1ZXKA

Crystal structure of cadherin8 ec1 domain
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
98
structure length
96
Chain Sequence
SWVWNQMFVLEEFSGPEPILVGRLHTDLDPGKIKYILSGDGAGTIFQINDITGDIHAIKRLDREEKAEYTLTAQAVDFETNKPLEPPSEFIIKVQD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Type II cadherin ectodomain structures: implications for classical cadherin specificity.
pubmed doi rcsb
source organism Mus musculus
molecule tags Cell adhesion
molecule keywords Cadherin-8
total genus 18
structure length 96
sequence length 98
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00028 Cadherin Cadherin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.60 Mainly Beta Sandwich Immunoglobulin-like Cadherins 1zxkA01
4ZMXA 2YSTA 2OMZB 2A4EA 4AQEA 4OY9A 2QVIA 1NCIA 4AXWA 3FF7A 4XXWC 4ZI8A 4AQ8C 4AQ8A 4NUPA 4QD2E 1O6SB 2OMVB 4AQAB 2WCPA 1NCHA 4AQEB 4ZMNA 2OMUB 1OP4A 3LNHA 4ZMLA 3UBFA 2OMXB 4AQAA 5CO1A 3LNDA 2X2UA 2V37A 2A4CA 1ZXKA 2OMTB 4AK1A 4ZMVA 4NQQA 4ZMZA 2OMWB 3Q2NA 2WD0A 1ZVNA 3LNGA 4ZMTA 3UBGA 3LNFA 2QVFB 4ZT1A 4ZMPA 1FF5A 1Q1PA 2WHVA 3QRBA 4ZMQA 3LNEA 1SUHA 1WUZA 2YQGA 3Q2VA 4NUQA 4ZMYA 5KJ4A 3FF8A 5CZRA 4NUMA 5JYMA 4ZTEA 3K6DA 5JYLA 4APXA 4XXWA 3K6FA 3K5SA 3UBHA 3PPEA 5DZVA 1EDHA 4APXB 2O72A 3Q2WA 2OMYB 3MVSA 2WBXA 4ZMOA 1L3WA 1WYJA 2EE0A 4ZMWA 3LNIA 3Q2LA 1NCGA 4AXWB 3K6IA 3K5RA 1NCJA
chains in the Genus database with same CATH superfamily
1T6WA 3EH4B 1JGDA 5CSBA 3CBRA 1TQCC 3PABB 3S34H 1HKLL 3T0WA 4FQLH 4WI5A 2W95A 2DBLH 1C12B 2G3XA 1IAOB 2JJVA 4XPGL 4BQ8A 5I1EH 3QRFM 2EYSB 2IJ0C 2NY3B 3FF7A 2Y2WA 3VFGH 1FCCA 2EYTA 5EUOE 3OHXA 4W9HC 1R0AL 4GW5A 1B4JL 2XZAL 4JZOA 5HPOA 4NLHA 5IHHA 3GQFA 2AJSH 1KIRB 3V0WL 1Z9PA 4MGXA 1S9VA 4P23D 1N6QL 3LH8A 4CDHA 1S7QB 3ULUL 3AG4B 3SODB 4NNPH 2Y1VA 4TVPH 3EGSB 4QAWA 1E6OL 3OR6A 1YQVH 1YPZA 2NY7H 1U93B 5HHPA 3WHE1 3G5VB 1ZXKA 2EC8A 1HXKA 3UYPA 4HALA 4HOWA 4MQSB 3UYRH 5A16A 5IQ7H 3MJ7A 1BQHG 4Z76A 3ZKSD 2FL5A 3BJLA 5D7JD 1RFDH 4HDIA 1F56A 5JZ7D 4FA6A 1UFGA 4RH4A 4WUKL 5IIEA 5I66A 4AUUA 4PGDB 4KPHH 5JIHA 3BSHA 2QJDA 4OZHA 5IREA 4PJXE 3AWGA 1D2PA 3K74B 2TSAA 4X6EB 2Q86B 1Q72H 4BKLB 5E5UB 2D4FA 1HL8A 2CHNA 5FHAH 2PW1A 3MMEB 4WZ9A 4HIPA 4BM7A 4B60A 4FFZA 2J4WL 2XWBA 3DETC 5CBAB 2OYMA 2KI6A 4NPKA 4FKEA 3RNQB 4RGMC 1NSNL 1BD2D 1IGCL 2E5EA 2Y36H 3RWFA 2ZSVB 2WYTA 3E80A 3TFBA 1W2KT 4ZNCD 4JFDB 5I1AB 5DZAA 4G6AD 4NZRH 3OJDB 4HMDA 4X50A 4KDWA 2ZKHH 4FHBD 4X7EC 1VFUA 2X6MA 2YQ2A 3E3QC 4APXA 3AQYA 3DTUB 1VDGA 4PD4K 3T8XA 2EICA 1PNDA 3TVMC 3ZQXA 3BGAA 1HIMH 3APFA 1KWGA 5DZVA 3UGEA 3VXOA 5I30H 2BS8A 1KCUH 4A6YL 3SE4A 5GSRB 3S36L 4JB9H 4LIQE 3BC9A 2Y6SD 4P59H 1DVFA 4PJAF 1HSAA 4FP8L 2RCSL 1GR7A 3HE6C 4X7CC 2VLJB 5LGYA 4ZQTA 1PEWA 3QFGA 4FGMA 5BUAA 2X44D 2VM9A 4OD2A 2AV1A 3X3FH 2HTLD 2O30A 4Q6IA 3QULB 1XAKA 1V27A 3ZT7A 3GSXA 4LCVA 1Y0LA 5D2NA 2BCKA 4HGMA 3L3KA 5F96L 1T4KB 2UWEE 2ADFL 3BWAA 4PJFF 4G6KH 1T83C 4ELMF 2EKJA 3CU7A 4G59C 2FQEA 1ZLWH 3PCYA 4XN8A 3CZGA 5A7EA 4QHNB 2XA8L 3VXOB 4Q4EA 3GI9L 3OX8B 5EO1A 5E6IA 2E9JA 2YWYA 3IGFA 3JQOB 2FJFB 4OF5A 3AFLA 2JI1A 4S2SB 4Z5RB 5KYWA 2UXTA 1TFHA 4JJ5B 4UAHA 1TU2B 1MF2L 3DVGB 5HHXH 4O2FB 1DLFL 4NM4H 5D70H 4XAWL 1L0QA 4POZC 2YMXH 3B8YA 4J28A 2V37A 3JZYA 4QRPE 4DK3A 5C0RH 3IF1B 4TSBH 1D9KA 3HLKA 1JZ4A 3JV4B 3KPOB 4HJTA 2IAMD 2WTRB 3VXQB 4WV1B 3G5ZA 5LBSL 2C9SA 3SQBB 4F5CA 1QBML 1XR9B 4N2FA 1BSIA 5AAPA 3SIKA 4J4PA 3WNNA 8PAZA 1HI6B 3VFPB 2J8OA 3FT1A 2G4EA 4ZO7A 3HMWL 2QHLA 2WXQA 3VG9C 3PNRB 4KMQA 5FYJL 2E7LC 1MLBA 3H55A 2A73B 5ALCH 2VQ4A 3X3FL 3DYMA 1R5VA 1C9SA 3WKNA 1IGJA 4Q0XH 1GYCA 1ZJAA 4ABWA 1KT2B 1RZJL 3G5VA 3HHSB 4HQQL 3GWJA 4UB0H 1MSPA 3F7VB 4LSRL 5AVXB 3W5NA 2CIKA 5D7LE 3K2UH 1QLRB 5D1XB 4U1JA 3QIBD 4AYFA 3CZEA 5HJ3A 3JVGA 4TOYL 5FWRA 4Z8FL 1FBIH 1FL5A 1NWPA 1S7QA 4P2RA 4H0HB 4ODWB 3HS0C 1Z3GL 1WDAA 4X4YB 4MXWL 3A22A 3IJYB 3KVDD 3NACH 4N0UA 4PJCA 2HP4A 5HVHC 4PFEA 2XFGB 1ZT4A 4BSWB 4JLRA 3SOBH 3V0EA 3VI3F 5BOJA 2Z8WC 4GKSB 4LRIA 5DTFB 3FFCD 5HHNB 3T4YA 2G9HB 3G6DL 4CVUA 1IBYA 3TT3L 4E9YA 3F84A 3DI3B 1UZGA 1FCGA 2JLPA 3PP3K 2H3KA 4BFIB 3TM6A 4Q9RL 4MA8L 3P0VH 1KLFA 3E1ZA 5HHMB 1Z6JT 4XCCH 1MCNA 3O0RH 4GW4A 3P4NA 1IE5A 4MMXB 4CSZA 1T0NA 5HJGA 3KM1A 4Z7WA 1P1VA 4Z7VA 2EIDA 1PVHA 1KYOJ 3QG6A 2DH2A 1CDYA 2E4FA 3FJTA 5F0MB 3VMNA 4ADIA 4YK4C 1SM3H 2Z31A 3QQNA 1AO7B 1HH9A 3ABLB 3O4LB 4YZFF 2XU9A 4OFYA 5L9DL 3EJRA 4OJFH 4Z7OE 1DEEB 1X5LA 1L9RA 3GSNA 5EZIH 3L6FA 1EANA 5ALCL 3WL9A 4KNTA 3N1FC 5D2NC 4B9IA 5IJCC 4Y19B 5HYQB 2WBKA 4HAFA 5GGTH 2WIMA 3DX0A 3L9RB 2K6WA 2BP0A 2PNDA 5FWQA 1SYVA 2Z7ZA 2J6EA 4HULB 2PABA 4PRBA 4M4RA 3O4LE 4HHAB 3R7QA 3DSFL 3UDWC 4X9FA 5IW6A 3JWOH 3U6RB 1N6QH 1HYSD 4HPOL 1SXSA 3ZW3A 2B59B 5LGJB 4LSRH 1XTMA 2ZAGA 3MLUH 1HSBB 2IPTL 5ISZB 4Z7UB 5B8CA 4X7SH 4GG6A 5FYJH 2R2HB 4TUOA 2EYRA 3NFSH 3UZVB 1AH1A 4ONOA 3WGUB 4P5TA 1L4IA 3B4NA 4D0DB 1HKLH 2VZSA 5KANG 3K6SB 4YDKH 2GUOA 2I5YH 4S1RH 1F13A 3WYRA 2WVSA 2QR0B 1I8UA 3P9MB 4NN5B 2DMCA 5F6IB 4JPIB 1HAUA 4QTIH 2BW5A 4ONFL 4JMXA 3TGXA 1OP9A 4PGEA 1KB5L 1VADB 5F7HA 1EZVX 2AFNA 2ZG1A 4KBPA 4XVTL 2ISDA 4FOMA 3S96B 3KGRA 1VADA 3QO1A 1A02N 1DLFH 5HPMB 2FBRA 3AVEA 4PJEE 5CINL 4BIKA 4IOIB 2WWMC 3DX7A 4LRNL 3RP1A 2EIBA 3UEZA 3BAIA 4KROC 2PYEB 1J8KA 4MDJB 3C87A 4HUXB 4F2EA 4Y4HC 2AXWA 1OAQH 5I0DA 4GRLD 4YXLL 5C0JB 3U2SB 1A9BB 3JWNE 4Y4KB 1N6UA 1LO2H 5AVTB 3VFNB 1EAJA 3KWUA 2WUBL 4LARH 1I8KA 5DZPA 3T9WA 3VGAB 1CYXA 1W8NA 3MNVA 1UENA 4UZSA 3ARPA 3IDYB 5INCB 3S37X 5IOPA 2XXFA 1ADQL 5FA3A 3U36A 3NCFB 5D1ZD 2VXSL 2WVUA 1G7HB 2P8MB 5I1GH 3GHBL 3VXNB 3FCUB 2VWEC 3DJTA 1DJXA 4Y5VB 1O5PA 3FQWB 2D31A 2ZOLA 1U8LA 1L3WA 4HEPA 5IGXL 2P9RA 3IDXH 2MOVA 5LAXB 3RL1B 1JIBA 2G2NA 1NEZB 4L4TD 3ROOB 2CUMA 2HJKB 5F0JB 4MZRA 4B41A 1E30A 4XCFH 5SWSE 2UZXB 5C0JA 4OLYH 5GS1B 4UQ2B 2YSSB 1OARH 2D0HA 1MNUL 5BZWB 1IE4A 4R7XA 2EE9A 3EXLA 2X2IA 4NQXB 3I2CH 1OAKH 2CKBL 5TH2A 4KVNL 1KMGA 4FQJH 4X9YA 1LQSR 4H25A 1ID5I 1MHEA 3U1QA 3WO4B 1B6DA 1BGXH 3ARBA 2ZWYA 4JPWL 1KGCE 2AXFA 3LPGA 2WZAA 4XPFH 3P1VA 4ICWA 3ECBB 5C0BE 4KZDH 3K0WA 1UWXH 3UZQA 1D5IH 3LH2L 4B9KC 2OMUB 3UTZA 1QRNB 1IGCH 1T3FB 3SBQA 3QUYB 2HB0A 4G6JH 1H9DA 1ZVHA 4QOKB 2OMUA 3UTZB 4LIQL 4APQB 3K3QA 3V4PB 5AB0A 2AK1L 2ERJB 1M7UA 5BUPA 2P5ED 2DIJA 3T0EB 4JCLA 1K4DB 4GSXA 5D4IA 1K8IA 2OMTB 1TVHA 3CVIL 4KO5A 2DDQL 2UXFA 4OLWL 5CLWA 3MBEB 4IOFC 2OR8A 4YSCA 3WNMA 2IV9A 3TN0A 2IDSA 3LB6D 4WJKB 5TH2B 3BH8A 3QZPA 3I9GH 1IQDB 5IW6B 1QFWI 2JKRM 3CX5J 3TEZA 1TTUA 4HHAA 3PHAA 2NY3D 4BKTC 3PAYA 3MLXL 3NCYP 4LCWE 1WZLA 4B9JA 3TOPA 2YZ1A 5TF0A 1KXTB 3BAWA 3NZHH 3SEPA 1CFMA 1F3RB 3N41B 5SWSD 2G3MA 1NMCC 3NYKA 4TN9A 3R19A 3RVWD 1CZ8H 1MLBB 4PJIA 1OL0A 3G9VA 4FABL 1U8PA 1AZNA 1IFHH 3GXIA 3KBHE 4PCKA 1JWMA 2ATPB 1UCBH 1HESA 2GIYA 4FFWD 4FLHA 4ICXA 4BHUI 3VSTA 4NNYA 4EUPG 3VXQA 3IE9A 4E68A 4Z7VB 4ZO9A 2NY1C 4JQXA 5D7JB 5GHWL 4ZBJA 2JXMB 1RJZA 3UABA 5IW1A 1NKOA 2OI9C 5J6GA 1NPUA 4GP5B 4NJAH 4PJFE 1BWWA 2IMNA 4P5MA 2JIXD 3PWNA 3V8OA 1FZKB 2GBUA 1OZTG 1MPAL 1U92A 2DYPD 3LN4A 4ECNA 5IP4A 1UM5L 4MMYB 4U1KA 3WAJA 2CKNA 4NQED 3FT4A 5HYSG 1JNLH 5CEZE 4EI5A 1F86A 2IADA 4E2OA 3LS5H 2PCFA 4HISA 2BMKB 3REWB 2A4EA 4XNQB 4UOZA 1DQDL 4CJ0A 5F89A 4JX0A 4LCWD 5HD8C 1FZMB 3MTRA 2BCKB 2QEJA 4AEFA 2LQRA 4Z77A 4MCYA 3PHOB 4L8DB 2EO9A 4JFHE 1N10A 1PIGA 2ZCLH 2FUTA 4KROB 5AVQB 4P2OD 3AS3A 4HFWB 4X4KA 1ROWA 4ZOAA 3RKDC 1DVZA 4NKMA 3U79A 4AQAB 3BFQG 2X88A 2VLLB 2A83B 2TAAA 1B0GA 4P46B 4HK0A 3IETA 4X9IA 1KUMA 3HN8A 4PJDA 3OR7B 1ZK5A 2ADGA 3PL6B 1IL1A 2WJ5A 3V9CA 5ITBL 1QSEB 4M4RB 3D05A 4R96B 2OSXA 3HC0B 3BIKA 2KC0A 2QSCH 1FFRA 4U05A 3P73A 3LV3B 4DPBX 3I50L 3V6ZA 4FQ1L 2ADYA 5H37H 2H6UA 2GBAA 4UAOC 3MV8D 4MZIA 2RTTA 3C5SB 4G6FB 2BRRL 3I6KB 2O5XL 1QBBA 2CIIA 2BNUA 4PU2A 2Y2YA 3IGUA 1L0PA 3QPXL 1EFXD 3U7WL 3PXLA 3ZE0E 5B21A 3FB6A 3LNFA 1FV1B 4XN4A 4U4IA 3I6GB 3KLDA 5DD6A 3SKNA 1WS7A 1VCBC 3AXHA 3CH8A 3VJ6A 3MMEA 3R8BB 5CCJA 4R7VA 5LG1A 3WUWG 4H5SA 2IPKB 2W0FB 2RFXA 5I6NA 2OFQA 3KL0A 4N8VB 4NXSA 1MVUA 3WY1A 2R23B 2K45A 4EBQL 5KW9H 3L3OB 5LLIC 1AGEA 3NJLA 4XNAA 5T1MB 5D2NB 3F83A 3GI8L 2Z4TA 4F20A 1QYGH 4M5ZH 5JXEC 5BVJB 2NUPB 1UYWL 3MRDA 1NAKL 3ZUNC 3LPFA 1X5KA 2IAAC 4NNXB 1CUOA 4D9LH 3UERA 4I9XA 3KJ4C 1GJUA 4WWPA 3K1DA 1LYQA 5F9JB 5I6KA 2VWEE 4NO0D 1SBSH 2P5WB 4UT7L 3PDOB 4RRPA 1I4FA 5DJ8A 3VCLB 1X5MA 2QVKA 1JZHA 1UT2A 4KXBA 4L8BB 2CJSA 4YDZA 5AVYB 1BDYA 5J57B 2WVVB 4GAYB 5ICZB 3F5WB 3DMMD 5I2IA 4QHKI 1GZPA 4M6OL 4MJHA 5F21B 3BLKA 3V4VH 5J56B 3U25A 5GJSL 2R2CA 3QJRB 4Y2DB 1AGEB 3LIUA 4NDMA 3QC5X 1T4WA 5DK2A 5E4IA 2GAZB 4LSVH 5LB1A 3VTMA 1FFTB 5T3ZD 2F54A 4E9LA 1S78C 4NO5B 4DO4A 4OLWH 4POYA 2J3SA 3QJTB 1KB9J 4H5SB 3G5ZB 4KI5D 2Z31D 4GO6B 1L9OA 4P2CG 1ORQB 2ZP8A 4JGJA 3BP4B 3L3GA 3O8XD 4PYHA 5IKCB 4OJCA 5DDHB 3WU1A 2WY3B 1ODAA 2YAPA 1BOGB 4O9HH 4W70A 5JTWA 2UZPA 2OW7A 3M07A 5K5YA 2FO8A 3Q13A 4GINA 2VN5A 5L2KA 4LQFL 4QRPD 4C83A 4OD1L 4F33A 3IN0A 2VLKE 2BVEA 3D3VB 1YEJL 2QTVA 3F65A 3QDGA 3RNKA 4EIBA 3BFOA 3D7PA 2WUCH 1KFAL 5CR1A 4Q74A 4BWTA 1E4KA 2WXLA 5GISL 2V9QA 1U93A 4LOUD 2FEDC 5E1QA 5HHPB 5JO5B 4WNQB 1TYRA 3OKKA 4XNUH 4Z7OF 4FJZA 2X4OA 4GSQA 4B9YA 2YPKA 5TPWH 1MNUH 4JVPA 5DS8B 4JDZA 3S37L 4K3EH 1XGYH 4DKEH 3MU3A 4I2XB 1YUHB 3B6SB 4E42A 3GS4A 3QPQC 5T33H 4S1DC 3UBGA 2LW3A 1IM9B 3HRZC 5E9DE 3QUXA 3SE8L 4XCYA 5H35A 1YNKH 2EEFA 4I5BB 2NMSA 4HFWA 2QKIA 5C08D 3QUZA 2W88A 4KK8C 4ZQKA 5IGXH 4LEOB 2BVUA 1FZMA 1UM6H 2VXSH 3LPWA 3FQTB 1WK0A 2ADJA 3BZFA 4PN6A 3NTCL 1LDSA 2QLYA 3PWPA 3ARGC 4AYID 1GGIL 2E9BA 3GMMA 4FJYA 1O5DT 2XICA 2XPYA 3WKYA 4LHUB 4R7LA 1I3VA 3VFUA 1WF5A 4YAQB 4X8JB 1OO2A 3VD1A 3I6GA 3LKOB 4APXB 1UB5A 2XG4A 3O0LA 5HI5C 1QFWH 1C1EH 2OTWB 4WI9A 3OKDA 2YXWA 4YSAA 2LAAA 1R5WA 2NY0B 3L3HB 1F02I 4PREA 4QOKD 2DQGH 4P5TC 4KJQD 4L4JA 4N0YH 3QJFB 4Y2NA 1PIFA 2QQQA 4XNZB 2XX1A 3SPGA 4UM9B 1QZNA 1R3JA 3MBED 5E5MB 3AREC 4NWUH 3QDGE 1YMHB 4V1DB 1MG2C 1ZANH 2MCG1 5ESVB 2QHRL 4DN4L 4YQXL 2MQCA 2WZPA 1JWMB 4LLWA 1NCAH 4LDCA 5KTEH 2BVOA 3AC0A 4BFOA 4KKLC 5I76A 2HFTA 4LLMA 2DI8A 1BECA 2Z91B 3LKRB 1GGTA 5FGBC 5EC2B 5A16B 4NUPA 1ASOA 4X0KA 1MCOL 5IHBA 2ZXGA 3QUXB 4TL4A 5I6LA 5DMGD 4UYPA 4AEIH 3FO1A 2F6AA 4GMTL 4NKOB 3C6LD 5AOZA 5B1JC 2MPAL 2DPKA 1UWFA 2FO4A 1V05A 1DHKA 1DBBH 1NIEA 1TEYA 5C9JB 3FN3A 2OXGA 4YSTA 4N9OB 3GZOA 3QQXA 4ZXBD 2A74B 3NG5A 2F18A 4L3FA 2F5AL 4X4ME 2VL5B 4YNYB 2DQDL 3IKCA 2IALA 4A7TA 4X8CA 3EOAA 2WWNA 4ZYKB 1RIUL 5LNGA 4HKBA 4X0NA 4UIKH 1A6WH 2ILLA 2OA9A 3LKSB 3N5AA 5FW6A 5DT1H 3CV5A 4OSUL 1RU9H 1JGUH 3P4LA 3N50A 1HYRC 3RWEB 3HG0A 4AC4A 3ME0A 4MMXC 2CR6A 4HJ0C 1EJFA 5IKCA 2AGJL 3GTTA 4UIKL 4Q97A 5DRWA 3T6ZA 4NENB 1NUFA 1MWAA 2FUQA 2UZIH 4AGLA 4N8CL 5ICUA 1I7RB 3H7LA 3BKYH 4AMKH 2WVTA 3P9WB 4FZ8H 3FKUS 1CVRA 4XCEB 4FC3E 4HPYH 1TXKA 1TQUA 4R2GC 3U9PH 5SWZD 2Z0UA 3CFUA 2GK0B 4UTAH 4KJYB 5EOTB 3BPLC 5I6PA 3H9SD 3EOBB 1Q38A 4AEIL 1NFAA 2EEXA 3ZVVA 5ICZA 2ZWNA 1XCWA 2HLEB 2VJXA 4XWOC 3WIFA 1YYML 3DVFA 3EOTH 2R1WA 4HWZB 4U3CA 4Y0GA 5CN2A 1A3LH 1SJXA 2OCFD 3FQWA 3OPZH 4JDTH 4PYGA 4DT2A 1OIOA 3MLRL 3RVWC 5FFLA 3V4UL 1U91B 3LKNB 4ANUA 1YHPA 3F2LA 3LQAL 1DQIA 5H37G 1HCYA 2AI0L 4DWHA 3ORJA 4FQ2L 5EO0B 1CB4A 3MACL 1MREL 4JM4H 3BP6A 1OGTB 4LL4A 4F7TA 3FN9A 4EN3B 5JA8B 2PPAA 2WLYA 5EPMB 1QLFB 5KSVA 4PJCE 4XPAL 1QR1A 4F1SA 4LPUA 5IROC 3ZBMA 4ZS7H 3UG4A 2DWSA 4XRCA 3KLSA 3GXFA 1P5VB 2PP8A 3LIZA 1IQWL 2QVIA 4OZFH 2J21A 4R4NC 3A0OA 2FE0A 3KPPA 1IEHA 4OZ4A 1PU0A 5E1HB 1OP3K 1JHLL 3SDDD 2JQAA 2PTVA 3KDMA 3NQIA 3NZ8B 2WXKA 5PAZA 4R7DA 5KEZA 4JO5A 5DUML 3IFOB 4MD4B 3OGCA 1MI5E 1QI4A 2R29A 2WXFA 4JZNB 4RDQF 4JFQB 1KBGH 3KPRD 5I1DB 1R3HA 3A6CH 3LVEA 3VB9A 3UPCA 3D0VA 5EB9A 4LVOC 4XGZA 1DN2A 1CBJA 4RQQB 3QEGL 4XP6L 1V7NH 2C26A 4AJ0A 4E9SA 5CKAA 3PGFL 2AV7A 5KSBA 3UTTB 3D9AH 4KQ4H 1RPKA 5ISZA 4ZNEE 3HG1A 3IFPB 4XMKH 3MLWH 3C8DA 5FM5M 2E6QA 2VDQL 2V0AA 4QLRA 5IEKB 4G7YL 4B3VA 3J8F7 3KL3A 3IXTB 4J3SA 1K9TA 3SDAD 3SYAA 2WOBA 4GRMA 4K3EL 5C0CD 4K9EL 4DN3H 1AQKL 1UD5A 2XWTA 1XHHA 2Q2LA 4KRPB 4LGRB 1DQJB 2X6VA 4EZJA 1FGVL 2DTML 3FU7B 2OTUB 4M7JL 1OWRM 1PAZA 4RMUA 1D9KD 1X5ZA 4NKDB 3LKQA 2CO4A 3IS0X 3DTDA 5BRZA 3SE6A 4HT1L 2IDFA 1TYJA 32C2B 3QXVA 1AI1L 3PL6D 4PTTA 1ZRUA 2G4GA 1R3LA 1GTNA 1MRCH 1JF5A 2WXOA 5B4MC 3FT4B 3ARXA 1ZT1A 5DVOA 1KTLB 4GLRI 1JZ7A 4GJTB 1U6AL 3KYMA 3AACA 1KIPB 1PDKA 2OL3B 2VDOH 2Z31B 3U0TB 2VITA 5T5FA 3W81A 1K4DA 3CFJB 5DS2A 3PWNB 4GQ9L 4BK5C 1GZQA 3ZE0F 3X2QB 2X4QB 4MS6A 4UQDA 5K39B 5J6GB 43C9B 1J8HA 2RR3A 2YD8A 5T5FL 2YS4A 2B2XL 3LXCA 4YDVA 4ZTOH 1S7RB 4K7FA 4ZFFB 3LQMA 5KJRH 2PWFA 2XQYK 1JDCA 3GIZL 2J8UA 3GRWL 5DD3L 3KBEA 2BINA 4URKA 3SQRA 2FH8A 4ZOBA 1ETJA 1D5ZB 4PJBB 4PY7A 2CJUH 2Z8RA 5FM4A 2OK0H 4X4YA 2QQLH 3HNVL 4HLJA 4MNQE 4D8PB 3DV6A 2NY2D 1CCZA 4CGTA 5FB8A 1B9ZA 2Y7NA 1CLZH 4LFHD 2GT9A 5F1KC 2VMJA 3EJYC 1KXTA 5LAXA 3Q3GA 2ZPKH 1YQVL 5AVRB 1ET7A 2JKNA 2YPVH 1L9NA 1FN4A 3RQ3A 4DGIL 3CIQA 4OZIB 2F8OA 1BFVL 1IEAA 1ZA6B 1N0LB 5HGAB 4UOW0 4ZPVB 5F7WC 3DBSA 2K4AA 3V0WH 3U2IA 3RUGF 1IBGH 2HX7A 2NQCA 1BM7A 4P3DB 4YBQD 4PAZA 3WJMB 3JWDL 5E1AA 3C8HA 1R0AH 1F2QA 2WXIA 4N4YB 2D7OA 4PJFA 4P23C 5JOFB 5DRWB 4AH2B 5GGRA 4YXHH 4R97C 3CFBB 1WA0X 1S7RA 1TENA 2LOEA 4FQLL 4K7FB 2P24B 2CKBB 2OJEB 3Q2NA 3MPCA 1T3FA 5E2WH 3BFWA 4I18B 4RX4A 3CFTA 3MRGA 1FG2B 4JRYD 1NAMH 1SOKA 3LEYL 3WEOA 3U30C 3T4YB 2BZ7A 1JPGB 1YMMB 1RK1A 4QXUH 3T1WA 3CFNA 2ITFA 3NABL 2BWQA 1PZ2A 2CDEB 1S3KL 1CDHA 2VW7A 5FYJE 3RVXD 3DIVA 3TYFB 5I6MA 3DWTA 1RZIB 1CN4A 2FWLB 3BN9D 4XVJL 4I85A 3HB3D 2FSEA 1MHHB 1I7ZB 4LVOB 4LKCA 4NS0A 5D1XA 5E2VH 4EXPX 3KPNB 4FF9A 2EYRB 1FNSL 3WEAA 1IBBA 2YA1A 3BAXA 5GRWA 5A40E 3CLFL 1NC2A 4NERA 1VF5C 1OM3H 1HSBA 4HUWB 2PWHA 3AQDA 2COVD 5JIMA 3L4VA 3L48A 5E2VL 1CTOA 1Z0NA 2D7NA 2UUDH 4HP5A 4EMZA 1JHTB 1LMKA 2DWDA 3QYCA 3GJFH 1W6WA 2IH3A 1ICTA 3V0HA 1BZ7B 3OWRA 4YFDB 2Z4QB 3VFOA 4WI0B 4MNGB 5MI0B 5E7FA 1FFPB 3D8MA 2ZOTA 5F6IC 3VRLF 3ARBC 1TCRA 2XVBA 3EUUA 4UIMB 4GFTB 5I74B 4AIOA 5DHDA 3T6XA 4M02A 2CRZA 4L9LA 5HI5D 4BV1A 4NQCB 3MRRA 4MNHA 5C0AA 3OGCB 5DJXB 5IB2A 1T2XA 2WLLA 3UTSE 1BM3L 5GIRB 5C92A 2IQ9L 4P49A 7CGTA 1GSMA 2YKKA 4DKTA 5IESH 4OZ4B 4POZD 2F0CA 4PGEB 2IDTA 3BVXA 4TQEL 2O61B 1IC5H 2OJ1A 4C59B 5HVHB 2X89D 3WKPA 4QHNA 4M1GH 3RWEA 4AV4A 2BIHA 3FN0L 1KLFB 1RURH 3ZHFA 3AMKA 3O3AB 4GG6E 4F8OA 5IF0B 4DVRH 5DZOA 2NY5L 3NIFF 2EVGA 1T4KA 2YO3A 5IIEB 5E2JA 3ECWA 3GBLA 2EUVA 1N3NA 3Q44A 3TCXA 2VXVL 4Z76B 3BP6B 3ARFD 1JOIA 2IMMA 2CCVA 1YNTA 3W11D 3MJGX 2FNBA 5CSGA 2B39A 4RNRB 2SEBA 5KSAA 2JI2A 2WLMA 4HUCA 3QFJE 4DZBB 4X99B 1ZVNA 1H15A 1XH3A 1JGLL 5CMAB 1EEYA 4ZMPA 1JGVL 2DIEA 4MD5A 4HF5L 2QT6A 2OSWA 1DEDA 1F00I 15C8H 3I75B 4PRHA 1YJDL 3T8XB 4ZMYA 3VXPA 3H1ZA 3B9VA 1G7MA 2YR3A 2YPVL 1RUPL 1MQKH 3I9PA 4DP0X 2EXWD 5LDUA 4OIBA 3GMRB 3ZE0B 2OMVA 4GRWH 5AZ2H 3D39A 4TYUA 2BSRB 2EEAA 3UBHA 5JORB 1E2VA 4F9LA 3TEUA 3SDAA 1T0NB 1PMYA 3GS0A 1RZ8B 3Q8FA 3NIGB 1AFVH 1OSZB 4HEME 3WKML 4QT5A 4QHPA 2VDOB 5C71A 1QUNB 4YDIL 2DLFH 1TKWB 4MQ7A 1A5FH 4WVRA 4FA7B 5I0YA 3KPRB 1HCVA 4S2SA 3GM8A 2DB8A 4XXDB 4K2UH 2D7MA 3TBWB 3BWUF 1G1CA 4PRHD 1WCBA 2V7HA 1UJ3C 3QQ3B 4LVHC 4PRDA 4UMGA 1MFDH 3AT9A 4CADA 4PRIE 1ACZA 3CVHH 3QWOA 2P5WA 3IEAA 4JUSA 4U6YB 4MYWB 1FNLA 2XYBA 5ALBL 4G7YH 2SEBB 3B7YA 1Y1DA 3QFJD 5T3XH 1BWMA 2CNZA 1Z1WA 3QCTH 4Y1SA 3V6OA 1MOEA 4R5TA 4PGCA 3BMWA 2WXPA 3QUZB 2Z91A 2R7EA 3LKRA 4MA7H 4PRIB 4ZQKB 3V2AR 1TJIH 5I75B 1AC0A 3MLPA 5FYKD 3DK2A 1FNSH 5EIIG 4QRRB 2OTPA 4AJVA 3RL2A 1BEYL 5EUKA 4QEGA 2R23A 3SHSA 2CU9A 3UTOA 4ISVB 2C3XA 3HNSH 5DGQA 1FGVH 4G1EB 1ACXA 1G6VK 2EXSA 5JW4R 1S3KH 4EOWL 4R4ND 1PZUB 4JGUA 1YY8B 1I9RL 1Z5HA 3L3DB 1ERNA 3CAFA 3NIGE 3BZEA 1NAML 1JVOA 5ECGA 1F45A 5I1IL 4ONFH 1XCXA 4Z7VE 5IFHL 3O45B 1KYOK 1KTDB 4MNHB 2JNZA 5CU9A 4OF0A 4G8IA 3WTXA 5JHDD 1FNFA 1PX3A 1RV6X 4GB9A 4LP5A 1BXXA 2FTAA 1W72A 4JW3A 3OHMB 2PXYC 3KPQA 3RGHA 1GZHC 4OJAA 3CFCL 3BQUD 3QO0A 1CQKA 5IVNA 1MAKA 1BVKB 4PLKC 3D18A 2JJSA 1RAMA 1EX0A 2EDFA 1IBGL 3DUUA 2AABH 2E7BA 1HINH 2J73A 5DEGB 1P7KA 2VLLA 3N55A 3OAWA 3T3ME 1Q9OB 2ZOOA 3M8OH 4RMWA 1U42A 2QKIB 1CDIA 4LNVA 1VB9A 1CG9A 1NWOA 3TJHD 4JFXA 2CD0A 4ZSOA 3V5HB 3DRTA 1RCYA 3EYOB 1J48A 3KNBA 4GAJH 1ET8A 1I1FA 5DSCA 2J43A 1JDDA 2Y7OA 3DROB 3FB8A 5KOMC 5E6ZA 5C0CB 3CVHA 3CD4A 1PLCA 4IDJH 1G7IB 1MREH 2OX5B 4ORGA 3RWCA 4F57L 1BV8A 1PSKH 1YMMA 3E9UA 5EZOH 3SGJA 1A8ZA 4DUXA 5AKVA 1S9KC 3V4UH 4WSJA 4XN7A 3VDAA 3TBYA 2VJ0A 3DHJA 2A9DA 4RCAA 2C4XA 3L3OA 1RZFH 2APXA 3BUBA 3V7AG 5TE6H 4KH9A 1WWBX 3I9IA 5FO7A 3HNTL 2IPKA 2W0FA 4FZEH 3H9SE 5FGBA 1SLUA 4KOBA 2Q87A 5I8CA 2XWBB 1VRSA 2Z8VC 3GJFK 2IDUA 4OZGA 3SKNB 2DLGA 1E4XL 2XWJB 1ZKAA 3IGAB 5TDNB 5AW0B 2UYLA 3QUMA 4WI4A 2CCLA 5SX4H 3D09A 4Y1AA 2ZCHH 3QQ4B 3LB6C 1UZ6E 2XN2A 1YEIL 1I75A 2AJVL 5AENA 2VISB 4KWUA 1JZ5A 3L2LA 4JRXB 2FL5B 3TWCH 2DLHA 2UV3A 4TOYH 2P8LA 4JKNA 2FX8L 3B3IA 3TVMB 5HDQL 2AQQA 3GXUB 1IGFL 1LXMA 4WAFA 4RFOL 1LILA 3EH1A 3ULVC 2WAHA 3O6LL 4W6XB 4OI9A 1S9WB 5J12C 2ATKB 5D1ZB 2MEJB 4WO4A 1GL4B 1T5XB 3KHOA 4Q89A 1FNEA 4FQHB 3G04A 2P47B 2VR7A 4DGYL 3FSVA 5DZ9A 3EUDA 5JHAA 3ESVF 1ZT7B 2LT9A 1BAFL 4UDUA 3G5XB 1N3NB 4KC3B 4YZWA 3WIIH 3NUKA 3VW3H 3FF8A 3CN2A 1UOVA 5BRQA 1INEH 3BPNB 3FRPA 4KNQA 2ALWA 1KYDA 1CQYA 2CE6A 3FOMA 4GAGH 4J23A 4KXZI 4XPTH 5GJTL 4OD3H 4RFEB 4MFHA 1GZQB 1AQDA 1YCSA 4BUGA 2X1XR 3FT2B 4OZFA 1KIQA 4Q52A 1OGAD 3MJ9L 2WMPA 1JN6B 4XN9A 2VDPH 2YQ3A 2KUTA 3FTSA 5MEQA 1ZTXE 1F1DA 3VGFA 4GH7B 4Y4FD 5JIKA 4IMKA 1MW0A 3VXMB 1VCAA 4PS8A 4X6CF 3BLPX 3RFRA 2JLLA 4P5MB 1X9QA 2AC0A 1KIUB 2F7QA 4Z7UE 4LEEA 5IWLA 1KYAA 3DECA 4FL4B 4LPXA 3DARA 4OZGE 3W2DH 4DK6A 2ZKXA 4WHYG 3TLRA 2YSSA 3WFCL 3ZDWA 3PLYA 4L37A 4UI2A 3ES6A 3V6ZB 1SQMA 1J9QA 4XX1E 3LKQB 3HZVA 3T0ED 3WS6A 4AQZA 3KE0A 3ILPB 4I77H 2A6JB 3NJHA 2LU7A 5MHSD 3BZ4B 3P0YH 5C9KA 4KQ3L 1QABA 3D39D 5KYUB 4ES8A 1BZ7A 1G6RA 4YEEA 2YGPA 4EDXA 3T0AA 3SDXA 2X09A 1JXDA 1UZ6F 4WUUD 2D03L 3QHFH 3PAZA 2ZX5A 4OQ1A 3GT6A 3R4RA 4P59L 3OF6D 4GBXB 4FFVD 1MCKA 3RU8H 4KRNA 1P2CA 1P5UB 5HGBB 2HVJA 1ZEAH 3RA7H 4F2FA 4G7SB 4RQQA 3S35L 2DYPA 1Z9NA 4DP7X 2Y7QB 1A3QA 2MTPA 5GS2D 4WCYH 4X6DB 1Z5YD 4JS7A 1UH4A 3H3PL 5J4MA 3CZJA 1XMEB 2IADB 4RAUA 3S3BB 5I28A 2CDEA 2JQMA 4HGWB 4JG1H 2NY0C 1LK3L 1FFNB 3V0IA 4ZMVA 4O9HL 2F53D 1O6VA 4G43A 5HYJA 2BIMA 4B5EA 3PP4H 1F42A 3OBAA 1NDMB 5A2BA 5E9DA 5J9PB 2O5YL 1FE8H 2VR8A 1OVZA 4AL8C 2JF1A 4ZPTB 3FU3A 3V6OE 4W4OC 2HJLB 3U83A 2DD8H 4L5FH 5F72S 4ODXB 1KTRL 1VERA 4M5YL 1PYWB 2D0GA 1QR1B 4BE5A 3LEVL 4KJPC 2O5YH 3EJQA 1BOYA 3UZVA 5F7AA 2VDQB 1FSKC 4JY5H 4TXVB 5EU4A 1XF5A 1OGTA 1PSKL 1A3RH 1YPZF 5IQNA 5E1AB 1EDYA 2C34A 3O3EB 2APFA 4N1CA 4FQIH 3OKEA 3WKMH 4BH7A 1GMEA 1J0KA 3IT8D 3BT2L 5AVUB 5L6YH 1MCPL 2P8PA 3P11L 4GKNB 3UBXI 1U8OA 1WFNA 1PFOA 1PZ5B 3QAQA 4PI0A 3TBSA 4GAJL 4M8RA 4MJ5A 4IHOA 4L3CA 4OCRH 1N67A 1B4JH 4IHOB 4P2OB 3WJLA 3B2UC 1SDAB 5CEYA 2B14A 2XZZA 2LR4A 3BVNB 4HWNA 3SO5A 1DANT 4NCC2 4PR5B 3UEQA 3B3BA 5CP7A 4TQIA 1IQDA 2XBZA 2VLRE 5EN2A 4F15B 5I1EL 5K9KA 2VO5A 3QDHA 4OBSA 1R4XA 4LK4A 5FUZH 4R26L 4RIRB 4FTVD 5F9WC 4NCC1 1M9WA 1DSWA 4L2YA 4HF5H 1ZS2A 3ZYOA 4IJ3C 5F0PB 1PPIA 2AEIT 1IBHA 3MRQA 4IDJL 2AMUA 1MWAB 3ABKB 1TVHB 4OTXL 5GS2H 1KCWA 2AXGA 1IEBB 3SJVD 2FIRT 3DV4B 1JF1B 1JUFA 2QPUA 3BUIA 4IKKA 1GKOA 3R8QA 3MV11 3VXTB 2WXHA 1RY7B 2X4QA 4XNXH 1MIEH 2J5LB 3KXFB 3WFHA 1WS8A 1FORL 4JANB 3ZR5A 1DVYA 4S0TD 3WTVA 5DHVB 5DLML 1MFAH 2ICWB 3FRUB 5LHDA 5LGKA 4WUUA 4Z3EA 4NQTA 3AT8A 1ZT1B 2V5RA 2D0FA 5GXBB 5E8DL 3VRJA 3P9MA 4N0CD 4CC0A 3C60C 3MCKB 3EFFA 4HCRA 3N1PC 3JWNG 2BX5A 4OLUL 1BYPA 4GUPA 4IRJB 4Y16D 5IB5B 5BZWA 4NO2A 4QO1A 1E7VA 3RWJB 3T3PE 3P4OA 2DYPB 1E4XI 1LP9F 3KYKL 3Q1SL 1CPUA 1XCTB 4Y4KC 4PJ8B 4XO8A 4QRTA 2OZNA 1NFDB 3X12B 4PJ5B 3MA9L 3C2SA 5F0LB 4RMRA 1MHCA 4WTWA 5CLTA 3OG6B 2FWUA 1TQTA 1YNKL 3B7RL 2A73A 4NI6A 5GSVB 1FYTD 4LF3B 1IKOP 2FD6H 2UY7B 4N68A 3RBGA 2GITA 5EWIH 4FI7A 4XNMB 4MXVF 3LNGA 1N64L 5CLZA 4HWUA 2YAOA 4DTGH 5E5MA 2X4SA 4PRID 1RLBA 4XVUC 4KJWD 4OLVH 1AJ7L 3JV4A 1BG1A 4ZUUA 4KFMA 3OAYH 2FQGA 4YH6A 1HEHC 5DJAB 2VUKA 4YSDA 2EEBA 2OSLA 1BQKA 4JFQA 5FYLD 2YAMA 3KS0H 4XP1L 2JH2A 3VMPA 2R2EA 3KLKA 4YHYC 3JTTA 1D5MA 4PJXB 3WXVH 3LKPB 1BF8A 4QRAA 3A21A 2BC4B 3KH3A 1OF0A 2R0WH 1IV8A 2PXYD 4K4KA 1S5IH 2I69A 5F1NA 3FT2A 4EI0A 3LAFA 5AZ2L 5M95B 5GGUA 3RVVC 5I18H 3BYTA 3S2AA 1EJ6A 2N1TE 2ADJB 1XGTA 4NWTH 3MOQA 3WE6A 1BG9A 2J1WA 2DWEA 4I13B 4XZUB 4N0FB 3QULA 1FO0L 5GS3A 4XBPB 3O6FC 3QHZH 2CGRH 3LNIA 1QMUA 4KV5F 3VGAC 1HTYA 2BXZA 5E51A 1JZFA 2VUYA 3FAWA 2CHWA 1CIUA 1MJJB 3C6LC 1JD7A 4HKJA 5E9DD 5LVEA 3QQ9C 4RISL 1SBSL 2DQ6A 1UATA 1WC7B 2WZ6A 3ARQA 5B1CA 1TEGA 2ZUWA 4V1DE 3IWVA 1HILA 4LBEB 4QYAA 3KPMA 3F05A 3C08L 4AIZA 4UWQB 2HSIA 2GTZB 4YHZL 3A4AA 5EU6B 3T2LA 3ZE1E 4JQXC 1CD0A 1SNRA 3Q48A 2DEWX 4EIUA 5IFAH 5SWQB 3GPEA 4YWGL 3PWLB 4PM1A 1UXSB 2W65A 3BQVA 4ONGL 4OW6A 3U0PA 5EBLA 1MFCH 1W0YT 9PCYA 3VM7A 1OD7A 1PY0A 3N85L 4QXGH 1OGAB 3PQYA 4JG0H 4R83A 2FJHA 5CJXA 1IB5A 1GGBH 1RZ7L 4LCIL 2NUTB 5H37A 4NOBA 2B3RA 4OZHB 3TURA 2WO3B 1LGVA 4JFOA 4KVNH 3SKJL 4PW9A 3TO4C 1TU2A 3TJEL 3JTSB 3CLEH 4FTDA 4PBDA 3O2DA 5MP6L 3OAUL 4HDIB 4YLCA 5DD3H 4PB0L 1IKFH 3QXDA 5DVLA 3O9WC 4QRTB 2F8XC 2VO8A 1N59A 3STLB 2C9XA 1XCTA 3LD8C 1KPUB 3L4XA 4PMEA 2CJ3A 1OANA 4X4ZA 5I1JH 1I1CA 2XX0A 2VL5A 1ZLVK 4UM9D 4LXFA 3M46A 3B5GA 3VRJB 4ODWA 3WTTA 1QFHA 5FK9A 3LZRA 1A6UH 2R0WL 5HVFB 3UMNA 1HQRB 5F7YC 4WUUB 4JPWH 4W9IC 1CFNB 4FXGA 4JL1A 4AQ1A 1EGJA 3OB0H 3US0A 2YOCA 1MHPL 2H3XC 4JZOB 1XSJA 1MZYA 1MCCA 1OAKL 2WQWA 5B3JE 3CN1A 2EIZB 4NRYB 5DJ2B 5IQ9A 4C58B 3MRHA 2OZ4H 2E9WA 2C5DC 5T1LA 1FH2A 2Y23A 4CMHB 4M1CD 5GRYA 4XVSH 3KM2A 3HE7C 5ENWA 3A23A 4LSUL 2HT4D 1XIWA 4HBCH 1TQSA 2JB5H 3FB5A 3IS1X 1JI2A 3E6HA 1BREA 4GRWB 1JNLL 3OF6A 4DN3L 1N64H 4AYMC 2BERA 4MNQA 5EA0L 5TF1H 2WLIB 5TE7L 4XVSL 5C0NC 4QXUL 1U8KA 1YEDB 1PX4A 1U2CA 4ZMXA 4FMFA 2B1AH 3MLWL 4NBXB 1S7VA 3EADA 4NHUA 1HHKB 3CLEL 3BVNA 2HPTA 1KN2H 3GSWA 3CLFH 3X1NA 2OS7A 1R3KA 2GSGB 5GZOA 4YHIA 2LLGA 3IDNA 1PCXA 5E95B 4WW1B 4B50A 1V7NL 3C5JB 1CBVL 2CO6B 1T0MA 4HEMA 2IO5A 5LGHH 1ZIAA 4NP4H 1AR2A 4MB4A 2GG1A 4LHUA 43CAB 4YHPB 1A6VH 3EJZD 1NPJA 2PF6A 4XWGH 1NCHA 5DHVH 4X6EA 4DERA 3PWPB 1EJOH 3L5IA 2AKRB 3BWAB 4XVTH 5K9JH 2AJZA 3KPSA 2JCWA 4GEJA 1WH0A 1KY6A 1XO8A 4QJ4B 3FZUD 1LL1A 1H5BB 1BYOA 2P44B 3II3A 3MJ7B 4N0UE 2MMXA 3ERXA 4OCWH 1QFPA 1WBXB 4HS8L 4WTQA 4XNXL 5KYXB 1OWWA 4ZUWB 4ZS7L 3IDMA 4Y4HD 4YX2H 2X2HA 5GGTL 2HA1A 4UUJB 2NQDA 5DJZB 4G8GB 3RZCA 3GUTB 3VWKD 1N68A 1WSST 3PQYD 4EUPB 1DVTA 3N85H 4G43B 4MA1B 3Q43A 4Z1PA 1RPQA 2JKSA 5I8OH 4FFYA 1M4KA 2EINB 2EADA 4WNQA 5ERWA 3E1F1 3IDUA 4Q56A 2ZOKA 4JL2A 1U92B 3H9SA 5CZRA 4M9OA 1JNJA 1RL1A 4JDTL 4YS4A 4Q14A 5I1AA 4OFVA 2WYIA 2XYCA 3O0RL 4EIZC 2FBJL 1FNGB 4G6JL 4NN5C 3B9AA 4BQCA 1SYSA 1J5IA 4NO3B 3LSOB 2K7QA 4PJEF 5DDHA 4F9PA 1ORQA 4XPFL 2WKOA 3TESA 2LFEA 4W9DC 2YGQA 1BBJA 1EAQA 3OM3B 5B8CC 1MCSA 1QLEL 4N0RA 3X1GA 1A2YA 2DEXX 3MRLB 1Z9SA 1NGXB 1PJ9A 5FDYA 1FO0H 3GBNH 5AVVB 1UZ8A 3OGOE 5KUKA 4KHXL 3F7YA 2EILB 2DKMA 4FG2A 4G1MA 1NICA 3CQPA 4HD9A 1J5OL 2XOTA 2H2SD 3BXNA 3MNMA 4YL4A 3FUHA 2DMHA 5JNYA 5CGTA 2PR9A 2YAFA 2C3GA 3D25A 3UTSA 3DIFB 4L5FL 1YPZB 1EEYB 4URTB 5IB1B 2TRHA 3EGSA 4D7PA 4GQ9H 3ZO9A 4YIQA 2Q7YA 4TNFA 4MXQC 5D2LF 3JUZA 3VXMA 2QGCA 3I6LE 1OD9A 4JQIL 3VQ1C 3WXVL 2LLLA 2AK4E 3MGAA 1ADQH 4Y8AA 1YNTB 2OQJB 3ZGIA 5JDSA 2QELA 5B1AB 3KJ6H 3M45A 3HRPA 2R0LH 2W94A 3P30H 4AW7A 4WI7A 3TA3B 2BK8A 3QUML 2XXCB 1O9VA 1IBDA 2NY2C 3MGTB 3QEUB 2CPUA 2K8MA 3VFWA 1NCCH 4H13C 4P2YA 1CU4H 3EYSL 3F01A 2JJTA 1CFVH 4U2ZA 3NJXA 4OIFA 5HHQB 1KULA 4U1LB 4WU5A 1S2EA 1QI3A 3ARBB 5FYLL 5TGBB 5IT2H 4IBYA 1JZ3A 5FOBA 3TP4A 1ZS8A 1CYGA 2JCCA 5B7FA 4N2DA 3RVXC 3EBHA 3SBWC 2X9XA 4AUJA 2VXTH 2IDQA 5KVGL 2V2WA 3EFDL 1FVCB 1TVDA 1UJ3A 1NIFA 4I77L 1XGUB 4BZ1L 1UXMA 4G6KL 2BZDA 2ZJSL 1FIGH 3Q1SH 3SDDB 1F4HA 3HAEB 3EJCA 4HOMA 3BIKB 2MSPA 4PP1C 3IMTA 4QRPA 3HPLB 1QFOA 4X6FA 4M6ML 4AGNA 3BPOB 3S3DB 4U1HB 4DP6X 4UM8A 3Q8EA 3CUPB 2ITCA 3K81A 3DX9A 1LD9B 2C7UA 2EXYC 3NP3A 2DLIA 4OCYH 1CI5A 5KBDA 5IJBC 1YG9A 4C54A 3C5ZC 2OW6A 5IJVA 2EIEA 3UJJL 2IAMB 3W39B 5ICXB 1NC2B 5BO0D 2NX5A 5I8EB 1RJLB 4P5KB 3AB0C 1WPCA 2AEQH 4IW4C 2ORBH 4KJWC 3M1OA 3BHBB 2ZD0A 5CD3B 2A6KB 5DVKA 3I74A 1JFHA 2B4CH 2KZBA 4XNQA 4C56D 1DVUA 3PYCA 3Q5TA 1I85A 2PYEA 1UG9A 5I16A 1G84A 5KSAC 5L0QB 2V2XA 1KGXA 3BMVA 5ERWB 4FQPA 2X5PA 1MKFA 4GXVL 1KJ2H 1TMCB 4G70B 5IBLC 2OMNA 2VLRD 4XMVA 4D2NA 5I15L 5DD1L 3WMQA 4BFKA 1A0QH 3ZDYF 4EUPA 1I8LA 1E90A 1XGYL 3IWUA 2J8UE 3ESMA 3K46A 1A6TB 1Q72L 2QR0A 4J3VA 3WG7B 4CA4A 5ID1A 4M1DH 3HN5A 1GXEA 4AE1A 2VW6A 1J5DA 4M61B 1DP0A 1SVZA 3JV0A 3SB3A 2MCMA 3WXWL 3O6MH 4XB8A 4QHUB 2NY5C 3NJNA 4BJLA 4OFPA 5DEGA 3QDAA 1M42A 1DFBL 3ARFC 2B15A 2HLFC 1TIUA 1P53A 2ENJA 4P5SA 3FT3B 4JREC 3G6JE 4ODUB 3CZLA 3J07A 3D18B 4KZEL 4XI5C 1E6OH 3FCTB 3RRQA 3UAEA 2XWEA 43CAA 1V8HA 1IC0A 2C1OA 2VT0A 5KZCB 1L9QA 1SLXA 5ABDE 5MEPA 1LEIA 4AK1A 4FA8A 2VLRA 2B7DT 2HLAA 2NT0A 4AK2A 1NUGA 1GGCH 5BMFH 3C5JA 4MVBC 1BIHA 2D8KA 3FU5A 2OMXA 5D71H 4WTZA 3RPIA 3O45A 3SZ6A 4F27A 4E9XA 2YBGA 4K9EH 1I3GL 1ZLVH 4A2GA 1S7VB 1ACYH 2PCPB 5GJSH 1D7CA 1B9KA 2J72A 1VJSA 5KTEL 4XMLH 4AV5A 1U3ZA 5DQ9A 5HGDA 1NDGA 3CDZB 3PUUA 2C9QA 5GRXG 2XWXA 2PO6B 2VIRB 3T2QA 4NWUL 3QNZB 3WFBH 1F4WL 1C16B 1XWVA 3Q1EA 3SJVE 4L1HA 4U1MB 1IGTA 4KKRA 5EU6D 3LXAA 4PJEB 4PMFA 2IBGA 3QEUA 1NTDA 4TLTA 1TZIA 4ZFFA 1JGEA 1JI1A 4ZG1A 3P4NB 4HW6A 3TA3A 3ZMRA 2OZ4A 4R3SA 3BRFA 3X11B 1R24B 5D70L 2VR5A 3MRMA 4NQCD 3X14B 4D9LL 5I1HL 4K15A 4N3TA 3P9LA 2IG2H 3W9EB 5JDSB 1A14H 3F64A 4JFSA 5KVFE 2NT1A 4TPRL 5IWLC 3UZQB 3NZSA 3KG5A 3HR6A 4EEEA 1G7JA 1ORSB 5SX5K 3E6FB 4XPGH 4WY7H 1CXIA 4GKSA 1XGPB 3H3KA 3IAGC 2E76C 5IMMB 2J5WA 4PCSA 2ZX8A 1T04A 3DXAA 4XB7A 2XY1A 2QQNH 4HUMB 5CEZD 4TPRH 2A0LC 2ZCKH 3QHTC 1G1KA 5L4JA 2G75B 3PWPD 4WEBH 1YNLH 2BPBA 2HRPH 5ABAA 3Q9QA 1K2DA 3O8XC 2FCBA 3UO8B 1YEGH 3N9GH 5IVXE 1BD2E 3FCSA 2R1YA 4PP2B 1WFIA 3MFFB 3ARFB 2IANB 2PCXA 1GJIA 2XTSA 5E8PA 1TKWA 2AANA 3F85A 2XWTB 4MQ7B 1WHOA 3M7FB 3MZTA 7FABL 4AKQA 3UGXA 4Y4HB 3ZIYA 1CE1H 1A1MA 3ENEA 1X5GA 4DGYH 5C8JA 4XXCA 3N0AA 3L9YA 1VAHA 3ZXAC 1M7DB 1J0IA 2FEDD 5TPWL 3LSOA 4HIIB 4FG0A 2XKUA 4RFNB 1FZJA 3HNSL 1CF1A 1S8DA 1SLWA 2FWOB 5F1IB 5K1JA 4DESA 4GI9A 4AKPA 1FDLH 5MENE 4IEFB 4KNSA 4XBMA 4A67A 1AIFA 4UTAL 4XT1C 1DCLA 3HN3A 5T1KA 4S1DD 2GTZA 1ROCA 3OKOA 3CFQA 3DVGA 2XG5B 4NAQA 4UTBL 2VR3A 4LQFH 4XNYH 4FQIL 3STZA 4MTMA 1N18A 1A7PH 2A4CA 4NRZA 2GHWB 3MN8A 1YEEL 2K4WA 3B9DA 3GSQA 4K23H 4FYTA 2CO3A 1KJVB 2XWZA 3IE4A 1KLGA 2C4FU 1E4JA 2VN3A 3DDFA 5FHAL 4LVEA 3WEBA 8FABB 1X7TA 4ZFZB 4KI5E 1ACCA 4KUZL 2W60A 3P4MA 3V6BR 1RU9L 2BSEA 1RZFL 1B3JA 1F41A 1R17A 5HDQH 4WF7A 5F7LB 2X3AA 3D4CA 5B38A 1BAWA 1RIUH 5F7EL 1DZBA 1XH1A 2FB4H 4X5WA 3VXUB 1USQA 1BF2A 1AZVA 1IGYB 4OCSL 3HI1B 4AYDC 2Z9TA 4NQDB 1QLEH 1ANUA 5FM5O 2AHIA 4L3EA 1D6EB 1T0PB 5JPNA 3U4BL 1MW1A 3ULVE 3LCYA 1L9PA 2A9ML 1GC1C 4E41B 5BQDA 3ULUH 2J55A 3KLHD 2ZXBA 4P4KA 5HDOA 3O6FB 4J3OG 3HNTH 4FZEL 2EDMA 5JHDA 2IGTA 3EG9A 1SYVB 3C09B 1XGZA 1MCOH 1GPOH 4UDTB 3BWSA 2DQFB 4GW1A 4OM0L 3RVTC 5DHXB 4PWFA 3CZNA 2B1OA 5HYFA 4WGWB 4KKLD 5H94A 3L4YA 1DJZA 5F3HB 5ILTH 1U8KB 1HINL 1YEDA 4X6BA 1T5KA 1V10A 4IEFA 1VKXB 3CPUA 4M6OH 3T4AC 2WBXA 2NY6B 2X4NB 4L29A 2J2ZA 5I8OL 3T77A 3IFNL 3D69B 5I19L 1WZ1L 1JJUA 4LKXB 3PGDB 5ICYA 1T1WA 3DX6B 2NR6C 3SYQA 1BVZA 2QGEA 4UMSA 3RWDA 4CVWA 2NX5E 4HJSA 3HS0B 2H1PL 3D1MC 1MWAL 2H0JA 2WAQA 1TNMA 5TDPB 4AENA 4OV5B 1SFDA 5DJ2A 1CGXA 4KRMB 3O41B 2F74B 4N9GB 3CFEB 3H6AA 1IFGA 1AQMA 1QFWL 1VGEH 4PJ5A 5ADOH 2HVKA 3IFLH 3LRSB 3QEQE 3UJIL 2AQNA 2F53A 1P7QB 2AABL 1M05B 3D08A 3N43F 2VDPL 4HIEB 3FRPG 4R5VA 4FG6C 2GC7C 2IGLA 1CFVL 3INOA 4H8UA 1ZOXA 4AT6A 4KTEL 4QF1A 5K59F 3AUWB 4B95C 2XFXA 1RK1B 1S9VB 3N6YA 2KH2B 3PGCA 5CCGE 3WIIL 5DHVA 5BVPH 3V0AC 1ZE3H 3A4EA 4KOCA 4XOBA 3SDCA 3LHPH 4PWIA 2I60H 4NKIH 3S35X 1KCVL 5IFHH 2QPFA 5EEXA 1EERB 3HPJA 3IMSA 2ITDA 4PS7A 2PWDA 4RVBA 1GZHA 4Q9BA 2QSVA 2J88L 3K72B 3VH8B 2X7LA 3L7FA 1TZIB 1H6EA 2WIIB 3ILEA 4LSPH 5CS7A 1T1WB 3DX6A 3I3DA 3MRCB 4NGHH 1SPDA 4PW3A 5GGVL 4WFGE 4BCZA 1DL7H 2YAEA 1NGWA 4RFOH 3FU0A 3G6JA 2X4NA 5K9OB 3S88H 4J8RB 3GHBH 4N6RA 4I48A 1IO4C 3GNML 4I89A 1DLHB 2I85A 3QUMH 4AYGA 1WFJA 3P30L 1J1XH 3SCMD 4XPBH 3NSXA 4JFPB 2M8XA 3IJSB 4KTDL 4LLDB 1J11A 4M5SA 2A74C 4Z0XA 5PCYA 3GJFA 5KSBF 4IS6A 1C8PA 4MWFB 1SJHA 1FQ9C 3UCRA 1F58H 2FJFA 1G9ML 1JK8B 1CK0H 1OAUH 2HLAB 4NSKA 3OAYK 2WQSA 2ZQKA 1WEJL 4KO7A 4DKAA 1B6UA 2I7SA 3X1EA 1EDHA 1HNFA 1BZQK 4YJZL 2CUIA 3OKNA 3QP3A 2CXKA 1MCHA 4GKZB 2NYYC 3VSQA 2JJTC 4TQPA 2Q0ZX 3QWNA 1NFDE 4LRNH 4CKQA 3AXIA 4NQDA 3EH5B 4RRPG 4BQ6A 1WAAF 1KXQE 3FQTA 1SF3A 1X3DA 1XGPA 1G9EA 5J3HC 4Y4FC 1WYJA 3LEYH 3F7LA 2E86A 4U6XA 3UOAB 3VGGA 5B38B 3QXAA 3TVMD 5I5RA 4Z3GA 2X28A 4FQXC 4YDKL 1YAZA 1ED3B 1WO2A 3FQ1A 5BXFB 4K5NA 5GS0L 1JGEB 2Y06L 1YUHA 2DLTA 4E42B 4ERSH 1ITCA 4YXHL 1XR8A 3CZSA 4KXCA 4MDIB 4IKNA 3TEXA 4XH2B 1L9TA 4B0MB 3KXFE 1NC2D 3W37A 1NC4B 3O4OC 1S3RA 4FYSA 3QNZA 3LEXA 1ASPA 2RAMA 1IKNA 2QPEB 4FCHA 4K3HA 4G6MH 1YJDC 2FGWH 2LTQC 4F8NA 3RPBA 3CVIH 1WBZB 4AM0Q 1H8LA 4A66A 3SDAC 2F15A 1XSIA 3ZYJA 2BDNH 4LMQI 3EHBB 5D7LD 2VAAB 2Z3FA 3WJLC 1YJDH 3MX0B 4KKAC 4UT9L 2AK1H 3IRCA 1JPTH 1RJCA 1VACB 2WO4A 1WV7T 1S8DB 2GPZA 2YRPA 5F8QC 3SSGA 4DUVA 3IDIA 1HEJC 1CLZL 3FO0H 5FO9B 4C57C 3Q01A 4ODBD 4UV7L 2YAQA 5ANME 4LOFA 4NHCH 3RZCC 4KAQL 1BX2B 1OGSA 3VXMD 2C7UB 4L1LA 4WWKC 2FDBP 1E3XA 2CJUL 3R7RA 3NT0A 2DWTA 2PCYA 3UTTA 4I3SL 4GIOA 2DDQH 2A1WL 4D9RD 4FNRA 2XWRA 2APBA 4KMTH 4PP2A 5AYUH 5FC9A 4Z3IA 3GIZH 3BH4A 5K9JL 3SPJA 5LNDA 4PUBH 4RETB 2GTWA 2YQGA 3L3JA 1P84K 4DVBB 1DVXA 3LVTA 3QIWC 5HY9B 3APCA 4J2XA 3T71A 3IDXL 3T8MA 4AIEA 3MCKA 3R1GH 3VD4A 2ZWKA 1BZOA 2JVUA 3DSNA 1D5IL 1OPGH 4LCCB 5E8NA 3TPUB 1KDIA 3TYGL 1TJGL 5AOJA 2X2JA 3G6DH 2I27N 5E9AA 5F9JA 3W56A 1M7IA 4QWWC 1BGXL 3T1FA 3WN6A 3WJJA 2QZ5A 5I23A 1RVFL 3US1A 1S7XB 3ROLB 4QHLA 2V2XB 4PH8A 5I5MA 3HA0A 5CBEB 5T3ZL 3RYMA 4QXTB 2EE3A 2OM5A 3CXDH 1KTKE 4PJDF 2NW3A 3X11A 3KPLB 2Y1ZA 5CD3A 3VGHA 3S88L 5CGYD 5JR1H 1Q0YH 4WK0B 4KDVA 2YMOA 4XMZA 3CK0H 3PS6A 1UWXK 2DAVA 5JOPD 3J27A 4PD4J 1AGDB 2P26A 4PLOB 1AR1D 2QFPA 3C75A 1U58A 4XOCA 4MZ3A 1VGKB 1T5WA 2FD6L 2OBGA 3B2XA 3D85D 1V3KA 3G3LA 3QCUH 3TJEH 2CIIB 2HT3C 4X6FB 4DW2L 3L13A 1EJ8A 4N0CC 5D1QC 5BVPL 1BW8A 3MA9H 5CSZA 2F7IA 3TU6A 2HXAA 1U0QA 2AJYL 3IAQA 1T03L 3K2MC 5DMKB 3UH8A 2XZCH 4L8CA 1DDTA 1F2XK 3EOBA 1W0VA 1J0YA 4OM1L 3K8KA 5C0AE 1UQSA 4QR7A 3DYOA 1BJ1H 4M6AA 5J1SC 4KTEH 4GT7A 4A7QA 5IZ7A 1JXKA 4JY6B 4Y2OB 5D1ZI 2BP8A 3DK0A 3OWEA 1RUMH 5IVXB 1JNHB 5DQDL 4J3OH 1TDQA 1HXMB 4JE0A 2F2HA 4PIBA 4KI5F 4ZUSB 2C3VB 2FNWA 3BW9B 4OZGB 4C4KT 4E9RA 3BDXA 2E7CA 4YFLI 2H32A 4HG4J 3H9HA 2IAND 1T1XA 5AW1B 2VMDA 3MBXL 2ESVA 3IDIB 4J12A 2H1PH 1NBYA 2F7PA 3IN2A 5CJXC 2C9PA 1EFQA 1XH0A 2WD0A 2VDMH 4ZX5A 4PJGA 3LIZH 2RH0A 5HYJE 3N44B 4K94L 4AMXA 1ZVSA 5F8RC 1Z9MA 3EOAB 3CMGA 2AQ1A 1MLCB 4OF7A 4KITB 4FTVB 3S5ZA 4P2RE 5L2JB 5EEZA 2BIPA 1XB6A 3O3UN 2BM3A 2CGRL 1EXGA 2A74A 2YXFA 4IMLB 5DJDB 4YWGH 3RKPA 3QWQB 4IDLA 4DP9X 4JDEA 3SJVB 5AZEH 3FB8B 5C0CA 4WQOA 3ULSA 2D7TH 3KBPA 1I1FB 4JPKL 2DQIH 2D4DA 1SGKA 1OE3A 5T5FH 2P42B 2W0LA 3IAPA 4ADGA 4J6RH 1AGCB 2NZ9D 1RURL 1CG9B 1G7QB 4HLZH 2W0PA 3MCLL 3VFVB 1FFQA 2VDRB 1IU1A 1T2QL 3QFDB 3V0JA 4F1ZA 4PJ9B 2A9AA 1OALA 5HBBA 2UY6A 1XF3B 4CU8A 3D39E 2NY4B 3VE0A 4KHTH 5E1IA 1NSNH 2Y36L 3CXHJ 2ATPA 3LTVA 4XP1H 2ZG3A 2HRGA 2UY6B 3IDJB 4LL1A 3ZKQD 5F3BB 1E8WA 1NJ9A 4JRXE 4Z7NE 4H8HA 4YDNA 1V7MH 3OKNB 3BQUA 3QYNA 3W9DA 1EEZB 3MXWH 2YOAA 2C3HA 5KJRL 3Q6GH 2QDVA 4L8CB 4PJ5D 1XGRB 5GGSA 4X6CB 1TTRA 2V2WB 5I6XC 4C8XA 2WINA 4EI5C 3EJTA 3DBXB 1Z32X 3KJ4B 4UF7C 3ATAA 1P6FA 1AHKA 1A66A 1RFDL 1BIIB 1CGYA 3H9SB 4XBGB 3QI9A 2HG5B 5E1GA 4OAWA 3O6FD 3SGDI 2BFVH 3NJMA 4I48B 2PLTA 3DPBA 2BSSB 2A99A 2VMFA 1A7PL 3LN5B 4U1LA 3W11C 3WFEH 2ZUVA 2BFGA 2X12A 3MBEA 2K1MA 2VXQA 1K5WA 3JWDC 4RFEA 4BYHA 3DGDA 4BRVA 1EUTA 4ISVA 5AAMC 4WEEA 3TO2A 1K85A 3KPSE 3JYCA 3HG2A 4NEHB 2DIAA 3AM8C 3QNFA 4LOEA 1K4CA 3F6LA 4OGQC 4C47A 3AY2A 4B96A 4Z7QE 3QQDB 1E5ZA 4GSDH 4XVJH 5IMOB 3SDYH 1PLBA 4H20L 5DMIL 2LTQB 3BP5A 1E27A 4TNVF 1A1NB 4Q9QL 4N26A 3MOAL 2TRYA 4Y2DC 2AKRA 4M7LH 4J4PC 2X4RA 1ZANL 1MCWW 2NY6C 2Q7YB 4KTYA 3WNOA 3KXFD 1URZA 2XA8H 1QBMH 4L4VA 5I71C 1SMOA 4JY6A 4Y2OA 5BCAA 4GKLA 4G7RB 3BSZH 1IVLA 3RUGE 5FCSH 1KYFA 3GKWH 5AB1A 4PJAA 4O00A 1KPUA 4M7LL 1CICC 2ADFH 1AACA 3MDJA 1ZGLM 5IBTL 3RNKB 3LNEA 3FHAA 3O6KL 4WI3A 1PKQB 4AGMA 1ZDQA 2BLFA 5HHXL 1JK9B 3GSWB 2D31B 5L2KB 4Z78A 1C1EL 1AP2A 2MNJB 3MRLA 2K3TA 5D9SB 4ADJA 1U8MB 5J1AA 1IMHC 2NUTA 2VR9A 2DWXA 1H3VA 1RIHL 1S7SA 1JCKA 4N6RB 3DSFH 3FDWA 4X6DF 3JWOC 3BKJH 1A9VA 1WFTA 3MRPB 2YZ8A 1MIEL 4N3UA 1F3JB 4IBTA 4LCYA 4GAGL 2X4PB 2HTKD 3FFDB 3CLWA 2H4EA 4LDEB 2BFVL 4Y4KA 4V2BA 3E0GA 4AWJC 5C0ND 5KVDH 2VAAA 2Z34A 2Z7WA 5LBGA 1I8IB 2GCYA 4QRBA 5CBEA 3KPMB 1W15A 1ZSDB 4FDWA 3ZDZE 3HC4H 3I75A 1SN0A 5IG7B 2FJUB 2K78A 4GXFA 3VU2A 5A2IH 1WUNT 3BUQA 4YOKA 2L3BA 5D1XD 2CMRH 1XBDA 2Y25A 3SE3C 4JFED 4QF1B 5GRUL 3S37H 1PZDA 1UXWA 4Y16A 1NLBL 1DJYA 3T4AB 1CURA 4X9BA 1CE6B 5TK2A 2YGVA 3EJZC 5BS0D 4N86A 1FNHA 3NK3A 5E56A 2O5NA 5E99L 2AK4B 4MA8H 4LVNC 1PW3A 3NPZB 5I82A 4ESKA 3D6GA 2NUPA 3IBOA 3MRDB 2BVQA 2VKXA 2F58H 1YDPB 3NFPA 5DZJA 4AQ8A 3N0PB 5DJ6A 5A7BA 3ZKXC 1DSFH 1YPZE 2B1HL 4EDWL 1JZDC 3A67H 3BEWA 2ETWA 1U4FA 4FQCL 2ZCHL 2GEQA 3T0XA 2CCWA 1G7LA 4DQOH 2FYYA 5D1QE 5F9OH 1DUYB 2VDNB 4BINA 3OSKA 4ONHB 5F1NB 3T09A 2O93L 3N44F 2VQ1B 1AD0B 1ECZA 2O61A 1G43A 3M7OA 3QAZC 4L1BA 1E9OB 4QRFA 4M62L 2ARWA 1NIAA 4D3CH 3MSPA 4M1DL 5GZOD 2AITA 4LLQA 1JNNL 1L7IL 3ETBF 3ZDXF 2PYFA 2QGDA 1G6RH 1JV2A 1Y7VA 1QVOA 4HIJA 4LL9A 4OZGF 2WJ7A 3QHFL 4G72B 2CHDA 4I3RH 5IHUL 2PYFB 1ZLEA 2HG0A 5IQ7L 2Q7NA 3TN0D 5C0EB 1NKGA 2KL6A 5LJYH 4P0DA 4S11A 2B4CC 3FQXA 3ALWA 4K3JL 5BZDA 3S8GB 1T1ZB 2G3NA 2CA4A 3PWJA 3GBDA 3KPSD 3TZVB 4HWEH 5JYMA 1JHTA 2DWDB 4OFQA 2ZG2A 2YC1A 4UAOB 2ZX9A 1NGYB 4M8QB 2YA2A 2FJGA 3F04A 4N25A 1TJHH 4Y5VC 1PEZA 4Y4HA 2Q8BL 2YD5A 3VM5A 4BFIA 4XXWA 1KJ2B 4KU1A 5G5DA 2XSKA 3QT2A 2Q8AH 3HZKB 5DUMH 4N8UA 3UJJH 1HL9A 2BS9A 1JTOA 4PJHB 2G9HA 1I9IH 1T66D 4K8RH 4OM1H 1AZCA 4YQXH 3CPLA 3P4OB 2WWKT 3VNYA 4WW2B 2H7WA 5EMYA 5MERA 1CS6A 3QIWD 5CWSA 5IB5A 4HK3J 2BZCA 4N0UB 4CADB 5DHYA 1CGWA 1J05B 3CDGA 4GKZA 5CP3H 3IPEA 1N7MH 3ULVL 3QJZA 4A38A 4N90D 3VQ2C 3A5VA 1NOAA 3CVDA 2QBWA 4KFZC 5KAQF 1AZZC 4XXCC 2ZUUA 3QISA 3PWPE 1NH6A 5D1QA 3OVUB 3CGTA 1BJMA 3EFDH 5HGHB 2OR7A 5AKRA 3CK0L 2PYED 2CBTA 3IPBA 4FQ2H 3RI5K 4OLEA 3X14A 3MYZA 4M7ZC 1KN4H 3ZSTA 4PI2A 2K6ZA 3RWDB 3SGDH 4OKDA 2EDDA 4W68A 4Q6IC 3SYCA 3VWKB 4YLBA 2DQTH 3PQYB 4A1RA 2EKSB 1DO6A 2VDLH 3BVVA 5DGRA 1F3JA 1B0IA 1MAML 1XR9A 1MVYA 2ITEA 3O6LH 4N1HB 3D69A 1GS6X 4K5OA 3SDXE 1KACB 3WS3B 4P3DA 1DVFC 1S7SB 4CKVX 1MZZA 4OJYA 3L3IB 5CCHE 3NDYE 5D7JC 4GRWE 4ZMLA 2YEVB 2Q5BA 4KY2A 4O51A 2J5LC 4QYOB 3DMMA 4R4FH 1RULL 5F3FA 2MJWA 2YEZA 3GIVB 4L4TB 5D1QD 3H0TB 3RGVA 5J11B 2Z31C 1A4CA 3B1TA 3G7TA 4EE2A 4PUBL 3BIAX 4H88H 1K2DB 2P46B 3DETD 3DV6B 2V9RA 4AUYA 1HHGA 2QPDB 2Q1EA 3MR9A 5K1NA 5AG8A 2XWCA 5DRZB 4K73A 4WW2A 1TZGL 5I1KH 5DT1L 1AG0A 2XTJB 4QRSB 2UUDK 3MC0A 3ALPA 2H6OA 2Z35A 5BS0E 4ZSOE 2EXYD 1KXVC 1T7VA 1Z0MA 2EH8H 3QDGD 3GJEA 3QRLA 2DWEB 4N5UA 4J2QA 3ZZQA 5JZ7C 4WWKB 3TCTA 4KV5E 3HZMB 1NCWL 2Z93A 1GY2A 1JV5B 4JO1H 4WI6A 4C55A 2EC9T 4UZGA 5KYYB 3VWJD 3KWWB 1E3ZA 1LP9B 2LAGB 2P5EB 2VC2B 3EBAA 5C0AD 5JHLL 5JXAH 1YEHH 1FUNA 1AKJB 3T0EC 3MLVL 1BPLB 2X6BA 3QPQD 5DHEA 3WN5A 1GC1H 2W9EH 4S0HA 3GINA 1H0DA 3JV6B 3KYMB 4G42A 3TV3H 4JHZA 2BS71 3MRJB 4KK8D 2FLBT 4WWID 4PJAE 2B9AA 4LCWA 4LDLB 3WIHL 1BPVA 2PCPA 2OL3L 1CJYA 1CZ8L 4FABH 2RHEA 4R90L 4U2YA 1AS8A 1TCRB 3VYNA 5CEYB 3FTZA 4L3ED 4F57H 5FFGA 2AF2A 2VN6A 4POUB 4ATTA 1YN7A 4IGBC 4DAGL 1JFQH 1XIWC 2HKHL 4HJGA 2DJSA 2ZWZA 2C9UA 3O6FA 4MNGA 3OZKA 4IKIA 1INDH 2C1OB 2Y6SC 4QNPF 1LEIB 4OZIE 4ODSH 1ZHBA 2ZONA 5F3BA 1ET5A 4A37A 2YRBA 4JNXA 3IGLA 1GCYA 2LGNA 1F11B 5KSAD 3SDXB 3QH3B 1C5DB 1C5CL 1G7LB 1Q9WA 2EIMB 4HS8H 4BWWA 5KYUA 4H44C 4S1SH 1M53A 1OKEA 3ARFA 4LLVA 3L4ZA 4OGYH 4U1GB 4OCXL 4XC3L 4XP9H 3FYEB 4P57B 5IVOA 3DVNA 2XLLA 5FA4B 1IGMH 2FECL 1UJTA 1WQVT 1I7ZA 4HBQA 2IAMC 4B27A 4N24A 1S4IA 1UJ3B 3NJVA 4HCRH 5KVDE 4GUPB 3EO9H 4IRJA 3APNA 4NC1C 4F58L 3ARED 3MRIA 1GRWA 2JJWA 4HH9A 1E4WL 2JIXB 3P3RA 4MAYD 4ZPTA 2YD2A 1JZ6A 3GXPA 4F91B 1UXWB 4PJIF 1N6VA 3KDMB 3S96A 1ZLSL 3UYOD 4PRAB 2IFGA 3WLBA 4NJ9H 1OCWH 3AG2B 4JBSA 2IQ9H 1BLNA 1EZUA 1TZGH 1KEMH 2FVNA 3LRLA 4JANA 4WU5B 2VERA 3RY6C 5I1KL 4J39A 2YD9A 3RAJL 2FO1A 3AY4C 4U1NA 5F88B 1MUJA 3ASNB 4PJHE 2Q9OA 4OLYL 2Y5EA 4OQTA 5HDRA 4FQ1H 2HUEA 2X1QA 5JLZB 4D0BA 3DLQR 3DV4A 3DX2A 1KN4L 4V33A 1SEQH 3IU3A 1KOAA 4HIIA 1A65A 2GJ6A 4HUUA 5AAWC 3EYQD 1EMTH 4F8QA 3PWUB 2F8IA 4YR6A 5IJVB 2E7LA 5EBMB 5C8JB 1OT1A 3IDGB 4ZPVA 1TR7A 2VE6A 1F4YH 1OSPL 5IB4B 1TSRA 4ZW8A 3ARDC 4LPCA 4J4PD 3HE6B 1OM3L 4MA7L 1QSED 1S9WA 1VLXA 2YFOA 1NOFA 3QGVA 2JELL 5JPNC 2IANA 3TS8A 2VDNH 4YDLC 1FG9C 2AK4D 4M4PA 3MNZB 1R9FA 4JHBA 3TT1L 3ML8A 1I1YA 1J1OH 2CHZA 4JQVC 3VFSB 3CCHA 3TTSA 3PPEA 3IJ9A 3AAZA 3QS2A 5HYQA 3VD9A 4H4NA 3CCHB 2B5IB 3MNZA 3D51A 3TONA 1NEPA 1UC6A 5CGBA 4W9FC 4WWOA 5I24A 4AZ8B 5BJTB 3UPRA 1N8ZA 1A7OL 3DKHA 12E8L 1UT9A 5IB4A 1E0OB 1MQKL 5C09B 1U58B 2YXMA 1UM5H 3T3PB 3L5XL 3DRQB 1MPAH 5MEQB 2QGBA 3OAUH 3V8CA 1AIZA 3VG9B 5CAYB 1MI5B 3FTYA 1WZ1H 2BNRB 5E4AA 5GRZA 2A0LD 3NZHL 3IFNH 1F4XH 2HT2D 2Z92B 4W81A 2ENQA 3D30A 2UZYB 4GRWF 3APDA 1AFVL 5C08E 4R2GB 1CVSC 4K94C 5GGVY 4D9RE 4GO8A 4JDVB 1MUJB 5HYJD 4ZYKA 5EF2A 2VDMB 1U8IB 4MB1A 4X7SL 3U0TA 3HW7A 5C07A 4YE0A 1U8HB 1UADC 5CJBA 3VXRE 3TJPA 1JNNH 1L7IH 4ONGH 2Q8BH 1EEUA 3DPBB 2WBWB 2HVBA 2LHAA 4M62H 4YDLB 4PJCB 1G7IA 2W9EL 3GXMA 4G2AA 1A47A 1FNEB 3P3TA 2P5WD 1BFVH 3QUHA 4HWEL 2Y7QA 3LNHA 5C3IA 3FCBA 5E8NB 2AZUA 2NY5H 2OMXB 2WCGA 1WE5A 3U4BH 4LIQH 2FIKB 1PJWA 1I82A 2JI3A 4XVUD 3FO2B 5C1MB 1P2CB 4M1GL 3TX4A 3ATDA 2VLRB 1UH3A 1NCWH 2W81C 4HPHA 5CEZH 1IGJB 1EAOA 1KZYA 4NQQA 3S97C 4P57A 1XZ0B 3HNVH 3MFGB 5KVFL 2KZKA 2DM7A 5ACMA 5IEKA 4OUUA 2AEOA 3AY4A 3DUHA 4Y5XB 1NGQH 4YFLF 4GY4A 1ZGLB 1A25A 1JNHA 3QIWB 3S9DB 3QH3A 5B22A 3DTXB 1BVKA 1MEXH 1S7UB 2MOQA 3EO0A 5D7EA 3W3BA 1GIGL 4HJIA 5EC1A 1QBLH 3JV5A 1Q1PA 3QS3A 3SDDA 4KY1H 1EHLH 5T1JA 3F3HA 5L2KE 4QPEA 4TNWF 5CP3A 5HDLA 4PS3A 4WW1A 1PKQE 2Z7UA 4DQOL 1ZLDA 4YDMA 3RVVD 3UROR 1ASQA 4N2LA 4CW1A 5ID0A 3RVTD 3TPKA 3IYLW 3MX0A 4UTBH 2CDFB 2OTWA 2JTDA 3F6IA 2DN7A 4PJ6A 5JPMA 3X13B 3SJVA 3TASA 4I4WA 3KWXA 3UBXG 5IM7B 3W57A 3VGDA 1QFUH 1FDLL 3U4EB 2WLIA 4KKCD 3K5SA 2WMPB 3H8NA 3RDTD 4H0IA 4PB9H 4FNPA 4QNPE 3TN0C 4RZCB 1H0DB 4G42B 5LUMA 3LEXB 2XVGA 4UBDD 5C07B 1P5VA 1YVLA 3X17A 1E5YA 4XAKE 1J12A 1TQCB 3RIFF 5HP5A 3RZCB 4XB3A 5M94B 1KWKA 1EO8L 2NLJA 2HN7B 4K8RD 4OLVL 5KVEH 4ZUWA 1MVFA 5T1LB 1BZDA 1TG8A 3V52H 2N7BA 4U3SA 4DKFL 1RJLA 4JFFA 3ZX1A 1QHOA 1P4IH 4P3CH 4WWKA 1F90L 3GJEB 5JMOC 4HXBH 3KPSB 1OY3B 4W9ZA 4XHJD 4FLSA 5I17A 4WFGD 2XRAH 1NKRA 5K9QG 1SZNA 1YAIA 1HCZA 3HBQA 4UTCA 1CXLA 4JDZB 4B7IA 4UINL 4DOHE 2ZSWB 4JJHA 2CRYA 4L2LA 1J9CT 2DJUA 3MA7A 5D2LB 4C4UA 1F0LA 5JO5A 1JZ2A 2XTJD 4DVBA 5EIIA 3HAEA 4MJ6B 3ZHLA 2JK5B 4CN1A 2CK0H 2NQ3A 3CZUB 3GMPB 4OCMC 4K8RL 3DJ9A 2ENSA 3MV8E 1NBZB 4ELMB 2VXQL 2YLKA 1MW2A 1WGVA 4OLUH 3QORB 3VXUD 1X5IA 5KS9E 2O6DA 2ATAA 4PHXA 1DBKL 3D2UB 1P84J 2IEPA 5TGBA 1P6WA 4MBOA 3AXLB 5E24E 2NY3C 2ZXAA 4WW2C 3OAZK 3SPVB 1OGAA 4YC2C 1PLGL 3ME0B 3QR1A 4Y88A 1SJMA 3LY6A 1CDGA 3ZPDA 4G1EA 4O5LL 4ZMZA 2EABA 1U3JA 5EG6C 3GLEA 1XIWB 5C0BD 4YHLL 3W0WA 2QKSA 5EF0A 3UZEC 4G9DA 3LMJL 4ODVL 1DBJH 5IHUH 3HE7A 1B2WH 3TBYB 3WHE0 1ZGLP 1I8MB 4PGCB 2YN5A 1M9SA 3NEXA 4UZUA 4PCTA 3F5WA 4KK9D 2N01B 2BP3A 3VXSB 5DWUH 4YDJA 1GY1A 3CSYA 3PAUA 1R6VA 3F58H 4C56A 5KN5B 1XR8B 4A2DA 4TUKH 3WI9A 5FK9B 1UWGL 4UNIA 1I7UA 3CSGA 3FCGA 2CRIA 2H32H 2ZYHA 4XNBA 2J25A 5EIVA 2V5MA 1H19A 2XKNA 1DSFL 4J1UB 4ELKA 3TBVB 2F68X 1P7KB 2J6EH 2P45B 2ZKHL 3KEHA 5E8EA 5D93C 4XR8C 4LLWB 3L1FA 3O41A 3VRLE 5DK3A 1FHGA 1NGXA 4JKPL 1FH5H 2E27L 3D85A 1E9QB 4MAUH 1SXAA 1FFOA 1JWUA 1X5JA 2W07A 4BZYA 3V95A 1OARL 2NY1D 2AJXH 2PXYA 1MJUH 2YK1L 4I0PD 4I0KA 2Z0BA 5DD1H 2PTTA 2WQVA 2Y7LA 4H8WH 3EDFA 5E94B 5ADPH 1LJMA 4QXWA 3B83A 3JTTB 2NSQA 3K6IA 2DI7A 5KS9F 5A2AA 4J6IA 5IW3A 5DJXA 1KV3A 2X89A 1HHKA 3MQIA 2IOMA 3VVVA 3DO7B 3WAKA 1T2QH 5EH1A 2MHAA 1TLMA 1YA5A 1G0YR 3I9AA 5H4ZA 5FYJU 5BRPA 2BVYA 4JG1L 2NY7L 4F7PA 5AB2A 4MCMA 4IGBD 4U7KA 4JMNA 5LBSH 3GMMB 1TTBA 3AADB 1TETH 2Z4QA 1IL1B 3BD4A 3IK2A 4NC0B 5C0FA 5JHBA 4NNPL 4PJDB 2WKOF 3VWKC 3LHAA 3KCWA 3CG8A 3ZMNA 2J1KA 3NN8A 3B7TA 4L3EB 4N87A 1OAQL 1DUYA 4AQAA 2W92A 1PCSA 2VRQA 2ITDB 1FYTA 1MRDL 1YYCA 1QRKA 1KGYE 2QQKH 3BKCH 5C08A 4Q0XL 4X5WB 3VXUA 4DEPC 2F1BA 4XZUA 4MCYB 5FS5A 1PD6A 1FIGL 1W0WB 2ZUQC 4KKAD 1RXLA 2XZCL 3QWOB 4NO2B 4QO1B 5EDXA 2BVPA 3L5WB 5FOJA 1JXFA 3PGFH 3PXJA 1LO3L 1UURA 3T4AA 4ZJ9A 5D2NE 4NIYE 3HUJB 3ARDA 2V7HB 4K71B 5GGSY 1L6ZA 5DD0L 4ABVA 1D5RA 3L5XH 5F96H 3GSQB 1FO0A 2V9TA 3NFSL 4CU7A 4BHUA 1SJHB 3P54A 1BQHB 5DYFA 1HKFA 4M48H 2GB2A 4UQ3A 2E7HA 2PP7A 3EF4A 3X1FA 5AW9B 1J86A 4ELDA 3OPUA 4BD4A 2RCSH 4PJ8D 4B9PA 5CGMA 3QNXA 1OCCB 3PGDA 3HFMH 4KX9A 1WIUA 1NC4D 2R9H