1M6UA

Crystal structure of a novel dna-binding domain from ndt80, a transcriptional activator required for meiosis in yeast
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
265
structure length
265
Chain Sequence
FKVGPPFELVRDYCPVVESHTGRTLDLRIIPRIDRGFDHIDEEWVGYKRNYFTLVSTFETANCDLDTFLKSSFDLLVEDSSVESRLRVQYFAIKIKAKNDDDDTEINLVQHTAKRDKGPQFCPSVCPLVPSPLPKHQIIREASNVRNITKTKKYDSTFYLHRNHVNYEEYGVDSLLFSYPEDSIQKVARYERVQFASSISVKKPFQQNKHFSLHVILGAVVDPDTFHGENPGIPYDELALKNGSKGMFVYLQEMKTPPLIIRGRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the DNA-binding domain from Ndt80, a transcriptional activator required for meiosis in yeast
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription activator
molecule keywords Ndt80 protein
total genus 55
structure length 265
sequence length 265
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-07-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1390 Mainly Beta Sandwich Immunoglobulin-like NDT80 DNA-binding domain 1m6uA00
2EVJA 1M6UA 2ETWA 2EVHA 2EUVA 2EUZA 2EUWA 2EVFA 1MN4A 2EVIA 1MNNA 1M7UA 2EVGA 2EUXA
chains in the Genus database with same CATH superfamily
3CHSA 3LOWA 3WO4B 5BS0D 4UTAA 3DGCR 5KYWB 3IJSB 1WTLA 4GRWB 5EBMA 1FZOA 5DJZB 3AZUA 4XWGH 3BZEA 4LOFA 4OZIE 3EYOB 5ANMA 5C0NC 1NGZB 3CX5J 3OLIA 4R3SA 1CT8A 3MRLB 4YHIB 3DSNB 4Y1TA 2WLZA 4OJFL 4GIAA 5DEZA 4JM2B 3EYUH 4NPKA 2ZP8A 4M7ZC 4ELMA 3OV6A 4IBZA 2F5AL 2ZXBA 4UOZA 4PJFF 4YLQT 2MCPL 1OAQL 1OAXL 3STLA 4FTVE 2FSEB 2XWZA 4MDIB 2WXGA 4GFXA 1YEHH 1KYUA 2WD0A 1GL4B 4P3DA 2G5BB 3WE6B 5IGXH 1Y1UA 3DC0A 1PY0A 3A4AA 4NN6C 5FGCE 5GIRB 4K94H 4OBSA 1J10A 2C8NA 4NRYA 3UDWC 3ULSB 5JXAH 1NBYA 1TZGH 3D69B 5C0DB 5AW8B 2L7QA 4G9DB 3DSNA 5F9WB 5DQ9B 5F97E 3CLEH 3ZDWA 1IBYA 1J0IA 3GINA 4R7VA 4U6YA 2NXZC 2H0EA 4XO8A 4FQCL 3S35L 5KS9F 5FUZH 3O3EA 2MIZA 3GMQA 2F15A 1R3JB 1E40A 2FSDA 4BYHA 4Z7QE 2J44A 1RSFA 3ZKXB 1CI3M 4URTB 2XQYK 3L3KB 4FXGC 1QAWA 4DPCX 1RZ8B 4DZBB 3E3QC 3EJJX 5I26A 4KI5F 5J89A 3EH3B 3FUHA 3O45A 2H1XA 4FDWA 2I7OA 1KJ2H 1YUHA 1XH2A 2E6PA 4QRTB 1IGIH 4DGIL 3H2PA 5LDSA 3WE1A 3LYRA 3QEUA 3QIUC 4GRWE 5CILL 5IIEA 4G7VH 4CJ0A 1GH7A 2ZUQC 4K7FA 4X7EC 2E9GA 4XN4A 3UC2A 3TP4A 1CTOA 4ODSH 2X6CA 3KLQA 4ZO8A 3BZ4A 5E6ZA 3SDDC 3H3BC 2DOCA 5DXWA 3PDOA 4LESA 2XWDA 2BSTB 2E74C 4QYOB 1KXTB 2FJHA 2AXHA 2D9CA 3WHE1 1DANU 4BE6A 1YY9C 3K6SB 4PV8B 1P4IH 2IWEA 5D6DA 5CN3A 1M3JA 3HI5L 3KR3L 5G5DA 3X12A 2MCAA 3C6LC 2HYMA 4H7VA 5I15L 1GW0A 3OKYA 4UV7L 1CURA 1ZIAA 1RH8A 3IJYA 3FH5A 4KO6A 4YVUA 5D70L 2F58H 3V6OC 5KJRL 3KPRA 3AGVA 5DQJA 1NTDA 1SJMA 5F9OH 1ONQA 5DD3L 1YNTF 3QISA 3MRMA 4LEXL 5IBLC 3W9DB 1UGNA 2DAVA 1N0XL 1T4WA 1K3IA 1IC5L 3CLFL 5EZLB 4J28A 5C0BD 5EU3B 1SXZA 4BKLA 3NP4A 5CF3A 3EADA 4ELKA 3O8XA 5KVFH 1T0PB 3EW3B 4U7SA 4XZ4A 2HMID 3QHTC 4ES8A 4HWZB 3HMXH 4S2SB 3DVGB 4IRJA 1NGXA 1EZSA 1GOHA 3N2JA 3QIWC 4KKPA 2IOMA 3L13A 1UKSA 2X28A 1LM8V 1JZ6A 3KPMA 5JLZA 4N6RB 3DI2B 2J1ZA 5EZJA 4KJQC 5FWQA 5ICYA 3HPLB 3UC0L 2XX0A 3ARDA 5KTEH 4UQEA 5FLVA 1ZPLA 3B5GA 3Q8FA 5EDSA 3TURA 2R8SH 3VH8B 5B8CC 3IMTA 1AGCA 2YRBA 3HW7A 5C71A 1INDH 5JHLA 2Y0SA 3DJTA 5E1AA 3ZBMA 1AZCA 1A6WL 3CXFA 3NSCA 4GAGH 4P5TA 3HC4H 1GYUA 4Z7UF 2WO4A 1SEBA 2HLFD 3IFPA 5IHWA 5I1IH 1JZJA 1HAWA 1DLHA 3VFTB 4NYLA 1HJBC 4W6WB 3TCTA 1S8DA 1W0WA 2L04A 3N1QC 1RJLA 3ZHKA 3NQKA 1TZGL 2RJMA 1V3MA 1X5YA 3K0YA 4PD4K 2P48B 1YCSA 4PJ5D 5J1TC 3IWVA 3A6CL 4FHJA 1AR1D 1IGML 4XPAL 1RZKL 1VZGA 2FEEI 2A9ML 4OCMC 2VLRB 4APXB 3IJ7A 5LO7A 2NPLX 5KSAA 1JPEA 4PCYA 2YJLA 1U95A 2OV0A 1TEGA 2WQSA 2YAMA 5AVYB 3RVTC 4LPTA 2VB5A 2IFFH 3NSDA 3QIWB 3WFCL 4J4PA 1A9VA 3T0EA 4XE5B 3FU3A 1QATA 3MV01 2ZUXA 3MLXL 3P77A 5D1QE 4V1DD 1CIUA 1RERA 3AM8A 3O2WL 4HOMA 1NGQH 2H0FA 3CBKB 4Y2OA 4KV5F 3JBG7 2KUTA 3FQTA 3QWOA 1IGIL 4I18A 1LHZA 2OZ4A 3TWCH 2J71A 5ANME 3HIZA 2YXVA 1O6VA 2OMWA 3V0VA 2XXFA 5EOCJ 1ZT1A 2X4OB 4N0FA 5JXED 1WS8A 5FGBC 3OXRB 1MXDA 3A23A 3W5NA 1IBFA 1RZFL 3M46A 4TUKH 4UQ2B 3FS9A 2B0SH 3GS0A 3ZE2F 2PXYA 2GUYA 4PJAB 3U9PL 2WWKT 1JWUB 3EO9L 3P73A 4R26H 4HHAA 3BZFB 2DL2A 3G6AA 2NYKA 3RTQB 1LE9B 5ILTL 3MV7A 3DK0A 1LNUB 2AK4A 1SDAB 2XU9A 1XAKA 4JM0A 1F13A 4UQAA 3CLEL 4XMKL 2ZX6A 4FNRA 5AVTB 5FYJE 5GS0L 2WKOF 4DETA 1QLFA 4GQRA 1UT1A 4OV6F 3VVWA 1I3VA 1HFUA 3DXAE 1FFQA 2W65B 4Z77A 4PV9A 4DO5A 2NT0A 3NK4A 3I75A 3OXRA 4JQVC 2V2WA 4AGNA 4O2EA 4PW9A 1J7VR 5DJ2A 4KRPB 4QDGA 4HCGA 3CCHA 4L29B 3G5VA 5F0LB 4PLNC 4AYMC 5D4IA 1I1YA 1IM3A 4DN4L 1HHIB 3X2QB 5K39A 2FECI 2G4EA 5J13B 1AAJA 4MFHA 3BC9A 1JV2A 1M2VA 4E9LA 4P59H 5DS1A 4ANKA 1QWNA 5ABZA 3GRGA 5IVZB 1NUNB 4OF5A 3WFBH 2ARJQ 3ABLB 4D9LL 4G6KL 3UPRA 3BE1H 4M5SA 2GTZA 3GKZA 4GSQA 4O02A 4PJCE 5L7XH 1F5WA 2CLRA 2E7HA 2CR6A 2V2WB 5EEXA 2WUCH 3RNQA 3ZIMA 1P7KA 1HNYA 1BXXA 1BOGA 3CDZA 4G8IB 3T4AB 3VXNA 1JGEA 2G75B 1JFQH 4K5LA 5HJ3B 2C7FA 2IWGA 4IRZH 3ARUA 5DUJA 1T1ZA 3PWPD 4UT7L 1OGPA 4GSUA 3H9SA 3GK8H 4PEEA 3FTUA 3QUZA 4B0MM 1MN4A 3RJOA 1MRCL 2I25N 2VDLL 3EFOA 2WVUA 1A1NA 1CR9H 3OKEB 2V5YA 3BZ4B 4RVBA 4HK0B 2N1TE 3MRRA 3FU7A 5L6YH 2ZWSA 2R59A 4NO2A 3RTLA 3UZEA 3O6MH 3V4VA 3GJFB 2F53E 4UDUB 2H9GB 3MLZH 5FA3B 4TVPE 5I17B 1U0QA 2OZ4H 4JFHE 4YMPA 3VA2C 3JWDC 3SDYH 4BSVA 4ZXBB 1JVLA 2NY6D 3IB4A 3K6IA 1MAML 4MA7H 4XVTH 2ISDA 1EANA 4AW4A 1OB1B 1NMBH 4AG4H 4MNHA 2VISB 1L9TA 2PCXA 4B50A 5C8JA 3QT2A 2RCSL 4GW1B 3J8F7 1WGOA 5K1NA 1KTDA 3AFLA 4KTDL 1I7RA 9CGTA 5J11B 4G7YH 4U1GB 5FFGA 4M4RA 1MFBL 1RIVL 2WZAA 3P3SA 5DQJB 3IGFA 3RX5A 3TPKA 3CVHB 4R3SB 5HHXH 3KWUA 1IU1A 4NQDB 5E8DL 1QHPA 1ETZB 5ALBH 1T2JA 2W9EH 5DK2A 5F1IA 2WAQA 1IC4H 1HXYA 1AYOA 2J88L 1CF8L 4HKXB 5BZDB 1EBAA 2L7JA 2BXYA 2GAZA 4L3EA 4P2YA 5I28A 3O8XB 4BFEA 4Y9FA 1RHFA 2FUQA 4O9HH 1J8KA 2D8KA 3CN1A 1N5AA 4QKXB 4MCMA 2HLAA 2CAKA 1TQBB 3EGXA 4P48A 1S7QA 4X6CF 4RSVA 4WW2A 4Z7UB 4GAYA 3U2IA 3LQZA 4JFSA 3TU6A 2YD1A 3IDIB 4JHWH 2O6EA 4AV0A 1HH6A 1BVZA 1UXLA 3QPQD 4IKNA 4BFFA 4XN5A 5E4AA 2F7QA 3DV4A 5F1NB 1NCDL 2Z93B 2EDOA 3FRUB 2XZAH 1XIWB 2B59A 2P5WE 4NFBA 1T89C 3MLXH 4KVCH 3BSZH 4NPYB 4OGAD 1A4JA 2EQDA 4XX5A 5DQ9A 5FOBB 3ESPA 4UDTA 3ZMRA 2XIDA 5BRZD 1BG9A 4R97B 3X13A 1FO0L 1WH0A 3ZGHA 2YXFA 1IIKA 2NY4D 3O3BB 3GSXB 3P11L 1FORL 3HAEH 4K8RL 2SEBB 1IGMH 1Q9WB 1YAZA 3R18A 2YGQA 4WWID 3PGCA 3OMAB 2XACC 5FDWA 4XCNB 2B08A 4TSCL 2P5WD 3FUDA 2HJKB 1ZRUA 2VDLB 3QQ9C 4TNGA 1PCSA 1H6FA 4APXA 3JV6A 1KACB 3W9EB 1E6JH 2BFGA 4RGNB 2ARJA 2DV6A 3QRLA 4KKBC 4NWUH 1UJTA 3QORB 1KIRA 2MTPA 3FDWA 2ICES 3RYMA 5JOPD 3QWNA 3VD9A 4Z7QB 1XV8A 3DO7A 2Z3FA 5L88L 1P5UB 4QCIB 2DYPA 4A7VA 4ZYKA 3QQNA 4X9BA 3WO3B 3ZMNA 4G8EB 3HZKA 3VB9A 4HWEH 2ZKYA 4HJSA 4ABWA 3PAZA 4BELD 1TZAA 3KBFA 3KPSB 4GRLC 5AWNL 5JO5B 5IMLA 4NGHL 1KBPA 1WAEA 2O5XL 2W5PA 4P3DB 3WFHB 1E50A 1NSNL 1AP2A 3IN2A 3L4XA 5ALBL 1U8NA 2JCCE 2Q6WA 1SMDA 1VAHA 4YWGL 3ROLA 2CGRL 3EJSA 3MLSH 3KYOA 4CU6A 3MRJA 3C60B 4GQ9L 3H2QA 4N2MA 2ZUTA 4KUZH 2IQ9L 3RKDC 4ZZFA 2EACA 4NWTL 2CBMA 4F7TB 3OKNB 3CHOA 5INCA 2WGXA 3WN6A 3QORA 5IB1A 1ZWIA 2Y7LA 3MU3A 4XMUA 4YGAB 3CSTA 1LTXA 1W0VB 1AH1A 4GT7A 2BNRA 3AS2A 1ZDQA 3IDNA 3UZVA 5ISZD 2EDYA 1DSYA 5E2JA 4H8UA 3CXHK 3Q3GA 4JY4B 1CQKA 2F58L 3FFDA 3Q6GL 1CXHA 4K9EH 3TA4D 2UYLB 2JVUA 3TX4A 3S3DB 5EU3A 4MAYB 2JI1A 2WZ5A 1P4LB 2J6EH 5F7HA 2ADGB 5AZEH 2PWFA 2VWEE 3TBSA 4YDVA 5I66A 2E59A 3GMLB 1NAMH 3O6LH 3EJRA 1UURA 1D2PA 3OR7B 4I0PA 4KX9A 5EEWA 4Y4FD 3ZJAA 4Q9RH 1MRCH 3UGUA 1MCSA 2IGLA 4KVNL 2FX9H 4OM0L 4GRLB 5HD8C 2HTKD 4ZX4A 3VXQB 1RZPA 5EOQH 4PBVC 4ZW8A 4JREB 1F8TL 1SDDB 1A7PL 3IMSA 2R2EB 4GKLA 3DX4A 3D25B 3IMUA 4EKJA 1F18A 3RILA 1YY9D 1DQKA 4PJDE 1NCJA 3QDMD 4PRDA 1E5YA 3KXFD 4WI6A 1H9VA 1TTBA 3CC5B 4PG9A 1ND0A 4LMQE 2ADGA 1KXHA 2P80A 4Y2DC 5JW4R 3CN3A 1KTCA 4P2AA 2Z9TA 1OGAD 3LRGA 3MUGB 3ERXA 1QUNA 3MV8A 4NQCA 1KPUB 4JO1H 4ZOAA 4B97A 1MHCA 4XMPH 5IB5B 2I07B 3L5HA 4K7FB 3WDHA 2YPLD 3UAJA 1HCVA 4R2GC 4BEIA 3ARBA 4JM2F 3MXWL 4LSQH 2NX5D 4JM2D 4QJ3B 4WSGA 1OVZA 3BVWA 2HVJB 4HDIB 4MYWB 4U0RC 3T6WA 2NRDA 4ALAH 1UEYA 5F9OL 5KVDE 1WHPA 3C5XA 5D1QA 1GYCA 5CJOL 5BV7H 1CGWA 1KN2H 3MJGX 2R4SL 4ISVB 1DVXA 1JPST 1NEZG 3H9SB 5I1HH 3VTAA 4NKQB 3PFUA 1R3KB 3OR6A 5IJVA 4Z78B 5FYKE 3NIFE 1I75A 1QASA 1G6RB 1FYTE 3CC5A 1NGYA 4ZFQA 4AQ8C 4R9HA 2EZ0C 3EBAA 3EGSA 1AD9B 4G8GB 3BWAA 5LWYH 5ITBL 2Q3AA 4H5SA 4L1TA 3UBXA 3GIZH 4PN6A 3OZLA 1JHLH 3OX8A 5ENWA 3T2NL 3UTTE 2GUOA 3F7YA 3CN2A 5JOFA 2NY4B 4KTEL 3BKCL 4ZFFB 5CEZH 5KOMC 5DVNA 3NBNA 5EUKB 2YKLL 4Z7VB 2YMTA 3GF8A 4X50A 4Y0GA 1F86A 2PR4L 4BZYA 3IPBA 1HEZA 4KK6C 1HIML 3BAJA 3IGUA 4FADA 3HUJA 4NKOB 3MYJA 1SLXA 4XBEL 5T1MB 4TQEL 1IFGA 3BAKA 5D5MA 2DM7A 2NTSP 3FN0H 2QVKA 2ZKWA 3QJSB 1BEXA 3CVHH 2DWDB 3MXWH 4ANVA 2FATH 2PW2B 3MC0A 4L4TE 1YEJL 3N85H 1K6QL 1WDAA 3KYMB 1LEIA 1DN0B 1F00I 4YFLF 4I1NB 1ZKAA 2COQA 2L7EA 1FNGB 2EDMA 3T0EC 5GJSL 5F7EL 4IU3A 5L2JB 4XVSL 3L2LA 4MQXD 5EWIL 4PRPB 2ZOLA 4EEEA 4J4PC 4MCZB 2NY2C 2OTWB 3DVNB 1D9KB 3IXAB 4BSWB 1Q9OB 3PHOB 1AQKL 1Q1JH 2W1NA 2DPKA 5IB2B 3SGEH 1KPVA 5MI0B 4N0UA 1UM5H 2BP0B 3OB0H 4GG8A 5E8PB 4GAYB 3RZCD 4Z76A 4XBGB 5AW6B 5G55A 3V6FA 3VXRE 3WJLC 3IGLA 3S7GA 5IQ9A 3IM1A 2VLKD 1QHOA 4M9OA 4QRQB 1M2VB 1E8ZA 3RJDA 4R8WH 4W1TA 4U1MA 1BZ8A 3BOVA 1R3IL 1UACH 1P1VA 4M43H 1XX9C 4X9HA 5ACZB 1YMHA 5JMOC 4MB1A 2WV3A 4LQFL 2N4IA 4KY2A 5D1ZB 5B8CA 1JVOA 3QEGL 1CICC 1INEH 1R5WB 4NUJB 3ARDC 5J6HB 5DD5L 1X5HA 1R3HB 1NFIB 1X5FA 3FB5A 2BC4B 1CFQB 3QJFA 1DANT 1NZRA 3RVUD 3UBFA 5I1GL 1R24A 4JGNA 1YN6B 3JTTB 4ELMF 3LTVA 2E7MA 1Q38A 3K8LA 3O6KH 3BKYL 4WI8A 5FOJA 4JB9H 4Q0XH 4C83B 1TVBA 1FL6A 2GW5A 2Z7ZA 4NQVA 4A67A 2YFOA 4NQCE 1Q90A 2XBDA 2D03L 1G0YR 1UXSB 1Z9PA 1PZDA 4X4KA 2X3BA 3E6FB 5E6IC 1PDKB 3QNYA 5HBBA 2QVMA 1S7SA 2BFVH 1ZVHA 4NO2B 4DAGL 1SHSA 3A6OA 1S9WB 4KZEL 3CLFH 4XBMA 1L9QA 3GMPB 1MHHB 1K6QH 4F2MA 3GI9H 3HE7B 4ODXA 3QUXC 2BOLA 1OW0C 4ZOEA 3TA3D 3MKKA 1FAIL 3G5ZA 4ZTPH 3IGKA 1MRDH 3DTUB 4JPVL 3N40P 3ZDXE 2ZKHL 4Z7NB 2C9AA 5FCSH 2ZWYA 1ORQA 3QHFH 4OM0H 4LRNH 3UZQB 3TESA 4W6YB 4AMWA 4E41B 3SKUD 1D5BB 1XL6A 2ERJC 4RRPM 5EU6D 2LLLA 3GSWB 3EOBB 4U1LB 1LO5A 1KENH 2W9DH 4B9FA 2XPGB 5CEZL 2WXFA 1EFXD 2E56A 1QRKA 4O02L 3WG7B 4QF1A 5EHFA 3MRDA 5HHPB 4AYFB 1IBZA 3IKKA 1S7SB 4F5CE 3JVGA 4O2CB 4XN1A 3WEBA 5TFSL 2JKXA 4BFRA 5JIDA 5JW3L 4J8QA 4FXKA 4S1SH 1U92A 1E8WA 3FQRB 1YEKH 2X88A 5CFAA 3P9LA 4U6VL 2UY6B 3N0PB 3HHMA 2AJZB 4L9DA 4JFXA 3LY6A 3KPNA 3FSWA 2D3VA 3EJYD 2X4PB 3DUSA 3KEDA 3ZKQD 2WBXA 3SB3A 2WOBA 2CGRH 4X6BA 5EZPA 2YD5A 4OLEA 1FPTH 2R0WH 4Y19E 1AO7D 3FTZA 3PAUA 1VADB 2EIJB 4I3SH 4NB7A 3KAAA 4XVSH 4PWHA 1BM3L 1VEMA 4Y9CA 5A1AA 4ENEC 3N9GL 5CCKL 2CLVB 3K6NA 3BQVA 1W72B 5I6MA 2FHFA 4ZUUB 3QRGL 1MJ7L 1K3ZA 3V4VL 3KBEA 4KJYA 4LKCA 1GTFA 5FFOA 3MUUA 2CK0H 1LWRA 4R7DB 5MEPB 4DEPC 5ESQB 4MJ2A 3TO2B 3ULAB 1MRFH 1Y0LB 4LHUA 5ICZA 4P2OA 4WLCA 1BBDH 4LHQB 5TF1L 2DQIL 2EEXA 3NFPA 1KB5L 2PYEB 4L3ED 4ORGA 3CU7A 4MJID 4Y19D 5EO9B 5B3JE 2CK2A 4CVZA 1MCJA 1OM9A 5CBAA 5I71C 5JPNA 3UDWA 2KDGA 2XV6B 3GXUB 4G6MH 2B5IC 2YBRB 4XHJD 3E1ZA 3UTPD 3QEQD 2DLHA 2HFFB 3RIFK 1WSST 4KI5D 3S3PA 2W07B 5C1MB 4MDJA 2IH8A 4JR9L 1W8NA 1U93A 4LLMB 3V0WH 4AVHA 1Y7VA 4GXUN 5LBSA 4E9VA 2Z8WC 1BMZA 2GK2A 2JI3A 4FFYL 1T2QH 3SDYL 4IMKA 2NX5E 2ZPKL 4PM1A 1G7PB 2A74C 2F19H 5EEVA 1GYVA 3MCG1 3VXUA 1CDBA 1NGXB 2B39A 4MB3A 3QFJB 2XVGA 1JXKA 3HA0A 3QCUH 1UWGL 4K3HA 1BVKA 4PGEB 3DSFH 4JFTA 1UQSA 4G83A 2D2CC 3UYPA 2JKNA 3RY4A 3FPYA 5C0CD 1J0ZA 4KK8D 3S4SG 4JQVA 2WLLB 2PWHA 3LV3B 4P9ML 1AGCB 1MWAH 3DBXA 3UJIH 2BSTA 4CA4A 3U1SL 4XPHH 3MLPA 4HEPG 2VJ8A 1PGRB 4DP8X 1S7XA 3EF4A 2NSXA 4FQJH 2XTJE 1ZTMA 1TXKA 2JCCA 2Z8VC 5AOLA 4ANWA 5GJTH 3QG6B 1WLHA 2QKIC 4KK8C 2DF3A 3Q2CA 5F89A 4E41E 3CX2A 1IC4L 1MY7A 4LXFA 2F8XC 5DJAA 2WGNB 3ETBJ 2OJZH 4HS3A 3WHXA 2F61A 3HRPA 1UVQA 5AKVA 3ULUL 2IANE 1O7VA 4IKKA 1CN4A 5EOCL 5MEQB 1MFEL 2ZCKH 4BQBA 2QGEA 4M56A 4EZJA 2PF6A 4HW6A 3D39D 4JDZA 2OS7A 1D6EB 3V6ZA 4QHUB 4ENZA 1UXMA 3D39B 4PLKD 3V55A 4K3EH 3HTLX 2QQLL 1H8SA 3PDGA 1MJUH 3VXSB 1W0YT 1Z3RA 4PVLA 4MB5A 4BGLA 3CWGA 3Q5YA 1D6VH 1VGEH 2L7UA 3P4NB 4KKRA 1QPXA 5E4OA 1CE6A 1JG9A 3WIFB 5EZOL 3NFSH 4UI2A 1KCUH 2AEPH 2MQ3A 5C08D 3TV3L 4A2MA 1AXIB 2GEEA 4GKSA 1AXTL 1EEQA 2G4GA 2QGBA 4P2RB 5DJ6B 1CZ8H 2R2CA 4ZW6A 1IFHH 4HD5A 5DCCA 1FDLL 4Q2ZB 1BREA 4OUOA 4DKEH 3OHXB 2BY3A 2XFXB 5TTRA 4HHAB 2P5WA 4L8CB 3T8MA 4U7KA 4M7KL 1FGVH 3U2SB 4JRYA 4NQED 4U6YB 1J5IA 5SV3A 4UBDC 1HU8A 2WQXA 4F7CB 5DJ0A 2ZUUA 3L8QA 4QPEA 4X83A 1HDMA 4AGOA 1E42A 1GS6X 1TCRB 5LBVA 5JPMB 1UA7A 1AFVH 1KDJA 2HP4A 3QXAB 4L37B 5C7ZA 3EYQC 4Z7WB 2AQRA 4G8GD 2AXFA 4M8QA 1PKQE 3HAEB 1CFSA 2YUWA 5EPMA 3BUPA 4K2UL 5FW7A 3L1FA 1CD9B 3ESOA 4M1GH 3EUDA 4MAYA 3IFOB 3TJHC 1WAPA 4H0HB 4MX7A 2AJXH 5HYSG 1YVLA 2ZOOA 3SJVB 3SPJA 3TF7C 4U3HA 5AOZA 3H42L 3ZX1A 4JANA 2XV0A 4PRPE 3X1FA 4ZG1A 1HILB 4JCMA 1RURH 3S5YA 1B4TA 2XIIA 5E8NA 4BZ2A 3P4MA 1ZWIB 4WTQA 4MMXA 2YR3A 2I32A 4GRLA 1DFXA 1H8LA 4Z7VA 3VXQA 5KVEL 1HDMB 4IJ3C 1S7UB 1Z9OA 4F7EB 1NFDE 4XP9H 3WCYA 3NJHA 3EZ8A 5E24E 4ORZC 3BDXA 2GB2A 3KVQA 4RZKA 5ESVA 2VR6A 4HC1A 1M7DA 4AIEA 5BMFH 1I8IA 1F11A 3QG7H 3TIEA 4S1RL 2CBTA 3QNZA 4PG9B 4ODBD 1N2RA 2FQFA 2FR4A 4J12A 4J3OD 1UH3A 3FUKA 5IROA 3L5WA 4LCCC 3QA3B 4J3OF 1Q9KA 3U46B 2XV2A 1QA9A 4NHCL 4PHZA 1NCTA 3B9KD 4PTTA 2OTPA 4CVUA 4DUVA 2FUTA 4D9RE 5AG9A 5EV7A 1I8KB 1XL4A 2IMMA 3T0WA 5A2FA 2HFEA 4KRNA 3WJJC 5KBPA 1G7LB 3NA4A 1YECH 3MPCA 4WGKA 5FEBA 4JFFE 3DROA 2VOTA 5HYJE 1OM3H 2VLKA 2WLIA 4HCRL 4J3SA 5HHVL 4TLSA 2EXSA 4IEFA 4PRBB 1GR7A 1T89A 1F41A 1G7IB 4YBQD 3TT1H 1R46A 4JREC 1ZLUH 2WTRA 3MLRH 4QD2E 4HLZH 5JUEH 3QNXB 2FR4B 5J4MA 3B5HA 1Q0YL 3CZUB 2QSVA 5EN2A 2R2HB 1WD9A 2ED6A 4JUTA 3DURA 3N55A 5HYSA 5F3HA 4XODA 3VTTA 5TE7L 2M83A 4NM4H 4KUCF 3WEOA 5JQ6L 1I8KA 1IAIH 3WU1A 4P59L 1QO3B 1NH6A 4LEOA 1QKZL 1AC0A 4ZJ9A 3VWJC 3IRPX 3MOAL 5AW4B 2GEQA 4F5CA 2VE6A 2VDNH 2PUQT 1WS7A 5DHMC 4H26B 1KBGL 4N8VG 2X4NA 2FB4H 4FD0A 5CU9A 3KYMA 1I1CA 1LEIB 4RDQF 1U36A 12E8H 1UWEL 1YO4A 3H3PH 4AH2B 2YEQA 1XGUB 5K9KB 1A47A 3HE7D 5J8OA 2QPEB 4NKDA 5D7IE 2GCYA 4J23A 4ZXBD 2H41A 4HXAH 4N22A 4MCZA 2VLLB 2ESVD 4QY8A 3GTNA 1U21A 1XCQA 4GW4B 4JO3L 4DERA 3IDIA 2VR4A 2B77A 1I1AC 2QPSA 3BWSA 5BV7L 3M7OA 1MCHA 4I77L 4R5VA 5D1XB 1DUYA 1E3FA 1WV7T 5JIIA 5J12C 1A3QA 1DVUA 2DY2A 4OW6A 2ZP0T 4RAUA 2BM3A 5DRNA 5HYJD 5I8OH 3T6ZA 1NEZA 1B3IA 4HEME 3PL6B 2FNWA 4LCIL 3ZL4L 4WDIA 1IC7H 2CSPA 2K7PA 4JM2C 2QQNL 3GSXA 5KSBF 5AENA 3SGDH 3LKOA 4M6AA 3U2JA 1TKWB 3MJWA 2H3XC 1FV1A 1ZT7A 5I30L 2P1YA 5F9JB 1NCWL 5I0YA 4ZUSB 2OR7A 2DQJH 4G80B 1E9QB 4OQTH 4YSSA 4Y7OC 2J1YA 1OSZA 1Z9SB 4JPIA 4L8DA 3U7AA 2ZWZA 1RD6A 4ZS6D 4GG6B 4OZ4A 4X80L 5DMKB 1SUJA 3HNVH 4M4RB 3SGJA 4JDVB 5F7NC 3KBHE 2QR0A 1ZV9A 2W38A 2WYIA 3CZSA 1P5VA 3X17A 3JWDH 2ZXWB 3BP4B 1MWOA 4OLXL 1M1XA 5IP4A 1KGWA 3LRMA 3RURA 4OTXH 2VL4A 5ISZE 3PWUA 5IM7A 4NQXB 4YZFE 1WFJA 3AWGA 2F1AA 2FD6H 4O2EB 4JKNA 3VX0A 1DBAL 3T09A 2B2XH 5C0ND 1ECZA 4G42B 5T1DH 3VFVB 3H2WA 4IIQA 3UAFA 4ADJA 1TJMA 4YK4B 1FV1B 4K71C 4U1IA 4EIUA 2D3LA 1N4XH 2QZ5A 3MBWA 2MJWA 2E9JA 4UT9H 3UG3A 2APTA 5EBMB 2OMYB 4YIQA 1L9SA 1JK8A 1RP8A 4AGPA 2G60L 2KL6A 3OXSA 4U05A 2E47A 4F9PA 1B0RB 1AD0B 1IGYB 2B7DT 2QQQA 2YN3A 4E41A 4BDVA 3ULUE 2PNDA 2E4FA 2Y7MA 2CZNA 1KIUB 3VWJD 4PBXA 3S36X 25C8L 5CJXA 4MD4B 1KJ3H 3BPLB 2DJMA 1DVQA 1LVEA 3AXHA 1MEXL 1FYTD 3RVVC 3UPCA 5B7FA 5F2FA 1R0AH 3HG1E 4U1JB 5BJTB 4TQPA 3QXAA 3W81A 1P7KB 3RX7A 3JYBA 3TTSA 1JDCA 4LASL 1PLGH 2DQTL 4S11A 3KPOA 4JKPH 2OKMA 2X87A 3G6JF 1BYOA 4D94A 3GRWA 5DEJA 3B9KB 2OMUA 3AU1A 3TF4A 4LCYA 3WUWB 5T1DL 3N42B 3N43B 1EGJH 2HT2D 4XCYB 3GIZL 3J2PA 4I18C 2YSTA 4JHUA 2KC0A 3T8XB 1A7QL 1RZIB 2XQBL 4WU5A 2GBUA 2G9HB 3HLAA 3IDGA 1L7IL 2WPGA 3EHBB 3KWWB 4EUPG 1JF5A 4JLRA 5D70H 5IHZA 1VIWA 3D2UB 3VD2A 3GJFA 4UDUA 4FKKA 1H6TA 1U3HA 3MFGB 2YD6A 2IDSA 4TNVF 4YEFA 1YC7A 5IW1B 3C87A 2E27H 1HQRB 3P2BA 4LOVA 3EFFA 3GSQA 1CICB 3H4FA 4OCYH 3KYOB 4ZFOA 3LNEA 3QUGA 4WIQA 1DFBL 1FO0H 3UO1L 3LJ3A 4GW1A 2XG5A 4IHOB 1YDPB 4CVZB 5JPNB 4TTDC 2D7TH 2FWLB 5I5MA 3NJIA 2K4AA 4LCIH 3FPXA 3ECUA 4M4PA 3MRQA 5GPRA 2VDOH 3O3AB 2XWTA 2V5RA 1DBJL 5EWIH 5ITFA 3QDAA 4L9LB 1YAIA 3GXIA 3JTBA 1W72H 3M8OH 1J48A 4JDZB 1YPZE 5IW1A 1BF8A 4JO2L 4LL4A 2WQRA 3KYAA 4Y4FB 5FW6A 1RJLB 4NT6B 2MQCA 5GS0D 1SYVB 3T1FA 1CBVH 4HUWA 4E9SA 2IBGA 2Z4TA 3C8KB 1AS7A 4RNRA 3AMLA 4U1KB 1MZYA 3GNMH 4KVNH 4OZHB 5E99H 1S46A 5EZIH 3LIZA 4Y19A 3KWXA 2BP8B 5E8DH 5KJRH 5IOPB 4NC1E 4X42A 1L3WA 1WBXB 5BPPA 3OSKA 2VQ1B 3WFDH 1LJMA 4JFOA 4UIKL 4W4NA 3BZ5A 3DJRA 2B2XL 1E3ZA 5FO9B 3V0JA 1GS7A 3I9AA 3MRKA 3QEQA 4HVBA 4U7MA 4Y2LA 1CZ8L 1CJYA 3S4SB 4AM0A 1S7XB 2I9TA 2WVVA 2XJLA 5BCAA 1KGYE 2NZ1A 4FA8A 2ODHA 3Q1SH 4JM4L 5GGVL 1BJ8A 1BJ1H 1XCXA 1PY4A 3CMOL 3S96A 1EMTL 4GSXA 5IVXA 3GKWL 3V0VB 1ZHBB 1H3TA 1MJJB 4QXVA 3WY3A 2QJDA 4F58L 2OSLB 2J43A 3C5SA 1F6FB 4FJZA 4FXTA 5A40E 3GMNB 3CFEA 3WTWA 1VENA 5IZ7A 1A6AB 1FFNB 2JF1A 2XBTA 2XZAL 3VD7A 2CRYA 3G5YB 3WHXB 4N26A 3AWEA 1BBJB 2Y72A 3GM0A 4KMTH 3PAYA 4PWFA 4N0UB 4WEBL 3F84A 5CBEA 1P2CA 5EB9A 4O51A 4LGSB 1YLBB 2JCCB 3MA7B 4NGHH 1NC2A 5I8KL 4GO8A 2AJXL 2E5EA 2NUTB 1BF5A 1LEKB 4AL8L 4G6JL 1AY1L 5LXGL 1T03H 3SPGA 2MFNA 4XNQB 2H2PD 4XXCA 3VM7A 1M42A 2GJ6A 3ZSTA 3IS0X 1N64L 4WKZB 1ET7A 4UIMB 2WXOA 5CHNA 1NEZB 2Q2EB 3L7FA 1QBLH 4EZMA 2J5LB 2EH8H 4PJAE 4X5PA 5FR3A 4PJEB 3LH2H 3UJTL 1N4XL 5F8RC 5DFVC 5I1LA 1BBJA 1Q0XH 4WWOA 3LIZL 4P2QD 1KV3A 1R24B 2UXVA 5FHBL 1JRHL 5I1EH 5I6PA 1I1YB 2FQDA 5JZ7C 4HCFA 5AW0B 3NACL 4OIIH 2WBJB 1O6SB 4IGBD 1WZ1L 2GT9B 4MQXC 4EOWH 3FOLA 4JHZA 1P4UA 1RJYB 2XVKA 4AT6B 3I3BA 4UTAL 1VGEL 4W6XB 4E5XB 4F8TA 2APWA 3PPSA 4FCAA 3VFGH 1FL5A 1IB5A 1FNHA 1TNMA 3MXVH 4QRRE 2DMGA 1NLBL 4UNIA 5AALA 4MXQC 8FABA 4IU3B 2R1XB 3WAKA 2XQYA 4JRFA 4LPYA 3UBXG 3TBSB 4X9GA 1T04B 4S1QL 3UAAA 5L2KB 1AC6A 4P46C 2NNCA 1I82A 5IHHA 1E4WL 1Y18A 3MI6A 5IJCC 1N6QH 4HETA 4N2AA 1AHWA 5GS0H 1JZFA 3G6AB 4L0ZA 4MVBC 3RTQA 2XWCA 2IQ9H 3NCFB 1TU2B 4JQXA 2YLHA 3RPBA 2YD0A 4IBYA 4P46B 2YD9A 1U2HA 5T33H 4JFFB 4G3YL 1A7NH 2KLSA 4F80A 2FHBA 1Q0YH 5DYOB 1GYAA 3JWNC 3SBRA 5MENE 3WSQH 5E5MA 5EUOF 4MWFB 4UM9B 3PHAA 2WVSA 4FQLL 2XCMC 4L1HA 3HBQA 3PWLA 1OLZA 1KIUA 2AJSL 3H3KA 2H26A 5E1HB 4KITB 2BZ7A 2WTOA 2K4WA 2DQHL 4JEGB 2MPAL 5DHYA 5TJWK 3TNNA 1JGVH 4WTZG 1AZZC 1T21A 3FO0H 5ERWA 1KYAA 3EXLA 1QSEE 3QUKA 1MREL 3P1VA 4KRPC 2YN5A 5FCUH 3VGHA 4L18A 1UD5A 3FB6A 4NPJA 1MIEH 4X8JB 2HVJA 4HDIA 2D31B 3H53A 4AYGA 3NOIA 3CHRA 2ADIA 4N20A 3S34H 4DGYH 4PJAF 2Q3ZA 1T83C 2C9SA 4U2ZA 5KS9E 1EAPB 4LKXA 5CIPB 1HVXA 4HBCH 3MRCA 3MBED 4C4KT 1T7WA 4N87A 4MXVE 4NRXB 1NGPH 1UD8A 1NGYB 3OWEA 2P4AB 4YXKH 4BWUA 1DVFB 2DEYX 3DETD 3QUZC 3QPXH 4HWBL 4XP5H 3O2DA 1KXVC 3C8DA 1JWSB 3QIBD 4EVNB 1U8QA 1DSFL 3MRIA 1TENA 4L4TB 4F2MB 4NNXB 4QTFA 5ICZB 3V0IA 3G9VA 5FKPA 2JQAA 1HWGB 3FTWA 4GQ9H 3QO0A 1FVEB 3HC2A 5EU4A 4JN1H 2E8YA 1J12A 1J9TA 3NA9L 1RFDH 3FRPG 3V7AE 2ESVA 2E9WA 4JDTH 2Q76A 2A6DA 3G3LA 2HAZA 3FTYA 3H42H 4HEMA 4FP8H 4NO5A 4B7LA 2PABA 1V3KA 1MRDL 4I2XB 4JPVH 4KMQA 5FK9B 3NVQA 2XPGA 3SODB 2VWEC 4U1NA 4HZAA 3VFWB 2WTRB 3QJVB 1GYWA 4XH2A 3MODH 3IETB 3WTTA 1OP3K 2P46B 4PH8A 3WFBL 1HNFA 1CF1A 1MLBA 5F9DC 3BPNB 1L6PA 5BVPL 3ZL2A 4NWUL 4FFZL 2B4CH 2Z92B 3BH8A 4OQ1A 3NJNA 1VGKA 4FJ6A 2AFNA 4KMTL 3J7HA 1QI5A 4J39A 2V9UA 4EI5B 1T7VA 4RA3A 1L5GA 5I6KA 3EF7A 1VFBB 2G3MA 2AS5M 4NZRH 3SDAB 4U1IB 2D7TL 2EC8A 5IMKA 2ZWKA 4G9DA 2Q76B 3VG0L 3FQYA 3MNMA 3TYFB 2RAMA 5GQBA 3ATFA 1DBKL 2HX8A 3LNHA 5DVLA 1ZD6A 2FL5B 4Z3IA 4QWWC 4MZIA 5EZOH 3P4OB 4LF3B 3UTSD 2XSKA 3SGJC 2NTFB 5FYKD 5GRUL 2M26A 1EZUA 1U3YA 2WWMC 1GY1A 2JKSA 1G9ML 1HEJC 3GSOB 2FT6A 3L3KA 1DJWA 5I8EB 4HJUA 2ETWA 3VXMB 4PCSA 4ACTA 2P52A 4ODTL 2VXTL 5GGQH 4WFGD 3RWDB 5HVHB 3RTQD 2IV9A 4QCIA 4XMKH 1PLCA 2V37A 4PY8I 4B3VA 1XD0A 1T6BX 4UZSA 4F2FA 1E65A 4GP8B 5FM8A 5EZIL 3SDAA 1KLGA 3O8XC 1UB5A 5DZVA 2C3XA 4FG0A 5GS1B 5I73C 1D5RA 3PV6A 5K59F 2EEAA 2HN7B 2Z8RA 3EGDA 4JCLA 7CGTA 4BHUA 1IEHA 3QUYC 3ZUNC 3RDTC 5ADPH 2EUWA 2FECL 4QTHA 3RE0A 3PL6A 5J1SC 1NCCH 5DRXB 4LAJH 3O2DL 5F88A 1W91A 1FZMA 4JDTL 3ZVVA 3NGBC 2HFGH 1QMUA 2VDOB 4YR6B 1OWWA 3GHBL 3QUXA 4L8SB 3T3PF 3DOIA 3IDNB 5D1XD 3UZVB 5EFIB 3V52H 5KVFL 2P8PB 2SEBA 4IU2B 5FYKL 2Z6FA 2KQNA 4M3KB 3WXWL 4GKZA 2V5TA 3ZN6A 3CDYA 1QPPA 2Z91A 3CFJA 4KXDA 4XP1L 3I3EA 3MRGB 3VI3E 3C60C 2X2HA 1ACCA 2GQHA 2XRAL 3D9AL 3DWTA 5DD3H 4I0PB 2COVD 2DH2A 2X2UA 3FCTB 1B4JL 4QOKD 4KKAC 1IBGL 2A83A 2ROXA 3A47A 3PIQA 4Y1AB 3E2HB 5F8QC 1T7YA 3BGFC 2IBBA 5DC9B 5AOJA 3VFGL 4W9KC 2K9FB 5KVGE 2RMNA 4P05A 4BDVB 5CR8A 1I9JL 3O3BA 1BMGA 4MBRA 3NESA 1DTUA 3AQDA 1VERA 1KMGA 3DXAB 4G9FE 3HHSA 4N0YH 4NC1C 1IKNA 2Q87A 3AADB 2F2HA 1O7DE 3H9SD 1ZTXL 4ZYKB 3POCA 4FABL 4RDQG 3U48A 4FTDA 2HT3C 4NXKA 6CGTA 1A8JH 4CNIB 4O5LL 4BK5C 1J5CA 1JGVL 3DUHA 1LP9A 3O9WD 3VSVA 2AJYH 3FUNA 1CG9B 4HJIA 3TEWA 4H1LH 4YHLL 3GMOB 5DYFA 1CU4L 1HILA 3C5ZD 4KPHL 3HZVB 4PJFA 1U8MB 1ZGLA 3VG9B 3U6XS 2O26U 2HRLA 5DVOA 4IKLA 3BN9D 2NY3B 2OJ1A 1SBBA 3PL6D 4R4BA 1TQUA 1I9IH 1JK9B 3VXSA 5T5FA 4WSJA 3PRZA 4BFOA 3VM5A 2BX5A 5E5MB 3RX9A 5ADOH 2R56L 3QXUA 2GSGB 3FB8B 4DKTA 3NIDB 3B9DA 4JZNA 3E2HC 4LCCA 2JKWA 3CVHL 3RB5A 4BKTC 3V6OA 3MV9B 2XZCL 4HD9A 4R6UA 2G5RA 1WA1X 4O4YH 5AKSA 3VRIB 4IBQA 3MV9D 1QWUA 3DOSB 4Q2ZA 4UT9L 2WSPA 3OKNA 3OX8B 2K8QA 5DLMH 5ENWB 5GGUB 1OAZH 3T0EE 1R17A 5IKCB 1XGZA 3I50H 3D50A 5HD8D 2YBRA 1EHAA 4WNQB 1WBZB 4HZLB 4FFYH 4HA1A 2X44D 2HVBA 2NXYC 2IH3B 1FCCA 4OFYA 1XF3B 1ED3B 4N86A 3B1TA 3DROB 3NN8B 5GRYA 4M8QB 1ZY9A 2FO1A 2QGDA 4HSQA 1RHHA 1KENL 3O4LB 3M1BB 2A6KA 1URLA 4XNYH 4ZMLA 7PCYA 1K4DA 1E9PA 4XCEB 3Q6GH 5D1XC 3NTCH 3STBA 3WDJA 1W80A 3UO8B 1FHGA 5LGHL 2EEFA 2CUIA 3UJJH 3FU6A 1H5BB 1OF2B 3ME0A 1N70A 3IFNH 1QI4A 5E8NB 1QEWB 3RIFF 2PPEA 1JF1A 1II4E 2Y6TE 4V1DE 2YAOA 1MFAL 1A1MA 4PJGF 7FABH 4GMTL 4EIGB 1FNAA 3DXAD 4FYRA 1FFRA 3H6AA 4HJGB 3IJEB 1ZPUA 5BQ7B 4Y5XB 3W56A 3LXAA 4E0RB 1ZK5A 3MLRL 3WAJA 5HGAB 4ZOCA 3UADA 4JZJC 1RZ7H 2GI0A 3MRHA 5BS0E 3VI4E 3D0AA 4KV5E 5DA0B 4RBPH 2IC2A 4KQ0A 1SHMA 4F58H 3KPQB 4U6VH 4M02A 2ILLA 2CDFA 5C0CE 4BWTA 3NAAL 4OD1H 5K39B 2W0LA 3FO2B 4NN6B 5HDBE 3OVUB 4O00A 5LCVL 3NT0A 4CGUB 3AXIA 4FZ8L 1JV2B 5GGRY 4L0YA 1L9PA 1NEPA 2FZ3A 4FABH 3RWIA 3NPSC 1NAML 5EO0B 3LRSA 1TUPA 3F12A 3UH8A 1A4KB 5C09B 3MLYH 1HOCB 3A6BL 3T4YB 4YUEL 2O5YH 1EZLA 1UB6B 3MJ6A 3B83A 2NY1D 4GAJH 4X7SL 4B5EA 2IOIA 3ROOB 4OIFA 1D3CA 1MF2H 2C3HA 2R4SH 2VO5A 3GTTA 3LKQB 4IOFD 1G9HA 3J07A 1VFMA 4G11A 4WK2B 1EGJL 2EKJA 2BZDA 2HKHL 3DRQB 4FULA 2IDTA 2ZX5A 1M71A 4U0QB 3II2A 1U8OA 3F7VB 1SMAA 2OTUB 3QZWA 4OZIA 4KU1A 5TE7H 3SIKA 1YJDL 1ZS2A 4JO2H 3K72B 2Y24A 5DWPA 2X12A 2NR6C 4G6FB 3VJ6A 3DI3B 2LAAA 3S88L 4OLZH 4EI6B 3G5ZB 2PO6A 2N59A 1ZSDB 2WB7A 3HC3L 2BP0A 1FRGL 4GG8B 5E8PA 4DGIH 3MNWB 4GIOA 2GTQA 4XTRC 1MCOH 2HKFL 1HYSD 4GB9A 4BUGA 5F0JB 3BAIA 4LLVB 4KJPC 4XP4H 4U6TA 3V4VB 2M1KA 3JV4B 4TULH 3THMH 4AZ8A 3E8UL 3CFKB 3PLYA 4J3TA 1FI8C 1LO5B 3R19A 1OTTD 3P40A 1YMHB 4ERSL 2I9LA 2D7NA 2NW2A 2F7IA 3BPCA 1WEJH 5C0BB 4JY5H 4A7GF 1SDYA 4PJCF 1WWAX 3TCLB 3E80A 3D4GA 3WIHH 4OCWL 1CC3A 1GC1C 4P5KA 1I9EA 4QI3A 4N3TA 2XI9A 3DTDA 3V6FB 2NNAA 1LO3L 3CHPA 1KYOJ 2OMYA 3DGDA 3LKNA 5KUMA 3AY4C 3P2DA 4E5XA 1HI6A 2WKGA 2ICCA 3Q13A 4OTXL 1FL5B 1LP9F 4KTYA 4G7RB 3P11H 1S7VB 4G59C 1WWBX 1JYWA 4MSWA 5JPNC 2HMIC 3WENA 1QACA 2PCPB 2OMBA 2QQLH 3DJSA 2J7LA 4IBSA 3W11D 1WK0A 4JDEA 2YFNA 2IF7A 4M93C 3U0WL 3RAJH 4L2YA 4LP5A 3TN0C 3WJMA 3FF8A 3OB8A 4HUMB 3ABKB 4AI7A 4KK5D 1HXMA 4JJHA 4ODXB 1L9MA 2DDQH 4P2OB 4C83A 5KEZA 2F54A 2NW3B 1MWAB 4I48B 2PYEA 4HX1B 5GRWA 4C4BA 4XNZB 1BIHA 2ITCA 2J8UA 2YD4A 1DJZA 3L48A 2DS4A 1YNTB 2J8UF 4HKZA 1KJ3L 2YOCA 4MWFA 1C7TA 2VLRD 1KPRA 2Z35A 2EICA 1RK1B 1RV6X 2HRPH 3B2MA 1O6TA 1RLWA 4UTBH 2CLZB 2AKRB 1DEEA 1UOKA 1OPOA 1QOKA 3HRZC 3KWTA 2K1MA 1N5YL 3CXDL 4NERA 1GMIA 3D2UA 5AOKA 5KWYC 4KQ3H 4E9YA 4IBVA 5GGSA 4I77H 2WNWA 4HLJA 4AM0Q 3GMRA 3AQZA 3LKSB 1JWSA 5FYLL 4YSUA 1D5XA 4NN5C 3WKML 2ZXDA 4MMZC 2CJSA 2NXZD 3PWJB 4KKCD 5IWLC 3CNKA 1TTGA 4DVRL 1LNUA 1XBRA 3PREA 1ESOA 2NR6A 2X4QA 4OU3A 3X14A 2AJZA 3T3MB 1OARH 4X6FA 1OP3H 3TV3H 4BCZA 1U3NA 1UCTA 1NGWB 2ADFL 3BJ91 4JQIH 1NBZA 2JJTA 4PJ9B 5AKRA 1RK1A 2FBJH 1NINA 2Z34A 3OL2A 2X4SB 3N41F 4Z1PA 4HP5A 2FO8A 4FCHA 3JQOB 4PV9B 4PJHA 5GHWL 3DBXB 4G8FB 1JNNL 4ZZKA 2K3HA 3MACL 2YAEA 1MUJA 2V33A 4YHPA 2PYFB 2OJEB 2ZUWA 4ZW7A 4FTVA 4JN2B 1QI3A 3QQ4A 4PJ8D 3SD5A 5F6HJ 1SXNA 2L4OA 5HHMD 3BP7B 4EOWL 4J3UA 1CLOH 1RZ8A 1BD2B 4HJ0D 5D9SA 5KSUB 1Z9MA 3S37L 2Y2YA 4GXFA 1G1OA 3AROA 4TL5A 3WGVB 2I85A 1THAA 4NUGL 3QDJD 5JHLH 5IFAH 3N06B 1CIDA 4PBWD 4XN9A 3QEHB 2E86A 2HG5A 2PYED 4N6RA 3PGDA 1IUZA 5JZ7D 4BFGA 5EZJB 1LE5B 1F58L 3QRBA 2ZONA 5I6OA 5T3ZH 1KEMH 3FH7A 3LMJL 4KGJA 4L3AA 4LL9A 3JWOL 4NKIH 4U4BA 4UB0L 1TYEB 2VR9A 3MGOB 3PGFH 4OSUL 4NP4L 2J2ZA 4R0LB 4HUKB 4M62L 4JJ5A 2B20A 1CL7H 1NIEA 2FX8L 5JHDD 2ICEA 4ZNEE 2G3XA 4PV8A 1DVFD 2G2RB 4HV8A 3KXFE 5T1KD 3VUAA 1MAKA 1AO7B 2ZNWA 1ZHKB 3BXNA 3LRKA 3VRLF 3HFML 3O9WB 4PRAA 1BVLB 1CICA 2ESVE 4Q9RL 4J8RA 5IBUB 5MENB 2CMRH 3ELQA 1TTUA 1IL1B 4OFDA 4UM9D 2MQ0A 2BIOA 1S9YA 3L4CA 2VDML 4ZTEA 2P28B 2MCMA 4WTXA 1AGEA 2VW7A 4TNWK 4F8LA 1CDJA 1X7TA 2ZOTA 4MA8L 3MUHL 1OSPH 4WWKD 1FSKC 3T9WA 2V3FA 5EO0A 2DIBA 2P43B 1KELL 4GO6B 5DZ9A 1QKZH 2OL3H 3X12B 2C3GA 3HS0A 5FO8B 4ZMNA 1EFXB 1AQDA 1QABA 4KI5E 1UCBL 1L9OA 3O0RL 2LU5A 2RGSA 3CFDA 3CH1B 3NCEB 3ZHLA 1KIPA 5IF0A 1SPDA 4X98B 4P2RD 1FL3B 4N2BA 3P0YH 1JD7A 1NJ9A 5AAWA 3P9MB 5BW7C 1LO3H 4APQD 3LZNA 4ZSOA 5AUMA 3B7YA 2Y7OA 1RU9H 5DI8B 2OA9A 4AQEB 2N0KA 2ZCLL 3GRWH 1IEBB 4AKOA 4YH6A 3MV9A 2ALAA 3HC4L 4FFZH 4DTGL 5ICYB 4KZDH 2ENJA 3EBIA 3MRGA 2ADJB 3C08H 2CO6A 1GZQB 3CXDH 4YHKL 1GIGH 3W9EA 3D08A 1C12A 1A14H 4OZGE 5AEAA 4ZX5A 3OQ3B 3IMRA 5D7KE 1YYLH 2AI0L 4HKJB 3K2UL 4PJ7F 2Y06L 5CKGA 3N43F 3SHSA 4GBXB 4L0PB 4O2FB 4TSBL 4DP6X 2OSYA 1FNSL 2DIJA 1MPAH 4WU7B 5GS1C 5I73B 3D7PA 4MA1B 1IQWL 2RBLA 4JRXA 4P9HL 4QIRA 4OH2A 2HT3D 2Z91B 4MA3A 1BJMA 1JCKA 2A6KB 4Q8BA 3IDXL 2XY2A 1IFHL 2RCSH 1KOAA 2NX5A 5B22A 1DQDH 1J9SA 5GZNC 1QA9B 3CVIH 4NBYB 3UYRH 3QPXL 4XP5L 4FQXC 2IIJA 1MCNA 2BSBA 2ZYSA 3QH3A 5T5FL 2Y07L 3FQXA 4RFNB 3DXAA 4W4OC 2PW2A 5D1QC 3VA6A 1YMMB 2KQMA 4YXLL 1R47A 4I8DA 5KANI 2WZPD 1BXUA 1X9QA 4KVCL 5F7WC 1IAII 1CE6B 4G5AA 5T3ZD 4MXVF 3RL2B 2NT1A 5KVMC 2AXFB 1KSRA 1T1WB 4ZAKB 2F8IA 2FEDC 4TQHA 4L4JA 4V2CB 1G4RA 3CFCL 3IGAA 4GOSA 1R3IH 1SVZA 3Q8CA 4N24A 1T1YA 1TTCA 1CG9A 1W9XA 1EVTC 1WF5A 4K8RC 4U1HB 1UGKA 4LCCB 3T4AC 3QAZC 5MERB 1PX3A 5DRWA 3IXTA 4KDTA 3RPIA 3JTSA 3ZKMD 3WIHA 3FJTA 1T5KA 4PS4H 1EDQA 1JNHB 1OY3B 2ARJB 3SE3C 1S7TA 3BPNC 4F7MA 3V4LA 2GPZA 3QAZB 4KRLB 1NUGA 2YQGA 3B6SA 1AFVL 3AAZA 1JK9A 3FK3A 2F8OA 1ED3A 4X9FA 8PAZA 1K5WA 2VITA 3JYCA 3UABA 4A37A 1QTYT 1A7NL 3DX7B 5K33A 5IMLB 3MTXA 5A2IH 1CFVH 2ZIDA 3CU1A 3P3RA 3LEYH 2BSCA 1MQKH 2VMFA 1UA6H 2R9HC 4RFNC 3C12A 4M3HA 1GKOA 4FJYA 1KCBA 2D4DA 5MERA 2IWKA 3B3IB 1O9WA 2EE3A 4FQXB 2JKIS 2GHWB 1ZA6A 3V9CA 3T0VA 5I1DB 3OMNB 3OMZA 4FQCH 1MIML 4KMLB 4L3CA 4NKDB 1UUSA 1HCFX 4UM8B 2IO5A 2VISA 2EE0A 3AAZB 2UZXB 2Q20A 4HISA 1D7BA 1FIGL 4ISVA 4LNRA 5DK0B 1JL8A 3BESR 3APFA 4QRUB 3QXVA 3SYCA 5FK9A 3P0VL 4N25A 3Q5OA 1GRWA 3LKPB 2YZ1A 5EO1B 4F8OA 3RFZA 1L4IA 5H35B 5D8JL 1JE6A 3C2AL 4QHLB 4K0OA 2HXAA 1G9NH 2V3EA 5DK2B 5B1JA 5HI4C 4KI1A 1N10A 1G7QB 1OD9A 3F64A 4JHAL 2R23B 1BZ9B 4HF5L 1SLWA 4B41A 1JPTH 4PTTB 1KCRH 1IT9H 3U0TB 5K9OB 3NEEA 5ESAA 3LKOB 1UEMA 4PV1C 4KQ3L 5IEHA 5IMMB 2LU4A 4HPOH 4X4ZA 3HBGA 2YGNA 3HE6D 2ZWNA 3EGXB 1XCTA 3BW9A 1Y1DA 5CR1A 4UM8A 1E5UI 1N8OE 3ARED 3LS4H 1HWWA 4BZ1A 2OCJA 4WW2B 2YGVA 3L7EA 3MRFB 1MHEA 2AK1H 1QSVA 4GRMB 5MP6L 1EJFA 5DUMH 1BGXH 2ZJSH 4IK6A 3P4OA 4QLRA 5DMKA 2HA1A 3QRFM 4WCYH 2AK1L 3PPEA 4FFWD 3FONA 15C8H 2GJ6B 1GGCL 2DKMA 1JWMA 2EDEA 3B2VL 1LQSR 3WLWD 1MJ8L 4X99B 4ZOBA 2VAJA 2UUDK 5AYQA 5L4MA 5CEYB 2I07A 5CD5D 3QJOA 1W6WA 5I16B 4NQXA 3MACH 2R0ZH 1UFUA 5EU5A 1TIUA 3TH3T 5LQBL 3RWJB 1M2OA 4IDLA 5DMJB 1CGUA 2X4PA 2VR7A 5C8JB 4G1MA 1KB9K 4DT2A 1ZXQA 4NKMA 2HKAA 4IMLA 5I9QB 3AGWA 1U42A 5GS1A 4NSKA 2WYTA 1JRHI 6PAZA 4FNTA 1EZVY 2DLIA 3ARQA 3GZOA 1A6UL 5CZXD 1HK6A 12E8L 5DUPL 1WFMA 1F4XH 2H9GA 3EHBC 1Q4NX 5FA3A 1BEYH 2Z35B 4XT1C 5F1IB 5C0IA 5I1HL 3QYCA 1DQVA 1SVBA 4P07A 2R39A 1XGQB 3S5LA 3TIDB 4AEHL 4RGOL 3QGVA 4ZDHA 3KVDD 4Y2DD 4PLJD 2CCLA 2Z7UA 3D9AH 3QJZA 4ZXBC 2Q8BH 5F9WC 5F3BB 3RUGF 3EDEA 5CBAB 1LDPL 2ZG2A 3OTTA 4TVPH 4AJ0A 3EDKA 4Z7UA 2ZXEB 1D5MB 4OCSL 2BVPA 4LK4A 3ARGB 2HKFH 3ARTA 4RAVB 3I3DA 4YSEA 1GZQA 1IC1A 3NZUA 4LF3A 4U31A 1GAFH 5E2VH 2BS8A 5DR5H 1HXYB 3O0LA 4I87A 2F7PA 4M1DL 1V3JA 2GIXA 3BKML 1MCBA 4KKQA 2BSDA 4QRPD 4M6OL 3X3FL 1CXLA 2OR9H 5K5YA 2BCKB 5HP5A 3C6EA 2E7DA 4WJKB 2VMEA 5HI5C 3GBEA 1H0DB 5CLYA 2Z7YA 5I18L 5B4MC 2Q8BL 2X4UA 3OB0K 2XV3A 3CK0L 3II3A 3VXUE 2XTSA 4ABVA 3Q1SL 4JM4H 1WP6A 4KK5C 2OYLA 5HYJB 2DW5A 3R4RA 3B4NA 1JGIA 1NDMB 5D7EA 1EDYA 3MN8A 1FFPA 1T5WB 2AV7B 4Y9GA 3O11A 1ZA3A 4HXBH 1S4IA 1CGSH 2JXMA 5J6SA 4IOFC 2Z1KA 2TRYA 3L2NA 3CPLB 4K5PA 3AC0A 5LBSH 2C3VA 4HXBL 2UWEE 1IGCL 3RNKB 3RWEA 3X13B 4JKLA 3QCTL 1PF3A 1KIRB 2VDMB 1TTFA 4JKMA 1HL5A 3RIAK 4MQ7B 4V2BA 5LCVH 4BZ2H 4N2DA 3KNBA 4QHMA 1I7UA 3HFFA 4ADIA 5D6CA 3QZLA 3KJ4B 4AIXA 1FAIH 3ZHFA 1BD2E 2YXMA 1RLBA 1UA6L 3R8BB 2G2RA 4NWTH 4QT5A 1P6AB 2OBGA 3H7LA 2IEPA 1AO7A 3FN9A 5FF6B 2UY6A 3OGCB 1D9KC 5JDSA 1XH1A 1KJ2A 3EYFB 1PZ3A 4HUWB 2WBWB 4PGJA 4CBZA 5F1KC 3U9WA 4NC2B 2ZOKA 5TPWH 3BDYL 4Y16B 5AW9B 1Q1PA 3RZCC 2N7AA 2J4WH 1GGYA 4FI6A 3QBTB 4LIQE 3OKKA 3OHMB 2TAAA 2QL1A 3NZ8A 1SOSA 3M45A 4B9KC 3EG9A 4DQAA 1PDKA 3QNYB 3ULUD 1R75A 3V9EA 1E2VA 3BUDA 5JR1H 5EF2A 4XBPA 3EHBD 4GQPH 4WI3A 2YMXL 3HI1B 4JZOA 1CO1A 2A2QT 1NPUA 4CDGC 4HPOL 3WMSA 1XF5B 3VE0A 2QDWA 3DX6A 3BUQA 2RR3A 5GGRB 5KSUA 3S35X 4DESA 4PLJC 4N0RA 4NQEE 1CFNA 1TQTA 5LUMA 3Q2WA 4Y9EA 1B2YA 2R1YA 5JMRA 4Y5YB 4YBHA 4E9RA 4MD0A 5DUPH 4G43B 2OSLA 1NFKA 4A2DA 4ACPA 1HHGB 3V7AG 2P47B 4G6AC 4X2UA 4FL4B 4E42B 3IMBA 1VPOL 5GS2D 3SDDD 3I6KA 2F1EA 3ILEA 5DF0A 5IMOB 3ARFC 1P2CB 4LLMA 4F9LC 2JKJA 3ENEA 1IBDA 1VLXA 5SWSD 2HJLA 4N4YB 3BP7A 1JHTA 1QRNA 5HHOE 5G5DB 2V8MA 4WI0B 1T4KA 3PHSA 4X80H 5B1BB 5EZLA 4Y88A 2DWEB 3ZKND 4O2FA 4LRIA 3B7RL 3DX6B 1PLGL 5AB2A 5F9AC 3MGTB 1YNLH 3CAFA 1WAAE 2E46A 5CWSA 4JFHD 1FFOB 2IAMD 3U79A 1L7TH 1GAFL 4UNTA 2X0UA 4RNRB 4U6HA 2CDFB 3MBXL 4XWGL 4IRSA 3VFRB 1ZVSB 4M5YH 3MJ9A 1HKLH 2IVFC 1T5XA 4TTGA 4Y7MA 5I8OL 4KY1H 3EJTA 3CUPB 3VQLA 5AB1A 5F6HI 2VL5A 3B3BA 3FT3A 4LFHG 5A7BA 1Q94A 3TJPA 2BRRH 5FO9A 4BK4A 5I5RA 4OB5H 4HT1H 2CGYA 4DZBA 5D72H 5PAZA 1IKNC 2DWEA 3HG5A 1VA9A 4OT1H 1BX2B 2X3AA 4HIIA 3UCQA 4Q9QH 2B15A 5HHMB 4GW5B 2D4FA 5IVXB 5EO9A 4AC2A 3T2LA 3T2NH 1C9SA 3VXTA 4JPWH 5E0FA 5A3IC 2K6ZA 3ARDB 2EILB 1MCDA 3DSFL 3BD5A 1TJIL 3FT9A 4N0YL 1CFQA 1OSPL 5F7MC 1NLBH 1BAWA 1RIHH 1ZSDA 3CDFA 4AE1A 1ITBB 2GJZB 4LIQH 3MA7A 2Z8SA 4JFDD 4AKQA 4D8PB 4HH9A 5HYQB 3EBGA 1AI1L 3P77B 1QRND 1F3DH 1W0WB 1X5KA 3I6GB 3SCMB 3B2VH 1PIGA 5ID0B 5L4JA 3LN5B 5EU6B 3SCMD 4DF9A 1TYRA 5HGHA 4YHOL 1JN6B 2B1AL 2DI7A 1AOZA 3ULUH 1KGCD 4M7LL 3QUYA 5FHBH 3KPQA 1JPGB 5FYKH 2NY2B 3ESUF 1WICA 2AQSA 4Z7WE 4ZDHB 4TSAL 3U82B 2E7LC 3FT4B 3WLBB 4NKOA 1IMHC 4IRZA 4BQCA 3KGTA 2PCYA 3ZE0F 4MMZB 3JT0A 3L6FA 3G5XB 4TQ8A 4N3UA 2RQEA 2X1XR 1KEGL 3ULVF 5HDOA 5C09A 2CA4A 4RZCB 4G6AD 2YAPA 3WTVA 4PJ8B 3GMMB 3FW6A 3LEXA 4LHJB 4ENED 5FO7B 4G5ZH 4QRQA 1UOVA 1D5BA 1VFUA 4ODWA 4MAZA 2NR6D 4O58L 3ML8A 5CHNB 4LOUC 3E7JA 2B1AH 1Q72L 3GQFA 5GSVB 3CZJA 1UM6H 3F6LA 2CWRA 4YDZA 1M9WA 3PWVA 1FPTL 2R0WL 3ZKNC 2EECA 1U8OB 2OP4L 4WO4B 4NQQA 1JF6A 2PXYB 4AJVA 4BSWA 1UWGH 5J6HA 1DJSA 4QTIH 1R3HA 2DM4A 1MNUH 4H0IA 4M5ZH 4ODTH 1QVOB 1P1ZB 1PAMA 1BZ9A 1RZJC 2ZNXA 3QJFB 4FA7B 2J73A 4E9QA 4YJZL 1FLTX 1RZJL 4XPTL 1H8NA 3KPRE 1ADQH 2XN1A 1A3LH 4POYA 1MCWM 1GXEA 2XRAH 3D12B 4IIQC 1TVBB 1M4KA 3DUSB 1WWCA 2Q3XA 2XHNA 4RAUB 4NM4L 1U8PB 4AYDC 1NIDA 1FG2B 1KB5A 2VDKH 2CUHA 1G5AA 4NHUA 5IG7B 4YSAA 4LLWA 1CD8A 4ZTOH 4IBWA 4D0CB 1OIOA 2BC4A 4MBOA 2R2BA 4MJHA 3RPIB 2KLTA 2Y7QB 3KNBB 4QHMB 4KO7A 4PJ6A 4W4OA 3Q2LA 1ILUA 4G7SB 3WIHL 4CBPA 4X99A 1NSNH 2ZCZA 3NCXA 1QFHA 5DC4B 4FQXA 5FM5M 1IRAY 3SDAD 4OLUH 3ZO0A 3CZNA 4PRID 4ERSH 4YFDB 1I8MB 1FZOB 1DQLH 1GSMA 4KXCA 1EIBA 1YJDC 4XO5A 3NPZB 5JHDA 4PJCA 2IDUA 1I9RH 1QWHA 4V1DA 1WO2A 4WO4D 5AOMA 3AJ7A 1MCEA 1P5VB 1PLAA 2ZUSA 4GXUM 2PYEE 1B9ZA 1BQHA 3BP6B 3BDYH 4YDIL 4Y4KC 2CJUH 1G7IA 5CU5A 2VXSL 3FSAA 1KXTA 3S88H 2BNQA 4KFZC 2CNYA 4KO5A 3VD1A 5D2LE 2N01B 3BN3B 2ZX9A 4M8VA 4PRNA 4IIQB 5KVFE 5C0IB 1LK3L 2O93L 1ZMYA 2ZXCA 2DICA 3LB6C 5SX5K 3TBWB 1N0XH 4UQBA 5HYSB 1JZDC 4OGYH 3VI3F 5DJYB 4DQOL 3U9UB 4KJQD 3VYPA 2MOGA 4ZW3A 4OJAA 1QFOA 1X9UA 2OL3L 5HHOD 1INQA 4U49A 4YBQC 4NRYB 5KBMA 3RY6C 1FGNL 1QD0A 2X4TA 3A6CH 4XN8A 5DD6A 3WEXA 2V4LA 2PPFA 1PQZA 5J5EA 3QFJE 5EBWA 3V0AC 5JORB 2P24A 2P7TA 3BVDB 3TNMA 3MMEB 2WW8A 3VD4A 1E28B 3TEXA 2EDRA 5E0QA 3MR9B 4TLKA 2VLJB 3NIFF 4M48L 5CXPA 5FDYA 3GNML 4PRNB 3NAAH 4OD1L 3RDTB 1F3JB 3D52A 5D7LA 2VDQL 1K9TA 4OGZA 4U3CA 3TZVB 5EU4B 2GCYB 5F21B 3FQ4A 5IHBA 1KTRL 1NUDA 5KOVC 2P8PA 2G3ZA 2KMWA 1FH5H 3LX9A 4B6ZA 1TNNA 4RAHA 1NC4B 4UTCA 1A5FL 2CE6A 2R69H 4H44C 5T5NF 3OPZL 4YC2C 4LASH 1S7QB 4NKIL 1NMAL 2LT9A 4N1CA 2RQ8A 1DUYB 1RFDL 4I9XA 1YN7B 3P3YA 4P3CL 3QFJD 4DKDC 1KCWA 4X6DE 4TS6A 1BXAA 3MZTA 2DEXX 2A9NH 4XVUC 3FMGL 1A4JB 2JJUA 5CEYA 2QHRH 2P5EB 1A6TA 1EUTA 3NEXA 1CLOL 2EYSB 3DPBB 2KS0A 3Q43A 3D39E 3PWPB 5LGHH 3SJVE 2H2SC 4I1RA 1N9PA 5CZRA 5DI8A 5TH2B 2AZAA 3QCTH 4P23A 5I5JA 3B2XA 2C4FU 1W16A 4GKSB 4K3EL 1RIHL 2YKLH 2VZSA 4LDCA 5I71B 3UYPB 4X6EB 2EXYD 3A6BH 3GXTA 5GGSY 1X5AA 3ZKSD 1A6UH 1KIQA 2VE6B 4LLDB 1NCNA 3UTTD 4CRPA 5E2TL 1BECA 3QDGB 4JFZH 5EBLB 5IBTL 3V0WL 3MGOA 3FO9B 4QHKJ 3ZDYE 4HKJA 2VLRE 5FCUL 5LJYH 5LAPA 5DJ0B 2DLGA 1A3ZA 1OT2A 2Y3NA 4GI8A 3QPQC 5DJCA 1HT6A 4CGTA 1ZGLP 3P30H 5EEZA 1RUQL 2ZT9C 3ML9A 4M00A 5DD0L 5EFIA 3K4AA 4BK8A 4AYBA 3UACA 5TF1H 3DKHA 4J8RB 5DVKA 1SFHA 1TSHA 1UWXH 4RFOL 1ZLSL 4JE4B 2A74B 4X5WB 3SJVD 5JQIB 2VUKA 4NOFA 5H37A 1J18A 1GKEA 4UTBL 4QAWA 3VD5A 3WFHA 5E95B 4P5RA 5BUAA 2HN7A 5D55A 1R0AL 2NY3D 4WWKB 4OV5B 1GJIA 2NY6B 4OF8A 1WFIA 3FHAA 1U3ZA 4RGMC 5I76A 3B7TA 4YHZH 4FOMA 2AC0A 1A3RH 1MDTA 2YPVH 3KDMB 4MMZA 1W8OA 3RFZC 2W81C 4WEBH 3U7YH 1MFMA 4RX4A 3GTVA 1IO4C 3KWVA 1C5DA 4TXVB 1EBPA 4LU5H 4MNQA 1A1OB 5CCHE 4Z5RA 5I8CB 1SMOA 2K7QA 4P57A 4KHTH 2M2DA 3P9MA 1NAMA 3BLKA 3QARA 1A7OH 2R0LH 3AG3B 3Q8BA 1VDGA 4ZI8A 1BEYL 3LQZB 4TRPH 3ROLB 2L0DA 4KZ0A 4R4NC 1HINH 2IDQA 2VABB 2CBQA 2VZUA 1RUKL 3H8NA 4G9FA 3KW8A 2C5DC 4HJ1A 2H32H 2X42A 5E5UB 4UOJA 1MHPH 1KN4H 1N6VA 1NFDA 4MS6A 1U6AH 4ZD3H 3BP5B 3WXVH 1S7TB 1U8LA 4F7MB 1A6VL 1I9JH 5I1EL 4QHNA 3VAEA 4PJHB 1JTTA 2WBKA 4J3BA 5LQBH 1G7LA 2ODIA 4EF3A 4EZLA 1IBGH 3IDMA 3WMPA 3D5OF 5D2NA 1W8EA 3S3CB 4IOSA 4JW3A 4YHMH 1NICA 1ZLVK 4GJTB 1EJOH 3EO9H 4YSPA 1A4CA 4AUUA 2OX5A 4E5XG 2ENSA 4MX7B 1TVHB 4Q14A 4F33B 4TULL 3THML 4OKVB 5I1LB 1BGXL 2ZJSL 3OPUA 4J6RL 2X5PA 5CJQL 1U8IB 5H2BA 5C3TA 4BQ8A 4TUOB 1OCRB 2DWTA 2GVYA 4LP4A 3K80A 4ZO7A 1W72L 2YEVB 2AV1B 3KLAA 4ES9A 3QDJE 3EG9B 3QW9A 4RMUA 4AK2A 4E42A 3GLZA 3HN5A 5ICXA 3VFOB 3IK2A 1TO5A 2ICWA 4BXVA 2XYBA 3D18A 3ZKMC 3L5XH 2VXUH 4MNQD 2WQ8A 4WVRA 2Y5EA 4I9WE 3U4BH 3TONA 4J3OH 1VZIA 1R9FA 1NBCA 3SE9L 5EOTA 2DKSA 2NCEA 1ZHKA 3IFNL 1J05A 1FG9C 1N0LB 1ET5A 1RUAH 4GUPB 3EOAA 5GZNA 4K23L 4JFWA 2WWNA 3O6FD 1O7SA 1AE6H 2Y36H 4NAJA 1B6DA 1QW9A 1M71B 2Y2WA 4MRCA 2WCPA 3E1F1 4JFEB 2FLMA 5FV2A 4X4YB 3CMGA 2QBWA 2BIQA 3HZ3A 3L3OC 2WLHA 4V33A 1E6OH 1BCIA 4UUJA 5D7IB 3BWUC 3GLDA 3RBGA 4Z0XA 4BD4A 2WVVB 2VDRL 2NYZA 4UYPA 3ARGD 5DZPA 4IJ3B 2X0WA 2ZYHA 1DVTA 2IAND 2IADB 3HNVL 4HS8H 4I0KA 2IANB 4GUPA 5DO2C 2WC7A 1FVDB 4DAGH 2MKWA 2FYYA 4KX8A 5BUPA 3IU3B 4O4YL 3HN3A 3JV5A 3FFCA 5AW2B 1BOGB 3CDZB 1SJEB 4L1SA 4WJG3 2R56H 3VXPB 2LR4A 3DTXB 2PN5A 3DX9A 2G5UA 2AEQL 4L8BB 3VFUB 1EERB 3Q05A 3L9RA 5DUML 3VXSE 3Q2VA 4A7UA 4V11A 4NUPA 3KLSA 5ITFB 4IOIA 2NUTA 1SJVA 1MFAH 3MA9L 1OP5H 5CLTA 3MJ8B 1F97A 3MCLL 4Z7UE 1UHVA 1XWVA 1ZLDA 3OKEA 3ULVH 2Q7YB 1BQRA 3L1EA 3IPFA 2XKUA 5FUZL 1QQDB 5EF1A 1M1SA 2ZCLH 2VXQH 3T0ED 3VGAB 4PREB 5ID0A 3EZJB 1ODAA 2FYYB 1RUQH 2XN9E 3FH8A 2Y23A 3F65A 2EDFA 1GVIA 4OZHA 3TYGL 3WKPA 2NXYD 3EFDL 4KTDH 4PWGA 4WWPA 3F7VA 3HPLA 4TYUA 3TVMB 1UZGA 1XBDA 2R15A 4MCYA 4XTRD 1MDAA 1FLRL 2IALA 3O4OB 4HAKA 4M3JA 3VFUA 1DJHA 4HALA 3SDCC 1OGTB 4IKIA 3L9RB 3VW3L 4PMFA 1LO0L 1RUAL 1ZLWH 1O6SA 3GXMA 3MRKB 3QEQB 4XMLL 4EMZA 5DQDL 2F54B 2NW3A 4BRVA 4I3RL 4OGYL 3NIDE 1J11A 4H2CA 1UJ3B 4LSPH 2VZ3A 5CJOH 3VFTA 1YEDB 2BRQA 2BNQE 3FFCD 3S34L 1JUFA 3EDDA 3O6FB 4JFUA 2AK4D 1NCWH 4XNXL 4Y5XC 1IQWH 4P9HH 4OZIB 4ELDA 3L3GB 2GAZB 1M6OB 1AXSB 3CVBA 5IHUL 3BVTA 3MV7E 3WEAA 1XB6A 1N6UA 2DLFL 3CSPA 3HG1B 2A9AA 1QFPA 1OGTA 1S9WA 1H3GA 2WY3B 1BLNB 3ZE0E 1NC2B 1AZNA 2AJSH 4NN5B 3T1WA 3OF6A 4H0LC 1UZ6E 3B1UA 3CSYB 2WCSA 2EVFA 4YHKH 2N1KA 4P46D 3IYLW 4A7GA 1GTNA 1WHOA 5GJTL 4Y2OB 3M07A 5AVZB 5T3ZE 1H15A 1SEQL 3FQTB 3QWOB 4LBAA 4KNUA 3DYMA 3Q01A 3DX2A 5FGCB 4ZFOL 2YUVA 4WKZA 3AW5A 3DPDA 3K4DA 3WELA 5C0EB 3P0YL 2E7LA 1JHLL 5GGTL 4G80A 5D2LF 2EVGA 5SV4A 5HJDA 3RLSA 1B0WA 1EJ8A 3H3PL 1ADQL 3MBWB 2JCCF 2D31A 2BY0A 3GB7B 3LZLA 5CD3A 1OAQH 1HI6B 4PJGE 3V8CA 5CN1A 1DQQA 3N1FC 1C08A 3MNVA 1NFDB 1AD0A 1IGYA 3PY9A 5DHDA 3QFDB 4XVOA 3VNZA 2MH4A 3FCBA 1BA9A 2ICEC 1ASOA 1P7HL 1OP9A 4RFEA 1MFCL 1XR8B 2QQNH 3IDMB 1R3JA 3W11C 2F53B 2O30A 5FYJU 3PP4L 2R23A 2ZOUA 1J1OH 4KWUA 2OLDA 2DI8A 5KSVB 1AR1B 1G6RH 1CLCA 4JHVA 3FCGA 4B3EA 5A3ID 1Z32X 4WW1A 3ZZ1A 1WPCA 1FYHB 1HHJA 1SYSA 2MNWA 3ESVF 1B0GA 2CXKA 4HCIA 5C0JA 4OB5L 3SBWC 1BZQK 4RETB 2YK1H 4I3GA 3BSGA 2QSCL 3MAWA 4QXGH 1S3RA 2ENQA 2FJFB 4G6FD 2WTPA 4FQPA 2QADC 3C60A 5CEZD 1AO7E 3QI9D 3SDCD 1ASPA 2BNUB 3L7EB 1U8IA 4HULB 2HRPL 3TJEL 3ZKXC 1G7HA 1DQJA 2P5PA 4HBQA 2ERJB 2F7OA 1XZ0A 4FL4C 5DWUH 1NWPA 1WUZA 1B90A 1MCLA 2H2PC 4DW2L 1S2EA 3CFCH 4L5FE 1JV5A 4NHCH 3EAKA 2HSIA 4XCCH 5DJYA 3ZYOA 3F7PC 4W9IC 4UYQA 3RDTA 3CZEA 3MKGA 3WIIL 3ARXA 4TSCH 4NCDA 3HB3D 8CGTA 3UBXB 3L9EA 3V8OA 2IQAA 3PAVA 2FWOB 2ZOKB 3IJYB 3GSVB 3ULUF 3NFSL 2AJ3B 1A64A 4ZQKA 4NKMB 5JORA 3ABMB 1QLRA 2FLRT 5AYUL 2ENPA 3G5YA 5IT2H 2FGWH 4XR8C 1NBQA 3OC5A 3L3IA 4IM8A 2FJHB 2UZYB 4YN3A 3ZQ9A 4YZWA 1PZBA 2TSAA 3HEIB 1F4YL 1AKJD 1HS6A 1A21A 3AU0A 1Q0XL 5D5MB 2WIIA 2EDNA 1QBML 5KYNA 1BFVH 1M3IA 3ETSA 1BAFL 1MVYA 4GPVA 1C5CH 5GRJL 3CSBA 3HRZA 4A68A 2VGLM 4NENA 5CMAA 3N04A 3LQMA 5BVPH 2XKNA 3VNYA 3FO0L 3MREB 3SKNA 5I1KL 5I24A 1RQ5A 5JR1L 3U9PH 3BPOB 4ZBJA 1NL0L 3QE5A 5IB5A 4GS7C 5K9QG 5L2JA 1D5ZA 2P42B 2DL9A 2DJ4A 2F1BA 5MEND 3VGDA 4ODVH 1D5MA 2FIRT 2Q86A 2VABA 4CAGA 2BP8A 2J88H 4UB0H 1OGAA 5DURB 3N9GH 5CCKH 3EGDB 3GMQB 4PGZA 5DURD 4XNXH 3MLVL 3FQUA 4XBGA 3VI3B 4PWEA 2YGPA 5AB0A 2W94A 4CC1A 4M61B 2NOYA 5E6ID 1P5UA 3DVFA 5JXEA 2WLNA 1MFVA 2BHUA 5D2NB 1U3HD 1YNKL 1E9PB 4KBPA 5BO0D 3LXBA 1EMTH 2CKBA 2W59A 5ISZA 3SY0A 3QYMA 1L0PA 1C16B 3OSVA 4GMSL 5T1LD 4YXKL 2X1WL 2W91A 3F7YB 3OF6D 4AQZA 1GZPA 2EIZA 2WHVA 3DMMB 5IVOA 2OX5B 1DBKH 1KIQB 5LNEA 2E76C 4WSKA 4P2RA 5DJ6A 2Q86B 3SQBA 5KBKA 1FC1A 4OKVA 3S2CA 5J7CC 2EXWD 4KFMA 1BIIA 3OLEA 3OWRA 5JDJA 4XVJH 4QXWA 1JNHA 3W0WE 1SBSL 1NANI 5CUSH 1U8KB 3NJFA 5IB1B 5JIPA 4TNWF 3HI6L 3L5IA 4NZUH 3D85B 4UDTB 4MQ7A 3VWKD 3MLTB 2C9QA 2ZKHH 3CK0H 5D1ZD 1BXVA 1JOIA 3OAUH 3MRHB 5IV2A 5EA0H 3HB3B 3I02A 2XQYG 1KCVL 4DN3H 2P5ED 4XWOC 43CAA 4Y5VC 1M05A 2WBJD 1YEWA 3N0AA 5JLZB 3GEWB 4YFLI 1JI1A 5CGYC 5D72L 4XCNA 5SX4I 1KB5H 2OCCB 3QR2A 4LO9A 1RZ7L 4DWHA 4NZDA 1PKQB 3BGMB 2FT8A 2X3CA 3MYZA 3QIBB 5GRZA 3HMWH 1U2CA 2VLMD 4JRXE 1N5YH 1FRGH 3EH4B 3SCMC 5BVJB 2CUAA 1NLDL 3SE8L 4GG6F 1VESA 4ICWA 4Z9KB 3V5KA 2NDFA 3L3JA 5E6YA 3K6DA 4UT9A 2ED7A 2WYHA 3BDBA 5F1OB 1VEOA 3QI9B 2YARA 4PJDA 3DO7B 5I8CA 3W1ZA 4Z7WA 4YLBA 1UCBH 3O0RH 4EPSA 4WJ5A 5HY9A 3WTXA 1R5VB 3GM8A 3TBBA 1N3NA 4D0BB 4CL7A 2GSGA 3FB8A 1LMIA 5ACZA 4I88A 4ZAKA 4L4VE 5DZJA 1ICTA 1WC7B 2VUOA 3TJHD 1AP2B 1D2OA 1B2WL 3RWCA 4MQTB 4AIOA 3C5ZA 2CH8A 3BGMA 1TVHA 4LLAA 4F33A 3G04B 1FJ1B 2WXLA 4A7SA 1L3NA 5KG9B 1O0VA 2PPDA 5K9OA 4TN9A 4Y5VB 2D3NA 4NO3B 1AMXA 3LHPH 5JHDB 3WS6C 1BQLL 4XO4A 4B0MB 2BH0A 4OLXH 2J12B 3HS9A 3L95A 4XN2A 1K72A 4E9XA 4ONGL 4L4VD 1RP9A 5KANG 3BUYA 3EH5B 4FLOA 1RSYA 2HUHA 3DHUA 4POZD 4XI5D 2CO1A 3RU8L 4OI8A 1XT5A 4MJJA 3TGXA 4AV4A 4ANXA 2A3TA 4KHTL 1SOKA 3GJFK 3MQIA 5F44A 3O45B 2PXYD 4NAMA 2EXYC 2EDTA 2VMJA 4FI8A 4L4TD 1NKRA 4CC0A 1P7QD 4JY5L 4APQB 1FC2D 3L5WB 4F8QA 3KPPA 4H8WC 2OSWA 1QUPA 3LPGA 4AJWA 3A22A 3RVWC 3B2PA 1OTSC 1ID5I 1T21B 2B0SL 3C2SA 3DHPA 3EYSL 4OM1H 4XB3A 5I82A 3VRJB 1OE3A 5I1DA 1U8MA 3EO0B 3FTGA 4G6KH 4PJIF 4YVNA 2GC4C 5HXMA 1AANA 1QFWM 5LHDA 4N5EC 3FTSA 1JTPA 1ZE3H 3L4UA 2E6QA 4L37A 3EOTL 5HYFA 3WYRA 5D1ZI 3BUYB 1OE2A 4JRWA 3KE0A 5E6UB 3JVGC 5E5RB 5GISL 3UERA 1ZT1B 1B4LA 5E70A 1IT9L 1JNNH 5EO1A 3D3VD 3RFZB 1A1NB 4AVIA 3KXFB 1XQ4A 3UO1H 3GSOA 1PZUB 4BCXA 1QR4A 4FMFA 5JXAL 4W68A 4Z3EA 4MJ5B 1HC1A 1C5BH 1W2KT 3UBHA 3SY6A 4G8IA 2OMXA 3GYRA 1NMCB 1NPNA 1Q8MA 2H3KA 3O6LL 5ESAB 4UT6A 4ZXBA 1I8MA 3P2TA 2EEBA 2Q7AA 3WL9B 1S7UA 2DQDL 2FJGA 4LVNC 1QSFD 4LEOB 3DRTA 5CIPA 1DQML 2VLLA 1YY8B 1UB5B 4HGKC 1LILA 3T65A 2EH8L 2CCVA 3H9SE 1PZ5A 5HYEA 4OCWH 4QHLA 2WLLA 4HK0A 1QFUL 4AEIH 3PL6C 1P7QA 2BNQB 1N2RB 3SE9H 4P2QE 4BUQA 5KAQG 1FA4A 4OLYL 3D85D 3QA3A 3TH4T 3GMRB 3F2LA 2BSSA 4AC4A 1NFAA 3L5XL 3CBRA 2OMNA 4IRJD 1XH0A 3MLSL 1RVFH 5CP7A 1NAKH 5DJAB 4ZFZA 3G5XA 1Z9LA 2VUYA 4MASA 3N1MC 1UUNA 3TYFA 3U0WH 2B14A 3PF2A 3STZB 3CVHA 2YD8A 3UPRB 1H6UA 1NIAA 5IK3B 1E8XA 3PE9A 4OGAC 2PTUA 4W9GC 1HKFA 3QNXA 2AERT 4D2NA 1NIBA 1VPOH 3SBWA