5AAPA

Complex of the fimh lectin with a c-linked para-biphenyl methylene alpha-d-mannoside
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
158
structure length
157
Chain Sequence
FACKTANGTAIPIGGGSANVYVNLAPVVNVGQNLVVDLSTQIFCHNDYPETITDYVTLQRGSAYGGVLSNFGTVKYSGSSYPFPTTSETPRVVYNSRTDKPWPVALYLTPVSSAGGVAIKAGSLIAVLILRQTNNYNSDDFQFVWNIYANNDVVVPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of C-Mannosylated Anti-Adhesives Bound to the Type 1 Fimbrial Fimh Adhesin
pubmed doi rcsb
source organism Escherichia coli
molecule tags Cell adhesion
molecule keywords FIMH
total genus 33
structure length 157
sequence length 158
ec nomenclature
pdb deposition date 2015-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09160 FimH_man-bind FimH, mannose binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1090 Mainly Beta Sandwich Immunoglobulin-like Fimbrial-type adhesion domain 5aapA00
1N0LB 5JQIB 3BFQG 1UWFA 2UY7B 4X5QA 3SQBB 3ZL1A 4AUUA 4CSSA 4AV0A 4XOEA 2J2ZB 3BFWA 3MCYA 4J3OH 3ZL2A 5F2FA 4J3OG 4XOCA 4AUJA 4ATTA 1PDKB 4XODA 4XOAA 3JWNE 4XO9A 5LNGA 3JWNH 5FS5A 4CSTA 5FX3A 4AUYA 5CGBA 2JMRA 3BWUF 2UY6B 4X5PA 5IQMA 1QUNB 5FLUA 4LOVA 4AV5A 3RFZA 5AALA 4X5RA 5AAPA 4XOBA 4BUQA 5LNEA 2VCOA 5ABZA 3ME0B 1TR7A 2W07B 5AB1A 5F3FA 4CA4A 4AV4A 2XG4B 5IQNA 3ZPDA 4X50A 4AVHA 4J3OF 1KLFB 1KIUB 4AVJA 5IQOA 1N12A 2WMPB 1ZE3H 3JWNG 4XO8A 5FWRA 2JTYA 4AVKA 4AVIA 2XG5B
chains in the Genus database with same CATH superfamily
2J21A 3LQMA 3RWEA 4UQIM 3OSKA 1X6NA 4HA1A 3W1ZA 1JDCA 4YDMA 1E4XI 1XCTA 1QI5A 1MJ7H 4WW2F 5GGRY 1XCXA 2E7CA 3HNTH 3NFSH 3H9SB 4KKCC 2KQNA 5G4OA 3VXNA 1LE9A 3X17A 3E6FA 4ZBJA 1N4XH 2AKRA 1SN2A 4G8EB 4QOKA 2AJZB 5AW8B 1Z9OA 3MLRH 1F11B 4CILA 4ZFQA 3LH2H 4MMZB 3BN9D 4HWZB 5D1XC 3MCKB 2Y06L 1A6UH 4NC1C 2NT0A 3TN0C 2EDFA 1L3NA 3MLZH 3H7BB 1IE5A 3IETA 2ZXDA 1OP9A 1N12A 4DO5A 4LASH 3LZLA 2DQFB 1A1MB 4WO4A 4NKDA 2DJ4A 3BVXA 3GIVB 1QLRB 3R0MA 4GPVA 3DX4A 5F0MB 5L2JA 1RLWA 3IMSA 1OARH 2VXVH 5DR5L 5EO9B 5HDQL 5D8JL 5GGQL 3BW9A 4BH8A 2IANE 3EZ8A 3GLDA 3P4OB 1UCBL 4DN3H 1NCNA 5T33L 12E8H 3BYTA 1HT6A 2Y3NA 1TR7A 3O2VH 1NGQH 1Z32X 2CKNA 3KWWB 1WDAA 5TDPB 3GXMA 1JERA 4N2EA 2IAMA 3T77A 4YC2C 3G5YB 4I5BB 1MAMH 3UMNA 1G1OA 4MXQD 5CEXA 3S5LG 5EC2B 3QQDA 4M3JA 3S8FB 4TUOB 5I1GH 5DD3L 3WENA 2YFNA 5F44A 4HK0B 1YDPB 1MCBA 1XAUA 4QRTB 3QH3A 1IAKA 3CE1A 4EZLA 4ZMOA 1MCOH 2DLIA 2GC7C 3CHXA 3DO4A 5KSVA 2WWNA 2E46A 2AF2A 2X6BA 3MLRL 1OANA 4FTVA 1YA5A 3QUYB 4N5UA 4XNUH 4EN3C 1MNUL 1PLAA 1IAII 1U6AL 2R0WL 1FVDA 4M9OA 2NYYD 1MFMA 2F5BH 3A4EA 4NO2A 5CN3A 1UD5A 4GMSL 3X3GH 3R1GL 1MPAH 3SIKA 3ZTJH 1RIVL 4LKCA 3FCBA 2R2BA 4YVNA 1S7RA 1SPDA 2QZ5A 1N67A 1EK3A 4MX7B 4JFFA 5GIRB 3IYLW 4PJ7A 1ZD6A 2ZKMX 3V4VA 1JAEA 1KENH 1O6SA 3IB4A 4KI5E 3VRLE 1MIMH 2A4EA 1G0DA 2JIXB 3BQUD 5DK2B 1LEGB 1NCDH 3G5WA 4QY8B 2DB8A 2NYKA 3TNMB 3NJLA 1U9KA 3BHBA 3UJTH 4MXVF 3FK3A 4I3SL 4WU5A 3SQBA 1A21A 3V0JA 4I85A 4WFGD 2W65B 3OSVA 2ZX7A 3OAYH 1CQYA 2WUCL 3QDHA 3FSOA 5DFAA 2WQWA 4V1DA 3ZSTA 1I1YA 5KSAD 4JQIA 1LE5B 5DJAB 5IMOB 4OFKA 3MCKA 1HH9B 4GSUA 4XVUD 1HWGB 4NAQA 2P47B 1T5KA 5SWZA 2WBJC 3H7BA 3IFNH 1XGUB 5BO0D 5I1EH 2QPDB 3RA7L 5IBLD 4GH7B 1I3GH 1YMMB 1BVNP 3QUZA 5GRZA 4GNKB 2D3VA 1TMQA 1RL1A 4XP4H 1R3IL 3L3OA 5JHDA 3KZ8A 2VR4A 4ANKA 1I9IH 4Y4FD 3AAZB 2OMTB 5E99H 1DTUA 4OIIH 2CBPA 2Q5BA 3CXHJ 5KVFE 4AYEC 4K94C 5GS1B 3VCLA 5DWPA 4QXTA 5CEZD 1JYNA 4RFNC 3NIFB 4JL1A 3T0EA 2VB5A 3EUDA 4L8SB 4ZPTA 4Q7DA 2HRLA 3ZZQA 4AKPA 4FE9A 1NDMB 2WVSA 4HUWB 1ED3B 4KRPC 1UZ8A 3VGAB 3IE9A 3MX0A 1OPGH 3SYQA 3UJTL 4URKA 2ZYHA 3OKYA 2WB7A 4N24A 2XFXB 3ZHDA 4KKAC 3V6OC 1A4BA 1P84J 1YHPA 1I8IA 1ASPA 5JXED 1CLOH 2Y2YA 1N5YL 3FTUA 2VZ1A 3ZL2A 1QW9A 1HZKA 5EOTB 3I3BA 1QLEB 3QGVA 4N9OB 5ANME 3QQ9C 3BO8A 1OOWA 1S3RA 1RERA 2VLME 3AG3B 5T3XL 2JTDA 4R0LA 3S96B 3RWFA 1T3FB 1Y18B 4OFYD 2BFVH 4IRJC 2Q3ZA 4AQ1C 4B97A 2NQDA 4ZAKB 4JY5H 2JJWA 1CJYA 4UOW0 1WZLA 4ODXA 4A2MA 4FYSA 5HHMD 3HG1A 2I85A 4TULH 3U2SA 3LKPA 3QCVL 3ME0A 4JHVA 4JCWA 1KELL 3RDJA 2XZCH 2DTMH 4QIRA 1MWAB 4U7KA 4L1SA 3DPBA 2PTTA 4KI5F 1HDMB 4EKXA 4FNLH 4P46B 3FRPG 3KXFA 5BQDA 2AERT 4JKWA 2DQUL 3FPYA 1NINA 3KR3H 4J1UA 4EUPH 2J3SA 4LRIA 3L4XA 4JFHD 3IDMB 1I1FB 5B1CA 3FQUB 1HEZA 3C6LA 3AY2A 1ZLUK 3EJCA 4L0PB 3VGBA 3QR1A 4JHAH 2OXHB 3MCLL 2DMGA 1E4XL 4UIMA 3T4AB 2AMUA 3EYFA 3HUJA 4JJ5B 4MZRA 3QZBA 2XTJB 4ENZA 3BPLC 3KJ6L 3O8XA 4YGVA 4JO4L 3VFRB 1GRWA 2KC0A 4BH7A 2ICES 5F3BA 4P5TD 4F9PC 3GTVA 1ES0A 2FJUB 5FUOL 3WMPA 2JKRM 1AZZC 2CGZA 5JHAA 2ZWKA 3VU2A 3C09C 4KWUA 3WY2A 5T3XH 4UYPA 2AK4B 3AS1A 5I1CH 2UV3A 2X4UB 2XKNA 1PJWA 2KZWA 4NPKA 4K8RD 2ZG1A 3RIAF 5JXAL 1R46A 3C12A 3DIFB 1HYSD 3IJYA 1IGMH 3NEXA 3MFFA 4LSDA 2AXJA 3NSYA 4XX5A 5G2NA 2VTFA 3K5SA 1IEBA 2WPGA 2FNBA 2GEEA 1AFVL 3ABMB 4BKLB 2ERJC 5HVFB 1CBVH 4PV1C 3OHMB 1UACL 4LBEA 2NXYB 2AITA 2CO6A 5AEAA 3QFJE 4L29A 3UFIA 3SJVB 4P9HC 2CO2A 2ZYIA 5DUPH 5LN4A 1A47A 1Z66A 2K3TA 5E1HB 3GEFA 3VDAA 3UG3A 4DOHB 3FXIC 1EPFA 3GSNH 3AQYA 3CZNA 3CZSA 2HFEB 4Q0XH 3UO8B 4DGIL 1F6AB 3B3BA 1WD9A 1B3IA 1IBZA 2R23A 5JQ6L 1GW6A 5KYWA 2YAOA 5IMLA 3KPQB 5DZ9A 4GAGH 1QACA 3IGAB 5A40E 4MD0B 4PRNB 2W5PA 4RMUA 5IMMB 5G5DB 2EH7H 3OAZK 3S4SB 5E6IA 3WL9B 1DZ0A 4Y1TA 4AH2B 3ERXA 1FWXA 4HS6A 4L5FL 1SOKA 1ND0B 1X5FA 5D5ME 1YPZB 5DCCA 2F53D 2OMVA 3L95A 1GYUA 3DURB 3MO1B 2FSEB 4U1NB 4D2NA 4F80A 5F0LB 4N1CA 4NP4L 5B21A 4DGWC 5B22A 3P30H 1WQVT 4B9JA 4YPJA 4ANWA 3MRLA 2GAZA 4HLEA 3LZQA 2DYPA 4OI7A 5CGYD 1ET8A 4HHAB 3C87A 4NLAA 2D3JA 4P3WA 2DWEB 1C5BL 25C8L 3EKCA 1BLNA 4X4KA 5I8KH 2FWOB 5E1GA 2WZPD 1HQRA 4XO5A 4O2FA 3DVFA 4QXUH 4OM0H 4FQXD 5K9OB 1A7QL 1N18A 1S46A 2R4RL 4Q89A 2JJUA 4GG8B 4Y0GA 5CGMA 4JUTA 1T0NB 4OZHB 4YSOA 1ZGLA 2TRYA 1MCNA 1NJ9B 2X4NB 1FJ1A 2DRUA 2CU9A 3GHBH 4AC4A 2IQ9H 2D03H 3EW3B 2OMUB 4YFLF 1P4IL 1MAKA 3CFUA 3O4LA 4YHLH 4HDIB 1JV2B 3POHA 3L3IB 3CU1A 4GAAA 3QK0A 4BRJA 1SM3H 2W9DH 2F6AA 3K4ZA 1EDYA 4L1DA 3FUNA 4TPRL 4PY7B 3KCPB 2DF3A 5ECGA 2QVKA 2OMWA 1YNKH 4PLOB 3CHPA 1SUJA 4UBDC 4XPGH 1KXVC 5DEZA 1DYZA 2W9EL 3B3IB 3QJUB 4ZUUA 4K7PL 3T0BA 5DHEA 2EILB 4IRZA 2AEWA 5I17B 2PWHA 4GFXA 1E67A 1XH2A 2CDEA 4P3DB 3ASWA 3KWUA 1UT9A 4LLUA 4HBCH 2B3IA 1RURH 1YN7B 2V2XB 2GI0A 4RISH 5AVRB 5HHNA 5E8EA 5C0IB 4RZKA 1GL4B 2GJZA 5IEHA 2B15A 5JW4Q 4HFUH 5FM5M 2IFFL 1JZ3A 3LXBA 3QPQC 3KYOB 4QXUL 2R23B 4LLWB 1X9UA 4J12A 1JNLL 5DVKA 2OPCA 2HLEB 4JR9H 1U92B 3PAUA 3IGAA 4M7JL 5I75C 4BGLA 4J39A 4ZOAA 1B9KA 2QKIA 3BP6B 3F7RA 5IMKB 1QEWA 1SHXA 3MNZA 4PJAE 2X0UA 4QRRB 4A7TA 4TLSA 4IHOA 1KJ2H 3TYGH 4Z7VE 4DHLA 1NBYA 1KCSL 4CADA 4PM1A 1UASA 1X44A 3OB8A 1J8HB 3TYFB 3VXSA 3ULUC 4ZQTA 4TNWK 4ORGB 2NZ1A 1T04B 1I82A 4GBXD 1BAFL 3KPRB 4JO3H 4IRJA 3LPWA 2W92A 4LPVA 1KYDA 3BAJA 2VXSH 5IW1B 3LXAA 3N2JA 5FUZH 1FSKB 4PJEE 1GGBH 2APXA 4WW2A 1WA2X 3FO9B 3LDBB 3V4VL 3BH9A 3AACA 3BZEA 5JIIA 2WIIA 3GI9L 1S7XB 3AFLA 3FOMA 4X6DA 5HXMA 3EO9L 5CAYB 4MKTA 3WNNA 4UNVA 1P5VA 1VERA 4FFZH 2JIXA 4XN7A 3L1GA 1RKRA 3GC3A 1G6RL 4WNQB 5FV2A 2FEEI 5KYXA 1KIQA 2MQ0A 4QJ3B 1UT2A 1GZQB 3ATBA 1GH7A 3QDGE 1AQDA 5DJYA 3D9AH 5EN2A 5HHXH 3RWDB 1AGEB 1QR1B 1Y07A 3O6KL 1JNHA 1NBVL 3HR6A 2CD0A 5EA0H 5CR8A 5BQ7A 3UYRL 5IROD 5IQNA 5ELIA 3MRFB 2WLMA 1SJHB 3X1NA 2G75A 2APVA 4XNQB 1ZTXH 1FIGL 2VRAA 3MLYH 5CLTA 3O2VL 1R33A 4KC3B 4E41E 5FB8B 4BEIA 2ITDB 5C0BD 5IVXF 2Q86A 3FZUC 4YHNA 1I1FA 3QI9C 5ITFB 1U2CA 3LNEA 3D39D 1AVAA 1F4XL 5DLML 5B39A 4LCUA 3BSZA 5JNYB 1EVTC 2X3CA 1Z9SA 1CG9A 3RFZA 2X38A 1DEDA 1BECA 3ARZA 4GG6E 3CZFA 3VXUB 4Q9CA 4DEPC 2YD7A 1U4FA 4XVJH 1AQMA 2FZ3A 3U0WL 3BPCA 1BD2B 3WE6A 3U7WL 1G4RA 3DSFL 2YA0A 2F53B 4AENA 2X6UA 4UQ3A 1JPEA 5AQ0A 4EI5B 1RHHB 4F7EB 5I1EL 3NSXA 1S5IL 3ISWA 1CFNB 1CR9H 2PP8A 1T22B 2XX0A 3MSPA 3MRGA 3TO4B 4CW1A 3L7FA 4LLMB 3OJ2C 3SGJC 5KJ4A 1WWAX 2Q3AA 5EZJB 5DMKB 3ZE2F 3ILQD 3QEUB 4JZNA 4LPUA 5IHZB 2UYLA 3G08A 5KOMC 2XZAH 1SNRA 4CA4A 3FUKA 4B9GA 1VKXB 1E5ZA 2VW6A 3CD4A 4XB7A 2VQ1A 2PTVA 3OZ9L 4Z7OF 1SY6A 2FCBA 1BFTA 1DANU 3CZLA 3W81A 1T7WA 2ICWB 5E56A 4KQ4H 1LQSR 4L1LA 3ZDZE 1X9RA 4KRMB 5M7QA 4Q6IC 3QS3A 3IDGB 4FC3E 1CZ8H 4H26A 1FORH 2E27L 5DRXA 3AVEA 4FKKA 1JIBA 4P5KB 4BXSV 1YN6A 1FLTX 3EOTL 4WW2B 5F7LB 4YR6A 1DEEA 3MLUL 3QXDA 1UQSB 3FT3A 3DYMA 3PWUA 4XAWL 2WNKA 3BZEB 3FBKA 4M7LL 4XNYL 1IVLA 3ILPA 5HDBF 5KUMA 5L4JA 1T80A 1A0QH 2WUBH 4HWBA 2BOLA 3SCMA 2EUZA 5JOPE 2ZUSA 1SXZA 5C0RL 2ICEC 5HGBB 1L7TL 3ESNA 3QZWG 4NO0B 1YSOA 2AJ3B 1NC2A 2APSA 4MQ7B 5DFTA 1IEAB 3VH8A 3VQMA 3CBJB 3PWJB 1KV7A 2CUHA 1CXKA 3UGXA 3CPLB 1DO6A 2VDRH 4IK7A 5SWZD 4APQB 2B0SL 1KB5L 3MNVA 4Y1AD 1VFAA 2DI8A 5I0VA 2H26A 3QUZD 4PFEA 3WIHL 1EMTH 4OFDA 5D2LB 5K39A 3VXPB 4R7LA 1BFVH 1KLFB 5D55A 3BH8A 2PCFB 5TQ0L 3MUGA 1DBAL 3QDJE 1QRNE 4HSQA 4QHKI 5FK9B 1A2YA 5JW3L 4X9BA 3EZJB 4WEUD 4GEIA 2IMMA 4G82A 4DEPB 4FXLA 3L1EA 4ICXA 2GPZA 4XN8A 1AHKA 1JGVH 4PV9B 4AW7A 2HH0L 1IBHA 1I9RL 2ZPKL 2GUYA 3ATFA 4EVNB 3BPCB 4Z7WB 4S2SB 3CC1A 4L4VE 3P9MA 5D1XA 3K0YA 3CX5K 1T7YA 3OPZH 1RZ8B 1P1ZA 4ZFFB 4PJEB 1FNGB 2EIDA 1RZIB 3KPSB 4MHHI 3HI1A 4UTBH 4F24A 4GRMA 4N0RA 2QGCA 1U8PA 1R47A 1Z3GH 2BSSB 4KQ3L 4N8VG 4YO0A 2VYRE 5C8JB 1M6OB 1L7TH 5D7KE 4R8WL 4KKCD 5CSBA 1S7TB 2RMNA 3MBXL 1XGPA 4UM8A 3DYOA 3QCVH 3LRKA 4S0SD 1GGCH 2Q76A 3CDGA 3GKZA 1AO7B 1RZ8A 3BWUC 1UB5A 4FNSA 5INCB 4HJSA 2VQ1B 3AQDA 3I9GH 4PP1C 2A3TA 2LVCA 2NLJB 4LHUA 1WZAA 4I4WA 1QPPA 4BSJA 4RIRB 5I28A 4TTDD 1E5BA 1P2CB 2OL3A 1OGTB 3DX8A 1S5IH 4HJUA 3SE8H 4GT7A 2Z31D 3T8VA 1UM6L 3T77B 5CR1A 1EHNA 4M7KH 3TEWA 4RMRA 5HGAB 5D96B 2EVHA 4KY1H 5GHWH 2Y1AA 1MJJA 2A77H 1JVKA 1U58B 4NDMA 4R4ND 1L3WA 1MG3C 3BDYH 3FYIB 4DKDC 1JZHA 4PP1D 2CA4A 4ZS7L 2WVVA 4NZRL 4L5FH 3JZ7A 4HPOH 5BS0A 3E7JA 4JFZH 5K9QG 1DQQA 1A3RH 2H45A 2JQMA 1AGCB 1TNMA 3ETBF 4HX1B 2K70A 5L0QB 1QSZA 4I18B 3FB8A 4L8SC 4CSSA 3EH2A 1JXDA 1TFHA 5F8QC 3ZE2E 5J4MA 5MHSD 3TX4A 1T89C 2WXNA 4RFNB 4IBTA 4HULB 5EZLB 5F21B 5K69A 3HAEB 4I2XB 4P3CL 3ULVH 3AY4A 4RGNB 4ABQA 1OAYH 3C6EA 3CJJA 1QSFB 1PEZA 4PJFA 1IL1B 4B3EA 3NCYP 2CBQA 4FQQA 4L23A 1Q9OA 4HIPA 3HS0A 3NPSB 5HVWA 4PJCA 2W88A 3FKUS 3MJ7A 1GZPA 5FW6A 4I0PB 5KSBE 1N0LB 4JFSA 1GZQA 5HI5D 2HG0A 1FL3A 4HJ0C 5D1XB 3F64A 4HOXA 1UWXH 4AQAA 3BVDB 3C60A 4UILH 4ZUUB 3QI9B 1QFWI 2CCVA 2YARA 5DMYA 3SE9H 1V7ML 1UJTA 4RLDA 2IAND 5IFHH 2QL1A 2OJZH 3NIGF 2ENSA 3QUZC 1PG7X 4HP5A 1DUZB 3O9WA 1MN4A 4J2QA 4HLZH 1AXTL 3DXAB 3V4UL 5F1NA 5J56B 3RWCB 1P6AB 1S7SA 3WGUB 4L1BA 3FQTB 3C60B 4RFEB 3T4AC 2HVKB 3GGWA 1WFOA 5IHWA 4WJKB 5KVGE 2VLKB 5DS8B 1CK0H 5K59E 3UAJA 4BCZA 1I9RH 3P30L 4NSKA 3GLZA 4KROC 5F7WC 1FC2D 1MQKH 1Q38A 2F53A 4HC1L 4XPHL 1QEWB 5FUOH 3MNZB 4M1GH 2GSGB 2F9BT 2AQTA 4P2RD 3RTQB 3CSBA 4AYFB 1CL7H 3S97C 3HJEA 1WF5A 4Z3FA 1G1YA 1IKNA 3QUXA 1DL7H 3TF7C 1BM3L 2VDOL 2DYPD 1VHPA 3AU1B 2OZ4A 3TPKA 4M7JH 1RJLB 3FO0L 1U8HB 2X6AA 4WY7H 2WVUA 3UTPD 4Y16B 2W07A 2YD2A 2WVVB 1CDHA 3T2QA 5E5LA 1JHKH 3CFNA 3FL7A 2CLVA 1OSZA 1O9VA 4RMWA 4HX1A 4B7IA 2R69A 3VFWA 3C5JA 4R0LB 2DWDA 3NCCB 2BY0A 4FQPA 4CC4A 4Z3HA 4OZFG 3T6VA 4K8RH 1AKJD 3FONB 4OD1H 3O4LD 2H2PC 4XPGL 4ETQB 2YXFA 5LJYH 4Q9RL 1JVOA 4E9QA 5BUPA 1CE1L 4GW5B 2J43A 3LRSB 4M48H 3KPLA 4KKPA 3X3FH 3ATEA 1UENA 1E8YA 4XI5C 4Z7NE 5CS7A 5C09A 2CNYA 1BQ5A 1SOSA 3NA9L 1GMIA 1Z6JT 4X9FA 3DMMC 2AQNA 1N7ML 4HZ1A 4AQEB 1CS6A 2CCWA 1V3MA 1NFDB 4MJ6B 5AFAA 4HUXB 1H15B 5DHVB 2Z1KA 3QO1B 4ANXA 4ONFH 4ZUSA 4BK4A 4XBMA 2PETA 4K2UH 1B6DA 2X7LB 2O6FA 2VR3A 1GZHC 2IBGA 1WAEA 3O3EA 1FZMB 4NQQA 3ZE1B 4OIBA 2VO5A 4XMZA 2DEXX 4DVRL 4E9VA 3HC3L 1KJ2B 3S35X 4JVPA 4KZEH 3QQ9D 2OJEA 4TKWA 3V0WH 4BZ2L 3DROB 1YG9A 4LZKA 3AT9A 4IU2A 1OLLA 3ZUCA 3F58H 1CICB 2AP2A 1L9NA 3ARWA 3IJ7A 1H8NA 3OZLA 4OGYL 5D7LA 3ZE0B 3ZIYA 1IBBA 4DGUA 1GGTA 2YSSB 2JKXA 2GITA 4I0CC 4LL1A 4K9JA 4UOW1 4JHWL 3F65A 1MCIA 3QDAA 4JRXE 1R6VA 2DZEA 3DROA 1UVQB 3HE6C 1J8HD 4DK5A 3NABL 2NZ9D 2VERA 1WIUA 1N4XL 4C4UA 4I9WE 4QRRD 3QUXB 3SDCD 3PWLA 2WXPA 3FT2B 4WI0B 4PW3A 5C0BB 3DX7A 4GBXC 4QKXB 3EFDH 43C9A 1G6RA 1AOHA 1P6WA 3UYOD 3LHPH 1OAUH 2PR4H 1T1ZA 2HFEA 4OQ1A 4P48A 3QEQA 3QIUD 1NBVH 3NRFA 4PTUB 5FFGA 3GIZH 5EUOF 4MNQD 2CK0H 1KXVA 1G84A 3L1OL 4R5XA 3RZWA 2NY5H 3B2MA 4W6YB 2NY1B 3DTXB 3ETSA 4W6WB 3MREB 3H42H 3V7MA 2G3NA 3H9HB 3FHQA 3VW3H 4CMHC 4K3HA 2NOYA 1OALA 5JW4M 1U8LA 4MNGB 3WOVA 3RL2B 5BRPA 3QPQD 4WCYL 2UZXA 3ETTA 1JHLH 2PTUA 3IK2A 1TEYA 4W1TA 2TSBA 3OHXA 1RUMH 1WS7A 4AVIA 2H6OA 4U1HB 1T4KA 2VLKE 3QHZH 2L0DA 3HJ0A 4YGVB 4ANUA 3ESUF 3PWPE 4P23A 2MKWA 3LS5L 3IN0A 4KROB 3BQUC 4HIIB 3FULA 5F6HI 3U1SL 5F3BB 3NIDE 4Z7UE 2BSBA 3KYKL 2FJFB 3KE0A 4XVOA 4X6BB 3NGBB 2LTQC 2K6WA 2OMZB 3ULUF 5EU4B 1AS6A 1A7PH 2FD6L 3KW7A 1OCWL 4KY2A 2VW7A 1MRDL 2ZWZA 3QG6B 1RPKA 3QDJD 1MRCH 2LFEA 4OCNC 4R7VA 4RBPK 5D4IA 4XPFL 3WSQL 1EHAA 4HIEA 1WCBB 1N3NA 4FRWA 1QKZL 1VADB 3HHSB 4IOSD 1U3YA 2GJPA 3UTOA 1JXJA 1A1MA 4JG1H 2ZXBA 4Y4KC 4NHUA 3VA2C 4U4BA 1CLVA 3L5XL 4D8PB 4KNSA 4MJ5B 4XTRC 2VSDA 3DUHA 4FZEH 4JPVL 4LSSH 5SWZB 4HKJB 4LSUH 1EVUA 1J9RA 2ZXAA 1C1EH 5AD0B 4LASL 3CDYA 4Y4HC 4EDWH 3NEOA 3DUSB 2Z91B 3IKCA 1G0YR 4LLYA 1L9SA 5J13B 3T1WA 1BFOA 2AJZA 3WTTA 1NCCH 4BFNA 1GIGH 4C56D 3H4HA 2R9HD 1K4CA 5F89A 4PR5B 4LGSB 1SBBA 2A83A 2WLLB 4YN3A 2RACA 3P4LA 4KFMA 4QAMB 2YD4A 2CM6A 4GP8B 4Y2DA 4XWGL 1I75A 2VDRB 1IJ9A 3RVTD 3GBML 4MMYB 1UZ8B 3FAXA 1DLHB 1IC4L 3IFOB 1IGTB 2X0WA 1SFDA 4U1GB 4HQQH 4DTGH 3ARQA 4JCLA 1TVBB 5DZPA 1KYAA 3CLFL 2ZKHH 2WXQA 3DK2A 3M46A 1TXKA 2CLZB 2NNXA 3LPFA 3MYJA 4TNVK 5CJ8A 5CF3A 2J2ZA 4LB8A 2XQBH 2FEDD 4XC1L 1IGFL 4WJ5A 3FB8B 3HC4H 2IOMA 2F8XC 1T1YB 3ZMEA 1LO4L 3AITA 3LPPA 1WBYB 3CUPB 3F84A 4NT6B 3MUY1 3PDOB 4U3SB 4L4VD 1BVLB 5IP4A 3TA4D 1HE8A 3TH2T 5J8OA 4EI5D 3QNYB 2VN6A 4M8QA 1O7VA 5CXPA 4R7DA 4CUCA 3RLSA 2LU4A 2VDQL 1QBLL 4JN2A 2R0ZL 4NOFA 4UQ9A 3WIHA 4MCYA 3CIAA 4PVMA 5DC9B 1FFQA 4QRPB 2BNRD 4FADA 2P8MA 3RDTA 1LO0H 4Z7VF 3W39A 1EFQA 2H0EA 5B3NA 1N3NB 3F00A 1FRGH 2LE9A 1XF2B 1FYHB 4WU7A 2PO6B 5J1SC 4F7CA 4DCQA 1JGEB 2OSYA 4X7SL 3WJJA 3QI9A 3BAEH 4OV5A 1HH6A 3DOIA 4LSQL 4HQQL 1BQUA 1HNGA 3MN8A 4HWBL 4AQ1A 2C1PB 3VFMB 4BH7B 3WS6A 1Q0XL 2MCG1 4ODBD 3PS6A 4BUQA 1C8QA 2LV4A 1PG7H 5GS1A 2XTSA 4KK8D 3TJPA 3WHXA 1MW0A 3C5ZC 5FO7A 5DRNB 1F56A 5ILTL 3T3PF 2W0LA 4HGWA 4HLZG 3FO2A 4H25A 5FXCH 2AQ1A 3RQ3A 3V5DB 3AXLB 3BGMA 4EDXB 3M7OA 3SBRA 4DZBA 1UEYA 2BM3A 3L4UA 4OGAD 4Z8FH 5GZNA 1CD0A 4QHUA 2NX5B 1EGJA 1LJMA 4JY4B 2Z9TA 3SPVB 4ZMAT 5FLVA 1OQXA 4JHBA 4L8BA 1ZLVK 1MCOL 1S7UA 1UZ6E 1XF3B 3UROR 3OKOA 3KLAA 5DRNA 1CFNA 5DS1A 3PHAA 4DKFL 3IE4A 1T20A 1U6AH 3MMEA 1P5UB 5CEXB 4M1CC 2ZXCA 1OP5K 5A16A 1CGSH 2OMNA 2PWEA 3IWUA 4C59B 3P2TA 3QDGD 4JFQB 3II3A 2ODHA 3GXUB 5TPWH 3ILEA 3INOA 4OZIF 4KVNL 5GS3A 2BWIA 4FMKA 2Y2TA 3CN4A 3BLKA 5TQ2H 1E5YA 5DRWA 4N2HA 1D5XB 4HIQA 1TVHB 3S48A 5LVEA 3B9EA 1QSFE 1THCA 3J07A 2VDMB 1ZLEA 5DJ6A 3SDXB 5IVOA 3T0ED 4BFJA 1I1CA 1U3ZA 4BIKA 5IHUL 3DX3A 3FN3A 1KCWA 2EDLA 1I31A 1OGPA 4JX0A 3ARGC 1HILB 4LQFL 4NPJA 3US0A 3BSZL 3B5TA 1IMHC 3FTYA 1L9MA 2BXYA 4YDNA 3RWDA 5CHNA 3RY4A 2VC2L 3HCVA 4RAVA 5CD3B 2B0SH 4QHLA 3TTYA 3PDDA 2L7JA 3GBMH 2J8UB 3VGAC 1ZK5A 3SSGA 4N1HB 1Y6KR 1HSBA 1H19A 2PW2A 3K71B 4EBQL 3RURA 3WS3A 1F5WA 5BMFH 3N44B 4UNIA 3K80A 4Q4IA 1SVBA 3WDIA 1PZ2A 5D1QA 3W9EB 3QIUC 2Q86B 1DSYA 5FW8A 1M7DA 2A73A 3CDFA 1E27B 2ATPB 4KMLB 2YEZB 4W9KC 4A7QA 4BQ8A 1CYXA 2X4TA 1ZVSB 3MACL 2VZSA 2WINB 3WTVA 2J8UA 5ESAA 4NNXA 4AL8L 2PW2B 3OKEA 2YUZA 4AM0A 1MI5D 3CZUB 5TE6H 2K78A 5FYJH 1KIRA 5BRZD 1PD1A 4NAJA 2BX5A 5DD1L 3LKNB 4PCYA 3REVA 5FF6A 1F02I 2AV7A 3Q13A 2XZAL 3S2AA 4P23C 4D94A 4Y19A 5LQBL 1TTRA 2MSPA 3RUGB 2MCMA 3V0FA 4N90D 4OTXH 5HYJA 3MNDA 1MJ8L 4PRHB 2DMKA 5DYFA 1LEKB 2FBRA 2NW2B 1G4MA 3TBWA 4BFIA 4JM2A 1OPGL 3EADA 2N4IA 3BEVA 2JB6B 1DJSA 2ZXGA 4A2LA 5TF0A 4KAQL 3QEUA 5IVXA 2W60B 3MJ9L 5LNGA 4OT1L 4DVRH 5HHQB 4Z0XB 3AU0A 1TTFA 2HKFL 1M71B 3QUXD 4XO4A 4JQIL 1XWVA 1GGUA 1Z9LA 4HEMA 1OGAD 4ZX4A 2NY0D 4WQOA 3SYOA 4JFUA 4OUOA 1T20B 2AK4A 4HMCA 4OSUH 1ZY9A 2VDKH 3OAUL 5EEVA 5EF0A 4NPYB 3C8HA 1KUMA 3BD4A 5C09E 4X5RA 2ZUXA 3D06A 3HMWL 3U9WA 1N2RA 4X98A 4EXPX 3P4MB 3EJQA 1ZLWK 5DU7A 2B7DT 2WBJA 1JZJA 1E4KC 2IPUK 1UQSA 3C5XA 3PWUB 1U92A 3SQOH 4DQAA 1IC7L 4CN4A 2MNJB 5ISZD 1W91A 2J7LA 2OYLA 1ZHLA 1WGVA 1J8HE 5EUKB 3DETC 1QI3A 4EN3B 4D9RE 4DVBB 1QVOB 4AIXA 2YEQA 3TZVA 1BFVL 3CZJA 5ACZA 4NUPA 2H2PD 2D9QB 2WTOA 3EBAA 3H1ZA 2O6DA 3LHPL 3QBTB 2WCSA 1QHPA 3EYVB 1JNJA 3DV6B 4PMFA 2BJMH 4LCYA 4Y16D 4MMYA 1MWAA 2N7AA 3CFIC 4PJAA 2IBBA 2J1XA 2Y07L 5EUKA 2PYEB 3ARDA 2V5TA 2WO3B 4HIXH 1INDH 3E2HB 4XE0A 5I0DA 2QJDA 1C12A 2CR0A 4V2BA 4GW1B 1N6VA 4YE0A 1X7TA 3VD5A 5IV2B 4XZUA 4WCYH 3KYMB 2NX5D 4IRSA 5E6ZA 4CC0A 2R1WB 1FO0A 4WFFD 2YWYA 4XOBA 3WEXA 1FGNH 3A4FA 3DRTB 5DTFA 4NT6A 1DJHA 2W8CA 2OCJA 2QVFB 3JTSB 3D3VD 1BFSA 7TAAA 1TPXC 1IIIA 5E8DH 3O2WL 5IEKB 3BT0A 1YY8B 1PGRB 3BMWA 4MA7L 1X5HA 5HDBB 3VUAA 1CICD 2FT6A 3MZTA 3F7VB 3MLVH 1SN5A 5I9QC 3GKWH 1A7PL 1FP5A 1IEHA 3W57A 3LV3B 1OM3H 3PV7A 3S34H 4K3JL 1J1OL 5JHLH 5C3LD 4WU5B 1UURA 4ONOA 1MDTA 2PPAA 5HBBA 1G7MA 2J6EA 1XB6A 2EKSA 4HF5L 4I1RA 4AY0A 4MQTB 4E5XB 3QXVA 4NJ9H 3JWOC 5IHBA 1DQDL 2M1KA 3K46A 4UDUB 3V8OA 3F7VA 2F54E 1YUHB 3QRGL 4LMQI 4N8PA 4XHJD 4WZ9A 1U0QA 1RULL 3O2DL 2C1PA 2P8LB 3SKNB 2VLJD 1FIGH 3QEQD 3SJVA 2CDGB 1U8CA 3UABA 1JK8B 4RGOH 1AYOA 4GO6B 4JNXA 2K4WA 4ZFOA 4HHGA 1E0OB 1QFHA 2AXHA 2BP8B 1JHLL 2F1EA 5A7BA 4ADGA 2W1NA 3WNPA 4PJDB 5DD0H 3S36L 2E4FA 2QSTA 4L1TA 2AJUL 2VR5A 1YEJH 4X6CF 4PJHB 1QTPA 4PRAB 3J8F7 4F20A 2IH8A 2H3NA 4FLRA 4D0DA 3T0AA 4HJ0D 4J6RL 4Y2NA 4FGMA 3E80A 5CBEB 2MOVA 1D2OA 1NFDE 1JTPA 1OXYA 4XP5L 4PLJC 4OCYH 5D1ZA 2E6JA 3DX9A 1LDSA 1QNIA 4FFYH 1TYJA 3H4FA 1RZKL 3DJ9A 2HUEA 2HVJB 4HEPA 1B90A 1J12A 4MCZB 1W6WA 4X9IA 2F54D 2R8SL 5AKTA 1U8IA 2ARWA 2HRGA 2BVTA 4HF5H 4PD4K 1OF0A 3D85A 4HALA 2ZUTA 5I2IB 3ALWA 4QO1B 1LM8V 4FCHA 4R5TA 2DYPB 3SDAC 1JE6A 1OAQL 1WRFA 2J25A 2JK5A 1HFUA 1OTUD 3IDJA 4M48L 1TVHA 4QHNB 1HK6A 1M9WA 3NYKA 4MS6A 3B37A 3ZO9A 5DURB 3SPGA 1LP9E 3JYBA 5EORL 4ZX6A 3BE1H 1TF4A 2QHLA 1YEFH 2F54B 2Y4SA 2Z34A 3II2A 5ALBH 5JR1H 3VSUA 3QEHA 1SDDB 2JWYA 4FI6A 3CH8A 5IK3A 3LQZA 3U2SB 4UQBA 4MVBC 2F7PA 2ARJQ 4K7PH 2PWGA 5HY9A 4UTAL 1CL7I 1GJIA 3NTCH 2VXUH 3LRMA 1N68A 2AK4E 5AENA 3CQFA 4GS7C 4HG4J 1GOHA 1KTBA 4OV5B 5DJAA 2V5SA 1G7JB 2R29A 1T1XA 2P5PA 1F4WH 1CTNA 4V33A 3UOAB 5HHPA 2I32A 3FS9A 3W9EA 3M7FB 1NSNH 4PIBA 3QWRD 1WSST 5J9PB 5FA3A 4XXWC 3T8XA 4I8DA 1HC1A 2AVGA 3E0GA 1W0WA 2ORBL 1DVZA 3AS0A 3MV8D 3MLWH 4NQCE 2CDFB 3RNQB 4RGMB 3QHZL 1EO5A 1KNOB 2J44A 4U6YA 5TDOB 3Q7JA 3TXAA 3V10A 3WFDH 4YXHH 2V9RA 5KAQF 1KXTA 3ML8A 4FJZA 4RMBA 4HH9A 1TZGH 2HRPH 2ADJA 4Z7UB 5EC1A 5FA3B 3T0XA 1QFUL 2DLTA 1JHKL 4UTCA 4MA7H 1M1XA 3CIQA 3F8UB 2MNUA 2R0WH 3QJRB 4ZFZA 2PYEE 2D8KA 4XBPA 4LIQE 4KTGA 2Y36L 1PSKH 4TRPL 2DM2A 4YLCA 5KJRL 2AEQL 5LG1A 2DV6A 1TZ8A 2JH2A 2W81C 3GD1C 4NJ9L 2I9TB 2ICEB 4OLZL 1Z7JA 2RALA 4PWEA 3TJEH 3N6YA 1TZIB 3HG1D 4XP1H 4KQ0A 3LSOB 2L7QA 2FATH 4H40A 1BLIA 3H7LA 4QOKE 4BFKA 3C5JB 3HMXA 2EE0A 1C1EL 4ONHA 5IVNA 1THAA 3JWDC 4PRBA 5I8OL 1JPTH 1QFWL 1DZBA 5SX4I 5KVEH 1QSVA 2BIOA 4A6YL 3GMPB 1EFXB 4GI8A 1ZIBA 4K5PA 4FQCL 4Y2LA 2BNRA 4AM0Q 4WI6A 4FL4B 5I71B 3G6JA 4ODUA 1BBDL 3F7LA 3L9BA 3Q8CA 4QF1A 4YE4H 5D2NA 5IW6B 1HDMA 2AJVH 3KPNA 3Q6GH 4ZMQA 3KYKH 2ATAA 4OZFH 3RWJA 4H0IA 4N8CL 2R1XA 4P5TA 2P46B 4UNTA 1N19A 4JDTH 4WSGA 3BDXA 4XWGH 4WNSA 2FD6H 1BP3B 4F15C 1KN2H 1I7UA 2UZIH 1H15A 2OTWA 1RZKH 4TNGA 2NXYC 5DHVA 1PZDA 4AGMA 3WTSA 5C70A 3WGVB 3PAYA 1ETZA 1NGYA 1E42A 5TH2B 4MCNA 1JI1A 2V6HA 4LBAA 4YHPB 3T8MA 3W11D 1RHFA 2BINA 2EEXA 2QSCL 1T21A 3FT4A 1ZPUA 1ID2A 3SZKC 3G04B 2XPGB 2XNAA 5D1QE 2JKLA 2X3BA 3TO4D 2H6PA 5EU6A 3R06A 1WBXB 4AZ8B 4O58L 1BDYA 2R1YB 3ILQC 1FYTD 3ZZSA 2LOEA 5I15L 1M57B 3PNWA 3DYPA 2Q20A 1Z9PA 4N0FA 3UTSA 4GRWB 4JFFD 5FGSA 2X4UA 3JWNE 4ZMLA 4QTHA 4KHTH 2EC9T 1FL3B 3BX7C 5H94A 5GJTH 1WZMA 2ZUQC 1WT5A 3UAJC 3TA3A 4AQAB 3GSUB 1ZEAL 4JM2C 4NHUB 3AZUA 4KPHH 2EH8L 4LLMA 4TOYH 2NY4D 3O11A 3MOQA 4R26H 3ZL1A 5DA4A 5I6PA 5MEQA 5EZIH 5F9JA 4RCAA 5F72S 1G7MB 3DHJA 5AW7B 5I6XB 1KFAH 1S78D 2R7EA 5D6CB 5J1TC 4PJIB 1LQBC 5F1SA 3TA3B 1GOGA 1CXHA 2ZKXA 3B2VH 3HG4A 4NKDB 4QRFA 4Q2ZB 1A6WL 1F6AA 1ZMYA 3BJLA 1QFWM 1KB3A 1RPUA 3F7QA 3QIBC 3WY3A 4B60A 1G7LB 4KJPC 2AJYH 1NCGA 3F5WB 4FG2A 1QHQA 4A7SA 1DLFH 4NO0D 1ML0A 3IDYC 3I84A 3MRDB 4ELDA 4HIHB 4ZAKC 1D9KC 3SDDB 3SE8L 5C0RH 3FZUD 3J2PA 2A9DA 3NJVA 4LP8A 3RIKA 2XU9A 4OCXL 1FI8C 4YHMH 1VENA 1UKSA 4JZOB 4BINA 4DKEH 5FYLL 3HS0C 1YUKB 4ZPVB 3UBGA 5A7EA 4KK5C 4MRCA 1NZRA 1MEXH 1JWMB 1TYRA 5D1QD 5FKPA 4I9WD 4PJAB 4QRRE 5JHDE 3VSVA 1VGKA 2J6WA 2VABA 4EIGB 5C07B 4NN6C 3O6FD 4HS8H 5IF0A 4F9LC 1BPLB 2UXFA 2BC4B 2ZX8A 2I07B 3QC6X 3L4YA 1F42A 2HXAA 4NZTL 4MQ7A 4AK2A 2FAUA 4AQOA 2UZPA 2OW6A 3EO1A 3GRWL 4R90L 5DFWH 3B6SB 5JXEA 5BRQA 2P8PB 4GQPH 1LWJA 4FXGB 2FH8A 4CVWA 2WZ0A 4PS3A 4LCWE 2XNAB 1TQSA 1DSFL 2JFCA 4JRWA 3V5KA 1SXAA 5TF1L 3QCUL 2MTAA 1BZOA 2CIKB 4MXWL 4K07A 4XN4A 5BV7C 4UQ2A 2VDKL 3OAUH 4JFDE 1X5MA 4A2GA 2OTUB 3QJVB 3CN0A 2W0PA 4X50A 1KGXA 2N1KA 2QLVB 3INUL 3ULUD 5JO5B 2QGBA 2ZG2A 3GS7A 5H35A 1IJNA 3P9MB 3Q1EA 5ECJE 1CO1A 2D31A 2JKNA 1QYGL 1UGKA 4X5XB 4RDBA 1KTKE 2KZ1B 2KLRA 2ADGA 1M9SA 5CGBA 2FO4B 3COOA 2YOAA 2EE3A 4PTTB 1SYVB 4PJCE 3CN3A 4M7ZB 2B9BA 1O5PA 4HGMA 4PJ9C 4MAYB 3MGOA 3N42F 3K2UH 3C9NB 4JPIA 1KJ2A 3BW9B 4Z6AT 4XB3A 1EHLH 4MJ4A 5E8OA 4TSAL 2WWKT 2H5UA 1OLZA 4EQ3A 3GI8H 2BVYA 1R0AL 3PE9A 5DJDB 4ZX3A 4HJTA 3B43A 1VEPA 4MJIE 3EO0B 3BFQG 4RWHA 4JFXA 2EIZA 3DOSA 4XCNA 1L5GA 4J3TA 3DWTA 1H3UA 2H1XA 2OCCB 4MMXA 1KTRL 2YAHA 3RWGA 3DHMA 3LS4L 2NLJA 4JKLA 5GZOD 3UTTE 2EQDA 3UTQB 3OGCA 4XPHH 4AGPA 4KMTL 2ZT9C 4WV1A 4FOMA 3QFJA 1NCUA 2MMXA 2PLTA 1T66D 3GK8H 1CLCA 1S7UB 4HKZA 4TSBL 4QXTB 3FFCD 4S1SH 2A4CA 4Y16A 2CLRA 2ESVA 4UB0L 3E3QE 3B9KC 5B7EA 3IDIA 3MMEB 5DHMC 5DD0L 1YEDA 3BVNA 2Q87A 4U1IA 1PFOA 3CVHB 3PU7A 4WV1B 3D08A 3MHZA 3G9AB 5TTRA 5FFLA 3B2UC 3HR5A 5T3ZD 2GSGA 4FQ2L 4MA3A 2BNUB 3GM8A 4Z7WE 4XMVA 1PKQB 2RH0A 2D03L 3HG2A 2PYFA 1GPOH 4PGDB 5L2KA 1ADQL 3X1EA 5GRVL 1BXVA 4LOUC 3NZHH 2LVEA 3RL1A 3V5HB 2YN3A 5FPIA 1G1CA 1XGYH 5HYSB 3U2IA 2IGFL 5HGHA 2OA9A 3K1DA 1HZHH 4L8DB 3SCMC 4Q9RH 4JGMA 3SQBB 3VGHA 5F7UA 5BV7B 4A2EA 1NANH 3BXNB 5D7JD 5KVDH 5T5NF 4U3HA 1B0GA 4FERA 3GHPA 2IPUG 3NP4A 5B1KA 4ZUSB 2MPVA 2ED6A 3PWVB 4MFHA 1HHHA 2YKLL 2E7BA 3TF4A 3R7RA 2P24A 2X4QB 2A9MH 1B0WA 3BP5B 1VF5C 1ACXA 1JRHI 1TMCB 4QRAA 2EXTA 4PJXB 3ZT6A 4G6KL 4WWNA 3HG1E 2OMYB 2XA8L 2KZKA 2NCMA 4XT1C 5IVZB 2W95A 5EO1B 1JXGA 2HX9A 1Z9SB 5ADPH 1UXSA 4OFPA 1JWSB 2WZPA 1BAGA 1TSRA 3DXAE 4HLJA 5D7JB 3BKJL 3PP4H 2APWA 2NTSP 2MHAA 2X1PA 5FGCB 2GW5A 3EYQC 3O0LA 3NIDB 4XWOD 5AWNH 5T3XD 5GZOC 3IVKB 2PCYA 4GLRH 5HP5A 2YKKA 4NZUL 5HJ3B 4OM0L 4PGJA 3BUYA 3FHEA 1NEZG 4RQQA 1D6VH 2YMTA 3RWGB 2NXZB 4PV9A 3NQIA 3QDMA 4MGXA 4G72B 3FB5B 4CVZA 4PJXE 2UYLB 3GHBL 2V9UA 4JRFA 2WXLA 1G6VK 1RJZA 1XIWC 1GGBL 1EAPB 3VD3A 4TLTA 5IZ7A 1MJUL 1CBJA 1Q9LA 2O1AA 2CJSA 1AHWA 2CHWA 2ZSVA 3OR6A 4I18C 4IW4C 4NWUH 5LXVA 3ASOB 1C7TA 1U95B 3LH2L 5DJ6B 1L6PA 2A9NH 3GTTA 3SDXA 4BH8B 4ZSOB 5ICYB 5KW9H 3QQXA 5GRXG 4YDLC 1CLYH 3L6FA 3POCA 3PRZA 2OI9B 3QO0A 1PYWB 3D3VB 5DLLA 3GBNL 3V6ZB 1GA2A 2DYSB 2WGNB 1Y6NR 4GT0A 5C0CB 4E9SA 1IE4A 1BXUA 3I9AA 2ODIA 1OSZB 1QBMH 3O81A 4CJ0A 3HHRB 3C2SA 5T5FL 4BDVA 1SHMA 5DT1H 1KACB 4Y1AA 4YXKH 2VXQH 5EWIH 1CU4L 1JPSL 4O2CA 4HBCL 4RSYA 12E8L 3GLAA 4KXZH 3FC8A 3TT1H 1EWHA 3R4DA 1PVHA 2CLZA 4FQJH 3PJSB 3IDMA 4JY6A 3KLQA 2X6MA 1Y0LA 2BW5A 4L9DA 4F7TB 1HCZA 5DHDA 4KUCD 5L7XL 4JQXC 2E5EA 4G7RB 4MNQA 4P57B 4O2CB 4QKTA 4NKIL 3RTQD 4Z7NB 3RVUC 2RFXB 3QDGB 3O6MH 5IHLB 4H0LC 2VCOA 3BLBA 3MRBA 4NN7B 3RIFF 1VFMA 4FFYL 4YPGB 5C0DA 3I02A 1BX2A 4E36A 4U1HA 3PNWB 4FJ6A 4PJ5B 2YRZA 2XIDA 2N3JA 3K5RA 1KGJA 5DYOB 2VH5L 2Q8BL 2X9WA 1AGBA 4WDIA 1R1CA 4HIIA 5E4IA 4D9QE 5FOJA 2BRQA 2VE6A 1UA6L 4D7BA 4LVHB 1CFVL 3PGFH 3OD3A 1AZRA 1CDCA 3DUSA 1IM9A 1L9QA 1DBJH 2MFNA 1HHIA 1R5VA 2VDQH 5EORH 4LIQH 3V4VH 2X70A 4FFZL 1CDBA 5J3HD 5DRZA 4LVHC 1XF1A 4BQBA 2OL3H 2VO8A 4YS4A 4YSSA 1UWEH 1J9QA 3FB5A 2XXGA 3FQXA 3MRPB 4EF3A 2C5DC 4ODVL 4QRSB 3IAGC 3KWTA 2CKBH 4U6XB 2A9AA 3B1UA 3KL5A 1OCCB 2BMKB 3WBDA 4OZGF 2WUCH 5I19H 1UB5B 4K0OA 3ISYA 5FHBL 3BAXA 1F97A 4TUKL 3O41A 2VQTA 4KX7A 5E94A 2UX6A 3ZHLA 3HAEG 3K6NA 4OZGE 4ZNEE 1JGDB 5D70L 5E8EB 1DBKH 4F7KA 5C0IA 3VI3E 4OCYL 1TJXA 1IAKB 1RZJH 3N3EA 2DQFA 3S4SG 4JGNA 5CIPA 3HNSH 1FG2B 1JZ5A 4QRQA 4U49A 2QVMA 3PPSA 1QQDA 5C0CE 3L95B 4HCRH 4GINA 4P2QA 4DKTA 2JCCA 5A16B 2DTML 2BSRA 4UINL 2X40A 3S5ZA 2YPKA 5FM8A 2X1QA 5HHMB 3AABA 1IT9H 2G3XA 1V3JA 3VFUB 1GW0A 4X5WA 4RGMC 2J1ZA 1ZSDA 1I8KB 1P0SE 3W2DH 4GW1A 1TENA 5EOTA 1S7VB 5JQHC 3N1FC 1OHQA 3MLZL 1LO4H 5I1IL 1T4WA 5EU6D 1AG0A 5KSBB 3IJEA 3D85B 1E4JA 4BK5A 2NDGA 4OZHA 1T5WA 3VD4A 5IUCA 4Z78B 4ANVA 1TZOA 2J73A 3A6BH 3S37X 2HTLD 3WUZA 1QUNA 4ELMB 1SQ2N 2NXZD 3OG6B 1ZE3C 4NZTH 4KXBA 4XCEA 1QLEL 3PV6A 1A9BA 2YGVA 4JDEB 3GSXB 2C1OB 2F74A 5E00B 2IANA 3Q2VA 3MTXA 4EN3D 1CD1B 5DI8A 1MHCB 3D39E 5IB4A 1OE3A 1AGBB 1F6LL 4AYBA 4YHOL 1BA9A 1FORL 3SY0B 3VGDA 5LGJB 3VX0A 1VADA 4A6YH 3VNYA 3M07A 3RPIA 3ARGB 3LJ3A 4PJIE 4UU9A 4JHZA 1XH0A 1I53A 3CFEB 4R96B 5AOKA 4NO5B 3VXMD 2AJVL 4MXQC 5DQJA 4AKQA 5HD8C 5KBNC 2FTAA 1G7JA 3BIAX 3FFCB 3VFRA 4L8CA 1XDTT 2FT8A 1XT5A 1A1NA 2J1YA 5CP3H 2P4AB 3IFNL 2D9CA 3QVAA 3GMRB 4EUPA 2AABH 5DUJA 1TQVA 5I1LB 3BEWA 1DN0A 1XSIA 5FYKH 2CRIA 4LCUB 5MP6H 1HESA 4AV4A 1T2XA 1L5GB 1R24B 5GHWL 1I9EA 1DJYA 3ZPDA 1QWNA 5L2JB 4I2XE 5DXWA 5F71A 5B4MC 5FC9A 4NN5C 2UVEA 3SHSA 5LUMA 4F37K 1DSWA 3GYRA 3GO1H 4LU5H 4D0BB 2R39A 4MAYD 5A6LA 5DC0A 2DQIL 5DRWB 5AVWB 4HCFA 2FECI 2JQAA 3LEVH 2DM4A 4CW1B 3ELQA 3ZHKA 2YMOA 5D1XD 1J87A 3RI5K 4AYMC 2WXIA 1PKQE 5HVHC 4N0CD 3B34A 3CN1A 1BXAA 4PVLA 1H3PH 3S5YA 3EJSA 4MCZA 4NNYA 2VSCA 2ZCHH 3C6SA 5C07D 3QUMB 5IGXH 2YAMA 5FA4A 2YPVA 3OR7A 3VU1A 3HN5A 4HOZA 2F68X 1GCYA 2A0LC 2VMFA 2A74C 4JREC 3O9WC 2QQKH 4HEME 4K7FA 5CJXC 3OR6B 1WCQA 3O3DB 1FFPA 4QRPD 4OLUH 4RBPH 4FEMA 4ZUVB 1A3QA 3FF7A 1PD6A 2I25N 3FT2A 4PJHE 4EMZA 4MHHG 2VKWA 5T1LB 1TU2A 4MVBD 2BXZA 4H1LB 2YQBA 4IIQA 5K5YA 4R8WH 3QW9A 1E4KA 2GHWB 5FA4B 2A74B 3A3YB 2AI0H 1XGTB 5CCGE 4NQDE 4XVSL 3PL6A 3N41F 4O2EB 1RU9H 3V55A 1E43A 3ZMNA 4WEBH 5D93B 4OIIL 1EJOH 4B27A 3HFFA 5DMIL 5F96L 3VDBA 1FGVL 3OKDA 2FJHB 1KYOK 2BSED 4W4OA 2V7NA 3HVDA 1TZGL 3D2UA 4LGRB 3T4YA 3C08L 15C8L 4R9HA 3QQ3B 1Y0LB 4G6JH 1UH4A 4F58H 3SDAA 1A7OH 1IBDA 2EIBA 3C8DA 3MCG1 4NI3A 4ZO7A 1RSYA 1J0IA 4XMWA 8FABA 4BV1A 5E4OA 4P9MH 3DRTA 2COQA 3F85A 3P11H 3JV0A 5KJRH 4G42A 2P43B 1NUGA 3MPCA 3C8KB 4XMUA 3UL4A 2QTEA 2VGLM 5D7IE 2BHZA 4PS4H 5FX3A 1AS8A 1MCPH 4I1NB 3BZFB 2CUAA 3K0WA 2J88H 5AKRA 4C57C 2KKQA 2ADIA 4V1DE 1MCWW 3AM8A 1SLUA 4NHCH 4YSTA 2BFVL 1M7IB 2PMZA 2P5WA 2QMJA 1F3JB 3MV7A 2VDNL 5CZKA 3L3OC 1XZ0B 3HZYB 5DEGB 4GRWH 4ZDHB 2HKFH 3WNMA 2X6CA 3N85L 3F7PC 5TF1H 2EO7A 2ZKYA 4YDIL 5EBLA 1A25A 3GBEA 3FAWA 2ITFA 2IC2A 1OSPL 1NC4A 3RWIA 1CBVL 1PY4A 1L9TA 1NCAL 3ZGHA 4MJ5A 1NDMA 2VZ3A 1BAFH 4JO3L 4M02A 3Q1SL 3ARFC 4YHYB 5GRYA 1MCQA 1QVOA 4JRXB 4KKQA 3GXPA 1E7VA 4DEUA 3N40F 3O9WD 4OUUB 1NFDF 3IRZA 5D4JA 4UILL 1NEUA 2G5BB 1SEBB 3N1GC 1CXFA 2K9UA 1XV8A 3ARED 1OCOB 3ZUNC 1ZLVH 4DW2L 2OXGB 4MAYC 1CICC 1MVYA 4TM9A 4CU8A 5IFAH 4NUQA 4WF7A 1E8WA 1RULH 2F15A 4PR5A 1CI5A 4OZGB 2B08A 1JUFA 1HS6A 1EHLL 4Y1AB 2AK4D 2XOTA 3NN8B 4IHBA 2ZE0A 1ZJBA 3CLWA 4WI4A 1QOKA 1F8TH 1WHPA 2MQGA 3AS3A 3P4MA 1AXSB 4Y2OA 1YNTF 2PR9A 3HG1B 3V6FB 3U0PB 1I7UB 1TJMA 4HC1A 5KSUA 1J8SA 1FO0B 4KKNA 1TJGL 3VWKC 1OARL 5DO2C 3FTVA 4I87A 2HT4D 3A23A 1HOEA 2DQTL 1A14L 1UM4H 2E75C 4W9JC 4Z7VA 4H20H 4PD4J 3MGTB 2XWBA 2PXYD 5LBSH 3MJ8B 1E2ZA 2LQRA 5LAPA 3QQ3A 1RZFL 5IB1A 3W5MA 1BPVA 1KIPB 1YAZA 4OLUL 1B2WH 1F4XH 1GY1A 1S7WA 5DLMH 4HDIA 3F05A 5LBGA 2ERJB 1HL8A 5JMRA 1KJVA 5DUPL 1S8DB 4ADJA 1X4XA 3LZFH 4F15B 3VYPA 2ZWNA 4KAQH 1FV1B 4LKCB 3VXUE 4DOHE 3GSNB 2CO3A 2A1WH 4H88L 5SV4A 4NKIH 4U7SA 4JFEA 4BE5A 2X05A 1L7IL 5AW9B 3V4VB 5FHAH 3EH1A 3MLVL 4MZIA 3NP3A 5B3JE 4CAGA 2FBJH 4GG6A 4UQDA 2G3MA 2ZUQB 3MJ7B 4HAFA 3RAJL 4GRMB 5E24E 3L3KA 2G60L 2DM3A 4DJMA 4F5CE 1QR4A 1R3HA 2OSLA 3O11B 3RIAK 5C8JA 5H4ZA 4KUZH 1T83A 2FIRT 1MPAL 5IIEB 1FF5A 3CQPA 4RRPG 4YMPA 2IOIA 4ALAH 2OP4L 2AQRA 4GIPD 2BNQB 5HGGS 3US1A 3LEXB 3AW5A 3C5SB 4H2AA 4HU8A 5A2FA 1H9DA 3T0WA 4F9PA 1SVCP 2NY0C 3VFNA 4MQXC 5F7MC 4N0YL 1BQHA 2DEYX 3P0VL 1FHNA 3QUXC 1FPTL 1S4IA 2VDLL 3VXOB 4L4TD 1K6QL 3T0DA 1BZ8A 5EBWB 5JW4R 4MLSA 2GJRA 3EO0A 3FQTA 1LHZA 2NQCA 1FG2A 3KG5A 2IAMB 3AREB 4MDIB 4LPWA 5KYWB 1IGYB 2DQCL 1ANUA 4G7VH 1ADWA 1AZVA 3MV9B 4OF6A 5KS9E 5AW4B 3QCTL 5TDNB 4DGYH 1DDHB 3W0WB 2DIAA 5EU5A 2EXYD 4L4TE 3FUEA 3OKMB 4DN3L 1RZKC 4X99B 3L17A 3IS1X 1OQOA 3SJVD 1E4WL 5J5EA 4UDTB 2ZOUA 3MRMB 3ULAB 2G2PA 3U0PA 1F18A 1B3JA 3MZGB 2FSEA 3UX9B 3CSYA 1JL8A 2P28B 3Q3GB 1DUYA 3VI4F 5AYUL 2NZIA 3NK3A 4WJ5B 4QPEA 1TTGA 4Z0BH 4G8GA 3D18A 3UC2A 2V3FA 1YY9C 3QYCA 4Y89A 3EJYC 3ZDXF 1TQBC 2WOYA 4QRRA 4OV6F 4MMXC 1GC1H 1SGKA 4Y5YB 2W9EH 4YEFA 1JS4A 5CM1A 1PAMA 1W8EA 2VM9A 4I0PC 4LLVA 1DEEB 3MUHL 3QXDB 1ZWIA 4J4PD 1G9MC 4GY4A 3LIZL 5IG7A 4UQ2B 1BBJB 1HCYA 3AWGA 1OPOA 4FQ1L 5IFAL 1N8OE 3QI9D 4WKZB 4NRXA 1SY6H 2AGJH 4ZOBA 3OMNB 3VTAA 4AOFA 4PJGA 5IJKC 4YSCA 4FZEL 4LSSL 4YBLC 3L4TA 1JGVL 1MCHA 3DUUB 4CU7A 5FYLE 5SWSB 1SMOA 4P46C 1XGTA 4LSTH 1CTMA 3BZ5A 3HRZA 2P9RA 2E27H 3QJFB 3QR0A 3VRLF 4JFEB 4KRLB 1CIDA 1XSJA 4RAVB 4TN9A 5CD3A 4F7CB 4L37A 7FABH 4LAQH 3VFOB 1EGJH 2XN9A 1NBZA 3APMA 3LS4H 5IVXE 4KMTH 1A65A 3LRGA 4L3EA 3G04A 2DKUA 4LDLB 4A7VA 2BSDA 4YSUA 5E8NB 2QPUA 2H6PB 2X9XA 4OM1H 2PCFA 4U2YA 3NCXA 3HZVB 1RHHA 1FVCA 1NCWH 4HCRL 1I7RA 1WEJL 4HOWA 4ZMTA 2P42B 4K3EL 4UT6L 5IVZA 3BKCL 4YBQC 2KL6A 2P5EA 2GTZA 4I48A 4M1CD 2VSKB 5JPNA 2ZP9A 3MRQB 1R9FA 3PAZA 5CJOH 4G1EB 3WLWC 3AQXA 3N0AA 1H6FA 1M2OA 4P2OA 1JK8A 2E9JA 2RCSH 2Z7ZA 4FQ2H 4G9DA 1R3JA 1ZHNB 3EYSH 2YUWA 4ZMYA 4Q6KA 3W0WD 3CDCA 4ZPTB 4BQ6A 5CMAA 1OHZA 2F7QA 4UTAA 1YEIL 4KKBD 1Q1JL 4X7TA 3WFCH 1IAOA 5E1QA 2IGFH 3IAQA 5F9JB 5CJBA 2VN5A 1PZCA 1ZGLM 5C71A 4OZHF 3L8QA 3GSWB 4P8QA 4FQHA 4PGCA 4PJGF 3M86A 2FE0A 4H26B 4LAQL 1QLEH 5HYJE 2VL5A 1QBML 2XWTB 4HIJB 5HTSA 3WYRA 3BKYH 3FRPA 3RWIB 2IPKA 1PZUB 1AR1D 2NQ3A 5DZLA 5GGSY 3CK0L 4FKEA 2L8AA 1JFQL 3S96A 4MMZC 1W16A 3G08B 4M8VA 4QGTA 5AZEL 3QIBA 4JANA 4OF5A 3KWXA 2J5WA 4DP1X 2WNWA 3FRUA 4DNLA 1D3CA 2JK5B 1NM9A 3DX0A 3IDJB 3IN2A 4Z3EA 2IALA 2VZTA 1AFVH 4XPAL 4KI1A 3AUWB 2CO7B 2IF7A 1S7XA 4LESA 3S3JA 1H3TA 4LSQH 2GUOB 2W91A 2WXFA 1NGZA 5AW5B 1ZE3H 3G5VB 3L7EB 3TM6A 4DETA 1BW8A 2WP3O 3MLTB 3NPSC 3TLRA 4JDTL 5K59F 2EXWC 5L8LB 1E4WH 2J12B 4GXVH 1B2YA 2E9IA 4Y19D 5EN3A 3TN0A 3V6FA 4BCYA 1T0MA 4F57L 2ITEA 5HHOA 2ISDA 5J12C 4ECNA 2APBA 4ODUB 4X9YA 3GSRB 1MCEA 1MEXL 3CHRA 2PNDA 1FN4A 3NJHA 4WI9A 3AG1B 1JZFA 3HB3D 2LU7A 1EZVY 1YJDH 3GZOA 1FGVH 2D0HA 3Q2LA 2Z31B 2PXYB 5CO1A 4UZSA 3CZKA 1QSFA 4X5PA 5EU4A 2ZKHL 3DVGA 4KZDH 2XKUA 3KHOA 4G6JL 3FT9A 4LEEA 4M6NH 5I1HH 4JHAL 5D7JC 5L6YL 3GRWH 4R90H 5PAZA 3DOHA 2A9NL 5CU9A 4RQQB 3B7TA 4OQTA 5LNDA 2XVGA 1T1WA 3U2JA 4GSDL 2J6EL 2CJ3A 2MCPL 2CKBL 4G2AA 3K3QA 3GZQA 4LOUD 4YDKL 5EU6B 3PIQB 3MLUH 5HSFA 1NDGB 1RIVH 1SJEB 2GI7A 3IU3A 2R1YA 4JKNA 5KTEH 3VQLA 1DO5A 2Q0ZX 3CSGA 3V4PB 3DDFA 4AMKH 5C6TH 3V0GA 4NUMA 4NHCL 3MQIA 2PP9A 3QXUA 2OL3B 1JZ6A 1DJIA 1E2VA 4GUPA 4JRXA 4YZWA 2VQ4A 3UZQA 4X8XA 2EE9A 2EVJA 1FNGA 2OULB 1SZNA 4KHXH 1MWAH 5AW2B 5IT2H 4YQXL 2WMPA 1QWHA 4HWBH 4MZ3A 3FOLB 4PJ7E 4Y4KD 2BY2A 4TV3A 4JN1L 3S7GA 5CUSL 1UXMA 2LR4A 5IQ7L 1KTDA 4DVBA 3GJFA 4GUPB 4F58L 1AO7A 2RGSA 1DQLH 1KN2L 3FRUB 3VVWA 3GMPA 1EFXA 2VR9A 3UO1H 1E3XA 1FO0H 2CIIB 2XJLA 4OAWB 32C2B 3N1MC 1CK0L 5A3IC 4I13B 3HAEH 3QWNA 1OEZW 1CFTA 1NTDA 5BXFA 5FDYA 4PJ6A 3RX9A 1LYQA 4HIHA 3VTMA 4G71B 5KVFH 5I5JA 3QDGA 2IOOA 1WAAF 4NO0A 3S35H 1F8TL 2C9QA 2X4PB 1IKFL 2A6DA 4KNUA 1E90A 3VFGH 1T03L 4JFZL 4M43L 3MJ6A 3KW8A 3I6LE 1T1YA 5LXGL 5JHLA 5DZNA 5C0FB 1KCVL 4YHOH 2XCMC 1I85A 3J7HA 5D7SH 4CJ1A 2UY7A 4KUCF 5DC4B 2SODB 3IKKA 4LCWA 3SKMA 1DVFB 1MCRA 2VN3A 3LKSB 4POZC 3L54A 3O6FA 3RNKA 2P5WD 1ET7A 3RY6A 3MV7D 3BUBA 1A9EB 2R2CA 4TUKH 3KYAA 2BS8A 1FE8H 3VSTA 4L4TB 4PBVC 3UPRB 4I77L 3K91A 4EOWH 1BWMA 1B6UA 3T2PA 4ZS6C 1AQDB 2YXWA 3SE4A 2N0KA 3N43B 1TJIH 4GKZA 5AG8A 2RR3A 4FNPA 4OD3L 2N7SA 4UF7C 4B95C 3DOSB 1IFRA 1TQTA 3FH7A 3ATAA 2YXVA 1U8MA 3BZ4B 2XIIA 5TE4H 4AIZA 4EBQH 3GXDA 3BP7A 2XVLA 3V0DA 1TG8A 4U0QB 5DK0B 2LLNA 2GK0A 3APFA 4AG4L 2J1WA 2R4SH 4MZ2A 4M6ML 4E42B 1HL4A 4CGTA 1RZGA 5H2BA 1R34A 4X5XA 3HN3A 4LLDB 2ESVB 1W2KT 1UA3A 2DQEH 2KDYA 2NY6C 5CKAA 2R0LH 4PJDA 5F7AA 4F92B 5LXGH 4KV5E 4P2QB 2LAGB 2JCCB 4Z7NF 2AJSH 4Y9GA 5ADPL 1JTTA 1UM4L 4NP9A 3D1MC 1NIDA 1AZCA 2DQHH 4ERSH 2BSTA 3TIDB 4K5NA 5GRJH 5JW5B 2O61A 1I85C 2JXMB 3TH4T 3TP4A 4F7MB 5E2TH 1ULVA 3VWJA 1P9MC 4NERA 1XXFC 1KENL 2CIIA 1LK3H 2QDVA 2BNRE 2DD8H 3F83A 4JR9L 2H8PA 5DJZB 5D6DC 3ZHNA 4MWFA 3MJ9H 4E41D 3ULUL 3F6IA 1HIML 3IM1A 3LS5H 5IJDC 4LARL 1NPNA 1BJ1H 3GMQA 2A6DB 2YR3A 4BFOA 1TOXA 4H8VA 1IGML 3S3CB 2KERA 3LRSA 4AYGA 5IBLC 1MW2A 3S5LA 1HAWA 2R29H 3IT8D 4BDVB 2OI9C 2V8LA 2OM5A 4EJ1C 2PO6C 3U36A 4AG4H 1ZV9A 2WBJD 3V4UH 4B9PA 4POZD 2A74A 5EU6E 1OT1A 4U6TA 1CYWA 3FNKA 4XP6L 3TURA 4Y5XC 5H4YA 5KSAC 5LGJA 3GMLA 4X5LA 2UZXB 3FSAA 2B20A 5B7MA 2AJXL 1WWWX 2W65A 4YR6B 1GVIA 3A24A 1FL5A 1E40A 3OBAA 4ZUTB 1SOXA 3B4NA 2AXFB 3LVEA 2BY1A 1D9KA 2W0FA 2D7TH 4XR8C 1U3HB 4LKXA 1RZQA 1ECZA 1JPFB 3LQAL 4P57A 3RZCD 1A6PA 3TBBA 2X2YA 4G3YL 4N90E 4ZMXA 2RFXA 5EUOA 4UZUA 2ZIDA 3EGSB 1UM5L 2Z8RA 3X11B 3CFTA 2JKTM 2NXYD 3NJJA 4DP0X 5E7FA 5IBUB 3SDAB 4F7PB 3JWNC 4KO5A 4M61A 4ZX5A 5ESAB 1OP5H 1XAKA 1E5UI 1P6FA 3KNBB 2D4DA 1IFHL 3RU8H 2FWLB 1KYFA 1TJGH 1XF5B 4WI2A 1NCCL 3AAZA 2WNXA 4AGLA 5LB1A 4ODTL 2NX5A 1DHKA 4BD4A 4EZJA 1CFMA 2X10A 3NJGA 1ID5I 2LFGA 4ELMF 3FB6B 1FQ9C 2GT9B 3N50A 1UWYA 3IJSA 4N2MA 1DJZA 2YPLB 3BZFA 4IMKC 3TBTA 3RE0A 3BIBX 3UYPB 4H8WL 5GS0L 1NGWB 1LNUA 1UXSB 2CNZA 4XMKH 3QXWA 3BAIA 5FV1L 5FO8B 4KKRA 3RGHA 3FQRB 3D4YA 1XB8A 5LDUA 4JY5L 5F7YC 2QR0A 2XTLA 5JQ6H 5EZPA 2ICEA 3BJ91 3ECQA 1JI2A 3EYSL 4NWUL 3PDGA 4X6DF 1J5OH 1BZQK 3F62A 3ABZA 3LQAH 4ZUVA 5E94B 3NZHL 3BO8B 4AITA 5C86A 2D3LA 1O7DC 4P4RB 5F96H 3TO2B 4NQSB 1A3ZA 4WO4C 4E0RB 2Z0UA 3EYUL 5I23A 5ALCH 2K1MA 2RA1A 1GYVA 4NM8H 4PVNA 1RJZB 1UJ3B 2BNUA 3ISRA 5C9JA 2HWZL 4F8OA 1FFOA 1XR9B 5KZCB 3FTGA 3RGBA 4M5ZH 3ARVA 1PF3A 4M5TA 3MA9H 1CF8H 1QPKA 5D9SA 4N0YH 4APXB 5D2NB 4I4WB 1UD8A 1Z3GL 2VLKD 4UV7H 1ZHLB 43C9B 1HXYA 3EIFA 3G5XA 4GQQA 2V7NB 4KRNA 5D1QB 4YDVA 1FCGA 1EXGA 3BN9C 3E1F1 3K7UA 4WI7A 3IDUA 3HI5L 4NWTL 3RYMA 3LN4A 4TVUA 2EUWA 1M7DB 2A73B 3C6LB 3S36H 1EO8L 1I7TB 3WY4A 3BPLB 2WWKO 2Y7QA 2WINA 2AQQA 3DX2A 3OC8A 4WWKA 1ODUA 3ZTEA 2XTJE 1U91A 4DO4A 1VSCA 4UINH 4Y5XA 6TAAA 5KSAA 5TH2A 2X2HA 3AREC 4L1HA 3UTSD 2HRHA 3V0AC 1YYCA 3WTYA 2JB5H 5DMGC 4TVPD 3RFRA 2X4QA 2P24B 1BD2D 3BP5A 4MS8D 1PBYA 1PNCA 2D2CC 1QZ1A 4TQPA 4OI8A 3ZLQC 4PJXA 3V4LA 1W72A 3H9YA 3VWKA 1R5IA 4JFYA 3T65B 4KDTC 3DVGB 3TWCL 4OVUA 4G80B 5DQ9B 1KJVB 1YPZF 3MYZA 2AXGB 4YIQA 4QT5B 4F33B 2C7FA 4HISA 1KB5H 5GGRB 1F3JA 3MV7B 2JB6A 4GO9A 3W39B 3QUYC 1FHGA 4UV4H 4CMHB 3LZNA 4TTDC 3RPIB 5CEYB 2ZXQA 3ZQXA 3MRCB 4FJYA 3T65A 2JVUA 1DBAH 4MS8C 3DHPA 1LNUB 4G5ZL 3P0VH 4AC2A 4NKOB 1P69B 1LO5B 3FJTA 1JBJA 5LGYA 1FZJB 3MRJA 2C3XA 5H35B 2P80A 2F5BL 3KH3A 4P3CH 4F2FA 3ULVL 3FQRA 4V2CB 4X8CA 2D31B 1J48A 1XGPB 4IOFC 1YLBB 4QWWD 3VFPB 4KJWD 5I30L 5GISH 2G30A 2PF6A 3E6FB 2RBLA 1FUNA 1TCMA 4BA8A 5ICXA 5DMJB 1E9QB 3O0RL 4BSVB 1U95A 1QG3A 4Y9FA 3N44F 3L9EA 4MAUH 3QPXL 4L8BB 4PS8A 2K6ZA 3FFCE 1KDIA 2P7TB 4QHMA 1MFAH 1PKOA 2VZUA 1JXKA 1NSNL 3MVSA 4JRLA 4C47A 1KBKA 4PLJD 3RBSA 3NFPA 1JCVA 4MMXB 4Y5YC 1FNHA 2Z64C 2AK1H 4KHXL 5FO9A 1P7QA 4KJYB 4WO4D 4JO2L 4IRZH 2PPFA 1A7RH 2DLGA 2OV0A 2F1AA 1YMME 3OKMA 3ESMA 2VRKA 2YPVL 4N2FA 4EZMA 5E4EB 1MY7A 5EOQH 2WN2A 2YD5A 3LZRA 4JFVA 5I9QB 1TTUA 4K7FB 5EEYA 1OK8A 4IJ3C 3IMWA 5I0XA 3N91A 3T0VA 1TQUA 4JFHE 4OGQC 2HFFA 3WFCL 3TBCA 2Z8VC 1IGFH 4PCSA 3ARDC 5JHMA 1X4YA 2A0LD 3RDTB 2ZF9A 5JPMA 2R27A 4KKLC 4X5QA 2FGWH 4ZS7H 2XWJB 2PYFB 5D7HA 5FCUH 3ES6B 4XX1G 4HPOL 2VLJB 1FYTB 3SO3B 5I74C 2H0FA 2J1KA 5E9AA 4N0CC 3MLYL 2EH8H 3H0TA 2FATL 4E9LA 3WIIL 1OZTG 1BZ9A 3FFDB 3CUPA 2XQ0A 2I7SA 3BCDA 4A38A 2NMSA 1MFDL 3RDTC 5IIEA 3FUDA 2ZWSA 3OXRA 4E9YA 4C4KO 3HS8A 3HBGA 5PCYA 5IT2L 1NCOA 3BEWB 1JGIA 1CZ8L 1TETL 2VC2B 3ZY7A 4CU6A 5DJXB 2EDQA 1R24A 2X88A 2F7RA 2X9YA 1YYMH 5K93A 2HT2C 4Q6IB 3EDFA 4LLUB 1BQHB 1U8CB 2JJSA 3QFJD 3EG9B 1EERB 2RD0A 4B9YA 2V5RA 4EPSA 1XF2A 1MNUH 2WLHA 4J3VA 3L2MA 4E9XA 4PJBE 3PGCA 1JGEA 1TPXB 4Q97A 2HVKA 3CFEA 1HKLL 4FS0A 4GG6F 4K23H 4YK4B 5I6KA 2GK2A 2VITA 5ICXB 3TL5A 1ASQA 3Q44A 1PD0A 1INEH 3A21A 3CFDA 2BFGA 4ZDHA 3FO1A 2FH6A 4GI6A 3SDXE 2CG9X 2FGWL 3OX8B 1M3JA 3CHQA 2Y25A 1WITA 4XOAA 2ADFL 4GQ9H 4L2LA 4M6MH 3GPEA 4XN2A 1QBBA 1UYWL 4QLRA 3ECUA 4A55A 5JDSA 2FLMA 3VH8G 4C58B 2Q3XA 1TEGA 4ORGA 5JW3H 5L2KD 4HXBL 3VXRA 4JAMB 2ZCHL 3REWA 3BH4A 2EO1A 1JZ4A 3HC0A 3EOAA 4HUCA 3RGVB 1RK1B 4IRSC 4AEFA 3VACA 3BC9A 4NN6B 4UOJA 5GRJL 3N43F 3T0EB 1IU1A 4M1GL 3QCUH 1KCUH 4FL4C 2QHRL 3BGFB 2DH3A 3FCGA 1Z0NA 3D07A 1UZGA 2P45B 5DEFA 3HBQA 1ZTXL 1M6UA 4LCWD 1URIA 3RX7A 1FAKT 4RAUA 5GGUB 3NAAH 1OE1A 3VMNA 1OM9A 1N64H 1PG7L 2WKGA 1KIQB 2EEFA 1QSED 4UT9L 2R2BB 1RU9L 4XCYA 1DVTA 2H1LM 4JPQA 1U33A 3DURA 2XG5B 3B9KB 3MO1A 3CC5B 1KCLA 3LKOA 4U1NA 3L5WA 4NM4H 2OYMA 1CN4A 1P5UC 3MBEA 1Y18A 4N8VA 1HINL 4XO9A 1MHCA 4MQSB 3TPUA 3ZT5A 4IBUA 2UWEF 1ACCA 3QIWA 2YUXA 3SY0A 2WTRB 3K6SA 4NYLA 2YD0A 1DVYA 3GQFA 3WV0A 4MA8H 4NBZB 2O6EA 3SEPA 1ETZB 2E0PA 3KPMB 2PCPA 5JPNB 4YHPA 3VD7A 1FNFA 2MCPH 4YSPA 4G8FA 1WE5A 2Z7WA 4G1EA 3FTXA 3P3SA 4N85A 1W0VB 1NFIA 2GJJA 2OMXA 4TSBH 1R17A 5L2KE 4JRYE 1MXDA 5E4EC 4LP4A 1EBAA 3LEVL 4J3XA 5EBLB 1ESOA 3IVKA 2O72A 1NMCB 1V3KA 2HN7B 3CHOA 4QT5A 4F33A 1OCRB 4IDJL 5DYOA 5EZJA 1WCBA 3EJPA 5IY5B 5IB5A 4LARH 2D73A 4RRPA 2YZ8A 2EYRA 4NUJB 5DVOA 5FYKE 4ZYKA 5GZNC 5LN8A 1HNYA 2NSQA 3IGFA 5I1JH 1UVQA 4TMPA 1RZIA 1IAIH 4N3UA 3NJNA 2XN9E 3KPRD 4I3RH 1U8KA 3DIDA 5CGTA 5GS1C 2A38A 2IWGA 2VWEE 2IEPA 3APDA 5IB5B 4ZFGL 1JPGB 2YA2A 1K4DA 3CFKB 4QRBA 2A7BA 3KYNA 4HV8B 4PY8I 1I3GL 1QKZH 2VDOB 1UM6H 5I5MA 5AVXB 3D09A 1MVUB 1E4XH 4PB9L 1JDAA 5JHDD 4KO6A 4PMEA 4AL8H 4JFDD 4QTFA 1NAMB 1V54B 2KMWA 3JVFC 1FFPB 4Q6YA 1JGUL 4BSWA 1V3LA 4X7DC 4APXA 1JGDA 1U8OB 1Z9MA 4N2GA 1HXYB 3G5XB 2VDLH 4UM9B 4G6AC 3BSHA 1YNKL 3GHEH 35C8H 3O6KH 5CHNB 3PWJA 2C3VA 3GRBA 2DWEA 4X4XA 1KGUA 4NQCA 2HLFD 4M5ZL 1B0RB 1OTSC 1YEJL 3FN0H 5FAAA 3NRPA 4ELKB 4RA3A 3EOBB 3LH9A 5JXAH 4IYKA 5LDSA 1ORQB 3GZPA 4W4NA 5JQIB 4BGDA 4YDKH 2QPSA 4IMKA 5B1JC 1F4AA 4GKLA 4LCCB 3QUYA 1EZVX 1MCPL 1B9ZA 1S7VA 4U1KB 2Y5EA 3EGXB 4Z7AA 5AUMA 5DQ9A 5F7EH 1V05A 2QT6A 4O00A 4WTQA 5C0FA 5K9JL 4HJEA 1BIHA 3M8OL 1UUNA 2CJUH 1DL7L 1FH2A 1MHPL 2A1WL 4LP5A 1YEHH 2QPFA 3LVTA 1P4BH 3NCMA 4XAKD 2OW7A 3U9PL 1F1AA 3U1SH 1GYCA 3C8KA 2K8QA 3JSSA 3MLXH 1HE7A 3Q5YA 3QJFA 2NY2C 4H0HB 3T2OA 2JTYA 1FH5H 3D5OF 3IU3B 1HXKA 2JI1A 1G1KA 1I1AD 4Y2DC 2EH7L 3TWCH 3KXFD 5C3IA 3NACH 3HB3C 3JV6B 4YHKH 5LAXB 4JFOB 3BIKA 4LVOC 1USZA 4GEJA 4MYWB 4W70A 4DP4X 4DZ8B 1F00I 4PRPD 5ITFA 4G8IA 3FQXB 1C5DB 2EYRB 3FHAA 1Q72L 1UATA 2DQDH 4U6XA 2Q7AA 1GOFA 4FQIL 3TONA 3IMBA 2FO4A 4WO4B 2FYYA 9PCYA 5KVDL 1BGXL 2BMKA 3MRQA 4I3GA 4K9EL 4FAAB 5JDJA 1J86A 2E9WA 1HH9A 1I1AC 5LGKA 3D33A 1O6VA 4LPTA 1XGUA 2IMNA 5A2JH 4ACTA 5CBEA 2DM7A 4LLDA 2WLLA 1EO8H 3A22A 2YZ1A 4GI9A 4WFED 5FS5A 1CURA 5C0AB 4HU2A 3HW7A 1FLRL 2VLKA 5DS8A 3WLBA 3FCTB 4E9TA 5D93C 2F8OA 4ZO6A 2GEQA 2GJ6D 3GUFA 2VITB 4ZFZB 1KFGA 4M7LH 4QHUB 4XNYH 1XTLA 3PABA 3UH8A 3HG5A 2DL9A 5B3JF 5D7SL 3M17A 5AKVA 3VI3B 3QPXH 4JDZB 2CJTA 2GYSA 1ZA6A 4UNUA 2HMID 4Z7QB 1MFAL 3I2CH 1ITCA 1RXLA 2KDGA 5CLYA 1TCRA 2R29L 3EYVA 3PFQA 4O9HL 1CWVA 2EO9A 3CXFA 5I66A 2O6PA 1FFNA 3HOGA 4ZFGH 3NUKA 2QKIB 4FNUA 4XNZC 1NANI 3HR5B 4XXWA 4JKKA 1A4KB 4S11A 4A6YA 2D7NA 1MFEH 3V8CA 4ZD3H 2N59A 5CINL 1J8KA 1A6UL 2IXQA 4NRZB 4V1DD 5I1AA 1FFNB 2C8NA 1KPVA 2W59A 4PRIB 1U8IB 4LXFA 4M3HA 5B3SB 1WBZB 4DWHA 4X0KA 4Y5YA 3HMXH 5DFVC 2OZ4H 4ZW7A 4IRJD 3PL6B 5KWYC 3HZVA 1MI5B 1E5AA 1TLMA 4LLAA 4ZUTA 3ME0B 2MPAL 3DIVA 3S2CA 4J2XA 2DJMA 1UXWA 5LCVH 2YAFA 5EOCJ 4V1DB 3QHTC 4KKZA 2FWUA 4NO5A 4ODTH 1LD9B 1TZHA 1YNTA 1HN1A 5IMOA 5JXEC 1BMZA 2C26A 1OOAA 2HT3D 1DUZA 1PG7W 1UCTA 3AB0B 5AOIA 2OMWB 2ZJSH 4OZFA 3F58L 3AXHA 4WUUD 2CSPA 5J7CC 1GGCL 3UZVA 5T1KB 1OAXH 4PJ9D 4P46D 5EV7A 2RTTA 4LFHG 5DHVH 1NBZB 2DQCH 3AG2B 3D4CA 3HE6A 3ZO0A 1A7NH 5DZOA 3WJMB 2VMDA 1KIRB 1MRFL 5I18L 5TFSL 4L3EB 2YPVH 1EDHA 5C08E 4BZ1L 1YAIA 2QSCH 4CSZA 4XO3A 4ISVA 3U1QA 2GBAA 1Q8MA 1P7QD 1XX9C 5HJGA 2EP6A 1PIGA 4KH2A 2EAEA 1BVNT 3W2DL 1T0OA 1W0WB 4KZDL 5HYQA 1I8LA 3GJEA 1XO8A 4LLWA 4JPSA 3JWNH 4K23L 4NQUA 5AZ2L 4TPRH 5LBVA 2C4XA 4YLQT 4V11A 5ALCL 1NL0L 2KZBA 2E86A 2UUDH 4PRBB 5FM5O 1D5IH 4ZMPA 1FFRA 3BWZA 2IPTH 4NCC2 2RQEA 1HCVA 1GYAA 5F1IA 2CHZA 1WZ1L 4Q9QL 3OGOE 1H3GA 4ILDA 1FC1A 2X41A 3LN5B 4J3BA 5HGDA 1BF5A 1G0XA 4ZNCD 3KL3A 3ZTNH 2ZP8A 5AVQB 3F12A 4H1LA 4X7FC 4MD4A 3SDCC 2YS4A 4N2LA 4WWKC 4L8DA 4XBEH 4MNGE 3D34A 2V37A 3NT0A 3TBVA 1MH5A 3FUHA 3FMGH 3BXNA 3MTRA 3U7YH 1CF1A 2A99A 1JZDC 4JG9A 4H5SA 4YFLI 2DLFL 1DJWA 4MBOA 5KN5A 5ESQA 4PRNA 4HWEH 1IM3D 3CPLA 3X12A 2AAAA 5I19L 5C0EB 2B1HL 1KPRB 3WHE0 1UCBH 5CCKL 4N28A 1I7ZA 1KY7A 2IAAC 4XE5B 4P5SA 4PN6A 3DKHA 5DO8A 4AQEA 3P4NB 4N0UB 5AG9A 1MH5B 1MF2L