5AAPA

Complex of the fimh lectin with a c-linked para-biphenyl methylene alpha-d-mannoside
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
158
structure length
157
Chain Sequence
b'FACKTANGTAIPIGGGSANVYVNLAPVVNVGQNLVVDLSTQIFCHNDYPETITDYVTLQRGSAYGGVLSNFGTVKYSGSSYPFPTTSETPRVVYNSRTDKPWPVALYLTPVSSAGGVAIKAGSLIAVLILRQTNNYNSDDFQFVWNIYANNDVVVPT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FIMH
molecule tags Cell adhesion
source organism Escherichia coli
publication title Structures of C-Mannosylated Anti-Adhesives Bound to the Type 1 Fimbrial Fimh Adhesin
pubmed doi rcsb
total genus 33
structure length 157
sequence length 158
ec nomenclature
pdb deposition date 2015-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09160 FimH_man-bind FimH, mannose binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1090 Mainly Beta Sandwich Immunoglobulin-like Fimbrial-type adhesion domain 5aapA00
1KIUB 1PDKB 3JWNH 1N0LB 4XODA 4AVKA 2VCOA 2XG4B 4XO9A 4AV4A 5FLUA 2J2ZB 3BWUF 2W07B 1N12A 4J3OF 5IQMA 5IQOA 3ME0B 4AVHA 3SQBB 3BFQG 4J3OH 3MCYA 1UWFA 3JWNG 4AVJA 1TR7A 5AB1A 3JWNE 2WMPB 2UY7B 4X5QA 4XOBA 4CSTA 4X5RA 5F3FA 3ZL1A 4AV0A 4CSSA 3ZL2A 1KLFB 2JMRA 4X5PA 5AAPA 3RFZA 2UY6B 4AUYA 4LOVA 4XOCA 5AALA 4AVIA 4ATTA 2XG5B 4AUJA 4AV5A 4XO8A 5F2FA 5FWRA 4AUUA 2JTYA 1ZE3H 3BFWA 4XOEA 5FS5A 5LNEA 5CGBA 4X50A 5JQIB 3ZPDA 1QUNB 4XOAA 4CA4A 5ABZA 5IQNA 5LNGA 4BUQA 4J3OG 5FX3A
chains in the Genus database with same CATH superfamily
1PJ9A 3G5XB 2FB4L 1BG1A 4YBLC 1JF1B 1JGLL 4FNTA 2CLZA 4NWUL 4Y9BA 1BPVA 1R5IA 4MJ6B 3VG0L 1ZANL 4J4PD 2ZX9A 5TQ2L 2GBVA 1DQJA 4PSRA 4NKIH 3ES6A 3VXNB 3PABA 4KROD 4JM4L 4PRIB 3L54A 3KXFD 4PG2C 2YPLB 4QLWA 1PX4A 2CKBA 2ITCB 3NOIA 3LDBC 5KS9E 1UM5H 4S10A 5KVDH 1E9PA 4ODVH 3DX2A 3GO1H 5D70L 3LPOA 4R8WL 2P28B 1UQSB 4OCXH 5T33H 1TTAA 3I9GH 1JVLA 1NWPA 1YNKH 4G3YH 4U3HA 4WI5A 4LDCA 2HH0L 5HHOD 3HIZA 2FEDD 1SEBB 5E5MB 3MV7B 5GGUB 2YSTA 4ZTPH 1ZLVK 4JE4B 3CLFL 4W9HC 2NY4B 4QRQA 3LY6A 2DTMH 1UXWA 3NP3A 4L9LB 4K7PL 2VC2H 4P5TB 4G6FD 4JO5A 4XX5A 1N7MH 4IKLA 2H0JA 4L4VD 5I6LA 3O3DB 4I0CC 4L1BA 3NJXA 3OKLA 4C83A 4KXCA 2BK8A 2Y7SA 1JNLL 1RULL 3ASWA 3BH8A 4LO9A 4B95C 2NUPB 2IVFC 3BWSA 1BD2A 4P2RE 1D5BA 5FO9B 4Z0XA 4IK6A 3FSVA 4XX1E 4O2CA 4AXWB 1MCNA 1QRNB 2ADFL 1JE6A 4HLZG 5SWZE 5CD3A 2E46A 5DRZB 3A21A 4NO5A 5EU6E 3WNJA 3C8KA 3X3FL 3U46A 2JB5L 4FABH 1DJYA 1K72A 4LQ1A 3ZKSD 1IFHH 5EU6A 4DVBB 1D9KD 3KL0A 2BWDA 4WF7A 1WS7A 3FB7A 2PTTB 4ZW8A 2DLFH 3MTRA 4EZLA 2VDOB 2WXJA 1ACYL 3NRQA 1UXWB 2UVFA 1VFAA 3BKJL 3O41A 1U58B 3P9LA 1HFUA 5DHVB 5ERWB 1M71B 2O61B 1D2OA 1AD9B 1NCUA 1T1YA 2FX9H 3ZPDA 3SCMA 3FSAA 3ZT6A 2OR9H 4P59H 15C8L 4MS8C 1L9TA 2CHDA 1SN0A 5L0QB 5AVQB 1EFQA 2IWGA 3HZYB 1EK3A 5D1ZA 5HHQA 2DDQL 4IHBA 4KKNA 2AJXL 1A1MA 1DBAH 2YXWA 3FF7A 3I2CL 5FGBA 5K59F 1LO3H 2DTSA 2DQIH 4IIQC 3D39B 3F12A 3V0FA 4EKXA 4PB0L 3N40P 1X6LA 1PZBA 3HNTH 1H3XA 3N1QC 4FQLH 2JTDA 5L2KB 3PDOB 2D73A 1YNLL 2OI9B 1H0DB 2W1NA 4MJIA 4CRPA 4DZ8B 4JO4H 4JFOA 4F1ZA 2IF7A 5CKAA 2RQ8A 3FRPG 1A3LH 2VDQL 3Q2VA 3PDDA 2FB4H 2V2WB 1I8UA 4Z3GA 3BCFA 5ENWB 3QFJB 1B2WH 4XVTH 2WC7A 1K4CB 1J5OL 1A1MB 1KT2A 2AQSA 1NKGA 1GZPA 1JZHA 1YO4A 3GRGA 2F54D 3ESUF 3T77A 3GNMH 1W6WA 1OV8A 2JIXD 4L9DA 1F97A 4UTBL 2NUTB 1TETL 2R29L 2G75B 2LABA 4MJ5B 3ZKMC 1ZK9A 4N5ED 4RQQA 1OANA 3SDXF 3MUJA 1I7RA 1S7UB 2AZAA 4LCYB 4LCUB 4QHUB 5JIQA 4NAJA 2D9QB 4DK6A 3A4DA 2DQFA 3WMQA 3C6LD 3RX9A 1BVKA 2H6OA 4WFED 5KSVA 1RPKA 4OM1H 2AQPA 3GSNB 3NJVA 3RL1A 1GGCL 3IMTA 2WNGA 1XGPA 2B77A 3CJJA 3HHMA 4UNIA 5LQBL 4OZ4A 2E9JA 3DGGB 1AGCB 1JNHA 3RGVD 1UM6H 4DGWC 4E41A 3FT0A 4XMTA 2MNJB 4FDWA 5DJXA 1OP5H 1EO7A 3RB7A 2YMTA 3U30C 3G6AA 3V0IA 4MRCA 3F83A 3IF1B 3ARUA 5GISL 4B3EA 5C08A 1QUPA 4FEMA 1A9EB 1X7TA 1NTDA 4FOMA 2R1XB 2AKRB 2CIKB 2PO6B 4G9FD 2RCSH 4KJPC 5C0IB 1FORH 2P5EA 2SODB 2DWTA 1CGXA 1ID5I 4PRHA 1SDDA 1G7JB 3G3LA 5SWSB 4CU8A 3HNSL 4ATWA 1QSVA 5I1IL 1KTBA 4WEMB 4ZW5A 5E6ID 1FNHA 5EU5A 5AAMA 2O30A 4QXUH 3MMEA 1PY9A 5DMGD 2R0ZH 3H55A 4LRNL 4PRIA 4XPBL 1AR2A 3E80A 3L4UA 2HRLA 4NGHL 3FOLA 4WCYH 1O6TA 1YPZF 3ML9A 2J44A 2XN9D 4K9EL 4WFFE 2YMXH 2NY1C 3OJDA 4H0HB 2JCCF 1GGIH 1K8IA 4LAJH 4PRBA 3ZDZE 2XIIA 3STBA 5TD4A 3W3BA 2JCCB 2PPAA 3D4YA 1I8MA 4U0RC 2HMIC 2XWJA 1I7UB 2EKSA 5INDA 1J8RA 1V8HA 4L2LA 2WBKA 3FZUD 5BZWB 5JHDB 5A2KH 3NESA 5I66B 2BC4A 4M7LT 1KY7A 2WSDA 2I7SA 4XMPH 2HRPH 4R90L 2HFEB 4D3CL 2A4CA 4HUVA 4H8HA 3DHUA 5IW1B 3FRUB 4LGPB 3ECVA 3QBTB 2WLMA 1RJLB 4JM2A 4L1DA 2ED8A 4Y89A 1JZ2A 4OD1L 4TNVK 5ESQA 5FWRA 3VXRA 1CWVA 3T2NL 4Q9CA 3OHXB 1IQWL 4PTUA 5C3TA 4NRXB 2EECA 3RI5F 2FZ3B 5FHAH 4CW1B 5KZCD 4S1SH 4XODA 2Q1EA 4ZTEA 3SGDI 5A3ID 1FL5B 2TSBA 3PABB 1KGWA 1EJOL 3FRPA 3MACH 3WD5H 4KQ0A 3PWPA 3KM2A 4HKBA 5BRZD 1R3JB 5IBLC 2HG5A 4ABWA 3QDJA 1BF5A 1P9MC 3QJTB 2XPGB 2EH7L 1S7XA 5HJ3B 4OT1H 2IADB 3O6FC 3ZE0E 4TUKH 4UT9A 4DCQA 2GK2A 3CDFA 3ARBA 5TGBA 3SYOA 2FO8A 5EUKB 4PTUB 1ODAA 4IRSD 4PAZA 1KB9J 2JXMA 5ID1B 3SPHA 3BVUA 3QORD 4PJXA 4X8XA 5D1QD 3VXMA 1EGJH 4AQ1C 1R17A 3JV6B 1F3DJ 1MSPA 5I76B 1B4RA 2QEJA 3QDGD 3DO7A 4ADIA 4PJBA 2D8KA 1ZA3B 1IZJA 3F6IA 3FMGL 1F3JA 2AJSH 5BO0D 1T2QH 1RIVL 1FV1A 1HH9B 2X6UA 5E51A 1MJUL 3GLEA 1JPSH 3HAEB 4Q0XL 4K9EC 4CSZA 3C5ZD 1U8QB 3MJ8B 1PZAA 3DETC 4H1LA 1O0VA 4M7ZB 4L4VB 4XVSL 4UIMA 5C86A 3WTXA 1O5PA 4NO0B 5ID1A 1TO5A 1JN6B 1T1XB 3P2DA 4K5MA 1NCAH 3PFUA 3AY2A 2A6KA 2H8PB 3O6ML 1I8AA 4E42B 3RZCA 2DMKA 3HS8A 2QV4A 1NFKA 1NCDL 4UINH 1FNEA 1FNSL 3IETA 3MRMB 4J3BA 4TN9A 4MNQE 2XQYA 1H3PL 5GS0D 1HYSC 1LEKB 1T20B 4ONHB 5JQHC 3RPIB 1LWHA 2OMYA 5DEZA 3TH4T 3UTZB 2IGLA 4EUPB 4YHKH 5E1GA 3ESOA 3MI6A 1N12A 5HHME 4LHUB 4DK5A 4MA7H 2E7LC 1Z66A 4Q9RH 3B7UX 4WV1C 3NIGB 2Q20A 3E6HA 5IREA 2COVD 5HYJA 2EAEA 2ATPA 3IFPA 3MCLL 1N8OE 3SDCD 1GVIA 4DETA 1J10A 1K9TA 1BEYH 1GKEA 3CFEB 4OD1H 3DBSA 43C9A 4HIPA 4Y4HA 2OXHA 3QUKB 2XA8L 3SE8L 5HI3D 5M7QA 4JQXC 3MKGA 1I8KA 2DQIL 3THML 5J56B 2BP0B 3VQLA 1G0YR 1MLCA 4KNUA 5KSUA 2XZZA 1DE4B 3AZUA 1KJ2B 3KDMB 3NRFA 5HYFA 1VGEH 2P4AB 1INQA 2UY6A 3WE6B 2J25A 4N90D 3JSSA 3OKOB 3H85A 1AG6A 4ODTL 3JUYA 3QR0A 1G84A 2XTJB 3N9GL 2ZTBA 1UKQA 3IKCA 2W5PA 1I82A 4JZJC 4LCIH 1UOWA 1ND0B 2B20A 3ERXA 2X4UB 4PW9A 4TUKL 4GW4A 1FFPB 1A4AA 2DLEA 1GSKA 4NXKA 4O00A 1X4YA 1AZUA 1LP9F 4K23L 5DD3L 3LS4H 2OMVA 1G9NH 3BVDB 3I6KA 4FFZA 4K9JA 1N0LB 2MPAL 2R4SH 3BP6A 4NWTH 4DKTA 5A40E 1YEIH 2I27N 4MA8L 2XNAB 2QSTA 1T0MB 4U1NB 3ULVF 5D7IB 4XP1H 3OB0K 3OKOA 4G8GB 4RGOL 3OHMB 1KXVC 5DVLA 4DQOL 1PYWA 3E2HC 2R56L 2JKSA 4JN2A 5D7LB 1JGLH 5DJCB 1DQIA 3EO1B 4OUUB 3T6QC 4OV5B 1K85A 4M6NL 5IGXH 1G7QB 3LH2L 1IAII 4OIBA 3AY4C 1A9EA 5DEGB 5FM5O 2AVGA 4XVSH 1LVEA 2CZNA 1IM9A 3KXFB 3H9SD 3U7YL 3QWNA 4IBLT 3JVGA 2DH3A 1U21A 3QR2A 5DO2C 2BVUA 3IJEB 3LJ3A 3OG4B 4WQOA 3O0LA 1B4JL 2KPNA 5D7SH 2CLVA 1MHCA 2EACA 1SY6H 2OJZL 1YEEL 4L3FA 4N9OB 3HN5A 3QIWB 3C2AH 4WU7A 5K9KA 1TJIL 3ZSTA 2CBTA 4UDUA 4RX4A 5IB3A 2BVOA 5CLTA 4A2EA 3FTYA 4PS7A 1K4CA 1B9KA 5F9AC 1BFSA 1UGNA 2Y06L 4BFKA 3FQWB 1MUJB 1EJ6A 3RE0A 1A6TB 2ZKHL 4XO5A 2HUEA 5HPMA 1WICA 5E99H 3OKMB 5EBWA 3L1OL 1SJHB 3SGEI 2XBZA 3S3BB 2EEDA 3LV3A 2OM5A 3V4LA 3INOA 5L4JA 5FR3A 1NEZA 5CJ8A 5EV7A 4B9PA 4MDRA 2VJ8A 5J11B 3IGLA 1L7TL 1UG9A 2YUVA 5HHNB 1HXMA 2A77L 3CMOH 1IBBA 2WKLA 3MBEC 4MCMA 1EGJA 2D2OA 1MHEA 4IDLA 4JFFE 4E68A 3QISA 5DRNB 1OP3K 3O3AA 4BWUA 1LP9A 3D25B 2OLDA 2UZIH 4YDJB 1G9NC 3FCSA 3FQWA 2W07B 3FFCD 3VCLA 3QEQB 2NY7H 4LU5L 3ZE2B 5IR1B 4BWTA 1QR4A 2QKIC 5JHLL 3U0TA 4O51B 4WFFD 3VNZA 2YGPA 4ODHL 5D5MA 1MFVA 2VNCA 2HFFB 2YA2A 4G6KH 1G0DA 3GSRB 1TFHA 1U3HC 4U1GB 4GEIA 3I3BA 3ZO9A 3WS3A 5SWZB 1JZJA 4PV9B 3W0WE 3GJFH 2HSIA 5LVEA 2WP3O 4UYPA 1BYNA 1XSIA 1P5UC 3HA0A 4FXKB 5ACMA 1HOEA 2X1PA 4B9ZA 4YDJA 2P5EB 1H6EA 3EFOA 2YD3A 3CK0L 3QDJB 1E28B 1MIML 4X7SL 4DP4X 2AXJA 2BNRD 2H1LM 4X9GA 4XP1L 1MCFA 5DVOA 1F3DH 4Z7IA 1F4YL 4WRLA 3FCBA 3T4AC 3X3GH 3PAVA 1TEGA 4NZRH 1NCCH 4BQCA 4D0CA 2EEBA 2XYCA 1J0JA 4MX7B 3EJYD 4TUOB 4Z95H 3H9YA 1LO5A 1KXQE 5F7EH 1NC4D 1JBJA 4LLDA 4YXLH 4FRWA 5DD6A 1EJOH 3ZRCC 3ABMB 3D9AL 2AXFA 2AS5M 4MQSB 4PJIA 3VTTA 1B6DA 4UNVA 4JRXA 4MXWL 4RIRA 3S36X 2AXHA 3D3VD 3GNML 2WXMA 5EOCH 4QHPA 1VRSA 1J18A 1SQ2N 1ZA3A 4XN7A 3V0GA 4AMXA 1H8OA 3VI3E 3J27A 1AFVL 1XF2A 1MCHA 3PWVA 2P52A 3JUZA 4L48A 1YEEH 5IB1B 4LF3A 1H6TA 2W38A 2B1OA 1EGJL 5DC9B 5J11C 3TX4A 1DJIA 5D7KE 2YXMA 2MSPA 4EOWL 3GSXB 5IVNA 1AH1A 2AEIT 1E90A 3G6JB 3ILPB 2C9VA 5JIPA 3EZ8A 1PAMA 1LO4H 2X0WA 4F20A 1XD0A 3LYRA 1MCEA 3ZE0F 3PWPE 5JW3L 3APFA 3Q8AA 2PCPA 1J1PL 2AQQA 1PQZA 1AKJB 2FATH 2WMPB 4E9WA 1HH6B 5F89A 3X1BA 1RZKH 2ZG2A 1NDMA 3UH8A 4G80B 4PRNA 4P9HC 1JZ5A 3W5NA 5EEVA 3KDPB 3OXSA 1CGWA 5ECJE 3NN8A 1AQMA 4XPHL 3MLUL 2ZAGA 3R4DA 4ODWA 1YYLH 1QO3B 4EO5A 3BQUA 4GAYA 2FWSA 3WJJA 1AS8A 4Y19D 1BYOA 4OZGF 1GGYA 3W9DB 4AQAA 1JCKA 1IZKA 3L4ZA 1G4MA 4BH8B 2NNRA 4M1DH 4MA3B 2Z92A 4ADJA 2X4PB 3TEZA 4FG6D 2J8OA 5FPIA 3EG9A 1P7BA 4N0UB 4WUUE 2COQA 2IOMA 3PGCB 2IH3B 5I15H 4DTGL 1NCBL 3ARRA 4ZOEA 3U6XS 3C6SA 3V2AR 5E4EC 4ZJ9A 4CBZA 1HL4A 3A6CH 3BZ5A 3OTTA 4I1NB 4LHUD 2ZUYA 1PG7X 3WFDH 2JXMB 2CO4A 3GMPA 4NBXB 3R4RA 3T8VA 4Y1AA 1EXUB 2Y25A 1JTOA 3NJHA 1KTCA 1XGPB 1RURH 3PXHA 3I02A 4L3EA 3UO1H 5FOBB 2HT2C 3GMNA 5B1JC 3F7RA 3VD4A 4XXDB 4AYBA 4AVJA 3SDDC 5A2FA 2KQNA 2OZNA 3UJTL 1WFUA 5AAWC 1AXTL 4LEXH 5IKCA 4UUJB 3VI4E 1M1XA 1VJSA 7PAZA 1R0AL 1UWGL 2DQUH 1KG0A 4L8CA 5ADPH 2X1XR 3HC0A 1F4WH 4LNRB 3ZKND 4ZFOL 3SDCB 4RZKA 4D3CH 4TVUA 3UJIH 2DWDB 3SDAA 1QFUH 4PP2A 1RL1A 2KI6A 1T0MA 4FJ6A 3LPGA 3HC4H 2NW3B 3T9WA 1KMGA 2EILB 4ZMNA 3R1GH 4MDJB 5E8PB 4B9GA 2LU3A 2A1WH 1PZ5A 2H1PL 2OMWB 3WKQA 5LGJA 4MCNA 4JCLA 3VU2A 1NBQA 3TBCA 1TZIB 4QXVA 4XXWA 1MI5D 5FYJU 4BUGA 2NNXA 3BIKA 4YL4A 1MRFL 1SOKA 1XTLA 2EYRB 2WQUA 1QI4A 4JY6B 4TULL 4WO0A 3AREA 1EAPB 5TE7L 3BAJA 3VDCA 3U2SB 1U8CA 3ML8A 4UMSA 5ICXA 2GTWA 3OKEA 1NDGB 5BO1L 5GGVL 2DLGA 4YHOL 2EC9T 4WEEA 2DQEL 1C1EL 4DKEL 5BRZB 4K3JH 1RHFA 4UT6H 3BX7C 2ATPB 3H42L 2XCMC 5EEWA 1KBVA 4JZNB 3TF4A 2J8UF 3DYPA 2N56A 1DSYA 1KNOB 3PDGA 3QUKA 5EZIH 3WDIA 3DOIA 2X3BA 4W6YB 1I1CA 2DAVA 1JGEA 1HHHA 1R5VB 2NSQA 3MRQA 4XNQB 4JAMB 2FD6L 4LLMA 5HHMB 2WM0A 4JG0L 3T3PB 1BBDL 1SOQA 3TPUB 3GEFA 4NSKA 1P7HL 3MA9L 1U9KA 3ZRSA 2B4CL 4YR6A 4AQEA 3L48A 4PJ7E 3TNNA 1B4JH 2Q6WA 4LCWE 1GZHC 1M53A 1OGTA 1L6PA 4KI1A 1TIUA 2CHNA 5T1MA 2LU4A 1I8IB 2K7QA 1IARB 3FU9A 5E8NA 3VM5A 3NCJL 3LEVH 4U2YA 3JYBA 3QUYC 5CEXA 1ZTXL 5C3IA 2F1AA 5E00B 2IMMA 5CHNB 5EU7E 2C3GA 5BV7H 5I26A 3GMQB 4HSAC 2FJHA 1S7SA 4XH2B 2UZPA 2AJUH 1IKOP 3MHZA 1J9SA 5JORB 3L1OH 1P5VB 3Q2CA 3VXSB 3RVVD 1UD8A 2CDFB 5GRJH 5K1NA 1N0XL 1JIBA 5IB2B 4L8DA 3L9RB 1Q0XL 5ACZA 3DRQB 3TJEH 1WFNA 2F53E 4JL1A 3VD2A 4H25A 3ZUNC 1CYXA 4O58L 3BPCA 2CRYA 2YBRA 1S5IL 5IVXF 1MRDL 4ZD3L 2ZWKA 1EANA 1QPKA 4L8SA 4Q6KA 1MAJA 1UOVA 5JIKA 4LSQH 2ARJB 4L4JA 1E6JL 4BQ8A 1UB5A 1NJ9A 3PGFH 3ZU8A 5JLZB 4NERA 5D5ME 2WGXA 3KL3A 2Y1ZA 5KVMC 2JQMA 1DQML 3HLAB 2J55A 1NDTA 4GAFB 1Q38A 2N3JA 2Z8VC 3FB5B 3GGWB 4M93C 4L8BA 4PRPD 4FQCL 4PY8I 3UGXA 2NR6C 5DFVD 2WMPA 4ZMQA 5C0CD 1ADQL 3SKJL 2VDNL 2Q8AL 4JFYA 4ZPVA 2X6AA 4YDKL 4L29B 1EEQA 2P5WA 4MHHI 1CGSL 3IGAB 1E9OB 3K72B 4X7TB 5CILH 2VIRB 1NCJA 1F6LL 1HHKB 3B1TA 4KRNA 2Y0SA 3DOSB 4KNTA 4MDIA 2DWYA 3TJPA 4AI7A 1P7QD 2WXPA 5GJTH 4IJ3B 1JZ6A 5ESVA 2XWEA 2DM4A 2K7PA 5AOKA 2AGJL 4ODTH 4X4MA 3U4EA 1PFCA 2O5XL 1OAKH 3MJ9A 5HY9A 1C1EH 4DKEH 1J9QA 1ET7A 4FYQA 2VQ1B 1ZVSB 1I85A 4NC2B 1FZKA 3EYQC 5IHHA 5CSGA 2DQFB 3HS9A 5CN3A 4JY4B 1FE8L 4JX0A 1WUZA 3FHAA 4K55A 3UYPB 2FJGB 3EBGA 4JFYB 5A16B 3DBXA 5F9OH 1QNIA 4ELMA 3T0EE 2QADC 4PR5A 2EZ0C 3JTTB 1FH5L 3WJMA 2CG9X 3SBWA 4EI5C 3RQ3A 1ZANH 2WSPA 1KIQA 1XF4B 5FXCH 4K23H 5I0YA 4KUCF 3QJRB 3LN5A 1KENL 4NN6B 3CDZA 5D7KD 3D0LB 5I19H 1LDPH 1QFPA 1XGYL 2YJQA 1AXSA 1KEMH 5CGYD 3WTVA 2IPUG 3U4EB 1W15A 5I2IA 5CU9A 3FBKA 4OQTH 1OAXL 5GS2H 3DMMC 3EO0B 1J8HB 2VOTA 1EZVX 4J3OD 5K93A 1RFDL 3W57A 3GF8A 3VXUA 4XP5H 4JY4A 3ZMNA 4RGNE 4GAJH 1KBGL 5ISZE 1PTZA 3N91A 3WXWH 3TP4A 2ADYA 3ARDC 3T2PA 1URZA 3WJJC 2O5YH 2J4WL 3KGUA 4LPCA 3QSKB 3JZYA 1U91A 1PD1A 3V5HA 3QUXD 1WSST 5T3ZH 2A73A 3LN5B 5DJ2B 5CN1A 2NY3C 2YD8A 4Z7NF 4ZSOB 5CN2A 2HVKB 2BSTB 5JNYB 3NJFA 1CZ8L 5EU3A 3VX1A 3AADB 5I5IA 1RJZA 3OQRA 4HGMA 4NZTH 4R4FH 4PWJA 5F8RC 5C7XH 1AO7E 3KLHC 4EVNA 4V1DE 2WLZA 2XXFA 2EDRA 3QNXB 1HT6A 3DIVA 1GHFL 3WEMA 4PS8A 3G6JF 4JFZH 2A6IA 2DQHH 4U1IA 4H20H 1MAMH 1RLBA 5A7BA 1O6VA 3NABH 4LCWB 5C09A 1U8OB 1BEXA 4MCYA 1IM3A 4HH9B 4M61A 4X8CA 4DP6X 1YQVL 1ZMYA 4Y5VA 5AAPA 2BCKB 5DQDL 5LNDA 3QZBA 4AT6A 2YD5A 3RWGB 3BFOA 1TYRA 3PWNA 4N1HB 3L4YA 1Q9WB 2ZX6A 1JPTH 5I1KH 4MB1A 4HCGA 4M29A 4BFEA 2NNAB 2C4FU 1GGBH 3PP4H 3EO1A 1AANA 1KZQA 1JGEB 3MRQB 3KBHE 4M6OH 1BGXH 4F8NA 4OGXL 4UUJA 2YMOA 5I5RA 2O6CA 4ELMF 3WLWC 1A25A 4GKZA 5FWQA 2XWTB 3V8OA 3SO3C 3CHQA 4RAVB 2D7TH 3KXFA 2VAAB 3W39B 1KUMA 4N0CD 1MW1A 4RETB 3VNYA 4JHAH 4KC3B 3IDNA 3M46A 5CZKA 1CLYH 1FVEB 2VLME 3TXAA 3C5XA 2GY5A 1OAKL 2ZJSL 5BW7A 4LP4A 4V33A 1Z9SA 5D6CA 2IAMA 2OMWA 5B1CA 5KYXA 3VRLF 1CU4H 4I77H 4PGDB 5TH2B 2YPVH 2OK0L 3HCVA 3QS2A 2XRAH 4PJFA 1CT8A 3QFGA 1BOGB 3HZKA 3K6DA 4F93B 5DCCA 3MGOA 3OKMA 5EBWB 3DX1A 2IG2H 3LKRB 3T3PE 4C4KO 3LS5L 4NQVB 1QPPA 1VZHA 1WBZA 2YN3A 1TU2B 2W0PA 4UTBH 4ZAKB 3RWFA 2CJUH 2JFCA 4ZW3A 2O5ZH 3F3HA 3T6ZA 1B3IA 2JV6A 5GJSH 1RFDH 2XZCH 4AKQA 32C2B 3T1FB 4YZWA 4XPFH 2OAAA 4AGOA 7FABL 4BDVA 1UXSB 4RDQF 3MRBB 3P3SA 3DDFA 1W8OA 1CDJA 2G4GA 3P54A 4G83A 2O61A 1EZVY 4UB0H 4U3CA 3RX7A 3LVTA 3K2MC 3TBBA 5IMMA 1DJGA 1GZQB 2GTQA 3HW7A 1FVCB 3MR9B 3D87B 3BD4A 4YDZA 1ZK5A 4V2CB 1PDKA 3MLWL 3RIAK 4F3FA 4R4BA 5FKPB 1CE6B 3PYCA 3VG9B 3JWDL 1H3WM 3GXIA 2YAHA 1U8JA 4FNLL 5EZIL 4I18A 2Y2TA 1Y07A 1Q9OB 8PAZA 4XNZB 3CPLB 1TJXA 2Z8SA 2VDMH 5C0JA 2ZUWA 4PBVC 3RX8A 3Q0HA 1CGVA 3WJLA 3AG2B 3ILQC 4MJIB 1LMKA 1KYFA 3Q1EA 5JW5B 5CJXC 2GT9B 1E5YA 2HZHA 2O72A 4K71C 5T33L 2E7DA 3L1EA 2V2WA 4LVEA 4OCWH 1PLAA 1HEJC 4EQ3A 4GG8B 4A7TA 1AHKA 4EKJA 3IRZA 3EH1A 3QZLA 5DWUL 3VFMA 4F3FB 1ZTXH 1JRHL 2A74C 3NTCH 4B9YA 4D0DB 3G5WA 5DD5L 1FGNH 4AYGA 4Z8FH 2BIPA 1U3HD 3AT0A 1Q9OA 1UKTA 4DT2A 5BRZE 5A2JH 1YN7A 3FB6B 3NIFF 3QC5X 3PREA 1OTSD 3CHRA 1U36A 1BD2B 3BC9A 5JXEC 1JZ8A 1WHPA 5BZDB 4QNPE 4JB9L 4TLUA 5JPNB 1KB9K 3CFEA 3NT0A 5T1LB 4UTCA 4ZO6A 2FVNA 1MPAH 3LDBB 4FI7A 4IDJL 4ZS7H 1CBVL 3FC8A 4RFOL 5FO7B 4C56D 2B39A 4GS7B 1I9IL 2DH2A 2D3LA 3AB0B 4QJ4B 3S8GB 4WUUB 4HS6B 4I77L 3EOYG 2NSMA 3N44F 2VXSH 1GOFA 4EN3C 1VFAB 5MP6H 3PJSA 1KBKA 1FFRA 1F6AA 3BE1H 3APCA 2GFBA 2ZCZA 2R2CA 4YSUA 3DURB 3BIBX 1YEFL 3MAWA 1AI1L 2DM7A 3P69A 1W91A 1P7KA 4L9LC 3R06A 1GYCA 4G70B 2ITCA 3PJNA 4M7LL 1OZUA 2RR3A 3TC9A 1FFOB 2E9GA 2E7LA 3RZWA 1G7LA 1QATA 4QNPF 4BKLA 4WV1A 4W1TA 3U36A 4JFDA 2LAAA 3O9WA 3MXWH 3UJTH 5BZZA 1XDTT 4WU5B 2WZPA 5J6HB 4S1SL 3PL6D 5E2TH 2IQAA 7FABH 3ULUC 1P7QB 3UTPD 3CSGA 1FP5A 4XBEH 3STLB 4F7TA 4DKDC 1KB5L 2MHAA 5DK2B 4BQ6A 1NWOA 2CNYA 1NEUA 3AREC 2Y5TA 1TZ8A 3DMMA 3J8F7 3MRKB 2EP6A 5D6DA 1A7QL 4LNVA 4CC4C 4FEIA 1AZCA 4A55A 1BQ5A 4A7UA 2MNWA 2VMFA 1DBBL 1ZHNA 2CPUA 3ESNA 4HPOH 1W80A 5GGTL 3IT8D 2IH3A 3BO8B 4HC1A 4URTB 4MJJA 3M88A 4I3SH 4FI8A 4JHUA 4R6UA 4BRVA 5IB5A 3F7KA 5IHZA 5C6PB 1MRFH 3GKWH 3VI3B 2AQ2A 2WYTA 4YN3A 1K8IB 5FUOL 3T0VA 1B0RB 1H15A 4IIQB 3E9TA 1KEML 2DQEH 2WXHA 5E23A 3WNOA 3MLTB 1JGDA 4JDTH 4NZUH 4NBZB 1I1RA 3PWJB 4QGYA 5ALBL 4TOYL 1NFDE 5EU3B 3ZDXF 5FEBA 5ID0B 3FQ4A 4B50A 2XG5A 4RVBA 4O5LH 2BY0A 5JTWA 5HDBE 1WD8A 4R2GB 3F7QA 1ZT7A 1MIEL 4NRZA 2WBJB 4Z3JA 4B3VA 2YFNA 2CE6A 4X7TA 2J8UB 1DHKA 2PW1A 1X5KA 4NKMB 2A7BA 5IROD 3NQKA 4BSWB 1ZJAA 1A4CA 1WBXB 3K6FA 1J8HD 2W80C 3M1BB 2R69L 3KM1A 4GIPD 4HKZA 3SZ6A 3FSWA 3MCYA 4A04A 4CN6A 1P6FA 3OZKA 5C0BE 3RTQD 3VWJC 4HCFA 2G4EA 5EUOE 3B9VA 1BBJA 3VYPA 2RB8A 2ICES 4LSVH 1BQSA 1WZ1L 3MRIB 4X6DF 2XG5B 4XN5A 3T3ME 1MJJA 2DLIA 1GYAA 3NCJH 1MHEB 1PPIA 4QHKJ 5I74C 3UFIA 3GT6A 3S34L 1UJ3B 2L7EA 3F6JA 5JQIB 1LO2L 2GYSA 2HCZX 2R9HD 5DHVH 4YSAA 1LJMA 2E4FA 2IOOA 1JZFA 1MKFA 2VABB 4OV6F 4R3SA 5CF3A 1G7JA 4N2HA 3LN4A 4EE2A 3VRLE 3TEWA 1GCFA 3BE1L 1E65A 2PW1B 2K70A 2FWLB 3QJSB 3GS0A 5BRZA 4XAKD 3PAZA 4R4BB 4DJMA 5E5UB 1RV6X 1AXSB 2JCCA 4JFFB 2JELL 3N1FC 2NR6A 4YSOA 5AW5B 3UZVB 3EOAA 4WNSA 3UIYA 3GSQB 3NJGA 1QLFB 4PMFA 1IC7L 3C5ZB 3C2SA 4XBPA 4YHIB 2JKJA 1PW3A 4Z23A 1G6RA 4K9EH 5EO9B 2HX7A 4Y4FC 5E2TL 3REVB 2VZ1A 1T7XA 2KT6A 1IEAB 1QSEA 3ROLA 4XHJC 4YLQT 3NFSH 1MF2L 4H8WL 1I9EA 3LN4B 1Y7VA 2D03H 3QZPA 5F21B 3HFMH 1B88A 4CUCA 5AB1A 3HG1B 5CBEA 2WCPA 3H4HA 3ETBJ 1CK0L 1WBZB 4J27A 3KEHA 4LCCA 1BQHG 3LB6D 4APXB 1NIFA 2XRAL 4KY1H 1ES0B 4P5KA 1SRDA 1T80A 3EJTA 3C5ZA 5I0DA 1JOIA 4YK4B 4XGZB 3HZMA 4AZUA 5IMLB 4FTVD 4PGCB 4FXGA 4XO9A 4BK8A 5J9PB 2YARA 1F58H 2O5XH 5ACZB 4K8RL 3V5DB 1YMMB 4MS8D 4G2AA 1MFBL 1BJ1H 5AEAA 3ETSA 2NCMA 2O6FA 4DQOH 3C6LC 2NY4C 3RBGA 4FHKA 2UX6A 5AB2A 1GW0A 4WK0B 2W91A 2X4OB 2MQ0A 2C9PA 4I4WB 4JG5A 1DQDH 1TMQA 1NZRA 4D8OA 2BS8A 4GRMB 3LH2H 4Z3HA 1ES0A 4P5KB 4Z7UE 2WTOA 4XOAA 1EHKB 3ARYA 3RWJB 3BAEH 1VFUA 1KN4H 3OJVC 1A4KA 1PMYA 1J0ZA 2J5LC 3F85A 4WW1B 1TEYA 2DD8H 5E9DB 3W5MA 4XMWA 4DO5A 6PCYA 1FPTH 1PZUB 3BMWA 4ZUSA 1N68A 1LEGB 2DWXA 2ZXWB 3CC5B 4OJFL 1G7IA 3QCVH 5E8EA 3GB7B 3CQFA 1IEBA 3K8KA 4NQUA 5J12C 5F7MC 5GRXG 3LXAA 4GO6B 3V4PB 2Y3NA 4X0KB 3C2AL 3LKNA 5JO5B 3V10A 1J5HA 5HYSA 4WDIA 3IGKA 5CKGA 3D39A 3ESPA 3F12B 3QXDA 4PW4A 5EC1A 1C12B 2CIIB 2LT9A 2Z7WA 4MMZC 3D06A 2R59A 1DL7H 1OGAE 4MZ3A 3WO4B 3B2DC 4FQXA 4MQXC 2CUHA 3E8VA 1BV8A 3LPWA 1MN4A 1U3JA 2AJSL 1UC6A 4OJAA 4PJ8A 1P1ZB 1IE4A 2AHIA 4N0UA 3WNKA 2OL3B 4U1JA 1T83C 2WLYA 4JANA 1UZ8A 2AEQH 4X6DE 5DWUH 4Z7NB 3UABA 1N18A 1WITA 3MCKB 4M8UA 4LQFL 5ENWA 3TV8A 4EN3A 2HFGL 4L4VA 4MCZA 3UGUA 5ANMB 4CW1A 4PJAA 1KIRA 3SO5A 4N9GB 1EXUA 1GZPB 5D7IE 4L4TD 2C9RA 3P11H 2IBZY 3HN8A 4YDNA 3VGHA 4JB9H 2APSA 2UZIL 3WLBA 3AB0C 2YD4A 3GMNB 5JIDA 2X4NA 3IE9A 5LJYH 5C6WH 2X4QB 3DV6B 4RZCB 4Y4HC 4WHCA 5JR1H 2DWEA 2FL5A 1D5XB 1TSHA 4ONHA 5DGRA 4Z76B 1E8ZA 3Q2WA 4UV4L 4JKKA 3TYFB 3VFOB 4ODHH 1GJUA 1Z5LA 4QOKE 1CICD 2YGQA 3HC0B 3SQRA 3MCG1 3SJVE 3GJEB 3A67H 3Q8FA 5LN8A 1DJHA 1ECZA 4PP2B 1GA2A 3QHFH 4P9HH 5AZEL 3MREA 3AXLB 4IMLA 4DEUA 3MGTA 2QHRL 1UUNA 5I23A 3QPKA 4PCKA 1AR1B 4HAGA 4M5YH 4NEHB 1E4XI 4G9DA 1R3IL 3H9SA 4OB5L 2EKJA 1OTUC 4R96B 4PJBB 4OCYL 5CLZA 1MREH 1K4DB 5CCGE 4X9IA 1GYWA 2WAHA 1UH2A 1SEQL 3WIAA 1E4KC 1RCYA 3SE8H 5H35A 4U1LB 4DOHB 3PPSA 1FG9C 4HG4J 1RUPH 5GZOC 1T21B 3PHQB 1OLZA 3GSOB 1HDMB 5F7EL 3U2JA 5EIIG 4RGNB 1BIIB 2XN9E 3JWOC 4LFHG 4ONGH 4HWZB 4Z7OF 3RILA 3TF7C 3P9WB 3T65B 1YPZB 4MXVE 1KGIA 1XH3B 3SGKC 4JKPH 2AK4B 4LDLB 2KBGA 4N2DA 3VWKC 3FFCB 2I32A 5ITBH 1THAA 3PWNB 1N5AB 5L2KA 3FULA 5AG8A 3C9NA 2ZCKH 3IEAA 3V8CA 4NZJA 3QCUL 5EFIB 4I89A 4YBLB 5HGAB 2JKLA 1V7MH 1EZUA 3PQYA 5AVTB 1ZSDB 1KLFB 2JIXA 5KANG 4FA6A 4KPHH 3VXTB 5LDUA 4PJ5D 5JOEA 4MAUL 3IVKB 4DO6A 3BUTA 4UB0L 5CBEB 3KCWA 2GFBB 3CN3A 2F7QA 4PRDB 2IDCA 4H5SB 1I8LC 3IMWA 1FVEA 1E40A 4O5LL 1HHIA 1M7IB 3DI2B 3WAKA 1FL3A 3CVHB 2VR7A 3HUJE 5DYFA 4W68A 4UDUB 1UXMA 5K1JA 3CZKA 1N59B 3GI8L 4XH2A 5B1AB 4HALA 5FM5M 4PGBA 2G0LA 4JREC 1FVDB 1SM3H 4MNQD 4N25A 4MD0B 4YBQC 1TLMA 2CGRH 3R8QA 2VERA 1BYPA 1E0OB 3BFWA 5FS5A 4PG2A 3VB8A 1WWBX 5C0EA 5E4AA 1AZRA 3WL9B 3LTVA 5C08D 5FUCC 5EB9A 3RVWD 3ISRA 5ESQB 3VXRB 1WGVA 4WIQA 5DMJB 1LO5B 3L2LA 1SYSA 3DXAD 1X7SA 2MCPH 1YY8A 4NRXA 2O26U 5C2BH 4PJXE 3MBEA 2N7AA 4Y5YB 5MERA 3WGUB 1FL3B 5JHDE 3TN0A 3NSYA 3MRBA 3K4ZA 3MV9E 1NC4A 4LSTH 4S0HA 5CJQH 2WXOA 2XZAH 4ATTA 1UADC 1JTPA 4G7YH 2YO3A 4Q4IA 1AGDB 1BXVA 2BFVH 2G30A 3BDBA 4C4UA 2JKNA 3LKOA 5C0DB 3K6IA 2P7TB 1A4BA 1F8TH 4JFXA 3MMEB 3T2QA 5I6KA 2P24B 1O7SA 1RHHB 1TR7A 4HUCA 4I48B 1ZAGA 3TBWA 3MLZL 3PV7A 3IDGA 3VXMB 1BZQK 1H19A 1RJCA 2AQNA 4JPIA 3QUYD 5F7WC 1MRCL 2R2EA 4ZZKA 5IJDC 3O6FB 1AI1H 2K1MA 4RFNB 2F8XC 4IBQA 5PAZA 5TGBB 1T03H 2X2IA 2OI9C 2CA4A 4LASL 2MWCA 1YAZA 4MYPA 4PD4J 3WIIL 2H1PH 2EYSB 2WXIA 3ZDYB 2A2QT 2BC4B 1HCYA 3QUZB 4QKXB 4YE0A 4ADGA 1YUHA 4K71B 5E2UH 1SJVA 2AK4E 3QXWA 3EFFB 3GPSA 2FIRT 4D9RD 5I8CB 4AUYA 1CLZL 1GXEA 1LO0L 4PJEA 1F02I 4AV5A 4HJ1A 2A9DA 3WKNA 4MAUH 3QI9A 3VH8A 3H6AA 4HJGA 5IEKA 4WWKB 4HFWA 4KTYA 1OKEA 4WFHD 4HBCL 2WW8A 2GCYB 4R7DB 4X5WB 3ZDXE 4L18A 1GCYA 2D3JA 4UM9A 5GSVA 4NFCA 3RL2A 1HSBA 4UOZA 1YJDL 4PJHF 2DMBA 3QDJD 4OLUH 2VGLM 2CBQA 4YWGH 1HXMB 2E0PA 1N4XL 3S98A 4YMPA 3I3DA 1KJVA 2QMJA 2DYPA 4JS7A 3KGRA 3MRLA 4F80A 1ZLVH 5D2NB 1CFTB 1CTNA 1S7TA 2ZYRA 3L3OA 3V95A 3MLRL 3ALPA 2KH2B 4NO5B 3CZFA 2W0LA 3LRGA 3BP7B 3WO4C 1U8PA 1SBBA 5FDYA 3D09A 5DJYB 2FSEA 4QRTB 3A0OA 3EDEA 2I60H 4PJ6A 2PTTA 1NKRA 4QT5A 4UI2A 3P4NA 1M2VA 3AAZB 3MUUA 3SDAB 1UENA 2DI8A 1HHGB 3WFEL 3TZVA 5I9QB 4N9GA 1KJ2A 3K74B 3KDMA 2HX9A 1P6AB 3ZMEA 5DMIL 3CQQA 1UEYA 2YA1A 5FYLE 4HUXB 4EI5D 2P8PB 4PBDA 1AQHA 1E42A 1AD9A 2H32H 4I2XB 4S1DD 1W8NA 2IDUA 1T89A 2OXHB 5JOPD 5I1CL 4XMLL 4N0YL 5I1HL 1RZKL 2H2PC 3TJEL 4XWOD 5HD8C 1OF2B 3MGAA 4CU7A 2AV1B 1TJHL 5DJ8A 1OAQH 2QDWA 1MLCB 2QQNL 5HHVL 5AD0B 2ZYHA 1PBYA 3MLUH 1E3ZA 4HCRL 4ZMYA 2B3IA 1LO2H 4NQDD 4PRHE 1MELA 1IGIL 4F2EA 2GAZB 1CXKA 2R0KL 1OZTG 3F04A 4XX1G 3IDNB 3TA4D 1ORQA 1BQKA 1GIGL 5A1AA 2D0FA 2EVHA 2WY3B 3ZYZA 3CBJB 5DUMH 4E42A 2EYTB 4M8QB 1URIA 5D6CB 1IAOA 2FX9L 4J2QA 2DI7A 4IRZH 5DYOB 3AUWB 3DTDA 4LXFA 1T5WB 2AFNA 2DY2A 4GQQA 1G1OA 1FG2A 1PVHA 3DX8B 1CL7H 3V4PA 1QASA 1HIML 4NENA 1CR9H 4Z7WA 5LHDA 3VWKA 4IHOB 3RGHA 1MFMA 5AW0B 1SGKA 5C9JB 3FL7A 5IVOA 3RFZA 3KH3A 3IAQA 1E43A 1L6XA 1B9ZA 4F7CA 1MNUH 1QLEH 5EZJA 3HFML 3MLVL 1AVAA 2F58H 5HYJB 5HDWA 5E7BA 4D9QD 4DVRH 4OAWB 3SHSA 3HC3L 2WLLA 1NGZB 2NY4D 1TT6A 3QQNA 1RJYB 3UAJA 3INUH 1VPOH 4DAGL 1A3LL 2VDQH 5SWSD 1QNZH 2B59A 3CZEA 1DUZB 4YUEL 2Z0BA 1ONQA 5FFOA 3GRBA 1AR1D 5LDSA 3HB3D 4X5LA 2ESVD 1OQXA 4JM2C 4M8VA 4PV1C 2QGBA 4LT7A 3DRTA 1MJ7H 2O6PA 1RZGA 3BDYL 1YUKB 1Z3GH 4GFXA 1NUGA 4N0FB 1G1CA 3WYRA 1FAIL 1BVOA 1ED3B 3FUFA 1UUSA 2UZXA 3KW7A 1QR1B 4DZBB 5HI4D 4OFVA 1M7IA 1PZDA 3EG9B 4X99B 1JS4A 4GW4B 2V8LA 3TT3L 3UACA 5EUOB 2NZIA 3W0WD 1DYZA 4QF1A 3VM7A 2VDKH 4HGKC 1DQDL 4YGVA 3QPXH 2BCMA 3QJHB 3TV3H 2KS0A 1BSIA 1NSNL 3S2AA 3ZYIA 2AEPH 3H1ZA 3IMSA 5BV7C 5F3BA 4KFMA 2R0WH 4WI9A 4UZUA 4D2NA 2HFTA 1R5IB 4MJ6A 4Y4FB 2ZWZA 4U6XA 1U8KB 5IVXE 1BVZA 5F9JA 2Z7UA 4JO1L 3MBEB 2ZUSA 5AZ2L 1HHHB 1IM9D 1R5VA 1J7VR 3S4SA 3ZUCA 3TN0B 2Y7NA 2R2BB 1Z5YD 1QBML 5F1OB 3HZMB 1VLXA 3KYNB 1TTBA 4AMWA 2D7NA 1EMTH 4R26H 1PEWA 4K3EL 4EN2A 1ZHLA 1GC1H 4KAQH 3BDXA 2FK9A 2FJGA 3V4UH 2DBLH 3IPFA 4LGRB 3HR5A 1HHJA 5D4IA 1A3ZA 3EGXA 5D4QA 3NCYS 5SWZA 4N8VA 3BXNB 5ICUA 3D34A 3N85L 2NZ9C 3GJFK 3N1GC 1JF6A 5L9DH 1F6AB 2R4RH 1S7SB 1KYOJ 5KJRH 3CDZB 4WVRA 2ED6A 3U0PA 4S1DC 4FLQA 5JLZA 2AJUL 3E9UA 4D9LH 3KYOA 5MEND 3MNVA 4ZO8A 5T1KA 2VC2B 4JHAL 1CFVL 4BE6A 4FQ1L 1RPUA 1G6RL 4AH2A 4P99A 5F70A 3GB7A 3K91A 5GZNA 1CGTA 4GLRH 2WUCL 1JI1A 3WI9A 1LTXA 2R83A 5AL8A 1SBSH 2OR8A 1SNRA 3FTZA 5HHNA 1CXEA 2CDGB 1RY7B 2WB7A 4OCRH 4EIGB 4HGWA 3RIFF 1IQDB 2LLNA 3V0DA 2ARWA 1M05B 1ZLWH 3UZQB 3MV9A 3ZQXA 1EDYA 3O4LE 3P3TA 2VLLA 5IG7B 1OLLA 3LKPA 3NZHL 1DTUA 4FKEA 1UWXH 2X0VA 1DVUA 2BSCA 1Q1PA 1UZ8B 2Y69B 2PYEA 1RUQL 5L88L 3A23A 3UADA 4QTHA 4IEFB 3O6FD 3C87A 1KV3A 1L0PA 3O9WC 5AYQA 1ZLSH 4ONFL 4LVOB 2TRYA 5EEZA 1WA0X 1XXDC 2D7OA 1PLBA 2JKXA 3AS3A 3QDHA 4YFLI 4NP9A 2ATKA 3W9EA 4H7VA 2QQLH 4M8QA 2ZF8A 1TPXB 4Z7OB 1Z5HA 4OJEH 2OKMA 2BVQA 2AK4D 1KXQA 3QJVB 3ECBB 1A6WL 1J0IA 2FEEL 1LXMA 2WZAA 1SN5A 5HSFA 1PG7L 2C9XA 3NFNA 3KLSA 3QWRD 4CC4A 4YDIL 5FECA 1EHXA 4OJYA 5CJ5A 2YLHA 4QRTA 4WY7H 4WW2B 3RDTD 4HMEA 4HXBH 1Q94B 4AK1A 3NJMA 2ALAA 1Q72H 1WAPA 4RAUA 2AQ3A 2BHZA 2DS4A 3F6LA 4ZMWA 2N0MA 4EXPX 2WQSA 5ICZA 3ULUE 3M1CA 3Q8BA 4XP9L 1GC1L 2WXQA 2ROYA 1WIUA 5JZ7D 3BN9D 3RHWK 7TAAA 2AJVL 2Q76B 4ZPVB 3HG4A 1SVCP 4E0RB 2P8LA 3PNWA 1B0GA 4PJ9C 2IAMD 3IDJB 4GRWH 5FYLL 1SJEB 3WXWL 3ZTJG 4PJFB 4CDHA 4PG9B 2F53D 1FHNA 2ILLA 4HMDA 3KL5A 1MAKA 5D6DC 1DLFH 4WEUD 3KPNB 4KKBC 5CUSH 5IJKC 1OM3L 4AGLA 4EI5B 3H9SE 5KBDA 1MJ8H 2NYYC 1ORSA 1TFPA 1UD2A 3JWNE 4XXDA 1P84K 5I1CH 2B9BA 3HTLX 4PP1C 5AYUH 1PZ5B 1UXSA 1NEPA 5CSZB 2G2NA 3CH8A 4TQIA 2DM2A 5C0GA 3U0WL 3VFNB 2V5MA 4NT6B 5HDLA 3RWCB 5EEUA 3VYOA 4EDXA 1M9WA 2ZPKH 2HRGA 2ICWB 4Y19A 5J6GB 1BM3L 4YH6A 5TQ0H 2QSCH 5H94B 3H6JA 4P46C 3TWCH 1FYTD 3M86A 1LEIA 1PLCA 5ECGA 2Q10A 4N0CC 5GS1B 2AMGA 5CD5C 3IJHA 1VADA 3SPCA 5IUSA 5F8QC 3ZHNA 5D2NA 4BH8A 2EUXA 1Z32X 3Q3GA 1M57B 1JXJA 1KEGH 2AXGA 4Y7OC 5IW6A 5DQ9B 4KV5F 2EO7A 2Q0ZX 3PGCA 2Z4QA 4RWYL 1I7ZA 1UYWL 2ZUVA 1J1OL 4XI5D 1HWWA 2VMJA 1IFRA 4KX7A 5KTEL 2W65B 1U3HB 1QVOA 4LSSL 1CFQB 1ZT4A 1ZHLB 3NIGE 3GFUA 5I1DA 2CUAA 2F8VA 1OCZB 1P5UB 3KPLA 1FC1A 1W8EA 4FXKC 4MTMA 4TTGA 4K7FB 2UZYA 5IZ7A 1Z9SB 1JYVA 4FCAA 1T03L 3RWFB 1SYSB 4GXVL 2WTPA 4XCYA 2OL3L 1JK8B 2UWEA 1CUOA 4IKKA 2BSEA 4UDTB 1FH2A 5LG1A 4C56B 4EI6B 1X5JA 2A6JB 3KPPA 3D18B 3FU8A 2VXQL 4ODUB 3SPGA 4R90H 4EPSA 3PIQB 4MXQC 4HUVB 5T1DH 3HEIB 4KXBA 2CKBB 1XCTB 3FN3A 2JI1A 4ZODA 3LQAC 4YLCA 2YD9A 3RVUC 4E9SA 2FT8A 2ZX8A 5DU7A 1M9SA 3WNMA 3CHPA 1OAZL 1FVCA 3MR9A 3LKOB 2XWRA 1FZJA 4KI5D 3TIEB 3NIGF 4C55A 1DVXA 5TF1H 2OSWA 2HT3C 1EZLA 3NSDA 4I0PC 3TO4B 1YMHB 4YC2C 5D71H 4U3XA 2H47C 1YEGL 1EV2E 1QI5A 2FH6A 2XY1A 1IO4C 3DURA 1YECL 3VSTA 2IDSA 3EGDB 5G4MA 2G60L 4K94C 1HKLL 1RSFA 1JZIA 1NGYA 3RBSA 5E8OA 2RMNA 1AJ7H 2XTJD 2VO5A 4GG6F 2I26N 3ZQ9A 3MLWH 3T0EA 5GGRB 2CDEA 2VSMB 3L5IA 4GG6B 4FNLH 5LBSH 5AZ2H 5IFHL 1A02N 1RU9L 1RJYA 1F2QA 1Y1UA 3O9WD 2DMHA 4Y2OB 1QBMH 1TQSA 3J7HA 4U4BA 4LIQL 2PR9A 5FW7A 4FTVE 3RU8L 2QSCL 2X4NB 4IRJA 5E0QA 5BJTB 4E5XG 5D1XE 2OMBA 1T2QL 3ZDZB 4G8GD 3MSPA 4J3OH 4YPGB 1B2WL 2APBA 2UY7B 4ZPTA 5F7LB 3T0EB 3UGEA 1GMIA 2PP8A 4BFFA 4EIZC 2H6UA 3FTXA 5GRVL 1A6UL 1MHPH 3WTYA 4QRPA 5I82A 1U92A 1MVYA 4B9FA 5HGBB 3UERA 1WHOA 4OY9A 1U6AH 3A6BH 4LHQB 1AGBB 4YFDB 3AU1A 2NXZD 1BAFH 1F00I 1SLXA 3HKFA 2OQJA 4P04A 3BEWB 4LSRH 4F1SA 4WI6A 3CFNA 4R96A 4WFGD 5E56A 2VMEA 4R83A 1LE9A 5FK9A 3BW9B 3DRQA 1II4E 4Q52A 4AL8C 4OJCA 2AMUA 1I9IH 3PNWB 4F7PA 1KIPA 4JFDB 1DBJL 1LL1A 2GC4C 2EIKB 2VLRE 5EC2B 2C3VB 2VXQH 4PRPA 3UC0H 5KYWA 5MEPA 4I0PB 1NJ9B 3BT2L 4K3DL 3TO4C 1D5IH 1KTRL 1X6NA 2HKFH 1JZEA 2CQVA 5K9OB 3BSHA 2AP2A 4GXUM 4YZFF 3S35L 3TYGH 1X5MA 3WG7B 4XC3H 3UBXB 3MBWA 4DGYL 2GT9A 2FX8L 1UWXK 1A3RL 3KBEA 1N6QL 1KB5B 1W72H 4DPAX 1XF2B 4WU5A 1T1ZB 1EUTA 4F91B 4PIBA 2P5WB 2JQAA 3ESMA 3MRNB 5A6IA 5DFWH 1P7QA 4JG1H 1BQLH 3LD8B 1L4IA 4GRWB 3HMWL 3DOSA 4TNEA 4OI7A 5EPMB 3E7JA 1VADB 3KJ6L 5J06A 1YN7B 2XTSA 2VJXA 3FB6A 4P2YA 5IMKB 1CI3M 2NY5H 2OX5A 4OF6A 3JTSA 5TFSL 2PXYC 2NXYB 4QRRB 5E8DL 3UL4A 1ND0A 9PCYA 2VXVH 3DOHA 1WEJL 1TCRB 2C7UB 3GXTA 4ANWA 3V4VA 2FGWH 4XC1L 1IBZA 2FIKB 3RVUD 2R23B 3QG7H 1LMIA 3VTAA 5LO7A 1HINH 1HWHB 2E7CA 1OTUD 4PR5B 4WY7L 3ZN6A 1TQBC 3CVCA 4IYKA 4YO0A 3VFUB 4P48A 1DUYB 2ZG3A 3QCTH 3QPXL 3QZMA 4UT7H 3MODH 5IF0A 3BPOB 3P0VH 3MLTA 5EPMA 5E9DE 2YPKA 4Z9KB 2FNWA 4AMKL 1RIHL 3P0YH 4IQHA 5CEZL 5EZJB 5TDOB 3VSQA 4JN2B 3BOVA 3TESA 1S4IA 2AJYL 2ITDA 3L3JA 2F53B 2WQVA 3WCYA 3DX7A 5BVPH 4I8DA 1WA2X 4WHTA 1ERNA 1BVKB 3BGMA 1G5AA 3ZE1E 5IMLA 1QFOA 3E1ZA 5DJ6A 4BZ1A 4JR9L 4EIUA 4ZMXA 1QSEE 3EJZC 3W9EB 1G1KA 2XXGA 2Y2YA 3GIZH 4XVOA 3X13B 3V6OA 1P4UA 2WLIB 1D6VH 2I5YL 3ABKB 4A67A 4BFRA 4OLYL 2P44B 4RWHA 1ZDSA 3G6AB 5ILTH 1UJ3A 1PKOA 2BVOB 4PRAB 1HQRA 2OW7A 2KLRA 4BJLA 1EUUA 3UMTA 4I9XA 4KRPB 1ZPUA 1KG0B 4AIOA 4L8CB 5E6ZA 3QS3A 4EDWL 4WW2A 4MMXA 3A67L 5FYJD 1XGUA 1R9FA 1JZ7A 1R3KB 1QRNE 4ZI8A 1NAKL 3EF4A 4HS8L 5MENB 4YEEA 2GJJA 3B2UD 5IV2B 4K7FA 4FQIL 2WXKA 4LCCC 4NDMA 2GSMB 1SLVA 1EERB 3MRFA 4TVPH 2E4TA 3WFBL 4BDVB 3SQBB 2VDKB 3ZKXC 2WUCH 5D2LA 4PRAA 4OFDA 2HUHA 2FQGA 3TVMB 4DP2X 2ZSVB 1AS7A 1GZHA 4GQ9H 1RZJC 1NPNA 1O7VA 2XFGB 2OMZA 2PMZA 3NFSL 3B8SA 5BMFL 3S2CA 35C8L 5T3XD 2ZCLH 3HG1A 4OGQC 4HJSA 4WUKH 1OOWA 3QXAB 5JHLH 1XH0A 3WNLA 2WTRA 1EO8L 3BPOC 5GGTA 1NOFA 5LCVL 1QHOA 4HIJB 1XBRA 4NDMB 2RQEA 4N0UE 3GIVA 4JRYA 3RA7L 4HUKB 1YA5A 4NZ8A 1TTCA 2J5WA 1AYOA 2YQGA 4PJ7F 1CF8H 5I76A 2NY2B 2GBTA 4IIZA 5DHXB 2P9RA 2PWEA 2HTKC 4I4WA 1M71A 1CGYA 1OQOA 4KTDL 3OSVA 2R39A 4JAMA 3J07A 4LLMB 1LE9B 3NIFE 4PWHA 4AE1A 4APQD 3TT1H 4LOEA 5DJDA 5FFGA 1JRHI 3FU3A 4JDEA 2QQLL 5BO1H 1EPFA 1QZNA 1NICA 1S7TB 1U30A 1UM4H 2J43A 1JGVL 4P8QA 3O6LH 3KVPA 3PAYA 4HYTB 1SPDA 1WIOA 4M5SA 3CCHB 3Q13A 4G43A 1SXCA 3RKDD 4K94H 4MD4B 4GQZA 5DK0B 4NC1E 2YHGA 2AK1H 4Z3FA 3QAQA 4KKCD 1T4KA 2AXFB 1DP0A 4Y5XC 3AM8A 4WI8A 1CPUA 4Q89A 2WXNA 3FXIC 1JTTA 2DKUA 4IRJC 4WKZA 4X2UA 4ECNA 3BHBB 3FPXA 1QD0A 1M05A 5FYKU 3QH3A 4NQCA 4PJHB 5EMYA 2DEYX 2NQDA 2KDYA 2VDLB 1A5FL 1HEZB 2NOYA 1D6VL 4NS0A 3ARDA 5FLUA 1EAOA 2YRPA 1JCVA 4OVUA 1CD8A 5EUKA 3FO2B 3LEVL 3B2VL 1CXFA 1P4IH 1Q0YL 1QYGH 1NEZG 2QQKH 3KS0H 3IXTB 1ZGLP 2A9MH 2ZP9A 3ALXA 5IQ7L 3FT2B 4LSTL 4YSCA 3T0EC 4PJAF 2K9FB 3V4PH 4X6CF 3RRQA 4Z78A 1XB3A 5DRZA 3DMMB 1FRGH 5LGHH 5I1GL 3N41F 1H5BB 1VESA 3DIDA 4P23C 3O9WB 3CQPA 3I6LE 3V52L 1BQHA 5HYEA 2ITFA 2C4XA 2F54B 3IWUA 3Q01A 1F0LA 3HZYA 3UTSA 1T89C 2BRRH 2IQAB 4CJ0A 3MNWB 2JB5H 3ARDB 3TO4A 1XR9B 1F5WA 2SEBB 4HLZH 4Z7WB 4N90E 4XBGB 1HHKA 4P9ML 1WCQA 3GMMA 3RIAF 3WO3B 3MLZH 3AY4A 1JV2A 1BECA 1G6VK 2DYRB 2WUBH 1WZLA 3OR7A 4PGZA 1SUHA 4PJ5A 5EORL 4UT6A 3RUGE 1UOLA 2HT2D 2OSLA 4DZ8A 1BZ8A 2HJFA 3BKCH 5DQJB 1HAWA 3V7AE 2JF1A 5DZOA 4HJJL 1FL6A 5GGQH 2Q8AH 1DBJH 3OLGA 1YSOA 3RY5A 4UOW1 1KJ2H 2HN7A 4QTIL 1J0YA 4YSRA 4Q2ZA 5AVVB 1ZWIA 2L04A 4WUUA 2E9IA 2EC9U 3TH2T 1A3QA 1M3JA 4HOMA 3KH4A 4GSDH 2ZKWA 4YSDA 4EBQH 2OJZH 5EWIH 3CFDB 2QADD 4JFDD 4KKRA 4KITB 4FQXB 1TJIH 1NL0L 4IRJB 3PCYA 1E9QA 4ZW7A 4ZQKA 2YEQA 5LNEA 3SKNA 4G8IB 1DVTA 3P77B 3QQ9C 4GFTB 4U1LA 3K2KA 4I0PD 2QMKA 3ZL4L 1DDHA 3T8XA 3DXAA 1JG9A 1N3NA 3VE0A 4V1DA 1FNFA 1G1YA 1NM9A 1BQLL 3L6FB 4K94L 1TTUA 3FO0L 2PXYB 4X6DA 1VCAA 2DWDA 1MFNA 1R3KA 4WJKB 3EF7A 4JKPL 5DHYA 1AGBA 3GTNA 3MOBL 2A9AA 3GMLB 3MN8A 3VO0A 2IPKB 4ZSOA 1MHCB 1I7RB 1S7UA 4LCYA 4QHUA 3WLBB 3S88H 4L0ZA 1DVFD 2XJLA 4FFTA 1BQRA 1AZVA 1OE2A 4UT9L 5IB3B 4ZZFA 3IJ7A 1D5XA 2A9CA 4MRBA 1SHXA 3RY4A 3ISYA 4BFGA 1HCZA 4PVBA 5IW6B 4ELME 3KHOA 2J2ZB 4PI2A 1OM9A 4YXKL 3VSUA 2W65A 2PO6A 5GGVH 1YECH 4FHJA 4BZ2L 4W9FC 1AGCA 1JNHB 2J4WH 5DJ6B 1HKLH 1EAJA 1RK0B 1JPGA 1XGRA 3CV5A 1P5UA 1JWSA 3KPLB 1T66C 4J8RB 4AIZA 2FO1A 1H3UA 3ASOB 2QDVA 1G9HA 3HRZC 3V6ZA 1A14H 2ZIDA 3VXQB 4ZX6A 1SFHA 4XNUL 3ZIYA 3T4AA 3V9FA 4U49A 4YDLB 4OI8A 5JOPE 5EZOL 5B4MC 3OZLA 4J6RH 1TO4A 4AV4A 4OCMC 3S5LA 5FFLA 4MKMA 3P73A 3S3DB 1D5BB 3WENA 3SKOA 4I18C 4ODXB 4MASA 3SYQA 4XPAL 2KHAA 2J73A 5AW2B 4UOW0 2WUBL 5EORH 1I3VA 2CGYA 2GK0B 5I1AB 1C5CH 2VXTH 3L4CA 4WSJA 4DQAA 5E4EB 3IDYB 3ULVD 5ILTL 4FG2A 2EDQA 5C6TH 4KKCC 4KJPD 1A6AA 4KH2A 3QNZA 4HX1B 4MXWH 4LRNH 5E1AB 3QO1B 1CL7L 3C12A 3GK8L 3L17A 4ELKA 2B1AL 1ZTMA 1OIOA 5ELIA 2M1KA 1CTOA 4IRSB 2NR6D 1SJHA 2HWZL 3FFOA 3OM3B 3FHEA 5BRPA 1HILB 1HZHL 3LXCA 4G6ML 4FQPA 1VEMA 4MZ2A 3WMPA 3VQ1C 3MLVH 2J3SA 4KK8C 1MRDH 1NEZB 1WISA 3PRZA 5F93C 2AABH 2ARJA 2DI9A 2IV9A 3RAJH 5FC9A 3SDCC 5E03A 1QSED 4JFED 2HVJB 4YHYC 2OW6A 3I50L 4PP1D 2YPVL 5L8KB 4KK6D 2IQ9H 4XMPL 4F7MA 3LSOB 2A9NH 1MG2C 4IMKA 3REWB 1JNLH 1HS6A 1T04A 1OCCB 2GJZA 1L0QA 5BXFA 1KCBA 2P26A 3CN2A 2XWBB 3TYGL 1N6VA 4XNYH 4TSBL 1K8DA 5DUPH 1AQDB 4M7KL 3LS5H 3ZDYE 4K3HA 1QFWI 3HBGA 4ZFOB 1C7TA 3BPLC 4YVUA 2J8HA 2EDLA 2FECI 5EC1B 5CFHA 5C0CE 3A6OA 3FUNA 3TT3H 5DD0L 4AJVA 4XPFL 4DKAA 1BZOA 2WOYA 3GD1C 1S7RA 1EVUA 2OQJB 3OBAA 4UQ3B 3VXME 4ABVA 1INDH 2HJFB 3UDWA 2JI2A 3DGDA 2EDWA 1HQ4A 5A6MA 1Z9PA 4NZFA 4PJDA 4DTGH 3RVTC 4RZCA 2Q76A 1NBCA 1JZ3A 1WEJH 3MUY1 3OPZL 4M8RA 5F9OL 2NYKA 2FUTA 2Z34A 3I2CH 1KC5L 3GSNL 4LSPH 5T3XE 2EO9A 3FB8B 1QFHA 3ABZA 4M4PA 5DZVA 3JV6A 4YHNB 4PQXA 4R4ND 5EC2A 1AMYA 3HB3B 4J3WA 1GW6A 4IOFC 4GW1B 5CJOH 3H2PA 4LVHB 4UQBA 1NGWA 1XO8A 1N2RA 4L3CB 2DEXX 3OGCA 4GKSB 4L37B 5D1QE 1CFTA 3NA4A 4UOQA 3SKNB 9CGTA 3FZUC 4IRSC 3VFOA 4LDOB 4NQCE 3C6SB 5KSBE 1L3NA 3FQ1A 2YPVA 5ADPL 1CFSA 3WTWA 3ALWA 2BIQA 4E9QA 1W0YT 5B21A 4XOEA 5D9SB 3TA3C 3BP5A 3D2TA 1T1XA 5ICYA 4I85A 1H3TA 5F0JB 2A73B 4Z8FL 3FSOA 1LP9E 3MUZ1 4ZUTB 3O8XD 3IDIA 5KVGH 3LZRA 2OX5B 2NUPA 4KJWC 2UZXB 3HPJB 3QYCA 1ETZA 4MMXC 5DJDB 5BS0D 3V0HA 2FWUA 3VH8B 5IEKB 3WS6A 2HTLD 3EKCA 4DP8X 1KXHA 5HGDA 3C8KB 4EIBA 1S78C 3PHQA 5GGSA 4CC1A 5CEZD 4M3HA 3EXLA 3IU4L 3N3EA 4FFYA 3JWNC 1Q9LA 2GQHA 3H3KA 4OT1L 1E5BA 3KE0A 4M93B 2C3WA 1X9LA 1DCEA 4F57L 1KGJA 3FN0H 1MG3C 1QSFA 2X9XA 3VFUA 4OCRL 4RFEB 5I6PA 4AT6B 5C1MB 5HVGB 3VWJB 1J1XH 4FG0A 3L3KB 1UM6L 3NQIA 2WBJD 4KVCL 2ED9A 4KKBD 3FO1B 3EH4B 4N0RA 1UEMA 3V0AC 4X5PA 2GSIA 4ZQTA 3S4SB 1BGXL 4ZDHB 3TO2A 2FD6H 4Y88A 2ZUUA 1MWAH 3L16A 5CIPH 2OYLA 5EO1A 3FO2A 4GSQA 4X9YA 4WI2A 1T7ZA 3I9GL 4G3YL 5AAMC 1JPST 3PE9A 4RFEA 2HH0H 2A4ZA 2DLTA 2UXFA 2EXYD 2XKNB 1KXTA 3BP4A 4DWHA 4KWUA 2YD2A 1GGUA 3KPSE 3RKDC 3ATAA 4HP5A 5HI4C 3VB9A 3JT0A 4ESKA 5JOFB 2F54A 4NYLB 5G4NA 3CDYA 1R24B 1AC0A 1RULH 2FEDC 2JJSA 4JFPB 1PD0A 3CG8A 4YGVB 3LZNA 4TL5A 3ATEA 3M1BA 3OJMB 1MEXL 3BH9A 1UGKA 3ROOA 1FAIH 5MENA 3QAZB 3EJZD 3C6LA 4ZFGL 4KNSA 4DZBA 4RQQB 1U93A 1I7UA 1P53A 2EKSB 3IMVA 1A6VL 4WU7B 3C60B 3N1PC 3P4MA 3QIUB 4XBMA 4CL7A 2VE6A 1BZ9B 3GINA 5DO2D 2BHFA 5BPPA 1LK3L 4YHZL 4FXKA 4G82A 3TV3L 2PP9A 1QRKA 3CXFA 2CDFA 3EYSH 2PETA 3VFTA 3NFPA 3K3QA 4HZLB 3U2SA 3MJ9H 4LOUC 1FAKT 2X6VA 1DFXA 3QUML 4FX5A 3D2UD 1A1NB 1OM3H 5C71A 1HYRC 1RJLA 4JM2B 4H25B 3U7YH 1MJ8L 1IVLA 5I28A 4RMWA 4JN1L 4RA3A 4H5SA 3CDGA 4OZGE 3EYQD 5K9JL 4PUBL 4PJFE 2ETWA 1VERA 5DZLA 2WXLA 4IOFD 4HIIA 4B60A 5FF6A 2BX5A 2P5ED 3MLYH 4Q8BA 1I3RA 2WYHA 4MNQA 3RWDA 3NEOA 2HPTA 1SVBA 1KNOA 2PYED 2M2DA 4WI3A 3WD5L 4GQPH 4FYSA 5KANI 1P4IL 1Q0EA 2EUVA 4LAQH 2K6YA 3O6FA 4NQQA 4LPWA 3ZTNL 1OGPA 5DWPA 1KELH 2QJDA 2E27L 1E3FA 2Z9TA 4NCDA 2VUOA 2CU9A 1A2YB 4PW3A 3TNNB 3VFGL 5J12B 2OV0A 1DN2A 3VFMB 3QFJE 2V7HB 2YAMA 3ASNB 2BIMA 2XACC 5C0RL 4IU2B 4P57A 5GRUL 4QRFA 2HFFA 4Z7AA 5I8CA 1OARH 5DC0A 2DWSA 2M83A 4IW4C 1IC7H 3GK8H 5I1EL 5IWLA 1YRKA 3OZ9H 5ADOH 2YD6A 4HJGB 1NKOA 4IBTA 5JORA 2DYPB 5J1SC 4MD5B 1OE1A 2FDBP 1ZJBA 1YLBB 4Y4KB 4CNIA 5J5EA 4O02H 4GY4A 5TDNB 4YBQD 4Z7QB 5D9SA 2K6ZA 3G6DH 5G5DA 1IGYB 3AW5A 4DPBX 1Q9KB 2VXSL 3EYVB 4J1UB 4QHLA 3D08A 4TS6A 1D5MB 1OGSA 2DQCH 3S97C 5GPRA 1HHGA 4MLIA 4C54A 2C1OB 1MFAL 3SKOB 5CU5A 2R2EB 2C7UA 1E4KA 5I1GH 4BKLB 2HTLC 4H2CA 1S46A 1MAML 1A0QH 1OSYA 3HOGA 4GW5A 4JO3H 4FA8A 3X12B 4OVVA 1VF5C 2DQJH 5D8JL 3OV6A 1IEBB 5EZPA 1MLBB 4JVUA 2QZQA 1C5BL 2ICWA 4Y19B 4MVBD 5EHFA 2FO4A 5CR1A 2J6EL 2EYSA 3FQTB 1DQKA 2XNAA 1GR7A 5D71L 4R5VA 2OTUA 3V5HB 1IC4L 3QI9D 3CUPB 4S2SB 4Y16B 1T5XB 4XCFL 2YPKB 3LRMA 3QWQB 4UQ9A 3BAEL 4MAYB 1CICB 2FRGP 3CX5K 3FJTA 2Z1PA 3R0MA 4AYFB 4LLYA 2HLAA 1IGTB 3MRGA 3DX7B 1DVFB 3CFCH 4R97B 1B0WA 4P4KD 1UCBH 5C07A 4E9YA 4L5FL 4LNRA 2X2UA 4ELMB 3GBNL 3QDGA 3WEXB 2P8LB 4Q2ZB 5F7YC 1ZS8A 5IFHH 1UB6B 2IXQA 3B8YA 3FUJA 1KFAH 1G9MC 3ILPA 1FNGA 2HB0A 3Q6GH 3HJ0A 1Y6KR 3BPNB 5T5FL 1DEEA 5HVFB 1DVZA 4ZNEA 3OB8A 2FYVA 2WWMC 3F7VB 4KKQA 1CD1A 1W2KT 4M3KB 1LO4L 3G04A 4W93A 1SYVB 3ULVC 2BZ7A 43CAA 4OGYL 5C0NC 4ICXA 2H1XA 4J12A 3JWNG 4B9KC 1E2ZA 3MO1B 3BD5A 2VT0A 4ZMLA 4OZGA 4M62H 2BSED 1C08A 1ETB1 2PXYA 4BSWA 2R0LL 3DVGB 4JFWA 2CBPA 1QQDB 3B2XA 5JPNC 3Q9QA 2C9UA 5CMAB 4IMLB 3QK0A 1OCWL 2ID5A 4N2FA 1U93B 2NY5C 2X4PA 2Y1VA 3L3KA 4GS7C 3R7QA 1ZHBB 1QHQA 5L7XH 2OPCA 1OOAA 5TH2A 4M6NH 5FHBH 5HHOE 4NBYB 3QNXA 4HDIB 4LSDA 4FQQA 4KQ4L 1WIPA 4K8RD 1DJZA 1LYQA 1M4KA 1ACCA 1DVYA 1NCHA 1QTPA 3QDMD 5IP4A 4WWOA 1U8NA 4ALAL 4IU3B 2W07A 1FZOB 1NGXA 4KJQC 4WGKA 5C07E 4ES9A 3A6CL 3US9A 4ANKA 4U0QB 5K59E 4GINA 1UQSA 7PCYA 3CFBB 4AG4H 1V27A 3O45A 5CMAA 2CDEB 1KLUB 3QEGH 4F9PA 1MCWM 3C9NB 1KPUA 3FOMB 2Z93A 3II1A 3FTVA 3H53A 1N6QH 2DQJL 1XF1A 4A7QA 3KPSA 3OG6B 1AGFB 2JSFA 2EDMA 2YK1L 3RVXD 4AEHH 1IVTA 2X1QA 3EFOB 3GI9H 1E6OL 1MUJA 4KDWA 4A2FA 3C5SB 2IQ9L 1UA7A 1H3GA 4IHOA 2AEOA 3C08H 1U2HA 3HPLA 3CVBA 3ECQA 4HKJA 4BXVA 4J7RA 3CFBA 1U8KA 1IEHA 4NO2A 3IBOA 4DH2A 2GITA 1R34A 2Q3AA 4TNWF 5H37H 1KPUB 3FOMA 3RWEA 5DJAB 1JWMA 3VSVA 1UA3A 4PJIB 3APMA 3MV8A 5EU6D 1D9KA 2EADA 2FEJA 2QELA 4YBHA 1ONQB 3K1KC 3NIFB 3PGDB 4L8BB 4WHYG 4DPRA 5A7EA 2PR4H 1FVDA 1K6QH 3FCSB 1NCDH 4LU5H 3UG3A 5I1LA 1BOGA 3ET9F 3QCTL 2Y07H 4X7EC 3Q6GL 4PY7A 1INDL 4G8FA 4YHOH 4NO3A 4O02A 1A6PA 4HKJB 3LZFH 5HHQB 3KPRD 3BN9C 3KPRE 1I1FB 2V2TA 2FLRT 4W9LC 3W0WA 2ENJA 5FYKL 3OPZH 1WK0A 3H42H 1Q4NX 3GHEL 3KWWA 4MNGE 5DD1L 1O9ZA 2ZD0A 2J1ZA 3H0TB 1TKWA 2OJEA 5D1ZD 4OZHE 4HA1A 4R5XA 2R8SL 3RVWC 2J1KA 1I7ZB 1I3GL 4FQHB 4F7MB 5DRWA 2OFQA 3MZTA 5AVSB 3WIHL 2GIMA 2XKSA 3TS8A 3CSFA 3AM8C 1OGTB 1PKQA 4KJWD 3CH1B 4DF9A 1SVZA 2XVBA 1G94A 2DQGH 4HC1L 3BRFA 1G7IB 4N86A 5E8EB 1MCJA 4HOXA 3O6KL 3UBHA 2APXA 4GP5B 3NDZE 3VG9C 3QIBA 2ZOLB 3QIWA 1ETA1 5FGCB 2NSXA 1W16A 1JK8A 2UWEB 2WK2A 3OF6D 3D2UB 5IWLC 4KQ4H 2XVLA 1UB5B 4W6XB 4XRCB 4WJ5A 3IMBA 3K5RA 3OWEA 1WT5C 3L95A 4QXGH 4BKTC 5DRWB 5C0ND 4MB4A 4EDWH 2FECL 5I8OH 3ELQA 1YYML 2PYEE 1GTNA 4OIIH 3LV3B 3FCTB 2VUKA 5IESH 3F01A 2ZICA 3UYRH 4FYTA 5B1KA 1RUKH 3NIDE 3UAFA 3JV0A 1KJMB 1Y6MR 4PJDF 1E3XA 3BYYA 1PZ3A 4PJAB 4DN4L 3QRFM 2YN5A 1HZLA 3WFBH 1E2WA 4QHNB 4AVHA 5G5DB 2QBWA 3BRDA 4ZD3H 1U6AL 1TQUA 5HYJE 4HT1H 2PTUA 2HP4A 1CC3A 2D0GA 2LVCA 5DHVA 3GO1L 2CJSA 1OXYA 1GS8A 1H6UA 1E6OH 1NGWB 5TDOA 4F58H 2Z8RA 2R56H 5HP5A 2J88H 3VWJD 2CWRA 5JW3H 1CGUA 1NCGA 4O02L 3CFIC 3TIDA 3RGVA 1WQVT 1ZVSA 4XMVA 3FCTA 4AH2B 4UV4H 3QPQC 3TZVC 2WSKA 2WHVA 3RURA 1HSBB 4MWFA 1D5RA 5GS0C 4M61B 1UD3A 1CGSH 3DVNA 1RZQA 4M00A 4DFHA 4U31A 5CIPA 2VR5A 3AXLA 4H8QA 1COBA 4Y0GA 5DXWA 3TONA 3T3PF 1ITBB 3IJ9A 1VIWA 5MHSE 4PJCE 1CLZH 2JJSC 4NUGH 4NQDE 4PRHD 4KZDH 4OIAA 3TEXA 3AGVA 4MAYA 5SX4I 4DUWA 4FABL 4HWBL 2AGJH 1MVFA 1AE6L 4ERSL 3MRDB 3RFZC 4LLVA 3L3OB 2HT3D 1JUFA 3UTQB 1ZT7B 2WNKA 4RESB 2QGDA 3LKQB 3EH3B 1AXIB 5EOQL 5C0GB 2NLJB 3GQFA 1D5ZB 3GHEH 2JLLA 2X1WL 5FCUL 3VFRA 4IEFA 2ESVE 2NYZA 2EXWC 3MFFA 5F97E 4PGJA 3SKUD 1DUYA 1I3GH 3HBPA 5DA0B 1L5GA 2ZXGA 3BEVB 3BAYA 3VFVA 4XOCA 4TQEH 1E8YA 2DJMA 4FG6C 2WO4A 4HS3A 5CAYB 2BVQB 4WEBH 3D50A 4S1QL 5FW8A 2BZCA 2HG0A 5DVNA 5IBLD 3QWOB 2V5RA 4FLOA 1HZKA 1G7MB 4I3RH 1WWCA 1DCLA 3LAFA 5E2VL 3FCGA 1ZHNB 3GBNH 3RIFK 5AOIA 5F6HI 3UC2A 1AY1H 1CO1A 2E3VA 3DUSA 1MF2H 1IGYA 2NY7L 3MGOB 5CINH 3UJIL 5CZRA 3EYSL 3IMRA 2QQKL 3UG5A 2BDNH 1DQTA 5JNYA 3HRPA 3KYMB 2A6DA 1KTKE 2OZ4H 3B9KA 1SLUA 2O5NA 4M48H 4U6HA 5DMIH 5IQ9A 3V4PL 3EH2A 2FJSA 2N7SA 4MZRA 3SDDD 2KLSA 2ZP0T 4I1PA 4H4NA 4JRLA 4GO8A 3BSZL 2Z31A 5D7HA 5F89B 3MROA 4AQ8A 3D85A 1RUKL 2Q87A 2WQ8A 4GAAA 1GHFH 1L7IL 4NYLA 2PABA 5TE7H 3BKML 4F2ME 4YS4A 4GRWE 3MUGA 3MZGB 3GXPA 4L8DB 4CADB 5CP7B 3H9HB 4HD5A 2NY1B 4AXWA 4LAQL 4GKZB 4FFVC 3HMXL 2OP4H 5F6HJ 3BH9B 2FYYA 4RMVA 3DHJA 5B38B 4QCIA 4ZO9A 4FKKA 3A4AA 4KDTC 1UT1A 5KSBF 3VJ6B 3EJJX 1U2YA 1T3FB 1YDPA 5DUJA 3IFOA 3K46A 4UTAH 2E86A 1NANI 2ZKXA 3KGSA 4ZAKD 5C0RH 4G6JL 1AG0A 1XR8B 3CFUA 4UIKH 3WAJA 5DDHB 4QTIH 3MLSL 1TVDA 1IBYA 2DD8L 2P80A 2H45A 5HDBF 1RUML 2HLFD 5G2NA 4JG0H 3HRZA 3MPCA 3NCBB 4BFJA 3QCVL 3Q44A 4HS8H 3CN1A 1DBKH 1JF1A 1UD5A 3HPLB 3RKPA 4F37K 1WCBB 3OJ2C 5DMKB 5CCKH 2BSSA 4FZEL 1KDIA 5J8OA 3F7VA 3QDGE 3QXTA 4GG6E 2GUYA 3QQ4B 4J5VA 4D0DA 1AO7B 2MMXA 2XWDA 2WZ5A 3U4BL 2N1KA 3ES6B 4LLWB 4JFFA 4LMQE 1IAIH 4YDMA 3VXNA 4U6VL 2HFEA 4WJ5B 3IFOB 3DV4B 3SDAD 4K3GA 1CXLA 4DGVH 1VPOL 3ARDD 5DZ9A 4Y2OA 5BOPA 4DK3A 2OK0H 5AW7B 2Y36L 1ZVYA 3UEZA 4D0BB 2DQCL 3S5YA 1KGUA 5EO9A 1SDAB 5I9QC 1NUNB 5L0QC 1N0XH 5JA9A 1WA1X 4APQC 1MFUA 3MRJA 4GT7A 5I1JL 3DJSA 1KF9B 1PFOA 1MI5A 3DBXB 4OIFA 3GWJA 3QQ3B 4HEPG 4LQFH 1TPXC 5E1QA 3M1OA 3ULVE 2WKOA 2E8YA 1KT2B 3QRGL 2HKAA 4KGLA 1ZDQA 5KBKA 2JCWA 1YYLL 4LCWD 2ICEB 3NDYE 5GIRA 3M45A 5E6RB 3F84A 5DK0A 4N8CH 4ODUA 1JNJA 4BIKA 1XF3B 4D7BA 4CMMB 4R9HA 1M56B 1IGML 1TTFA 4XHQA 3LZQA 4FG4A 2AF2A 4WKZB 4X6CE 3BEWA 4Y16D 3DUUA 5B1BB 1B4TA 2CGZA 5SX5K 5BUAA 3HVNA 4ZUWA 4FADA 3SE9L 2XXCB 4WWID 2NTSP 3MCKA 3HHSA 2H32B 2BINA 4QRPB 4DSYA 2ADIA 1TZGH 3P3RA 5K33A 4MGXA 4YE4L 3DSNA 3LHAA 3C75A 5A6LA 1TVHA 4PJBF 4YXHH 4WGVB 3EYFA 4OF5A 4OZ4B 2LFGA 4M5YL 4KMQA 2ESVB 3V6OE 4OTXL 4UAOB 3SY0A 2IGTA 2QKIB 4HULB 1CDYA 4XTRC 1S7VB 1ZXQA 2X89D 1BMWA 2NZ1A 4HPYL 4XNBA 3FHQA 3NSFA 5I16B 4EUPG 2I69A 5D1ZB 2A0LD 4KAQL 3OB0H 2I9TB 5T1MB 5BVJB 4RLDA 3D4CA 4XVTL 2FWOA 1F4WL 1FH5H 3FQXA 3B2VH 5MEOB 1YYCA 4N1CA 4LPYA 3CZUB 1JRHH 2H5UA 3ULVH 3X1FA 1G43A 4HISA 2BOBA 3QEQD 3LQZB 4PREA 4YHMH 25C8H 4ABUA 3BYTA 3GSWA 3L8QA 4EMZA 3VFVB 2H9GA 2OCCB 1RUMH 1WBYA 2Y24A 5T1LA 1MXDA 1X5FA 2GVYA 3MJ6A 5TE6L 4F92B 3UTTD 3R06B 1IGCH 1KB5A 2J57A 3FF8A 4OQTL 3KCPB 4RH4A 3V5KA 5JHLA 1BLIA 1I7TB 5IJKA 3RFRA 2BP8B 2ARJQ 4BV1A 5KVDE 4XT1C 5DJ8B 3QUMA 3W2DL 4NJAL 4WV1B 4XCNB 2WPGA 4Z7NE 1HDMA 1NGPL 3GLDA 3B3BA 2IIJA 1QWHA 1HC1A 2R23A 4HJEA 1CVRA 2WVTA 4P9MH 3FQXB 3H0TA 4OCLC 3CLEL 1VFMA 4ALAH 2VJ0A 5MP6L 4J8RA 4JMXA 4QRRA 2EVFA 3ZKMD 2ZAIA 1CZ8H 2IAMB 5HDOA 5J13C 5KYXB 2VN7A 1YHPA 3F5WA 3EOBB 3JV4B 1JPSL 3T8MA 1ZT1A 1NFAA 4HJJH 4WSKA 5HGAA 3SJVB 4LHJB 4XNYL 2A6IB 3DTXB 3S9DB 1LHZA 3RL1B 3MLPA 5JW4M 4BFIB 3TYFA 3P3YA 1IC0A 1RZ7L 3LIUA 4ODVL 3LB6C 3WNIA 1JK9B 3HG1E 3MUHL 1MFEL 2OTWA 3QG6A 4EBQL 3A4FA 4A7SA 2FNBA 5K9OA 3BEVA 4PGEB 3FUHA 4ERSH 1VEOA 3SGJC 5ICZB 2NX5D 1J5CA 4KXZH 1FFPA 1DVQA 2DTML 3BUYA 4LDEB 5BV7L 2EE9A 2BY1A 4FKHA 4ALAC 5CM1A 4X4YB 1JFHA 5D1ZC 4MMYA 4TLTA 4MSWA 2A83A 3CSPA 2ZYIA 2QGCA 4FNPA 5KYYA 3ULUF 4CA4A 1JXGA 1QFWL 3TBSB 5D2NC 4PJIF 3O2DA 3OHXC 4JZOA 1Q1JH 1A64A