5AAPA

Complex of the fimh lectin with a c-linked para-biphenyl methylene alpha-d-mannoside
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
158
structure length
157
Chain Sequence
FACKTANGTAIPIGGGSANVYVNLAPVVNVGQNLVVDLSTQIFCHNDYPETITDYVTLQRGSAYGGVLSNFGTVKYSGSSYPFPTTSETPRVVYNSRTDKPWPVALYLTPVSSAGGVAIKAGSLIAVLILRQTNNYNSDDFQFVWNIYANNDVVVPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion
molecule keywords FIMH
publication title Structures of C-Mannosylated Anti-Adhesives Bound to the Type 1 Fimbrial Fimh Adhesin
pubmed doi rcsb
source organism Escherichia coli
total genus 33
structure length 157
sequence length 158
ec nomenclature
pdb deposition date 2015-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09160 FimH_man-bind FimH, mannose binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1090 Mainly Beta Sandwich Immunoglobulin-like Fimbrial-type adhesion domain 5aapA00
3ZL1A 4J3OH 3JWNH 2UY6B 3BFWA 4X5RA 5ABZA 3BFQG 3ZPDA 2XG5B 4BUQA 4AVJA 3MCYA 5FS5A 4AUYA 2XG4B 4X50A 5AAPA 4CA4A 5IQNA 4CSTA 4XOAA 4XO8A 4J3OG 3JWNG 1QUNB 2J2ZB 4XOCA 1KIUB 5JQIB 4AVIA 4XOEA 5IQOA 2VCOA 1TR7A 1N0LB 4J3OF 2JTYA 4CSSA 1PDKB 1ZE3H 5FLUA 4AV4A 5FX3A 3ZL2A 2W07B 3JWNE 5LNGA 1UWFA 4AV0A 4AUUA 3SQBB 4AVKA 2UY7B 5IQMA 5F2FA 5F3FA 3RFZA 4AVHA 4X5QA 4XO9A 4AV5A 1N12A 5LNEA 4XODA 2WMPB 3ME0B 4XOBA 4AUJA 5FWRA 2JMRA 5AB1A 4LOVA 5CGBA 3BWUF 4ATTA 1KLFB 4X5PA 5AALA
chains in the Genus database with same CATH superfamily
1IGTA 1N26A 5IVOA 5B38A 1ND0A 1AG6A 5DMGD 4WWKA 2E6PA 4WVRA 3F65A 4U6HB 3FSVA 1MJUH 4PJ8A 4RISH 1A22B 4IRZL 1OIOA 2OMBA 2J25A 2QFPA 5AD0B 2B59B 2IWEA 4YAQA 1KV7A 4PJHA 4NHCL 3OR7B 3MV7D 4Y19B 3U4BL 4N2HA 3QORA 3BZEA 1U8QB 2Y1YA 3VE0A 3CFDA 2CIIA 4H25A 4M1DH 3CIAA 3QWOB 3RAJL 3FDWA 3TBYA 1Z7JA 1HOEA 1P4BL 3BZDA 1JHTB 4PRBA 3NSJA 2NR6A 4J6IA 1CO1A 3PP4L 1PGRB 2VWEC 2ZXBA 4AVJA 3SDXB 4E5XB 3RVXD 5HDBB 5H8DA 5B39B 7CGTA 4PSPA 5DVKA 4KOBA 1G0DA 4MNGB 3L3GB 1J5OL 1CK0H 3MQIA 2PWDA 3POCA 4KQ0A 2LLGA 1D5IH 4HEMA 2CUIA 3RNKB 1OAKL 3IB4A 3QDJE 2NYYC 5IFJB 3RWGB 2IJ0C 1JN6A 2XZCH 4OD2A 5K9QI 2GQHA 4UUJB 1T7XA 4MAYC 2XN9B 3ZZLA 3QDAA 2AK4A 4NLHA 1CLZH 2H0EA 4LLYB 2GTWA 5D7JD 2DI8A 5C0RH 3ESMA 4BKLB 1KJMA 2A6DB 1RK1A 4JO4H 4PTUA 3W2DL 1U8PB 2XJKA 4PGEB 2VDNB 4HIIA 5EMYA 3MV01 1LO5B 3FRPG 4CL7A 1XGTB 4UNIA 4NN7B 4DW2L 1FNAA 4NQDA 3BQVA 2YQ3A 2QJDA 2VSCA 2K1MA 2BNRD 3MLWH 2D7MA 3LPFA 3S8FB 1FG2A 3MLYH 4UDTA 4M6AA 3RTQB 4UAOB 4I85A 4EN3A 5IBTL 5F7EH 1E42A 3E3QE 4TYUA 2ZICA 2WKOA 1F4HA 1LO0L 3I6KA 4RZCB 2ZWSA 4ERSH 4GRLA 5A2FA 3EOAA 3S88H 3Q13A 5LNGA 1BGXL 1MH5A 1JXJA 1VSCA 2H6PA 4FQIL 3NEOA 4XAKD 3EHBB 1HJCA 3IU4H 3UTTB 4O2CA 4ZOBA 3BAXA 1UOKA 1G7LB 4G8IB 4AC2A 4N2FA 1YY8B 1KCSH 3NQIA 3MLSH 2QHRH 2Q0ZX 4X8XA 5HTSA 4X5XB 5J6HA 3KPSA 2IQ9L 4KX9A 5ILTH 1BEYL 2C7FA 3ZKQD 1U2CA 1C08B 1BZ7B 1EV2E 4K3JL 3PGCB 3VFMB 4PVNA 1E6OL 3PHQB 5C08E 4E9VA 5IUSA 4R2GC 2Y07H 3CLFH 4P2QD 5AWNH 4N3TA 4WK4B 3Q48A 4UCFA 4NENB 5KSAB 1E4HA 4IM8A 2A6KA 3FZUC 4NKMA 1DCLA 2BFGA 5AZUA 3QIWA 4F8OA 3ECBB 4IU3B 4FTDA 5C7XH 2IOMA 4NQTA 4YSSA 5KYWA 4XP1H 5DT1L 1FI8C 3AS0A 2OYPA 3TBSA 3ZT5A 1BLNA 4Q4IA 3QRBA 1FV1B 3R1GL 4NQED 4ODHH 5FWQA 1ZXQA 2XQYK 4FXLA 1KB5B 4LBEB 3BFQG 2XV2A 1BBJA 3MODH 2IFFH 1OP3K 3VGAC 2BVUA 2XX1A 1AO7B 2X4UA 3TZVC 2QDVA 5AVQB 3VSVA 3FU7B 4IOFC 4FJYA 4PJCA 4R7LA 5AZEH 4RBPH 2W60B 4X6DF 3EH1A 1XF4B 3DRTA 5HHOE 4LPTA 1PX4A 4ODVL 3ZHLA 3QZOA 5HDOA 1Y7VA 1AD9A 1DQJA 3K3QA 4BFIA 3IBEA 3MJ9H 2DQEL 2PW2B 4M1CD 4DK3A 3US1A 3V0JA 4LCUB 3T08A 3U9UB 2FJUB 1UKTA 3FQWB 3UZEC 2ENPA 4NQXA 4P2CG 2PPCA 2IADA 1ACYL 2QQNH 4H88H 4X6DE 1U3HC 3C5ZA 1AZNA 4LLMA 4OCWH 1INEH 1OAYH 5KBDA 1KLUB 2AXGB 2K8QA 4BZ2H 5C71A 5IWLA 2ESVE 3K5SA 2HP4A 2NUPA 1RMFL 2APTA 2V0AA 4WAFA 1NBQA 1SJXA 2X9XA 1AQHA 4JQVA 1HHGA 3QULB 5F7KC 3N42B 5FYKL 3U7YL 3WY4A 4C54A 3MRQB 3KD4A 4I1NB 4J3OF 3ZHFA 1JCVA 4M1GH 1RUKH 3SDYL 1CG9B 1SLXA 2DBLH 4F7KA 4PV1C 4Q9RH 2FJFA 3KPPA 3GXFA 1FYTE 4MCMA 1BVKA 5ITFB 1JZ8A 4YX2L 4YDKH 2MQGA 4GKNB 3T71A 3K8KA 4ZMLA 1HK6A 1MCBA 1INQB 1QWNA 4X0KB 1JRHH 1J8RA 3CDGB 4LU5L 1K9TA 1DBMH 2HLEB 3IFOA 4X7SL 1VFAA 2BP0A 3K7UA 2IPKB 1LMKA 2A74C 2R0KH 2VH5H 3DETC 3QXTA 4R96B 4GYBA 4DGYL 1R9FA 1WHPA 2E9JA 3LZQA 1GHFH 3FRPB 3CH1A 4PJFB 1QSFA 3DJRA 5FGRA 5EH1A 3ARDA 3WJJA 4PJ9D 1AS8A 32C2B 3ZDYF 4KRNA 1KGJA 1OANA 3IETA 3CN3A 4RBPK 4GQRA 5DVMA 5F9OL 1KJVB 1N2RA 1MRDH 4JZJC 1YA5A 5DD0H 4XN2A 5F3BA 4WGKA 1CDYA 4J23A 3TA3A 5JHBA 5IVZB 1FZKB 4UV7H 4ATTA 1YEJL 3ZDYE 3L3IB 5AW2B 4I18B 5CR1A 5CZVL 4PV9A 1LMIA 2OP4H 3PG2A 3FH7A 3GUTB 4JHUA 3D4YA 5TE4H 4NXSA 3TFBA 3TT1L 1XGUA 2FGWL 2YSSB 4HFWA 5I15H 4D0DA 4APQC 1JPSH 1J05B 3C09C 4ZK8A 4WW2C 4NNXA 1GR7A 4X42A 3ECWA 1T5KA 1P6FA 5B4MC 2VE6B 3L4VA 4WEEA 4QKXB 4JFOB 5EEWA 2JJWA 3AGWA 3KGRA 1KUMA 3FQNB 1KCRL 4M5ZL 3MRIB 3DUSA 4Y2OB 3FO9A 5D1XD 5DHVA 3KPLB 2WKLA 5D93B 3U30B 1HXYA 1HSBB 2MWCA 5CU5A 3V6ZB 4NX0A 1I3RA 4PRDB 3IDIA 2YK1L 3NAAL 2EDQA 4APXA 2D9QB 1J5CA 1Z3GH 1L6PA 4OCRH 4PGCA 5D1QE 1NGZB 4PLJD 4YIQA 4AMWA 5I5IA 1P4UA 3ULUD 1J8KA 3D39B 2P44B 4FG0A 4MNQB 1NCWL 4TV3A 1RK0B 2XQBH 2ZXCA 2O6PA 3V4LA 1S7XB 1WITA 3EUDA 3QUXD 5EDXA 3U9PH 3UJJH 2CM5A 2PCPA 1SJHB 1P4BH 1PDKA 5DJYB 2V33A 5JHLA 4KAQL 1QACA 1I8LC 3MCKA 2GK0A 1K4DB 2G9HB 2ZCLH 4PTTB 5AOIA 4GBXB 4TPRH 2CCVA 4JPKH 4P23D 4OI8A 3F7YA 5EBGA 1N6QL 1DQVA 1O5DT 4FFVC 3VRJB 5FO7A 1MUJB 4TSAH 3WFBH 2WSKA 3U0PA 1S9XA 1GCYA 12E8L 5GRVK 4JVWA 4YZFF 5I6XC 1AGEA 2BVTA 2NSMA 4LFHG 4HV8A 2JK5A 5IW1B 3UPAA 3ZK0A 2F61A 4HPYH 3PGDA 4S11A 5AOMA 2N1KA 3PWPB 3WN5B 2YMXL 2BRRL 4W93A 1X5HA 1WEJL 4YSUA 2EKSA 2IDCA 5DMYA 4YZFE 3KPNA 4IBTA 4XWGL 3RWHA 5F7DB 2DLFH 1FFOB 4GQPH 1M9SA 2IAMA 3CFJA 4PBXA 3HMXH 3KYKL 4YWGL 4K23H 1NPJA 3H42L 3E8VA 4FQLH 4HA1A 2WO4A 4WCYL 1ETB1 2VUYA 4LEXL 4GY4A 5HGHA 1LDPL 3OAZH 3DGGB 3T0XA 5LLIC 3BQUA 3EJYC 1WIOA 5CJOL 3S5LB 3ME0B 3QNYA 2UUDK 2Y2TA 5JHDE 4C58B 1LO0H 4GKZA 3VXUA 5F9DC 3G6DH 3FCBA 5EU6B 3CGTA 5GS0L 1BGXH 2WN2A 3LN5A 4UNUA 2DWXA 3ZTJG 3QEGL 1ZLVK 2OULB 3FFDB 1TCRB 1WBZA 4HD9A 3N6YA 3RDTC 1LP9F 3IDGA 1EAPA 5EPMB 2HX7A 3VA2C 3ZKNC 2W59A 4BFNA 4EDXB 4IHOB 5TFSL 3KLKA 4XBGA 3S8WA 3WL9B 1GC1C 3JV6B 4X99B 1J0HA 1AHKA 4KWUA 3TIEB 3NN8A 3ZTCC 1LP9E 2KPWA 3O6LH 3N85H 4PW9A 4N2MA 3GRBA 5EO1A 1FFNA 2Z35B 5KSAD 4BUQA 1E4XL 2JE8A 3QT2A 4GI9A 4YBHA 1CIUA 1W72A 4WK0B 3U2IA 5JORA 1XGYH 4LKCA 2OR9L 3O3DB 2NZ1A 1A7NH 4BE5A 1RUQH 4OCMC 1OKEA 3QDJB 4Y4HA 3C5JA 4IDJH 3QRLA 3VWJD 5A2IH 2R29A 1XO8A 5F9WB 4J3OG 5DTFA 5E8EB 4OFDA 1CI5A 5BMFH 4ZOCA 4UDUB 5BQDA 4JRXA 2FEJA 2HRHA 5ENWB 1NMCC 5ANME 3SCMC 3BKYH 2Y9RT 2OMTA 2OZ4L 1QEXA 4PUBL 1FAIH 2R9HD 4PJDF 3WEXB 5DRNA 5E9DD 1RUPL 3LHPH 2H0PA 3D51A 3F7PC 1NAKL 4KXDA 4AIZA 3EO1A 1FNFA 5E95B 4ZFQA 3QUZD 1W15A 4OM1L 5GS3A 4K73A 3F05A 3OPZH 3SGDH 2G3NA 2ICEB 4FKKA 4TVSa 4RSYA 1QBML 5FOJA 2WSDA 3A67L 4PJDE 1DTUA 4HIXH 2BS8A 3MOBL 5JIKA 4NB7A 4OCLC 3GXPA 2EH7L 1SHSA 2RHEA 3EGDB 2VWEE 5FKAA 4DGIH 2ARJB 3RYMA 3GMQB 2MKWA 2PYEE 4KHXL 1FWXA 2J1KA 5GRWA 1HYRC 3MGOB 3TCLB 1NCDH 4DPBX 3ZGHA 1HINL 1BD2B 2H32H 5C0CB 2J8UA 2YAEA 3OX8B 3O0RL 4R97C 3REVA 5IIEA 3D0AA 2A4CA 3EJCA 3QZBA 4DCQA 4HT1H 3O11A 1CGSH 4N2OA 3LKRA 5D71H 2ZYHA 5C09D 3UYPB 3MTXA 1WFUA 1N59A 5TH2B 3O4LD 3FQXB 4PRPB 2FYYA 3TT3L 2WQAA 1QHQA 5C0NC 5F0JB 2WYZA 1E4WH 3HNTL 3LNGA 3NUKA 2BVYA 4PCKA 3ISYA 3QEHA 4EMZA 1MCWM 3B2PA 1IC4L 1BPLB 1EZUA 2QVTA 2YZ8A 2WTRB 3NRQA 5DXWA 1WZLA 1F0LA 2YKLL 2AEPL 3EBGA 4NC1E 5GRUH 3OJMB 3WHXA 1IM9A 4HC1A 4F15C 3P0YL 1BM3H 3K0WA 3T0WA 4WV1C 5E2VH 5DJXB 1CDUA 1U8LA 3H0TB 4ODUA 4BSWA 4LP4A 2XIIA 4AMKL 1OTUD 5AB2A 4KXZI 3PWUB 4JFDD 1J8HD 4W6XB 3ATEA 3IU3B 1T21B 4U3SA 2YBRA 5JPMB 3D69A 2Z64C 2DDQH 2CLRB 1TJGH 3ULSA 3KMDA 4QWWD 3GJFA 1BQUA 5CMAB 4CN1A 2PO6A 3PWNA 1NBVH 1NIEA 4HDIB 4N8VA 4C4KO 3PV6A 2PWFA 2KLRA 3RKDC 5HHOB 4DP9X 1OALA 3P4MA 4X50A 3PJSB 4TLSA 5F6IB 3IGAA 3K71A 1P0SE 2VZSA 2XV6B 1ZLSL 1TOXA 5FGCE 1WA2X 2PWGA 2AKRB 4LGPB 4NRXB 1CFSB 4DF9A 4AEHH 1NJ9A 3QDME 1UCTA 2R4SH 3QYMA 1A4JB 3KPRA 2A6JA 1FN4B 4GW4B 3KEDA 4YHML 4ZMNA 3IJHB 5EF3A 1A14L 1LDSA 1I7ZA 3UTQA 3D39D 1MJJA 3WS6C 1CYXA 2IG2L 1NIBA 4M56A 5H37G 3ETTA 3QYNA 3LZFL 2O6FA 1JDCA 2WVVA 5FO9B 4MDIA 3TA4D 1XCTA 4K8RD 4DP7X 5JPNA 3PL6B 1ZT7B 4L0PB 4O02L 1BZ9B 4GUCA 3AQZA 1DL7L 5FDWB 2ODIA 4P99A 3QJHA 5KVGL 1BV8A 1HOCB 1SEQH 4YR6B 3GKWH 5KYXB 1YYMH 4P57A 3WTSA 2H1PL 1ZLUH 2ITDA 1KPRA 5GJSL 1QVOA 1UFGA 1G7HA 3WI9A 3QG7H 2F7QA 5BRPA 5C3TA 4KNUA 4G9DB 4KY2A 1OB1B 4LT7A 2YPLE 1EDYA 2CBMA 2VLRE 3ABMB 4DK6A 4J39A 1MFBL 1Z1WA 2G60H 4X7DC 2QADD 5TDPA 1DBKL 5D1ZD 2JLLA 3FUKA 4MAUH 4NQSB 5SWZE 1BW8A 2JKXA 4ZUTA 2LQRA 1XTLA 1E27B 1MJ7L 1XAKA 1Z9NA 3H9SE 5F88A 5F7HA 4OZGF 3ARFB 4PG2A 4X8GA 3VXNB 3FOMA 3GIZL 2PXYD 2VGLM 5EFIA 3ZDYB 3BEVA 3CZFB 5ICUA 3V9FA 1AGCA 4KO6A 4FQPA 1EHXA 3DC0A 4LASL 2B7DT 2QZQA 5C08A 1F2XK 5J56B 5K9QG 1OARH 4J3BA 5MP6H 3MRFA 1DP0A 2GHZA 3PFUA 4NPKA 5GZND 1GGYA 5GRXG 1JOIA 1XEDA 4LEXH 4HOZA 3KPTA 3UCQA 1IAIM 4GXVL 4L05A 1FH5L 2CJUL 3ASWA 2EDJA 3OG6B 4G6AD 4Y88A 4AITA 1EO8L 3NJLA 4OUOA 2HTLC 2B08A 5FO2A 4LPYA 1AOHA 3PHSA 4MX7B 4NZUH 2EC8A 4MA8H 5HHXH 4K5PA 1FO0L 4N0FB 5JMOC 3D06A 2B2XL 5DFVD 4C56E 5EC1A 3CNKA 2QGEA 2FT7A 1WK0A 1T66D 2YQGA 4HCRL 4FQXC 3LPPA 1AP2A 3Q06A 5TFSH 4PRIE 1E4KC 2LLNA 2BVPB 3EJPA 1S7TB 4LGRB 3C60C 3RZWA 4FXKC 4PR5A 4I48B 1I1YA 3HE6C 5HVWA 3T6QC 2MOQA 5IJVA 3KH3A 2ZNXA 1CLOL 3LQZA 3BJ91 2BM3A 3KPOB 1SBSL 5DHDA 3QK0A 5ISZD 5E08H 2H0FA 4WW2F 2VXUL 5T5FL 2DOCA 1TO5A 1T1ZB 3M86A 2IV8A 3AITA 1LYQA 2VISA 4KXBA 3I9GL 4L8DB 4O9HL 1WH0A 3NFPA 4KTDH 5DEZA 4JRYE 5FLVA 2WZ0A 3LIUA 4FKEA 4OLYH 1FZJB 1K5NA 4K7PL 3ZTNH 5JW4N 3IMVA 3QCVH 3U6XS 3SZ6A 3S3DB 2X6MA 2FL5A 2CHWA 4PGBB 1Y6NR 4LCYB 4N2CA 1IBGH 2CJ3A 3D12B 3OKEA 5I1IH 3SZKC 1FYTA 2EO1A 4QHMA 4FCAA 2EYSA 3VD7A 4KTEL 5JW5A 4HS6B 2GY5A 3C6LD 3SGKA 1JGUH 3VFWA 2F0CA 1KPUA 4BCZA 1UKSA 1A6ZB 1EH9A 4WWNA 1TTUA 3V6FB 4U0QB 4I7ZC 1NIDA 2R2BB 3L3OC 3R8QA 1S78D 1JXDA 2WVTA 2JB5L 4O00A 4LLWA 4OTXL 3VXQA 3W0WA 1QWUA 3QH3B 3GIVA 5D7EA 1IQDA 4OJYA 3UP6A 3E6FA 3JVGA 5JHDB 1LE5B 4LIQH 1NCCH 1JE6A 3KYMA 4ADIA 4AYGA 4F7PA 4Q0XH 1UASA 1JF1A 4QRPB 4LSPL 1XB6A 3ARVA 1NANH 1IFGA 4DFIA 5HHMD 1XFPA 3SPIA 1SDDB 3MI6A 5DK0A 3DA0A 1HXMB 3I85A 1HHJB 5HPMA 4Y4FB 2VN5A 3KJ6H 2RB8A 2HFFA 3WD5L 2IWKA 2ZG3A 2O5NA 3X1EA 4NFBA 1F6LL 3S2AA 1FSKC 3SE4A 3MBXH 1Z32X 1ILUA 4ZMWA 1KGYE 3TT3H 1CUOA 2B3RA 3NSXA 4FA7B 1MWAH 4XVTH 4AL8H 5FCUH 1F3JA 2AQRA 2XCMC 1KGCD 1DEEA 1NBZA 1JPTL 4LF3A 1N0XH 1PNCA 3OGCA 3VRIA 3QQ4B 3AFLA 2ZIDA 5LBGA 4ZFGL 1Z66A 3K2IA 3NRPA 1A1MB 3AG4B 5HJDA 2R56L 2BIIA 4YDMA 3RI5K 3MOAL 2OJZL 3ZX1A 1AZBA 2FRGP 1VACB 3NRFA 1G1YA 4HK3J 5DZVA 1ZHBA 3NPSC 5DHMC 3AY2A 3Q0HA 4M6OL 4MA3A 4RIRA 1FNLA 1RJLA 4ANVA 2FWOB 3S35H 1PY0A 4K8RH 2DI9A 2EAEA 3J8F7 4Y2NA 1HAUA 1AZCA 3T0VA 4HIEB 5HDLA 4YLQT 5EULV 5F7AA 5C07E 4Z7OF 1X5YA 4WI9A 2BW4A 2EDWA 3EYQD 2QPDB 2K4AA 1V3JA 3CDZA 3IDJB 1HZHH 3X12B 1XXDC 1JVKA 4PS7A 2FQGA 5GGTH 3HI1A 1FL5A 1M3JA 1B6DA 1NKOA 1N0LB 2RACA 3ORJA 1CICD 3W37A 3EGXA 3GI8H 1KN4L 5D7LB 1KC5H 4Z7OE 1MFDL 4PJDB 3AG3B 1YCSA 2IMNA 1C5BL 3SSGA 3T2PA 2NW3B 5DJAB 5JR1L 4Y1AA 1E43A 1AGBB 3O4OB 4H8HA 4MBRA 1AVAA 3N1PC 1ET7A 1P1VA 2MPAL 3D34A 4EKXA 1YHPA 1T1YB 4HWBA 4JQIH 1AXSA 3HG1B 2JXMA 5GRYA 4HKZA 5DLLA 5IJKC 2XKSA 3BGFC 1NCUA 3M17A 3PHAA 4JY5H 4L1HA 2WZAA 2AK1H 1AIFB 2UY6A 1JK8B 2AAAA 4FL4C 1JNHB 2VZVA 1VENA 2HCZX 4TTGA 3CZNA 4MAYB 1KLGA 1KDJA 1U8OA 3AS3A 4YE4H 2QPFA 1XEUA 5H37A 2YAPA 1UB5A 3CN4A 4ZXBC 5GGSA 1ES0A 1ZTXE 3ARBC 4FFZL 1OP4A 1DJXA 4H1LG 3OKYA 2BZDA 4TNEA 3RIFK 1CE6A 1I3UA 1FLTX 1NUGA 4H5SA 3EYFA 4ODWA 4KKBC 1C5DB 3EYOB 3OBAA 5F1NA 3FTXA 1XX9C 3UJTL 3TH2T 2C4FU 3P77B 4PJXF 4XMKH 1WWAX 1QA9B 2KL6A 4JE4B 5CIPA 3NCYP 4JCLA 5CD5D 5HYIA 5IOPA 1P4IH 1M1XB 1OW0C 3VB8A 5CGTA 1YEIL 3WNIA 3L4UA 4B9IA 4Y9FA 1IM3A 1OE3A 5HJGA 3L9RB 4P3WA 4PJXE 1JTOA 1SFHA 4YK4C 3Q05A 2WUCH 4G7YL 4PJGF 4Y5VC 1W0VB 1G9NC 2DJ4A 4LASH 5GRJL 3H2QA 3CC1A 1AJ7L 2VIRA 2DQFA 2OTUB 1BX2B 4LCWA 3TPUB 4LLDB 4TUKH 4QRUB 3WDHA 4PJGE 5PAZA 1QFHA 4URKA 3MHZA 3OHXA 4NGHL 5FGCB 1TG8A 3W9EA 4P5RA 3VFGL 5CSBA 3OKOA 1UT1A 2Y22A 4GI8A 2D7OA 4MD4B 1F4AA 2ADGA 5FYJU 4L29A 4HU8A 2CZNA 2PNDA 1OSEA 1S9WB 3IFLH 4ZFOL 4FNSA 3FAWA 3FO0H 3UFIA 4JW3A 5ACZB 2WNGA 3MJ7A 3L4WA 5CLTA 1MLCA 3BZ4B 5E99L 1NDTA 3JUZA 1XIWB 4WO4C 2W07A 4AQEA 5ANMA 2GYSA 5EUOF 4AYID 1HWGB 4RMRA 4I87A 1M2VB 2DRUA 4XMUA 3UPRA 2VXVH 4UILL 5TDNB 5KBKA 2VLJE 3DMMD 4UB0H 4PGDB 4PG9A 5HI4D 5BO0D 3NCFB 5EUOE 3WIFB 1AQDB 1NINA 4LNRA 1M05B 2XPGA 2ED6A 5F1IA 4HJJL 4HJGB 1AYRA 5HDRA 4YHPB 2IH3B 1UM4H 3KBEA 1UM5H 4A2EA 1YECH 2IALB 2PYEA 4P59H 35C8H 4N0RA 5T3XL 2A4ZA 1AHWA 2VSDA 3TEUA 4OLZH 5GRZA 4KC3B 3BZFA 4A2GA 1JWUB 3CFNA 4WWOA 4FA6A 3H9SB 1OGTB 1U3HB 2XICA 3BISA 4O4YL 1AZVA 1NDMA 3HZMA 3IKCB 2DL2A 4XMVA 5TQ2H 4UT9L 3Q1SH 2GI7A 4ZPVA 5E5MB 3HE7C 4XCCH 2A83B 1WAAF 4ZDHB 1QFWH 4KK5D 3QEUA 5SWSA 4OZGB 1QSED 4RNRB 2ENSA 3R18A 2XBZA 4QRTA 4RWYL 4EI5C 1WCQA 1NCOA 5EU3B 5IW6B 4OCSH 1WAAE 4U1HB 2WXFA 4NWTH 3QJRB 4CGUB 4URTB 4OR1A 4QRPD 4Z3GA 1L6XA 1NWPA 2FDBP 4OGQC 5EF1A 2YXFA 3CU1A 3NZHH 5I82A 4ALAL 4F27A 3DVNA 3V0VB 4W9CC 1UZGA 5DD1L 3KCPB 2A74B 1A3QA 3HFML 1YLBB 2QKIA 2VZ3A 4H1LB 2DQUH 1MKFA 4MMZC 4LOFA 5ICXA 1XAUA 1X9QA 3QA3A 5DJ6A 2EIMB 3WD5H 5T1KA 4PRIB 1II4E 3SPVB 4HXAL 4K9EL 2BSRB 1XZWA 1FE8L 4XN4A 1EPFA 5EC2A 3MBEA 5IB2A 5MENB 4JFZH 1RZKH 3RX5A 3DV6A 5JOFB 1NGQL 4KK6D 4JZJB 3L1OL 1XV8A 3OLDA 5JIMA 4KI5C 1A9EB 2YQBA 3AY4A 2WB7A 1CGTA 4RCAA 1MNUL 2QSCH 5HSFA 4C59B 4W9LC 3QR2A 1BJ8A 4JRYB 3CVBA 3WFCH 4UOZA 3G9AB 4APQB 1Z5LA 1THCA 1ZT1A 4J4PA 1YEFL 2EIJB 1AY1L 1MFAL 4NN5C 1DQQB 4X7FC 4PJ5E 3HAEH 3RGVC 3V10A 1E9QB 4BH7B 4PMEA 3B7YA 2I07B 3IS1X 1U30A 4QAWA 2GB2A 3APNA 4QT5A 1IGIH 2JKJA 4G8FB 1I7RB 2EDKA 4ZW5A 2VLME 4P5TC 4UINH 2Q8AH 4I9WE 3LQMA 2MJWA 3LIZL 1E9PB 4FI6A 3SOTA 1H5BC 4DPAX 3TZVA 2KZ1B 3Q43A 3BP4B 2DQTH 1E9OA 3BX7C 3PDOB 4KZCA 3HC4H 1U4FA 4P46C 2YPLA 4MA7L 2Z7WA 5D7LD 4XAWH 3X13A 4FULA 2HJKA 3FFCA 2E56A 4GMSH 4Z78A 2NTFA 4MKTA 2VLKB 3AADB 4G6FB 4JO2H 1A8ZA 2XTSA 3DNKA 3QJFB 5SWZA 1JD7A 3DV4B 3IM1A 3CFEA 3ELQA 1YEDA 4IOIB 4X4ME 5INCB 3WUWA 4X4XB 2X4PA 4B0MM 3BESR 4JG1L 4N28A 5TK2A 5J0BA 4GG8A 2K45A 5L2KA 4EQ2A 2C8NA 4DT2A 1FQ9C 2ZUQB 1RQ5A 2VLLA 5BS0B 2EDXA 1ZHKB 1MFNA 4GO8A 4J3XA 1BZEA 5E00B 4WFEE 2FO4A 1J5HA 5LBSA 3SHSA 5G5DB 4BK5A 3OGOE 4OFQA 4Y5YB 3KYAA 5AVWB 5F8RC 5CEZE 2NNRA 4Q9CA 4BUGA 3QDGE 3GXUB 1J0IA 1XF2A 3HRZC 1HFUA 5FYJE 5MHSE 1XVSA 4E42A 1I9RH 1C8QA 2HT3C 2W1NA 4HOWA 2BSSA 2Y5TB 3LRSB 1XH3A 3L6FA 4LCCC 4B9YA 2CO7A 4IRJA 1KIUA 1R5VB 1Q0YH 1H0DA 2PP9A 4KRMB 1QLEL 5ESQA 3DSNA 5CU9A 4C56A 1URLA 1XCQB 3UG5A 2AXHA 3C5XA 3CXHJ 3SDDC 3U7WL 5HXMA 2CCWA 4ZAKC 4A6YL 4Z23A 2CR3A 1MVUB 1S7RA 1KPVB 3B2XA 3CVHA 1KCVH 1E30A 1NCBH 1FZOB 3TNMB 2PTTB 1QRNE 5HD8C 4JCWA 3QIBA 1OCRB 4F7TA 2GTQA 2QR0B 5JYLA 3LXAA 4H8WL 5AL0A 3FN3A 3P02A 1EIBA 3GSNL 4U1KA 2YUXA 1QWHA 2E7MA 3V95A 3CFBA 3U2JA 1SLWA 4JFPB 3VWKD 3IE9A 5E7BA 3S34H 5I28A 4OBRA 4MJIE 5A16A 2FX7L 1C7SA 1L4IA 1WFNA 2VRQA 1NL0L 5IM7B 4Y9EA 5AOJA 4AG4H 1QBLH 4F8LA 4YAQB 1JGDB 4Z7OB 3BAWA 3MROB 1SF3A 4TTDC 3HC2A 4AKQA 3CFDB 4RMTA 2COVD 2DQJL 4B96A 4LPXA 4NNPL 4HUNB 2Z7UA 4KXCA 3EH2A 1SDAB 4BH8A 4IRSB 4JFEE 4L1SA 1XF3B 1XIWD 1NAMA 4OF0A 1XGZA 1JI1A 4GSDL 3CCHB 2HVKA 5B22A 3MXVL 3T8XA 1E90A 1NOFA 4ZSOE 2MCMA 3G5YA 4S1RH 4N6RB 1QLFA 4KVPA 5ADPH 5E0FA 1DN0A 2FZ3B 1PF3A 3BPOC 3M1CA 4S1DC 2FJGB 1CN4A 2DN7A 1E4JA 2V17L 3KCWA 4PRAA 3NK3A 3P4NB 5C0BB 3MDJA 1JHLH 3D85D 2H2PD 3IJ8A 3TGXA 1CQYA 2AABL 1KJ2A 5FYLE 4G7RB 1DDHB 1I85C 3ARSA 4Z95H 4PTUB 3CVIL 4UYQA 2E3VA 3BXNB 1TYRA 3EDDA 3ES6B 1GIGH 3QI9C 3KLDA 1ASPA 1G5GA 1A7RL 5CHNA 1KCKA 2WLIB 1ZVHA 2OI9C 4MJHA 2F54B 2VQ4A 1DJIA 3RIKA 4DO5A 3GPSA 2BK8A 3G08B 4ZS7L 5DRWB 3HNSH 3F7QA 2GJRA 2YC1B 3NA9H 2FX8L 5AW5B 1SYSB 3PWLA 1BIIA 1T0NB 4AZ8A 3UTOA 4UDTB 1J11A 4L5FE 2AF2A 1CFQA 1IT9H 2ZJSL 5GS1C 2CK0L 2DQCH 5DHYA 3T4AC 5M7QA 2RAMA 1N7MH 2EIZA 3I02B 4DQOL 4G8EB 3CSYB 3I6KB 2V2XB 3IEAA 2VDRB 3GTVA 4OQTL 2GBUA 1B3JA 4QOKD 3AREA 1K3ZA 1MH5B 2ITCB 1U58A 1FJ1A 4FLOA 1EHNA 2FO8A 4GS7B 4DPCX 4PJGB 4R97B 3BPLC 2IPTH 1DVQA 4PB9L 1DFXA 4NRYA 1ZGLB 2PTVA 4NT6B 1AQ8A 1RURH 1RI8A 4BA8A 1KIQB 3QQDB 2NZ9D 3RURA 4FMFA 1OGAE 1NFDF 2I60H 4F93B 3Q5YA 5CP7B 3MREA 2NTSP 1YC8A 3WXVH 1MEXL 5EBLB 1EANA 3LKOA 4JREC 4KK8D 4LRIA 1XF5B 5DLMH 3N44B 1NFDE 2O5YH 4Q9QH 5C07A 4WV1B 2B5IC 4OZ4A 3O2DL 3O45A 2VLJB 1ZY9A 4I88A 2CGZA 2WO2B 1J0KA 3S5ZA 5HGDB 3FO2A 5EUOB 3BUTA 3L13A 2WANA 1N64L 4ELMF 4NSKB 3DTDA 2MQ0A 3AUWB 2WMPA 3OMIB 1FVCA 3VD1A 5FFLA 3TESA 2Y5QA 5K69A 1JAEA 5BVPL 2NX5E 4OIBA 3US0A 1IAII 3Q3GB 2B1AH 4OGXL 3HNVL 1LM8V 3RL1A 4TM9A 4OT1H 4ELME 2UY7B 3F5WA 2XWBB 2XA8H 1D9KD 5ID0A 1NLBH 3DRTB 1MFAH 3BGAA 3MRGA 1QQDA 1AD9B 1DQJB 1HSAA 1RP9A 5LAXA 3MOQA 4F7EA 4Z7UF 1CFTB 2WZ6A 2FBOJ 3NYKA 5GS0C 4XPFH 15C8H 2WQ8A 1S7UA 2AQ2A 3KLLA 5TK4A 1E6JH 4ZZKA 3QPQD 2WNXA 3A5VA 4QXGL 3FTVA 4AOFA 3L3HB 2XZZA 3V5DA 3AXHA 4F57L 5HYSA 5KJ7E 4Z7UE 2MHAA 1CXFA 2XI9A 5HHQA 2HG0A 2OCJA 3OKDA 4XTRC 3ZO9A 4NQCA 4S1QL 4WNQB 3C9NB 1YEGL 2XPYA 4ZQKB 4YLCA 2IH1A 4H26B 2WQXA 1HHGB 1V3LA 2PW1A 2WXRA 4EI0A 2ZONA 3E2HC 1ANUA 2Q7YA 1OY3B 1HI6B 3V4PA 1TZHA 3ZSTA 4P9ML 2BP8B 2R1YB 1TPXC 4L3EE 3I9IA 5EG6C 3MV8B 2LABA 1T83C 2F74A 2NY5L 1BVKB 4JDVA 2BOBA 2L8AA 4XE5B 4GG6B 3CX2A 4RMWA 2QVKA 1MI5E 2WLLA 3FQRB 4L1TA 4R7VA 5FYKU 1FYHB 3HLAA 1USZA 1YYLL 3LD8B 4I77H 1L6ZA 4UT6H 3OD3A 3IFOB 1LNUA 1VFAB 2BP0B 4JM4H 4F2EA 1QFUL 2EVJA 3WIHH 3FSWA 1O7DC 5BS0D 2Q10A 4WEBL 4BWTA 5DZ9A 3DIFB 4YQXH 1KXHA 5B8CA 3CH1B 3KHOA 5IK3A 2WZ5A 4ZQTA 1GAFH 2DQIH 4B6ZA 1UCBL 3LS4H 4PJ6A 4N8CH 3TASA 3WEOA 4CA4A 3OM3B 4RX4D 1WWBX 3MLUL 1DBBL 3TH4T 3VFOA 4FQHA 1P7HL 3QXUA 1N2RB 1DJGA 3T9WA 4F5CA 4FLQA 1ZMYA 4P5SA 5KVFH 5AW3B 3B4NA 1MLBA 3I6LD 2CR6A 1GJUA 4XPAL 2GEEA 3N1FC 4PIBA 2OL3L 3FO1B 3M7FB 4X5WA 3K81A 2LHAA 2JJSC 4HQQL 1D5BA 1XGUB 4HFWB 4D0DB 4PJ5B 2AQSA 1R3LB 4W9FC 3EJJX 1TZIB 4I0KA 2XNAA 5G55A 1UXSB 4LHUG 2OFQA 4PS4L 2JKTM 4JN2A 1FL6B 2C7UA 3U0WH 3FO9B 1BQHA 3L4CA 4ZYKA 3DPBA 1E4XI 2QPUA 3FN0L 5CJQH 3L3JA 3QEQD 1MHCB 25C8L 2FSEB 4LRNL 5IOPB 4MZIA 3HB3C 1I3RB 4DZBB 4WWKD 3HBPA 4PJ8D 4APXB 3FQUB 5DEGA 3EYUL 2ZP0T 4HCGA 4YSTA 1VEPA 2D31B 1IARB 2EJ1A 4JGMA 4QY8B 5FA4B 2X05A 1PEZA 3QORD 1IEBB 2I5YL 3SDAC 5MI0C 4KI5F 4FXKB 1I3GH 4QHUA 3HE6B 2PWHA 2BWQA 1MHEA 4P3CH 4R90L 3U6XA 1OZTG 2DQJH 4UTBL 1R3KA 4NNPH 3IF1A 5GGQL 4HAGA 2NR6D 5D96B 2X0WA 4E41E 4FQCL 2HFGH 4DUXA 4QLRA 5IUCA 1IIIA 43C9B 4JY6A 2L7UA 4KI5E 1V3MA 4YBLC 3VXSB 5EZJA 3OJDA 1EJ6A 4ECNA 1E7UA 3VFPA 2XN0A 4FQJH 2WXJA 4D9QE 1TKWA 3V4VA 4BZ1H 3U0PB 2VC2B 4IIZA 2GCYB 2JSFA 1CLCA 1OSPL 3LB6D 2WAQA 1GOHA 2AK4D 1CLVA 1PYWA 4RSVA 1A4KA 5I0XA 3LPWA 4WRLA 4JFHE 4DO6A 3CE1A 1KT2B 2X2YA 4R4FL 2Z4QB 2BXYA 3CHPA 1M7IA 4ZBJA 2DYSB 4FG6C 4N2DA 1NA8A 4XXDB 4POZD 1UWEH 3KPNB 2R69L 2AAVA 3OWRA 3DX9B 3SBQA 1A7RH 5CEXB 5DMIL 3LKQB 5TPWL 4NQDD 2OX5B 2HKHH 1I8AA 3AMKA 3KYOA 2W0FB 5FS5A 4ZUSA 5BV7L 2YPKB 4KO5A 4N85A 3CFKA 4RMQA 4Z9KB 5AKSA 5DYFA 3WEMA 4BELD 5IMLB 2OMYA 4QXTB 4JLRB 2DZEA 4HOXA 4U1SA 3U1SH 4F9PA 5A2KH 5TQ0H 4OSUH 2GJ6B 3WBDA 1B2WL 2NQ3A 1QRNB 4GRLD 4HS3B 2H41A 1RJZB 2IDTA 1YUKB 4M8QA 2C1PB 4OU3A 1DQKA 4Q6IA 5E6UB 5I8EB 1UTDA 1E8XA 4J8RB 1FNEB 2XZAH 1R5IB 3JYCA 4P2RB 3CLEH 2ZXDA 4XNUL 2FBJL 3P3RA 4KQ4L 4XNYH 3LN5B 4P49A 4RMUA 3RL2A 2P5WE 3HZVA 4DTGH 2X1OA 2V2WB 1S7WB 3TC9A 3IDGB 4L2YA 4RDQF 4RMBA 2UWEB 1JHKL 3LKSB 1KEML 2Z65C 1EAPB 2AGJH 1K8IA 3ASOB 3L45A 4J6RL 5LGHH 1VESA 3RLSA 3KPSD 1XZ0A 2ZOLB 4NO5A 5HVHC 2YD1A 3QFJB 4HFUL 1S5IL 4XC1H 4CU8A 1B6UA 3DARA 4UANA 1F5WA 1TLKA 3FTUA 3MA7B 1MPAH 1FFNB 2BNQE 1QKZH 4ZFFB 4KDTA 5ALBL 2MNWA 5CJXA 5DRXA 5C0DA 4YL9A 3D0LB 2OKMA 2C26A 1JZIA 4ZSOB 1JWMB 2WWMC 1PX3A 3VFUA 3O2DH 2X88A 4KJQC 3SJVE 4GFTB 5KSUB 5IQ7L 4S0TD 3C5JB 4FQXA 3HZYB 4DP8X 4Z7NF 1UWXK 2HUEA 3A6CL 1YNKH 3B5TA 5CILL 1U8NA 1K6QL 2VDNL 4LOUC 3NPSB 4NERA 4PLKC 3C60A 4QRSA 4KMQA 5DTFB 1MCRA 1GGCH 4GKSA 1RJYB 1QNZL 3PREA 4I0PA 5A7EA 3VXME 2PCYA 4WWPA 4YHOH 4Z7NE 5C2BL 2WINB 1NSNH 3GSXA 2JH2A 4L4TE 1F4XH 3HNVH 4X4MA 3QSKB 1JZHA 4PHXA 3UBXA 4AW4A 1MREH 2KI6A 3APDA 2IBBA 4OGZA 4TQPA 3ZHNA 2X70B 3SY0A 4NAJA 4GSXA 5IJBC 3EO1B 3OKKA 4EZKA 2BJMH 4NZTL 1NLDH 4YDJA 1MRFL 5IB5A 4N90D 1L9PA 4JL1A 4XH2A 1CDGA 5HVGB 1T20A 2CH8A 4WU7A 2G75A 4GRWH 3MRDA 3PYCA 5CAYB 2ZE0A 4XP4L 3QDGA 1T03H 2OQJB 1OP9A 1UENA 5I9QC 5IROA 3IJEB 4M5YL 3H4FA 2WZPA 3AU1B 3BGFB 3ZYZA 4XI5D 5A3IC 4L4VE 4W9GC 1Z5HA 3NCJL 4HJ0C 1TTCA 3L3OA 4FL4B 3T6ZA 1XGPB 1Z5YD 1ZANH 5E2UL 3ZDZF 4G8GA 1QD0A 4UF7C 3CMGA 2A7BA 4M6MH 4ZXBB 5I24A 2FYYB 2EINB 1G6VK 5C0FA 5KBMA 4TNVK 1GW6A 4XCNA 3ZDZE 3OLIA 1WT5C 4JM2B 3ZE1B 3MUGB 3QG6B 4XMPL 5DSCA 2ZXQA 2G5BB 1NFDB 3IWVA 1QSFD 1V5JA 3AROA 3L5HA 3ZUNC 2YEZA 3ZOAA 1UH4A 4FXGC 4PJ7B 1NICA 4WNSA 5BUGA 1KB5L 3LH2H 3NJNA 4ODUB 4MJIA 3WKMH 2XLLA 5IHZB 4G1EA 5L88L 5IT2H 4HIJB 3OKMA 1R1CA 1QTSA 4IHBA 3EBAA 3TA3D 3CN0A 4PI0A 2APWA 2R8SL 2F8OA 3STZA 1S6NA 5EHFA 4U3SB 4CILA 2YBRB 3CUPA 4TSBL 1KYOJ 2FYVA 2X1WL 4JFEA 5E6IA 4X80H 5DC9B 1OXYA 3GC3A 1BVNP 1PAMA 4WDIB 5EO0A 4AM0B 1VFBA 1I1RA 2XQYA 5BPPA 4DNLA 1H3TA 3SPCA 2FWLB 3RFRA 1DLFL 4KKRA 3TIDA 3HG0A 4OY9A 4LKXB 2C1OA 4KGLA 4OD1L 4WUUE 5EEZA 2RFXB 2MFNA 5JZ7C 3CXHK 2HVBA 4FABL 1T5WB 5IKCB 3OXRB 1E7VA 4CAGA 1OK0A 2H9GB 2JB6B 4LHUA 3KPRB 2A6JB 4IBQA 2P3YA 3T1WA 3DX8B 2XDHA 1I7ZB 4G7QB 5IFHH 1MJJB 4ADJA 4BKTC 1PPIA 4HH8A 4KUCD 3UH8A 5D2LF 3LKNB 3V0AC 4CU6A 4MXQD 1DFBL 4NWUL 4YDZA 4L3EB 5HYJB 4EBQL 5ABZA 2Q6WB 3IXTB 4J2QA 5KOMC 5HPOA 4HK3N 3OZ9L 4WKXA 4OJFL 5D2LE 5H4YA 3GK8L 1TEFA 5GGUA 4PJEA 4AYFA 4MCYB 1SOQA 2DEWX 4JKPH 1G6RB 3VG9B 4YNYA 3GSRA 3TBTB 2DQDH 3ARGC 3O6FC 2VR6A 3FYIB 4Y1SA 5CBEB 2OXHB 4X9GA 1B3IA 4DWHA 2BOCB 3HPJA 4U1NA 5J9PB 1HZLA 4WUKH 1ETJA 4KROB 4DP4X 2ARJQ 2GFBB 3H3PL 3QUYB 5D70H 4FYTA 5FXCH 3IJYB 3T6VA 2X4TB 2IAMD 1HDMB 1ITCA 1IGML 5SWQA 4F3FA 1OE2A 4NUGL 5EFIB 3GMNB 3T3PF 2DH2A 1OVZA 3T0EC 1COBA 3MUUA 3MX0A 1F1AA 3MNZA 1JBJA 4N0YL 4OGYL 5JQ6H 2QVMA 2Z91B 4X8CA 4LQFH 1EHKB 2BX5A 4GI6A 5I1CL 3R8BB 4YSEA 4EI5B 3BQUD 1IKNC 3T3PE 4XGZA 3QJZA 2XVBA 4JPIB 5DJDA 2WTOA 2Y4SA 1VHPA 3Q1EA 3VXUD 1F45A 4MS8D 3SDCC 4D8PB 4EO5A 4G9FA 3WFDL 5L8KB 4GUOA 2ZOWA 4Y5XC 4AQAA 1ASOA 2WBJB 2NY1B 4MMZB 2R1XA 2VXQA 5HJ3A 4HD5A 4Y5VA 3P0VH 5L0QC 2GSMB 4OLVL 1O7DE 2NX5A 1RUML 4AMXA 3VD0A 3V7AG 1JZEA 4J6RH 1AP2B 4NZDA 3FUIA 4ELMA 4ABQA 3BP6B 4XMZA 3VFSA 4DJMA 3CVDA 3FH5A 2Y3NA 2B20A 3CZEA 1PKQA 2ERJB 1CFVH 3I9AA 4E41B 5IJVB 2VDQL 1BFSA 5KANG 1U91B 1UKQA 2DYPB 5EZLB 2OMXB 4GAGH 3UTPE 3KM2A 4R8WH 5T1LB 5DJ8A 4G6KL 3WE6A 1KWGA 1ZEAL 4Y4HD 4ZMVA 3ATAA 1WZAA 4LVHB 4P2OC 4P8QA 4HK0B 5E94A 5HGAB 1JGVL 2YGVA 1YUHA 2DI7A 4HWNA 1S7VB 2BDNL 3ARUA 1S8DA 2OTWA 3VG0H 1PZDA 4UM9A 4ZO6A 4W9JC 3V8CA 1UADC 1ADQL 1KELL 5FGBC 2HT2C 4Y89A 4PREA 3SGJA 3K5RA 4JRXD 1RVFL 2DQHL 1UJ3C 3L3DB 5FHAL 2V7NA 2N0MA 2CWRA 3QUKB 5DD3H 5JW5B 1MI5A 4PD4J 3UMTA 1M56B 5EBMB 4FMKA 3JWNC 3L1EA 3WLWD 2IXQA 2VDLB 3WY3A 5IREA 1EX0A 1VLXA 3DTXB 3CX5J 2FX9H 3QUML 4N0CC 3L9BA 3W0WB 2GC7C 3QRGH 3V8OA 5I66B 4P4KC 3E6FB 4FG4A 5L9DH 3MRHA 1QR1B 4HUXA 4HBQA 3LRGA 4ONGL 4XVJL 1W80A 3VXOA 2KDYA 3DROA 1ECYA 1PLBA 5FHBH 5SX4I 3RIFF 4MJ5A 2VT0A 1N3NA 5GSRB 1ROWA 4FQQB 1SBBA 1T6WA 2XWDA 4IRZA 5F3HA 3BH9A 3O3EB 3VM5A 4C57C 2FLBT 3HE7A 4I2XA 2ZP8A 1IILE 3O8XB 5DUPL 4S0SD 4AVIA 3X1GA 1VPOH 2ZPKL 5E2UH 3T2NL 5KZCB 3AZUA 1EJFA 4WIQA 5F7WC 1TVHA 4M03A 1KBBA 2MMXA 3GB7B 4ANUA 5BOJA 1DSWA 1GGIL 1ZE3C 1KFAH 4OQ1A 1HNGA 1MSPA 1W8NA 2XVGA 4JDEA 5C8JA 4X9HA 3DI3B 1FBIL 2OSLA 3TBCA 4NEHB 4QJ5B 1OE1A 5BW7C 3HRZB 2GSIA 2WGNB 3BLBA 4M61A 1IL1B 3RBSA 1EXGA 4G43A 2Q86A 1HH9B 4EIBA 4Q74A 1JWSA 1PFCA 2Z92B 3H55A 1IM9D 5DHVH 1DEEB 1NBZB 3RY6A 1O6SB 2BNUB 1HHHA 5E4AA 5T1MA 1GZHC 1FORL 1SM3H 4NHUA 2FD6H 4GO6B 4ZAKB 5DJZB 4FHJA 2DYRB 3UEQA 1V27A 3BUQA 3RVVC 4XP9H 5DO2C 4EXPX 4FTVB 1RFDH 3SYQA 3WCYA 5E2TH 2P80A 3SB3A 3IVKB 4ZMPA 1IEHA 3BKCL 1D5XA 5F6HI 3VXMB 1G9MH 4D0CB 4KO9A 1ZCRA 2PO6D 1J88A 4MHHI 1SNRA 5JHLH 3C5SA 2GIYA 1T0OA 4CVZA 1AE6L 1TJHL 1DLFH 3ETBF 4OD1H 1L9RA 1MIEH 2R7EA 3K72B 3I50H 3KVDD 4L0YA 1LO2H 1PQZA 4JMXA 3UO1H 1FHNA 1BVLA 4FNQA 3QISA 2OM5A 4ZTPL 3RGVA 1C7TA 5I0ZA 4XNZB 4YLBA 3FB5A 3RBGA 3KXFE 4M6NH 3IDMB 4Y1AB 3KPRD 4QXWA 3WJMA 5ADOL 1JGLL 4WGVB 4U7MA 3ROLB 4W9IC 3PGFL 4P5TA 1P53A 1EMTL 5BRZB 1CXIA 4PBWD 4YBQC 3TO4C 2JXMB 2DQGL 4GW5A 3TTYA 5KUKA 1H5BA 3GJEA 3EADA 2AW2A 5HYJD 4LAQL 1E2ZA 3FCSB 3DBXB 2CHXA 1DE4B 4MD5A 2X3CA 2N56A 4P46A 3N91A 4DN3L 4IGBB 3B3BA 2XYCA 4OGAC 1KLGB 4AQ1C 1U8OB 1WG3A 4R9HA 3ARZA 3A4DA 2EXSA 2EO7A 4MMYA 1PCSA 2CKNA 2VOTA 1A7QL 1AI1L 3PHOA 5GGSB 4MJJA 3QCUH 4RETB 3SE3C 5I6MA 1X6NA 1QPXA 2OMWA 5HHVH 1AFVL 5I1JL 3BDYL 4NJAL 2JJTA 3QI9B 5T1DL 1YDPA 4RQQB 4B27A 3WAKA 4ACTA 1CLYL 3NZ8A 4Q9QL 3K6OA 1K8DB 2P5WA 3O9WC 5TDOB 5IR1B 5INDB 4OAWA 1CC3A 4OD3H 2P48B 3D18B 5K39A 1S9YB 1P5VA 4I3RL 3LMJH 5EORH 5F7LB 1R3JB 3UCRA 3FSOA 4KROD 1B0RA 4GSRA 5GS1B 3I84A 5IF0A 3THMH 3RWIA 1CF1A 3B9EA 4V1DE 2BSDA 1IGMH 4KKLD 3QQ9D 1E8ZA 4MJ2A 5JUEL 1VDGA 3FUMA 2YLHA 2YEVB 2EDMA 5L6YL 2OA9A 5C08D 3KL3A 5DDHA 3WNPA 3B9KC 4AV4A 2BNQA 1NC2A 5DJCB 3PNRB 1WS7A 2X1PA 4JX0A 3BUYA 1IAKA 3BPLB 4UQCA 5LBVA 3WTWA 1S5HA 4LCCA 4NM8L 1W72H 1WC7A 2Z31A 4WUUB 3BE1L 2J5WA 4QRBA 2OMVB 3OHXB 3SJVA 4JR9L 1AGDB 4HJTA 4KMTL 3ZTEA 5F93C 5IBLC 3D0VB 1O75A 5BXFA 1D6EA 1OF2B 3K6SA 3SBRA 2Q8BL 2FATL 4C4KT 2NY1D 1JUFB 1OCZB 1CI3M 3X1NA 5GGVH 2R29H 3FYEB 1WAPA 3B83A 5I1GH 4JREB 3L9YA 3FFOA 1NIAA 4L4TA 3ZL4H 4L8BB 4Z7WB 2ADJA 3R06B 1A6TB 1Q4NX 3PPEA 1EK3A 3SE8H 4K9JA 2NW2B 4K3EL 3APMA 1E3XA 1MJ8H 3L16A 2BY3A 2RQ8A 4GFXA 5E1GA 1W91A 2IANE 4GOSA 1UHVA 4JKKA 2K7PA 3KAAA 1A5FH 1X7QB 4HUCA 1WDAA 1Z2KA 4XCFL 1SMOA 2EYRA 2VITA 2A9BA 1KB9J 1HL5A 1U3JA 1NGWA 4PY7A 4JS7A 2AFNA 8FABA 1B0GB 4OCYL 4AT6B 2BFVL 1PG7W 3GPEA 3RY5A 1G94A 3TL5A 4KUZH 5ETUA 4AJ0A 5IFAL 4R7DA 3WKQA 1ZDQA 1QBBA 5BVJA 1KENH 3O3AB 1F58H 4PJIE 3TJHD 1S9KC 3UBFA 4GNKB 4P4RA 3FONA 4L4VA 5CM1A 4DGVL 2AJVL 4HS8L 3QNXB 4ZS6D 1I8KA 4H8WC 1FYTD 3PAVA 1R75A 3FQTA 4XC3H 4GSUA 2A6IB 3NTCH 1HE8A 3LV3A 5AZ2L 1U36A 1OAZL 4KKCD 1VKXB 2DKSA 3GHPA 3QIUC 4N2NA 4O58L 4H0HB 2HMIC 4AEEA 3SYOA 2BCMA 1HKLH 5SWSB 3AABA 3HCVA 1EZVY 2WIIB 3W0WD 4JGJA 3E2HB 1QP1A 3M8OH 2BHUA 1I8MA 43CAB 1TPXB 5DQJB 5C70A 4HC1H 3SKOA 3TWCH 3SE6A 1UZ6F 4TNWK 5BRQA 1YJDH 3BSGA 3UROR 4GAAA 4QRRB 4XPBL 4JHAL 3T4AA 5C0GB 5KN5B 3I6GA 1R3IL 2ZTBA 3NFNB 2A38A 3OB0H 5DQ9A 3ZKXC 3PNWB 1I7UA 4H44C 2GG1A 5DUPH 5EBWA 4TSCL 3ZMEA 1UZ6E 5KZCD 1PG7X 4AUUA 1FLRH 1MCOL 3T2NH 3MLPA 4R5VA 5T1KB 1J9TA 1V8HA 1MW3A 2NNXA 3GJFH 1U3YA 1BM7A 2Z8VC 1KXTA 3LVTA 1GGIH 3RP1A 1KTDA 3D4ZA 1AKJA 2C9SA 5DZPA 5I8KH 3DV6B 3BKJH 3BVDB 4JPSA 3W5MA 4EUPB 4TRPL 3ARQA 5EOQL 4G6JL 3BRGC 5E8PB 5KJRL 3H4HA 2WQUA 2RTTA 4LZKA 5AYTA 1P6WA 3T0EE 2B4CL 1LK3L 1YSOA 1ZVYA 5HJBA 1MHHA 4AENA 4ZUVA 3FSZA 1Q94B 3N41F 4UM8A 3WDIA 5IG7B 4ZNCD 3L48A 5KVMC 3RUGA 3H7BA 3CK0H 1OP5K 3I75A 2X0VA 4JO1H 3S96B 4FF9A 5L4JA 3RU8H 3GWJA 2BHZA 4BDVA 1LEIA 1EGJL 5EU5B 1F4YH 5DMGC 3FJTA 3PXHA 1A4BA 1LWJA 4NUJA 3RPKA 3DJSA 2NXYB 3GMOB 1MCIA 3OKNA 2W9DH 3ILEA 1TETL 2F8VA 4OVUA 4R26H 3STLA 5CJ5A 1N4XH 1CL7H 3VACA 3VW3L 4QTIH 3WEAA 1MCHA 3RWJA 1KYOK 3P2DA 1P4LA 3VD9A 2CLVA 4L3AA 4CVUA 4PTTA 5AW7B 4F7CB 1TQWA 2FQEA 1YN6A 3OC8A 3QCTL 5MI0B 1IE5A 4QXUL 3HBGA 3MV9E 1P2CA 4U1MB 4XBPB 3FFCB 4FNLL 3RVXC 4ZTOH 3VXPA 4Y1AD 1NUFA 3BP5A 1JFHA 1ERNA 3FRUB 5HI3D 3H6AA 3OL2A 3U2SA 2GJJA 1KYFA 1JGLH 2V9RA 3L7EA 3B2UC 2UZPA 2BMKB 1JZ7A 4YBLB 1EMTH 2HA1A 5DC2A 2KKQA 4N2EA 4IKNA 5IMMB 5L2KB 2J21A 2P5PA 1NDGA 4FXTA 3E6HB 1LILA 2XXCB 3WTXA 5D7JC 1DQDH 3DXAE 3JV0A 4S2SB 4O5LL 2X3AA 1EHAA 1RV6X 3KWVA 2FO4B 4KKQA 3UX9B 4HHAB 1U8IA 7FABH 1E3ZA 1QPPA 2R1WA 3IMWA 3KDPB 1A7QH 1JPGA 3ULAB 4UNVA 2BOLA 3GMRA 4G5ZL 1T83A 5F70A 4DGWC 2PPEA 3K1KC 5D4JA 1AR1D 3N9GH 1NBYA 3OB8A 3DSFH 1K5WA 1U6AH 3HBQA 3L6FB 2G2RA 5MERB 3JWNE 2HSIA 1X5JA 2FHBA 3AWFA 5CLWA 4WI4A 2EVGA 3VFTB 4YSOA 3FTSA 4IU2A 1IM3D 1TTRA 1S7QB 2ICWI 3FT4B 4ONFL 2NXZB 1OHZA 2XZQH 3JT0A 4Z8FH 1RIUL 1ACCA 3MVSA 3E1ZA 5IOKA 3O2VL 3GXTA 1E0OB 2K7QA 4NUQA 3LQAH 1RZ8B 2CR0A 5BO1L 1I9IL 1H15B 4N9OB 3M46A 3BHBB 4JDTL 3BKML 2OZ4A 4WI0B 3QBTB 1VCBC 1OV8A 1QUNA 1EJ8A 4LCWD 4E9QA 1TCMA 4FNPA 4PCYA 3UC0L 4J3SA 3CFBB 3VVWA 2AJZB 2YD5A 2VDPB 4JG5A 3ESPA 2X9ZA 3UGUA 5ITBL 2FUTA 2BSTA 1JL8A 1AXIB 3WIIH 1N5YH 2NY5C 3ZRCC 4A2HA 2XBTA 1F6FB 1XGQA 2WSPA 2X38A 4NYLA 3MRJB 5EZOL 4M43L 1KBWA 3CSFA 3KWXA 3KXFB 3T5WA 5FF6B 1KWKA 3HN8A 5D7IF 4BH8B 4U6XA 1OCOB 1WBYA 1DR9A 3OR6B 3RJQB 4EXKA 3AWGA 2UZXA 2EC9T 2A77L 2ENJA 4B53A 3G5YB 2J5LB 4KX7A 2XY2A 2EIBA 5D7IE 3GNML 3KYNA 4L8CB 3HC3H 4RVBA 2WBKA 2EXWD 3LSOA 3F64A 2DD8L 1DZ0A 2B0SL 2H8PB 1ZSDA 3FK3A 5E6SB 3S98A 4D9LH 3BSZH 3SDAA 4Y1TA 2IEPA 1REIA 1T6VN 1YAIA 3LKPB 4HWEL 3ZE2F 2OSYA 5FUZL 4PRNB 2BFVH 3BIKB 3GBNH 2PYED 3WXWH 1S9VB 2WXPA 4M1CC 4U6TA 3ZMRA 5GHWH 3U25A 2MRYA 3MRMA 1A7OL 3ZE2E 5IW3A 3JTSB 5C0EB 2GI0A 2DTML 2VYRE 4AEFA 2IWGA 1KFGA 1YO4A 4ZD3L 1OPGL 3JSSA 5KAQF 2WTPA 5AZ2H 2OCFD 1EVTC 2HN7B 4KGJA 3F7KA 5AQ0A 5I9QB 5SWSD 2XWTA 2GBAA 1BREA 5CZKA 3UDWA 3KPQA 3AREB 5KVDH 2K78A 1U58B 1FJ1B 4DKEH 2NNFA 2WNKA 3S48A 1AD0B 1AXTH 4PD4K 2YD9A 1SMAA 1G7MA 5EIIA 2E76C 3SE9L 4FNUA 1A1OB 4R84A 4WY7H 5LWYL 4PP1C 4JANB 5KG9B 4G42A 4NI6A 3IDNB 4XPBH 2X6UA 2OJ1A 2VN4A 2A9NH 1NQBA 3TFKD 1YMMB 4X9IA 2J20A 4PJ9C 5CCHE 2HLAB 2MNUA 5T1KD 5C86A 1JNNL 1DVFA 2W65B 2NMSA 3QUGA 4O2FA 1IKFL 3J27A 4O02A 5TF1L 3DYMA 3MBED 4FE9A 4JZNA 1SY6L 4QRFA 2ZUVA 1U3NA 2XWJA 1JS4A 4QF1B 1OM3L 3U0TA 1FC2D 2V37A 3MTRA 1CS6A 4TOYL 3BT0A 3N0PB 1KULA 1FVCB 4G1MB 2B4CH 4R2GD 4UQDA 5KS9A 2OBGA 4MXWL 4AQ8A 4GRMA 1SOSA 4L9DA 3FZUD 4J4PD 4CMMA 1E2VA 2F7RA 2PKDA 3MO1B 5D1XC 3QZLA 3VGHA 2DEYX 2P8PB 1JF5A 4EVNA 1F86A 1WICA 4QJ4B 4G6MH 4HWBH 1R47A 1WISA 4R83A 1PKOA 2WKGA 3DHMA 4XPGH 3CPLA 3FAXA 2BC4A 4FZEH 3SGDI 1TETH 3ULUC 3JWNG 3BW9A 1BHGA 3TZVD 5H37H 2AXFA 2OXGA 3CQPA 1WFTA 2JI3A 3QUXC 4XNDA 2YPLD 3HA0A 3LZPA 4R3SA 2FJSA 2WBXA 1QR4A 1TEGA 3FFCD 4YXHL 4QXUH 4K4KA 2Q7YB 1FH2A 3PQYB 2D0HA 1U8JA 5FO8B 5SWZD 4UOW1 3IAPA 3VH8G 4OCXL 5CIPH 1P84J 1ONQB 3T09A 2BOBB 3S36H 1HZKA 3O2WL 1FO0A 1UOWA 4NJ9L 4V1DA 2X53A 5L2KD 3HLAB 4NNYB 3X3GL 1VERA 2YD4A 3Q5OA 3S4SG 4HCRA 1VGKA 1CVRA 2OCCB 3TN0B 2UZYA 4YS4A 3BAJA 1OCCB 2J8OA 4HSQA 5CKGA 3P0GB 4XN8A 2P1YA 2WXHA 4O5LH 1K4CA 3ARGB 3O6FB 2C3XA 2WW8A 5IK3B 1A1NB 3MYZA 1T7ZA 2P5EA 3U36B 1I8IA 3NIDF 3RFZA 4KJYB 1JK9B 1RZ7L 3QGVA 2C9UA 4IKKA 2CO6A 2Z93A 2Y7QB 5LNEA 2IFGA 1YVLA 4NZJA 3UYOD 1DUYB 2Q7AA 5B1KA 3GXMA 5T5FA 1HEZB 1ZA3B 1G4RA 4JKWA 4IRJD 3T0EB 3NIDE 3AQXA 4XNXH 4F9LC 2OV0A 2V9QA 3G5WA 2HRLA 1WT5A 3FB8A 3QS2A 2C5DC 3DWTA 1IQWL 2WWKO 4KKPA 2XFGB 2NXZD 1MHPL 4V2BA 1QX1A 2X1QA 2EE6A 1VJSA 4NQVA 4Y0GA 3GO1L 4FXGA 4JZOB 2HPOA 5JO5B 1G9HA 4RRPM 1HQRA 1TTAA 3LRLA 2EEFA 3NMEA 3QIBD 4J3VA 5BZWB 1I9IH 4YHLL 4Y5XB 3FPXA 4W6YB 4PM1A 1J1PL 2CDEA 3GXNA 3ESVF 2R0WH 2FNWA 4A7SA 1YNLH 4JK0D 2TSBA 1E3FA 1LD9B 2X4QA 4LO9A 1NGXB 1Q72L 1SRDA 3JWDH 1NFIB 1FIGH 3ZIYA 1IFHH 3QQ3A 1N8OE 5IHUH 3MV9B 4RESB 1F3DJ 5B4MD 1TJIH 1QEWA 5A6MA 4PJIA 5KSAC 3VTMA 1FNGB 4OLXL 1L0XA 5D8JL 5I17A 1R3KB 3HPLB 2CKBB 4PW3A 1S3KH 3JWOL 5BJTA 1BQKA 1KBGH 4B3EA 3ROOA 4M5TA 5KAQG 2GJZA 1CT8A 2AXWA 3DX6B 4ZRGA 3VWJC 5I0WA 4QCIA 1EO7A 1RUAH 3GNMH 4P2OB 3UZVB 4ISVB 2GK2A 1TKWB 1XSOA 3V4VB 2WN3A 2DD8H 3KL5A 2N0KA 3GLEA 1D7FA 2VDOB 4LCIL 1SHXA 1GGBL 1KCLA 2VL4A 3LEYL 1KJ3H 2BWIA 1ETA1 2AJUL 3OLGA 4TQ8A 2VDKB 2WV3A 3LZRA 3V5HA 1XB8A 2R9HC 3BDBA 1GMEA 1M7IB 4MSWA 1FZMA 3BOVA 4ZNEA 2B8OT 5I1AB 2VQ1A 3BAYA 1T22A 5CSZA 3S9DB 1JZGA 3QUZC 3QFDB 4NO3A 3MV7E 1FRGH 2EADA 1KB9K 2X4SB 2DAVA 3ATDA 1NMBL 4FFVD 4M4RA 5DHEA 1V7NL 5DC4B 1SXSA 1PY9A 4N2BA 5KSVA 2OMZA 5C6TH 4PPTA 2QBWA 1JXFA 5E03A 4QHNB 1B9ZA 3E80A 4P4KB 2KS0A 5IJCC 2BSEA 5DS8B 2BCKB 3EG9B 3QNFA 4KKAD 5D7SL 1UQSB 4TNVF 5ES4B 3VH8B 4Q6IB 3ARED 1IBFA 1CB4A 1M71B 1KCUL 5EDSA 2R2HB 2P8LA 5D4HA 3I9PA 3CZKA 2ZP9A 4QTHA 1G1CA 1OAXH 1YEKL 4M62H 4X8JB 5CCKL 4FERA 1I31A 4DIXA 2ZYSA 3LEVL 2Z6FA 4MB1A 1K8IB 2FB4H 2V5TA 4W9KC 2OK0H 5LWYH 1EJOL 3VXRB 3LXCA 1ACXA 3SOBH 1UD4A 5E5UB 3UTZB 3A6BL 5DYOA 3Q6FA 2KT6A 1C8PA 1TZGL 3CFCH 7TAAA 4JFQA 5IVXA 3CZGA 1LVEA 3N43B 4HPOH 5E6ZA 2FLRT 4XP6H 3SDCA 3INUL 4CC1A 1IJNA 1Y18A 3W39A 3QXVA 5C0DB 1D5ZA 1FGVL 1BMGA 1OTUC 2BNRE 2VN7A 4G80A 5C07D 4B5ZA 1N67A 1JMZA 2J2ZA 4JUSA 4KFMA 1FFTB 4HEPA 4U6YB 5IHHA 5EU4B 3AXLA 2YMOA 3GMPB 4I18C 1S3RA 5F71A 2UVEA 2GTZA 2N3JA 2P24A 4QWWC 4OZIB 4CRPA 2DM4A 1U8NB 1V3KA 4FFZA 4QRSB 5IQNA 1JV5A 3OXSB 5HYQA 4R0LC 2A99A 4EDWL 1BCIA 3PAUA 3UYRL 4AL8C 1DO6A 4FLHA 4F58H 3OLEA 5I5RA 1BXUA 1RZIB 1ORSA 2A0LC 3FU5A 1Y0LA 2Q7NA 2ROXA 3IFPA 3WEBA 1SJEB 2PPDA 4YDIL 3BLKA 1MAML 3P54A 2AQNA 3QHZL 4L1LA 3FB7B 1DJZA 1FCGA 1XWVA 3LEXA 5CEYA 2ATKA 1T80A 2FAUA 2V5MA 4JAMA 4M8RA 3RNQA 3AGVA 2VAJA 2BS9A 3F58H 2CMRH 2VDRL 3BN9C 3V4UH 3W11D 3MLTB 5DR5H 4P2QE 2VABA 1L9MA 2QQQA 2Z8SA 4Z7VF 3T3MF 5I1KH 1GPOH 3X14A 5L7XL 4P9HH 4TKWA 3V6OA 1B4JH 1EAOA 1UVQB 3EBIA 2AERT 4HWZA 5LBSH 3FS9A 4K8RC 4ZUUB 3TLRA 4NQCD 3MUJA 1RZFL 1P9MC 4KVNL 3TO4B 1NPUA 4Z7VE 2X4NA 3T3ME 4AYMC 4NQEE 5AOKA 3B2DC 4F1ZA 4Q14A 3JV5A 4RGNE 4RFEA 3H56A 4GBXC 4AVKA 4IOSA 4O2EB 4WNJA 3SKUD 5JXAL 4PRHB 4QKTA 2ZUWA 4Y8DC 5J6GB 5L4MA 1GKEA 2WLKA 3PY9A 4KHTH 1MCCA 1SEBA 1TSHA 3MBWA 4ZFOA 4D0BA 4MNHA 3B1UA 4X7CC 4IS6B 3V5KB 3DK2A 1BOGA 1N18A 3CVHH 3DX0A 1P7QB 1CF8H 2A9AA 5J6SA 3TN0D 2QADC 4RLDA 3L2LA 5D1ZC 2JMRA 1BDYA 4IJ3B 5DSCB 3HR6A 1H3XA 4Z3TA 3L7FA 3SBPA 5CUSL 5C0IB 2MSPA 3NOIA 3Q8BA 1G7IA 1HNFA 2GITA 2Z1PA 3VCLA 2XIDA 4BIKA 5KUMA 3L1FA 3M1BB 1KV3A 1BIHA 3V52H 1KSRA 1P7KA 1KZQA 5HDQH 2BO0A 3S4SA 1QI3A 4CBPA 4NDMA 3QXDB 1KBVA 3V0FA 2Q20A 2AV1B 5GZNC 5ACMA 5DU7A 3PJLA 3U7AA 2AJYL 4AYSA 1WFMA 3B9KB 3F01A 5BW7A 3MLZL 4IKJA 4JJHA 1IGFL 2CALA 5ECGA 1FNSH 4NKOA 2R0ZL 3EGSB 2YRBA 4F20A 4G6AC 4WKZA 2BS71 5EO0B 4QJ3B 3A23A 1NAMH 1PZCA 1VFBB 5KVEH 1CXEA 1M7DB 2NY0B 2HT4D 5D7IA 1Q0XL 2ZWKA 4HGKC 3TIDB 1N5AA 2HFEA 5T3ZD 2Z1KA 4KRPB 2QLVB 5IQ9A 4CDGC 5DFVC 4L37B 4YH6A 3TYGL 4UT9A 1KTLB 1H3VA 5ID1B 2E9GA 1T66C 2HKFL 3ABGA 4Q6YA 4DN4L 4JVUA 5IEHB 2XPZA 3MLXH 3ZE0F 4X6FB 4N3UA 2G3MA 3G04A 4NKDB 3II2A 5C1MB 2F6AA 3AG2B 1KJ2H 2H26B 3GM8A 2YFNA 5B1JA 3IDUA 5TTRA 3GT6A 1N68A 3ZHDA 3EJTA 4ADGA 2ZAGA 1JFQL 2D03H 3FT0A 4LPWA 3ZE0E 1H3PL 1YQVL 1F4WH 5D8JH 5I5JA 3PAZA 4G2AA 5IQOA 4ANWA 1PFOA 3BVTA 3C6SB 2VN6A 3QR1A 3T0AA 4E0RB 5KSBF 1J0YA 1FFPB 5LQBL 1Q1JH 2BVOA 5F9WC 2W94A 3F7LA 1BEXA 4AYFB 3H85A 1EEYA 1NCAL 1JYVA 1NFAA 2WNWA 3MJGX 4YFLI 5JLZB 1A3LL 4LSTH 5D1XE 2WCSA 4X4YA 2E9BA 4TUOB 2PCFB 2BSCA 3ULUF 3SQBB 2VXTH 4P07A 1GGBH 1M53A 4U1JB 2XWZA 2A9DA 3FT3B 5DI8A 2J7LA 3O3UN 3C6LC 3PWVA 2ZUUA 4OJAA 4NPYB 5DEJA 3CBRA 2O61A 2Y36H 3F12B 3AWEA 4JFXA 1S78C 3ULUE 1NEZA 3QIUB 4F3FB 1YNTA 1UH2A 1U92A 3CFMA 3IXAA 3MCLH 4LLAA 2P7TB 2ICEC 3SE3A 3TF4A 2TRHA 1T2JA 5E1AA 5J13C 1BFTA 3MX0B 5LO7A 1G0XA 3MFGB 1ZPUA 1B9KA 1MOEA 1T0MA 4QO1B 5HDWA 4M9PA 4RAVA 1E5CA 2NUTA 5I19L 4MMXA 2XRAL 4Z3FA 3IJ9A 4MNGE 1O9ZA 2PPFA 2PTUA 3DUUA 3EKCA 1I8UA 5LXGH 1PD1A 2E47A 3UGEA 4B9FA 5CCJA 3B34A 4MQ7A 4KVCL 4LSRH 4FP8H 3KWWA 4CGTA 3LIZA 1GTNA 1LJMA 1A25A 3VI3A 5DFAA 1JNJA 3ZKXB 1GC1H 1LEGA 2R1XB 1PY4A 1BMWA 4K3HA 1UD8A 4I8DA 3ZJAA 2AC0A 3DYPA 1ZHLA 3O6KH 1U93A 5C0AA 4YHZL 2LVEA 4HUWB 1IC7H 3C75A 4TS6A 4BZYA 4GSQA 3GXIA 4D9RD 1NC4B 3EO9L 3T4YB 2HTLD 3KLQA 2V9UA 4I9WD 3MLVH 1TQSA 5MEOB 4JFFA 2WXLA 2VC2L 4LSQL 4X9BA 5DJ8B 1TIUA 3HN5A 3ILQD 1KXQA 5HHPA 5SX5H 2AJXH 4L3CA 1WAEA 3P9MA 3GSOB 4FQXD 1ZTXH 2MIZA 1S8DB 3TV3H 3ENEA 4XN5A 2EXTA 5DJ0B 2YD2A 5DD6B 3C60D 2HRPL 4LSSL 3UTTE 3MRLB 3A21A 3MNWB 4I0PD 1RK7A 4NZ8A 4R6UA 3UYRH 3EYQC 3ARTA 4UT7H 3U6RA 3V4PH 2ORBH 3N04A 3QNZB 4GW1B 1AQKH 2KQNA 3OKLA 5FEBA 4C8XA 4KXZH 4B41A 5CNHA 3K8LA 5AYUL 2Y6SD 3S5YA 2EE2A 3ZY7A 4D3CH 2PPAA 4A6YA 2DMKA 4EIUA 3K1DA 1UD2A 4KI1A 4IEFA 1DSFL 4KH9A 2D7TL 2VR8A 1ED3B 3HVDA 4HXBH 3M07A 5AUMA 5EF0A 5CEZD 4L8SC 3M1OA 3MUZ1 3QDGD 2DLEA 2DJUA 5FYJD 3D50A 4YGVB 2NNAA 3GSNA 3LRMA 4YXKH 4AGPA 1Q9WB 5IROD 3K4AA 4RGOH 3GDCA 5EWIH 1SDYA 3VD5A 2WZPD 2WVSA 1R0AH 2WXNA 5AVTB 2YGPA 1ODUA 1TO4A 1LO3L 3REWB 4I2XB 1T04A 5D7JB 4A7GF 5AKTA 4U1LB 1AO7E 2Q76A 4G8GD 3S6CA 1R33A 3PCYA 4Z6AT 3ECVA 3CHQA 5C2UB 4DK5A 3KGTA 1LE9B 4XXCC 3OZLA 5CINH 4DVBA 3Q01A 1ITBB 1UM6L 4L9LA 2XX0A 4OKVB 2JI2A 2IO5A 1UA6H 1CZ8L 1P7QD 4FFYL 1I7TB 5EUKB 3SKNB 2VJXA 3U1QA 5CD5C 2BNRB 1P84K 3NABL 5EN2A 4F33B 1KY7A 2B39A 3G6AA 4O51B 1JWSB 5CGYD 5T3ZH 4N0UE 1B4RA 2OMUA 5CUSH 2CIKA 1C12A 1UT9A 4JKLA 3WNLA 3OAYH 3L81A 3N42F 4BSVA 3TBWB 5BCAA 1C1EH 3UERA 5J12B 3F00A 4MJID 4PB0H 1HHHB 1F3DH 2ZUYA 3I2CH 3ARWA 1L9NA 1YQ2A 1MW0A 4Y2DA 5B1CA 3NDZE 3OC5A 4K3DL 5JYMA 4YL4A 2NDFA 3C12A 5CD3A 1L0PA 5E6RB 1BAFL 1UD6A 4PIRF 4Q89A 4U0RC 2UZIL 4CC4C 4WI2A 4JFED 1A21A 2AEQL 4LNVA 1XDTT 5E6ID 3UTSA 4ZOAA 2EYTA 5IHLB 5ICZB 1O9WA 4LSUL 3HR5A 2AJSL 1MF2H 3T77B 2BIQA 3BH8A 4XOCA 3TJEH 1ADWA 2NY0D 5BQ7B 4L5FL 1P5UC 1DLHA 3DPDA 1S46A 2WLJA 1ZGLM 4KRPD 4TL4A 2ODHA 3ESNA 1B4TA 5I2IA 2R7EB 2DV6A 2B9BA 4P2QB 4NO2B 5E2WH 2A1WH 1BVLB 1PZ5B 4LSVH 5IB4B 2QVIA 2HKFH 3FB5B 2VDOH 2O30A 4OQTA 4LHUD 5FYLD 2YAMA 3D9AL 4Y4KA 4PI2A 2HG5A 4ODXB 4XNMB 1T3FB 1R3HA 4JPWL 5HI4C 2FECL 3L3KB 3NK4A 4QAMB 3GZQA 2CHDA 3CTTA 4NQEB 2F19L 4C47A 3QHTC 2V7HA 2MCG1 4PJBB 1JPFA 2EVIA 4JQXC 4MD0A 4GUPB 4QRQA 3NH7H 4JG9A 2ICWA 4MD5B 3L17A 3OAYK 2WUBL 1TU2A 2AJ3B 5EOCL 3MR9B 2RJMA 1J8SA 1KIPB 3N06B 4R5XA 4XVSL 3ABZA 4Y16A 3PV7A 1UYWL 4Z7QF 2X4RB 4XODA 4N2KA 1VCAA 4WQOA 1DVZA 4U7KA 4H8UA 3ULVD 1QRKA 1MFCL 3CHXA 1CD1A 2C9AA 3H9ZA 3O2DA 4BBWA 1PG7L 4Z7QE 4NKIH 4HF5H 3KH4A 4N5ED 4OAWB 4DQAA 5EO9B 5L4IA 3POHA 3MRRA 1P5VB 4LDOB 5KW9H 4GXFA 3ZMNA 3MNVB 2R23B 1A6UH 1DQML 1FDLL 1G9NL 2ZCHL 3EOBB 2I69A 3KNBA 3LNHA 3RE0A 3ZO0A 5F9JB 1F11A 4KK5C 3GTNA 5IF0B 5FR3A 1KB3A 2DWEB 4XCYB 2MCAA 4A38A 2XT1B 3D39E 4IKIA 2UYLA 5DZOA 5I76B 2DTSA 4MNQE 2P45B 4K94H 2BPBA 3VI4F 2EUXA 5J11B 1FUNA 1NKGA 2XKNB 4XHQA 1RJCA 4XPHL 5DDHB 3ARYA 4LEOA 1KEGL 3IFNH 1TUPA 1EEZA 3SPHA 3NCCB 4NFDA 2IBGA 1S5HB 3VI4E 4OFIA 3BWSA 2ZF8A 1PVHA 2XC8A 3EF4A 4I4WB 1WC7B 4YN3A 1T7YA 1GY2A 5I8CB 4KOCA 1YPZB 4M3JA 5EOTA 3DRQA 1EZSA 1F8TL 1IGYB 4G9FD 4ES9A 1J7VR 1O6TA 1MFEL 4FQ2L 4M7JH 3KLSA 9CGTA 1DUZA 2HJLA 4RFNB 3WTTA 1R6VA 5BZDA 1T1WA 2HX9A 4J3WA 3QXAA 1I1AA 1G7PB 3AM8C 5GZOC 2NX5D 4C83A 3PWPE 1KGWA 1CU4L 3WFEH 5C9KA 4KK6C 4Q58C 1YYCA 2H32B 3D3VA 3VDCA 3NZUA 4ORZC 5FOBA 2VMDA 1V7MH 4WJ5B 3RWFA 4JFYA 1JCKA 4YFLF 4K7FA 4IMKC 2CO2A 2ISDA 4ONHB 2XTJB 4N1HB 4WTZG 2VR7A 2VITB 1FCCA 3IN0A 1G6RL 2YIHA 2OYLA 1GH7A 2N7BA 4UIKL 1FVDA 2F7PA 2VERA 4M7KL 8FABB 2WLHA 2YLKA 1R4XA 1U8MB 4KZEL 4NXKA 4QGYA 4R5TA 4KY1L 5D1XB 5ETUB 5CEZH 1PLGL 4OIAA 5B7FA 2FQFA 5EV7A 4UM9D 5EU6E 4XO5A 3G5ZA 4Z7VA 5JW3H 5FYJH 1RIHH 3AJ7A 4TVPL 2X4OA 3G7TA 4LSSH 2JIXA 1YRKA 3Q2WA 1PCXA 4KJPD 5DK2A 4FYSA 4JHWH 3EW3B 3NJFA 4NPJA 2FT8A 4K0OA 2DJMA 2CBQA 2ZX5A 4RMVA 1RZJC 4X6EA 3FQTB 1UACL 3P69A 4QHLB 4Z3IA 1JNLL 1MI5D 4FKHA 2CDGA 2DKUA 1QYGL 5AOZA 2OL3A 4HUUA 2XACC 1MFUA 2ZSVB 2IF7A 5AAMA 4IIQC 3QUXB 4MZRA 1XXFC 3O4OC 2Q1EA 4QHKI 4YXLH 1UZ8B 3RA7L 3WOVA 4EE2A 2COQA 5ERWA 1SF5A 3D2UA 4YHYB 3EFFB 5ISZE 1YMHA 3FUDA 4TUJB 2ZF9A 4QGTA 4HKJA 4P23B 3WJLA 3P3TA 4M48H 4JFTA 1VFMA 4XZUB 3RWCB 4BM7A 3N0AA 2R51A 5IV2A 5KYNA 4N2IA 2F53A 4QHPA 4ZW6A 2RCSL 1BYPA 2SEBB 1FL3B 1HQ4A 4ZUWA 2PYFB 3NIGF 1NMAH 2FNBA 5DS1A 5AG8A 4PLOB 2AS5M 1JI2A 4OH2A 1EHLL 2OJEA 2QQLL 2VW7A 4YDVB 1KXTB 5CCGE 4UTBA 3KVPA 3K2UH 5LCVL 4ELKB 4ABUA 1KTDB 5CSGA 1AKJB 1A3ZA 2VN3A 3NIGE 3Q5TA 1ICTA 3SKJL 1M9WA 5IESL 1CZ8H 4DKFH 3BEWB 2DH3A 3U46A 5F9AC 1OP3H 3NP4A 3NABH 3H3KA 3EO0A 4XMLL 1HIMH 1UWGL 4MKMA 1NGPL 3MRBA 1GZPA 8PAZA 1UGKA 3QZWA 4I3SL 1MHHB 1FA4A 2NY4D 4NM4H 3U79A 3K2KA 1E5ZA 3I75B 2L7QA 3MGTA 3PIQA 1F13A 4NP4L 3GHEL 4EEEA 5FYLH 2EC9U 3V0WL 2V6HA 3EOTL 2FH8A 1RSYA 3EF7A 4PWIA 5DMJB 1DBJL 3MXWH 2YD7A 1T2QH 2P80D 4P5KB 5ECJE 1BD2E 4OW6A 1BAFH 5C0CE 2F8XC 2WXIA 5D5MB 3T1FA 1YY9C 2AI0H 4NUJB 2X9YA 3VWKC 3HS0A 5IEKB 3VFRB 2Y2YA 2R69A 2VDLL 3FTYA 4PYHA 5FA3B 4LSUH 1IC5L 2LFGA 3KS0J 4KI5D 4HAKA 3QVAA 3UMNA 4XRCB 4PRPE 1HKFA 3HHSB 4U3HA 5FX3A 1WZ1H 1KGUA 2GAZB 2Z7ZA 3QJXA 1NGYB 4OZFA 2CLVB 3MJ8B 2VDMH 1GZQB 1IRAY 2YXMA 5DWUL 3CMOH 5FUOL 1XIWC 5GISL 1A6VL 2Y72A 2E75C 2DIJA 3VXPB 1KGCE 4JFHD 4Z3EA 2Y23A 3ULVH 5DEFB 3BP5B 3U2SB 2VKWA 4U6HA 1Z9OA 2WIMA 1SOXA 3L7EB 4D8OA 4P5TD 2XHNA 4CU7A 5AD0A 2B59A 3VWJB 3OR7A 4Y19A 3W5NA 1U8QA 3RY4A 2NT1A 1MCPL 4LARH 4CJ1A 5ESAA 3QWOA 5AAWC 5CGBA 2H2PC 4JO3L 4RMSA 1JHTA 4P46D 3VX1A 1GMIA 3VFNB 3C2AH 3TNNB 1PSKL 3ILPB 3P3SA 3LHAA 1NUDA 4KPHL 3SDXA 5FAAA 4C4UA 3HHMA 2CGRL 4E5XA 5B39A 1QLRB 1ZS2A 1U8IB 4XVSH 4MNGA 3L3GA 2DWDB 4JMNA 4CC0A 4U6VL 4Y9CA 5AFAA 1A3RL 5E9DB 4HP5A 5A2JH 3P9WB 2NY2B 4P04A 3MLRL 3GMRB 4OLWL 2F5BH 1J18A 4XB7A 2EH8L 3EFDL 3QUZB 5IFJA 2VMEA 4U1IB 4A55A 4N0UB 3RWGA 2P5WD 5I16B 2YAQA 1NEPA 4UUJA 5K9KB 2XN9A 3ZPDA 4A7QA 4LLYA 2VUOA 2IQAB 2VXQH 4BKLA 1TXKA 2A6DA 1U8PA 5JXEC 4PGEA 3UG4A 5E8OA 2FT6A 3S5LG 1X5AA 1KN2H 5IGXL 4LESA 1H3UA 2BNQD 2R27A 3GQFA 1NC2D 3P30L 2NT0A 1XMWA 4ZMAT 4EIGB 5C09B 3N1GC 3L2NA 4I5BB 5TE6H 3RVUD 1QUNB 4HULB 1YEEL