5AAPA

Complex of the fimh lectin with a c-linked para-biphenyl methylene alpha-d-mannoside
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
158
structure length
157
Chain Sequence
FACKTANGTAIPIGGGSANVYVNLAPVVNVGQNLVVDLSTQIFCHNDYPETITDYVTLQRGSAYGGVLSNFGTVKYSGSSYPFPTTSETPRVVYNSRTDKPWPVALYLTPVSSAGGVAIKAGSLIAVLILRQTNNYNSDDFQFVWNIYANNDVVVPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of C-Mannosylated Anti-Adhesives Bound to the Type 1 Fimbrial Fimh Adhesin
pubmed doi rcsb
source organism Escherichia coli
molecule tags Cell adhesion
molecule keywords FIMH
total genus 33
structure length 157
sequence length 158
ec nomenclature
pdb deposition date 2015-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09160 FimH_man-bind FimH, mannose binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1090 Mainly Beta Sandwich Immunoglobulin-like Fimbrial-type adhesion domain 5aapA00
3BFWA 4J3OH 4AVKA 2W07B 1N12A 4LOVA 5F2FA 4XO9A 1ZE3H 1KLFB 4X5QA 4XOEA 5F3FA 5LNGA 4X50A 4AVJA 1KIUB 5IQMA 4XOBA 5AALA 4X5RA 4AUYA 3JWNE 4AV4A 5FS5A 5ABZA 5IQOA 4XO8A 5FLUA 5AB1A 3MCYA 4CSTA 3RFZA 1UWFA 4AUUA 3ZPDA 4XOCA 1PDKB 2VCOA 4XOAA 4XODA 2XG4B 1QUNB 2XG5B 4J3OG 3SQBB 3ZL2A 3JWNH 4AV0A 3JWNG 4AVIA 4BUQA 1TR7A 5IQNA 2UY6B 2JMRA 5CGBA 4AVHA 3ME0B 5FWRA 4X5PA 2UY7B 4ATTA 4AUJA 4AV5A 3BWUF 3ZL1A 2J2ZB 2JTYA 5LNEA 5JQIB 4J3OF 4CA4A 5AAPA 2WMPB 1N0LB 5FX3A 3BFQG 4CSSA
chains in the Genus database with same CATH superfamily
4Z7UB 1W0VB 1BJ1H 4ZD3L 3BKML 1IV8A 5TJWK 4NGHL 4KKPA 4HHAB 3MLWH 4XXCC 4XXWC 2CSPA 4PTTA 5BZZA 2C9UA 4JFFA 3T1FB 1HI6B 4Y5YB 1G9NC 1GKEA 1XGPB 3LXCA 2QHRL 3UMNA 5FHBH 4KRNA 4Q56A 4P2QB 1MJ7L 5KJRH 2BCMA 5EBWA 3IJEB 4MA1C 4GW5A 4IS6A 5T3ZH 3BKYL 5E7BA 4ZFFA 4P2OC 2XPYA 5G2NA 1QSED 2AI0L 2YD3A 3TNNB 5K9KA 3CH1A 3KL3A 1R5WA 4IKJA 1HDMB 1UB5A 2B0SH 2GSIB 3WJMB 4X80H 3V0VB 3DSFL 4HAGA 1OK0A 1J87A 3DPBB 3B7SA 2EIZB 4AZUA 1OAYH 1NEZA 2Q2EB 2H6PB 3CLFL 3L7EA 2WLNA 5I8OH 5DR5L 3R8QA 3GHEH 4J3VA 4U6YA 4O02L 4WWPA 4YBHA 3BN9C 3PWUA 4I0PA 1HN1A 4DKFH 4O58H 2BOCA 3PGFH 3EO9L 3HHRB 2MCMA 3LEXA 4TQEH 4Z7VE 1W9XA 4DGYL 3IDMB 3Q48A 2DYPA 3IJYB 4HWEL 4N90D 4YHZH 4N0FA 3SDDC 3CDYA 4CU7A 4JO4H 1S7RB 1S7SA 3F7YA 3G5WA 3OM3B 2AK4E 3WDIA 5SWZB 4AUUA 5ADOL 1YNTF 1QO3A 4YDKL 1RU9L 2AAVA 5AVUB 1E4HA 4YK4B 2Z7UA 3AAZA 5E5UB 1IC7L 4ZPTA 2BSCA 1ZHNB 3QQ3B 4AK2A 3QWOA 3U2IA 2WSKA 4FNLL 1XIWD 1A02N 3DI3B 2PWEA 3M8OH 2SODB 3O45B 2YMTA 3FQWB 2VDLB 1PEWA 4L4VE 5KSAB 3QA3B 1QW9A 5EIIB 3L4WA 1TU2A 4M61A 4S1RH 3VQ2C 1GS7A 4A67A 1HS6A 3PWJB 4EF3A 4UQCA 3X3FH 3EOBA 4IEFA 4M03A 4PJBF 4ZODA 4DPRA 3IDGA 1HE8A 4K7PY 4XTRC 4B3EA 5DD3H 2YWYA 4YH6A 3F84A 1ZOXA 3APMA 1H6EA 3M7OA 3APCA 4JRXA 1MCSA 4NJAL 1U3HA 1LO3L 4DK5A 4OCYL 1FJ1A 5MHSE 2LAGB 5DEJA 3SKOA 2CKBB 1YC7A 3NTCH 3QG6B 3DO7B 2H0JA 2ZWLT 3CFEA 4N2CA 4O2FA 4DP9X 3KWWB 1FH2A 3BAEL 1DEDA 1RSFA 3LB6C 2WVVB 3ML8A 4XVOA 1WAAF 4CW1B 2RR3A 3VD2A 3GSWB 5AVTB 4LSRL 3O9WB 4JGUA 1URLA 5D7IF 3HZKA 5DDHB 3U0TB 1F11A 1FNAA 2ATAA 1YN7A 4GSXA 2OSLB 3LRLA 5HI5C 2EQDA 2V7NA 3LIUA 2NY6D 4QHMA 4DUWA 3OTTA 4F91B 1FGVL 3GM0A 4JRFA 4WHYG 5F0LB 3FT2A 5CIPA 4YE0A 3T0WA 2IDUA 4QRFA 2PPDA 2ZXDA 4HFWB 2P9RA 3L45A 3MOBL 1A6ZB 4JUSA 4KRLB 4DN4H 1B0GA 1MRFH 1H3TA 3RFZB 4IRZL 1S5IH 3C5ZD 1IILE 3DX4A 3FF7A 3FB6B 4PJCE 1MVUA 2DEWX 3BAIA 4FOMA 3MCYA 2V0AA 1I8LC 1UXMA 1E4JA 3I9PA 3X1BA 4JANB 1E6OH 4N2MA 3PHOA 4OAWB 1IC5L 3PAZA 2AQ2A 1TZAA 3TL5A 2XDHA 5DJYB 3H3BC 4L0YA 2OFQA 1SYVB 4FI6A 3VJ6B 2JKWA 1AZRA 4NM8L 3DURA 4RZCA 2G4GA 4ZO9A 5FYJE 5KJRL 1YYLL 2MMXA 1NC2A 4IRJD 3WEBA 1U95B 3MNZB 4ZS7L 2HN7B 4IIQB 4N2LA 3HZMA 4HIXH 5F9DC 4ZDHB 3GKZA 3BO8A 2X7LA 2NZ9C 3VDAA 2NXYB 5E2TL 5E1IA 3V5DB 3MQIA 3DX2A 2AEQH 2PNDA 4QWWC 5EIQA 4ZMZA 3PXJA 1RSYA 4HJGB 3W0WD 1A6AA 4Y9GA 2DBLH 4R96A 1I82A 3SQBB 5IGXH 3WOVA 1W80A 4ZNEA 1A1MB 1E3ZA 3D30A 1BG9A 3BKJL 3OQ3B 4GBXB 5KVFE 1R3JB 2AJVL 2UZXA 2W07A 4GAGH 3KGUA 1WCBA 1HYSC 1UENA 4GPVA 1J9TA 2Q3AA 1Q0XL 3MUGA 2IC2A 1Q94B 4OD3H 1DSFL 1PU0A 2YA2A 3PCYA 3HE6A 3DMMB 1WS8A 5F3HA 3SKJL 2ADYA 4N0UA 2DLFL 5F89A 2W38A 5EF2A 2KPNA 1TLMA 3MRLB 1XIWC 1QNIA 2IGLA 4FERA 3JWNG 1LTXA 4GRLC 1J9RA 5T1MA 2BZ7A 4TSBL 3MNWB 2R1YA 3AS1A 3MRFA 3WJLA 5B1BB 4DCQA 4YXKH 2A3TA 4MA8H 1N70A 1OCCB 2VXQH 3ZUCA 4BH7B 4EZMA 5CFAA 2FR4B 3GKWH 3I6KA 4UZGA 5F1IB 2VOTA 4LQFH 5IVXE 4I18B 4ZFZB 4BDVB 2IPUK 1QWNA 4LF3B 5DURB 1P5UA 1U8HA 1YPZA 3MRNB 5EZOH 5AVVB 2W81C 2PCPB 4AYSA 3BVTA 1LE5A 5IMMA 2NX5E 5E5LA 1N3NA 3I3EA 4RMWA 1PZCA 5BJTA 5FC9A 4XPFH 2P8PB 1N26A 2IAMB 3INOA 3WNJA 3HMWL 4NRZA 2Q7YB 3N41F 2QQNH 2V17H 1FFRA 3ELQA 4Y4KA 4K5MA 4YFLI 4AI7A 3ZKMD 2BSEA 3ARFD 2EXYC 3X14B 5F9WB 2XTSA 3F7VB 1OIOA 1XH0A 3MLVL 4QAMB 3QEQA 1F6AB 1QEXA 1BFVL 3JTSB 3L95B 2W8CA 3LV3B 3SBWA 4IBVA 2EE3A 4U3SA 5ESAB 4LP8A 4HS6B 2MNJB 2NY5H 4G6JH 1GPOL 2ROXA 1JWSB 2C3VA 2Q0ZX 3PP4H 4KJWD 1IGYB 4WUKH 5GGTA 4D3CH 4BHUA 5KYUA 4YXLL 1U3ZA 2UYLB 2FQFA 2HKHH 3MRQA 4UM8A 3VGEA 1ZWIB 3VQ1C 3CZLA 3FTGB 5JHLL 1YNTB 4J8RA 5I8OL 5C0CD 2DKUA 1X5KA 1AQHA 2B14A 1MNUL 1WCQA 2IOMA 1NMAL 2BIQA 3QC5X 4KX7A 3PV7A 3QUYA 5B1KA 3SDXA 5IUCA 1I8MB 2WLIB 2Q76B 3N40F 5TE6H 4A2EA 3QCUL 1A6TB 3OAYK 5HHOB 3S8FB 1KC5L 4XO5A 1QQDB 4J4PC 3FQXB 3ZKND 4GXUM 3E1ZA 3U1SH 2Y2WA 4X0KA 4WU5A 4QY8B 5BUPA 1JK9B 3MOAL 2E6QA 2JXMB 3ZRFC 3HPJA 4G8IB 5DCCA 1ED3A 2JV6A 3HMXH 3TBTB 3CNKA 2ENYA 4PG9A 4MSWA 1U8LB 3BQUD 1VFOA 3GS7A 3H42H 4FCAA 1KGJA 1DJYA 4P2RD 1E7VA 5EUKA 1AD0B 4UILL 2H1XA 5HYJB 4EI5B 3RZCA 3VWJD 5AFAA 1IBGH 2Y5EA 5EPMB 3QFJD 1BVLA 3T6ZA 1S5HA 5DRNA 4Z18A 4F93B 2PXYA 5CHNB 3FO2B 2EEFA 4B53A 4JRXD 2GBVA 3ULUE 1RZ7H 2NNAB 3ZZ1A 1CVRA 3JBG7 2K8QA 4WFEE 3BXNB 1QSEB 5C0NC 1E6JH 1A2YB 3WKQA 3WIAA 4PRAB 2FUQA 1R6VA 4MDJB 1S7QB 4QTHB 4ZUUB 4RNRA 3PV6A 4NKQB 3T6XA 5JQHC 4JE4B 4ORGA 2XTJE 4Z9KB 3WL9A 4KRMB 1AP2B 1CGXA 4FG6D 4MGXA 5FLVA 2CM6A 1T0MA 5ESVA 4XNZC 1BQHA 1BCIA 3F58H 1P6AB 3QCVL 5MERB 1C08A 2VWEE 3IDYB 4TVPD 5K39A 4BFBD 1CURA 4BSWA 3QI9C 4LAQH 1UKSA 5LDSA 4I88A 1BQKA 4ZMYA 3AUVA 4KDVA 2CJTA 5BVJA 4C4BA 3KH4A 2W88A 2QGCA 1L3NA 4X8CA 1JYNA 4LPXA 4TLTA 2ZNWA 4L2YA 2J6EH 3DTXB 1UWXH 3OD3A 4H8HA 4K7FB 3C5SA 1Q9OB 2DWXA 4GP5B 1DVSA 5F0MB 4A2GA 4AQ8C 1AXTH 4MJIE 4IOIA 5D4HA 4E5XB 4JW3A 3T3MF 3FUDA 3RY4A 4MYWB 4K9EL 3QXUA 3VGAC 1KIUA 1N64L 3ULVC 1MJJA 1VJSA 2VITA 4ZUSB 5LWYH 1D5ZA 3V5HA 1L0PA 4PJ9D 1GW6A 1R3LB 1BOGB 1QLRB 1EJFA 3LNFA 5DZVA 1OE3A 2AGJH 3QFDB 3BH8A 4O02B 5IB4A 3V9CA 1QRNE 2HVJB 2O5ZH 4MXQC 3CSTA 1JL8A 2VDOH 5E1QA 3HC0B 4OT1H 3R06B 1MUJB 3DXAD 1G9NL 3B8YA 1AANA 3E3QC 3BFOA 1OZUA 4EIZC 1OE2A 3VGHA 1Z66A 2DEXX 2EVIA 3C09C 5I66B 2WMPB 3GGWA 3C8DA 1CL7L 1F90H 3L3DA 2BWIA 2CLZB 1RMFL 1NCCL 5CJXA 1VF5C 3MO1B 4PJHE 5BS0D 4K3JL 1K72A 3RVWD 3W9DB 1RZ8B 4P5MA 2VSDA 4M1GL 3V6OC 2DJ4A 3JWOL 2R27A 2NY2B 4OZHA 4Y5XB 4JS7A 3CGTA 4FADA 1TZHA 1BAWA 2H1PL 3K6NA 1ML0A 2JE8A 2VDRB 3C08L 4AY0A 1FH5H 4PGBB 4YPGB 2H3NB 5I15H 5DMKA 4IU2A 1QHQA 4L37A 3S34L 4ZAKC 5I1KL 4LLVB 4LLQA 1OHQA 2XN9D 3QJVB 4JG5A 5IQ9A 4HKBA 2DQCH 3WFBH 1AFVH 2WINB 2X4RA 1EJ8A 1T4KA 4J5VA 1SLVA 1IQDB 1QRND 3QJOA 3DROA 4KI1A 2CUMA 3MRIA 3LAFA 4O2CB 1E6JL 5GS0L 1JHTA 1SMAA 3MV7E 4X5WA 1JZ3A 1JMXA 2D7TH 4Y1AA 1ZTXE 2HRPL 1JNNH 3MLUH 2VQ1B 1IL1B 2HJLA 2UX7A 2CU9A 2JB5L 3KH3A 4WV1A 2HFGH 3NZ8A 5SV3A 4HSQA 2XN9E 3ETBJ 5AZEH 1YEWA 4ORZC 4RAUA 2Q20A 3TWCH 4ALAH 2VN5A 2E8ZA 1SDYA 1ZT7B 3SDCD 3X1NA 4CJ0A 5CGYC 1AS7A 1QWHA 2ORBL 4A7SA 1HKLH 1GJWA 1PJWA 1JHKH 5ID0B 2BFVH 2HUEA 5FCUL 3B9EA 3LZFH 4N2IA 4X5PA 3GXNA 4UQ3B 4XMTA 1TJMA 2BS71 3DV4B 1NC2D 3FYEB 5GRVL 4AQOA 3O9WC 1MI5D 4HEPG 5JHDD 2DQIH 4XZUB 3UYOD 4G72B 4APQB 1ASQA 1NCTA 2B59B 4NSKA 3GBMH 3ZXAC 2FJHB 2FCBA 3CFNA 4XCCL 4HK0A 4JKLA 3QXWA 3BZ4A 4OZFG 1P5VA 5IF0A 4IJ3C 2RAMA 3DMMC 5A2IH 1T21B 5IROD 3ARSA 2BSRA 4RRPG 2F8OA 5JOEA 4DW2L 2VLKA 2F74A 1RJCA 2L7JA 4JM2C 1T22A 4AYFB 4YXLH 3ZBMA 2K45A 5FB8A 3C9NA 15C8L 1TZGL 3KAAA 1XF5B 1TF4A 5AZ2H 2MQ3A 3HE7C 3NSFA 3C5JA 1IEBB 1YEKH 4P46D 1DJGA 5I1IH 4L4TE 3HC2A 2EICA 5D1XC 1AS6A 1FL3A 5I82A 4AK1A 4CNIA 2PTTA 3S8WA 1E5ZA 4PBWD 1UACL 4Y4HC 4Z7WE 2HT3D 4RGOH 1BZ8A 3NEEA 4P9ML 1EXUA 2DQGH 1SEQL 3VWJA 4PVLA 5IVZA 4HH8A 1KEGH 2ICWA 2YQ2A 3ECQA 3GSUA 4B95C 3VA2C 4FQJH 4WTZG 3A3YB 1KIRA 1KJ3H 1CGYA 5IT2L 6CGTA 1OL0A 5LAXA 4C4UA 2P4AB 3U6RA 1JCVA 1U92B 2FVNA 2D8KA 4BK5C 1PLCA 5I6XB 2JSFA 4NN6C 5GZND 3PLYA 3E80A 3UMTA 2E74C 3GIZH 2MCG1 1AYOA 4MB5A 4CGTA 4XOEA 3VVVA 4PWEA 4D8PB 1HIMH 3MLZH 2R7EA 4MTMA 2GTZB 5DRWB 1KTLB 3N1QC 2OBGA 4BZ2L 1X7QA 3Q1EA 4Z3HA 4U1KA 5I24A 3NCXA 4POZC 5C92A 4K2UH 3FN3A 1JUFB 4HBQA 5B1CA 5CILL 3V4LA 4M00A 3T3PF 3VFPA 1L9RA 5D2LF 3ZR5A 2P44B 4TTGA 2ED9A 3LXUX 3ZRCC 4DP8X 5IK3B 1BVZA 1SQMA 3IMRA 5L2KB 1J1OL 3HNSL 1P2CA 3ETBF 4FHBD 1TETL 2P47B 4AGMA 1L7TH 2QSTA 2CNZA 3B9KB 3HVNA 3BSHA 1G1KA 4G9FD 2WZ0A 2Z8WC 1AE6H 4FFYL 4P9HL 3QRFM 4GAJH 4W9ZA 3JSSA 2F8VA 5TDNA 2DKMA 2LVCA 5J12B 1MH5A 2EIKB 2ADFL 5DQ9A 3IJSA 2YEZB 2ZYRA 2IQ9H 1EZLA 5J6SA 5HYIA 1OAKL 1IARB 2ZUVA 2HRHA 4J3TA 3BUTA 4Z7VF 3UACA 3LS4L 3WE6B 4KNSA 5I5RA 1WFUA 3T0EB 2CBMA 3IM1A 2QVFB 1XSKA 3SYPA 3HIZA 4CVXA 3FT1A 3TLRA 4NWTL 4K8RD 3C5XA 4F7MB 5B22A 4YX2H 2WVSA 3ISWA 3BSGA 3NACH 3V52L 3WS3A 1J88A 2HFEA 4ZFQA 1K8DB 1GIGL 5I6OA 3GJFB 3QUHA 2OP4L 3GMRA 3V4UL 1NUDA 3GBDA 4LOUD 2IPUG 4ONHB 2FDBP 1HHHA 4YAQA 2WV3A 4XBPA 3WO3B 5CMAA 1FVCB 3NN8A 5IKCA 4AYMC 3P73A 5DVLA 3TBWB 3TFKD 3IT8D 2WXQA 3UPRB 4NENB 1HAUA 1ETB1 4NN7B 3CMOH 2XTLA 1O5PA 1BD2D 2IPTL 2OL3L 4LCIL 1RUML 3QEHA 1W8EA 1OSEA 1CXHA 1PL3A 3HPLA 3TA3A 4APXA 1PG7H 3MUY1 1PY9A 4UNUA 3HAEG 1VCBC 5DD0H 1XO8A 4JKPL 4OUUA 1DVYA 3KL5A 4NQDD 4H2AA 1G7HA 1IFHH 3GYRA 5IESL 4F7CB 4FLSA 1N59A 5HHNB 5FF6B 4TOYH 1Z9SA 4AQEB 4OCSL 4KQ4H 3SDXF 2YAPA 3IDXH 1S7UB 2KDGA 4KQ4L 4ADJA 4NQXA 2IDQA 3F7PC 1F86A 3FFCD 3HC4H 2BJML 4RDQG 4YO0B 1KLGB 4ZW7A 4YHOH 5DLML 4GRWB 2WWMC 5HI3C 4AIXA 4OI9A 2HH0L 2AANA 1ZK9A 3E6FB 1E8WA 5GGSB 3FU0A 4DK6A 1EAPB 1J10A 5DJDB 1N6UA 5A6LA 1L6XA 1R1CA 2MQ0A 1EZVY 2DWEA 2Y1YA 3BPLC 3TCTA 4FLQA 1PY4A 3SDYL 3M86A 2BIIA 5K9OB 1RPQA 2E75C 4HD5A 3FN0L 1BIIA 2ITFA 3UJTL 1VPOL 5HGDA 4GINA 5M94B 3H1ZA 4RFNC 1KWGA 4PJGB 2QVTA 1SOKA 2ZXGA 3T4AB 3UPAA 1FNEA 3OR7B 2WNGA 4GW4A 3HE7D 1OW0C 4ODUA 3DJZA 4K94L 3AB0B 3VNYA 5FYJU 1XCQA 1IBDA 2VRAA 2X70A 4DQAA 5B39A 1YVLA 3SKMA 4DN3L 4LT7A 5KYXA 2FBRA 4YSTA 3UG5A 4LLYA 5F6HJ 4R4FL 2EE9A 1RFDL 4U1NA 1CYWA 2P43B 4UQDA 3VTAA 4L9LA 2PYEB 5KG9B 4M62L 3QSKB 3K1DA 4FQHB 2XG4A 4FZEH 1YMMB 2EC9U 4GXUN 4N2OA 4M6NL 3GRWL 3DRQB 5IBUG 3THML 4XNXH 4RAVA 4GSUA 2NYYD 1DUZA 1J8SA 1LEGA 4NNYB 1PS3A 4H13C 5FO9A 2F5BL 2HG5A 4DHLA 1V54B 3K72A 4Q89A 1ESOA 1IBZA 1WS7A 4RGOL 4X5QA 5CSZB 1SUHA 2IALA 1BV8A 3WIIH 5FEBA 4QHKI 5IHHA 1DQDL 1X9QA 3DIDA 4P9HH 3REVA 2FD6H 2J21A 1YUKB 1SVZA 4ODSH 1T1XA 4X4XA 3GSNL 3SBWC 4FXKB 4A2FA 2XN9B 2Y69B 3LH2H 3KPSE 3BP4B 5D1ZD 1BF8A 1BAFH 1EAJA 2YZ1A 2Y23A 3L5XL 1JI1A 5DA0B 4OZIA 4D9QD 1WT5A 1IKFL 3F6IA 3OKEB 3QO0B 3Q3GB 4R26H 4Z7AA 3JWDH 5JNYA 5BOJA 5EU5A 5E8PA 5KSUA 4KKBD 1RZJC 2WYTA 4PV8A 4QRPD 4HGKC 1XAKA 2XRAH 3VUAA 2LU5A 3GXDA 4NO0B 1H3VA 5EC1A 5FDWB 5C07E 3OKMB 1NFDE 2BHUA 4KUCD 3EH5B 1O7VA 5EBMA 3LKQB 4Y5YA 1AZBA 3JV4B 4PTUA 4JHAH 4P06A 3EJJX 2ZJSH 5F3BA 3J27A 2C3HA 3WJLC 3NABH 1KLFA 2C9PA 3UBXI 2X4PA 4M7JL 4HSCX 4B5ZA 4M1CC 4BZ1L 5I0ZA 3UTTD 4UV7L 4ZD3H 1IVLA 3K1KC 3D25A 4LLDB 5IT2H 1T80A 4J8QA 4HCFA 2PW1B 2CBTA 2FT6A 3AREB 5AALA 3FMGL 4KZCA 4TLSA 1D9KB 1NMCB 1TEGA 5AYUH 1D6EB 3ZTCC 4QRRA 4KWUA 2PCYA 5LQBL 1TQCC 3D08A 3STLA 1RJYA 4NLAA 3PPSA 1UACH 1WBZA 4PLKD 1K2DA 2E6PA 4PW3A 2XV0A 1GOHA 2O5YL 1A0QL 2ATPA 2CE6A 4RESB 3TEUA 1F8TH 2KQNA 1QFUL 3HNVH 4XVJH 2AJYL 4ZTPL 4M7KL 5DMIH 5FAAA 1KCVH 5DRZA 2R0ZL 5J9PA 3OJDB 4LSQL 3FQUB 3HRZB 4J1UA 5DZPA 2DYPB 2QSQA 1IGML 3IJYA 2P45B 2MKWA 2PPAA 3FCUB 1NIFA 3KZ8A 1LVEA 1VLXA 4YBQD 3QORB 1CGWA 5IP4A 3NCWA 4J7RA 3S96B 3TT1H 2PP9A 3QWRD 2ISDA 3WY1A 2GB2A 3ET9F 3RVTD 5CBAB 2QADD 5ICYA 4M6AA 1NLDH 3BMWA 2IGFH 1DQLH 1C1EH 4M7LH 2XWJB 4ERSH 1UZ6F 1TTCA 5C0FA 5E0FA 5C09D 1I8LA 1LO2L 2EYSA 2R8SL 2DM2A 2LLLA 2Z35B 5KN5A 3HC3L 2OL3B 3QHZH 1CFQA 1ZLVH 5AG9A 1KPUB 1XH3A 5ESQA 1D7FA 5JO5B 4ABWA 1SOXA 5DO2C 3NUKA 1FI8C 1MG2C 4U2YA 5KEZA 1AGDB 1XF1A 4HAFA 1U42A 3NZSA 3QIUA 1RKRA 4LLUB 3L3JB 2JJTA 2PW2B 3DBXB 4GLRH 2CJUH 5D70L 1AO7A 4PCKA 1TT6A 2DQGL 4H8PA 4N26A 1NBZB 3RFRA 2PO6B 4TUJA 2VLRD 4NUGL 1Q1JL 1VAHA 2WXKA 5DJAA 2RCSL 4NZUL 3CFEB 2Y7QB 4L5FE 1BW8A 3T0EE 1F18A 3D69A 2F54B 4FQLL 4MB4A 2C9RA 3RQ3A 5E1AA 2HWZH 5BRZA 3O2DL 3AS3A 3VSUA 3NJJA 5J89A 2NYYC 3LHPL 4NWUH 4WY7L 4F2FA 3TA3C 1RUPL 2XWRA 3QUMA 3SIKA 3L1FA 3BE1H 2FJUB 1KELL 1NCIA 4V2BA 4WHDA 5EEXA 2YAQA 1OGAE 5AYQA 1AXSB 4Y4FC 3HG0A 4WCYL 5EFIB 1SQ2N 2B7DT 3RA7L 3PJSA 5A16A 2J6EL 3KEDA 4YHPA 2A6IA 3NPSC 4AXWA 1T83C 2EDYA 2FEDD 2FL5B 3LQAC 2VTFA 4LLWA 2R4RL 5IEHB 5HJDA 4KXBA 2BHFA 4WSGA 1NMCC 1TQBB 1RZQA 4P3CH 1H15B 5AWNL 3KYAA 3VTTA 3OKLA 4GXFA 4FQIL 5CJQH 3RJOA 1JDAA 3LQAH 1YPZE 1JPTH 1FWXA 3ARYA 1IGFL 2FQGA 1PX4A 3GXPA 5F1OB 4X4YA 2IBZY 3GB7B 2FSEA 4OLEA 2AC0A 5E4OA 3GSOA 4M8QA 4JZOB 1M2VA 4HVBA 1UCBL 2FO4A 4HJJL 2EH7H 1QLEH 3K8KA 1ZSDB 1G9NH 1T7ZA 2NY0C 3NK3A 4Y2OB 3KM2A 3OSKA 4YNYA 4Y4FD 4EDWH 2EZ0C 2X7LB 2VDOL 1G43A 4KDWA 4PMEA 2XI9A 2DY2A 1ZS2A 2ZUWA 1UEYA 3RNQB 4OF5A 3RBGA 4A2MA 3VFGL 2PPFA 3P4NB 1Z3GH 4KUCF 4I85A 3SE9H 5I1HL 1ZGLA 1W72B 1ECZA 1KGIA 3UTPE 5KYWB 3DJ9A 2HVBA 3CZFB 5I30L 5ADPL 1GC1H 2AJ3B 1L5GB 2WLHA 4YBLB 1GCYA 3S36H 2A6DA 1MY5A 1AZNA 4JPIA 2BS9A 3L08A 4EN3D 3GNML 3F83A 5B3JE 2ENPA 2Q6WA 1H3WM 1KJ2A 3OR6A 4K71B 4R2GC 2XYBA 4NWUL 1JFQL 2J56A 3SEPA 4P5SA 4NHCH 4PJCF 5TE6L 3AVEA 4BCZA 1ODAA 1TEYA 4JVWA 1CDUA 2BVQA 4N0UB 5DO2D 5JW5B 1I7TA 4OFPA 4ZUWA 4JZNA 4Z0XA 4RSVA 4UNIA 1DQTA 5AVYB 2V5MA 5LGYA 5CZXC 3V0FA 1LO0L 2KDYA 2WWKT 3EO1B 4HZLB 3MNWA 3MRFB 3EBIA 4LOUC 5ISZA 5IWLA 1FAKT 1W91A 1HWWA 2PP7A 5DS8A 5IHWA 1CLZH 3KEHA 4LPWA 1DTUA 1KNOB 5C7XH 3LPGA 3O2VL 3Q5OA 5BPPA 4K8RC 4G80A 3OKOB 4NQCE 1R3IH 4OZFH 3U7WL 1RIVL 3ECBB 1XTMA 4LSDA 4F15C 1ZIAA 1ORSB 2BNQA 4P46A 3WFHB 3WY4A 2QPUA 1C16A 4JM2B 4NUJA 1TR7A 4GW5B 1HEZA 4IS6B 1UOLA 1JWUA 3HFML 3QIBD 3OJMB 3QNXB 3QUXB 1DQMH 1C8PA 4JR9H 4QOKD 2VMEA 3GS4A 5G4MA 1LO5A 1TJHL 1UB5B 3LIZH 2GSIA 1XD1A 1YMMD 3LV3A 4HZ1A 4LPYA 4H0IA 1BYNA 4A2LA 2GHZA 1INDH 1J8KA 4LEOB 1ZEAH 3LKNA 3OGCA 1CU4H 3WLBA 1EEQA 4NQVB 4HHWA 3TT1L 4ANKA 3H0TB 1D6VL 1YYML 4U1IB 1QSVA 1Z3RA 3NZHL 4MA8L 4XX1G 1T0OA 5JPMC 1I8IA 3UTSA 3V0WL 3ZKXB 4NO5B 3P69A 3KE0A 3VXRB 4MASA 3V4PB 1WIOA 3W9EA 5GS0C 1VESA 2GSMB 4M6OH 5HPMB 2Y9RT 3L4YA 4QPEA 3HB3D 2AEWA 2O4EA 3LXAA 3VI3F 3TJHC 2APSA 2FUTA 5CSBA 4N0RA 4DFHA 1F02I 1QQDA 2EKSB 5IM7A 3QJRB 3X12A 3IMVA 1LJMA 5EV7A 2DQFB 4YMPA 5GRWA 1M3JA 3DX7B 4G8IA 1RJZB 4NPJA 4WO4A 1HZHL 1GPOH 3MLXH 4UB0L 5GHWH 3BPOB 2NDGA 4PJEF 4PJEB 5J6GB 1E67A 4KNQA 3MC0A 1E28B 4JB9H 3VA6A 4KKBC 1GGIH 2DWTA 2GCYA 4ANWA 4HKJB 4EMZA 5E8EA 3FUIA 2WHVA 1U91A 5F6HI 2TAAA 3B6SA 3MLVH 3RRQA 4YSDA 3L3OA 4GRMB 1HXMB 5JIPA 2WUBL 2VB5A 1OANA 4F1ZA 5A6MA 3NBNA 4EBQL 2X3AA 1NL0H 2ZPKL 3S9DB 2AHIA 2PXYB 5CHNA 3FO2A 2OJZH 1NOFA 1SUJA 3HG1D 3HNTH 4P5TB 2BP8B 1CE6B 5ICXB 2NY6C 1FCGA 3EGDB 1T6BX 3MRPB 4WUUB 5TE4L 5JR1L 3QXVA 3BIKB 3F6LA 5C0BE 4B97A 4PRAA 4G6KH 4AWJC 3WNMA 4FG2A 5F70A 1ZJAA 1JZDC 2EIBA 2J5LC 3CPLB 3OHXA 5EO0B 1T7YA 1Z2KA 5GRXG 3AJ7A 5D93C 5BVPH 5IBTH 3IFPB 3T0VA 1XR9B 3POHA 2UXGA 4N2KA 4JO5A 1WAAA 1WTGT 3QEGL 1KC5H 4IMKA 1HEJC 2DIAA 1IEAB 1J1XH 2JH2A 2VJ0A 5IQ7L 4TSBH 1OCWL 1HH6B 3GO1L 5MERA 4E9QA 5GGTH 1CDYA 4HS3B 3PQYE 5HD8C 5BMFH 2CRIA 3TH4T 3N9GL 1GW0A 1TVBB 3GMPB 2AKRB 4L1SA 1YY8A 1MRFL 1N5YH 2Q8BH 2GEQA 5FV2A 4PMFA 5E9DA 4AZ8A 3D3VB 3V2AR 4EXPX 5CIPB 1HXYB 5KVDL 2P7TB 2F1AA 4Z7NB 3C5SB 3BAWA 4LDEB 4HPYH 3WFDH 2NY6B 2OTWB 3PQYB 5JW4Q 1UYWL 3O6FA 4ICXA 3H7BB 1CZ8L 2JCCE 3MBEA 4BBWA 3BDYH 2EDNA 3AADB 3JWNC 2ZKHH 5C08A 1YPZF 4L0ZA 2YKLH 1D5ZB 2OMUB 3A23A 1BGXH 5DO8A 1ICTA 2F6AA 3ZSTA 3G9VA 1IBFA 1SNRA 3UAJA 3GMOB 2VDKH 3S37H 3R06A 4GG6F 1LO3H 5HYEA 4Y2NA 5F9AC 4Z7NE 4L8SA 5IW1A 2JJSC 3WTVA 5LCVL 4LQ1A 4B3VA 3QAQA 3L3OC 4OGXH 2Z31B 3L5WB 1JTPA 2X05A 5M95B 2HT2C 4JHVA 3ARGA 5C2UB 1VDGA 5EZOL 3LEVL 4GI8A 1MIMH 4A6YA 3P30L 1H6TA 3PP3K 1UH4A 3LKSA 2ICEB 4OR1A 1MW2A 3B3IB 4Y88A 1SFDA 4PY7A 2EJ1A 1G6RL 5D6DA 3H4FA 2BHYA 3GZKA 2Y5TB 3NIGB 4TLKA 2E7DA 2IF7A 4HOWA 4FABH 4PAZA 5LCVA 1P6WA 2AEIT 3IDYC 1MZZA 5D72L 4AC2A 1JN6A 1AR1D 2WANA 2R2BA 1NDGB 4DN4L 3U36A 4JAMA 2UWEF 1ZS8A 2ZSWB 3RVWC 1DLHB 2WCSA 2F8IA 3DMMA 4PRNA 5C8JA 2VLJA 1UCTA 1YO4A 5AG8A 4LLMB 1A9EB 1DP0A 4U0RB 3IGUA 2H6UA 5FWQA 1AD9A 1XBRA 4DCQB 1S7WB 4NKOA 4OIBA 1U8NA 4JREC 4RMRA 1RP8A 3LRSA 4LCIH 3H9HA 3RJQB 3ENEA 4X7SL 3DROB 4Z77A 3H9YA 2Y25A 4HZAA 4WAFA 2PXYC 5E1GA 3SO3B 3GPEA 1IMHC 3P0YL 4AVKA 4LVHC 4LEBA 4HIXL 2GAZA 4AEFA 1QX1A 4OY9A 4TN9A 4WV1B 2CDGB 2IDTA 4JHBA 4LP5A 3CN3A 2XWBB 2C9XA 4JFEE 4NPKA 4YHML 3VFUA 1BREA 4MJIB 4YR6A 4IMLA 1XWVA 3ARUA 2NZIA 1E6OL 2WLZA 4AW7A 1CF1A 3BT0A 3F3HA 4G8GA 5TFSH 5F1NB 4UNTA 4HS6A 1CFVH 2ALAA 4GAFB 2C3VB 3KDMA 3U2JA 5IWLC 5E6IC 2ZX9A 3AQZA 1IT9L 1FYTB 1ET5A 1LDPL 1UADC 3PF2A 4X7SH 5D55A 3GSQA 4UT6A 3WYRA 5HVFB 2B59A 4NSKB 5FS5A 4XMLL 4XI5D 5JOFA 3JV6A 2XWZA 5CGMA 4X9HA 4BZ1A 5DHVH 2YC1B 1JTOA 3RY6C 3FRUA 4NNXA 1XGUB 3TNMB 4HWEH 4YHZL 1E5YA 1QASA 1ZHBA 2X6VA 1KV7A 2BSED 3DX6B 1RLWA 1XF4B 2ZG3A 3ASOB 1T1ZA 2ZT9C 2MIZA 2X53A 4F8PA 3MX0B 4JFFE 4U6VL 4X0KB 5BS0E 1JK9A 4R84A 4EUPG 5MEND 1C5BL 1FL3B 4PWIA 2P5WD 2PTTB 2QPEB 1QP1A 1TDQA 2D31B 4Y19B 5E0QA 2VQUA 4MMZC 1J05A 2IEPA 4KJYA 4HWZB 1EQWA 3CFJB 1TPXB 1J5HA 4I2XA 3GMNB 4OLWL 4WHCA 3UBXA 2X6MA 3F7KA 5ICUA 2EECA 3GXFA 1EPFA 3DJRA 3N40P 4OZ4A 3RZCB 1QR1B 4ZXBA 5GGVY 1UWYA 5HHOE 2O6FA 4OLXH 2E3VA 3BQUC 4F7EB 4X6CA 2W9DH 4FQQA 4LRNL 3FTUA 4AQ1B 1OGAB 1TQBC 4JN2A 1MWAH 3QG7L 4MMXC 1QSEA 4OGXL 3UBGA 2K70A 3WXWL 2V2XA 5F8RC 1K85A 5FK9A 1FSKC 3B56A 4MNQE 1DCLA 3I9GL 1EEYA 4HIEA 4A7UA 3I6SA 5FYKH 1I1RA 4U0RC 4ZUTA 2EUXA 3BEVB 4ZOCA 3F6JA 4JPWL 1FL5B 3T6QC 1AP2A 3QWQB 4PGCA 4HCRL 4NM4H 3O3EB 5I71B 5F6IB 3OMIB 3QJZA 2X4OA 4GS7C 4OKVA 3IDNB 2R23A 3UC0H 3CD4A 1JPFA 1R24B 3O6LH 4BSWB 4NAMA 2VDMB 2YUWA 4WJG3 3RIAF 4NKDB 3ZTEA 1J7VR 1OSPL 2JELL 3QNYB 2ED8A 2J8UF 2X12A 3MLSH 4ZPVA 1DO5A 1XCTB 1AQKL 5I17B 3NIGE 3F7RA 2A9NH 3ROLB 4PRIA 3WSQH 3SQOL 4HCRA 2WXRA 4PB9H 1GZHA 3IJ7A 2X1QA 1Z5LA 1Q8MA 3UGXA 4KKCD 5ABDE 5LN8A 3F05A 3WFZA 4XPHH 1QATA 4JJHA 4LSVH 1NICA 4Y9FA 4X7FC 5EZJA 5D1QC 1I8KB 4TF4A 5TH2A 2A1WL 2ZXWB 4UQIM 4QJ5B 5IJBC 1IGIH 4NHUA 1V7ML 4N8CH 4C54A 4IHBA 1HX0A 2VDPL 3WE6A 2C1OA 4FQXC 1I8UA 5E6IB 2HVJA 3AG3B 2ED7A 3FS9A 3BVDB 3QIUC 2WQAA 3FF8A 1KPRA 2WM0A 1ZHNA 3QQ3A 4PJ9B 4XHJD 2JI2A 3QWOB 4G3YL 1CDBA 3N04A 3KHQA 4Z7OE 4JLRA 1I1YA 3AACA 1IE5A 4K7PH 1NCAL 3HR5B 4LEXL 4PJ7A 3DSNB 3QR1A 1ADWA 3FPYA 4Z3TA 1OWWA 3VACA 4NZFA 4OLUH 4Z0BL 1I7RB 4HOXA 2HFGL 3Q44A 5I0DA 1INQA 3UAFA 5DJXA 1SJHA 5CJ8A 4KHXH 1S7VB 3JTBA 4G7QB 1G9EA 1IT9H 2C9SA 3QJXA 4XVTH 2EC9T 3VI4A 1PZUB 5D2NB 4XNDA 4YGVB 4IBLT 4LXFA 5EUOA 5KSVB 5I75C 5DT1L 2CKBA 4RWYH 4AE0A 4AVHA 4GRWH 4M4RA 1AGBB 1IAKA 1ZCRA 1R5VB 2X0UA 2IGTA 4RISL 3W39A 2DIBA 3X13A 3H9ZA 4KC3B 1QEWA 3HZYB 4ZNEE 2BP0A 2VMFA 5F7BA 3S97C 2CH8A 4H88L 1FYTE 2OMXB 4M7LT 4MB3A 1QBMH 4AYGA 2UXFA 3O3DA 4MVBC 4HKXA 1NUFA 1F13A 4FXLA 4PP2B 4NQXB 2WXHA 1MQ8A 2B5IC 1YEGH 4IKIA 1IQDA 1RUKL 3ELAT 3PWPD 1S3KL 2E27H 4HFWA 4U1JB 4MYPA 1MCLA 4XBEL 2CCVA 1HKFA 4XH2A 2PWGA 4L3CA 1I3GL 4YK4C 3UJIH 4P4KB 3ABZA 2X3BA 4JO3L 2VXQA 3FB6A 4I3SH 1LEIB 5A2BA 5C7ZA 2WXGA 1DJWA 2FYYB 1ZJBA 4NP4L 5LG6A 3NEXA 1VFAB 4JR9L 5B3NA 2V8LA 1WFJA 3FUFA 3VRLE 3LQMA 4XX1E 4H4NA 4DJMA 5I19L 1G7IB 3A47A 3DURB 5L4FA 1E4KC 4KDTC 2OJEB 1I1FA 2R4SL 2ZQKA 2X4QA 2RB8A 4L0PB 3RU8L 4PW9A 3D2TA 1MFEH 2Y1ZA 3RB5A 4C4KT 1R3IL 1I4FA 2MEJB 4GUPB 3VSVA 3ZHDA 3L3IB 3IF1B 4XPGL 3JYBA 3MJ7A 2Y7SA 3U0WL 3PWPE 1QD0A 3BZ4B 1KUMA 1XDTT 4LGSB 4MDIB 1P4LA 5B38G 1K8IA 1JZ4A 2ZAHA 4F1SA 5K9QG 1UASA 1A1MA 3EJZD 4R7XA 1ZANH 2AABH 2GYSA 1OPGH 4ZFGH 1ANUA 4GBXA 4Q0XH 3B1TA 2VLME 2Z4QA 5IREA 2YA0A 2QQKL 4XP9L 2OMVA 3N42F 2Z93A 4KI5D 3OWRA 5H94A 5K33A 4HUUA 3ECUA 3MODL 4TVPH 1RP9A 4LKXA 2ICCA 2BSSB 3OZ9H 3ZTNL 1TQWA 4H8WL 5I73C 2KZKA 4X8JA 3WKML 1E5AA 1U4EA 2MCAA 4G6AC 3VGAB 3QO0A 3T71A 4AX3A 1FCCA 4LLAA 1KB5L 2R1YB 1W0VA 1SY6A 2IV9A 4RSYA 5DVPA 3GSUB 3VFGH 4Z7QE 2BWQA 5FYJH 1E9OB 1FFNA 2VO5A 3KCPB 4HC1L 3S5ZA 4OQTL 1YHPA 1ZXKA 5SWSB 5T33H 3MRDB 3T1FA 4EDWL 3G6AB 1UA3A 4Q58C 3N50A 2YGOA 4FQXD 5JDSB 1DL7L 4ONFH 3BHBB 5AVWB 4K07A 2Q8BL 2E8YA 2J8UE 4X7TA 2ZP0T 2XACC 3ZL4H 5CD3A 2W9LA 3IRPX 5CP7A 1AXIB 1UURA 3EUUA 3CMGA 4WSKA 2WKOF 1OALA 3G9AB 2WCGA 5KVEL 4ILDA 1L7IH 3CH1B 2D0GA 4NC1C 3DUSA 3CVHB 2OYPA 4R2GB 1WBXB 1A4JA 3P77A 4KKCC 1FYTD 4L1LA 2HAZA 4OSUL 5I8CA 3MACL 2YMXH 4UT6H 3UYRH 3RVVC 1EJ6A 2ZX7A 5L2JB 2NNRA 3DPBA 1JWSA 3FBKA 4L3AA 4PRID 4WZ9A 2VUKA 1S78C 4JHZA 1MEXL 4ANUA 2YK1L 1T2QH 2VIRA 4A7GA 4MJHA 5SX4I 4P2QE 2DMCA 3PDGA 2VLLA 1NMAH 4ZBJA 4W9KC 2CO7B 1ZLVK 2BOCB 3ZQWA 3M45A 4DO4A 5KOVC 4K8RL 3ESOA 3ABKB 1J12A 4CJ1A 3QUYB 1PDKB 3KBPA 5MENB 4G1MB 3TN0B 2NY0B 3AROA 2NSMA 5ENWB 3B2VL 2C7FA 2VMCA 4NRXA 5GPRA 4EI6B 4M7KH 2XPGA 4HU2A 2X2UA 3I84A 3FN9A 4TYUA 4H5SA 3UO8B 2FB4L 3IFNL 2ZAIA 4PY8J 1CD1A 4YSEA 3HPJB 1F00I 1E40A 1ED3B 1KGWA 4WNQB 1BPLB 5EUOE 3MGOA 3T4AC 3WS3B 3QXDA 1NIBA 3MFFB 2DM3A 5IW6B 2ZYSA 4V1DB 2EYSB 1R17A 5H35B 1CQKA 2VZTA 2VRKA 1II4E 1AD0A 4UBDD 3VM5A 3FRPG 3WXVL 3V4VH 1DZBA 3B9AA 1OCOB 2HLAA 3K46A 3EH2A 5K59F 2BIPA 1DDHB 3TWYA 4Z23A 2N1KA 2JTDA 2X5PA 4ZNCD 3ARDB 4JO2L 4ZMVA 4ANVA 3FFDA 1KTBA 2AJXL 4LQFL 1FLRH 4K3DL 4Z8FL 3HN3A 4OJEH 4C8XA 1FNLA 2PO6A 1YEHH 4TUJB 5KJ7E 2FLBT 5HJBA 1KTKE 1GZQB 4DUXA 3WL9B 4XCFH 5H37A 3EG9A 3KPTA 3LKRB 1T0MB 5ESVB 5HHNA 4N5EC 4XRCA 2YIHA 4XMZA 2OCJA 3QJSB 3L48A 4N2FA 3BP7A 1T6WA 1TYEB 1S3RA 2EVHA 2AJUH 2BDNH 4WKZA 4WUUE 3RX7A 1QBLH 3HHMA 1ZMYA 5BVJB 4MCNA 2V8MA 1Y6KR 5HDLA 5DMIL 4BZ2A 1ZE3H 3VH8B 3FT3B 4PRIE 1JPST 3IE4A 4MAYA 1A6ZA 4OFQA 2VGLM 2DJMA 3HS0B 1R3KA 5I6XC 3RFZA 4IOIB 3QCTL 4XP4H 1ZE3C 4E5XA 3NK4A 3VXRE 5E24E 1CICB 1X3DA 4OLYL 4KXDA 1W72H 1HE7A 4Q7DA 5CLTA 3H4HA 2AQSA 1R3LA 2IIJA 1AQ8A 3M7FB 1A8JH 1GCFA 5IB4B 1FGNH 2W92A 3QH3B 4FFYA 2IWEA 4IGBB 5BQ7A 1IAOA 4M8UA 4P23D 4E9RA 1NCBH 3GSOB 4D0BA 1YMHA 3AITA 3H2WA 2HN7A 2VAAA 3MNZA 4XXCA 5FYKE 4P48A 4U1MA 5JLZA 1MFDL 5AAWC 1NCWL 3ILQC 2BOBB 5ISZE 4IRSD 1MHCB 4S1QL 3C5ZA 4F7TB 3QR2A 3WD5H 1MY7A 4CC0A 1WC7B 3NJGA 1OT4A 3NRPA 3RGVC 4E41D 4G7YH 4UCFA 5EU6B 5DHVB 4LEEA 5DZOA 4L4VA 1INEH 1GHFL 1S7XB 4Y1SA 4ZX4A 2WLYA 4JM4H 4U6XA 1GAFL 2IALB 2DMKA 3RX8A 1AR1C 1AG6A 1E5UI 5FGCB 5BXFB 3GXIA 5L0QC 2WXPA 5EO1B 3EYVA 2ZCLH 4LOFA 2XQBL 4AYEC 2AJZB 5D7HA 1WGOA 5IMLB 1AS8A 4NYLB 4FQCL 3VGBA 4HKZA 4R5TA 5FR3A 1UWEL 3K5SA 3MV9D 4DZ8B 3POCA 3D33A 4YHYC 2QMKA 2KZBA 1SN0A 2D03L 2H2PC 2YQ3A 32C2B 2Y5QA 5T3ZD 5D1ZB 5EU5B 4HKBB 2EZ0D 1OTSD 3AABA 4NQEA 5H37H 1JZ8A 2X1XR 3GLZA 3I6KB 5F1IA 2CBOA 3VDBA 4OCYH 4ZFZA 1NPNA 4X6CF 5D1QE 5FUZH 2BP5M 1A4BA 5EBMB 1JNHB 2EADA 1XF3B 3SGKC 4RAHA 4M4PA 4ODBD 1BZ7B 5BO1L 2F7PA 4N6QA 2FATL 3BT2L 1AVAA 1UM5L 3PL6C 2GITA 5MEOB 1ACYL 1FIEA 2XVLA 3ARXA 3NGBB 1GZPA 2ZOTA 4ELMA 4YDJB 4XNZB 3FRPA 4LAJH 3A5VA 2D2CC 2H0FA 3GDCA 4PIRF 1OAQL 1NAMB 3BH9B 2YAEA 3H9SE 2OZ4H 3V0GA 3DJSA 3UDWC 5JUEH 2DDQH 5IB3A 1IC7H 5KVGL 4ES9A 1TVHB 1WFMA 4YX2L 3H6JA 1H5BC 4Z7WF 1S6NA 3ILEA 4XWGH 1MJUL 3RTQB 4QF1A 1PAMA 3SGJA 1LQSR 3ZY7A 2ATPB 3BGFC 4UM8B 2R15A 1YEFH 4ZFOB 1QUPA 2EEAA 2FECI 5PAZA 3FTGA 3AG2B 4PJ8C 5H37G 2FJHA 3H54A 2DL9A 2CLRB 2XZZA 5AW7B 4HK0B 4NDMA 1XGTA 3EYFB 3NCBB 4H1LA 1VERA 4TQEL 3V5KB 5GRYA 4DGYH 4YFLF 5ABAA 4KTDH 4LHUA 2JLPA 4XBGB 5B8CA 1Z5YD 3SY6A 1NGZA 1QFOA 4QLRA 4XNYH 3TIDA 4RMVA 4YXHL 5TF0A 4TOYL 3B37A 1E4XL 2GT9B 4OLZH 4XVSH 1IC4L 5B3JF 5TQ0L 1Z0NA 2FO8A 2EDFA 1VZGA 3FK3A 4AGLA 5DD0L 4YHKL 2VZVA 3LMJL 3B43A 2CM5A 5J3HC 4YEFA 4RDBA 4PG9B 3DX7A 2J57A 1KIPB 1NFIA 1CUOA 3I50L 5HVHB 1KB3A 2DQTH 1A3ZA 2Z35A 3EBGA 4EOWH 2F8XC 5SWSD 3AQXA 3K6SA 2WUCH 1A22B 5C0CA 1IGTA 1KPUA 2UZIL 2BFGA 4M56A 3S35X 4FD0A 3L3OB 1F58H 3D0VB 1ZHLA 2IAND 2YQBA 2EDMA 4U4BA 3V6FB 2HTKD 3A6CL 3SE4C 3T8MA 3MLZL 3VXOA 1CT8B 1N2RA 4TQHA 4HMEA 4WK4B 2Y7LA 2XN1A 4LLUA 1KJ2H 2N7SA 3B7TA 1ADQH 2WLMA 3FO9B 3CBJB 4HIPA 2C8NA 3BIKA 2K7PA 2MWCA 5JYLA 4UM9A 5BZDB 2F9BT 3VWKA 2JKJA 2VE6A 2YXMA 2NXZC 2X0VA 4ELMF 3CFCH 4QYOB 4PCTA 1KCBA 5JQ6L 4Q4IA 5DJ2A 2Y7QA 2PCFB 3FHQA 1P7KB 1ONQB 5KW9L 3VXUA 3RAJL 3IRCA 4F24A 3WKYA 1C08B 2FGWL 2F5AH 3RWCA 3EFFB 4WGWB 2FEJA 4B9IA 1S9VA 2IMNA 3CZKA 3R0NA 3DHPA 5CJOL 1GC1C 3LZPA 3IXTB 4QXGL 2HX7A 1PNDA 3R1GL 3LKOB 3NJIA 3TS8A 1FZMA 4M5SA 3VFSA 2L7UA 2CUIA 3HS8A 2ESVA 2W60A 3A0OA 5IEHA 2VL5B 4K3HA 5E2UL 4YDLB 1QA9B 3RWHB 3SPGA 3T77B 4MJ4A 5L9DL 2OTUB 3PQYA 3TV3H 3C09B 2LW3A 2GFBB 1P7QB 2L7EA 1JGLH 4M1DL 1IM9D 1UWXK 3N85H 2RTTA 1LXMA 3D8MA 4U6YB 4FKKA 4XCFL 4HK3N 3JWNH 2BC4A 4XVUD 3SJVD 3GBML 2G2PA 5JOPD 3L4TA 2FSDA 4KO5A 4QJ3B 3KLKA 3MN8A 4EIGB 4NEHB 1D5XB 4WTWA 4XPTH 3BOVA 2IG2L 5AOZA 5GRUH 3I2CL 1UQSB 3TJEH 2Q8AL 3T2QA 2QKSA 4JKMA 4YHNA 2QZQA 3WUWA 3B7YA 2WMPA 5DJCB 2ZWSA 3FOLA 1TFPA 4YE4H 3IFOB 3UPCA 2W80C 3U9WA 2L7QA 4ZPTB 5CMAB 1F0LA 8FABB 3EUDA 3FNKA 3D87B 2K4AA 5D1XE 4OBSA 5JIDA 3OXSA 3W57A 4F2MA 2HJFB 3QGVA 2BINA 3SDXE 2AS5M 4TSCH 4MZ2A 2W0FB 2VH5L 3KPSA 4JCLA 1ZDQA 3QUML 2CK0L 2DM7A 4Q97A 2HRPH 1IZKA 2YOAA 2W91A 4XMPH 1F2XK 3QE5A 2R0KL 1T04B 3EOBB 3FC8A 4IEFB 5E4IA 1WO2A 4ETYA 5KS9E 3U36B 2A77H 4HV8A 3VD4A 2I25N 4L3EA 1DLHA 3NSXA 2NW3B 4ODHH 4XB8A 4LCUB 4NX0A 5I1EH 1V55B 1N59B 1FVDB 1L0QA 2UWEA 5F7EH 1HHIA 3KYKH 3RVVD 1JZIA 4QXVA 4G9FB 1FJ1B 1XH1A 2R29A 1ID2A 1U2CA 1ZXQA 2YWZA 3JVGA 4MJJA 4W4NA 1UTDA 4DP7X 5I15L 4JJOA 3S37X 5D7LA 3NPZB 1AD9B 4F7PB 2OXGB 4PJGE 1TTBA 2EDQA 1MXGA 3N6YA 3MBXH 2K3TA 4K23L 5FA4A 3K2UH 4DAGH 1V8HA 2VJ8A 2P8MA 3A67L 4HIQA 3KLLA 3SPVA 4GW1A 3P40A 4JFDA 4X5WB 5GS1C 5K1JA 4KZEL 5CJBA 4EN3A 4M5YL 4XO8A 1LK3L 2CWRA 2FEEL 1ETZB 2ZCKL 5FXCH 1YYCA 5CEXB 1UM6H 2FK9A 2P80A 4FFZA 3MBED 3LVTA 3WJJC 4UYPA 2VM4A 2VZ3A 3BZFA 2V7HB 3MRRA 1PCXA 5I1AB 1CQYA 2Q7AA 4YWGH 2FEDC 1XCQB 4G6AD 4QNPE 1MVUB 3HZVB 2BNQE 4KV5F 3PWLB 3PHSA 1LWHA 2F7IA 4E41B 4HIHA 4BXSV 3KDMB 1EO7A 4L9LB 1BD2B 4KI5C 1XIWA 3PXHA 4U1IA 4ZK8A 5CF3A 2VR3A 1MW0A 1I8IB 4RAVB 2VISB 4KI5F 4MD0A 3PYCA 3BZ5A 4LSPL 2PR9A 1FA4A 3WIHH 1ZVSA 1TVDA 3CCHB 4C4KO 1KEML 2DIEA 2P52A 4FLOA 3K4DA 3V5DA 4I1PA 5FOBA 3QUZD 3T4YB 3FAXA 1NCWH 1UOWA 5KS9A 3HR6A 3VI3A 2QVIA 4BH8A 2E4TA 4GP4B 5LVEA 2CGRL 4YIQA 4ZX6A 1YNKL 1Z6JT 4NWTH 2AVGA 3HHSB 1RZKC 4GAYA 3NIGF 2NY3D 4ODWA 1M71B 4LIQH 1KXVA 1RK0B 1X5JA 5C9JA 5ALBL 2XOTA 4YDIH 2ZOLB 2JCWA 1KJVA 5MP6H 1C8QA 3MV9A 3RTLA 5F96L 5C6PB 5IVXF 2ICWB 3UBXB 5JNYB 5KAQF 1X5FA 3CX5J 5CEZH 2CGYA 3G04A 3C2AL 3LJ3A 5D4JA 3HRZC 5DZNA 4YQXL 2G75B 5DD5L 5F3HB 3KM1A 5JPNA 4F7EA 4NZTL 5T5FL 4AMWA 3MCLH 1WA0X 5HVWA 5DWUH 3IJHA 2J12B 1G0DA 1DFXA 4JG0L 5FGBA 3DYOA 4PTUB 5F3BB 4E9SA 1AACA 1TQSA 4GQ9H 2PXYD 4LNRA 3CV5A 4RETB 4B7LA 5EZPA 2OMZB 3ZZQA 1A7PH 2I9LA 3IPFA 1RZKL 1ZLSL 4AL8L 6FABH 2R0LH 4HUVA 2PABA 3EBHA 4Z78A 4N28A 5F7YC 1EHAA 3DYPA 5LWYL 4ZTOH 3MAWA 3VB9A 1ZKAA 2OV0A 1D5MB 1O6SB 4RFEB 5I23A 1OSZB 4OZGA 1AXTL 1BX2A 2Q10A 1E9QB 1DFBL 3QNYA 1MIEH 4EXKA 4FTVB 4OTXL 1NUGA 3MI6A 1F6AA 2ZUUA 4TVUA 2EIEA 4M5ZH 4KKLD 3ZGIA 2VR6A 2WPGA 2WKGA 3D3VD 1P1ZB 5DSCA 4ZMOA 4A37A 2XKNB 3RHWF 5KYUB 1KEGL 2GJJA 1E8YA 3CDCA 4XNMA 3BPLB 4P9MH 1FNFA 3NCCB 4KK5C 3BVWA 4YSSA 2DWDA 4U6TA 3T0EA 3VD5A 4HH9B 4JDVB 3ASNB 4MLSA 4B5EA 3OAYH 3HTLX 3GMOA 4YHLH 5ICYB 1PNCA 1YEKL 3SZ6A 1XX9C 3AGWA 3S35L 4G6JL 4PJ9A 4O51A 1MPAH 3CQQA 5IIEB 3DSNA 5F9OH 1A64A 5BQDA 1UG9A 2K0RA 4PP1D 2GUOA 3V4VB 5HGBA 1JZ2A 5H2BB 1T5XB 3PUUA 4MA3B 2YHGA 3KPPB 3GZQA 4N8VG 4Y4HD 4WFGE 2IPKA 2WIIA 4AJWA 4FG4A 4BUGA 4KTEL 2QMJA 3Q05A 1AKJB 1Q1PA 2CIKB 4M9OA 1UXWB 3QAZB 4I9WD 5EUKB 3B9VA 1AO7B 4C57C 1NDMB 3P11H 3NFPB 3L2LA 4G7VL 1RZFH 1QMUA 3APNA 1CYXA 3G6DH 3FBQA 4PGEB 3JT2A 5CFHA 3OLIA 3SDDA 3T3PB 1UZ8A 2QSCL 1ORQA 4PUBH 2Y1AA 5JW3H 5TF1H 4FNRA 2E59A 4CU8A 2G9HB 4G7VH 5B38A 1IGIL 5HGHB 1DZ0A 3VYPA 1P4IL 2PR4L 2DTMH 3VDCA 5I8EB 3MRHB 4JRLA 2Y2TA 3QIWD 4IOSA 1A21A 1A5FH 1P84J 4FNTA 3UDWA 2VDRH 1AXSA 1Y1DA 3O9WD 3UTTE 4AGPA 5K5YA 1LE9B 1EFXB 1P7HL 3VFTA 2AF2A 3MROB 3QDGB 1ZDSA 2E76C 1P7QD 1DBBL 2TSBA 4FL4B 4OD3L 4GP8B 4R4BA 3VFWA 4G6FB 1KBGH 3D34A 3IDJA 1KYAA 4CC4A 2XSKA 2IANE 1HQRB 3DGDA 4UQBA 1CFNB 3F2LA 5C71A 4OZIF 5AOKA 5GXBB 3S88H 3SDAB 2NY5L 3B1UA 3EJPA 4BM7A 2KLTA 4QHLB 3FTZA 4QRRE 4Z5RB 2WSDA 3B2VH 2XWBA 5HGDB 1SHXA 2BVOA 4FKHA 3QYNA 4B50A 1RCYA 1LEIA 4QOKE 3QBTB 1D2PA 4JKKA 4RGMC 2IQAA 4TNVF 4A6YH 1FNEB 3OR7A 4GW4B 3ZQ9A 5I74B 1LNUB 4H8WH 3HMWH 3S98A 2C26A 2DQEH 3GB7A 4OFYA 4Z7VB 4HMCA 1LD9A 4JDTH 3ZSSA 3IMBA 3HS9A 4AUJA 2L04A 4P8QA 2DQJH 2XYCA 1FBIL 4BCXA 2CHXA 3BAKA 2W0LA 4Y1AD 4Y2OA 5BS0A 4Q0XL 1OGPA 3ZE0B 4DERA 1EIBA 3LZNA 1A9VA 2CRMA 4G5AA 5AUMA 1IC5H 1M9SA 3MA7A 4G8FB 4KK5D 1SYSB 4NCDA 5GSVA 5C09A 4KJQD 3ZDZF 3IGLA 3L7FB 4GH7B 3QIBA 5I6KA 3QPQC 3G5YB 4NO2A 3Q6FA 4HAKA 2O93L 1IU1A 2JVUA 1WUZA 4IRZH 4U1GB 3RVXD 2O5XL 5D2LB 1Y6MR 1JMZA 5JZ7C 3ARBB 2OMVB 4JPIB 4UT7L 2CLZA 3KBEA 3LN4B 3QQXA 1XMEB 2VKWA 3ARZA 3P0GB 5ISZD 4XXDA 1L6PA 1RZGB 2AEPL 2PYEE 5F1KC 2E9BA 1WWBX 4JG0H 3D85B 4WQOA 5IJVA 5HHQB 4PB0L 1ZHKB 4GO6B 3ZIMA 1Q0EA 2OXHA 4U1SB 3O4LB 1PD6A 3CHSA 3EO1A 5E8OA 3RWIB 3N43F 1E8XA 1BQLL 5DRXB 4AMKL 4BA8A 2V9QA 1DEEB 3N06B 2DQDL 1PW3A 4KFZC 4X98A 1FP5A 2F58L 3NTCL 4XMWA 3FCSB 3CFDB 4OCRH 2B4CH 4W6XB 4UU9A 4DVRH 4WI7A 2XVKA 3KLAB 4MXQD 1RJLA 1BXXA 2GBTA 5DEZA 4PVBA 5EU4B 1KLFB 4JFOB 4NM8H 1OPGL 3MRIB 3IK2A 2CCLA 1FDLH 3KS0H 4PY8I 5DGRA 4ETQB 2J5WA 3KPRD 4KK9D 4YHMH 3LRGA 3O3EA 2NT0A 1W0WB 5KSAC 1A4JB 2P5ED 3HI6L 1I85A 1J0HA 1FZJB 5E99H 3S5LA 1RJYB 2FT7A 2O26U 1G1OA 4NJ9H 5EUOF 1NGYB 5ID1A 3BN3B 2NY3C 3OB8A 4DKAA 2P1YA 3JWOC 1P4BH 1XCTA 3DV6A 5GGRY 1HK6A 2R4SH 3B2PA 4KMQA 4XP1L 4CVUA 1ASPA 3S6CA 5B7FA 3DOHA 2VIRB 3S3JA 2VXTH 2PO6C 4IHOB 2R2CA 1O9VA 3WEAA 5L4JA 3UTSB 2QV2A 3QUZC 2DW5A 4PEEA 3DV4A 2A83A 2J1YA 1NAMH 3V4PA 2VKXA 3REWB 3L17A 5DC2A 3WGVB 3GMMB 2ZD0A 2G3MA 1SOQA 4DTGL 3QZNA 2R69A 3U46B 5MENA 3VXUD 3BSZA 5TDPB 1OPOA 1MJ8H 3DK2A 3EH3B 4NZDA 4P5KB 3KYMA 1UWGL 5LAPA 3CLFH 4XBEH 4PGDA 3L9YA 1CGVA 3SO3C 1FO0A 2EP6A 3MOAH 4P4RA 1CD1B 5FGRA 1FZOA 1VACA 4XCYB 4WO4B 3EFOB 2N56A 1FG9C 1UEMA 1LYQA 2BZDA 4JLRB 2A6KB 4PJDE 3HR5A 3BEWA 2I60H 3G6JF 5C3IA 5AW0B 1PLGH 1U91B 1N5AA 3UERA 5J13B 1RURL 3ZTDC 2X9ZA 1G7PA 3X3FL 3QRGL 3FB7A 4LHJB 3T9WA 3C60C 1B0RA 4MJ6A 1FO0L 4QOKB 5DK2B 5E56A 43CAB 2ZTBA 4QUOA 3VWJB 1PX8A 2APFA 3FFDB 1T4WA 2F2HA 4KVNH 1H3PL 2O6EA 4Z7UA 5DS1A 5B1JC 3OKKA 5J11B 1DVFA 4G43A 1BA9A 1A6PA 1FFOA 5LAXB 3QR0A 2R0KH 1RULH 4YDKH 2VXSL 1OHZA 4IRSA 5BRZB 2CK0H 3EYUH 2GJPA 5JW4M 3MRGB 5HD8D 2EE6A 1HH6A 4I9XA 3QUMB 4JFPB 2OSYA 1MHEB 3O3DB 4ODVH 1BVNP 4MJ2A 4OUOA 3EO9H 3GMPA 1BDYA 4PN6A 4Y0GA 4XP5H 4K7PL 4LEXH 5EFIA 5KVDH 5MHSD 2DMBA 1JUFA 4LK4A 3VH8A 4LSUH 3V7AG 2VN3A 3WLWD 2Y07H 4MRCA 4PJFA 5A7EA 3P0VL 2F7RA 3N44B 3U7AA 3IDIB 2EIZA 1WUNT 4LGRB 2VXQL 5GGTL 3DARA 5T1DH 4MD5A 4PQXA 3RIFK 3ZRSA 3AY4C 3D48R 3A4EA 1TJIL 4ZAKB 3OPZL 5KSBE 3ZDZE 1N0XH 2BY3A 3Q01A 3K7UA 1C5BH 3JV5A 3LY6A 3FONA 3ABLB 4M8QB 5F7LB 2XZAL 3OAZH 4FGMA 1R47A 2VC2B 1WEJL 2OJEA 3IJSB 2BHZA 4X9YA 2X4QB 1NSNL 1A6UL 1SM3H 3ML9A 1XL4A 1OV8A 4U1MB 5JLZB 1N6QL 5HSFA 3Q1SL 4GUPA 4X7DC 3ZMEA 2KL6A 3CSBA 2IADB 2XNAA 3FZUD 3JYCA 5DZJA 1OTTC 2V4LA 2ICEA 1PD0A 3BDXA 5A3ID 3PGCA 3L16A 1B2WH 4WW2C 4ZFOL 1CI5A 2VN4A 3EJQA 3K91A 3QA3A 4EUPA 3AWFA 1KACB 5CS7A 3CVHL 3IETB 3W0WA 1RVFH 1YEIH 4LP4A 3KWUA 2ZOOA 5H94B 5LB1A 5DS2A 3DX1A 1RZJL 1Q9LA 1IFGA 3MNDA 4RX4A 2P5WE 3DUUB 2RA1A 4BFIA 2K7QA 4F8OA 1Q72L 4YS4A 3N44F 3GJFK 4Z3GA 5F0PB 3QEHB 3BQVA 4MNHA 3VG9C 2OK0L 3CZGA 3AC0A 5DHMC 3RPIA 3GC3A 4FXGB 4JFHE 4BUHA 4GT7A 3DO7A 2RHEA 4B9FA 4LBAA 5D1ZA 3QZMA 4PJ6A 4XI5C 5IMKB 2VABB 2IWGA 3U4BL 1KG0A 3CXDL 5E9DD 1D6VH 3AU1B 5B21A 2HSIA 4MQXD 1Z9SB 4HC1A 3INUH 4KOBA 5JIQA 1OTTD 1ZRUA 4ODXA 3FZUC 3ECBA 4JRYD 3D4ZA 5T1LA 3T65A 4QHMB 1QSZA 3MLYL 4L29A 4NUJB 4LPVA 3O6FD 5CD3B 1A6VL 4NS0A 5CP7B 5MEPB 4ODVL 5I1LB 5GGSA 3LN9A 1B0GB 4LBEA 4AUYA 2ZP8A 3H56A 4L4TB 4U6HA 4XNYL 4IYKA 4A7VA 3H2QA 3JVGC 4IQHA 1VEMA 3F12A 1J0IA 4XMLH 5SWSE 3LH9A 2UVFA 3MRBB 5L2JA 4BQ6A 1I9IL 1NCOA 2F08A 4N9GA 2ZWNA 2R0WL 4FC3E 1BP3B 1T7VA 3EGXA 4JANA 4R2GD 3DNKA 1U21A 1QSFD 1NGPL 4NJ9L 2B5IB 3BP5B 5HI5D 5FKPA 1VIWA 4U1HA 5TFSL 3GSQB 5JOFB 5DC9B 2X70B 5F7KC 3GRGA 1NC2B 2CO7A 5IZ7A 4OIIL 4DP4X 1FAIL 3ARBD 3W9EB 3HZMB 4APQD 5KANG 1RIHL 1NEUA 4LHUB 1RURH 3AMLA 4PCYA 3ZK0A 2VZSA 4JFHD 1T89C 3QEQD 3G3LA 3TN0A 1DSWA 4BKSC 1UFUA 1PBYA 3K0YA 3KPNB 2OYMA 2XG4B 3D85D 4OU3A 2PPEA 5CN2A 1A6AB 3HCVA 4QXTA 2OCCB 5AVSB 1CGUA 5GGVL 4R96B 5HI4D 3O8XB 1U8JB 1ZLUH 1ACYH 3SQBA 3U4KA 3WV0A 3ECWA 3O41A 1BD2E 2CO3A 5JQIB 1AQDA 1TNMA 4HJEA 2FYVA 5CSZA 1NANH 1LP9E 1YRKA 2F54E 2E7HA 3AQDA 1M53A 3FQ1A 3QXDB 3MFFA 4JJ5B 2GCYB 1MI5E 4NQDA 1I9EA 5M7QA 5ABZA 4H20H 1HXMA 1I7UA 1KGCD 5G4OA 2VXVH 4B60A 4FQXA 1TOXA 2EDKA 5EORL 5F97E 3M17A 1Y07A 4AQ1A 3CSFA 4HU8A 2Q2LA 3WE1A 1CT8A 1MQKL 1XGZA 3TPUA 3IMTA 3FO9A 4MCYA 5T1MB 2O6PA 3Q2WA 3O3UN 4PS4H 5FECB 5KSUB 4MZRA 2A2QT 2XQBH 1V3KA 2AK4D 1YPZB 3MRNA 4X6DF 2WWMD 5DJ2B 2WQSA 5FW7A 2FJGB 3A24A 5T3XL 1LHZA 3JV4A 2X4OB 4QRUB 5IMOA 2B9BA 3BP7B 3KBFA 5F7DB 1M42A 5FO2A 2J8OA 3UAAA 3UTSD 2EE2A 2Q7YA 3LKPB 4G9FE 1X5MA 4NRZB 4XNQA 3K81A 1V3JA 5ACMA 5EEZA 3VI4F 2YGQA 2VDPB 3FT3A 3BFQG 3ROLA 4FE9A 1T7XA 3STZB 2WNKA 4OGAD 4XO3A 2E9JA 5IJDC 3CXFA 5E8DL 4OF0A 3K71B 1EMTL 3QUKA 4N2HA 4CADB 3TBVA 2VR4A 1WBZB 4N4YB 4GMSL 2NCMA 5H4ZA 4IDJH 3TFKC 3MA9L 4L5FL 1D5BB 4GRLB 5AW9B 3K5RA 4OB5H 1QVOA 4HXAH 4NKIH 1YNTA 2ZNXA 5DVOA 1LMKA 4PB0H 5EULV 3QS2A 1ZLWK 4DP5X 1ZV2A 4MNQA 5K1NA 4AKPA 1SN5A 4HPYL 3ILQD 3WFDL 1JTTA 1UT2A 3EXJA 2V2TB 1YMHB 1XT5A 2EACA 4OJAA 1I1AB 4KVPA 3VM7A 3CVIH 1UD6A 3H55A 2EILB 2YPLB 1BXVA 2NR6C 1A6TA 2QZ5A 5HHOA 2O5XH 5J8OA 3W56A 2BNUB 3ARGB 5DUMH 3AM8C 1IBYA 1CTOA 4UDUB 4F7TA 2YQGA 3H3PL 4WSJA 4AV0A 1P4IH 3NCJL 3KNBB 1MHPH 1DHKA 3CSPA 2HRLA 3KJ6L 2N0MA 3NIFF 4RFNB 2BRQA 4ZG1A 2R1XB 4ES8A 2BY2A 2EYRB 4CAGA 4RMBA 4QRTA 2OL3A 1MAKA 4IK7A 1HL5A 2NYKA 2VLMD 4ERSL 3LS5L 5E2WH 4IIQC 4JHWH 3VYOA 1T04A 2DQJL 2DI9A 4PJDF 4M4RB 1H3XA 4AQAA 3D05A 1QPKA 5C8JB 5EWIL 1PLBA 3KPOB 3QZBA 4NYLA 5DF0A 3MKKA 2ARJQ 3W37A 4BRJA 1FVDA 1NL0L 3D5OF 1CXFA 1PY0A 1CL7I 2BIMA 4FMVA 1L9PA 1Q4NX 3BP6B 3PV6B 1SXZA 4HKXB 4BWTA 4ORGB 5DJAB 2XQ0A 2PETA 3SYOA 3DK0A 1GGIL 1CDGA 5IFJA 3PABA 2G5BB 5CZVH 3S7GA 4KKAC 4Y7MA 3AFLA 2NXZD 1DYZA 1YJDC 1NCDH 2WCPA 3PL6B 5DJ8B 4E41E 1MCDA 2FWOB 5AEAA 3ZE1E 3HJEA 1BWMA 1A8ZA 2GSGA 4BE6A 2DLGA 3EF4A 3TVMB 1V7NL 1WTLA 4LGPB 5IOPA 3IFNH 2GITB 4J3OG 4UDTB 3T3PE 2Z64C 3HVDA 5MP6L 1XGYL 2HTKC 4G2AA 2OZ4A 2GHWB 4WI2A 1VA9A 1ZT1B 2FL5A 4KUZL 1YEEL 4Y8DC 2BZCA 5EN2B 4GG6E 1K5WA 4GMTH 2YLKA 1ETA1 4ANXA 3ZE0F 1W8NA 4BKLA 4OGQC 1CK0L 3CG8A 4JHAL 3V5HB 1R3HB 4MHHG 3K6IA 2DQUL 2G60H 1CDHA 4QT5A 1QI5A 3W2DL 1I4FB 1FSKB 1SF5A 2PPCA 4H0GA 4NFBA 1QYGL 5JW4R 2AJSH 4D0DA 2FSEB 3HC0A 4CGUB 4TMPA 2YC1A 1UXLA 4NNXB 2UY6A 3LB6D 4UQEA 3X17A 3CIAA 3II1A 1N0LB 1R33A 4N22A 1YAIA 1F3DH 4GRWE 5D6DC 3R8BB 3RX9A 1ET8A 43C9A 2NQCA 5D7IE 2A9MH 3P9WB 1JGUL 1NAKL 1VB9A 2NMSA 1S7TA 4BH8B 4KO9A 3VXNB 3TNNA 5K9KB 3P4NA 1WFOA 2WJ7A 5IVNA 3FSWA 1NFKA 2XG5B 3MRMA 4LKXB 3VG0H 3T2LA 1J5DA 3M1CA 3WTUA 3CZFA 3PREA 4ODWB 1RZ8A 4P5MB 3ESMA 5DJ6B 1JG9A 4DIXA 5INDA 1Y7VA 2ZOLA 2A6DB 1ITCA 4LKCA 4M43H 1F41A 1AHWA 4PBXA 3UAJC 4DGIH 5E94B 1FQ9C 3D0VA 3E9UA 3QW9A 3KYNA 3C60A 1ZHLB 2VM9A 2Z92B 4NKIL 5CGYD 5INCA 2WXOA 4PBDA 5EZIH 1CXLA 1M6OB 3VQLA 4W9JC 1CICC 1T5WA 5JPNB 3CHOA 4AEHL 3VXTB 1M05B 1YEJL 4XN8A 5IEKB 3G6AA 2WAHA 1U36A 3ARQA 3SYAA 4XPAL 3ZZSA 5K69A 1SVBA 3TM6A 4OGZA 1S46A 3U6XS 5HBBA 4K3EL 3NIFE 4MS6A 1J5OH 1O9ZA 2JKTM 3KLHD 2X2HA 5KANI 2PCFA 1ONQA 4RFOH 1XMWA 4MFHA 2PP8A 1IL1A 1U33A 5BCAA 3NZ8B 3VGGA 1G7JB 1H0DA 1ZT4A 4NZUH 1JPFB 1R24A 4PR5B 1NBYB 5JXAL 5LG1A 1AC6A 1XB6A 4XNUH 4CVZB 3A22A 1ID5I 1U2HA 4GO8A 2E7LA 1L9SA 4HDIB 3HBPA 4FTVA 3CSYA 4JVPA 2UXVA 4YHOL 3BX7C 4LPTA 5DLMH 1CTMA 3CHXA 2DN7A 1VGKA 5CLXA 1KYOJ 3OGCB 3VI3E 3IDXL 3FCGA 4LESA 1XB3A 4WF7A 5DSCB 1O6TA 5AB9A 3TURA 4Z95L 2HX9A 4CILA 1QAWA 5AZUA 5FGCE 1OARH 1RERA 4FQIH 5I18L 4CBZA 2XWTB 1ERNA 3WENA 2NY2C 1KTJA 2VR5A 2ENSA 1TZ8A 2QFRA 4QXUL 1UXSA 5EA0H 5ANHA 4ATTA 5JTWA 2EYTA 3W0WE 1L9OA 2CDFB 1YN7B 3D0AA 1DVQA 1FPTL 2GJ6B 2OSLA 3L4CA 3QZOA 1BBDL 3TJPA 5I75B 1GTFA 3KWXA 1UQSA 3V55A 2ZIDA 2EDHA 3EYSL 3TZVC 1BYPA 4N0YH 4YHNB 12E8H 5I1GH 3R19A 5GISH 1HNYA 3BE1L 1JNLL 1IE4A 5DJCA 4RA0C 2YEQA 4CNIB 1U30A 2BNRE 3RE0A 4HT1L 4FA6A 4KQ3H 1S7VA 2CXGA 5C0AB 4HF5L 1E28A 1LGVA 4RGNB 5IVZB 3FQNB 4PW4A 4QDGA 1NDMA 4XE5B 5JHAA 3CDZA 4F57L 3OAUL 1G94A 4JFXA 4JFDE 1YCSA 5C0RL 4P5TA 5CUSL 1RUQL 5DUJA 3SY0B 1KXTA 5E51A 3MLRH 2W59A 2VDNL 1OTUC 4I0CC 4OFKA 2FT8A 5HGHA 2HB0A 1OSYA 4Q6IB 2P46B 4IIQA 3HUJB 1OWRM 3JTTA 1YECL 1RHHA 1UM4H 2KQMA 4HS8L 2ICWJ 3ULAB 2F54D 1NPUA 3W11D 2F19H 4FLHA 3ZDXE 3DOIA 4OV6F 3HC3H 4B9JA 2OSXA 4HJGA 3I9IA 4UINL 2A38A 1O7SA 3BD5A 3VFTB 4HG4J 4XPTL 1R34A 2J8UB 2J43A 1A7OL 3E2HB 3GTVA 3V9EA 2APBA 3FTXA 4MAYB 4DPBX 3L9RB 4JFDB 4E36A 4TXVB 2KLSA 1XSIA 1GGBH 4LOVA 4FFWD 3DX0A 3TO4D 2ZUYA 1P2CB 3VRIA 3QFGA 2NR6A 3I9AA 2EVGA 2AFNA 2R9HC 4TUUA 1KXQE 1IJ9A 1FV1A 3CC5A 3U9PH 4KKRA 4Y2DC 3I50H 1UWFA 1SF3A 3VFOB 3NOIA 1CLOH 2CR6A 3FTWA 3EHBC 4N0UE 5EA0L 1JE6A 1XZ0B 3GSRB 3MRRB 3ARGD 3ZHNA 1NM9A 2XFXA 4YHKH 3FU3A 4R6UA 3TYFB 4LSVL 1U2YA 3B2MA 1JVLA 5TE7H 1P7BA 1HJBC 2N0KA 5F2FA 4N1CA 4HX1A 3WBDA 5BS0B 1N7MH 3IF1A 1GRWA 3MLSL 4I18A 4WENB 5B3SB 5I9QC 4CVXB 4ACTA 4MKMA 1A3RH 1JF5A 2PCPA 5EH1A 2VUOA 2APTA 2X2JA 1FNSL 4JQIL 3OKDB 5CUSH 3GWJA 2NY2D 1GYWA 1TTUA 4LARH 5IROC 5TK4A 4M62H 5AVXB 1CR9L 3DVGA 2CO2A 2ZXCA 1SN2A 2Z4QB 4KZDL 3QEUA 1CFTB 1WV7T 2WBJD 3AWEA 1B4JH 5BXFA 2IOOA 3UG3A 4B9CA 2GBAA 5BV7L 4MD4B 5IKCB 1KGUA 1JIBA 3VVWA 2F68X 2OI9B 4NQQA 2B08A 3CAFA 1IM3D 2XVBA 2GJ6E 1SHSA 4U3SB 3HOGA 4HPOL 4X8JB 4S0HA 2XZAH 1OP5H 3VB8A 1J5OL 1IQWH 2DH2A 1FO0H 1KY7A 5L7XL 1KULA 2R2BB 4WEEA 1GY1A 2QKIC 4UIKL 3HPLB 4APXB 3RP1A 2H32A 4JPKL 4OUUB 3ZKMC 2JQZA 2NY3B 2LU4A 5EDSA 5F0JB 2NT1A 4F7CA 1Z5HA 1DEEA 2VW7A 1YEJH 1BLIA 2W5PA 3RPBA 1KBPA 4TSAL 4JY5H 1OB1A 3SDCB 2J7LA 3JUYA 2GC7C 3KLHC 1F3DJ 4GEJA 1MCIA 2J20A 3M46A 1U8MB 4YLBA 4M8RA 5MEOA 1GY2A 3KXFD 3C8KA 4UQ9A 4ELMB 5F7AA 4Z77B 4KMLB 2I9LB 3FRPB 3MV01 4NZJA 5DJDA 3CQPA 2JXMA 3N1GC 4Z3IA 5AB0A 5AYTA 3TWCL 4ALAL 4PVMA 3P77B 1RD6A 2DWEB 2WLJA 3E3QE 3SJVE 3NSYA 2AQNA 4MSWB 4Z7IA 2GAZB 5IB3B 3QUXD 3P1VA 1PG7L 2BNRB 4RFEA 2I24N 3I6GB 2C7UA 2G0LA 1N7ML 4FTDA 2EXSA 1HHGA 4PJGA 3ZN6A 3SO5A 4LRIA 5DUBB 5EPMA 1KCKA 3K2KA 1BVLB 1B3JA 4TM9A 2E9WA 3AG1B 1MFUA 2ZF9A 4AW4A 2P48B 2DLEA 1JWMB 2JK5B 2NSQA 1YN6B 4HBCL 4FA8A 4PRPA 4ZS6C 4RFOL 1HYSD 4N3TA 3FJTA 4PJIE 5F8QC 3B7UX 3EJZC 4HIIB 1DLFL 6TAAA 1SFHA 2YN3A 3RUGF 3REWA 2DQUH 5KVMC 4OCNC 4QTHA 1JGDA 1FNHA 4I2XE 3V0VA 3KXFE 3JV6B 4JN1H 3JZYA 3T6VA 1DUZB 1LEGB 2LU7A 4HH9A 1S8DA 4NNYA 3JZ7A 4P5KA 5D4QA 4D8OA 1BHGA 1CC3A 2CKBH 2P42B 3K72B 4N9OB 3TNMA 2NQDA 4JO1H 3L4VA 5I16B 4Y16D 3ARVA 4X5XB 3RWDB 5C0JB 1G9HA 4XMKH 3BEWB 1T1XB 4WWOA 5L4IA 4AYID 5K1VA 1ZLWH 3NP3A 3MUHL 4Q2ZB 2OMTB 1FFPA 1SGKA 2VMJA 4O5LH 4BWWA 3NGBC 2ZUQB 4OJYA 3QJUB 3LD8B 1T3FA 3ARDA 1KENH 3ULSB 5AAMC 3OKYA 3FQYA 3V0JA 2GIXA 1KSRA 1JAEA 1BJ8A 1NAKH 4GXVL 5LGHH 3TA4D 3VSQA 1TJGL 1KB9K 1QR1A 1BM3H 3WGUB 4PS7A 4P5TD 3KR3L 5EU7C 4FQQB 4G43B 1R5IA 3OKMA 1UZ8B 2WQ8A 5CILH 3EG9B 1L6ZA 3F5WA 5HDQH 2X4UB 4CN6A 5HY9A 1IIKA 2AXFA 4LL1A 4AC4A 4HJUA 5E99L 4BZ2H 1N64H 2IMMA 1ND0B 1OAQH 1EEYB 2PLTA 1BBJA 1G6RH 1JV5B 3LN5A 3LSOB 1T0NA 3CXHJ 4OCXH 5TGBA 5E2WL 5HHVH 3U83A 4NFDA 1AKPA 4ZMQA 2D4FA 4BIKA 1S9KC 5I66A 4I48A 3MROA 5A43C 2YAOA 3NACL 1Q38A 4G70B 3LKOA 4JFZH 3VFSB 4L48A 3VW3L 2WOYA 4QRRB 1R3KB 4NQUA 3NCJH 4OVUA 3UCQA 3J2PA 1AQMA 4PJAB 1MCPL 4DVRL 3GI9H 4LU5L 1TLKA 4WEBL 1T1YB 1GGCH 1OAKH 2IV8A 4YHIB 4ZPVB 2VAJA 2XWEA 3TT3L 3C6LD 2R2EB 4OVVA 1PSKL 2C4FT 4EI0A 4ZXBC 2AW2A 4KVCH 1QWUA 4IGBA 4URTB 3MV8E 3TF7C 1UGNA 3S3CB 2ODIA 2WNWA 3S88L 2GKIA 1X6LA 1IRAY 4Y2DA 5C07A 3J7HA 1L7TL 4NUQA 4AG4L 1QLFB 1PG7X 4YDVB 1H9DA 2V5SA 5CZKA 1WK0A 3ZKNC 4JM4L 4NERA 3FOLB 2LLGA 1INEL 1GHFH 1T20A 3CZNA 4U7MA 3T08A 3N2JA 4K2UL 2XCMC 5KTEH 4Y1AB 4UILH 2X42A 4L4VB 3CFBB 3KL0A 1YG9A 4HK3J 3FSZA 2HJLB 3W38A 3UAJD 3ES6B 2Z1PA 1MFMA 2XVGA 4KJPD 4A2DA 5LKNA 3SE8L 3QFJE 3FO0H 2MH4A 1W0YT 2H0PA 4DFIA 3VD1A 3VWKD 2Y22A 1KTDA 1WQVT 2BCKA 3FB5A 5EMYA 7PCYA 2AJZA 1XHHA 3ILPB 3P4OA 4G71B 4XXDB 2KI6A 5CP3A 1HKLL 2PWDA 1GGTA 4JPVH 2HCZX 3V4VL 5EZIL 2NW2A 5B39G 2OXHB 5KBDA 1HZKA 1MNUH 3KLDA 3U30C 1M57B 2V5TA 4APQA 1KXHA 1AGBA 3P3SA 1ZV5A 3FCBA 4QKTA 1H3GA 3Q6GL 3DA0A 4OLVH 3HZYA 1PYWB 3PWNA 4KMTH 1NGXB 3VG9B 4PJAF 3L13A 1BZDA 1XGRA 5GHWL 5C0IB 4AH2B 3HE7B 5EU6E 4J3OF 5DZAA 2EIJB 3MA9H 4JFOA 2C4FU 5E4EC 5DTFA 2W1NA 3NAAH 2YD0A 1JOIA 2DTSA 4YHPB 2F1BA 5MEPA 2A6IB 3T09A 1OM9A 1Q90A 1PX3A 4GIOA 5E6RB 4AXWB 5I1LA 3GD1C 1T2XA 4NN5B 25C8L 2Y36L 5D7JC 1GGYA 2BY0A 2XJKA 3BLBA 3HUJF 3R7QA 4N3UA 4A7QA 1T03H 1KCLA 3WTYA 4OM1H 4HIHB 3VXRD 3ZMNA 2VYRE 5IJKC 1FORH 2QKIA 5C0BA 3CK0H 4V1DE 4CMMA