1M6UA

Crystal structure of a novel dna-binding domain from ndt80, a transcriptional activator required for meiosis in yeast
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
265
structure length
265
Chain Sequence
b'FKVGPPFELVRDYCPVVESHTGRTLDLRIIPRIDRGFDHIDEEWVGYKRNYFTLVSTFETANCDLDTFLKSSFDLLVEDSSVESRLRVQYFAIKIKAKNDDDDTEINLVQHTAKRDKGPQFCPSVCPLVPSPLPKHQIIREASNVRNITKTKKYDSTFYLHRNHVNYEEYGVDSLLFSYPEDSIQKVARYERVQFASSISVKKPFQQNKHFSLHVILGAVVDPDTFHGENPGIPYDELALKNGSKGMFVYLQEMKTPPLIIRGRS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ndt80 protein
publication title Crystal structure of the DNA-binding domain from Ndt80, a transcriptional activator required for meiosis in yeast
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription activator
total genus 55
structure length 265
sequence length 265
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-07-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1390 Mainly Beta Sandwich Immunoglobulin-like NDT80 DNA-binding domain 1m6uA00
1M7UA 2EUZA 2EVGA 2EVFA 2ETWA 1MN4A 2EVHA 1MNNA 2EVJA 2EUXA 1M6UA 2EVIA 2EUWA 2EUVA
chains in the Genus database with same CATH superfamily
2VUKA 5DHVA 1K5NA 3TF7C 1I8AA 1P1ZB 4MMXA 3WENA 2WUBL 3BIAX 1TZIB 5GGVY 1OANA 3T6WA 4XMVA 1M3JA 2QQLH 2BS9A 1MFBL 1NTDA 4OM1H 1ODAA 1A4KA 3H9ZA 3TWCH 2H32B 1IGCH 2LTQB 4NB7A 3FQ2A 4B3VA 1PKQA 4ZQKA 1KELH 1LHZA 1YNTF 3COOA 5BO1H 2F5BL 4IKIA 2L7EA 1B0RB 3BPNC 5DJ8A 3TNNB 2K3TA 1SXNA 2JKJA 4YAQA 1P7QB 2NTSP 4PRHA 4OLVL 3G5YA 1ESOA 1WUZA 2ZX6A 4OAWA 3SKOA 3UAFA 3Q2VA 2EAEA 2IDSA 4Y89A 1KJ2B 2LAAA 4EEEA 3BEVB 5GGTA 2XTJC 5FGRA 1MWAA 4LEBA 3FO1B 2OTUB 5I1HL 4AITA 4EI6B 2H47C 1VCBC 1MFDH 3CMOL 2EC9T 4CL7A 3QDGD 3JV6A 1IC5H 5E8OB 5E4AA 5I8CB 2OR9L 3JVGA 1ZTXE 2BK8A 1AFVL 2OJEA 4PIBA 5HYJE 3KPSB 3KGSA 4XXWA 2XTJD 3I85A 4JDTH 2C9SA 3ZL1A 2HG5B 4GQZA 4QNPF 1S7QB 1ZWIB 5DJYA 2WLZA 4R2GB 3H54A 1AHWB 4HMEA 2FZ3A 2IDQA 2IBGA 2Y6SC 2O6CA 3GZKA 4LCVA 3NACL 2WO2B 4UT7L 4I18C 2DJSA 4HHAB 2AMUA 2FGWH 3H7BA 4OZHA 1HQ4B 5FF6B 5HHME 4L4TA 2X0UA 3GKWH 2YS4A 2PWEA 2X87A 5EU4B 3B9KA 2DI9A 4L5FE 1JXFA 5D7JA 2J5LB 2Y6SD 4JPVH 1O7VA 2IOOA 3S35H 1OPOA 2XNAB 1Z1WA 3N06B 5CIPA 3BUIA 2WIIB 1F00I 4IIQB 4RH4A 2F7PA 4CW1B 1LTXA 3P0VL 1FAKT 2H45A 3X12A 3EYUH 3RFZB 3QZWG 1Q9KB 4LLQB 1Y18A 4Y16B 1T2QL 1PJ9A 4QRRD 1ZSDA 3VDCA 2MCG1 3HRZB 1SXAA 1B4TA 2M2DA 3RUGB 4JGMA 4G11A 4JFEE 3MNZA 1LLAA 5HGDB 5E00B 3T0EE 2YMOA 4YUEL 1HIMH 1ADQL 1Z9SA 2WQ8A 3P40A 1AVAA 4I4WA 3IDNA 3KPRA 2EVHA 4OZFG 1GGUA 1UM6H 3KLKA 2VLMD 2OK0L 5I2IA 4XOEA 1W6LA 2BMKB 3P11L 3PWUA 2O5YL 5EIVA 1R17A 3UG4A 2PXYB 3MJ8B 5ACZA 1AO7D 2XCMC 3NGBB 3A6BL 1QLRA 4HA1A 4NQQA 3VXRB 2BHYA 4KJPC 2BSDA 4MMXC 1QP1A 1X7SA 4K5OA 3SZKC 3VGAB 1S46A 2WLIA 4BZ1H 1QWHA 3CFJA 3E7JA 1YEEL 3KWXA 4NKOA 3ZYOA 1LO4H 2YQ2A 1OP5K 3GLDA 4LHUB 4OIBA 4OU3A 2WQRA 3IDJB 2Y7NA 4FERA 2RHEA 4Q0XH 4JQIH 3IBOA 5GISH 1U8NB 2XKNA 4I5BA 1BW8A 4X7DC 1YEKL 4MRBA 1WYJA 4KJPD 3MLRL 4LLYB 1GYUA 4QOKE 1EXUA 1U0QA 4EIUA 4LLVA 2N59A 4OIIL 1N4XL 2UWEB 3V4LA 4MNGE 1VEOA 2PLTA 3II2A 4IKNA 4GKSA 5EN2B 5T5FA 1S7UA 3D18A 4PW4A 3EJQA 4AVIA 4B95C 2Q1EA 3SE6A 4GI8A 3K91A 1NMAL 5J8OA 4KH2A 4K9EH 1MFAH 2FSEA 4RGNE 4OF0A 2XZCH 4IMLB 2DQUH 5EBLB 3L4CA 3LRGA 2X1OA 5EIIA 1BEYH 2G9HA 1WK0A 4OCMC 4PRHD 2NCMA 5AWNH 2J1YA 3CPLB 2ZX5A 3JVGC 3P4OB 1F1AA 1S9YA 5IKCB 3Q2LA 4XXWC 4AJYV 3CG8A 5DD3L 4FTVB 1KGJA 4HSQA 3ZKMC 2DYPB 2Z1PA 4YFEA 3OJMB 4RISH 3V5HB 2B9AA 1EX0A 1U8QA 1JGDB 2AW2A 2YFOA 5F96L 2DKUA 1MNUH 4P2YA 1IAKB 4WZ9A 2YPLA 1ECYA 1JWMB 4TM9A 4KXAA 3WIFA 3WV0A 3IF1A 1RK0A 4BK8A 3B9KC 1OW0A 4X4ME 1ZJAA 5F6HI 1T6WA 3FU5A 3ZKMD 4AEHL 1DBBH 2X38A 3D9AL 3FTUA 3DX9B 1BXAA 5D7JC 4H0GA 5L2KA 4PJEE 2FE0A 1XGYL 3NP4A 5C08A 4L8SB 4YHZH 3GQFA 3O4OC 1HDMA 3NP3A 5EUOF 4L4TD 3OKLB 1FL6A 4GLRH 2WXPA 3B9KD 4QRSA 3MLVH 5KVGH 5D7JD 1EHNA 3ZKNC 5SWZE 3PJSB 3QUHA 2EXWC 1I31A 2CO4A 3D33A 4X5PA 2VNCA 1QR1A 2BIHA 4BQBA 3QG7L 32C2B 3U1PA 4WW1B 3QT2A 5D7LE 3VD7A 3W0WA 5J11B 1MFUA 1OZTG 1W6WA 2A74B 4KQ4H 3A3YB 3V0VA 4LL9A 5CBAB 4KRPB 1TQCB 4ZFZA 2BP0B 1I3GL 1ORSB 3ZKND 3IVKA 1AANA 2EXWD 3VG0L 4BDVB 1Y6NR 5CR8A 2JV6A 5AENA 4HWUA 4WJ5A 2XZQL 1S7TA 1RJYA 2QV4A 3ILDA 4MSWA 1KXHA 4Y5XA 3FSZA 3IU3A 4FX5A 4Z23A 5HYSB 4TNWK 4H44C 2WCGA 3V0AC 1C1EH 3HI5L 4PP2A 1MI5E 5CCKH 1SBBA 3K72A 2WAHA 3WFHB 4YHPA 3ZW3A 4BHUA 4BK5A 3F01A 3M8OL 1KGXA 3KPRD 3QUXB 4BFEA 4HP5A 4XX1G 1FUNA 4YSTA 2KDGA 3LZPA 4OCRH 4G6FD 4B50A 4R7NB 3WNNA 1AGCA 4O2CB 1O6TA 3D1MC 2FYVA 3CH1B 3TNMA 3C08L 4Z7WA 5TDPA 4GG6F 3A5VA 4XNMA 5FM5M 3U6XS 1VPOH 3ZXAC 4C59B 2N3JA 4KY2A 4MDIB 3MFFB 4JY4A 4ONHA 5HVFB 5KTEL 1RIHH 3JWDC 5GGUB 2VDQB 3L48A 2UY6A 4N2MA 3K1DA 3OBAA 4L3AA 1UJ3A 3HN3A 2N7BA 3RJDA 1B6DA 5BUAA 1A7RH 4HLZG 2HRLA 2IPTL 5CGYC 3G04B 1T66C 5I6XC 1JK9B 3FYEB 1AHKA 3QHZL 5BV7H 1U42A 3OXSA 3VI3F 1XBRA 3IJEA 4BM7A 2DQMA 1ADQA 1RZJC 4ZG1A 3WO3B 1JGLL 1TCRB 3M7FB 1VAHA 5DMKB 2FHCA 1S4IA 4QXWA 4NFDA 2X4NA 4KNUA 5I5MA 2NOYA 1JGUL 2L3BA 4G59C 5DO2C 1YEHH 3CD4A 1JYNA 1XF1A 1I8IB 1PCXA 4GW5A 1DQML 2KHAA 4QTFA 1SJHA 1KPUA 3GLAA 3VB9A 1G7IB 4MZ2A 4M3KB 2V5TA 2VXSH 3ZO9A 1LO0L 5FYKL 3UAJA 3S5LB 1OW0C 4YSDA 4MCYA 3HE7B 4R4BB 3SB3A 5FYLL 3QARA 5DO2D 2ATKB 5LVEA 1ZHLA 2WTRB 3U4AA 1CGTA 2H3NB 4ZSOB 3FTSA 3EGXB 1OGTB 3KPNB 1CD8A 3NMEA 4JRXB 1F4AA 2YKLH 1X6LA 5I75B 3DO7A 2YPLD 3W9EB 3QNZA 5FEBA 1Q9LB 3EUDA 1K8IB 4LCUA 1DFBH 2WZ5A 3BD3A 4PW9A 5EZPA 3UADA 3H3PH 4AYFB 2VERA 5L2KD 2FVNA 4N0YH 1WWWX 4JREB 4R97C 3MRLA 2VXQA 3KPQB 3QQ4B 5E8EA 1Y7VA 5C08D 5D7EA 3LN5A 4H13C 4L2LA 3ECUA 4UNVA 2Q3AA 2EDTA 4MS8C 2QEJA 1IKNA 3I02B 1BSIA 1VJSA 3N1MC 2OMUB 5EN3A 4W9KC 2OFQA 1JI1A 1SM3H 3RHWK 3U30B 3RL2A 3FB7A 4JFVA 5D7IA 3CHRA 1HX0A 2DWXA 4Y9FA 2IOIA 4X6CB 3UABA 2K6YA 2BIIA 3ECVA 4FQLH 4N87A 5A40E 4TXVB 2XBTA 1O6VA 2DQJL 3K0YA 2IDFA 4XBPB 4Y5XC 2I27N 1OIOA 4NWTH 4PLOB 4PRPE 1AZUA 4LASL 4PD4J 4QO1A 1OARH 4BK5C 1IEAB 1JHLH 3ALWA 2F53B 2OXHB 1WD8A 3AC0A 1KCSH 3ASWA 1E4WL 4XCNB 3LZFL 4B9YA 2VMFA 2Z3FA 2ICWI 1BEXA 1U3YA 4N8VA 3QDJA 2R4RL 2G75B 3G5VA 4JO3L 5I1LB 3CK0L 1GZQA 3BKJH 3HVNA 4QXTB 4LGRB 4NZFA 1QSFA 4V2BA 3VGFA 1WFUA 4UV7H 5DMYA 4HIQA 4WTZA 4JFQA 1UJ3C 5FOJA 3BP6A 4FLHA 4IRZA 1BOGB 4HG4K 4ZFGL 2K8MA 4E9WA 2WINA 3VGGA 1ID2A 2D31B 2K7QA 3RJOA 2RGSA 3FK3A 1QW9A 3ZTEA 4KITB 3QULB 3S8FB 1N59A 2VH5H 4XAKE 1SYVB 3FT9A 3H9SB 3BUYB 1NC4B 4OSUH 4H88L 3FT0A 3FTZA 3FB8A 3OKKA 2XI9A 5DVLA 1W15A 5DWUH 2DQCL 2I85A 4ZZKA 4P46A 3NCYS 4PGEA 3BKMH 1OALA 4DGIL 4HLZH 4JG1L 5SWSB 5KS9F 3Q8AA 3C2AL 4JY6A 1ZXQA 3MRQB 4X4YB 5LQBH 2KPWA 3OKYA 5ACMA 3SD5A 1F4WL 4ERSL 2IMNA 1MWOA 3HFFA 3ZDWA 1KCKA 2W65A 4BQ9A 3MNVB 4F20A 4U6TA 4AVJA 3QUZA 4N1EA 1DVXA 1KENL 2EKJA 2IQAB 2X89A 3F7KA 3UAJC 3VI4E 5MHSE 4P07A 3S9DB 1MIML 2APVA 2XQYA 1SEQL 4ZW5A 3I75A 5AKSA 1QZNA 1R24B 2H2PC 5L9DH 3FJTA 1UASA 3TIDB 5LUMA 1QQDB 1ZV2A 3UAJD 1DN0B 2CZNA 3HLKA 4ZAKB 1Y07A 3K6NA 2Z35B 5F9WB 2X6VA 3T0XA 5ID0B 4HCIA 2EXTA 2BC4A 3EOBB 4M1DH 4X9IA 1WFNA 2NLJB 2ESVB 5F93C 1IKNC 2H2PD 2GTZA 3RP1A 5CCHE 2MRYA 3I2CH 4PV8B 2XU9A 5KJ7E 2Z7YA 4Y1TA 3T1FA 1A1OA 4YSUA 5KYWA 4JJOA 4IBWA 3CCHA 3MCKA 1MFEL 1IVTA 2A9MH 3X3GL 3LAFA 2X7LB 1VADA 2F0CA 4NXKA 1SUJA 1HK6A 1QFWI 1KPVB 5CCJA 5DMIH 3NIFE 2EO9A 1G9ML 1HINH 3OWRA 1OLLA 4OF7A 3KBPA 3TT3L 2CAKA 1M6OB 3MRFA 4PV9B 5E6SB 4NIKB 2Q3ZA 1J87A 3INOA 4LU5H 3IFOB 4TSBH 4D9QD 3DK2A 2HFGH 4YJZL 5G4NA 3KVPA 2X09A 4XNQA 4R83A 2OR7A 5DQJB 2FX8H 4YSSA 1FH2A 5E08H 2ZAIA 1J5CA 2Z0UA 2WKLA 3F7PC 1EXGA 1K4CA 4P8QA 3T3PE 2SEBB 3A4AA 1DQVA 2CRMA 5AB9A 1JBJA 3LIUA 1TZIA 3QZLA 1TEYA 2FIRT 1T5WB 4TRPH 4XN7A 4YH6A 4P2AA 3ULUF 1EFQA 4MAYB 3HBPA 1USQA 43C9B 3H9YA 5FDWB 3V0JA 2VR6A 3QDJD 3VG9B 3BWSA 1SLUA 2H32A 2E9JA 2J1ZA 2IPKB 4HIIA 5GIRB 4ADGA 4AM0Q 3GMRA 5T1LB 3WFCL 3Q44A 4G3YH 1LEKB 1AR1B 5FK9B 2J7LA 2J20A 1G4MA 1MCKA 1MJJA 2YXWA 4EOWH 2Z31B 4GRWH 4RFOH 3ZUCA 4ABUA 3CWGA 3DXAE 4P46C 2APWA 1FYHB 1IBBA 1BQ5A 2HB0A 4W9IC 3QEUA 2Z4TA 1CLZL 3ZZQA 5D5MB 2CO3A 4TQEH 2VZSA 3U46A 3D5OF 1KZQA 1B4JH 3BEVA 3L1FA 4LE8A 3EOTH 2HXAA 4TLTA 1TENA 1XZWA 2O6EA 1E5ZA 3F7QA 4E9SA 1GPOH 4FI7A 5J89A 3QJZA 5E4EB 5I1IL 4P46D 1QVOB 3QUZC 1KWKA 1CDGA 2B4CL 2DTMH 4XX5A 2YA1A 3NZHL 1KLUB 4HQQH 4C4KO 4ZTOL 2FBJL 2E27H 1CR9L 1UWXH 2VLJA 3NSXA 3U0WH 1TTGA 4HUVB 1QKZL 2BJMH 4WFFE 2QFPA 4RAHA 4GW4B 3WL9A 4NQEB 1RZGA 2ODHA 3QUZD 4P2CG 3C8KA 2X89D 1HQ4A 1Z9LA 1GS6X 3GBMH 5IVXE 4C8XA 1F56A 1FZOB 1BVOA 3INUH 1EHXA 1MH5B 2ZWYA 1ILSA 4PRIB 2OZ4L 3C75A 4HBCL 3V0WH 1DTUA 1RH8A 4NSKB 1QHPA 1B3IA 4FZEH 4KK8D 2QVMA 3KDMB 4JPIB 4W9HC 3ULUH 5IR1A 4GXVL 2XNAA 1J9RA 2XUWA 1MREL 1DJHA 4JQXA 4PJ8B 3HS8A 3BIKB 1TG8A 3OKNB 2YWYA 4IIQA 3MLZL 4DQOL 1CL7L 3HC4L 5K59E 1CE1L 5GGRY 3GO1H 3UC2A 1XGPA 4CN6A 1M7UA 5FX3A 5F88B 1IGIH 2BVQA 4HJ0C 3WFEH 5I1JH 2F7QA 4X6DF 5CEYB 1AZNA 4HKBA 1CD9B 3PV7A 4L9DA 1T1YB 4NN7B 3IDYC 2R69L 4LVHC 3CFCH 2VZVA 3HRZA 3TV8A 7PAZA 1GJIA 1CXFA 4JCMA 1FYTA 4J2QA 5HGDA 3EGDA 5E00A 3STBA 2BX5A 2F5AL 2OP4H 3GHBL 5BQ7A 2VW4A 2EABA 5I28A 4HJ0D 5JORA 2AQRA 4F8OA 3FSAA 2BMKA 1ILUA 1QTPA 3LN9A 4AJVA 4CBZA 3BI9X 3CZUB 1GIGL 2EECA 2NNXA 3VXRA 4MB3A 4TLUA 1P53A 2V5YA 3QR0A 1CCZA 3M86A 5FYLD 3IDJA 5C0IB 1ED3A 1Q0XL 2MKWA 2JK5A 5DJCB 5F1SA 4IOSA 2VDNH 1NLBL 3P30H 1PYWB 4UTBA 1NUNB 3WJMB 4HWBH 3TOPA 3BH9A 3QS3A 5I73B 4RDQG 4YXKH 3RPKA 4UANA 4DFHA 1L3WA 3LRLA 2DMCA 3KR3H 2UWEA 3S4SA 4GP8B 3RX9A 3L4WA 1CLOL 4KNTA 2IF7A 4NKMB 2V5MA 1JZIA 1KN4L 1NCJA 4PJBE 5EPMA 3ARGA 1JGIA 2EIKB 4O4YH 3IFPB 2ZG2A 3N1FC 1G9NH 2Y1YA 3BN3B 3V5DB 1KACB 3PWVA 8FABA 1YY8B 1LE9B 1L5GB 1RZFL 3ME0B 3CPLA 3PE9A 4X5WB 1I8KA 3P4OA 1JL8A 1U8KB 1HZHL 3RBGA 2Z8RA 1FFPB 2DWDB 2H1LM 2J21A 2DYPA 1N19A 4AT6A 5TPWH 5D1XA 3B1UA 3TO4B 3KJ4B 4X6FB 3UZVA 3EXLA 5C97A 3FOMA 4G82A 5IBUG 2H0FA 3UBHA 4YDMA 1JWMA 1XGZA 4FG6D 3M1BA 3TJHC 3VFGH 3U4KA 2DQFA 2VLJD 2QGEA 4FG2A 1UYWL 1D5RA 1BVNT 3BSZL 2HFFB 1D6EA 4JN1H 3D4ZA 3KJ6L 4HSCX 4DPRA 1VFBA 1Q4NX 5F7EL 2EDRA 1CGWA 1LP9B 2HRHA 4WO4A 1NIDA 3TJHD 2HKFH 4QKXB 1Q94B 4ABVA 1XCWA 4IIQC 2X6BA 5TE4L 1TUPA 2A6DA 3EHBB 4OCSL 4NQVA 1EEQA 4AIXA 1HQRB 2Z7WA 2PYFA 4G1MB 4PJXF 1RFDH 5ELIA 5SWQA 3RUGE 2XG5B 4Y16C 3KPOB 1ZE3H 2CBMA 3WLBB 3ZHLA 1TYEB 1XD1A 3AG2B 1WV7T 3PWPE 5ESQA 3HRZC 3NRPA 1ET8A 3OSKA 4N2KA 5F9JB 3FH5A 3T2LA 3DSFH 4C83A 4GBXA 1NCBL 5AW1B 1AKPA 3G5XA 4YHIB 1A6WL 3ESPA 4GG8A 5H2BA 1ORSA 3WSQL 4XNXH 5FLUA 1BXXA 4MZRA 4LCYA 5JHDA 3DVIA 4Y8AA 3UTTE 1SOSA 1A22B 1WZAA 3FCBA 2Z91B 1V55B 1CURA 4YDIH 4PAZA 4YWGL 1I7ZB 5C09B 4CVWA 1FYTD 1O7SA 1YYLH 4IJ3C 1ZEAL 4WAFA 5DJZB 4ZJ9A 4WTQA 4YSEA 3QUXA 1N0XL 1L9QA 2YGVA 3DTUB 5J57B 3T65A 5H4YA 1ASPA 2W07B 2OZ4A 1T1WA 4Y4FA 4OCXL 4X0NA 3FCTB 1BVZA 3ZL4L 2QPFA 2YAFA 4O2CA 1MCLA 3VXRD 5I0VA 2YXFA 3N40P 4PGCB 1OB1B 3GJFH 3MFFA 4JG9A 4ZUTB 1EHLH 4KX9A 1RIUH 1UD4A 1UM4H 5GGUA 3LZLA 4WNQA 2X4OA 4G6ML 1CK0L 2YLHA 4IOSD 3D25A 4YNYB 3ZTCC 1RK7A 1NBYB 2BNQB 3VXQA 3ARGC 2EH8L 5I15L 4YFLF 1KT2B 5I6MA 2VDOL 3G04A 3FTWA 2XA8L 5I76B 2R69A 4IS6A 4MA3A 5CUSH 3FULA 3MR9B 4J1UB 3K4ZA 4TV3A 5T3ZL 4R5XA 3I9GL 1RD6A 1G9MC 5KAQF 3TEWA 5C9KA 4ONFL 1HJCA 4E9YA 2PF6A 1P69B 2RB8A 3HPJB 3ARGD 1WIPA 3POCA 4HS6A 2AAAA 4OJYA 2IJ0C 3FTGB 5FFOA 5KJ4A 3LSOB 3KCWA 3QH3A 4JS7A 4C56E 2R7EB 2NZIA 1KYAA 1FI8C 1G1KA 5L0QC 3U2JA 5D1XC 1CFTB 4HKZB 4WJG3 3SQBB 2BZ7A 2QDWA 4LDOB 3EDDA 4KXZI 2AQQA 2A73B 1AIZA 2C9VA 3O3AB 4F58H 5I8OL 3HE7A 1NICA 1JSYA 2D3JA 2DYPD 2IFFL 4KKAC 4XCYA 2VE6B 5D1XD 2WC7A 2JIXB 3MXWL 5E1IA 3NSYA 2H3NA 4ZSOA 1JS4A 3EGXA 1CTOA 2VO8A 3GSRB 4JRXA 1KIPA 3P9LB 5I23A 2NZ1A 3QXAB 1NMCB 4WO4C 4WFHD 1A5FH 5HPOA 3AXHA 4D9LH 4X6EB 3MRCA 1NEPA 3MAWA 4AC2A 1WAPA 2PR9A 4KKAD 3LRKA 4QRPE 5A2JH 3MRNB 4KZEL 3BUTA 4LFHD 1KTBA 3AU0A 1MY5A 4P99A 2B15A 1MXDA 5I1GL 3ZK0A 4F3FB 1IC4H 5J11C 1AI1L 1Q72H 4WO4D 3IRCA 2V2XA 2C7UA 3NA9L 5FKPB 4GBXC 1DJZA 1TQCC 2PCFA 2B5IB 3RU8H 1YQVL 3QEQE 1JN6A 1W91A 1UCBH 2C3HA 4ZW6A 2WVUA 2WWOA 3GHEH 4G7VH 5B39G 4WIQA 2HPTA 5HYQB 3VXMA 5D6CA 1PNCA 1SRDA 3CDGB 4JFPA 2OSWA 2VR8A 3QZWB 4UZUA 1QSEB 5DR5H 3BD4A 5PAZA 1LDPL 2H5UA 2Q7YA 3UYOD 4GBXD 4MDJA 5CINH 1HZKA 4X9HA 1UXSA 4NPJA 4LBEB 5D55A 1CUOA 3VXOA 1PDKA 2HCZX 2Q3XA 2B59B 1IEAA 5FUOL 3QUXC 4ZMTA 5JHDD 4FZ8L 3EO9H 4U1JB 3VWJB 1JERA 2HA1A 2NNRA 4NWUL 4Y4FC 4EI5D 1J5HA 4KV5F 1CLYL 2Y36H 4KBPA 5LBSH 2ZONA 3BSZA 3N6YA 2G75A 4N25A 1FVEA 3QUXD 2IGTA 2NUTB 4LOUC 1ZHNA 4X5LA 1YNLH 3FU8A 2WN3A 4FD0A 1QATA 1HOEA 5AYUL 2IDCA 3TJEH 5CSGA 4Y4FD 4LL1A 3NJGA 2R0ZH 3PREA 4ODBD 4P2RE 1BOGA 2OMYA 2AV7B 1IILE 2DQEL 3H4FA 3KYMA 3LN4B 4WI9A 3O2DL 3ZVVA 5IFAH 4PB9H 1KY6A 4P4RB 2Y3AA 2CKNA 2QGCA 2X9XA 3L81A 3QULA 1HESA 3OL2A 3BUYA 1FDLL 1BIIB 5J6HB 4DVRH 5BV7B 3G5ZB 3O6MH 1CBJA 2PKDA 1XH3B 3IKCB 3UZQA 4GY4A 1JRHL 2VCOA 4LGPB 4RMVA 1PEZA 4XMPL 5IQ9B 2ZXDA 4L2YA 3QXUA 5SWSA 2PWHA 3I84A 4DP0X 3GFUA 4JRYB 2WBXA 4PJ5B 4QRUB 3KYKH 5INDB 2OJZH 6TAAA 5D93B 3C87A 3NBNA 3N41F 3MNVA 2GJZA 1M3IA 1DJSA 4L8BB 4BH7A 3AWGA 5CJXA 5AVQB 2DIJA 4TVPE 1ZDQA 4U1HB 3WY2A 1MVFA 2DLFH 3HE7C 3RJQB 4CC1A 1A1NA 1F4XL 2VLLB 4PJIB 4ELME 3VFMB 4DP5X 5C71A 2K6ZA 3PP4L 1NGQH 3RFRA 4AKPA 1ZA6A 1R24A 5C7XL 3IJ9A 5D1ZB 3MHZA 5D7SL 5I75C 2AJUH 2CBQA 4HCGA 4OFQA 1X5JA 3DUUB 4G8GA 1AYOA 4KI5C 3SY6A 1E30A 2OMNA 4TNFA 4N0CC 2WYIA 4LSUL 5L7XH 3HE7D 4ZMWA 2QQLL 4BE5A 2Z35A 4N0FA 2D4DA 3MGOA 3ULAB 5IQLA 3GXNA 2EE6A 4G5ZL 4JRXD 1BQUA 4ODWA 4NM8L 1E4XH 5AVVB 4PBXA 4F7CB 5C0FA 4X6CE 4KI5D 5BO1L 3IAQA 5EO1B 4N0CD 5FOBA 4MNQA 5LCVH 1F3JA 4PVLA 3U30C 5JOPD 4DO6A 2A6KB 3EG9A 3L3IB 3TH3T 4AH2B 1WBXB 1TJHH 5IUSA 4KTYA 3VGHA 4CILA 3ATDA 3D2UB 2BOLA 1KLGB 4EQ3A 1RPUA 4EAEA 4JFDB 4N5EC 4B41A 1U3HB 1GGCH 5DJ2B 4BEIA 2GK0A 5JIMA 5KSBE 4F2MB 1E5UI 3C9NB 3VXMD 3N42B 1JMXA 2WBKA 1FRGH 4PJCE 1TETL 2NY5H 2W9DH 1EGJH 1F11B 3IFOA 1J9QA 3EUUA 2FX9H 4GI6A 4N5ED 4JDTL 4WU7B 4IGBA 3W56A 4LSRH 4YK4C 4OCWL 2UZIL 3FB6B 4Z7OF 2XXCB 1D2OA 2NSQA 3VFPA 3S88H 4PJGE 2X3BA 4X7CC 1A4CA 3HC3H 2FGWL 1NBVL 2VJ0A 2RCSH 3HJ0A 1YPZB 4PI0A 2GIMA 3GKWL 1X5GA 3DHUA 4TTGA 4UB0H 2I7OA 5BZDA 5MEOA 3AG4B 1IAII 2H1XA 5FDWA 3FUMA 3A4DA 4LP5A 1E3XA 5T1LA 2QR0B 4TTDC 3S35L 3FT2B 4XR8C 2EIBA 4IHOB 5FK9A 2YRZA 1IBFA 1NJ9A 3OJVC 1JVOA 2C7FA 3MROA 1M56B 1OWWA 2BVPB 3BH8A 1JGEA 1YAZA 2WHVA 2YQ3A 3BEWB 4KFZC 4GQ9H 3UIZA 3EYUL 3HKZA 5JPMB 4TTDD 1BZOA 2X4RA 5BRZE 5C0AE 1CMOA 2ZXAA 3DO4A 3HZYA 2BHUA 4PQXA 4X98B 5T1DH 3O3EB 4YBHA 3ZMRA 5CJXC 1KGCD 2JQAA 3FHQA 1HIML 5I17A 1PAMA 3HB3C 1KLUA 1I8LA 4JJ5B 3DRQB 3P4LA 2EUWA 5SWSD 5BZWB 4XTRC 3OLDA 1UM6L 3C5SB 4J3OF 3DSNA 4YZFE 3FB5A 3SO3B 2Y5EA 4HUVA 2ENQA 4TPRL 4GW4A 4NQEA 3ETBF 1ZA3B 1VEPA 5CJQH 2Q6WB 1GMIA 3M07A 4HZ1A 2ISDA 2OMWB 3HB3D 3NFNB 2BSTA 3U1SH 2WSKA 1RJCA 5DQ9A 2OCJA 4L3CB 4XTRD 1LO4L 5F9WC 4FQPA 3K2IA 4S0SD 2FYYB 3SJVE 4NSKA 3L8QA 4IRSA 2DMGA 1A9BB 4Q0XL 3L95B 2VKWA 3KDMA 4TMPA 4JQIL 2ATPA 2YD0A 3O2DA 1G7QB 4GFTB 4NXSA 5GISL 2WB1A 1JUFB 4ACPA 4G8GD 1H3PH 3LCYA 1FA4A 3BUPA 4WNJA 4H8UA 3G3LA 1ZK9A 4B9FA 1E50A 5AVTB 4I0CC 4NO0D 5CEXA 1OGPA 1I7TB 2OSLA 3F6JA 3R1GL 5F88A 5FGCB 5HHVL 5CP7B 3HE6B 2IALB 4ZRGA 2Y2TA 2LU3A 4MNQD 1AGBB 3EDFA 1EZSA 3LQAH 1I9RL 1MFAL 1OF2B 4K9EL 4M6OL 4BKLA 2XZCL 4W9CC 2DQUL 5DZPA 5DO8A 1BEYL 4FP8H 3KG5A 4KK9C 4HJGA 4LXFA 4RX4A 3N44F 4OD3H 4EKXA 1AKJB 2CMRL 5IB1B 3FFDB 4PG9A 2XWBB 2QGBA 1MELA 4IGBC 3BDXA 4XCFL 4ZX4A 4F37F 3A22A 4IBLT 5ESAB 1K85A 4AE0A 1SY6H 1G84A 1MSPA 1DCLA 3QO1B 4KK9D 4J7RA 4UV4H 4CU8A 4OR1A 1RZKH 2Z8SA 3BVXA 3JWOH 3VFVA 5I0XA 1BWMA 4QEGA 4S2SB 3BWZA 3ULSA 1EFXB 2RD0A 2VOTA 4OZ4A 3GUFA 5D4HA 5C0IA 5L4JA 1OOAA 4IGBD 4A2FA 1QRNE 5IT2L 3IU4H 2B14A 4CGTA 1T5XA 1PYWA 1I1FB 1NFAA 1BCIA 1ES0B 1S3KH 1KSRA 3FUEA 2CK0L 3WJMA 2LHAA 3SZ6A 4AL8C 1Y6KR 5C3TA 4PGDA 1PQZA 1AXIB 4C55A 1ZLWK 3OAZH 4GRWB 2AF2A 1FAIL 1WA0X 1L0XA 5HHOB 2VYRE 3UTZB 1B2YA 5E8DL 4F7PA 3CFKA 4IEFB 3KYNB 4F33B 5C0EB 3PDOB 1QLEL 2BOBB 3TBTA 4WK0B 1YY8A 1LE9A 4ZDHA 1KCBA 4WWKD 4G43B 1O0VA 3D4GA 4KH9A 5I1KL 2YAEA 4XC3H 3UTPD 5F1NB 1I8LC 2P5WB 4WI5A 1RURH 4ETYA 3GEWB 1FVCB 1U8KA 2VL4A 1FL5B 4B96A 3MA9H 2A83A 2EVFA 2Z6FA 1TZHA 2ADGB 3GJEB 1OP3H 2UYLA 3ZR6A 2YIHA 2PO6B 3MBWB 4N8CH 4PWGA 4J28A 3VU1A 1SZNA 2HVKB 1C1EL 2DBLH 1A0QL 4UDUA 3S3PA 4M48H 1CDHA 3UCQA 4Z3HA 3LHPH 4UT6L 3GI9H 3UBGA 5J6GB 2OMZB 4P2OD 2CHZA 5GPRA 3JTTA 1VLXA 4OCRL 1JWUB 4IRSC 4LDCA 2GUYA 4R5TA 3BE1H 4OQTH 4XPAH 4NQED 2WJ7A 2MHAB 1XGUB 4PR5A 2CRYA 1NFDF 3ARWA 3K3QA 4XPFH 1OF0A 4KKQA 1ZV5A 5CKAA 5C0RH 1T21A 3JYBA 3REVA 4DK5A 3UO8B 1IGYB 3QDGE 2VWEE 1WCBA 3K4AA 3T4YB 2FO8A 4IRSD 4JLRB 3CVBA 1UT1A 1YNTA 5F6IB 1NFIA 5EC2B 5I19H 2OTWB 2MMXA 1DQJA 2XTJE 3WLBA 3X2QB 2ALWA 2VZUA 3KS0H 5I30H 1I7RB 2JCWA 3H9HA 1OZUA 1SYSB 5BV7L 3DHJA 3PUUA 4PWJA 5IVZA 3KWTA 4YXLH 5DTFB 5ETUB 5C9JB 3D39A 5ITBH 4BFFA 5E95B 4EDXB 3CUPB 1J8KA 1DVUA 4BZYA 3QFJA 3OSVA 2AQTA 3QGVA 3S36X 5I16B 3ARVA 4U6VH 5C09A 1OCRB 1YEHL 3F85A 2PCPB 4H8QA 4JO2H 2CK2A 3FO9B 4R5VA 1XEDA 3LNIA 3GM8A 5K5YA 1I1AB 3NEOA 2AQPA 3GUTA 3ZL2A 2CO7A 5ANMB 4RX4D 2VXSL 1FO0L 2WXHA 1Y0LB 3FQ1A 1PEWA 5T1JA 1CS6A 4JVWA 3QUGA 4PGBB 4UYPA 3S36H 3HG4A 4B97A 5B3NA 1TJGH 1HC1A 1NCAH 2IH8A 4LRNL 4TQ8A 5MI0C 2VDNB 2IGFH 2ZOUA 4JQIA 2G2PA 3DX7B 4M3JA 3NJJA 4GO9A 1OB1A 1UT2A 1NCNA 2VM3A 3D85B 3D0VB 3UP1A 1C5BH 5HDOA 2GBAA 4WHTA 1DFBL 2YLKA 5ALCL 2IEPA 1CN4A 1WD9A 3ZE0B 1CXHA 2VXVH 2HFEB 3ABMB 3POHA 4YNYA 4WI7A 4JKNA 3SGEI 1XB3A 2VLME 3DX0A 1AQ8A 4E9VA 25C8L 4ATTA 4BELD 5D1QB 3ZDXB 1XZ0B 4HV8A 3KD4A 4WI2A 5I76A 2JLLA 3MR9A 5JOFB 1SM3L 2BXYA 3KE0A 2N0KA 1JZ8A 2ARJA 3LEVL 4X6DB 3IS1X 4ZMVA 4JGNA 1T0NB 2KQMA 4FQLL 5BZXA 5C0DA 4YXHH 3UL4A 4ZFFB 2R7EA 1EAPA 4ODTH 2FT7A 3UJJH 5K9KB 5FYJU 3KJ4C 4NWTL 3GZPA 2H9GB 2ZPKL 4XO3A 2AXGB 5ECGA 2QHRH 4RCAA 3CV5A 3EJYC 3WXWH 3WUWA 3W3BA 1BOYA 3C6LB 5IJKA 2BIMA 5KVFE 1SOQA 1KCSL 1FWXA 1WDAA 3ARZA 3BXNB 3EYSL 1DDTA 3AGWA 5DZAA 1ZIAA 5EDXA 2YMXH 2Y7OA 4AEFA 4RAVB 1U2CA 1OM9A 4U1MA 2B9BA 1E2ZA 1PKQE 5IW1B 3I6LD 1J9CT 1NEZA 2ZSWA 3EO1B 1KXQA 3GSRA 3OMAB 3RGVA 3EJYD 3RWHB 3QXAA 5JHLH 1G7LB 1EJ8A 4LPVA 3STZA 1MRFH 1NCCH 3QPXH 4PRHE 4UV7L 3TA3A 1BBDH 3ZDYB 4ETQB 2Z34A 2WCSA 3JTSA 3NIGE 3SDDB 4IJTA 1Q1PA 1J8RA 4LRIA 1RZIB 3ILPB 3OXRB 4P3WA 4AV0A 4AGNA 3NCXA 2VH5L 3FZUC 5INCB 3BZ5A 3Q05A 1X5ZA 2C3GA 2J8UF 4OSUL 2E7HA 4EUPG 3ML9A 2R15A 5HYQA 4GP4B 5DWUL 3AU1B 4FKHA 3MYJA 3QCVL 3MRPB 2VJXA 2D3VA 2Z1KA 1OL0A 3BKML 3PFQA 1VACA 1UWGH 2GBTA 5A3IC 4PTUB 4K7FB 4B6ZA 5LQBL 1JNNH 3NDZE 1L9RA 4DP9X 4LBEA 2BFVL 1OO2A 3D39D 4L4TE 4UT6A 4F1SA 2LV4A 2ARWA 2CO6B 4U1JA 3PUCA 2AJXL 4NRZA 3VWJA 3QFJD 5A3ID 1PX4A 1MCDA 3DVGB 4GQPH 3G7TA 1BGXH 2Z4QB 5C09D 2HT4C 3UACA 5GGSA 5IMOB 4K7PH 4OD1H 4PD4K 1A7PH 2VMCA 5GSRA 2HKAA 1LK3H 1CZ8H 2CDFB 5L9DL 1SFDA 1SXBA 1CC3A 1P7KB 5AW7B 4DETA 2HH0H 5IEHB 3GJFB 1X9QA 1NUDA 1YEJH 3EOAA 3VFRB 1P5VA 1WWBX 2HT4D 5G5DA 1OT1A 1FFOB 2CXGA 3LN4A 2XWJA 4M1DL 2AKRA 1J5IA 4UT9H 5EUOA 5EOQL 1HXMB 1QASA 3VE0A 2GSGB 2Q8AH 4K9EC 3I2CL 3KXFB 1HHHB 5DEFB 4EN3B 1WITA 3QIBB 1LK2A 3KW7A 2IH3A 3IKCA 4L3FA 1XH3A 5J5EA 4HDIA 1J5OL 1SPDA 2BCKB 4IOFC 3MNMA 1H6UA 4GUPB 5H37G 3U2IA 2A9ML 4AYID 4YS4A 2WXQA 1NBZB 5CILL 4AUJA 4LCIL 4JRYA 4H20L 5INDA 4PREB 3ZHDA 3DBXA 1V7MH 1T4WA 4JHWH 5EOCJ 1HINL 4KX7A 1FPTH 5D96C 3LKQB 3GI8H 3DDFA 4IOFD 1U41A 4RSVA 5IJKC 2ADIA 3LPFA 2EZ0C 4U1HA 3MCG1 1FO0A 2MPAH 2VLLA 5BCAA 3TO2B 5IB4B 3VFMA 4LU5L 3F5WB 3PWLB 3V6OA 4YDKL 3L2LA 4UM8B 3RGVC 1DDHA 4CU6A 2XZZA 5D1ZA 5E08L 2ERJC 2EDOA 3VRIB 3IFLL 5MERA 5IBUB 4CUCA 3B6SB 3L5XL 4M43L 2EZ0D 2EIZB 4FOMA 4TRPL 2OW7A 4S1RH 1AMXA 2VR4A 1M7IA 1EO5A 3TA3C 5DUPH 1KMGA 2ZCZA 3TYGH 4AGLA 3UYPA 4GG6A 5TK4A 3RGVD 4LRIC 3BD5A 3QA3B 2Y69B 3K71B 1W80A 4G3YL 1DJXA 4XNYL 2B5IC 3QDMB 4ZYKB 1UACL 1HHJA 3EGSB 3LZNA 1J1PL 2A6KA 3TA3D 3L3IA 4WUKH 4RFOL 5E9NA 2LT9A 2ZNXA 3ESMA 1J05B 4ZUVB 2JFCA 4OB5L 3H6JA 2KS0A 3X1GA 1R3JB 4W9FC 4TQEL 4XAWH 5A2AA 3WDHA 1B4JL 3VI3A 1RMFH 2CDEA 1Z0MA 3EOTL 3UX9B 5HGBB 3UG5A 1F4YH 1SN0A 5JW5A 4Z0XA 3BHBB 4F27A 4EUPH 2P8LB 3ATAA 4KROB 3F58H 1GPOL 1KGWA 1GH7A 2YPLE 3ZRCC 1V27A 4ANWA 4UYQA 3M17A 4WWPA 3VWJC 4WHCA 1F11A 1FVDB 3HG5A 3VH8A 2V2TB 5ID1B 3LVEA 4U3SB 5C08E 1CG9B 5C6TH 1A4JB 5AOIA 3SQRA 4RVBA 1IQDA 3FB6A 3HA0A 4HIXH 2ED9A 2GW5A 2JJVA 5EO9B 1NH6A 3K2MC 3T6ZA 3SPVB 4UMGA 3KWVA 1QX1A 2IGLA 5K1JA 3DBSA 3NQKA 3G6JF 1LEGA 3V0WL 2D7TL 4KDWA 1M2VB 2M26A 1RL1A 2EIEA 2D2CC 4FZEL 4NNYB 1NM4A 1T83A 3UBXA 3WN5B 1W72H 4OTXH 2ED8A 4Z8FH 3FT2A 3ULUL 4WGKA 3VXNB 2G0KA 3O4LE 5DLMH 5LGHH 4MD5A 1HXYB 3MA7B 2IH1B 1F45A 2BVPA 2FJHA 4HUUB 3UEQA 4PJ5E 3OR6A 3T3MF 3BEWA 1C16B 5J4MA 3VM7A 1IGIL 2J2ZA 3FBKA 3VFOA 1BJMA 1OTUC 5TH2A 5DF0A 1JDDA 4MBRA 1QBLH 3CFCL 4X98A 4K2UH 3EBHA 3IE4A 2P80A 4PJIE 3HMWL 1CO1A 1HHIB 4WI3A 2R2HA 3O3DB 4PBVC 1V3MA 2APXA 3CZEA 3MOAH 5H37H 1N3NB 1M71B 4H8HA 1N2RB 4OGAC 5JYLA 1AD0A 1AXSB 1OTUD 3PPEA 4G42B 4JRYD 3SGJA 4OZIE 1BLNB 3SYPA 3IBEA 3SPCA 3DOSB 3V6OC 1U3ZA 4MNHB 5D1ZC 3NH7H 1EJOH 4HZLA 2OMWA 4X50A 3BAWA 4TLKA 4EVNA 3MYZA 4L29A 4OGAD 5IB3A 4JDZB 5C2BL 1DJYA 2WJ5A 1UFUA 2LFEA 2FYYA 1D9KB 2NRDA 4PU2A 5L8LB 3SKNB 1A9BA 2VDNL 3P30L 5D1ZD 3MJ7A 3AXLB 3PU7A 2E7BA 2EE2A 3OKEB 1PY0A 1OQOA 2NYYC 2ZE0A 5HI3C 4HWBL 4DZBB 2NY1B 2QPSA 3CX5J 3WNPA 2GITB 4HAGA 4YXKL 1KPRA 1MRDH 4TUKH 5DD5L 3KR3L 4N86A 2VLRB 5HHPA 1W9XA 1I7TA 3VXTA 3B4NA 5CP7A 4U3XA 3MRMB 2P44B 1ONQB 4NP9A 2NYYD 4PJFE 4WFEE 4GSDL 5HI3D 4OZGB 1BX2A 3MCYA 1O7DC 4AQ1B 3GSOB 4ENZA 2W0FB 1P1VA 2ZOKA 3AQZA 4ZTPH 4HX1A 5DC4B 4YLBA 3NCJH 3V6FB 2QL1A 5KS9A 5HHNB 5B39B 1XH2A 3AG1B 1EEUA 4NO5A 2L7JA 4F9PA 1AKJA 4FS0A 4J23A 1KBBA 4NQDA 2WCPA 4YSOA 1IB5A 5ESAA 4MJ5A 4PP1D 4Z7VB 1N10A 1XTLA 1YPZE 4HOXA 2UXVA 5A6LA 2AEOA 1Y1DA 2P5EB 3QO1A 4FNTA 3IGFA 3P02A 4XX1E 3L3GB 2KUTA 4N2GA 4TNVK 4S2SA 3MLYH 4QDGA 4PJDF 5AOJA 3BP7B 3UH8A 5LGHL 5HPMB 3QXDA 4CMHC 3CQPA 3BVUA 5TE6H 1E5BA 2APFA 1U93B 3N3EA 4QTHB 1CFMA 3RWIA 2X41A 4HPOL 1BQLH 1T83C 4UTAL 3D7PA 5MEQB 1YMHB 4JN1L 3ZN6A 3BAEL 2YD8A 3FQUB 1B4LA 4XB7A 2QKIA 3GRBA 3Q9QA 5D6DA 1FFNB 5D7IE 5IBTL 4F8TA 1KIUA 1UURA 3I50H 4NGHH 2WW8A 1M9SA 1MCBA 1OSYA 4V33A 2IADA 1E9OA 3P9WB 4XC1L 4GMSH 1U8MA 3ZJAA 1QR4A 1RFDL 5GHWH 3FT4B 4NENB 5JOEA 4PJHF 1WSST 5A6MA 1KEGH 1TSRA 4LSQL 4JFZL 5HSFA 3QE5A 1T2XA 2W5PA 5DGQA 3NFPB 3VCLB 2J3SA 1BG9A 3DSFL 3GTVA 2O5ZL 4JFHD 2MCPH 1QBML 1EUTA 2R2EA 5F1NA 3D07A 1JCKA 4XNXL 1Z5HA 1UXWB 4XP4H 1FL5A 3SGJC 3SO3C 4F8QA 3CXDH 4I2XB 1LD9A 4C54A 4YDIL 1C08B 1TF4A 2PO6A 3QDJE 2P80D 3PGDA 3SDCB 5ISZA 1YYLL 1BFOA 4OV6F 1NCDH 4FFWC 3OQRA 2AXFA 2X4QA 3E38A 4FCHA 4R3SB 5IREA 5J6GA 3VMNA 4A2EA 2WBJA 4WCYH 1IJ9A 2MQCA 5CNHA 5FCUH 4Z7OB 3DARA 1AS8A 4PLKC 4EZKA 4H1LG 4ZNCD 3EF7A 2Q2LA 3UROR 3LQZA 4N6RB 2OULB 4XZUA 1RLBA 1U8IB 3D3VB 3RDJA 3ARYA 4FFWD 4KKPA 1OGAA 1ULVA 5EF3A 3N1PC 4F7MB 5D4QA 1EEYB 1EHLL 4U0RB 1RIUL 1UM4L 3GMMA 4Z77B 3AB0B 1FGVL 2J12B 1ZV9A 2PWGA 4KKRA 4PLKD 5IZ7A 2R8SL 3MV9B 1LEIB 4OLZL 4XVOA 4XN5A 3SDAB 4LNVA 2OTWA 1B0GB 3V6ZA 5IK3A 3MBXL 1UZ8B 3PXHA 3IE9A 3JUYA 1SYSA 4PJ9B 3W39B 2FNWA 1PW3A 4KTGA 3HMXH 2J4WH 1FORL 4MJIE 3V10A 3TPKA 5DTFA 5ETUA 5I1DB 2G60H 3EJSA 4TUOB 5LN4A 4F9PC 2AI0H 4OGQC 3NCCB 3IGLA 3NZUA 3C12A 3Q8EA 1J0IA 3RZWA 1KTCA 4IU2A 2BNUB 1CE6A 1E6OH 2XWDA 1JZEA 4CU7A 2VZ3A 1T04B 3HN5A 1IQWH 3LZOA 1MPAL 1OP5H 3VD2A 2J72A 3WTWA 3QWQB 2OQJB 5FYKU 1AKJD 1Y0LA 4F58L 2PN5A 3HTLX 1TTUA 4NQDD 4Z95H 3LNDA 1BVKA 2C26A 2F7RA 4U1SA 5E56A 3CU7A 2XZAH 4I0PB 2XETA 2QKIC 2EYSA 3ZE2F 1MQKH 2AJVH 3D85A 4HWBA 4IYKA 5D6DC 1A5FL 5EBWA 4AQ8A 3CZSA 4M6NH 2EH7H 3QI9B 1MHEB 1ZGLM 1P4BH 1KCRL 1L4IA 3OQ3B 4P57B 3PS6A 4G72B 5D1QA 2I25N 1IC4L 4LQFH 5JOFA 4NJ9L 3CIAA 4TL4A 3RU8L 3IDIB 3QPQD 3U0TA 5EHFA 3SYCA 3TVMB 3GHEL 3AJ7A 4X6DA 3ZT6A 2I9TA 1PF3A 3C6SB 5IG7A 4HOWA 4ZFFA 3GRWH 5CSZB 2YMTA 5DR5L 5EBMB 3CFDA 2PO6C 3B43A 3HUJB 3FFCA 5CINL 1PD6A 4U0QB 3BP5A 4PCSA 2AXGA 5EO0B 4AQAB 2JVUA 1ICTA 2ICCA 2J1KA 5E5LA 1M7DA 4OCYH 2IAAC 3V5KB 2IH9A 2HLEB 3KH4A 3BWAA 3EO9L 1JZ2A 1YN7B 4OLYL 1BXUA 3WU1A 2ZXCA 1BFTA 2FJGB 4OV5B 2Y36L 1BMZA 3FUFA 5D4IA 5ISZD 1R34A 5LBSL 5IW1A 1SUHA 2EYRA 4LLWB 4UTAA 3VGBA 1RULH 2GJPA 2R1WA 1U8OB 5ESVB 3ULUC 4FNSA 1G7LA 4TSAL 3L4ZA 3LH8A 5SX5K 2C1PB 1ACXA 2WBJD 4GRMB 4HS3B 3PQYA 3BPCB 1QRKA 4Z78B 3BW9B 1A3QA 1CXKA 1UADC 2BNRB 2BSSB 3F12A 3HNSH 3TJEL 1ZTXH 3V4UH 1VIWA 2E56A 2R0ZL 3GMPB 1XGQB 4H1LH 4QTIH 1SOXA 2VLKB 4HHGA 1YO4A 2ZX7A 4APQB 1YMMB 2NTFB 2EE9A 3N43F 1OGAD 5IFAL 5I8KL 3ULUD 4X0KB 4ECNA 5JO5A 2VN4A 1MG2C 5INCA 3T0AA 4OUOA 2DEXX 4X5RA 3O6ML 4A04A 4HF5H 5AD0B 3I74A 4JZJB 4P5SA 4QXUL 3BVVA 2UY7A 3L5WA 3FRPG 4U1IB 4Z7NB 2VLJE 3LH2H 3UC0H 2CHXA 4L5FH 3UAEA 5E6RB 2ZWLT 4Z7UE 3MRIB 5IEKA 1A66A 1UD8A 3CC5A 5FA4A 5F6HJ 1IBHA 2NY7H 3RWCB 4ZX3A 3DGGB 3KYKL 3WTXA 5J9PA 4OBRA 4J3XA 2IV8A 2H1PH 3HPLB 1SHWA 3GSQB 4KUCF 1OAQL 1O75A 43CAB 4FEIA 1FL3B 1JVLA 3K2UH 5E1HB 5DRXB 2X2YA 3GM0A 1S7WB 4X8JB 1KBGL 1KIQA 2I07B 1XFPA 4ZI8A 3DVGA 2ZWZA 5F7UA 4HKJA 2F8XC 1NGQL 4Z7QF 4U1GC 3ZTNL 2BPBA 4W9LC 1OCOB 3LRSB 1MAMH 3TT1H 3WNKA 4MYPA 4Z3TA 2AJUL 1DBAL 4HWZB 1P7KA 4ODSL 3SBQA 5HXMA 3FQNA 4R96B 5CHNA 4AQ8C 5IEHA 1FN4A 5L7XL 3FT3B 5EOTA 1H8SA 3MJ9L 1WA1X 5CJBA 2FLBT 1H3XA 3NZSA 2J8HA 4UU9B 5D1QC 2N7SA 1AJ7H 1E4XL 1WA2X 2GSGA 2RMNA 3D85D 3HZVA 4RFEA 4AG4H 4DUXA 1I8MA 3PDDA 1HHHA 4KU1A 3S37H 3QIBA 2PWFA 2KQNA 4OLEA 1DLHB 4PJXA 4RQQA 1G6RL 2BCKA 2AK4A 2WKOF 1QLFA 4A2GA 4GUPA 1TJHL 3JSSA 2YSSA 5JQIB 3FHEA 5D1QD 4FQIH 2VL5B 4OFYA 3AS3A 1CQYA 2EXYD 4PREA 4XP5L 1J0YA 1GGCL 3DWTA 3GKZA 8CGTA 4NM4H 5K9JH 2VSKB 2R4SL 1ZOXA 4F7EB 4OBSA 1PG7W 2APTA 1NDTA 1FRGL 4LDEB 3V4PB 1DSYA 1PL3A 1TTRA 1YYCA 2W9DL 3TO2A 5DGRA 5BJTA 2K4WA 1D5MB 1PNDA 3PWLA 4YDLC 3FFCD 4LSRL 2CUMA 1KTKE 1OCWH 1F3DH 4ONGH 3P73A 1S7SB 3RVTC 1KG0B 5E70A 3WMPA 1E5YA 3B6SA 3HC3L 3TASA 1AZRA 2EIZA 4QRTA 1A2YA 1P2CA 5C0NC 5I5IA 3IPFA 4FQ1H 4PJ7F 1NPNA 4UB0L 3H2PA 3LKPA 5DT1H 2Y5QA 3BGFB 2DM7A 4UOW1 1KBWA 1Y1UA 2TAAA 1A6AB 2V2WB 1NAKL 2N4IA 1V3JA 2QQNH 1JGVH 3MJ6A 1ZE3C 2NY0C 5EB9A 2FJUB 5GQBA 5IQMA 1RHHB 5HHQA 5K69A 3PQYD 5C0ND 3DIVA 3DMMB 2IXQB 3P0YH 4U1KB 2X4PA 1S9WB 2E75C 1YDPA 5K39A 1QUNB 3QNYA 1WFMA 2QT6A 2PMZA 5B1JA 5C3LD 4WWOA 2EYTB 4J3VA 4GQ9L 3DJ9A 4GB9A 2NY0D 1ZHKA 5LAPA 3F6IA 5D1XE 4XXDA 3RVWC 1QA9A 1NUFA 4WUUB 5T1DL 4I87A 3WE1A 3FCSB 4YHYB 3LEYH 2XXMB 3MRGA 5EZLA 2X2UA 5I9QC 4NN5C 2ID5A 4WFHE 3WKNA 4UUJA 5EF2A 4YGVB 1UG9A 3QRGH 5AW8B 2UX6A 2V2TA 3PY9A 1XGRB 2ZXWB 5ID1A 3C5ZA 3NCYP 3T6QC 3D69A 4U3SA 5JPNB 2PYEB 1PY4A 3KHOA 1Z0NA 3VJ6B 3C8DA 1L7IH 3OC5A 3U1SL 3LZRA 4FJ6A 1BPLB 1HJBC 3KNBA 3RILA 3RY4A 4JFXA 4WKZA 2R27A 4NZDA 1BZQK 1JPTL 1VA9A 3G6AB 3STLA 1MY7A 2F15A 2FB4L 4RBPK 4KZ0A 1E5CA 4TVUA 3GSUA 3ZE1F 1JXGA 5DFVC 1OPGH 4RMUA 3C5JB 3QIBC 2AITA 4U6XA 4PY8I 2H8PA 3ISYA 3GDCA 1HI6B 4HUUA 4M6MH 4QHLB 1OOWA 2ZAHA 4KRNA 5JHDE 3S0PA 1C16A 5DSCB 1QPXA 1QNZH 5A2BA 3Q01A 2OXGB 2YD5A 5DFVD 2ZKYA 4UCFA 5D70H 1NIBA 1ITBB 1AC0A 2ICWJ 2G4EA 4PVNA 4BHUI 1EVUA 1CDBA 2AK4D 4FP8L 3O3DA 4LEXH 3PLYA 4YHMH 3NPSC 4TKWA 1N3NA 4HJJL 3KH3A 4QYOA 1M71A 3CVIL 3H1ZA 5CN2A 1AXSA 4GEIA 4K23H 2CGYA 4G42A 4OD3L 1NSNL 4OFYD 4NC1C 1G7JB 3NFSH 1Z9PA 1NBQA 1QMUA 4XMXA 4FULA 4U33A 4AIZB 2VQUA 4FQCL 3HG1B 2FJSA 1SY6L 4JBSA 2W88A 4AUUA 4P59L 2KZKA 2JKWA 1HNYA 4I9WE 4RMBA 1ZT1A 3DV6B 5L8KB 3DGCR 3E1ZA 1UM5H 4Y9CA 1GGBH 2Y25A 1H15B 3DOHA 3MJ9A 3U6RB 4LHJB 4Z3IA 3GSWA 3BSHA 5IROA 4MCZB 1AH1A 1SQMA 3OKEA 4MXWH 4OKVA 3L1EA 3KW8A 4X7SL 3RWDB 2NMSA 2H3KA 1KDJA 1OXYA 2Y3NA 4UOQA 2J55A 3CFTA 3HAEG 2DF3A 1N6VA 1ACZA 3RWFB 2I32A 1G6RA 2X6UA 4GAFB 4XNZB 5CEZL 1FNGB 5B1JC 4ZOCA 5DD6B 4HUWB 1JHTB 3MRMA 1E3FA 1IAMA 4KTEH 2FLMA 2VZOA 4AQ1A 3GSOA 2W0FA 1UUSA 1FE8L 3GYRA 1T7VA 4NFCA 4EUPB 3CFQA 4NUQA 3V6FA 3QEHB 1OT4A 2BRRL 1T1ZB 3FDWA 4FN0A 4XC3L 4JKPH 2EVGA 2F1EA 1DZBA 4KC3B 1RURL 5EEYA 1N8OE 5C0CB 2O61B 3MA9L 3C5ZC 1OVZA 4YDJA 3X11B 4XCEB 4MLIA 4N8CL 4PWFA 2P5EA 4JM4H 3L5IA 3L3GA 1INEL 1DJIA 4NI6A 2APSA 5FW6A 4M48L 1KOAA 4WY7H 1EO7A 5E4IA 1QO3B 3GHPA 1BP3B 5JOPE 4AZ8B 3C5ZD 3L3JB 2BVYA 1IGJB 5FFGA 2CJSA 1U93A 3MLUH 1O9ZA 1SVZA 3BE1L 4XPAL 5LAXB 1P6AB 3UJTH 1XB8A 1W72B 2W9EH 3O3BB 4HH8A 4YL9A 3VI4F 4GINA 3IGUA 4XPFL 5E9DE 3V52H 1A14H 1FFNA 1ZT4A 2XJKA 2BH0A 4V1DB 5C0RL 5G55A 3IETA 2KLRA 3VXME 1JCVA 4HU8A 1NAMA 1TMCB 4AOFA 5LXVA 5DMGC 4A2LA 5I19L 1XAUA 4UQ2B 1CGSL 4GUOA 1DEEB 2G5RA 5I30L 1XL6A 3UPRB 1R3LB 1I1RA 3MRDB 4Y7MA 4E36A 3D87B 4BFGA 1UXWA 1XMEB 1MRCH 2Y24A 2HVJB 5DMGD 3CZGA 5ICZB 3NJKA 1T0PB 2VDLH 3PGFL 4JVUA 1C08A 3D51A 1IFGA 4Y19B 2VAJA 1YJDH 1E9QA 4R7DA 1JDCA 2DH2A 5FDYA 3TBSA 4L23A 3QRLA 1I9JH 4RMRA 1FNSH 3Q8BA 1TO5A 3KWWA 5E2UL 1QFUH 4KTDH 4KJQC 1D9KC 4LSPH 3QQDA 2XIIA 1MCRA 4UTCA 5DZNA 5MEPB 1NCAL 5IROC 3O0RH 1X5KA 1J9SA 2WO3B 1OSZB 3EAKA 2R2CA 3QWNA 4CSTA 3MLXH 4K55A 1DBMH 2AEQL 5DMJB 1XR8A 3MRKA 5J1AA 3V6BR 1EEYA 2K9FB 5B38G 4TULH 3MLTB 1C5BL 1QEWA 2WLMA 4LZKA 1KGCE 1PZ2A 4KJQD 1DN2A 4XP6H 4AUYA 1VZIA 2VXUL 4ENEC 1MUJB 1LO5B 3R06B 5IROD 1R19A 4P2QA 1B0GA 3ZLQC 1THAA 2TSAA 1IMHC 3EBAA 5C6WH 5ADPL 4BWTA 1C12A 1ZIBA 1FG9C 3ILQC 1O6SB 3WHXA 4AQ1C 4ORGB 4J2XA 1U92B 3BLKA 1S7VB 1UT9A 1J86A 3S2CA 5JIDA 4ZTEA 3UMTA 4ENED 4OUUB 4TUOA 1CF1A 5HDBF 4BKSC 2BCMA 2B7DT 3X1BA 4ONOA 1FQ9C 4YXHL 4GUCA 3ILQD 4ODTL 4MB4A 5J6SA 1C5CH 4PY7A 3ULVF 1SJMA 2N56A 1AG0A 3TWYA 4BBWA 4MCMA 3HG0A 4G8GE 2JQMA 4NLAA 2OX5B 5EU3A 3CFNA 3L7FA 4N9GB 4A63A 3WXWL 5FM8A 3AS2A 3IS0X 1NKGA 3BZ4A 6PCYA 2FCBA 3L9RA 2X4SA 3EZ8A 1A02N 4CBPA 4KHTH 2D3LA 3EYVB 4YBQD 3M45A 4TYUA 4KJYA 2P5ED 1NGWB 3V4VH 3ATFA 4JL1A 2R0WH 2V33A 4I0PA 5C92A 1UB6B 2AXHA 4MNQE 3UTQA 4DK6A 5JHLL 4FRWA 9CGTA 1MRFL 1AY1L 4X99A 4M8QB 3ARFB 4E42B 5DC2A 2ZUWA 1BBDL 2FD6H 2PP7A 2XWXA 5MENA 2WO4A 2HRGA 5IM7B 3SPHA 1ZVNA 3B56A 2ICWB 3MMEA 3AMKA 2B1AL 2GUOB 1HILA 2ZXQA 2HJFB 3PV6A 3C6EA 1H0DB 3TVMA 1MNNA 3ABZA 4BXVA 3C6SA 3ESUF 1UA6H 4OJAA 4S1SH 4ZMZA 1IL1B 4N26A 1IAIH 1QTSA 4MASA 3AACA 1UWGL 4UIMB 1UZ6E 2YEVB 2HT3C 4QY8A 2YA2A 3HUJA 1KYOJ 1JNNL 3LDBB 4NT6B 5DK0B 3ZX1A 1WIUA 1K8DA 4N28A 3V5KA 1RJZA 1NIEA 3T1WA 1WIOA 4QMEA 1YN7A 2DWEB 2KLSA 3VXUB 3F2LA 4CNIB 4IKJA 4Y5YB 2HT3D 4ZUSB 2DMKA 4HEPG 1BGXL 5FB8B 4K7PL 2AK1H 3KEDA 4OD1L 1LK3L 1Q9OB 1U8OA 4XMTA 3ROLB 4UDTA 5E6IB 2NY2B 3GPSA 1F3DJ 1ZY9A 2C1PA 2FK9A 4HS3A 1T0OA 1U9KA 4U0RC 4OF5A 2DDQH 5AL8A 1YEJL 1F6AA 1N5AA 1Z9MA 2BSSA 2XPGB 4QLRA 4XVJH 3UTPE 3P69A 2WXMA 3GMPA 1LDSA 4APQA 2VLKA 3PIQB 3OKDB 1YMMA 1CFVH 4HJTA 1C8QA 2WVSA 4LIQE 4PHXA 4D8OA 5HHXL 5HY9B 5KYNA 1OGSA 3WEOA 5IQ7H 4K71B 4KHXL 4MAUH 3QDHA 3UYRH 2HSIA 4WVRA 4BINA 3PABB 4ZS6C 4WLCA 1CD0A 3QHFH 4P2QD 5ICXA 5DHYB 2RH0A 5GRVK 4RGOH 5GS1B 5JQHC 4TUJB 5FO9B 5I26A 2QPDB 3DGGA 1DUZA 4DP1X 2EACA 4AJWA 5F7NC 3HPLA 1HH9B 4JHWL 4WDIB 3TBCA 1SEBA 2VUYA 1GRWA 2B20A 2KL6A 4J3OC 1FL3A 1R5VB 4JUTA 1AOHA 1B0IA 1G5AA 2Q76B 4ZS6D 3CLFH 1YNKH 3L4XA 5DRXA 2W60A 5CGMA 2EDBA 1F90H 1XSKA 4XN1A 1S7WA 2C9AA 2MKLC 1ZDSA 2HTLC 1JAEA 2WNWA 2EO1A 4MBOA 3WHE1 4EIBA 4GMTH 1H9VA 1YC7A 4I0PC 2VXTH 3IMUA 5DVNA 2ZCKH 4J3OD 1BPVA 5JMOC 2FATH 2OCCB 1LE5B 5C0BB 5HI5C 4I3SH 4XPHL 3FT3A 3B3IA 2BSCA 2HTLD 3LNEA 4PUBH 1NFDA 4UAOB 1RZ7H 5E51A 1TCMA 4MX7B 3TYGL 4EZLA 1V5JA 1ZT7B 2ZKMX 4I0PD 4PLJC 2RFXB 4ZXBB 3MV7B 2F54E 4OLWH 2RTTA 5HI5D 3S3SA 2LU4A 3IWUA 4HC1L 4HETA 1QBAA 3TTYA 1A7NH 5JDSA 4UILH 1CFQA 3B7UX 3TVMC 1RP9A 4MJ2A 5MEND 4JHZA 5CEZD 4GKLA 2XKSA 5T5NG 4PLJD 4U7MA 4LSSH 4FYQA 2D73A 4XAWL 3EADA 2GBUA 1X5YA 5L88L 1HL4A 2G3NA 2C4FT 1F4YL 3MX0A 4QHUB 2CM5A 4JN2B 5CZKA 3TVMD 1NCGA 2ZKXA 4Z0BL 3RUGF 1JF5A 4AVHA 4AVKA 5FWRA 4F7EA 1QABA 1ZSHA 3N04A 5J13C 5K1NA 1F42A 7PCYA 2CRZA 4PRDB 2FHFA 3NZ8A 2XVBA 3FUIA 3GK8L 4JO4H 5EC1A 5F89A 4URKA 4PH8A 1U95B 2ZYHA 4Y4HB 5CWSA 4M5YH 4B9PA 5F9OH 5C6TL 1EDQA 2KERA 2WVTA 1S7SA 2XWCA 2ALAA 1KG0A 4N1HB 2F08A 4TSCL 1IAOA 3QUML 1E43A 2ZX9A 5JHLA 4OF6A 4Y9EA 2W0KA 1RSFA 1LNUB 2JJUA 4YBLB 1IX2A 4APQC 2A6JA 4LLMA 1V3KA 5HYJB 4H1LB 3BRGC 3OHXA 3PGCB 3BFOA 4FL4B 1W72L 3CBJB 4D0CA 1XGTB 5CMAB 5GGSY 1A7OH 1H5BA 2R51A 4J6IA 4U1KA 3U9WA 4KXBA 2KZ1B 1HYSC 1QYGL 3K8KA 4KXCA 2VLKD 1TQBC 1QUNA 5HHMB 1W0WB 4APQD 1YMMD 4L9LB 1K72A 4R26H 3L3OA 2X42A 3T09A 4QCIA 1EERB 2QSCH 3HLAA 2Q8BH 4DKEH 1D7CA 3Q6FA 3CHOA 3GS4A 3MLSH 1JNJA 2P46B 2ZXGA 1QBLL 1NLDL 4WUUA 4K2UL 4PJAE 4OGXL 3FCSA 2H3XC 4DPAX 1HYSD 3F00A 4H40A 2J6EH 2VN5A 3K6IA 2ZKHL 3VFSA 1BBJB 1K2DB 1ZLDA 5ENWB 3A6CL 1TU2B 3O0LA 3TN0A 3UOAB 3P54A 1XGRA 1UB5B 5K9OB 4P5MB 3HIZA 2PYEA 2PP9A 5GZNA 3MODH 1XEUA 3VRLF 3NH7L 2YSTA 1EJOL 2BIPA 2UUDH 1YZZA 4LKCA 5A7EA 4XNUL 4Q89A 1GYCA 4JGJA 4JFEB 1KYUA 3SE3A 1J12A 2R1YA 3H7LA 2WQXA 1B2WL 3FU9A 3T0EB 3V55A 2WNKA 3QRFM 1DJGA 2UZPA 2OPCA 1CFNA 2F8IA 2XVLA 2C8NA 5ICYA 4N3UA 5E8PB 3C09C 4FQJH 4LBAA 2ENYA 1U8PB 3D0LA 2CO2A 2FHBA 1VFAB 3L4YA 5BVJB 3GBNH 4C47A 3U7WL 3LKRA 3BQUA 1BA9A 1AD9B 1MHHB 3FPYA 3D39E 3OZLA 4NCC1 2D03H 5DC9B 1LWHA 5D72H 3LD8B 5DSCA 3QFJE 3L1OL 4F91B 1B3JA 3DECA 2OXGA 2J8UA 4GI9A 3QB7C 2WWKO 4NUJA 4PB0H 5TQ2H 5E1GA 4E41A 2E4FA 4JPKH 4N2HA 4MMYB 3RX7A 1QFHA 3O11B 4U2ZA 4E68A 2VDRB 2HRPH 1B0WA 3ES6A 3OAZK 4QOKB 1JZGA 5J7CC 5IGXH 2QADC 4MNGB 1G7JA 3TTSA 4HGWA 1WISA 3SCMB 1PG7X 4DQAA 4JFYB 1VF5C 1MKFA 4PS8A 4XVUC 1A6UL 5D7KE 4F24A 3V7MA 4JFUA 1FIGH 3HVDA 3L3DA 4XPTH 3KBEA 4NNPH 4RGNB 1XF5B 1KNOA 1LYQA 4UQBA 1CBVL 1CL7I 1RIVH 2QADD 1TR7A 2B1HH 5IIEB 1H6EA 3BGFC 2KMWA 4M62H 4HK3J 1SGKA 5TE6L 1QPPA 2G30A 1WCQA 3FU6A 1BQLL 4MCZA 5DUJA 1FJ1B 1G1YA 4XVUD 1JNHB 3K5SA 2K6WA 1JF1B 1H5BC 2YPVH 1AGEB 2CM6A 1KCUH 4HC1A 2XIDA 4FA6A 4IM8A 4MRCA 3QZPA 1QI5A 4N20A 1BMGA 4ZPTB 1FG2B 3GT6A 4GMSL 4WTWA 5DD6A 4HUWA 4XH2B 5E2TH 3KCPB 4F7TB 1KEGL 4GUQA 3SKUD 5EWIH 3CX5K 5LNGA 5L2JB 3MFGB 4PJEB 3DX8A 5L6YL 2X4TB 1R3HB 4YHYC 1AP2B 3OG6B 4GRLB 1JF6A 5CN3A 2QPEB 1ZLSL 4AIOA 4M61A 3S5ZA 3S3JA 4N2LA 3WN6A 5DD1H 2HAZA 5D2LE 3TN0C 2TRYA 3Q8CA 3FRPB 4MXQC 2O61A 1QOKA 1J0JA 5EZOL 3ZRSA 5SWZB 5ECJE 4WUUD 4HGMA 1KXQE 3BMWA 4JG5A 3V0DA 5GZNC 3CSGA 2ENSA 1B88A 5D7LB 1NCDL 5E03A 4JVPA 3QUMA 2X05A 4GS7C 1HNFA 3TN0D 3SE3C 4AZ8A 4MXQD 3O41B 1MIEH 1S8DB 1A3ZA 4WCYL 5BUGA 1U91A 3L3JA 2BOCA 3ARBB 2PYED 5FCUL 5E5MA 3QFDB 5LAXA 4FC3E 4N1CA 4Z3FA 1JV5A 1W72A 4ABWA 1S5IH 1SDDA 4V1DA 3BQUC 1MI5B 3K6DA 4ODHL 2QQKH 5EFIA 4O2FA 4CJ1A 1A9EB 4KI5F 5EEZA 2GHWB 3PYCA 4MMZB 1OE3A 2YXVA 2ZNWA 3SE4A 2LQRA 2E74C 3AWEA 3DHPA 4I13B 5GS0L 3ERXA 3IFNH 3HBGA 1DEEA 4P23A 2TRHA 2VDQH 5KSUA 3B9DA 3BQUD 3KLLA 3HMXL 2EQDA 2J4WL 1U8JA 3LNGA 2FO4A 4NDMB 4X5XA 1ZGLA 4X6CF 3MV8A 3HG1E 3MJGX 4XMLL 5LNEA 2O6DA 1R5WB 2AI0L 4O58H 1OAYH 2MCMA 3SYAA 4E41D 4XOBA 4B0MM 4AYSA 3CLEH 1AGFB 2CA4A 1MVUA 4UWQB 4Q9QH 4NOFA 2GY7B 4G8FA 4HEMA 4AQEB 1VGKB 3CFBB 1ROWA 1FFQA 3E0GA 3BLPX 5EUOE 4XOAA 4Z1PA 5MEPA 2Y2YA 3SN6N 1NZRA 1OSZA 4TN9A 4M8VA 1SLXA 1WBZB 4KZDH 3JXAA 4LSVH 1MQKL 2AJVL 4W4OC 5FM5O 5GXBB 3MOBL 3WIAA 1J1OH 4TVPH 1WZLA 3O6FB 4NNXA 1MUJA 4A55A 3CDYA 1NCWL 4XPBL 3OZ9L 4BFNA 3VWKB 4KRMB 1USZA 1J9TA 2WOYA 1FNEB 1JYWA 1B9ZA 1X7QA 3VW3H 4JFFA 1BWWA 4LQFL 1NC2B 5IHLB 4B9JA 2FL5A 1M05B 5AZ2H 4JY5H 5IW6B 2QQQA 3RGBA 4M29A 4M4RB 2V9QA 4NO2B 4U1NA 3LZQA 2NY4B 4LLAA 3PFUA 4YHNB 3R18A 1DL7H 1HSAA 4NHUB 3O9WB 4XWGH 3D12B 3V6OE 4YSAA 1KBKA 1OTSD 4YE4H 4U2YA 1L7TH 2BS71 1DVTA 5GJTH 1F6FB 3JV4B 5DDHA 3LH9A 1KUMA 4Z9KB 1VZGA 4X4XB 1XXDC 2N01B 2UXGA 4K3EH 2Y22A 4OGZA 4YVUA 1HEZB 3OB0K 4OCYL 3ZT7A 3TBVB 1FBIH 1JJUA 1RK1A 1KCLA 3MLWH 4YQXH 3T5WA 5BPPA 2K3HA 5C07E 3WOVA 3MTXA 1ADWA 2NXZC 4GG6E 5FHAH 1J11A 1N8ZB 1NGWA 3U9UA 4MZIA 4R7LA 5EU5B 5JR1H 1E8ZA 1RUPH 3EYFB 3ZU8A 3ZGHA 5E8NB 2F19H 3GIVA 2KZBA 1OK8A 3CVHH 1WGOA 1ZLWH 4PRPB 1R4XA 5H94B 1DQLL 4M8QA 1OSPH 1BV8A 4E42A 2NXZD 3FHAA 3V4UL 1U36A 2PR4H 1ZTXL 5ADOH 1X4XA 4QHNB 5FECB 3SE4C 1NOAA 3WS3B 5LGJB 3VI3E 2OAAA 4NS0A 1DBKH 1E5AA 1O7DE 2JKTM 3HHRB 4P23C 2D7QA 4UNTA 4GAYB 4JE0A 5D71H 5DJDB 4HUXB 3QWRA 3TIEB 1MCWW 5LLIC 4L3EE 4BGDA 4RIRB 4U31A 2HJFA 1OAXH 4BUHA 3RWEB 1UXLA 5KBKA 1GTNA 4Y1AA 5C8JA 2UZYB 4Y2LA 1TQSA 4J8RA 4L8DA 2E9BA 2Y06L 3IPEA 1L3NA 3LH2L 3AXIA 4KMTH 4UIMA 5FKAB 4ZFOB 5BOZG 4P23D 1JZ4A 2GC7C 2VDLB 2GABA 3GD1C 4M5ZH 2ZZUT 1EMTH 1LGVA 3ETSA 4BWUA 3M7OA 4NT6A 5EUKA 3WAKA 2H1PL 1S78C 4E5XG 1ACCA 4LCCB 5KSVB 4RRPA 5F1IA 3BP4B 5F7BA 3K2UL 3TONA 3MV8D 1EWHA 1U8CB 4FAAB 4CNIA 3UGUA 1PVHA 1IGMH 4Y5YA 4ZUSA 1E9PA 2X9ZA 1T2JA 1J88A 5FB8A 1KBVA 2YPKB 1CVSC 4JB9H 2G2NA 4BSWB 3VFUB 1KYFA 1UEYA 1R9FA 1S78D 4PJDA 1T1XA 1Q9OA 4G9FA 1MAML 4YZWA 3ROLA 3FS9A 5A2KH 4ZO9A 1P6FA 4JFHE 1OKEA 4JE4B 1X5MA 3VI4B 3OKDA 4DCQB 2Z93B 1BFVH 4WWNA 5AVRB 5KYUB 2Y7QB 4Z76B 3NRFA 1WO2A 4FQXB 4X80H 3O6KH 3KLAA 4AG4L 3CSBA 2BW5A 4NPYB 4JRLA 3S37L 1KTDA 3U1QA 3FAXA 2COQA 3HAEB 3FQWB 3HMXA 1G7PA 1E8XA 4PJHA 5DS8A 5DHYA 4E9QA 1PZAA 2WXJA 4M00A 1XD0A 5DEJA 5GS1A 3QJHA 4TUJA 4R0LA 4K3JH 4MQSB 5D5MF 3VD1A 2RALA 4FQIL 4FXKA 4JFFD 2X70B 4L1BA 5FO9A 2UXTA 3EOYG 5IMKA 3BFWA 4CVXA 5AOLA 4AM0A 5K9JL 4DAGH 2FQFA 2LU5A 2W95A 2V8LA 5IV2B 3LKOB 2YD6A 5D8JH 2BDNH 3VFTB 4JAMB 1H8NA 2FWOA 2R23B 5DVPA 4JFTA 2OI9B 2C9PA 5AZEL 3QAZB 1AHMA 1OCWL 4FNRA 3V4VB 4ONGL 5T3XH 4PS4H 4BSJA 3RWJA 2ZICA 2YD3A 4GPVA 4QYAA 5C0BA 2F7IA 3NIFB 4IRJA 3GXMA 4AWJC 3L9YA 2CBPA 3TV3H 3EFFB 3FMGH 1TQVA 4FQ1L 3X1NA 4J4PA 3OKMB 4GYBA 2FWUA 3S96B 1ZT7A 3FH7A 2YO3A 1OD9A 3MV7A 1JGVL 1XH0A 1Q9WA 3MXVH 3VXPB 4JM2B 3DTXB 2QPUA 4IBZA 5FWQA 4XN9A 5FC9A 3DPBB 3T3PB 5BO0D 2KLTA 5KS9E 4G1EB 1MCOL 2XWTB 4G7RB 3IWVA 3TS8A 5CLZA 5BXFB 2VC2L 3X13B 4A6YH 3NJHA 1GHFL 1SQ2N 4NQDE 5DHEA 4FADA 1OAUH 5DJXA 1ZLVK 3QWRD 1C5DA 3LDBC 1XX9C 3VXUE 2WVVA 1TVBA 3BSGA 1X5AA 3LEYL 1BHGA 4Y1AD 2P8PB 3GIZH 3OX8A 4JDEB 2WXKA 4OFIA 2FQDA 2ZUUA 3SBPA 5HJDA 2LLGA 3I3DA 3QRGL 4Y5YC 1AC6A 1KEMH 2AVGA 3DXAB 3OC8A 4LPYA 4X2UA 4OJCA 3DUSA 3MQIA 5C2UB 4UIKL 2E7LA 1G5GA 2EUXA 1JPEA 3FPXA 2LVCA 3EO0B 5D2NA 4Q6IA 3FTYA 5DU7A 3E1F1 3LHAA 4WK4B 4YC2C 1N64H 2X1PA 2XN9A 5DRWB 3UGEA 5I8EA 3KGTA 3MRBA 1IIIA 4W81A 1F4HA 1D5BB 2DD8H 4ZUUB 2B3RA 4N0UA 4P5TB 5HYJA 1GA2A 4NO3B 4R90H 4G9FD 4YHLH 4LVOB 4DZ8B 2P43B 4G8EA 2YGNA 4HMDA 4KO7A 3RIAF 5GS0C 5I18H 3F7YB 4KUZL 1OEZW 2J44A 1UQSA 1E27A 3RZCA 1Z32X 4K71C 2GAZB 4PVMA 5B38B 3MZGB 2VT0A 4XPGH 4M6ML 3IRPX 3P3TA 5IVXB 1W0WA 1SDYA 3QJUB 4L9LA 1M7XA 4OCLC 5GS1C 3K5RA 5EEVA 4R0LC 1KB5A 5GS0D 1A6VH 4FXKC 5I66B 5AOZA 2IWKA 3TC9A 5ISZE 3HI1B 4G70B 4G2AA 5JA9A 2VDKH 5CZVH 2KZWA 3SGDH 4XNAA 4LEXL 1CD1B 4H8WH 4XNBA 1MJ7H 1PY9A 3JWNC 5ENWA 3RQ3A 1TEFA 1KLFB 3OV6A 5IFJB 4K23L 1FLRH 2ZCHH 1OGAE 3O81A 1ETA1 2VR9A 4DKFH 2F61A 2W1NA 3B7TA 2YUWA 2WN2A 1EA9C 2WOBA 3KPPB 1R3KB 2FEJA 3LYRA 3QC5X 3P4NA 4HFUH 2DQGL 3AREB 1UM5L 3T0EA 4N2OA 1O9VA 4XVSL 4J4PC 4G7YH 5LXGH 4FQ2L 1GGBL 4R6UA 1XSJA 3BKCL 1UH2A 3T0DA 4XP1H 1P7HL 4ZXBC 3MSPA 1U8PA 5C0BD 5M94B 1J1XH 2PW1B 3DPDA 4IRJD 2AGJH 3CDZB 4OIAA 2DL2A 3MRJA 3WTTA 1LP9F 3BO8A 3MRHA 4LLDB 4J4PD 5H35A 1IJNA 1DP0A 1OCZB 4AEIL 3BDYL 2PW2B 3PF2A 3MV7D 4KTEL 4YIQA 1MQ8A 3IXAB 2G5BA 3RAJL 3P3UA 5G4MA 1QW8A 3ZKXB 1OV8A 5L4FA 2VN6A 4NZRH 2VISA 4JG0H 4YLCA 1FFRA 2BERA 2L04A 4MMYA 3IB4A 4BZ2H 3O11A 2N7AA 2VR5A 4LGSB 4MTMA 4NP4H 3VRJB 1HKLL 4MD0A 2WAQA 5TJWK 2UV3A 1CT8B 1CTNA 5IF0B 2Y72A 5F7DB 2E7LC 5GRUH 4PJBB 4JR9L 2R83A 2A99A 2JQZA 1FZMB 2ZCLH 3J7HA 4JM4L 5D2NC 2HLAB 4Q6IC 2D7NA 2DBJA 3KL0A 9PCYA 1FV1A 3EFDH 4W4NA 2BP8A 2JXMA 2CIKA 5GSVB 5FUZH 5F8RC 5JZ7C 4HLEA 4YBLC 4PRBA 4PRNB 4OJFL 4B0MB 3FU7A 1CWVA 4KMLB 3CBKB 3EH5B 1JHKL 1AQMA 1KCWA 4E0RB 2ZSVB 3BESR 4HUCA 4L4VA 3UJTL 4L18A 2Y07H 1YUHA 4OGYH 3GMOB 5EZJB 2XN9D 4RAUB 3RZCC 4XBGB 1A14L 3B7SA 1VKXB 1IE4A 2ZTBA 1TJIL 5JZ7D 1OE1A 1Z9OA 2BVOA 3RBSA 1DSWA 1A8JH 5KVFH 1ZANH 4Y4KB 4ZPTA 1DVFB 1PLBA 5HYJD 1D5IH 4L9LC 4M7ZB 3T8MA 2V3FA 4X4MA 3ELAT 2CLVB 2NX5A 3BQVA 2DJ4A 3FU3A 5IHUL 1E7VA 2FT6A 2ZUXA 4HCRH 3FFCE 3RZCD 3F3HA 2BSRA 1OB0A 2HT2C 3U36B 2WKOA 5J12C 5I1EH 3X14B 5I71C 5LB1A 4XZ4A 5EIIG 4RNRB 3ZYIA 4GIAA 5EULV 1H6TA 3VFWA 5HHMD 4V2CB 5JTWA 2WZ0A 4D94A 3E6HB 2HJKB 3MNWA 2V9UA 3VQLA 3WNOA 2W8CA 2D2OA 2CBTA 4XBEH 3WY4A 1VGEL 5GGTH 5IESH 2HT2D 1MWAH 3U9PL 2A4CA 3RY6A 4U1LB 1YJDL 3VYOA 1BMWA 4NQCA 35C8L 3PWPB 2CHNA 5EZIH 4CC4A 4I3RH 4YX2H 4OI8A 3PQYE 1T20A 4GLRI 3S3BB 1DYZA 1PLAA 1U3JA 3O41A 2ZYIA 3RTQB 3T0EC 4NRYA 3CFUA 4KTDL 2H6PB 4U6HA 4IW4C 2M83A 3UTTB 3WCYA 1M1XB 4QXGH 2HKHH 3GMNB 3ECBA 3V0EA 4PJ7A 3U0PB 1DBML 2AC0A 1MI5A 3T0ED 5JQ6H 3AQYA 3ZZ1A 4BH8A 1H8OA 4XP6L 4O51A 5E4OA 4M7JH 2ZD0A 4L8CA 1BIHA 2C1OB 5TGBB 2DV6A 3BC9A 4ODUB 3DIDA 3OJDA 5LNDA 1N6QH 1RUKH 1XMWA 3BYYA 3V9CA 3IAGC 1DBJH 1RXLA 4Q9CA 3JT0A 5PCYA 5TF1H 3SE8H 4GAGH 2GJ6B 3F65A 1I3RB 4AYDC 3H3KA 4MQ7B 2QLYA 2JI2A 4TNVF 1KIRA 1JPFA 3T4AB 1BECA 4ICXA 2JELH 5F9AC 2VQTA 4OT1H 3D08A 1C5CL 2GI0A 1AGFA 4FKEA 3FONA 5BS0E 1REIA 2JB5H 1RVFH 4RGNC 2IBZX 3BJLA 3ZTDC 4XRCB 3FF7A 2DS4A 1VFUA 4AQEA 2CKBL 5ALBH 1GZPB 5CJOL 4JO5A 5FYJD 3TBYB 3U6XA 1G4RA 2VDMH 4KUCD 1K4DA 1FNHA 5FO7A 2XBZA 3EJPA 4KHTL 1CXEA 2DJUA 4K4KA 3VM5A 3V4VL 2R0WL 1A25A 4C56B 1JXDA 4XXCA 1S3RA 4RGND 4WV1B 5LWYH 4OKDA 4RA0C 4U3CA 1WBZA 3IDMB 4NC0B 4PJXE 5AYQA 5GGRB 4RMSA 2AK4E 2OMTA 1D5ZB 3DRTB 3QORB 3FUJA 4YPGB 3JVFC 4MXVF 4J6RH 4BK4A 3VWKA 4L4VD 2HN7A 4OY9A 5DRNA 4LLUA 5I1AB 3HR5B 3NTCH 2IANE 3RIFK 2LLNA 4QLWA 4HKXA 3TEYA 2DQDH 3IJYA 1IM3B 4KO9A 4LSDA 3JWDH 1KXTB 3SEPA 4NO2A 1GGIH 4DVBB 1E8WA 4IDJL 1D6VH 3FN0H 5CLYA 2NX5D 3BZEB 1KFGA 3QSKB 4NHUA 1GW0A 3F7VB 3AQXA 2ZP9A 5ANHA 4QRPB 4M7LT 3W11C 1S7RB 5D1ZI 4B7IA 5JXEA 3RY6C 2AJSH 2NUPB 3RI5K 1BQHA 3IXTB 3A23A 3Q5YA 1QTYT 4CC4C 1AE6L 4HIJA 2NQCA 2WQVA 1F3RB 1A1MB 2DI8A 2V7HA 1RZJH 3B2VL 3QEQB 3ULVL 3QC6X 1IFHL 1SJEB 3ARBC 3W11D 2A6IB 4LMQE 4A1RA 4K73A