FLBT 3TNMA 3WI9A 2PCFA 4IBWA 2XWRA 2NY5C 5HD8C 1M53A 1D6VL 2O4EA 1L9TA 1MQ8A 2FB4L 1PL3A 2GK0A 2WBJC 4B53A 2F08A 1SMOA 4BZ2H 3SY6A 2WKOF 2AJYH 2XQBL 3QR1A 3QUYD 5LNEA 2EIDA 5GGUA 3BMVA 5INCA 4WRLA 2GY5A 1R6VA 2NXYC 2XV2A 4PREB 2IQAA 4TVUA 3S0PA 1OT4A 3NCJL 3SPVA 1V27A 2FBJL 4RGMC 2GUOB 4FFTA 5LQBH 2ZTBA 4X80L 4NQDD 3WXWH 1DQML 3KBHE 3ECBB 3TYGL 2CO4A 4NQDE 2VQUA 1X5YA 3QDJA 1IJNA 4N68A 5MEQA 5I16A 5B1BB 1UACL 4GYBA 1RIVL 2AK4D 4HZAA 2VDOL 2O5ZH 1A6VL 3MLSL 4GKSB 1U8QB 1FIGL 3HE7C 1GGUA 2DI9A 3MBEB 2B1HL 3M17A 1NLBL 2DD8H 2VIRB 1NGPH 3EO0B 2G0LA 4XMPH 3CXDL 1JMZA 2FIRT 2EICA 4Z18A 4W68A 4ZX4A 2IG2H 3A6CL 5T33H 1RZGB 4B96A 1KG0A 1QATA 3QJTB 3S3BB 1MLCB 2Z31D 3ILQD 1DJYA 1N59B 3J27A 3TIDB 4DSYA 5AEAA 43C9B 4JY4B 3EJYD 5G4MA 3AY4C 4EVNA 1W15A 3NP4A 3SE9H 5KSAD 4K3JH 4F37K 1L3NA 3S5LG 3K1DA 4L3ED 2BSEA 5D5MA 3WTVA 1II4E 4S1QH 4NGHH 3V0IA 4IBVA 1VPOL 3A24A 1J10A 5DMYA 1HJCA 3ARDB 3RG1C 2F74A 3QFJD 5DJ6B 4XNDA 5EU4B 2XWTA 1GW0A 5EO9B 4MRBA 1DBAL 5F9WC 3EO1A 3ULAB 1JGDA 3TJEL 3OJ2C 1XF1A 5A2LH 1XCQA 4B7LA 5ISZE 1N67A 4EZLA 4Q6IA 5CJ8A 1OCWH 1HL9A 3FU6A 1OF2A 3V6ZB 3CMOL 3D69A 4PJBB 1WICA 3OMZA 4KI5C 2VNCA 2YMXH 3ESMA 4XB7A 4OSUL 4YBLB 3T3PB 1E3ZA 4HW6A 3ZT7A 4ZMVA 3TBTA 1Z32X 1V3LA 5BVPL 4HOZA 4GBXC 3F7VA 3L1OL 2D9CA 4FNRA 3TNMB 4F57L 2WWOA 1OPGH 2Y06L 2J1XA 3DOSA 3OR6A 5BUPA 1VCAA 4P2OC 5IHHA 4LCVA 2GK0B 3TWCL 2WXKA 3LD8B 5EO1A 3B8SA 4OV6F 5FW7A 5FCUH 1XL4A 2ZAIA 5GGUB 1JF6A 5INCB 3AREA 1XCWA 2UWEE 5GGSA 4KTEL 2IQAB 2F5AL 2V5SA 4URKA 2EDFA 3HC0A 1N10A 4O4YL 4HBQA 4XH2A 2CGRL 2MH4A 4XPBH 3SPVB 2OQJA 5HJGA 1KULA 3DXAD 3EYQD 1HAWA 5GGTL 1XD0A 1PIFA 2IBZY 2VQ1A 3GKWL 3QDJB 5DA0B 5F72S 4KDWA 1XD1A 4HXAH 3NZHH 1OCOB 1T7VA 4ZOBA 5KOVC 5JXED 3KPTA 4NZRH 3F6IA 3MLPA 2Y1YA 4KFMA 1Q94A 1F42A 1GL4B 3IMUA 15C8L 4OF8A 1FFRA 3BGFC 2ESVA 4KQ4H 5KVEL 2FSEB 3EUUA 3SDXA 1TJGL 3B3BA 2R69H 3RB5A 3S88L 1XZ0B 3ZZ1A 1FFOA 1GA2A 3FFOA 2PR4L 3U0WH 2CK0H 4H2CA 5KSUA 4HAKA 1XH3A 3DK2A 1KYOJ 4YWGL 1M3IA 3E8VA 1H19A 2AQQA 3ZVVA 1RZ7H 1S6NA 5I8CA 1I1AB 4NQED 1MCRA 4EVNB 2XJKA 4NWTL 3AVEA 3FQUA 2RMNA 3BW9B 1WRFA 5BMFH 3VD4A 5D5MB 2JKRM 2Y2TA 5F1OB 3V9FA 4Z7OB 2E9IA 3TYFA 3F04A 4LL9A 1PVHA 4HKJB 4MXVE 4LSTH 2F74B 3FCSA 3QXWA 1UURA 2XWTB 3H6JA 1QO3A 1KFAH 4D9LL 3O6FC 3EO1B 1GY2A 5FHBH 4APQC 1UH4A 1ZLVH 4JRFA 1XCQB 1A7NH 3E80A 4W9IC 5C0JA 1LQBC 1BBDH 1L0YA 3LEYH 4FC3E 5DQJA 3UTSB 5IQ7H 4ONOA 3APCA 4KRNA 3RL2A 1XAKA 4NUJB 1P84K 5D7IA 4MB1A 3OAWA 4JFQB 3V4VL 5BNXD 3JWDC 1ET8A 1ZRUA 4LK4A 4XCFH 1SQMA 3B5GA 5D8JL 4CC1A 3ARRA 4JRYE 2RJMA 3NZ8A 3DOSB 5I15H 4E9LA 2XV3A 1AY1H 2NW2A 5C0AA 1EHXA 5DHDA 5B1AB 4UTBH 2CDFA 3QNXA 2CO7B 2IOOA 4Z7UB 5EO1B 3UAEA 3MO1A 4JG1H 2ZX7A 4Q9QL 5EU6A 1U95B 3AREB 4G8GD 5DSCA 1CFTB 5GGSB 2NT0A 1AS7A 2K3TA 2NT1A 2AF2A 4Y5YA 4W9KC 3HC0B 3C5ZD 4XH2B 2WXLA 1YSOA 2OQJB 4G6KL 3KM1A 4TNEA 1RUPL 2MKWA 1G1KA 4KPHL 2PW2A 4MXWL 1Z0NA 2VQ1B 3CXHK 3H2QA 1JZGA 5IGXL 3MJWA 3X3GH 1TYRA 3MJ8A 4NOBA 4WVRA 3FTSA 1QVOA 2GIXA 2GHZA 4HPYL 1NKRA 2V2XA 4POZD 2YWYA 2ZPKH 1S7XA 4HHWA 1IEHA 4XPFH 1KENL 3PJNA 1N7MH 4YPGB 3UC0H 2DM3A 4M48L 4JO8A 4AJYV 3QI9A 4NO5A 3WYRA 1JD9A 1FFOB 1ZVNA 5AW0B 5KSUB 2NDGA 1XH3B 2YFOA 5GRJH 1ZMYA 4GG6A 2ZUQB 1DVYA 3CBRA 3HC2A 4GRWF 3AS0A 1MWAH 4F24A 3EBIA 1PU0A 2A6DA 1GSMA 1S3KH 3FQUB 3MRGA 3BVXA 3WTTA 3MBED 3KL0A 1CYWA 3DSFL 2A6JA 3MRHA 2OL3L 4GKOA 4YSPA 5HI4C 4JJ5B 4R90H 1KXQA 3VM5A 4XXDA 3QARA 3WO3B 4PJBF 2EACA 3W0WE 1QBML 3P4NA 1YDPB 4FQ2L 5JR1H 3T3PF 1T5KA 5JDSB 2D4DA 5D93C 4Y2DB 4ZSOE 3ATBA 3KWVA 2Q86B 1ZLSL 4NPYA 4AMKL 2LU3A 5GRUL 4CN4A 5C0JB 3A4AA 3CDCA 5K39A 5DQJB 5BW7C 4OLEA 4IBZA 4EI5C 1Z9NA 5D7IB 3I6KA 3GLAA 2BIOA 3P3YA 3QG6A 5LVEA 1H5BB 5BZDA 2GY7B 5I2IA 1MCKA 5AZ2H 4ONGL 2RTTA 3VRIB 3ARDD 2VISB 4RDQF 3H42L 4WHYG 2EE2A 3BYYA 1ICTA 5C0AB 2JSFA 2JXMA 4KUCF 3MV9A 3VI3E 3ZTJG 4GRWE 4RGOH 1ERNA 1KXTA 2CDFB 3S35L 3QNXB 3U2SA 2CDGA 1FP5A 5EU6B 4TXVB 4M9OA 4YHOL 1D5MA 2CK2A 1RERA 2OMZB 2W59A 3H55A 3WEXA 3D52A 5DSCB 3G7TA 6FABH 4XOBA 2FNBA 3PXLA 1UXMA 3KLSA 1LO2H 3H9SA 2R29L 1A5FL 1O7DE 1X5KA 2HUEA 5F1SA 3AS1A 1WFIA 4C4KO 5GS1A 2QSQA 2PW2B 3ES6A 1MW0A 4M7KL 1NEPA 4JFPA 4PB9H 5E2VL 4XR8C 3MJ8B 1H8SA 4C56A 4UNVA 1ZTXE 4GW1A 3QR0A 2CGYA 3NIFB 1E9QA 2V2XB 4W9HC 3DI2B 3UDWC 1W2KT 1S7XB 2FO8A 2NDFA 2RR3A 5KVFH 2F7IA 4UYPA 1IC0A 3ECVA 5HY9A 3AB0B 2PXYA 1BOGA 1VGEH 5E9DE 3Q44A 5D7JC 4JQVA 2IWEA 4K3EL 5D5MF 5DHXB 2QKIA 5DS8A 5EFIA 5TF1H 4Z7OF 4KUCD 4HJGA 1CTMA 2KERA 3QI9B 5F93C 2AAVA 4Z6AT 4BFEA 3QDJD