5AAPA

Complex of the fimh lectin with a c-linked para-biphenyl methylene alpha-d-mannoside
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
158
structure length
157
Chain Sequence
FACKTANGTAIPIGGGSANVYVNLAPVVNVGQNLVVDLSTQIFCHNDYPETITDYVTLQRGSAYGGVLSNFGTVKYSGSSYPFPTTSETPRVVYNSRTDKPWPVALYLTPVSSAGGVAIKAGSLIAVLILRQTNNYNSDDFQFVWNIYANNDVVVPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FIMH
publication title Structures of C-Mannosylated Anti-Adhesives Bound to the Type 1 Fimbrial Fimh Adhesin
pubmed doi rcsb
source organism Escherichia coli
molecule tags Cell adhesion
total genus 33
structure length 157
sequence length 158
ec nomenclature
pdb deposition date 2015-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09160 FimH_man-bind FimH, mannose binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1090 Mainly Beta Sandwich Immunoglobulin-like Fimbrial-type adhesion domain 5aapA00
5IQOA 2W07B 1UWFA 4J3OG 4AV0A 4XOEA 4LOVA 5ABZA 5F2FA 5AB1A 2UY7B 3JWNH 2JTYA 2J2ZB 5AAPA 5IQNA 4X5PA 3ZPDA 4X5QA 4CSTA 3MCYA 5FLUA 1KLFB 4AUJA 3BFWA 4AUUA 4ATTA 3ZL1A 1ZE3H 4AUYA 5JQIB 4XOAA 5AALA 4BUQA 3ME0B 4CA4A 3JWNG 3BFQG 4AV5A 4AVKA 1TR7A 2XG4B 1N12A 3BWUF 5LNGA 1PDKB 2JMRA 4XOBA 4XOCA 5FWRA 5CGBA 3RFZA 4XODA 4AVIA 3SQBB 4AVHA 4CSSA 4XO8A 5LNEA 5F3FA 1QUNB 2UY6B 4XO9A 4J3OH 5FX3A 3JWNE 1KIUB 5IQMA 4AV4A 4AVJA 2WMPB 1N0LB 4X50A 2VCOA 4X5RA 2XG5B 5FS5A 4J3OF 3ZL2A
chains in the Genus database with same CATH superfamily
4S0TD 1TSRA 4BZ1L 4JFYA 4HAKA 1RUAH 2I25N 1TEYA 3FC8A 5K59E 2J12B 4HKZA 3NFNA 3DVGB 5DFVC 1N59B 4OB5H 4ZW3A 3HB3D 3FFCE 4G8FA 4I89A 2YR3A 4I0PA 1GPOH 2ZKYA 3PQYA 1EGJH 3ZDXE 4UCFA 3RPBA 3TIEA 3VQLA 4MMXC 2BY2A 4OD3L 5DD5L 5EORH 4BCZA 5JHLH 2WWKO 3ZKQD 1X9UA 3BC9A 2MPAL 3CLWA 5GRUL 4FYQA 1K6QH 4YE4L 2FYYB 4XP9L 2AQ3A 4GUQA 4U6HB 3W2DH 1K2DB 2IPTL 4YAQA 3UTTD 4DKDC 2AZAA 3AUVA 1U93A 3SKMA 1D9KB 2PO6C 1U8OA 4HQQH 4N2CA 4WEUD 4HUNB 1ZVNA 1HZLA 3CQFA 3BP5B 3A67L 3B9KA 3DNKA 1RZIA 2DWYA 2R23A 2LABA 4GXUN 4UQ2B 2Z64C 4DFIA 3ABLB 3KLDA 4JZJB 4FZ8H 1JNNL 1QQDA 5SWSB 2YSSA 4A37A 1M7DB 5EUOA 4OLUL 2CUMA 2NY5C 4U05A 1SXCA 2BS71 1E27A 4XP6L 3V5HA 4FJYA 4EOWH 2V6HA 5DXWA 3VAEA 5JZ7C 4JQIA 2NR6C 1F56A 2Y7SA 3PU7A 3HIZA 3JV0A 5D8JL 3FUEA 3MV11 5HXMA 4Y4FA 3EHBD 1AFVH 3ZSSA 1I31A 2VLKA 4IIZA 5CCHE 4OCWH 4JB9L 2G5BA 1KJ2L 3JBG7 5KTEL 4NI3A 1H6EA 2QQKL 4HUXA 4KX9A 3NJMA 5DVKA 1VLXA 4P2OA 1KMGA 4Z7VB 1NWOA 4ZFOB 2BMKA 3MRKA 4R4ND 4LGRB 4Q89A 3VSVA 2FT6A 4N2DA 2I60L 4LDOB 4F9LA 3GHEL 1WRFA 1B88A 1HE7A 1HL9A 5EIIG 4V1DB 1U91B 3KJ6H 3MUUA 4WHDA 1MG2C 3MBWA 3MQIA 4N8PA 3EFOB 1WITA 1TJIL 4PJXE 4N86A 4P3DA 1PMYA 5ABAA 4J3WA 3MRPB 2ITDB 2AABH 5DZOA 3FT4A 3EF4A 4MRBA 3WKQA 4OAWB 2GIYA 1YEDB 5CM1A 3CFDB 2VDPL 1ZLDA 1SN5A 3CVHL 4K71C 2A0LC 1WT5C 2D3JA 2VDKL 5K1JA 3RWHA 1E5YA 5FYLL 3ZL4H 1JG9A 1N3NA 5I23A 4XAKD 4MA3B 3KWXA 4N87A 4O4YH 3FHEA 4OLYH 4KZDH 2C34A 4E9LA 1BYNA 3O6LH 1DSWA 4PMEA 4HZLB 5DEFB 3RWFB 4BH7A 4Q14A 4EF3A 4PLNC 1I9JL 4XMTA 2VWEC 4A6YB 1KFAH 4PBVC 4U1GC 1XCQB 4XXCC 5D1XD 2WPGA 2B0SH 4ZOAA 5DK3A 3S5LB 4BGDA 2PW2B 3BAWA 3B7YA 3MRLA 4TPRH 2ZUVA 5DEGB 5BRZD 4B0MB 4NBYB 3BH4A 2YA1A 4Y2NA 4G8EA 2ZNXA 3HHRB 1SHMA 3VYOA 1DZ0A 4JDEB 1T21A 1ZANH 1AYRA 4TNVK 2O5YH 2VO8A 2ENPA 5F9OL 1I9RL 1GW0A 4KY1L 2WV3A 4ATWA 5J8OA 4OZFH 5I5JA 1T04A 1T0NA 4JR9L 3W81A 1NC4B 1UWXK 3D48R 1XL4A 3D4YA 2DM4A 1QASA 2VR9A 5KSVB 3S88H 2O5ZH 5ILTL 1X5LA 3C60A 3NCCB 4KO7A 3EJUA 4ANXA 5A6LA 1N68A 4GAYA 1XFPA 5DJDB 4CSPA 3DECA 1WFMA 2PF6A 3J2PA 5JNYB 2EDWA 3CN1A 1RLBA 1XMEB 3CU1A 1HJBC 5CP3H 4HOMA 5J5EA 3PWJA 3FU0A 1NCCL 3P73A 3FB6B 1KC5H 4OSUL 1RU9L 1AXIB 3ARED 1T1XB 1KYAA 2M1KA 3UC0H 4G59C 1MCBA 5HGBB 4BDVB 1W91A 3SDXB 2DZEA 3B2VH 4MAYA 1NEUA 3IB4A 2WNXA 1JHLH 2PYEE 5I8KH 4JY6B 4PP2B 2UY6A 3HG1B 3UFIA 4EN3A 4IK6A 2YGOA 1AGBB 4Z7UB 5DJCA 3UZEA 1YA5A 3QIWC 4ZFFA 4GMTH 4LRNH 1S9YA 4OF8A 3KJ4C 2XKUA 3J27A 4WGWB 4UM9B 2E9JA 1IAKA 3HEIB 2H4EA 3K7UA 1E4WH 1T1YA 3M1BB 3TOPA 5DD0H 1OP9A 3E7JA 3L3GA 4QHPA 5IB1A 3S3SA 4D9LL 3NRQA 1FG2B 3FCTA 4H40A 3EYFA 1ZPUA 2I85A 2XTLA 2ZTBA 3TNMA 4LKCB 2GJZB 5GJSH 3PREA 1QOKA 3RTQC 5K5YA 2OTUA 2Z8SA 5I1EH 4XVJH 2DQIH 1KCSL 2OR7A 4KKBD 4UBDD 4YHPA 3SB3A 4HC1A 5I1KH 3Q43A 2D7TL 4MASA 4PTUA 3NABH 1OPGH 3S4SB 1AC6A 1Z5LA 1NGXB 2V5SA 5DMGD 4HPYL 5K9JL 1BVKB 2VDQL 1ZT4A 1F6LL 4Q7DA 4D3CH 2DRUA 4DGVH 4G9FE 4OCLC 4HYTB 2H47C 4NEHB 1YEIH 1CGVA 2CCLA 2HN7B 1U8LA 2W81C 1JPEA 2BNQB 2P8PB 4L48A 4LP4A 1FBIH 4HT1H 1K5NA 3TBWB 2BCMA 5IESH 3FAXA 3G5YB 4D9RE 4GQ9L 5EUOF 5JIIA 4PJAB 2WNWA 5ADOL 1RZGB 5CJ5A 2IC2A 3E3QE 3I9IA 1FIEA 4UQ9A 1JD7A 5K69A 1ZLSH 5KSAB 1F45A 4PJIB 2C4XA 4Q8BA 2F54B 1OGAA 1A8JH 2NXYD 5T3XD 4Z7OF 3MRIA 4MWFA 4IQHA 4IOIB 4AZ8B 1INEH 2J1ZA 5I1JL 3ZHKA 1X5JA 3UGUA 5GS2H 1VCBC 4GI6A 1L5GA 2WXNA 3AB0C 4XMLL 3SO3B 4YVUA 4OD2B 3WGUB 2XXGA 1DBKH 2X4NA 2FSDA 3FULA 1N12A 1EV2E 4B5EA 4DK5A 4M3JA 4PWFA 2NNCA 3MBEC 4W9GC 4X9BA 4D2NA 4BUHA 2LTQC 3PWVA 2G75A 4LLDA 3BDYL 2X2JA 2IDTA 1Z5YD 3VD5A 2IDSA 4YHYB 5C71A 1KELL 1FFPA 3CHSA 4G11A 3UIYA 1E4XL 5EU3B 5SWSE 3PWNA 5KYXA 1OP5H 4UTBL 2XTJC 1E9OB 1Z0NA 4O02H 2RCSH 1NIAA 4XWGL 4WU7A 1IAIL 5B21A 5K9OA 1SBSL 3P4OA 4W70A 4LLMA 4ELME 5T3XH 5IFAH 1EZVX 4XO9A 3H54A 1FFOB 4WHCA 2R0ZH 1RPQA 4X83A 3LNGA 2IH1B 3KPSB 4JO4H 3A0OA 4WTZG 5IQLA 4D9QD 3ARGC 3C5ZC 3C6LC 2KLTA 1NGWB 2XV0A 2DIJA 2ZUXA 1GGIH 3Q3GB 4R3SA 2HLAA 4WCYL 1DDHB 4NQEB 5CN3A 1SXZA 2ZXQA 3EJYC 4OUUA 2AFNA 4PB9L 4QY8A 1BAFH 1I7RA 4ORZC 4Z7VE 2YRLA 4XN5A 1J1PL 3FOLB 1PGRB 4FP8H 4NNXA 5CF3A 2VLJD 1U3YA 1WFJA 2ZAIA 4AXWA 4B9ZA 3VGDA 1RAMA 2EDMA 2JVUA 1J8HA 5IHUL 3VTMA 3N85L 3CMOL 5HI3C 1A9BA 1RURL 3MU3A 3D9AH 4UT7L 5T1KA 2WGXA 2MKLC 1RIHH 1A47A 4URKA 4YHIB 2F8OA 3D2UB 3VRLE 1MJ8L 2YC1B 5ACLA 1RZ8A 1G9ML 1HSAA 4KKLD 1XIWC 4RESB 2W9EH 3RGVD 3E6FA 1ONQB 1TPXC 3CZSA 3L7EA 2X4OA 3KGSA 1EZUA 1QP1A 3UPAA 3Q1SL 3CG8A 5IKCB 4HGMA 4KJYA 3UPRB 2XN9A 2X87A 5IHLB 3L3JB 4FQ1L 3KNBB 4AIEA 4XNQB 4X5PA 3Q05A 5ETUA 2LFEA 2FSEB 1OAJA 2FB4H 5FECA 1P4UA 1XH2A 5EIVA 1G4RA 2DL9A 1M1SA 2YIHA 4PRID 4G7VL 4H13C 3CH1A 5DHYA 4CGTA 5JPNC 4Z8FH 4YHZL 1CI3M 2G2RB 2A9CA 4KI5D 4NPYB 1ODUA 1RZ7L 3A47A 3IFOA 4R2GC 3SDYH 2GQHA 2WN3A 2XV3A 4Z3IA 2XKNB 5LB1A 1TQUA 1FIGL 1LQBC 5GS3A 4CU6A 2PXYB 1DEDA 3W9DA 1W15A 5AYQA 2O26U 1ID2A 5DC2A 1T6BX 2PABA 3ZZSA 2JJTC 2B5IC 5JOFA 1EJOH 2MPVA 5I6KA 1O6SA 2L8AA 3ULAB 1B9KA 2WBJA 3QA3A 4WENB 3ZTNH 4RFNB 5J7CC 3QDMB 3S8FB 2VE6B 1TU2B 2ADGA 3SJVD 3BH9B 2KZWA 4UINL 4P23C 3RIFF 2ZKWA 5AVRB 2ZPKH 1Q8MA 2O61B 4M93B 1N10A 1MW0A 3X14A 4QR7A 5KSUB 3LNHA 1HAWA 1C16B 1UB5A 3EOBA 1J8KA 3GKWH 4L1SA 3UEQA 1VENA 1BBJB 1Z9NA 4R4FH 2UZPA 1JERA 2C9XA 4GAGL 4AC2A 2VL5A 5JA8B 1QUNB 4AYSA 3QIUC 5DHVA 3BCFA 3D4CA 4HWEL 3SE6A 5IUSA 3WTWA 1FNGA 4PWEA 4YBLB 1KFGA 3JWNE 3MTRA 4DOHB 3PHOA 3RDJA 4EDWH 4F7PB 1REIA 3SDXE 4B27A 1JXJA 1AQ8A 4Z0BL 4OTXH 4UZUA 3ZTJH 2QHRH 4RNRA 5B39G 3MREB 4P4KD 4OGXL 2BSED 4X6BB 3HG1E 2H2SC 2F1AA 3TZVB 3WHXB 4AGLA 1L9SA 4A7UA 1CGSH 3VG9B 4N2MA 3ZZ1A 1MJ7H 4J3OF 1QR1A 3SD5A 5BRPA 3U1QA 1NMCC 3N43F 1ESOA 3LN5B 4WTWA 5HHMD 3WNJA 2XXCB 3RNQA 4RBPK 2WB7A 4S2SB 4I48A 3UGEA 1A1MB 2IPUK 4G6AD 3MNDA 1FL5A 5LXGH 4QXGL 3QJTB 2Y24A 4U6XA 4F15B 2XJKA 4LEXH 3HC3L 3U4KA 3TYGH 4JM2F 1XCTB 3T2QA 5I6MA 4LOUD 1NCDH 1VIWA 3Q0HA 4IRJC 5JORB 3SY6A 3QK0A 4H2CA 4JANB 4N2FA 5EOTA 5ID1B 3MRNA 2AEPL 2WSDA 2YPVH 4F7CA 2JCCA 1G5AA 5IG7A 4JRYD 5FYKL 5AVWB 2DY2A 3VFGL 1BOGA 1RKRA 3D09A 4ZUVA 1RHHB 4R4BA 4B3VA 1CR9H 4NHUB 1ZV9A 4RZKA 2HA1A 5F9WB 2BNUB 5BZDB 2X40A 4NJ9H 4MD4B 5KVFH 4L3EA 3B3IA 5E2TL 2BNQE 1FWXA 4ZXBD 3A6BH 2HG0A 3CDGB 1TYEB 1A4AA 2R7EB 3GJFH 2D3NA 3DDFA 5IROA 5CHNB 1CT8A 4MTMA 4NQCB 5D1ZI 3UBHA 1BPLB 5ABDE 1RJCA 4Y19D 4BEIA 2K7PA 4GRMB 4GBXC 2B4CL 4PQXA 3U0TB 3UO8B 1JYNA 4BBWA 2VN6A 4PJIE 3RAJL 2APSA 4I5BB 5DZLA 1JV5A 1NOLA 3ULVE 2DD8L 4LNVA 4XVTL 1EDQA 2NSMA 2KZBA 2CDGA 4OBSA 2HRGA 1ZMYA 4L37A 1LO4H 1OY3B 3ZN6A 4XODA 1MFBL 2DQFB 1SOSA 3NSDA 4G80A 1RUMH 1OTUD 1AP2A 4NB7A 4ZMQA 4UOW0 1QSEB 5DVLA 1LNUB 4MCMA 1IM9B 3UABA 2YKKA 4HUWB 2XFXA 1D6EB 1S7XA 3AITA 5CD5C 2W0PA 1YYMH 1KLUA 2V33A 4NO5A 2Q7YB 1QWHA 3X12B 2Z31A 5FYJU 3BVXA 1K8DB 2BLFA 3SE4A 4A2GA 2CLRA 3UTSA 2GC7C 2NLJA 4KVCH 1N6QL 3DETC 4PSRA 1KIRA 3LH2H 2BVUA 1BLNA 3MYJB 1HEZA 1U4EA 2R0WL 2R1WA 3AVEA 3CXDL 1TQBC 2N0MA 3NK4A 4JPVH 1PY9A 5H2BA 3IGUA 2HVKA 5DRXB 4MD0B 3QT2A 4XRCB 5AVVB 3ESOA 5B4MC 5KVGL 1HIML 1QSFD 5EIQA 2CRIA 4A1RA 1R3KB 4X5WB 1MJUL 2EH8L 4RAUB 4AMKL 1AXSA 2WLIB 2X2UA 5CFHA 2P5WE 3H55A 3JVGA 2XIIA 3SOBH 4NQEE 3UG4A 4BRVA 4C56E 4F7EB 1PYWA 4H2AA 4KQ0A 5DHEA 3CDYA 4LLQA 3RIAF 4QHMA 4ES8A 5F0PB 4LO9A 3MV9B 1JF6A 4F8QA 4DUVA 4MS8D 2HH0H 2BSSB 4X7TB 1RL1A 4X7CC 1FZJA 1GZQA 1SXNA 1CE1H 1X5HA 3O0LA 1Z0MA 2XWBA 4CBPA 2X4PB 1V7NH 3BGFC 3K5RA 4GP4B 3STLA 4OI8A 4ZFGL 4Q2ZA 3QEQA 1LILA 1DCLA 1P7QD 4G5ZH 2R4SH 1MW2A 4WIQA 3F7LA 5E8OA 2HJKB 2QZ5A 1VACA 2ZSWB 1OB0A 3OJDB 3IS1X 3T0BA 4R0LA 4FNPA 3PXHA 4H4NA 5DJZA 2HKHH 2R56H 4LARL 1XCWA 3RVUD 5H4ZA 1LO3L 4QD2E 3UBGA 2ZCZA 5FW8A 5IW6A 4OV6F 3CLEH 5IOKA 4NRYB 2YPKA 5CU9A 1T2JA 4R7VA 3MOBL 2V7HA 3C2AL 3Q13A 2QZQA 4ZUSB 2I07B 5CZVL 2F53D 5KANG 1FGNH 3KYMB 1AQMA 4OLWH 4LCUB 3K8LA 1MVUA 4L29A 1J10A 3FSOA 4OD1L 4NZUL 5ES4B 2WLKA 4HIXH 2QQLH 2HFGL 4DESA 5G2NA 5MI0C 5ESQA 1T03L 1ZIAA 4MNQB 1OAZH 2J1KA 3TA3D 1MCDA 4QJ5B 1EQWA 3MX0A 2VXQH 3QC6X 4PRBA 1PCXA 3Q6FA 4QTIL 1S78C 4WO4A 2G30A 2WQVA 4GT0A 3ULUF 1ETA1 1WZKA 2OMTA 2R2EB 3BLPX 2P24A 2H1XA 1YPZA 3SPHA 4K7FB 4S1DC 4YOKA 2MCG1 3OL2A 2PWHA 3MCLL 5EUKB 4QHUA 5CSZA 5TTRA 4DFHA 4K3EH 4TVPH 4Y9BA 3GB7A 3OAZH 5EWIH 3LXBA 3TU6A 1F42A 1PEWA 1QTSA 3AWFA 2VZUA 3TVMD 2DLFL 4A68A 5IW1B 2ESVA 3PWPB 1PIGA 4FXGB 4M7KH 4K9EC 4TLTA 1FAIH 4N2NA 2HAZA 1MCKA 4HPOH 2B59A 4X2UA 3I85A 4WTXA 2YARA 2CM6A 3DMMD 1JHTB 1AGEB 1NBVH 2WKOA 2VGLM 4TQEL 3P3YA 4XX1E 5FHBL 1Z9SA 4AKQA 2VO5A 1BDYA 5I8EA 1LDSA 2EDLA 3E9UA 1H9DA 2Y0SA 2NY4B 1GS6X 3QUMA 3QH3B 3IETB 1FNHA 5E6IC 1KT2A 5J12C 1FP5A 5FFGA 1A3QA 4PVNA 1QFWI 4X8JB 3RVTC 5KG9A 1D7FA 1ZJAA 3WGVB 1I8LC 4G8GB 4J3BA 1Q9WA 3SODB 3KYAA 3EH1A 3MLPA 3W11C 1KV7A 4G43B 4OFQA 3WFZA 1A6ZA 12E8H 1I3GL 4WWID 1Q0EA 4X99B 1IBBA 4DPAX 3S34H 3VE0B 3P02A 5F6IB 2XIDA 4AEHL 2AJZB 3DDGA 3F84A 3CN0A 5IQNA 4WI6A 1HHJB 1VEMA 2F58L 3MLRL 1AI1L 2XYBA 4NN6B 2XQYA 1T22B 4ZUWB 2XY1A 1WJ3A 4P5MA 5GRJL 1UFGA 3QZWB 1SLWA 4NKDA 5CJQH 2BNRA 3K72A 3MRCA 2Y5TA 1EO7A 4AYEC 5AVSB 3V0EA 1J5HA 5I71B 1T1WA 3RJQB 3OAUL 1HHIB 3MODH 1QFWM 1CD8A 3QDJD 3HMWL 3QI9A 2EDEA 3LIZA 3LXCA 3DK0A 2ZOKB 4NO2A 4FFZA 5F1IA 1IQDA 5ANHA 25C8H 1CLYL 2IAMC 3K3QA 4XTRD 4A39A 2EIEA 4AENB 2KI6A 4PWKA 1T2QH 4TUOA 5JW5B 5FO8B 5HHXL 4IBQA 4K8RD 4Y16D 1COBA 4KUCD 4RX4D 1EAJA 1GS8A 4EUPA 1UWGL 2PTTB 4ZMYA 3W0WB 2Z35A 2AK4B 2X10A 5BJTB 3DWTA 2VMCA 3CC5A 4XP4L 2UXGA 4JFQA 5E1AA 1SYSA 4TUKL 4WWKA 4IDLA 4A63A 1UQSB 4IU2A 4LCWD 4U6YB 3X11B 3SDDD 4X0NA 1H5BC 4BZ1A 1BMGA 2IQAA 3T5WA 1I9IH 2WQSA 2LAAA 3WEXA 2EDTA 4HKJB 3VXOB 1EH9A 4FQ2L 2F8IA 4JPSA 3VFTA 4JFFD 1CYWA 3MLTB 3QUXC 1YYLH 4G3YH 2BFVH 1BYPA 3NH7H 3WY3A 1HHKB 3QISA 4LASH 3JSSA 3C8KA 2EAEA 3BEWB 3OD3A 4Z7QF 3OKKB 4NAQA 4GRLA 4DPCX 1QSEE 3GD1C 4QO1B 3JTSB 4QOKA 5HHPB 4FQJL 4GW1A 1PG7W 5F1NA 2BOCA 2DJSA 1G7JA 3IKKA 1YVLA 4Y5VB 3T2PA 2K4AA 4AEEA 2N59A 1C1EL 3CK0H 4IRZL 1IIIA 3VRIA 4F2FA 2PPFA 2WHVA 1F6AA 4UAOB 4KWUA 5EDSA 2DYRB 1CD9B 4HJ0D 1UEYA 3FU3A 3S5LG 2IWFA 4GEIA 1S7TA 1T1ZB 1SXSA 1QPKA 3KPQA 2E6QA 4MQXD 5D7KE 5IK3B 4LVNB 5HGHB 3S35L 1RJLB 4YSEA 1CFQB 1WAPA 1HILA 4LOVA 5C0RH 1QAWA 1F3RB 1WEJL 1ZHLB 1S7SB 1TZ8A 2TSAA 4YDKH 3TV3H 5LKNA 2GT9B 3KCPB 4M61B 3IVKA 4JZOB 4L1LA 3K4AA 1BVOA 3APNA 5JHMA 1PLAA 2OZ4L 5MEQA 5DO8A 3UZVA 2AV7A 4JN2A 2BJML 3T6ZA 1WAAE 3F6LA 4UUJB 4Y2LA 2X09A 1HSBB 1AKJA 3PJNA 4LCYB 4N5EC 4K23H 3ABMB 5D4IA 4IGBD 4RWHA 1NDTA 4OZ4B 2IH3B 5L2KE 5CR1A 1QRNB 4X5XA 3AXLB 3VWKD 5HJ3B 4YXKL 2YJLA 1OSYA 4E42A 3WS6A 4JQXA 3AWGA 3ARFC 3QG6A 3EYSL 2A73B 3BT0A 3QHTC 1D2OA 3JWNG 2NZ9D 2HFFB 4PRPE 4PJ9A 3K2MC 1ZS2A 3NCYS 3S37H 1BM3L 3EO0B 5I1AA 4J28A 2XETA 1UXWB 1G9HA 3U46B 2CU9A 3IPEA 4K5MA 5LNGA 2FJFA 4BCXA 4ZD3H 1U8NA 5GSRB 3GUTB 3PHQB 1FL6B 1U8JB 15C8H 3NCBB 4KK5C 3IPBA 3THML 5AD0B 3H9SA 4NCDA 3IF1A 1HESA 1YDPA 1XR9A 2WKOF 3V2AR 5F3BB 2F74A 3CVHA 2IV8A 4HS3A 1UD3A 3MJWA 1KXTA 1UJ3B 2VDNL 5EZPA 2CM5A 4ZODA 4MNQE 3IN2A 5IMLB 5EEZA 1IJ9A 3V55A 3MCKA 2PPCA 3NFPA 4I1PA 1LMIA 2B08A 3L4UA 1KZQA 2A5UA 1EERB 4RAVA 3TJEL 2WXGA 5HDWA 2E8YA 3ESUF 4QUOA 3VXSA 4HCFA 1K4CA 3VI3F 3L6FB 1I7TB 1G4MA 3FO0H 1MHCB 2GIXA 2WXOA 1H19A 2OJ1A 4NGHL 2F5AH 1BQHB 4JCMA 1WA1X 1E67A 1GJWA 2IH9A 2LVEA 4LAQL 3LQMA 3DOIA 3IFNL 5I15H 4U31A 1H15B 4RSYA 5EU6B 4F1SA 4PN6A 3PWPE 5C7XH 2LQRA 5LGJA 3VSTA 3OB8A 1R5IB 3AM8C 3GSQB 4U2ZA 3L5WA 5AOKA 4KKZA 5EN2B 5I26A 3LHPH 2CRYA 2ZSVA 1XX9C 3KYKH 3ZOAA 3S6CA 1M7IB 1YAZA 1A7RL 3V0IA 4Y1TA 3VGAB 4MJIA 3U7WL 1P1ZA 1NMAL 3X3GH 3BUBA 4PVLA 2WZ5A 4GUPB 1MUJA 4JJHA 2YUXA 4TSAH 2VDRL 4FQQB 4MB3A 1TZHB 4MMYA 1ZWIA 5FO7B 3RJOA 2BWQA 3OKOA 1V8HA 3OX8B 3WD5H 4EMZA 1YZZA 3CVIL 1DUZA 3VXNA 4G8GE 4PJ5B 2YBRB 1MFMA 4PUBL 1CLCA 4V1DD 1JPTH 3F6IA 3MLVH 2W0FA 1F6FB 2F7OA 3HZMB 3MJGX 4JFVA 4XMWA 4YZFE 5DS1A 4IM8A 5AWNL 4GFXA 5L0QC 5IM7B 3D85A 3O0RL 4ZOCA 1SLVA 3NSJA 1E4KA 4NSKB 1AIFA 1XDTT 1JD9A 1CO1A 3BO8B 4FMFA 5E8PA 2XPYA 3ILDA 1J5CA 3TBTB 3FT2A 1KBWA 4KHTL 5TJWK 4Y5YA 2VXTL 4L4TA 2ZONA 1S9WA 5GS1B 3SCMC 1EUTA 2EIBA 3O2VL 2EINB 2J5LC 3HI1A 3BT2H 2XG4A 3NA4A 2NTFA 2BZDA 1J5IA 2EDHA 3L45A 2VAAA 4PY7B 4YHML 3HC0A 4U1IB 5F89A 2ITCA 2WBKA 3LS5L 1A4KB 2N7SA 4L8CB 4N8UA 2FL5B 1WV7T 3ABKB 1W80A 2FO4A 1B4TA 2WANA 5HDQH 3HE6B 1YHPA 3PP4H 4IRSC 3WUZA 3V4PH 1P2CB 3BLBA 3BWUC 3MSPA 9CGTA 3W0WE 3IGAB 3HR6A 1LE5B 5BOPA 4UQCA 2AK4E 3FT3A 2Y5QA 3EGSA 2UXVA 3B9EA 2DQMA 3HRZA 1ZV2A 1L6XA 3U9PL 3FCBA 5JR1H 1F41A 2XWEA 5D7IF 5DJAA 3C5SB 3LN4B 3BE1L 4DN3H 3KR3L 2ZWNA 1AMXA 1NC4D 4Y4HB 1TZAA 2FHBA 1MCQA 4G6ML 3GSOA 3QIBB 2NQDA 3FO1A 2OSXA 3ZRCC 1AR1D 4JG0H 1OKEA 1JYXA 4J5VA 1WFIA 3O6FC 4XO4A 1R4XA 3D39A 1MIEH 3TONA 1YY9D 4PYHA 4FABH 4XP5H 2JFCA 2VJ0A 3OKNA 4ZPVA 4W4OA 1N8OE 1BBDH 3TNNA 5BV7C 4Q6IA 1BZ7A 1MLBB 2E8ZA 5T1DL 4LAJH 2I9LA 4W9ZA 2ATPA 1JFQL 4JFYB 4N3TA 4V2CB 3T0EC 3BP7B 3CHOA 3W38A 3O8XA 2L7JA 4HKZB 1D5RA 2B1AL 3AQYA 4DP6X 1DJYA 4OFKA 5JHDB 4HOWA 1E4XI 3GO1L 4L0YA 3IEAA 2QT6A 3I6LE 5I16B 3L4VA 1IAII 1EFXB 1IT9L 1YJDL 5KVEE 4BA8A 1A3RL 2Y06L 4N0YH 1MLCB 4OCXL 3UYRL 3S36L 2EDRA 5KVFE 3C09B 3RUGE 3HI6H 5GZNC 1LO5A 2ICEB 3HS0A 3V7MA 1E5UI 2DQTL 1NCOA 2Q1EA 4NYLA 1Q9OB 4Z0XB 5JPMC 1U8OB 3D06A 1SF5A 3HBQA 1JS4A 2BIHA 3TBBA 2L4OA 4UTBA 4ZNCD 2DL2A 2YA2A 4I3RH 4CU7A 1P9MC 1ASQA 5KOMC 3O2DA 1ZGLA 1BZEA 1RZIB 2R15A 1FZMA 2AEWA 2NQ3A 3X1GA 5HYEA 3PAVA 4X9YA 3VFRA 1C8PA 1QQDB 1AGDA 1RZJC 5EUOB 2XWXA 1KDIA 1IAIM 4FTVB 2EUZA 1IC7H 1DBBH 1QRNE 2LU4A 1E27B 1EO8L 2Z4QB 4YGAB 4HCGA 3VD4A 4GY4A 4HU2A 3GIZH 2ODIA 1OD9A 1O9VA 2X38A 4QRUA 1RQ5A 3GSRA 3ILPA 3JWOL 5FGBA 1DVTA 3GPSA 2YAFA 3IAQA 2VLKB 4Y4FB 4XN4A 1OW0C 4FG6C 5GGRY 2JELH 4G6JH 4ODXA 5F0MB 3B5HA 4Z7OB 1P1VA 3BAEH 1G6VK 3NIGE 1BREA 4CSSA 3PL6C 4JW3A 1PJ9A 3G5WA 1TQWA 2F19H 4Q52A 3ARBD 3ZRSA 4DKEL 3MLYH 3NPSB 2IEPA 2BMKB 3MRKB 3PAYA 4N9GA 4J39A 3LMJH 4KTDL 4O58H 5L88H 1XTLA 1B4LA 3NA9L 3NOIA 4FFYH 4JKPL 3QCUL 2DMBA 5FUCE 3RL1A 4B95C 2F54D 4K55A 4YHOH 3ORJA 43CAA 1XF4A 4MA8L 3MBWB 5C0CA 2WW8A 4P9HH 3F7VA 5AW8B 4PS4L 4ZMNA 3D69A 3QIWA 5E0FA 4LDEB 5C0DB 5I6XC 4PJGA 3IJ8A 1TQCB 1M2VA 2YUWA 3FT4B 1CLVA 1D5IL 3OHXC 4MCYA 5HHQA 1D2PA 2E7LC 3ARWA 4FXKA 3LNFA 2PP9A 5HDOA 3N2JA 2J55A 1DEEB 3IDXL 4NO0D 2F1EA 5MENB 4QNPF 4G82A 2OL3L 3ARDA 3QXVA 5TGBA 1N3NB 3BW9A 3HE7C 2OA9A 4KV5F 3VGGA 1OT1A 2Y6SD 1RHFA 2YAPA 3R7QA 3FPXA 4QXWA 4UDTA 4BH7B 5C0JA 4N8VA 2XC8A 1NAMA 3RTQA 3GSNH 1VFMA 1UENA 5EU6E 1NLBH 4WW1A 1ACXA 2E56A 1NFAA 4W6XB 3S7GA 3AROA 4FQXC 1DVZA 4KJWD 3REVA 4BJLA 4YNYA 2JJSA 4ZUTA 1GYAA 3CSPA 3H56A 3KPSD 3MRLB 2EE3A 4BSVA 5FV1L 2VN4A 1P7BA 1RP8A 2WUCL 4G8EB 2A9NL 2AXFB 2BP0B 3VUAA 1MHHA 2F5BH 1T21B 2JCWA 1S2EA 1X6LA 2HMIC 1J87A 4PCKA 3QRLA 2OK0L 4UT6L 4J3TA 5JQ6H 4ETQA 3MKGA 4ZTPH 2R1XA 4JO2H 3MGTA 1T0NB 3RZCA 1KULA 4PJ5E 3WE6B 1KJMA 3WJLC 4A55A 1XZ0A 4ECNA 1KCWA 3GXPA 3II1A 1AO7A 3MA9H 2A9DA 2WXJA 4UIMB 3C2SA 3DYOA 4GG6A 1ANUA 2YEQA 4AEFA 4TVUA 3S2AA 3HN8A 4JDZA 1YMHA 3CBJB 2AJYL 1LEGB 1I3VA 4EDXA 2E4TA 4GAYB 3RX8A 1TETL 2X7LA 5AW1B 1CXLA 1DR9A 1M4KA 2CBTA 2HYMA 3FL7A 1S7UA 2BWIA 4ZTEA 3LPFA 3P73B 1QLFA 4TVPE 1Q9KA 2EE9A 2WLYA 2X89A 4PWJA 2ZCLL 2GJ6A 2YRPA 3NVQA 3VX1A 4AQ1A 1VSCA 4RGNB 1KPVA 2F0CA 1NSNH 2UY6B 3QHZH 4OQ1A 4K3JH 4EN3B 3KM1A 1T83A 2AQSA 5DJCB 1NL0H 3GI8H 5IVXA 5BVJB 4JFDE 4KFZC 3GI9L 2HLEB 1MVYA 1ITCA 1UATA 5C09E 3HG2A 4WFGD 4LPWA 5LG6A 5PCYA 4DUWA 2PXYD 2J5WA 4H26A 1CC3A 4U1KA 3RKDD 1J88A 1NANH 1T1YB 3L3GB 5CBEA 2FH6A 3FCTB 2MMXA 3EYFB 4XVSL 2Y9RT 3GZOA 3P4MA 2A6IB 3TNMB 1T2XA 3MNVA 4CNIA 2H3KA 1IIKA 2YD5A 3QDMD 1AHMA 5D1QB 2YGPA 1Y7VA 1GMIA 1NBYA 2EEBA 3LY6A 4XZ4A 1DUYA 1M3JA 1HKLH 3OR7A 3TIDA 3IMRA 4E2OA 2DQCL 4A7GA 4PTUB 4XNXL 4RWYL 4FADA 1Z5LB 2AEQL 2ZYHA 3NP3A 5T1LB 1HNYA 1ZT4B 2XXFA 3G08A 5AKTA 3B56A 2HG5A 4HUCA 1DLFL 2XV2A 4L5FH 4NRXA 2AI0H 2Y23A 3LZPA 3IE4A 1U8LB 4MMZC 1XIWA 5D6DA 3N44F 1K5NB 3MRRB 1T7XA 2CLVA 5I73C 5JHDE 1WC7B 4YIQA 6FABL 1MCHA 2KYIA 3N43B 1MF2L 3E8VA 4IDJL 2CR6A 3L9EA 1BFTA 1KB5L 2UYLA 3NQIA 1A1OA 2X70A 3DIFB 1BIIA 4B9YA 1FGVH 3K0YA 1B4RA 2ZX5A 4TNEA 4WUUA 4A7QA 4WI3A 1JE6A 1WBXA 2H32B 4JM2B 3HR5A 2AV1A 5T5NG 3UO1H 1UC6A 3GMRA 1UKQA 2GTWB 1RUKL 3VDAA 3WNLA 1XXDC 5BQ7A 4I9XA 4R90L 4LVOC 3V4PB 2A7BA 1AYOA 1H3UA 1VFBA 2X4SB 5DWPA 2BSBA 3LAFA 3GZKA 1A2YA 1RPUA 4OJFH 1XMWA 4OQTH 4PREA 4PBXA 3AG2B 3MN8A 3PWVB 2F61A 4LLDB 3CLFL 1GGCH 3V6OC 3QQDB 3B5GA 1DQQA 2JJTA 4RFOH 4XOCA 4LIQH 5IFHL 1EZLA 1UZ6E 1AR2A 4BK8A 3CDZA 1NOFA 4ILDA 1XD0A 4PJGF 4OLXH 5A7EA 5EUOE 4FTVE 3G3LA 2VABA 4YDLC 2MOQA 4FNLH 4DPRA 5K9OB 2Z8RA 1W6LA 5D93B 4PU2A 3PGDB 4NHCL 1ZIBA 3GRWL 2Y7QA 3LH9A 1ODAA 5AW2B 3D4GA 2VLKE 2C3HA 2WVVA 3Q44A 4XN8A 1MXGA 4XI5D 1KB3A 3LKQA 3MLWH 5KYUA 4Z7OE 4LLYA 2L7EA 2IFFH 4ZFOL 5J1SC 1MREH 3LEYL 5C0EA 4R3SB 2HLAB 3SKUD 1N2RA 2WQWA 3Q8EA 5TFSL 5IHBA 2OMVA 1TVDA 4QY8B 3LRMA 3MLXH 2RA1A 4NQCD 1U4FA 4PWGA 4A66A 3OKLA 1MCWM 1WP6A 2FD6H 3PDDA 4NNXB 4FC3E 4ODWA 1QW9A 5IGXH 5D72L 4AXWB 5D6CA 4WI5A 1GY1A 5A6MA 3DXAA 1G7HA 1A9BB 2XWRA 5T1KB 4LQ1A 3WKMH 4X7FC 2BSRB 4MVBC 3V0FA 4N2KA 4IJ3C 3MR9A 1HSAB 4HX1A 2AMUA 4E9WA 2OJZL 1RJYB 5F9JA 3E6FB 5F2FA 4QKTA 3QZWG 4CVXA 3L7EB 1OLLA 2E46A 3AGVA 2NY2C 2FZ3A 1BGXH 4BFIA 5MENE 1IM9D 1EHXA 4KJYB 1NCWH 4WJG3 2XN9B 3FT1A 4A6YL 4GG6F 1N4XH 3SE3C 4IRJA 5BZXA 1R3LB 4O2CB 4Q0XL 4U1NA 5CLXA 4UILH 2EZ0D 5IMKB 1VAHA 5CXPA 3V52L 5FECB 3QJQB 4K4KA 3ENEA 4ZNEA 3KL5A 4R8WL 1WQVT 2XZQH 4DPBX 2NYKA 2AJUL 5DHYB 2R0LH 1CG9B 1LWRA 2JE8A 3G9AB 3T1FA 2MEJB 3WN6A 3C5JB 2EIKB 5I19H 3IFOB 1KEGH 2X5PA 2N4IA 7TAAA 5JOPE 4PRNA 3TN0A 5FK9A 3RDTD 4WW2A 1TJHL 1UYWH 3CHPA 2X53A 4EI5D 4HA1A 1GC1C 2IANB 3CFCL 1O6SB 4OFVA 5KOVC 4AK2A 3QA3B 1R6VA 1M7UA 5IVXF 3MV9D 3POCA 4HGKC 1CMOA 4NKMA 1EHNA 4GBXA 4ONGH 4TL4A 4NNYB 3VXTB 4HF5L 4AG4L 5A40E 3MI6A 3WKPA 2FX8L 3WDIA 5I0WA 3U2SB 1BECA 4WV1C 1O9WA 3AY4A 3EOBB 3S0PA 7FABH 4NKOA 2ZKHL 3N91A 2AHIA 1FLTX 4L4JA 2JJVA 5IT2L 3N40P 1SY6H 4MQ7A 5EEVA 3GYRA 2VL5B 2VM3A 4AMWA 4BXSV 3US0A 5B38B 3CAFA 3BN3B 1K5WA 3CZEA 1KCRH 3N1PC 2AP2A 4F8TA 5DYFA 2J6EA 4JJOA 4GI9A 3PHOB 3HB3C 2BFGA 2V9UA 3O11A 3QSKB 1JK8B 4OFYA 4R5XA 4XMVA 4A7GF 5I0VA 3NJHA 3EDDA 4JFEB 2VERA 2H1LM 1QR4A 2QPUA 5TF1L 4MNHA 1BV8A 4OI9A 2X44D 4J4PD 2WQRA 1H3PL 2V9RA 3HPLA 3C08H 4HJGA 4OCSL 1H6FA 1OARL 1E2WA 1L7IH 4NQUA 1OSPL 4DCQA 3VQ2C 1QR1B 1PQZB 4E36A 2VMDA 3C87A 3WO3B 2VQ1A 2AF2A 1UJTA 1JCKA 5D5ME 5F71A 4I9WE 4Q4EA 3RNQB 3KXFA 2CWRA 4I48B 1S3RA 5K39A 1OOAA 1NUNB 2GAZA 4DKAA 3NGBB 5EFIA 3QNYA 1L9RA 3FONA 3T08A 2UY7B 2WIIA 5D1QE 5EOTB 1JPST 2MWCA 3MRNB 1RK1B 2Q0ZX 4MA7H 2GBVA 5SX5H 4ANUA 1TYJA 1E3XA 1N5AB 2C1OA 3GLAA 1FO0H 3NAAH 4P46D 4ZUVB 2ERJC 1N19A 4R4BB 5F8QC 2LV4A 3SGKC 1MHEA 5CMAA 5ITBL 4WGKA 2AEOA 2FT7A 3Q2WA 1MI5A 2COQA 5CEZH 4L3EB 3B3IB 1Z3GL 3BPNC 3KYOA 1CFTB 3EHBC 4XC1H 2MH4A 3T71A 1IC5H 3D18B 3W9EB 4F37F 3DX4A 5BMFH 3FUHA 3RI5F 3ZXAC 3TCXA 4Y8AA 5C0FB 1F00I 3I2CH 5DUBB 3RX5A 3FN0L 3VACA 2WUBL 1D5MA 2N1TE 3EJSA 4JPKL 1DLHA 3FTGA 2NY1C 4Y2DB 1RZKL 1WZAA 3ULVL 2CJSA 4UYQA 4F8NA 4R4NC 1KPRA 1TZGL 2RQEA 4YPGA 4AH2B 1UA6H 3AS1A 4IYKA 4MAZA 1AY1H 1OZUA 1JV5B 4N90D 3D07A 4BKLB 5EU4A 1FG9C 2CDGB 1KN2H 4C54A 4L37B 1PFCA 2W5PA 4IRZA 5EF1A 3F7KA 1YNKH 2CGRL 4G80B 1KYUA 2IGLA 3F7QA 1NCAH 4ODTH 1BZ8A 5CIPA 4IOSD 4LK4A 3F58H 4HP5A 3W82A 1U3HB 4J2XA 2CO6B 3WN5C 3T4AA 1BQHG 2BHZA 5C0GA 4FZEL 3BX7C 2UWEF 4QAWA 1KLUB 2ENJA 2HSIA 2Y07H 4K15A 4G8AC 2Z31B 3L1OL 4BUGA 3M7FB 2C9QA 3T9WA 3N1MC 2P45B 5JO5B 1NPJA 1QHPA 2CLRB 3VI4A 5I1CH 3PLYA 1CQKA 4ODSH 2NLJB 2LW3A 3FNKA 3LZRA 3PJSB 3U6XA 1OGPA 1HVXA 1HDMB 1VADB 1ZAGA 1KIRB 1XGQB 5LO7A 5TDPB 2N01B 1LGVA 3N9GL 2Z7UA 2R1WB 4D0CA 5CJ8A 5D1XC 1L9OA 2OZ4A 2GB2A 5FCUL 4GKLA 2A74C 1JPGA 3HG4A 5DVMA 1GPOL 4Q9RH 5ISZB 2Y1YA 5E2VL 4IW4C 4GOSA 4OLVH 3WIHH 3BSZL 2LU7A 3L9YA 3RVWD 5JHLL 2FIRT 1AXSB 3E38A 3NEOA 1G87A 3IDGB 1K6QL 1PYWB 3U30B 3KLQA 4LLQB 2AJ3A 4MDJA 4QHMB 2J21A 3RY4A 2RGSA 3LEVH 3ZK0A 4XOEA 3ZQ9A 3FB5B 4PGEB 1HHHA 2VLLA 4Z7QB 4ODUA 1FZJB 4WF7A 2WLNA 1GZQB 2NY3D 2KMWA 4HIEB 3PWUA 4GLRH 4Y88A 1T4KA 1CB4A 3HAEH 3QG7H 4YGVB 1OIOA 4AGPA 4X4ME 1FNEA 3G6DH 2KLRA 1VPOL 3LZFL 5D2NA 1I1FA 2G3XA 2V5YA 3BJ91 1J48A 4PAZA 4ERSL 2G0KA 2XDHA 5E8OB 5TE6H 4D8PB 3S5YA 5F7EL 1VACB 4FZ8L 5DCCA 4DAGH 3K8KA 1CVSC 3GK8L 4B5ZA 4R0LB 2DWDA 3D05A 3N1QC 3EH5B 4HLJA 5DJZB 2PO6D 3WL9A 4FG2A 4ZT1A 3TJPA 1BHGA 1EEZA 3L1EA 4U3CA 5IW6B 3AREC 1F4WL 2BRRH 1KBGL 4M1CD 4ZAKC 4YHNB 3ARVA 2V7HB 3K2UL 4IHOA 4ADIA 1IKFH 4XP1H 1AFVL 2BSTA 4ELKA 4TLKA 2OMBA 4OCWL 4B96A 5B3NA 4JHAH 1G7LA 3JV5A 1ORSA 1MVUB 1CK0H 4L29B 4Y9CA 5I8OL 1ED3B 2H3XC 1G0YR 3D0VB 1IQWL 4XC3H 2IAMA 2CUIA 5ESQB 4HLEA 1CZ8L 1L6ZA 2E9BA 1N8ZA 4PRBB 3Q6FB 2NR6D 4M7ZB 3LVTA 4WO4B 5H37A 3ML8A 1LDPH 2EDOA 4AT6B 2IANE 3KJ6L 5CSBA 2OMTB 3CFNA 2GFBA 2DQ6A 2P24B 2XZCL 2EE0A 3Q8AA 5D55A 1R33A 3JV6A 2CKBA 3P11L 4Z1PA 2DLHA 1Q72H 5DJ6A 4QHUB 5CSZB 3U0PA 4MD5B 3GB7B 3K6IA 1H5BA 2WVSA 3JXAA 4UBDC 3FAWA 4KKBC 4LSQH 3RY5A 2ESVB 3GBLA 1JZ4A 3ZU8A 1SF3A 1XQ4A 1NIBA 3II2A 3ZL4L 2B59B 3GTTA 5D7SL 4J3UA 2CJ3A 2HTLD 2NY5H 4O4YL 4OLYL 2XXMB 1G9NL 4XBGA 3O6LL 4U1MA 2V7NB 1VFOA 5F6HI 4OCNC 3MROB 5I8EB 3RL2B 1KFAL 4WI0B 3QUMB 3EYQD 4GSUA 3WFBH 2DIAA 2JK5B 5MEPA 1TFHA 1KT2B 1QFUL 2B0SL 2KKQA 2A3TA 2O5NA 2XG5A 3TBSB 1SM3L 2J8UE 1KIPA 1J7VR 3SKJH 3EFFA 4JFEE 2BHFA 3SYAA 5KG9B 3ULUE 3GMPA 4PLKD 3W5MA 3VI3B 4JY5H 4LNRA 4KXCA 5L4IA 1A6ZB 5BVPH 3KLLA 1YEEH 2O5YL 2NXYC 1RUPH 3ATBA 4APQA 3ZTDC 1WWWX 4L0PB 3BP4A 4OF5A 5AOZA 1TCRA 2VIRB 1BFSA 2SEBA 5FKAA 4ZTOH 3GQFA 2WLZA 1YNTF 1WA2X 5E99H 1O5PA 1NKGA 5I6NA 1HJCA 4FERA 3SHSA 4KDTA 1I7ZB 4P5MB 3TPUA 4NKDB 2BNRB 1W0VA 3MRCB 1QFOA 2TAAA 2Y5TB 3CSYA 1M05B 2YBGA 3M8OL 5HJDA 3T8MA 3WE1A 1T1WB 3LZOA 4ZX4A 1FVCA 3B6SA 4Z95L 4LSVH 1W8EA 3CSGA 3QI9B 3MMEA 4LE8A 5BS0A 1A3ZA 3APFA 4DSYA 1S3KL 3KPNA 1NDGA 2EC9T 3HNSL 1HNFA 4G7YH 1HQRA 3RFZC 3NZSA 4EUPB 5I8KL 3VI4F 3K2KA 3HHMA 2FO1A 1NPUA 2L7QA 1E2VA 4BZ2H 1Y6NR 4O5LL 4BFFA 1DSYA 4JFQB 4KJQD 4HIHA 5E1AB 4WWKB 3HHSB 2CSPA 3QJHA 4IU2B 1HI6B 1YG9A 2DKUA 4POUB 3RHWK 2DDQL 2FT8A 2CHXA 2Z7YA 4R97B 4OIFA 4F58L 1E4WL 5DD0L 3WEXB 3CHRA 4J3SA 4F5CE 4NC0B 1B2WH 3D5OF 4KI1A 5E8NA 3VFTB 4BFKA 1KEML 1UKSA 1A7NH 3VWJB 2PUQT 5I30H 3PY9A 3LRSA 3P2DA 2VQTA 3T1WA 3KPOB 3C8KB 5DMIH 4KKLC 2B14A 4XVJL 2G9HA 2DQIL 1XH1A 1RPKA 2R29H 3UTPD 4QOKB 4RFEA 3FUNA 1VFAA 4GW1B 3WDHA 1OPGL 3S35X 2BOCB 1G7JB 1QBAA 3QR0A 1VKXA 1MFAL 2YSTA 3GDBA 3EKCA 3OLGA 3VRIB 1F6AB 3U36A 4DGVL 1KY6A 1YEIL 2YAEA 4Y4KC 2D7QA 3BVTA 1S7TB 4OR1A 4FOMA 4GP5B 3KPQB 3GJFK 2ROXA 5D7IB 5JW3L 2G3ZA 4L5FE 3FQ1A 3PV6A 3VH8A 2BZ7A 5ISZE 1HILB 1F2QA 4BYHA 4KI5C 5IEKA 4QYAA 3PXLA 4H0GA 4LKXA 4XNAA 2IOOA 4L8SA 3WTXA 3RWJA 3QNXA 3V9CA 3GF8A 2DIEA 4QHKJ 3L4ZA 3SGEI 3VJ6A 3QUYB 2W91A 1BQKA 5J56B 4MKMA 5MEQB 3UZVB 3IMUA 5EZJA 2VZ1A 2NZIA 2AV7B 4JN2B 2VC2H 4UV4H 3CGTA 4Z7QE 3HJEA 1NIEA 3HN3A 3NEXA 5LBGA 1AKJB 2I7OA 3CPLA 3MO1A 2Y1ZA 4YDIL 2IOIA 5EF3A 4Y4HD 1ZSDA 3QCTH 3L81A 2BC4B 2GJPA 3B5TA 4I1NB 2IF7A 3NN8A 4KO6A 3RKPA 3D25B 2YGVA 3B2UD 1ZE3H 4WWPA 1IGJB 3C5XA 3QG6B 1UM4L 4DEUA 5IBTH 1FFTB 3VGEA 4PSPA 3ZT7A 4PJXA 4PJ9B 3BFQG 4GIPD 2WTOA 1P84J 1GHFL 1DVXA 4O02L 2RCSL 1PZAA 1EK3A 1UWXH 2CK0H 5IFAL 1U8NB 5IJKA 5F7UA 1FHGA 2FWOB 4KKCD 4I0PD 3BKML 4Q9CA 3PQYD 1HS6A 4PJ8A 4QPEA 3EO9H 4XCEA 2CNYA 5SWZB 1T6VN 3IF1B 1PPIA 4P4KC 1YDPB 2GVYA 3KPPB 3SPIA 3WJMA 1OOWA 2H6PA 3K91A 1GGIL 2UZIL 5GGTH 2MFNA 5C6TH 4BQ8A 2EECA 2G0LA 5C0AB 1ACYL 3MV7D 2VXVL 3VXMD 1KXTB 2OL3A 2W88A 2XTJD 4ZO8A 4JPWH 4L9LA 4N25A 4Z77B 3HG5A 4Z3FA 4ZI8A 1K3ZA 3NFPB 3IGKA 2OMYA 1N6VA 4DP7X 5A1AA 4RAVB 4YSSA 2ZCKH 3HFMH 3U4EA 3C6SA 3MRJB 4G6AC 4JO3H 5AZEH 4HJIA 2Q86A 3VXSB 4AM0A 4DEPB 3VA6A 1K4CB 3B9KD 2VLME 1KCUH 2NY0B 3SYOA 4LOUC 1UT9A 2IPKB 2EKJA 3EJYD 2ZP0T 3DTXA 4TOYL 1O7VA 3Q01A 2W9EL 3RU8L 4WDIA 4KTYA 4NP4H 4HJJL 2GJRA 4YFLF 4X6DF 3KL3A 1WSST 3QJFA 4YVNA 3CPUA 2FNWA 4P04A 2BERA 2DQDH 3AG1B 1G7IB 2KZ1B 1QWNA 5GGSA 1UOKA 4UT6A 2GHWB 1CGXA 1OAYL 1S7RB 5GQBA 2V8MA 4J3OG 4MRCA 4IBYA 4MJIB 4L4VE 4HS8H 4C4UA 1K4DB 2NCEA 4J6RH 4ZXBC 2FATL 4ZFQA 1O7DE 5J11C 3M1CA 3PUUA 3S48A 3IDNA 2JKWA 3MV8B 3PE9A 4Z8FL 4PY8I 3OMNB 1BAGA 2BS8A 2ADYA 3OKOB 2CUHA 4P2OD 4XNYH 4ZS6D 3SDYL 1GGBH 3IYLW 5TDNA 1OLZA 1DUZB 1UD2A 2XT1B 3CFUA 5GS0D 4UQ3A 3NDZE 1J1XH 3QFJE 3VI3E 4XVUC 3HZKA 2WWOA 2H3NB 1NUDA 4N2BA 4M56A 2W0FB 2VXUH 2G3MA 2PYEA 1YN6A 1EIBA 3D85B 4QXUL 3MHZA 4FNQA 5EPMB 4WUKH 2EDYA 4NCC1 3TCLA 5HYJB 1AIFB 3TESA 3OAZK 4QXTA 3TP4A 5FM4A 2ZPKL 3VRJA 1E5BA 5DMYA 1FNFA 1OE1A 1NEZB 1OTUC 2FAUA 3FT2B 5DURB 5EH1A 4Y5YB 4ZS7H 3BQUA 4L4TB 1S9WB 1A6TA 3ZDXF 4NAMA 3IMVA 1UT2A 3GKWL 2MCPL 5JXEA 2AANA 2P49B 2ZUQC 3HI1B 2XG4B 2IO5A 2K9FB 4R4FL 4MB4A 2NTFB 2XWDA 3CTTA 5JQHC 1GGTA 2XVKA 3TS8A 3NJNA 3FQXA 3O45A 4YLQT 3HCVA 4NM8H 3T6QC 3HNTH 3MUZ1 2H2PD 4EDWL 2D31A 2FO4B 1Y6KR 2HRLA 5J3HD 1SMAA 2PPDA 4HK0A 2BIIA 2QHRL 2RQ8A 2V3FA 4FCAA 3MUGA 4OZHF 3AXIA 3RPKA 4Z23A 1GVIA 1C5CH 4L8DA 2QKIA 1E5CA 4I18A 1NIDA 4G9FA 5JUEH 1JSYA 2F08A 3TWYA 3HRZB 4HD5A 1MJ7L 2F7QA 3EYUH 3NP4A 5DJAB 1N6UA 4XNUH 5GRVL 2P5PA 3DVGA 4DKFL 2IWEA 4MS8C 3QHFH 3JUYA 4FEMA 4IBWA 4UIKH 3PP3K 4DEWA 1BG9A 5F7MC 4Y1AB 3FO1B 3MC0A 4Y5XC 1A66A 2CALA 3D39B 3TT1H 3GRGA 5KW9L 4IHBA 4N22A 4PB0H 1BEYL 3C60D 3OKNB 3GJEA 1KB5A 1MCWW 2HRPH 2NW2A 3FFOA 2FYYA 3TNNB 1CXFA 4KOBA 4Q6IB 4U6HA 1BZ7B 5DUPH 3IJYA 5GGVH 3QEGH 1G6RH 2ATPB 4Z7WE 2ZJSH 2WC7A 1BVZA 4IBSA 1ETZB 3O8XB 4QOKE 3CIQA 4KUZH 3S36X 2OSLA 4NUMA 3AJ7A 1BD2E 3RVUC 1SHSA 3QWOA 2DW5A 4JRFA 5KVEL 2G60H 3CZKA 2EVGA 1E6JL 1SGKA 1C8QA 4M3KB 1J9CT 5KVFL 3WEBA 1AZBA 1IM3A 4MAYD 2ZUWA 2IALB 5IHHA 3OLEA 4ZO9A 4UQ2A 2JXMA 1MWOA 4RGND 3KPTA 2I69A 4JZJA 4PYGA 4PJXF 5D7IE 3BI9X 1MAKA 4EN3D 5CEZE 4U1GB 5B1CA 3ZT5A 2W80C 5SWSA 4FLOA 1HCVA 1BOYA 4NZRL 5CCKH 5IQ7L 3IMBA 1LO5B 2I5YL 4KROD 1F58H 1TKWA 3U4BL 4BK5C 4MX7B 1CTOA 4ELMA 1EWHA 1R34A 3ILQD 5GGUA 2A9AA 1EBPA 5CCGE 3QZLA 2Y22A 1LK2B 2FGWL 1XAUA 3EO1A 1F11A 1RIUH 4PJHA 1JGVH 1NKRA 2AERT 4QEGA 1G0DA 2CHNA 1CQYA 5K93A 4GB9A 4EI6A 1U3JA 5KJRL 1ZGLB 2ZXGA 2F2HA 1BFVL 1FZMB 2GIMA 4KY2A 3HPJB 5EZLA 3N44B 3VFRB 1HFUA 3LKOB 1BZDA 4GXVH 4Z7VA 3KLHD 5H94A 1AGDB 3JUZA 3MJ8A 4O00A 3WXWH 4ZFOA 3TVMC 3BWUF 3CN3A 1OE2A 1JYVA 3M17A 2PWFA 3AT0A 3RG1C 4M1DH 1X5YA 2AXWA 4KKQA 4QRUB 5FW7A 4B7IA 4F20A 5B38G 2FX7H 2IWKA 4GO9A 2YPLB 1T66D 5C08D 4P9ML 3EFOA 4KVCL 5LGHL 3HI5H 1TSHA 4R26H 2AXHA 2XYCA 3QUKB 4AEIH 1YEFH 1OAKH 1MRFH 4CGUB 3LH2L 4MAUH 1JI2A 3CXHJ 1NCTA 3IM1A 5HI5D 1F2XK 5DGRA 4PCSA 3P54A 2BCKB 4G7SB 3ZBMA 3L3OC 1X3DA 4WAFA 5B1JC 1PCSA 4N9GB 1NLDL 5SWZE 2CDEA 4MA3A 5K1NA 4B9CA 2LLGA 3NCJH 3FCUB 4ZUUA 5IB4A 3RWFA 3CC1A 5C0AE 1OGAD 4HZLA 43CAB 5C0CB 1I85C 4L1HA 3F7VB 1D7DA 4H20H 4A6YA 2E7CA 3QIWB 1XCQA 1MQKL 3MFFA 4PJGB 1MQ8A 1M2VB 3KJ4B 5C3TA 2PW2A 2LLLA 2JLPA 5HHQB 1V7NL 3B83A 4M1GL 4FXKB 4NP9A 3VXSE 3LKRB 2OP4H 3EJZC 4YUEH 2R0KH 3ARDB 5TGBB 2NY6C 3UJJL 4N1HB 2ZG1A 3BW9B 4GRWH 2QL1A 5GZOA 5J6SA 3CFBB 3BVVA 4UDTB 1GAFH 3V5DA 4N8VB 3RTQB 1NAMB 1FUNA 1ZXQA 4XPGL 3BD5A 1H8NA 4B0MM 1L9MA 1SXBA 2QMKA 1A22B 1JN6A 3A21A 3ZGIA 4WW1B 2HUEA 2WXRA 4RBPH 4RQQA 1FNLA 4OLZL 3REVB 4XTRC 4YNYB 3KLAA 4TUUA 5IY5B 4I3SH 3QO1B 4L3AA 5KSVA 1VZIA 4RGOL 4CN1A 3N40F 2HKFL 2ADFL 2MTPA 1XEDA 4K8RC 4MJIE 4Y16C 2FJHA 1JHKL 5I66B 1OSZB 1FGNL 4OLWL 3TA4D 1PZ5A 3GZPA 3NCWA 1KBKA 3EH2A 3WLWD 1I1YB 1IGFH 3FPYA 4G6FB 2Q6WA 3MV8E 3QB7C 1B0GA 2FTAA 4HIXL 2Q3XA 3MXWH 4DP9X 2BY3A 4H7VA 2WGNB 2D03H 4QGYA 4POZD 5G4NA 4J2QA 3DHPA 3FB6A 4XO3A 2R1XB 4F9PA 3MGTB 2X6UA 3DOSA 5CGTA 3SDDC 1KJMB 5HGBA 1XZ0B 4QNPE 3SDXA 1AO7B 2EC9U 3TURA 2BH0A 3M07A 3FU7A 1J8HD 4JY6A 5DZNA 4PP2A 2H45A 4UYPA 4LSTH 2QR0A 2YMXL 5T1KD 2BWDA 1BVNT 1R19A 1AMYA 4N26A 5HYJE 3GBNH 4EDXB 3OXRA 4K94L 4RMWA 4K3EL 1F4AA 3IT8D 4FL4B 3OJMB 4LU5H 1S7UB 1UACH 4KKAD 1FAIL 1S78D 3MBEB 3WUWA 4HPOL 1QLFB 3CU7A 2XN9D 1Q9KB 3V6OA 4XPAH 1DVFD 2AC0A 4HFWB 1MCNA 3MNWB 1ZXKA 2GJZA 4HJ0C 4LKCA 4XMUA 2X3AA 4S1DD 5D71H 4DKTA 1KPVB 4X4YB 3IU4L 1GZHC 5BPPA 2XQ0A 2QPSA 4MQXC 2NPLX 3OAYK 5IVXB 1P5UC 2ZOTA 4IEFB 5T3ZD 2YXWA 4W9KC 1A7OH 4ZFZB 4OCYL 2EDDA 4EZLA 2ZWKA 3S4SA 4ZK8A 1MDTA 2YK1L 3SZKC 2DQJH 1KOAA 3ARGB 4A2EA 3VXUE 2IGFH 2F15A 4H26B 4U1KB 2ENQA 1ND0A 1N0LB 2FWLB 3C75A 4X50A 12E8L 5E7BA 3ZDYF 3HVNA 2HN7A 2BNQA 2P8PA 3S34L 4YR6B 3TBCA 2P5ED 4H44C 1L0PA 2WBJD 4YHLL 1DQMH 5E1QA 3ZRFC 3T65A 1HAUA 2Y5EA 3L3KA 1DUYB 5F88A 1RZGA 4WEEA 3OR7B 4MBRA 4Y1AE 3TIDB 1U3ZA 1DDTA 2HXAA 4ELMF 2VNCA 1M7XA 3DJ9A 4IGBC 3QORA 1A3LL 1EVUA 4PJIA 4PJHF 5C97A 1KCVH 5DT1L 1UOVA 5CJQL 2JI3A 3DC0A 1ZK9A 5T3ZH 1ACZA 3OF6A 4WJ5A 5E23A 5HHOB 4AZ8A 5LBSL 2NZ9C 1XIWB 4ODBD 2WXPA 3CFJA 1TPXB 3BP6B 1BQUA 2DI7A 2GPZA 4PI2A 1T5XA 3LZQA 2DWEB 4YIQB 5DVOA 3CQQA 4MXQD 1SVCP 1U95B 3QXAA 4S11A 3DPBA 3V0JA 1A9EB 2UYLB 2X70B 3M1OA 3NJJA 3IBEA 1HHGB 1BIIB 5LQBL 4MS6A 1IFRA 3SE3A 3QQ3A 2VDOH 5AL8A 1HCFX 2VWEE 5HVHB 1WBXB 2AV1B 5EU3A 3GMRB 5H35B 3T09A 5BQ7B 4Y89A 4LCIH 1HEJC 1E9OA 1MRCH 5FUZH 1PLGH 4G70B 2VXSL 5IHWA 3FT0A 3KE0A 2MIZA 4HLZH 4KHXL 4KBPA 1FFOA 4K5LA 4EXPX 3DBXA 1TMQA 4PJFA 5DHVH 32C2A 2N7BA 1NGWA 2Q8AH 4H8WL 1DQQB 1KY7A 1ASPA 2EDKA 2B5IB 3GNMH 4HETA 2P5WA 1YYLL 3P77A 4C56A 3TH3T 5C2BL 1EGJA 3QYCA 2WSPA 3CDZB 3FJTA 4JQIL 4HIIB 5I75C 4P23B 3TBVA 5JHLA 4P2QD 3FOLA 2VABB 1XGTB 4BFJA 3WXVH 5GGVY 4RIRA 2A9MH 5EU5A 2OYKA 5AG8A 5E9DD 2Y7QB 1RFDL 3NJGA 2YPLE 3CK0L 2ZF9A 4S1QH 2WTRA 5FX3A 4ZMTA 3GMMA 1HINL 3F83A 3LKQB 3SDAA 1ZTXE 1PG7L 3CSTA 1LHZA 3LV3A 4LLYB 4YHIA 5EDXA 5AKVA 5K33A 2CBQA 3QIUB 4D0BA 1J8SA 4M48H 4QRRD 3NFSH 5LBVA 5GS0L 1ONQA 1CIDA 3X2QB 4TNWF 5IROD 1RSYA 3B7SA 4IOFC 4TLSA 3UDWC 2ZOWA 4PCYA 3ML9A 4YDKL 2UV3A 3TV3L 6CGTA 4ODWB 2WQUA 3C9NB 5D6CB 2AJXL 2DQUL 2UWEB 4UOJA 4PG9A 5CFAA 3C12A 4HH9A 4M6MH 3CSBA 1M3IA 2R59A 3ARRA 3B3BA 1I82A 3MLZL 2QHLA 4MQTB 4PJGE 3WNMA 5I1DB 1F86A 2XQYG 3MR9B 3MTXA 3O3AB 3TT3L 1ZJBA 1QLEB 1KCLA 3FMGH 4NPYA 5CBAB 2R8SL 5E5LA 1L4IA 5D1ZD 4P59H 2FZ3B 3Q8CA 4BFIB 4PJ6A 4NKIL 4OUOA 5EBWA 3MACL 4JHUA 4HULB 2BHUA 2JSFA 3ZZLA 2WYTA 2Z31D 4K3DH 4IRJB 3JTTB 1ZVYA 3UTSD 3QRGH 1XF3A 2Z93A 2VE6A 4S0SD 4KZEH 1XF1A 3DVIA 1FV1B 1SUJA 1MFCH 2O61A 3T1FB 4OT1L 2HJLB 2FE0A 4EUPG 2J6WA 4OF7A 5E6UB 3B9DA 4PRNB 1C16A 3V8CA 4HZAA 3SKNA 3TN0B 3ISWA 1BBJA 1HT6A 3B7TA 1F4YL 4XMPH 5DD3H 5T33L 1ZHKA 1IBHA 4P3CH 3RYMA 1A14H 2X1QA 2R69H 3D08A 5F72S 2R2BB 3ISRA 1DBJH 2Q3AA 1M53A 1AZUA 1QACA 2B1HH 3H2QA 3MJ9H 4HFUL 2GSGB 4BFRA 4NKMB 3FRUB 4GBXB 4K5NA 1IGMH 4HXBL 1ZLVK 3ULSA 5KVDH 5GRXG 4S1RH 1AR1C 1GJIA 2OMNA 3TCTA 2A4CA 1G7PB 4DP1X 3QEQD 1VEOA 4NKOB 5AVYB 1YY9C 1WWAX 4AVHA 1Q0XL 1SMDA 3STZA 2F5AL 4LMQI 3P69A 2PWDA 4RMVA 4YSQA 4F2ME 3CXFA 3AQDA 4HOXA 1B90A 4M6AA 5D4HA 2C3VA 1I8MB 1HN1A 2O1AA 4S2SA 4KRPB 1A7PH 3JWNC 1NFDA 4XBPB 1AVAA 1U8QA 3KYKL 1C5DA 4OW6A 4DGWC 4OZFA 3WY4A 4PS3A 3X3GL 2O6PA 1FL3B 4MNHB 1TZOA 3ARQA 3QQ9D 4JANA 1EJFA 4DGYH 1TJGL 4HJGB 1QSVA 2E7MA 2L7UA 4WFHE 4F93B 3FTVA 3B2DC 1HXKA 5KS9E 4DCQB 2NY7L 4U3SA 2OLDA 1UM5H 4Z5RA 3K4ZA 3ZUNC 4X8GA 3CFIC 4PLJD 1OTTD 2ZX7A 2BNUA 4NUGL 5BZDA 4WO4D 3P9MA 5CP3A 1JZ5A 1CD1B 3OGCA 5FYJD 1ADQH 1JPTL 3MLVL 2PCFA 1HH9A 2Z1PA 5LAPA 3QNYB 3P30H 3FONB 1CIUA 1KN4H 3L3HA 2WIIB 2R7EA 5DJ8A 3Q06A 3UYPB 3LRKA 2VDLH 5CKAA 2GBUA 4KOCA 2VW7A 2JTYA 3AAZB 2C1OB 2EH7L 2OCJA 4GRMA 4NN5C 1OK0A 3U0TA 4EAEA 3BGFB 2ESVD 2VR8A 4P9HC 4X6EA 5E6YA 5EO1A 1MHEB 6PCYA 4S1SH 4PJFF 4M5ZL 4JFHD 4KKNA 3FH8A 3QAZB 3N06B 1HE8A 1S5HA 1MI5B 1OF0A 5E70A 5HHOE 5I82A 3KYOB 2BIPA 3IJ7A 4NAJA 1JZDC 3SBRA 3UP6A 4GQPH 2OTWB 5IWLA 3KVDD 2JJUA 5HYSB 1FA4A 5ICYB 4PV1C 1QSEA 1QWUA 5I1LA 1DLHB 1D6EA 3AREA 2AJSH 4O51A 3V4PL 4HWBH 4N8CL 1YNTB 4BZYA 5KSAC 2Q7YA 4JNXA 3X12A 1KPRB 4UM8B 1P4IL 3QJUB 1ITBB 1Q0YH 1OL0A 5D4JA 4BCYA 5EU4B 1KF9B 4XOBA 1MWAH 1QYGH 4QLWA 2YXFA 3ULVC 2ZUUA 3MYJA 4E9TA 1DBAL 2VB5A 5MI0B 4DGUA 4DN3L 1SUHA 3AFLA 4PJDA 4AE1A 5GRZA 3SO3C 4XRCA 2VDMH 3IAPA 5CIPB 3ZMEA 1E7VA 1WBYA 4PJEE 2OULB 4RAUA 5TE7H 3T4AB 2P44B 3AS3A 3UH8A 1MIMH 4LVHC 4X9HA 1UM6H 4YSRA 1QLRA 1CPUA 1FN4A 2BNRD 4I0KA 4F7EA 2Y6SC 4YHYC 3VI4B 5ALCH 5I0YA 1URIA 3F04A 1UCBH 2BSSA 1AZNA 2GW5A 3QI9D 4LRIA 1QA9B 1JMZA 4D0CB 3R18A 4HIPA 4AQ8A 1MCOL 4KJWC 1NFIB 3GXMA 1JZ7A 3OZKA 1Q1PA 4QAMB 1O75A 2OZNA 1U8CA 4JQVC 1NCBH 1KZYA 5AOMA 5L2KA 3CD4A 4X80L 3CFEA 4FFVD 2AZUA 2HJKA 4HAFA 4N0YL 2BVYA 3I3DA 1KLGA 4JO1L 5EA0H 2AJVH 2W07A 4MDJB 3BAXA 4YWGH 4PRPA 3QXDA 4WU5A 3K5SA 5J12B 3HI6L 3EJTA 1J5OH 2C9AA 1PSKH 2VDOB 4CUCA 1HHHB 4ODUB 4WWKD 4EEEA 1U2YA 1CLZL 3PWUB 4NRYA 4XB3A 1PAMA 2FDBP 3BUQA 1T4KB 2UWEE 4U4BA 1D6VH 3MXVL 2I07A 1FNEB 1TO5A 3INUH 4O02A 4UU9A 1I1FB 1OP4A 3ZO0A 4G71B 1NEZG 3I3EA 4JVPA 3BRFA 1ZHBA 2P80A 1R3IH 4GQZA 1AJ7H 1UHVA 2BDNL 2LHAA 2D4DA 3QWQB 4W1TA 3V79C 4MNQA 4GRLD 4N5UA 2DWDB 3WL9B 3PXJA 5BV7H 3SQOH 1FFNA 4PV9B 1G1CA 4L1DA 5G55A 1MXDA 1EEZB 2V2XA 3WIIH 3GIZL 3VB8A 4CADA 3KL0A 1T7ZA 4FNSA 5AAMA 1UH4A 4AUYA 2BSTB 4ELKB 2ARWA 1CF1A 4ABQA 2P1YA 3FSZA 4MA1C 5EUKA 2QGBA 1G7LB 2D9QB 3LCYA 4BZ1H 4JRXD 5LCVH 4AVKA 3QR2A 3ATDA 1A5FL 4WWOA 2X3CA 2DH3A 2IAMB 3Q5YA 2F19L 5E8DH 5IW1A 2E6PA 1NFDF 3ET9F 2R9HD 1JGLL 3SPVA 3QDGD 1N8ZB 4QRQB 4O58L 4RCAA 5C0BE 5GIRA 4QTFA 4FFYL 3EAKA 3RFZA 2PXYC 3NIDF 4GW4A 4QRAA 3SDCD 4YHOL 5E6ZA 5DD5H 3RKDC 3D8MA 2GFBB 2MPAH 3LS4H 5GRUH 4DJMA 2ETWA 4JCLA 2ODHA 4YE4H 3JV6B 1YEJL 2CKBB 4QGTA 3QH3A 1P6AB 4OF3A 4S0HA 1ZRUA 5B8CC 2IPTH 2LU3A 3SGJA 1X6NA 1U42A 1CDJA 1H5BB 1XB6A 4Y9EA 2LFGA 3CNKA 3EXJA 4E41D 3ERXA 2VDRB 4AV4A 3MJ6A 1GGYA 3GXIA 1F1DA 3BOVA 3A67H 5DK0B 3BVNA 4X99A 4YJZL 3BZ4B 4XBGB 4FMKA 4PP1C 4ZMOA 3FF8A 3P3RA 4QHNA 1RULH 2CD0A 3GSNL 2WOYA 4AYID 1Z32X 5E5MB 4PJ9D 1NLBL 3MBXL 2MQCA 3LXAA 3RGVA 4GRWE 2VCOA 3ULUL 2ZAHA 3QR1A 4OV5A 1BQSA 3CUPA 3F05A 2XG5B 4N0UB 3G9VA 4OLUH 4RVBA 1MG3C 4EZKA 1QG3A 1G9NC 1FCCA 1EXUA 1KIPB 2X4UA 4XP6H 4HWNA 3JZYA 1UXSB 2NUPA 3EOTL 1URZA 4EIZC 3GMPB 3H9SD 2OJEB 1O9ZA 5D8JH 1H6TA 2VR4A 4AV0A 1WAEA 4G1EA 5EF2A 3TZVC 4JB9H 3P3TA 1N0XL 1BZ9A 1KJ2H 3VG9C 2WQXA 5FYLD 4DP8X 5KTEH 2KC0A 2ZOKA 3QGVA 3BIAX 4ZTPL 3BP4B 2XJLA 3HZYB 1TCRB 2SEBB 1BX2A 5FKAB 1JPSH 2CPCA 1J9TA 1PZCA 4X6DB 3UAFA 3KPMA 2I60H 5EEUA 4L3CB 4M9OA 1YEHH 4W93A 5FLUA 3U82B 2XN2A 1E5ZA 2A1WH 4XB7A 4XMXA 3W0WA 1W0VB 2NY0D 3X3FL 3CSYB 2AK4A 5FDYA 1DQIA 4M43H 2NZ1A 1FVCB 3MRHB 3T3PF 3B6SB 3DUHA 4AW4A 3BVDB 1AIZA 4PJDF 4U6YA 1MCCA 2QSTA 3X11A 3H3PH 5DZPA 4BV1A 5BS0B 2VDPH 5BO1L 4CU8A 1KTJA 4EKJA 1EJ8A 2X4TA 3KPNB 1H3VA 1IGIH 1NDGB 4G8IA 1MI5E 4QTHA 4HKJA 5LGYA 5FYLH 4WK4B 4AGNA 1JNLH 1YMMB 2VERN 3ARFB 1HQRB 1CICA 4XI5C 1YLBB 3CN2A 3QHZL 1NSNL 3KD4A 4HV8A 2VQUA 2QADD 2JIXD 4R9HA 3BEWA 2KT6A 1NL0L 3MA7A 3V4LA 3HMXL 1PVHA 2FECL 3Q7JA 1GGUA 4MZRA 1ERNA 2EXTA 3DX1A 7PCYA 2BW4A 5HJBA 2YAQA 2YPVA 4LEBA 1BG1A 3NCFB 1AQDA 4IK7A 3ZDXB 2X1XR 5IUCA 3WJJC 1AACA 5IVZA 1P6WA 5H4YA 1T1ZA 5E8NB 5L6YL 1IV8A 3D85D 2X4RB 4S10A 4R7NA 3LRSB 1CFVH 1I75A 3DPDA 4PRDA 5F9OH 1I9RH 1RJLA 2D8KA 1CFQA 5IHZA 3RUGA 2KS0A 2OMWB 4KMQA 1S7SA 4IMKC 2M83A 1OAQL 3FH7A 4JR9H 4L23A 5SV3A 3KCPA 4RFEB 5BOJA 4BKTC 1VFAB 2D7NA 3GJFA 4L4TD 4M8UA 3UCRA 1G84A 1DE4A 4N8VG 1XSKA 4OY9A 4OZHB 3BEVB 4B3EA 5ILTH 4BFGA 1XGYL 1B9ZA 1T20A 3A6OA 3LKPB 4L5FL 5MP6H 4HWZA 3GDCA 5AYUH 2EZ0C 2UZYA 3CFKA 5DQJA 5KZCD 4RLDA 2MQ3A 3BWZA 4UUJA 5IW3A 5IV2B 3AW5A 1WD9A 4AX3A 2XVGA 2D7PA 1JZHA 2FEDD 5TPWL 1NCCH 2F9BT 4OZ4A 1HC1A 4JBSA 5IF0B 2Q87A 5IEKB 1RU9H 3KPRB 1FGVL 2IADA 2MNUA 1SJHB 4L8SB 5GGQH 3RDTC 3RWJB 4Z7NF 6TAAA 3W3BA 1R5WB 3VJ6B 4CILA 1Z66A 3DVNB 4W9JC 4NZDA 1VA9A 3UO1L 5EZJB 4YDJA 5FUOL 5B7MA 3DUUB 3ROOA 2E7HA 5EU7E 1QEWB 2VLRE 4OGZA 1UXWA 4GSDH 3U46A 4NX0A 4EKXA 2EO7A 3K6SB 4QCIB 1U8HA 2WXIA 4FLRA 2CZNA 1KXHA 3CPLB 3PHQA 1FL6A 1U8JA 1KTCA 2NNAA 5B22A 5AW6B 5F96L 5TK4A 4OJFL 4OQTL 3PDGA 5AD0A 3O4OB 1GGCL 4K73A 5ITFA 1UCTA 3NN8B 3D39D 4P99A 1BF2A 4D9LH 5F3BA 5L0QB 1OHZA 2WIMA 1NGYA 2K3TA 3CXHK 3ZMNA 1UJ3A 1TLKA 4PRHB 5CNHA 2DJUA 4OLXL 4PJXB 3FBKA 3O8XD 3FFDB 5C07E 1WBZA 4FNLL 4N0FA 1BYOA 2GHZA 4PJCF 3L2MA 4WO0A 3SCMB 2CJUL 3WFDL 2KZKA 2GABA 1F18A 4PJ8B 4XCEB 4HPYH 4E9RA 4H0LC 2D7MA 3WJMB 2H6PB 2IFFL 3EJPA 1MREL 3CVCA 4J4PC 3O6ML 2QQQA 5D70H 1NBCA 3RURA 1F3JB 3SE9L 2NNFA 4H5SA 4L9LB 4FKEA 3MLXL 1V3KA 2D7OA 3H4FA 1R5IA 2VR3A 4IRSB 5GHWL 5LAXA 3GSQA 5I1IL 5ADOH 2HT2D 4PG2A 5EN2A 4DGIL 5IGXL 3DKHA 4KTEL 3KYNA 4KO5A 2VTFA 2Q86B 4TNFA 4LCCA 4AM0B 1PD6A 3K1KC 4ALAL 4GUPA 2VMJA 3WKML 5ALBL 3B34A 3DTXB 3V7AE 4NQDE 4DP4X 4DW2L 2IMNA 1P4BL 4XMLH 4WDIB 4B41A 2IAAC 1DVYA 4P46C 4AYGA 4ZMPA 1KG0A 4CRPA 1NCWL 2JWYA 3QZMA 4FXGC 4PJ5A 1OP3H 3VQ1C 4Y5XA 1MFEL 3QUML 1HOCB 2ZXEB 4JHZA 3CVDA 5GGSB 3WMQA 3N0PB 3MJ7A 1RUQL 2XVBA 5IM7A 2VXQA 4AYFB 1KXVA 1KELH 3CX5J 4RSVA 3HW7A 4NSKA 3T0EB 1E4XH 1W0YT 4X7EC 1IX2A 4N0UE 2NY4C 1GOFA 3EYVA 4UTBH 3IDNB 5I76A 5IVNA 2K1MA 4AOFA 7PAZA 5D7LB 1D5XB 3U4AA 3T6VA 4NENA 1SBSH 5DLMH 5EBMB 5GS1A 1QHOA 4RDQF 4NPKA 3WEAA 4DQOL 1UYWL 1C5BH 4ZOBA 4NQXA 3WG7B 3DYMA 3HZKB 3D34A 3TBYA 3MCYA 1XEUA 4IKLA 3ZJAA 4KAQL 1XGPA 2HCZX 4K9JA 3PWLA 3QS2A 3ZHLA 5C0CD 1B6DA 4U1IA 4OKVA 2PYEB 4WCYH 4FQLH 3WMPA 1YN6B 2K78A 5HYQB 3KBEA 1E9PA 4F7MA 3D3VD 1A4KA 5F6IC 2AKRA 1ZHNB 2FL5A 2AAAA 4A2FA 4JFDA 3VRJB 4ONGL 4X6DE 1Q9LA 3TA3A 2XPZA 5C09A 1U8KA 1LK3H 3AY2A 4WHYH 2AS5M 2FR4B 3MLSL 4MDRA 4OFIA 1Y18A 1A6TB 3FUDA 3IGAA 1UFUA 3UBFA 3ARDD 7FABL 5IHUH 5G4MA 3N85H 5HHNA 4FFZL 3UADA 1SY6L 3EUDA 4XNBA 4UT7H 4LQFL 2X05A 5I71C 5SX4H 1IC0A 5FGSA 1R75A 3LN4A 3O9WA 3IGLA 2DBJA 3FQXB 3O45B 2DKMA 3RUGF 5FB8A 3MUJA 3OXSA 2D31B 1JFHA 4XN7A 3IPFA 3MV01 3Q1SH 1DJGA 1FI8C 4ENEC 2RTTA 5CINH 1TG8A 1YMME 3DARA 4HK0B 2ZG2A 4QMEA 4AJ0A 3DMMA 1SVBA 3MUGB 3P0VH 4MJJA 2MNJB 4QYOB 1OK8A 4MJ4A 2X9WA 4QRPB 4NS0A 3RVWC 4L8DB 3V95A 3NSYA 4I18B 2VR6A 4UOW1 3VW3H 4HBQA 1QNZL 1F02I 3BP7A 2YEVB 1L7IL 2VN3A 3PL6B 3QJSB 3DHUA 3ELAT 2IG2L 4HK3N 3Q2LA 4Q74A 3W37A 4G7VH 2WP3T 5IB5A 3A4FA 4HWUA 1GC1H 5JHDA 4FG4A 1SXAA 4M7LT 5B1JA 1LP9F 1DQJB 3RZCD 2APFA 2NY3C 5LBSA 5ACZA 2CDFA 5EEWA 1AO7D 1OTSD 5I16A 1FIGH 2KQNA 3NT0A 1EFXA 3TGXA 4XVOA 3VXRE 5B1BB 2NCMA 3FUKA 1CF8H 3L8QA 1MLCA 2O6FA 5FKPA 3GJEB 1KB5B 2NW2B 4KZCA 4G9DB 1HYSD 2QDWA 3NIGF 4JE4B 3IJYB 4YDVB 3N41F 2VSKB 2ICEA 5ERWB 1JZFA 3KH4A 4UINH 4MCZA 3NAAL 2GITA 1Q9OA 2OSLB 4N85A 4Z0XA 4DN4H 1DJSA 3QWOB 1CUOA 3BZ5A 2X89D 3OTTA 4OZHE 4Y5VC 4GT7A 1P7HL 3HE7B 8CGTA 4M1CC 5CEZL 2GJ6D 3BPOC 5L8JB 3VFWB 1IM3B 3MNMA 1YQ2A 1U2HA 1PL3A 3EYOB 3K0WA 3T77B 3ZDYB 2PCYA 3M86A 2DQGL 4XCCH 1KJ3L 2JXMB 5BMFL 1LVEA 1JV2B 3ARXA 5KYWB 3I2CL 1QBBA 2J2ZA 4HWEH 4KK6D 4LVNC 4RZCB 4FTVA 4WJKB 1F4HA 2ICWJ 4H8UA 4JMXA 4Z3GA 1TKWB 2Z4QA 3GPEA 3KPRE 1MCLA 3QQ4A 3FQ2A 4ELMB 4Z0BH 5GGUB 5C2UB 2EE6A 4YBQD 1PLCA 1GOGA 3NQKA 3EO1B 1UA6L 1F11B 4PJHB 5FYKD 4WY7H 4M7JL 4OGXH 1IKNC 4KMTH 4EI6B 4Q9QL 3E8UH 5GGRA 4KVNH 4U49A 1AD0B 4NDMA 2Y3NA 4TL5A 1YNKL 2EYRA 3H3BC 2QTEA 3LKNB 5EZLB 4XGZA 3ZKMD 5LDUA 4HVBA 2NY1D 1NCAL 5L9DL 3LPWA 4ODTL 5H94B 4KNSA 4U2YA 3F58L 3MJ8B 4IJTA 2XV6B 1TR7A 4UNTA 3M17B 4QXGH 3LRHA 2HTLC 4M8QB 3TL5A 3UG3A 2JF1A 4JFFA 3WCYA 3QYMA 4PRHE 4HMEA 1FSKC 5C0DA 2VKXA 3DJZA 4HUVB 4MLSA 2AEPH 1IMHC 2UXFA 4DVRL 1FVDA 1MFUA 1AZCA 3NSFA 3POHA 3EYQC 1GJUA 4GAJL 5FYKH 2GI7A 4HGWA 4M6OL 3L4YA 3VFGH 3GXTA 4Q9RL 5LNEA 1DEEA 4R5VA 3UJIL 2IPUG 5MENA 1F0LA 4OLVL 2EEXA 5K1VA 2YAOA 1JGDB 1YEKL 2CDEB 4PLKC 2QLVB 3GHPA 4W9EC 2EIJB 2CHZA 4WUUD 2EDXA 2WXHA 1U0QA 5E2TH 4HIQA 4ZUUB 4AK1A 5IB4B 2WZPD 4HEME 4PW9A 5E2UL 1P5UA 4G6KL 1VDGA 3LEVL 4KJPC 3MFFB 1JOIA 1RJZA 1FFQA 5C86A 4YK4B 4AMXA 5KJ7E 1F1GA 1THAA 2B4CH 2BP8A 2WZ6A 3HTLX 3QG7L 4EBQL 1IFHL 3G6DL 3K46A 3RAJH 2WK2A 5AEAA 1S46A 2AXFA 2BP0A 2ZWYA 3V4UL 1AOHA 2DD8H 5E2WL 2P8LB 1WPCA 4XVTH 1EVTC 4ANKA 1INDH 1A1NA 3V5DB 3ESPA 5I1HH 4ODVH 4N3UA 2Q8BH 1JN6B 5DR5L 5AB1A 3ZW3A 4RQQB 2WP3O 3WE6A 2DBLL 1MDAA 3DRQB 3X1EA 3F00A 3KLAB 1DSFL 2BRRL 4UIMA 3VWKA 4JAMA 4ISVA 2RMNA 1LJMA 3AG3B 4XP1L 2QV4A 5HYSG 1USZA 2FJHB 5E9NA 1T7VA 1LEGA 3T0EE 1KLFB 2K8QA 1PZ5B 1CI5A 2ZUTA 2Q6WB 1N6QH 5EC2A 1B0GB 2KUTA 3JV4A 2Z4TA