1ZXKA

Crystal structure of cadherin8 ec1 domain
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
98
structure length
96
Chain Sequence
SWVWNQMFVLEEFSGPEPILVGRLHTDLDPGKIKYILSGDGAGTIFQINDITGDIHAIKRLDREEKAEYTLTAQAVDFETNKPLEPPSEFIIKVQD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Type II cadherin ectodomain structures: implications for classical cadherin specificity.
pubmed doi rcsb
source organism Mus musculus
molecule tags Cell adhesion
molecule keywords Cadherin-8
total genus 18
structure length 96
sequence length 98
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00028 Cadherin Cadherin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.60 Mainly Beta Sandwich Immunoglobulin-like Cadherins 1zxkA01
2OMUB 5JYLA 3PPEA 4AQAB 1O6SB 1ZXKA 1Q1PA 2WD0A 3LNEA 1NCJA 3Q2VA 4ZMOA 3QRBA 4ZMTA 3K6DA 4APXB 4ZMVA 3UBFA 4AXWA 1SUHA 1NCIA 2O72A 4ZMNA 3FF8A 3LNIA 2WBXA 5CZRA 2YQGA 4ZMWA 1ZVNA 1FF5A 4NUQA 4AQEB 4XXWC 3UBHA 5JYMA 3MVSA 4ZMXA 3Q2WA 3Q2NA 3K5RA 4ZI8A 3LNDA 4NUPA 5CO1A 2OMTB 2WCPA 2OMXB 4OY9A 3LNGA 3K5SA 2OMYB 3UBGA 2QVFB 2OMVB 4AQ8C 4AQ8A 1NCHA 3FF7A 4ZMQA 4ZMZA 4ZMPA 1OP4A 3LNHA 4AXWB 4APXA 3K6FA 4XXWA 2V37A 5DZVA 4ZT1A 4AK1A 3Q2LA 2EE0A 4QD2E 2WHVA 3K6IA 3LNFA 2A4EA 4ZMLA 1L3WA 1WYJA 4ZMYA 2OMZB 4AQEA 2X2UA 4NQQA 4NUMA 4ZTEA 5KJ4A 1WUZA 1NCGA 1EDHA 2QVIA 2OMWB 4AQAA 2A4CA 2YSTA
chains in the Genus database with same CATH superfamily
3VGEA 1A7NL 2VH5H 4HAFA 4HZ1A 1KZQA 1ANUA 5EO9B 4GXVL 5HHMB 2A7BA 1NM9A 1OM9A 1DVQA 5CSGA 1E7UA 4B27A 3VQ1C 1IAKB 3E8UH 4LKXB 2HRPH 3FO2A 4YDIH 5TDPB 4WNJA 1F8TH 4OGYL 4W68A 1DFBH 5E51A 1ET7A 4OGAC 2CBOA 2JKWA 4PTTB 3FT2B 1DZ0A 3UTSE 5EIIA 4KI5F 4M1GH 4PG2C 1EMTH 4JZNA 2O72A 2A77L 3MR9B 2EIEA 3OLIA 5LBSH 3FQXB 4ZNEA 3GMNA 4HMCA 1T66C 4CC4A 5IOPB 3NIFE 1N19A 2DQUH 1PY9A 3DX9A 5DVMA 4AQ1A 4OFIA 4X7CC 3P0GB 2HWZL 4FQ2L 1KGJA 3K2IA 5ECJE 2J3SA 2Z0UA 4N24A 1KJ2B 2YAHA 3US1A 1EO8H 2OSWA 4QHKI 3MGTB 2G2NA 4HHAB 4PY8J 4QHMB 1RUMH 4JUTA 4PJDF 4ZSOB 4AKQA 5JDSB 2HH0H 4NUPA 2G60L 4OUUB 4DGVH 5E1AA 2Q7YB 3K2MC 4EKJA 1NFAA 4P2QD 4YHOL 1I82A 2NY5L 4Y4HC 1P7QA 4G8EB 4QRRA 1IBHA 2V6HA 3QI9A 4UDUA 1U3NA 3ZGIA 1B4LA 1R3JA 1DTUA 1UA3A 4YFLF 3F64A 4FEIA 4KXBA 1GZHA 3QGVA 4U1KA 1H5BA 1CICC 2H3XC 2GTWB 5GIRA 1HQ4B 3KZ8A 3ARTA 1J0ZA 4U1NB 1JYXA 4YHZH 3VWJD 3V6ZB 1A1NA 3V6ZA 1BIHA 1BAFH 5FM5O 3RL2B 1ODUA 3CE1A 2ZX6A 2ZSVB 4BH8B 3JV0A 3L9YA 1BD2E 4HBCL 2Q8BH 3VFPA 1AGCA 1F4WL 4MA7L 1T7WA 4KX8A 5AOZA 2NNCA 1JXDA 2H32H 2WQUA 1B2WH 2X12A 4IRJB 4ONFL 4RZCA 2X70A 4L3AA 4RFOL 4PS7A 2AZUA 1YYLL 4CADB 5L9DL 2Z92A 5IB2B 2FNBA 5GS2D 5T1KD 1UCBL 2BSED 3FFCE 1TLMA 5EU4A 4Y2NA 4KKBC 3NZSA 1IKFL 2X4QA 4Y0GA 3BRDA 1KJ2A 3N42F 5A2LH 2K7QA 5GS1B 4QLWA 2VKXA 3BQVA 4KVCL 4ZUUA 5KSAB 3JTSB 1CL7H 1KCLA 4PGCB 4C57C 2XWRA 2PO6C 2FHCA 4WHTA 4XCNB 4CNIA 3RZCB 4YNYA 1JOIA 1D9KB 2QQKH 4PJ7F 2VDOH 3FQXA 3HFML 1TZOA 5DRZA 2Q76A 4L29A 2Q6WB 5T1MB 5T33H 4U3HA 3QEHA 3WKYA 4MJ6A 5EU6E 3ZLQC 5LDSA 5IW3A 4LIQH 3H55A 4PJXB 4UF7C 4DP8X 4YPJA 4PJIF 3GC3A 3QPXL 1A4KA 4GQ9L 1OCZB 1QFWL 1S7VB 2EXYD 4JZOA 2VSKB 5I6NA 3ZL4L 1C7TA 2EXYC 3FPXA 1EEZA 4Y16B 4JRYA 3JWDL 1Y0LB 4P5SA 5C0CE 3FUHA 5CU9A 1OGPA 3IPFA 4XO5A 3DMMA 1R5WA 1MW2A 1A6PA 5IREA 3MRPB 5KVDH 2V3DA 3I50H 3M46A 2VL5B 3JVGC 1BVKB 5CCKL 4GH7B 5KBDA 5GSRB 2CKNA 2EC9U 5E00B 1DJYA 2MCG1 4JR9L 2YFNA 4P2AA 4UQIM 2R2EA 4JZJA 5HGBB 2BVTA 4LNRB 5IBTH 3O45A 1AP2B 3SDXE 6PCYA 5LGHL 2VL4A 5C0CD 3UBHA 3Q1EA 1SZNA 2CNYA 1AO7E 4F27A 3QFJD 3L5JA 2JKRM 3RG1C 1DVYA 2OMTA 3QFJB 5JXEA 4RSVA 5AL8A 3UYRL 2H0EA 2XXMB 3K4AA 1NCBH 4JY5H 2WCPA 3QZWG 4C59B 2OMXB 2DB8A 1TTFA 1KTDB 3NP4A 1BEXA 1AS8A 1UADC 2R1XB 3L8QA 1EFQA 1ZXQA 2LGNA 3MUJA 2DWEB 4ZUVA 2BP3A 1KN4H 2XN9E 5PAZA 4JHAL 4FMKA 4ZUTB 4QHUB 2FH8A 3GSWA 1S46A 4UTAH 1OTUD 4LP4A 3C9NA 1YY8B 5C86A 2VDOL 3HFMH 4JFQB 1LO2H 4ZUSB 5E9NA 3UROR 2NLJB 3H9SB 3GJEA 3MX0B 1F18A 5BS0B 4EI5B 5DJXB 5CP3A 4OJYA 3ARBC 1LK3H 1M2OA 5DHVH 4FTVA 1QBMH 3NN8B 3TBSA 5IMMB 3H3PH 4P3DB 3A47A 2D03L 1I8IB 4JFOB 1B88A 1XGRA 4Z95L 1E28B 2GJZA 2IALA 3LX9A 4X5PA 1OALA 1DEEB 4R7XA 2A9DA 1MJ8L 4X8JB 4CC4C 4LCVA 1WEJH 1FLRH 3VXQB 4WJ5A 2VABA 3TZVD 3QUZA 5EZJA 1QPKA 1ETZB 2XFGB 4IU2B 2NTSP 3K72A 3GXTA 3WKPA 3CCHB 2WBWB 3QC6X 1TQSA 2XPZA 1T66D 4HXBH 1I9IH 1Q4NX 4KVCH 1DVSA 2TSBA 2HA1A 2CLVA 1I1RA 3AQYA 4X5RA 3VX1A 4BUQA 4ZQKB 5K39B 5F3HA 5FCUH 4E5XB 4W6WB 5BO1H 2V5TA 3K72B 1XVSA 3OJDA 3UAAA 3M17B 5F7WC 4DGYL 5DUPH 3HS9A 5IROC 1YMMA 4IOSD 1ESOA 4M1DH 2DQFA 3FTUA 3FONB 5E9DD 3L54A 4NFCA 4HOXA 3IRZA 1PJ9A 1NC4D 4J3VA 3UJTL 2OL3H 3QJVB 1A3QA 2KDYA 2Q2EB 4N0UE 1P84K 1FF5A 1FWXA 2ICEA 4QRSA 2ZUQC 3A5VA 2R9HC 4ZOAA 1UGKA 2BNRA 4HKZB 1D7FA 3I9AA 5F0LB 3UDWC 4X6DE 1JPTL 1Z7JA 3FCUB 4BA8A 1JHTB 2VDNH 3P3SA 3C09B 4H7VA 4DFHA 3IJHB 4GAYA 4PRID 4P2OD 4P59H 2QVKA 2NY5H 4ZOCA 5BRZA 3L3KB 4HEME 4FABH 2LFEA 1NAMA 3BVVA 4FLHA 3FQNA 2P9RA 4NNYA 1AE6H 1UOLA 3L9RB 5IBTL 2HT3C 3DURA 4HGWB 1H8SA 2BNQA 2AKRB 2AEIT 3FU3A 3ME0B 4KK5C 4QHUA 5CLYA 3S8WA 5CUSL 2R2CA 1PVHA 2J57A 1O9VA 3VWKC 4AV5A 1Y18B 1GAFH 2HWZH 1E4XI 4FQ2H 4P9ML 4NP4H 4NQVB 3LN5A 4JM4L 5C7XL 2ARJQ 3VH8B 4FA8A 3WNMA 2CSPA 5AZ2L 4XOAA 2PXYD 3MKKA 4LLWA 4PJDA 5INCA 1TJHL 1UA6H 2P5WB 2ESVE 4IYKA 1UKSA 2HUEA 2WAQA 2WMPA 4HLJA 3WJLC 5IV2B 2MWCA 3IXTA 4G9FA 1LWHA 3QG6B 4N2KA 1ZSHA 4X7DC 1OKEA 3RVUD 4Z3IA 4EN2A 1WD8A 1BVKA 1T20B 1TZGL 3H1ZA 4Q9BA 4XAWL 2H26A 4MQXC 1OOWA 5KYUB 5AVRB 3HBZA 2VLKD 1U3HB 2F9BT 4XCFL 2EH7L 2BVYA 4PLJD 4H8WL 4D0DB 4Y1TA 3WFDL 3VU2A 5I0VA 4LCCB 1KGIA 3HTLX 2ADYA 3IMVA 1JFQH 1CL7L 1Z9MA 2XTLA 3QQ4B 4U3SB 3TT1L 1MSPA 5F9JA 1E8XA 4NRZB 1QLRB 3VM5A 1TFHA 3PHAA 1A5FH 1AS6A 3RX8A 5ICUA 2VZUA 4K5OA 1RZ8A 3S9DB 1NDMB 3RPKA 4FLQA 2YN5A 2XYCA 4H8HA 4XMLH 2KQMA 5DJ6B 2VDQB 4FTDA 2DYRB 1GZPB 4X7TB 3GUTB 4UIMB 1N0LA 1ND0A 2EXSA 5C92A 1M7DA 5IBLD 5JHAA 1S9VB 4GKLA 2CHDA 3OVUB 5ISZA 2G3MA 4P2CG 3GBLA 3H9SE 4ZPTB 2F5AL 4G6FB 5FB8B 3K4ZA 5I1DA 4HUVB 1IGMH 2OJZL 4IMKA 1J8HD 1A3RH 5T1DL 1D6VL 1NIDA 1IEBA 4R3SA 1F3JB 1H15B 4LSPL 2G4GA 3HW7A 4UB0L 4ZMAT 1YQVH 3BIKA 3NTCL 1YEHH 5T3XD 4DVRH 2Z92B 3ASOB 1JNHA 5FUZH 3C8HA 5JIMA 3VFMB 1KCRL 4TRPL 5SX4H 4E36A 1UT1A 3O4OB 1EVTC 2XNAB 1LDPH 4Q58C 5E8OA 5JHDD 4YWGH 4FA7B 4XTRC 1X5YA 1CR9L 1ZVYA 4OCRL 1S7WB 2ZX5A 4HSAC 3N44F 4R97B 2AJYH 4J3OF 3ISWA 3CX2A 3TH4T 4M6ML 3MREA 3EO1A 2NT1A 2NT0A 2O61B 3D4ZA 4FKEA 5F9AC 2YWZA 4P57B 1AO7D 3MLZL 4GFTB 1E40A 2UWEF 3ZRFC 1QYGL 3HG0A 5KVDE 4URKA 5BO0D 4GMTH 4MBOA 4UT9L 3B34A 4MLSA 4L3ED 4ZFGH 2V7NB 2WLYA 4OF7A 3PQYB 5D8JL 3VXUD 5HI3C 2BWIA 3IDYC 1PQZB 4A38A 4PTUB 1PD1A 5KS9F 1XIWB 2CIIA 2ENYA 2XBZA 3VRIA 5CN1A 1P2CB 2WLZA 3EH2A 4ORZC 3MRJB 3HNSH 3L95B 4PG9A 2GJJA 4HIHB 1DQQA 4FNLL 3T0EC 4XWGL 4HIEB 3QUYC 2UY6B 5EBWA 3DETD 1ZIBA 2CMRL 4N0YL 1MCLA 5EUOE 1YY9D 2V5MA 4IQHA 4M7KL 5I1JL 1GJWA 4K3DL 1I1AC 1WHPA 5I71B 4TUKL 2ZD0A 1ZHNA 3BP4A 5IHLB 4HJUA 3VYNA 5D1ZI 3T3PE 3ZHNA 1AXIB 2K8QA 4NRYA 3CFBA 3LZRA 1E2ZA 1ZE3C 4CJ0A 4BQ9A 4GYBA 2BCKB 1ZLSH 1AO7B 4WY7L 2JKTM 4LLDA 1QKZL 2IGFH 2X4UA 2OMYA 5B38G 4HYTB 3Q01A 2AK4D 4GI9A 5GGTH 4ALAC 5AUMB 2E9WA 3LD8B 1C12A 4F7KA 4Y7OC 3MRFB 1V10A 5AWNH 5LUMA 5E4AA 5HVGB 1Q90A 4LAJH 3U6RA 4DERA 4K71B 1N4XL 5I6MA 3FAWA 2I60L 2C4FT 4M03A 3QEGL 3L45A 4G1EA 4QRPA 5TTRA 4Z7UF 2V9RA 3VO0A 1NBZA 4JO1L 3MJ6A 5C08B 4RRPA 2YUWA 3AXLA 3IKKA 2E27L 2JLPA 5KS9B 25C8L 2WSKA 1JRHH 3S3PA 3CTTA 2L7JA 2EH8H 2OMBA 2Z65C 5EFIB 1AY1L 4AYFB 4IIQB 3FN9A 3VXPA 3HI6H 3T1WA 1TKWA 2OLDA 4C4UA 4XPAL 2G75A 2XG5A 1MUJA 3UJIH 4CN4A 1LD9A 1RULH 3D0AA 3BPOB 1PLGL 2R0WH 2H9GB 3NSFA 5DDHB 1EBPA 4HC1L 5KJRH 4Z7QE 2CHZA 3OKLA 4F3FB 1ZGLM 2DWSA 2DTMH 4MAYB 4FNPA 2HT4D 5KYNA 4JQIH 3U83A 1B9KA 1KEMH 1SJEA 1JF1B 1CQYA 3QIUB 5ERWB 3ZT7A 1HHHB 4Z7AA 1M7XA 2YPVH 1LDPL 5FFGA 3JWDC 1HXYA 1BZ8A 2AK1L 5HDQL 3EDDA 4XX5A 4WFGD 1DBJL 2YXWA 4GO6B 1BG1A 2Y5QA 5CBAB 4DP5X 3P73B 3G6JA 5E8OB 1FDLL 4F58H 3ZDZF 2XNAA 1MNNA 2ENPA 3WS6A 3GJFA 1NCHA 2CLRB 4LL4A 3AUVA 2EAEA 3MYJB 5IR1A 1OP3K 2VXQL 3VXSB 3BFOA 5EN3A 4A1RA 2H32B 4JDZB 4AQOA 1K6QH 1KY6A 4M5SA 4AEHL 4GMSL 1IVTA 5C08D 3VFOB 5BOZG 5JHLA 2ICEC 2F5AH 4L1BA 5B4MC 5IVNA 3G9AB 2XDHA 3ULUL 1CFTB 3ASNB 2X4NB 4LLQA 1NBQA 4YSOA 1I9RH 5CSZA 4QIRA 1VFAB 5ACZB 15C8L 4GO9A 4KTEL 1F02I 3ABGA 1PCSA 4GSDH 4L5FH 4L37A 5AW4B 1FUNA 1KLUB 4A2MA 2LV4A 1H3GA 1M05B 1DBML 1KCSH 2RJMA 1R3LA 2I9LB 1SXSA 2CAKA 1S5IL 3AB0B 1ZHNB 3LS5H 1IKFH 3D39E 3GSXA 3ZZLA 5SWZD 2L8AA 2D7NA 5GS0D 1BMZA 1V5JA 3CC1A 4XI5D 4QY8A 3U1QA 5FS5A 1RFDL 3EO9H 4ZPVB 2IDSA 4P5TA 1YQ2A 2HTKD 1XZWA 3P2BA 5DC0A 2Y7MA 3L4VA 3O2WL 5FC9A 4M7JL 4GRLA 5JOFA 4NM8L 5FYJE 3F00A 3FQYA 5IUCA 3BWSA 4G70B 3BGMA 3LV3B 3PNRB 2VLLA 5E03A 2WLLA 4XO3A 4ZS7H 5IB1A 2K3HA 2FWOA 3K91A 1XR9B 1DLFH 4L8SC 4LSQH 3LPWA 5EU6B 2QSQA 4KVNL 5TPWL 3NSDA 2Y1AA 4KQ0A 1AMYA 1UACL 1BM3L 2GT9A 4JGMA 4JPVH 5IKCB 3QUZC 1F4HA 1NC4A 1NGYA 1YEIL 3EYVB 3WJMB 2W91A 4JKWA 2NCMA 2VITA 3LKRA 3WY4A 1GMEA 2V9QA 5TFSH 2DBJA 4M1CC 4KZCA 4YSDA 4AT6B 2P5WA 1A7OL 1VEPA 2BP5M 4PGBB 3ILQC 3MLSH 2D7MA 4IRZA 3EO1B 5ADPL 3H53A 3ULVC 3KLDA 3UO1H 2RR3A 3CN1A 1XTLA 1A3ZA 4W93A 3V6BR 1Z0MA 1NL0L 4BZ1A 1KXTA 3ULUF 1G5AA 2VR3A 4K9EH 1XEUA 3L48A 1O0VA 1Y18A 4FJZA 4LCWD 3SPJA 3IDMB 3KPSA 1ETJA 4PQXA 1X9LA 5IIEA 3K0WA 3UZEC 1JPST 1NWPA 2BWDA 2H8PA 1TITA 3UJIL 1T5KA 5CD5D 3HZ3A 4XXWC 3H56A 4GNKB 2DWTA 2UZXA 1I85C 4WVRA 4D9RD 3L9RA 3VDBA 3Q6GH 1ZOXA 3L3KA 4F8OA 4PWIA 2R56L 4I48B 5EPMB 4IGBB 2VRKA 2YQ2A 3WO4C 5HVHC 2JCCB 2FATH 4D7PA 2Z64C 4X83A 1NKGA 1AGFA 3V6OE 4NUJB 1JWSB 1INEH 1KYUA 3RUGF 1DEDA 2FEEI 4WK2B 1NMCB 1DJWA 2IDQA 4QXGL 5F6HI 4AEEA 1NEPA 5F1NA 3N43F 4XP9H 3UH8A 2C8NA 2F53B 4N0CC 4MVBD 5DJYB 2ZOTA 4KHTH 1A9EA 1AS7A 4FQIH 2VLKA 3P4LA 2OXHB 5D9SB 4X4ZA 4H0IA 2EE2A 3OR6A 1FO0A 2ZP0T 4GG6E 3NIFF 1H6EA 3MLVL 5AB1A 2CPCA 2DQMA 4XMZA 3L5XL 1MWAL 1S3RA 4GKNB 4L1DA 4KTEH 4L5FL 4KZEL 4OZFH 3ZDXB 1U3HA 1DDHA 4BZ2H 1SHWA 5JW4R 2C7UB 1TETH 3OSKA 4KAQL 1RXLA 1ADQL 4X9HA 3DVGB 5J13C 4R7DB 1HWHB 5JPNA 3N40P 1T6WA 4XVUC 4JKMA 5KAQF 4K3EL 5FGBA 3FPYA 1G1KA 1GH7A 2EDMA 1OD7A 3FQ2A 4IHBA 4JG1L 4NO2A 5LQBH 2R15A 2EDJA 3FH8A 3VXUB 4ODWA 1S7RB 3IJEA 1JDAA 2QQQA 3IFPB 4PP2A 3P9LA 2J56A 2AEQH 2ZOUA 1WAEA 1E67A 4YEFA 1S3KH 5FV2A 1IBBA 5F96L 5B39G 2R1YA 2IAMD 3ZE1E 3F5WB 3BZ4A 4UIKH 1SXZA 5DRNA 3J2PA 1OTTD 2AQTA 3L5IA 4NQXA 3HC0A 3LH9A 2GK0A 3ZKXC 5JHDA 1OGAA 2QV4A 3WNKA 2AP2A 4P05A 1WZLA 2MH4A 4GMSH 5EHFA 4HIJA 4O5LH 3EF7A 2ZP9A 5FDYA 4ZMNA 3EFOA 4PFEA 2L3BA 3NJNA 4N86A 1WAAE 1XMEB 3LNIA 4M56A 2MCPL 2OYLA 2Y3AA 5F9WB 1C16A 4W4OA 3V0VB 5BRPA 4X8XA 3QDMB 2LFGA 4GUOA 1LK2B 3GSVA 1OANA 4R0LC 2I7SA 4N0RA 4PJFA 4PGEA 2R29A 3GMOA 1H8OA 2OMXA 1YQVL 3NTCH 4MMXB 2XN2A 4PRNA 1J48A 3SO5A 3IWUA 5FGCE 4AVJA 1YMMB 2ZOLA 3RX7A 3FTXA 3VXUA 3RY4A 1O7VA 4BFRA 5GZND 3QCVL 3QHFL 3LPOA 4Z7VB 3LDBB 3OG4B 5ENWB 1A2YB 3PWPA 4YHLH 5TD4A 2IH8A 1I3UA 3UZQB 3GXPA 2P7TA 4LHQB 5FDWA 3NCJL 2XN0A 4BFEA 3EFFA 4UM8B 4XPFL 3RWHB 4FNUA 4F80A 4N6QA 5LBGA 3HC3L 3UTOA 4PJCE 2ZCKL 3KNBB 4KXZH 2VXUL 4R26H 1LTXA 3H42L 4K94C 5D96B 1RSYA 3OR6B 3KPNA 2H47C 3MV7B 2EEAA 3KL5A 4LSTH 4M6AA 4PJ8A 5I1HL 2VZSA 2XX0A 4J27A 3W5NA 1DUYB 2JJTC 2YRZA 5SWQB 5E70A 3IMBA 2F53A 3KS0H 1TZGH 5F1NB 3IJSB 3D2UB 4WSGA 2MMXA 3BMWA 3CZGA 2WXMA 2EE9A 3LXAA 1HIMH 1PIGA 5LGJB 2BP0A 2L7UA 2CG9X 1CLVA 4FFYL 4Y1SA 5DJ0B 3GIVA 2IWEA 5DJ0A 1JXFA 2BIOA 3LQAL 1SOQA 1IGCL 3MJ9H 1YMMD 1QEXA 4P2QB 2JCCA 2YR3A 2WLNA 5EBMA 2VMDA 2X4RB 4AIZA 1GGUA 2FX8H 2EC8A 1I7UA 3X3FH 4TUKH 1LHZA 4BFKA 4PWHA 1QACA 2XWJB 3HNTH 4L05A 3ZSTA 5FYJD 4GUPA 3KVPA 1KXQE 3EH3B 4ODXA 2H8PB 3RWJB 3L4YA 4UT6A 3JZ7A 5DMGD 2BO0A 2G9KA 5CILH 4CKQA 1P84J 1A47A 2R27A 4NO0D 4G2AA 5LNEA 3NYKA 3BCFA 4TSBL 1QMUA 1BECA 1FC2D 3TIDA 4GXFA 3VD0A 4FDWA 1QLEH 4GS7C 3LZNA 3P11L 4A6YL 1HQ4A 2Y25A 1M3IA 4DKEL 2FBJH 4BIKA 5JIIA 3I75A 1UVQB 4MA3B 3BT2H 3S3BB 2MNWA 3RTQB 3WE1A 2C3WA 4S1DD 5D6DC 1NC4B 1NGYB 3KWUA 3CDZB 3GMMB 3LS4L 2F15A 1BWMA 1UUNA 2J88H 2IPUG 4KHXH 3BAKA 4M61A 4NO5B 1GL4B 3RVTD 5DHMC 2Z4QA 5J3HD 4MMZA 1NIEA 3WXWL 4OCSH 3L7FB 1G7IA 1FH5L 5ICYB 3LRGA 1MFMA 2X4OA 4G9FD 5F7YC 2QMKA 1FHNA 3WKML 1CGVA 1P4BH 4UTBH 1TSHA 2WWMD 4MGXA 4JZOB 2A77H 5B38B 4W4NA 5DS2A 5SV4A 1IVLA 5ETUB 1TZHA 2WQXA 1CBVH 1K8DA 3K4DA 3TA4D 4HWNA 2WZAA 2WZ5A 4NO0B 5D1QA 5FO2A 1UOWA 4Y4FD 1T5XA 3EW3B 5JHDB 3O4LE 2R23A 1ZGLA 5SWSE 1OSZA 4TOYH 4M6NH 4PJ9C 1JGEB 2FAUA 3KJ6H 1A7PL 4NEHB 5D7HA 5E5RB 5T3XE 3V79C 4MXQC 2VMCA 4TTDD 2P52A 2WLJA 5IB3B 2FTAA 2DEXX 4OZ4A 4F7CA 3IU4L 2HVKA 4XBPB 2B16A 1WFTA 3O6ML 4I2XA 3OAUL 1ZS8B 5FGSA 3UGEA 4KZEH 2PCFB 1XF3B 4ZMLA 5EU4B 1CXIA 5DK2A 5FYJL 3TYFA 4IOIA 2D4FA 3IS1X 1TQTA 2UY7B 1I9JL 2N1KA 1C5DB 1XZ0B 4KVPA 4NZUL 2OPCA 1I7ZB 5IM7B 2GHZA 4LMQE 5JPMA 1O7DC 1MQKH 1QFOA 3O41A 3CN3A 4FFTA 3F04A 1JYNA 2EEBA 3FCSA 4DZBB 3GXUB 2QVIA 4NS0A 3WL9A 1FL3A 4KKZA 3LKQA 5KUKA 3DROA 3P4OA 2B4CL 1E4HA 1THCA 3H9SD 3JV5A 4CL7A 3MCG1 4FQLH 2Y5TA 1C5CH 2BDNL 1KENH 2GAZA 3QXDA 4YDJA 5I66B 3W38A 1NEZB 4OFYA 3V4UH 2VT0A 1NANH 5A43C 4EIUA 5E2UH 1WCBB 5IMKB 3FFDB 3LNEA 1I3GL 3L4ZA 3WS6C 2GIXA 1HNGA 3T0WA 4QYOA 3VXOB 2FQDA 2IVFC 1XH0A 3QJRB 4QTIH 3BISA 4L4VB 4P59L 4FABL 4YFLI 4NZFA 4ZDHA 5I15H 4H20H 4PV9A 1X5LA 1UD8A 3A6CH 4LIQE 1JZ8A 3HC3H 3POCA 1FL5B 1CE1H 4L2LA 2EDRA 3QJXA 3DX4A 2CCLA 1U4EA 1KJ2L 1JZIA 5CP3H 4ZO7A 5CCHE 4P4KD 4HWBH 4LGSB 5BCAA 3NA9L 4F33A 3WYRA 3I2CH 2BIIA 1KYFA 4G72B 5GISH 4OD1L 2IXQA 1CU4L 1KIPA 2MPVA 4Q97A 1E9PA 4JGUA 4G3YL 4JPQA 4AUYA 3ARSA 5MEQA 3NJVA 4PMEA 5A2AA 5B8CA 1FNGB 3DHJA 4AEIL 4MXWH 1ZLWH 2QGEA 3QJZA 1A1OA 2HRLA 5BXFA 2W0PA 1ML0A 3PF2A 3UTQB 5I16A 5DWUL 4KXCA 3FFCA 1KIRB 3RAJH 4NYLA 3ZHLA 5BW7A 5F1SA 1WQVT 1IAKA 4MASA 5D2NE 2OJEB 5G2NA 2YD1A 5MENB 2L4OA 3DX6B 3FCTB 4Z6AT 3EDJA 5EU3B 1UEMA 3RZCD 5C70A 4P46B 4G9DB 5ACMA 2A0LD 2H6PA 4JJHA 4PD4J 5C8JB 1VCAA 4X5QA 1MHCA 3GMPB 1NFIB 1KPVA 2R1WA 3J7HA 5EU6A 4WDIA 1IAMA 3VG0H 1EO5A 1OY3B 1S3KL 4D9QE 1XR9A 4ANXA 2NY6D 3MLYL 4JANA 4Y19A 2F08A 3UAFA 1E65A 3BGFB 1CN4A 2AV7A 4X6DB 2CDEA 3T6QC 5KVEH 4QRPD 3AWGA 2WVSA 3BH9A 1IC5L 2NYYC 2J8UA 5F44A 5A40E 1GTNA 2HX7A 3WFBH 1DBBL 1JZDC 4UM9D 2NX5D 3JSSA 3RVWC 2W80C 1PZ5A 2QMJA 2GBTA 3B37A 1J87A 3BQUB 1LO2L 1GTFA 1UM6H 2EJ1A 1U8KA 3GIZL 3KBEA 3SDDD 3CPLB 3ZZSA 1VFBA 4UTAL 1N3NB 1MCOL 2NR6A 4D0CB 3MLWL 4NN6B 3L7EA 2NPLX 3GSXB 4FG0A 4PW3A 5LWYL 3UBXG 5IVXA 1XD0A 1EV2E 1GZQA 4YHKL 5DFWH 2R56H 4U7MA 1HYRC 3ZIMA 5CEZL 1KIRA 4G7SB 1K4DB 2WVVB 5HDOA 5GRJH 3IKCB 4PS4H 2BSTA 3CZNA 5J9PB 2B3IA 5DS8B 4GO8A 3OXRA 3MNWA 4WQOA 5F97E 3WTVA 1BJ1J 3R8BB 3VFOA 3EGXB 4HJ0D 1DE4A 3HUJE 1I8UA 2HT2D 3TVMB 1BF2A 1OM3L 3QHFH 3OGCA 3TNNB 3EJTA 3R18A 2KERA 4N5EC 3RFZC 3S3CB 3T2QA 4R7NA 5JR1L 4BFOA 3BIAX 3QEQB 4OUOA 1S9XB 2C34A 3HPLA 3TCTA 3G5VB 3HZYB 1RMFH 1PG7X 5MEOB 2IBGA 5IQOA 3LEYH 2DJMA 4ZPTA 2X87A 3DBSA 3EJZD 1JPGA 5CIPB 4UUJA 3MRRB 4HHWA 3HE6B 3WI9A 4ERSL 4P3WA 3BAJA 4Y8AA 3CBJB 4JFPB 1NOFA 1UCTA 4OTXL 2ITDA 2UX7A 3OB0K 2X42A 2J8OA 4FKHA 4OY9A 4TPRH 4TUOB 2X7LA 3ZSSA 3SO3B 1U8KB 2YXFA 5EDSA 1N0XH 3KD4A 5AVYB 1IKOP 3U46A 3FT3A 1HESA 1MCEA 3EOAA 3GBML 3QUYB 4PB0H 5TDNB 4M1DL 4P5TC 2K70A 5D2NB 3K3QA 1PKOA 4XN1A 1U92A 4YSTA 4EOWL 1C9SA 4PJ8D 1OEZW 2CUMA 3I74A 1F11B 3SPVA 2VZOA 3TFBA 1BPLB 4E2OA 1I9EA 2EO9A 1PKQA 1E6JH 3V4PB 1QKZH 2ATKB 3HNVL 2M1KA 4K2UL 4DEPB 3RWEB 1CYXA 3O9WD 4KRPD 2YGPA 4LVNB 2KZBA 3IMSA 3BWUF 3DUHA 3JV4B 3QJOA 4O58L 2ESVD 1QSFD 3L4TA 5E08H 2FX7L 3TYFB 3OAUH 4FXGB 2E8YA 4AW7A 4DKFH 1KJ3H 1UWFA 3CN0A 1A66A 2E6QA 3Q0HA 4HIPA 1N2RA 4JDTH 2WANA 3GM0A 4BYHA 2EZ0C 5T5NG 5HDRA 4TOYL 3VAEA 1FYTB 5D7JC 2Z8WC 2TAAA 3UTTE 2WUBL 1G6RB 5AALA 4U0QB 3CDGB 1JV2B 4GKZB 3VMOA 5IGXH 2WNKA 3D6GA 1MCSA 2Y24A 4MFHA 4GFXA 1TIUA 1PZ2A 4UT6L 2LHAA 2OA9A 3L1GA 3JVFC 5K33A 5GS0L 3ARGA 2VLJB 5TE7H 1JHTA 3QPQC 1MFCL 2WWKT 2XIBA 3V9CA 1CFQA 2BZDA 2PABA 3IBOA 4I87A 4OKVA 5GRXG 4OF8A 1G7MB 4ABVA 4Y9CA 3TN0A 4P2RE 5M7QA 2H3KA 5GJTL 2DI7A 4M7ZB 1OGSA 4CDGC 3MBWA 1YG9A 2BM3A 4LEBA 1G7IB 4W81A 4MCNA 1AGBB 2JK5B 3QDHA 2BNQE 1RLWA 4GKSB 7FABH 1UD3A 4HIIB 3SY0A 1ZVHA 3VFWB 3VJ6A 3ZYJA 1P7KA 1OF2A 2DYSB 5F71A 3VXMA 4NKOB 3NK4A 4NZTL 1QPXA 1C08B 1VB9A 5C0DB 1G0XA 1W0VB 4G6FD 4FQXC 1GPOH 2E56A 4XZ4A 2XJKA 3NMEA 3SD5A 4AMKH 3L16A 2WQ8A 4MCZB 4DVRL 3ZUNC 4OQTL 3P3YA 1Y6NR 4G1MB 1W91A 1AD9B 2EECA 3V9FA 1HYSC 2VDKH 3C5ZD 1I8KB 5T5FH 1VADB 4XNUH 1IC1A 4EF3A 1KIUB 3P54A 3BWUC 4XN4A 1UXSA 4NZJA 4IRSD 2PCPB 5K9KB 1D6VH 3GSRB 3K8LA 4G9FE 4HZLB 1WZKA 2JELL 4LT7A 5DVLA 4FL4C 2YUZA 1SYVA 4HC1H 4JM2A 4HULB 2OMUA 2OSYA 2CGRL 4ODXB 1QI4A 1U3HD 4NQTA 1G5GA 5BUAA 4QNPF 2Y7NA 2RFXB 3IEAA 4HD9A 2V5RA 4JPIB 3EIFA 4M62L 5DJZB 1EHXA 1T1ZA 4LCIH 3WFZA 3HE7A 1IKNA 1I4FA 4OD3L 2X4PB 1PY4A 4HUWB 4KWUA 4M7KH 3NACH 3W57A 5ID0A 5F3BA 3SODB 3SOTA 5BW7C 3IBEA 3QHZH 4OFQA 3S36X 2XA8L 3D52A 2J73A 4HQQH 4KRLB 4YDKH 5DYOB 4UIMA 1U8MA 2A9NH 5CKAA 5SWSD 3ZTCC 3MX0A 5HDLA 4A7GF 3H9SA 1JTOA 2R2BA 3VD4A 2X88A 5FLVA 4TUJB 1OVZA 3GZQA 4PJBB 2RQEA 1ZDSA 1N5AB 4FERA 5L4FA 3EFDH 5DA4A 5C3TA 4UNTA 5B1AB 5AVZB 3TF7C 2F7PA 2EDEA 3P1VA 4LAQH 2WTOA 3CU7A 5FXCH 1CF8H 1F6FB 3MODH 1YNTB 3GF8A 1HI6A 2A99A 4HU8A 5KYUA 1S5HA 3REVB 1YPZA 4HS3B 3ZUCA 1DBAH 2P7TB 5FDWB 4X50A 1TO4A 1L4IA 3BUTA 2N1TE 1EBAA 1JS4A 1QWUA 2F54B 3MRCB 4QRFA 5E1QA 1KXHA 1XGPB 4N3UA 3FQ1A 4Y2LA 1PX3A 4LLMB 2XETA 2ZUVA 3W0WB 4X0KB 3X2QB 1QQDB 2A6JB 3B2VL 4PJDB 2JJSA 4MAYD 2OW7A 1FDLH 2XSKA 4XVJL 5CJ8A 4L4VD 2BRRL 2H1LM 5I19L 1R47A 5E6UB 5BV7B 2AEOA 1OHZA 1AQHA 4G6JH 4Q6IA 4YGVA 4ZX5A 3RWJA 1CGUA 3FQWA 1KEML 3WDJA 5JW3H 2B77A 2IDTA 3KPOA 3TBWB 1S7VA 4JL1A 3X3GL 3Q2NA 2M83A 2VLRB 5AYTA 3OKEB 1F56A 4XGZA 4HW6A 1UYWL 2QQNH 1CVRA 1M42A 4PR5B 4NNYB 4AL8H 3ULAB 2XVLA 5I0WA 3QCTH 3QAQA 3V2AR 1FO0L 2W0FA 4O4YH 4YHPA 2VC2B 1MJUL 3EGDA 4MXQD 5T1MA 3FCBA 4Z18A 4ATTA 1L7TH 1N64H 3GSUA 3M1BB 1PG7L 1SMAA 2YXMA 1MIEL 4ZODA 4JCWA 4BK4A 1CURA 1NTDA 1B2YA 4NNPH 3T8XB 4XPHH 4L8DB 4Y4FC 5EUOA 3EG9A 2WINA 3QRLA 5EBGA 2DD8L 3PJLA 4K7PX 3RGVC 3JTSA 1INDH 2E27H 5ICZA 1QHQA 1NCWL 5HHNB 1HHJA 1BFTA 1IT9H 1VGEL 4FZEL 2WWMC 4DO6A 1A65A 3MBEC 2ZYHA 1ZK5A 3DJSA 43CAB 5LXVA 4Y7MA 2EE0A 3CZUB 4OCMC 3NESA 4HGMA 1L9QA 4M5TA 4N2GA 4IBYA 5L8LB 1MFEL 4WI8A 4XZUA 5IZ7A 3FT0A 5L0QC 5K9KA 1M7IB 2WWKO 2WNWA 3LKNA 1YN7A 4KH2A 3NACL 3EUDA 2W94A 2FX7H 4AJ0A 2HG5B 3U36A 4LPXA 2MJWA 4U6VH 4YHYC 2LU4A 5E95B 5GS2H 1U8QA 3GXIA 4XOCA 3VWKA 2Q9OA 3TBTA 3BCDA 1HHKA 3U0WH 4J3OC 2YPLE 1LE5A 2VISB 1SXCA 5CINL 43CAA 4F7TA 2VLKB 3T0VA 5IK3B 2MKWA 3FRPG 1NGWA 5AZEL 5F7EL 1AG0A 3NJGA 3SY0B 2EH7H 3ARDC 3MV8B 1HN1A 5C07E 4YSQA 1H6TA 2DWDA 5D1ZD 3AY4C 1BQLL 4JG5A 4NM4L 3UDWA 2C4FU 3VI4B 2OAAA 3QQDA 1P1VA 3HB3C 4Z78A 5IQ7H 1CFQB 4EMZA 5ALBL 2M2DA 4LESA 2NY0B 5DD3H 3EFOB 1L6PA 5LXGH 4WWOA 3RQ3A 3FHAA 2IEPA 2CH8A 3QYCA 3VFRB 2CDGB 5IROA 2DLEA 2BOCA 4Y4HB 3HR5B 4M4RA 4A39A 1JXGA 4DTGH 1G6RA 2SEBB 4XHJC 3O11B 4HUCA 1BV8A 1KPUB 4RZKA 4JO4L 5DC2A 5IIEB 4OBSA 3C6LA 4C56A 1NDTA 4BWWA 5KSUA 5DRWA 3V6FA 1DBKH 2FQFA 1DCEA 3LIZA 3G5YB 1SHXA 3G04A 3KBHE 5JW3L 4PRBB 3PWJB 4XAKD 4U1MA 3NFPB 4J2XA 3KXFA 4O2EA 2MTPA 5GS0H 1IAIL 3MDJA 4J23A 1MRDL 1KDIA 1QQDA 4U2YA 4A2LA 3NJMA 3R1GH 5AVUB 3VFGL 3JUZA 5DO8A 1UB6A 2VMJA 4NGHH 2VM4A 4WNSA 1NGPL 4PB9H 4U6TA 4M93C 3D39A 4PJ8C 4ZAKB 3CZFB 4G6KL 1ZJBA 7CGTA 4FFVD 2RQ8A 1RVFL 2BP8A 1R5WB 1VESA 1OQOA 1KB5A 4ETQB 4P4RB 2QQKL 4NKMA 1GIGH 4U1MB 4XB7A 4YHIB 1SQMA 3V7AE 5HHOA 2VQUA 3UBXB 3UABA 3ARBA 1DJSA 4ELDA 1DQKA 4OM0H 4RIRB 4P9HH 3NZHH 4P3CL 3QYMA 3Q9PA 4KQ4H 2Z31A 2YGVA 1EDQA 4TNWF 3L3HB 3UACA 2EO1A 4N2CA 4UINL 4K7FB 3WEXA 1KZYA 2NRDA 5HVFB 3E1ZA 2YBGA 4AQEA 4GRWB 3EGSA 4KI1A 5GRVL 5LQBL 3H6AA 3SDCC 1N8ZA 3V4VH 2X4NA 2VIRA 1VKXB 3O3AA 2YAOA 1BF8A 4AQAA 4PP1C 5JXEC 2ZUYA 5FKAA 4O2CA 1WC7B 5AKTA 2J71A 1OTTC 4U3XA 5GHWH 4K7PL 2IWKA 2YGQA 1A0QL 4J1UB 3BUBA 3UTPE 3H85A 4LCIL 1JF5A 2ROXA 1CDUA 3IPBA 3SKJH 4DESA 1BMGA 2UWEE 2VSCA 3MLXH 2X9XA 5I18H 2AK1H 3UBFA 1BBJB 2VISA 1NCIA 1UXSB 3ZKNC 4BH8A 2FSEB 3NJJA 4TNFA 2A2QT 2BSRB 1Q1JL 4AH2B 1GSKA 1NGZB 2ZKMX 4JHWL 4PBVC 4P07A 1E4XL 4OF0A 5JIKA 2VN3A 5LG1A 5AAWC 4PN6A 5DRXA 3DMMC 3F7KA 2DQTH 2QQLL 1BX2B 1TLKA 1G1OA 3BC9A 4ZMWA 5F72S 2D3NA 1YPZF 1TCMA 5JUEL 4F7EA 3ECVA 1YN7B 1IMHC 5IQNA 4KRMB 1YMHA 2CNZA 4JHAH 4ICWA 4I0PB 2YMXH 2FATL 1XB3A 1RK7A 3Q2WA 4GB9A 3K5RA 5JMRA 2V2TA 1U33A 3MNDA 1JUFA 3ESUF 2IWFA 2CDEB 2YA2A 3MV01 1D6EA 1LO5A 3RTLA 3L1OH 1O6VA 1I7RB 2GYSA 2VLKE 4KXZI 32C2A 1ACZA 3AAZB 3IDXH 1ZLWK 3FW6A 4PJ9B 4GG6A 1DUZA 2A3TA 2WJ5A 2JQMA 3RURA 1BVOA 4RFNB 3QDAA 3ZTNL 1RJZB 3EOBA 3SJVB 4C83B 4F7PB 4Z3GA 4Q9QH 2B59B 3DX9B 4CN1A 1ZT1B 2P24A 3VXSE 3COOA 5IUSA 5C09D 2A83A 2EYSB 4HUXB 4A2HA 2GEEA 3T4AB 1V54B 3ES6B 1ACYL 1T22B 3O6KL 5DD0H 1HINH 3KYMA 5EEVA 4JFDE 5C0FB 4AVKA 1MFCH 1HHGB 4JB9H 3RGHA 4P5MB 1C7SA 4XPGH 2X4UB 1F4XH 5DK0A 2GY7B 4KBPA 5IJVA 4PJ5E 2XPGB 3AS2A 3SDDA 3SKJL 3UTQA 3T2LA 2OSLA 5HGHB 3BWAA 4CMMA 4JPVL 5G4MA 3IETB 5BZWB 2VUKA 2VZVA 5E8EB 3V95A 3GWJA 4Q0XL 4XHQA 2VR7A 3QQ9C 1U95A 5JIDA 2VXVH 3WTXA 5GGSY 3MYJA 4OCXL 1KB9J 4XOEA 2IXQB 3JWOL 4M4PA 4P4KC 3UG5A 3QIWC 3KYOA 4PV8B 4FTVD 3RWEA 1DVTA 1OGAE 3KLHC 3UTTB 3DARA 3OLGA 1UWGL 1FYTE 4MDIB 5EO0B 3ULVD 1NCWH 2EDTA 5FM5M 2V8MA 2WIMA 4ZYKB 2BK8A 2FWSA 1J9RA 3FUKA 1K5WA 1INDL 2NYKA 1KBGH 4G8AC 1MEXH 1AXTH 2XBDA 4HS3A 4MAYA 5D70H 4YSSA 2ZUQB 4KKQA 3MZGB 4BQCA 1NKOA 4IKNA 2GSIB 3IFNL 2GSIA 4KMTL 1CU4H 3CMOL 4Y5YC 4APXB 4Z7NE 1EHLL 1LL1A 1OCRB 4B5ZA 3QNZB 1IM3D 3N44B 4ZS6D 3ROOB 4N85A 4ZX6A 4FFYA 1RVFH 3MREB 4N9GA 3H2QA 1CG9A 3AWEA 5BQDA 2YEVB 2HP4A 2QADD 3IXAA 2W8CA 4ANUA 5DZNA 2F54D 3WLBA 4QPEA 4JDEA 3RDJA 3PWPE 3QG7L 5DYOA 3RU8H 1PZDA 1S9XA 2P8PA 4XI5C 3TT3H 1W8NA 4QTHB 1M2VB 5IQ7L 2XVBA 1ORQA 1QASA 1T21B 1XB8A 3QZLA 3LD8C 1IEHA 4IDJL 3RI5F 5TDOA 4UTBA 2R83A 5A2FA 4N0FB 4DPBX 1MCHA 2NY2B 2OMYB 4F7CB 5EC2B 3PHQB 2Y07H 4G42A 2IANA 3BPCB 1NPUA 3RZWA 3C60A 3D34A 4K3JL 3NJHA 1JP5A 4HDIB 5FB8A 1F4AA 5EOTA 5DMKA 3CFBB 1FN4B 2F53E 2MPAL 2OQJA 1TOXA 2EIDA 2WW8A 4KUZL 5C0FA 4P2OA 3D8MA 2QLVB 3SKUD 2D0FA 2R4SL 4ODUB 5SV3A 5EF3A 4U6XA 4XC3H 3K6FA 1A5FL 3CVHA 1RZ8B 1U0QA 2ZUXA 3BPOC 2YMTA 3UYOD 1N7ML 2R29L 4NDMB 1UD4A 5BZXA 2GY5A 1OLZA 3QA3B 4NM4H 1A4BA 1TYRA 2VDRH 4KTDL 5E2UL 1TJGL 2W5PA 3RY6A 1OHQA 1PLBA 1S7SB 4ZTOH 2XQBH 3RVTC 5EORL 3VGDA 3ZRSA 5D2LE 1MQ8A 4M6NL 2XA8H 3VI4F 2ERJC 3T0AA 1H6UA 4PJAB 1XXFC 2Z4QB 5DMJB 2PXYA 2ZP8A 5CEZD 1OT2A 4FFZH 2NY4B 3C6SA 3L5WB 4DAGL 3OHMB 3UAEA 1MN4A 2H6PB 3L5HA 5K59E 3MUUA 1MQKL 5LKNA 4NI3A 3TYGH 1OSPH 3E38A 1R3HA 4G71B 3RPBA 2DQDL 3LZLA 9CGTA 5L2JA 3RWFA 1PMYA 1FE8H 2VAJA 4HUNB 1TTRA 4W9JC 1L9PA 3TWYA 3WXVL 5M94B 2E3VA 3QDJE 4N87A 4W9EC 4NP4L 4GG8A 4UYPA 3LN5B 1O6SA 4AGQA 3MRGA 3KW7A 3SOBL 2VDPL 3FQRA 2C9XA 1KTLB 4FNLH 2AITA 2OQJB 3BESR 5AVVB 3OHXB 1NUNB 3D5OF 4AXWA 1H8NA 2QDVA 2XQYA 1IAOA 3CFKA 4HLZH 2ZXGA 3BIKB 4G42B 1BLNB 2V7HB 3MGAA 4DK3A 2A9ML 4E9SA 1UM4L 3UG3A 4BFIB 2D3LA 3NIDF 2FUTA 4GEIA 5ISZD 1LO0H 1P4BL 4UTBL 4HKZA 3QI9D 5I1EL 2ZTBA 1M2VA 5DEGB 4HUVA 5ANMA 4N2FA 3VD5A 3ZTJG 4FAAB 4FI8A 5LGJA 1CDJA 2KH2B 7TAAA 1WS7A 3CFUA 3N91A 1YEKL 2H2PC 1Q38A 2ODHA 4Q2ZB 3O4LA 1GGBH 3VE0B 3RBSA 1ZHLA 3FRUB 4L8SB 5MI0C 2AJYL 3A24A 3T0ED 1A8JH 1U21A 5FAAA 1QSVA 1HOCA 1MW1A 4OLWL 3EH1A 1XL4A 5FO7B 4JNXA 2FECI 4KQ3H 4ZW7A 3ML9A 3BEWA 3U7AA 1BQSA 3CFJB 5L4JA 4KK9C 4QKTA 4OZIF 4U31A 1WFJA 1Z32X 3ZL2A 1AR1D 3BSHA 2VZTA 4IW4C 1CGSL 4I2XE 5EUKA 6TAAA 5K39A 5HHMD 3QUYA 4XAKE 1WTGT 3RNQB 3CMGA 4AK2A 2PP8A 2EYTB 1I3RA 5AYQA 3NAAL 2BP8B 4WUKL 1FPTL 4MJ4A 4K5MA 3CH1A 5E2WL 4OGYH 1QNIA 1JE6A 3IT8D 3O4LB 5LCVA 1FL3B 3VI3A 5EZOH 1U8NA 4JFPA 2ZKXA 4K8RL 1AHWB 5D93C 3S5ZA 5HBBA 5ENWA 1KG0A 3O8XD 4OD2B 5CR1A 5T3ZD 4HCGA 1KNOB 3IAQA 3NCYP 1SQ2N 1MLCB 3BLPX 1NAMH 5DUBA 1J1OL 3NDZE 1ZCRA 4RH4A 4XO4A 4XXCC 5GGSA 1G7LB 1QFUH 1U95B 5DRWB 3QJHA 4NN5C 4XNZB 1G0DA 1XF4A 4B95C 5KJ4A 1F45A 1QA9B 1YEEL 4M7ZC 2EUWA 4JM0A 4WJKB 4TQPA 1A7QH 3TCXA 1CK0L 1KBKA 3IMTA 4G8GB 3BP5B 4OZGB 2A9AA 4ZRGA 3IDGA 1S9YB 1O6SB 3MJ8B 2AGJL 5F7BA 4H5SA 2AW2A 5F89A 1GC1L 1WSST 2XXFA 3TH2T 3C2SA 1T89A 5HPOA 1HZKA 4BH7A 3FB5B 1EQWA 2ZSWA 3BZFB 3PABA 4GI8A 1ZLDA 4OQTH 1LQBC 3BN9D 1BOGA 3GEWB 3X14B 4IBUA 2DM7A 2E0PA 5F8QC 3PWLB 3CIAA 3EJYC 5EEZA 1KTDA 5DHXB 2YQBA 2W59A 3PL6C 4Y5XA 3GYRA 3QFGA 3S2AA 3TCLA 2LVEA 3ZGHA 1QUNA 2HSIA 3IAPA 4NSKB 2XG4B 3RHWK 5BQ7B 4FEMA 4H25A 5KN5A 1A22B 4Y9BA 4OLZH 1MAJA 3US0A 1YECH 4G7RB 4JVUA 2ATAA 4YL9A 2VLRE 5F3HB 4OZHB 3APMA 3BJLA 5GZOC 1T4KA 3AABA 2XWTB 4O02A 2ADFL 4MKTA 4G9DA 5D1XB 4Y2DB 1W72L 3LNGA 1PDKA 5AL0A 3CDFA 5TFSL 3HRZB 3PRZA 3N85H 4PS4L 2QBWA 5E6ID 2PO6B 1NFDA 5TH2A 4ENZA 3UYPB 3QG7H 3EJRA 2COQA 3TO2B 2EEFA 1J5OL 1QUPA 1HNFA 3ZE2E 3Q48A 4PU2A 3F05A 4JK0D 1HWGB 2RH0A 4PY8I 4LCYA 2P45B 3S4SB 3VWKD 1TZ8A 5B1JC 2AQ1A 2G0LA 4MS8C 4KK5D 3TZVA 2DL2A 2DRUA 1D9KA 1I8IA 2YLKA 4RDQG 2VDQL 4X5LA 1MWAH 5IMMA 2GIYA 3BP7A 3CUPA 2P5ED 3LZFL 3GSUB 3AITA 2HG0A 3FDWA 3P69A 3GSOA 3LHPL 4OIBA 5JZ7C 5GS1A 1ET8A 2FZ3B 2D31A 2X4QB 3HNVH 3RI5K 3X1NA 1DUYA 4OM0L 1AZBA 2Q5BA 3L1EA 2CDFB 3CLEL 4NPJA 1CDCA 1TJMA 1UWGH 1II4E 2VZ1A 1L9MA 4YO0A 3TBWA 2X2UA 4QJ4B 5CEYB 2ICCA 1H3VA 5EBLA 2NW3A 4AUUA 3TPUA 3VFPB 3N1PC 1J05B 1NMAH 3HUJA 1LP9F 1KXTB 1KSRA 1AHMA 3ELAT 2C3VA 4EDWH 2HLEB 3SKNB 2WXNA 3LKSA 4DFIA 3U2SB 3TPKA 1DZBA 1PEWA 5FOBA 4WHYH 4LLMA 2E6PA 4A68A 3KPPB 1J1PL 1HKLL 3SGDI 4BFBD 3QE5A 2F54A 3MRCA 4JFED 5EWIL 5SWSB 5FWQA 1BDYA 3WL9B 2J1XA 1VZIA 1RZFL 3V4LA 4YHOH 2B39A 2ZNXA 3PQYD 2OTUB 3HS0A 5IVZB 2W9DH 4XMPH 4FADA 4ZNEE 1PJWA 2P5EB 4LGRB 3N55A 4MD5B 5I1IL 1XF1A 2DV6A 2BMKB 1KPRB 4AM0Q 1HI6B 1R5IB 2QQLH 3W11D 1S8DB 3DJZA 1R3KA 5HHVL 3QIWD 3MC0A 1E6OH 5ADPH 1D9KC 1XR8A 5T5FL 4JRWA 2QSCL 4BKSC 5JZ7D 2P8LB 3D06A 4JO2H 4EN3A 1A4CA 1XSOA 3AG4B 1HOEA 5I5RA 1NCBL 4JY5L 1EXGA 1NCCL 4Z76B 4XE0A 2JCCF 3CJJA 3KJ4B 3NCYS 3J07A 1OGTA 1CFVH 3VGFA 4M4RB 2VCOA 5E6IB 4IRSB 4AQ8C 5DHYB 4FN0A 5T33L 2CU9A 2O5ZH 1ASOA 1ZT1A 3KPSD 4YXLL 1VRSA 3FO2B 4Y9FA 2WUCL 2Y72A 3LMJH 3UPAA 4M7JH 1GYUA 3LZQA 2C26A 4C55A 2WM0A 5TE7L 1BD2A 3V7MA 4JRLA 4OZIB 3L7FA 4MAZA 2BVPB 4KMQA 1XX9C 3U0WL 2ZAHA 4MMZB 3S48A 2ORBH 3JBG7 2RAMA 1D7CA 2R0LH 4U1LA 3KPQA 2ZCLL 4QO1A 1OP9A 1UCBH 3G6JB 4NOFA 3F6JA 2BSCA 4YDLC 3B9AA 4CBPA 1KCSL 5GGVH 4G7QB 1F0LA 1EGJH 4ZFOB 4PI0A 5E2TH 3U0PB 4JG1H 1RPQA 3PL6A 1T5WB 3HAEG 3I75B 4GQRA 6FABH 1IM9A 1CJYA 5G5DB 1U8QB 4TLKA 5K1JA 1H3PL 4ONGL 1ZTXH 3O3UN 4G1MA 1A1NB 1NCOA 4U6YB 2HG5A 4NNXA 1A9BA 3BH8B 3MA7A 1FVDB 1YHPA 2D0HA 1WEJL 4NQQA 4P23B 2FSEA 4BZ2L 1T89C 1KELH 3ZR6A 1TU2B 1E2WA 3C09C 1KCUH 4UWQB 5E2WH 4JPWL 2YOAA 1J8HE 3CLEH 2Q0ZX 3ZKND 5JA8B 2PTTB 1ZIAA 3BN9C 2R59A 3ZE2B 1IU1A 5IEHB 3KWVA 1EZSA 1L9OA 3L4XA 2QTVA 3V0GA 4JRYE 5DHDA 1CXLA 4FLOA 2EXWC 4XMKL 1JV5A 5C0CA 1DBKL 2IH3A 3ZDWA 2DTML 5JXED 3QNXB 4XXCA 1KGWA 5H8DA 1QAWA 4J8QA 3SE3A 1Q0XL 2VUYA 5DJ8A 2IADA 4WTXA 2GW5A 3L17A 4PIRF 3CDGA 4GKZA 4M43L 3UGUA 4WI4A 4L18A 4UMGA 1TEYA 4ALAH 2AXGB 4YK4C 2PPCA 5IJBC 3PCYA 4M5ZL 5D7KE 4FCHA 3LDBC 1AYRA 3FU9A 4F58L 2BSBA 3IDMA 4OCYL 3SDXA 4Q56A 4P0DA 2P8LA 3QT2A 3C2AL 2VR9A 1RIVH 1WRFA 2I85A 1AO7A 2VXSL 5TDPA 3DDFA 4BZ1L 5DZLA 4AKPA 1YY9C 4LASH 3ZTDC 4KRNA 3IGAA 2ADFH 1X7QA 1OP5K 2QZ5A 1YCSA 4AZUA 3ZQWA 3FZUD 1WWAX 2Q8AH 1JIBA 1M1XA 1SLXA 1EO8L 4ELMB 3BPLC 5CCKH 2ZWZA 1WK0A 2A6KA 3I50L 2VDKB 3Q1SL 1T2QL 4N90D 5IHUL 1MH5A 4BGDA 5F7DB 2E7BA 3F7YA 4PAZA 4UNVA 1RQ5A 1ZWIA 1OWRM 1XGPA 3FFOA 2EDHA 2I5YL 3QWOB 3RL1B 4JQVA 4RISL 4J39A 1WTLA 1MHHA 1S7UB 3A6BH 2X4TA 3O3DA 4BRVA 1AR1C 4CVXA 1D3CA 1TTCA 2ZOLB 1X6NA 3KXFB 4O2EB 4HD5A 3QPXH 3NFNB 4FTVE 4Y4KA 4HZAA 5DZVA 4S0TD 1BAGA 3X11A 1NAML 4ZFFA 3FL7A 3B83A 1PZ3A 4X80L 1CVSC 3JZYA 3Q3GB 3U46B 4MTMA 1T03L 4IK6A 4K23H 4WRLA 2H2PD 2CK2A 1I1YA 4RLDA 2PCYA 3B4NA 3V0VA 3NDYE 1CLYL 1QRNB 5JQHC 5AOLA 2R0ZH 2I25N 3O0RL 2ZONA 5BOPA 5GXBB 3OQ3B 2AAVA 3QI9C 1CQKA 2IG2H 2P46B 3WUWG 1YEFL 1S7WA 1CWVA 2B7DT 3OR7A 2J72A 2V33A 4XHJD 4B9PA 2PWFA 3DTXA 1OGAB 1XBDA 5HYFA 3DYPA 1A02N 4YDNA 4TQEH 3INUH 4PJEA 1OE3A 3I02B 4J8RB 3SPIA 3B1UA 3MV9B 5E9DA 2QV2A 3OZLA 5DD5H 4U6VL 1MFDH 1JGLH 3LIZH 3W82A 1BHGA 1IIKA 1BZOA 4HALA 3HB3D 4X8GA 3FRPA 1HJBC 2VR5A 3S97C 2ICWI 3OKKA 1TMQA 2G4EA 3RX9A 2CIKB 1HE7A 2D4DA 2NY3C 4OR1A 5CJBA 1IEBB 4R3SB 1H3XA 3KR3L 3F84A 5CFAA 1UD6A 3BUYA 3GD1C 1SEQL 1TNNA 3ARDD 1L0QA 2BS9A 4E0RA 3OLDA 1BAWA 2QPEB 5AKVA 3RKDC 3NOIA 3WN5C 5CEXB 3MRMA 3JYCA 4OI7A 4J3OD 3VDAA 1KCRH 4N0UA 4TRPH 4PREB 1QRKA 1J0IA 3WIFB 1DJGA 1A6AB 1KIQA 2OCFD 3FTSA 3MUGA 5MEPA 3ULUD 2Y06L 3VSTA 1DDHB 1YEHL 5IWLA 3TBYA 4ETYA 4XPHL 3RVVD 2ADIA 1GVIA 1Z2KA 2R7EB 1YAIA 2KHAA 4AC2A 5I73B 1BEYL 3ULVL 3MNVA 1BQHA 3AREB 1JYVA 1OARL 4L1HA 3UEZA 3CFIC 1SLVA 1QEWA 1PAMA 4WO4D 4B9KC 1J7VR 1AANA 5BUPA 3VFWA 2Y9RT 4ODSL 3V0EA 1O7SA 3DBXA 3SQBB 2I9TB 2CZNA 4X7EC 3TA3B 4H8UA 3KLAB 3PDOB 4F9LA 4UQBA 1NFIA 1WISA 4HPOH 2Q1EA 5B39B 2V3EA 2FBJL 2Z8VC 1G94A 1HQRB 5DQJB 3INUL 1VCBC 2VC2H 4HUMB 2C4XA 3DC0A 4LLWB 3ETSA 4OF6A 5INCB 2YK1H 4J5VA 3TURA 2J4WL 4NENB 5MENA 1YYMH 1SJVA 1A6VL 1RIUL 4HWUA 2BIPA 4F2MB 5SWZE 2WNGA 1RZKH 2XWCA 4BQBA 4XCFH 1NGXA 4FFWD 1RL1A 2N7AA 4LLDB 4MZRA 4EBQH 2AC0A 3CFKB 2WHVA 2HFFB 3QULA 4FQLL 2HT3D 2Q3AA 1UOVA 4LPWA 5BXFB 1UKTA 3G6DL 4WV1C 4LPUA 3U0TA 1DJIA 3OKNA 4X80H 4XP1L 2KKQA 1MFAL 3FMGH 1HCZA 1DSWA 1N2RB 1WYJA 4MZ3A 5D1QD 3ZE0B 4NAMA 5BZDB 1GY1A 2Y3NA 5E6YA 3EADA 3WUWB 1LE9A 3ARWA 1EFXD 3A67L 5LCVL 4JFYA 2OMNA 1QR1B 2CR3A 4RGMC 2C5DC 4I7ZC 1V3KA 3ZX1A 1G6RL 1IGTA 2KS0A 5DUML 4JO5A 2CK0L 2VSMB 4JGJA 3B2DC 1ONQB 1MCIA 4PJAA 1ED3A 4PRAB 3SPVB 1ZLUK 1AE6L 1AZCA 1FBIL 4KX7A 3MFFA 5CJXC 1SVBA 2J8UF 1OAXL 1INQB 3QIWA 3VA6A 2NNFA 3FCGA 3CHPA 2WO3B 1Z3RA 3QEUB 2H3NA 1M71A 4ZXBA 5JNYB 5IW1A 1HL8A 3KXFE 3BKCL 5FLUA 5AW5B 3TO4B 2NZIA 1YRKA 4UQ3A 3KLHD 4LMQI 3MUGB 5MEPB 4AE1A 2WBXA 5DFVD 2YAQA 3DK2A 4ORGB 4HOWA 3PNWB 3QPKA 4FZ8L 5E6RB 1U8MB 3DHMA 2MRYA 1DHKA 4BCYA 3HIZA 1K9TA 3QQ9D 1NFKA 5GJSH 2L7QA 1M4KA 5ANMB 4B53A 5J6HA 1G7HB 2VRQA 3LNDA 3HI5L 5EU7E 1OOAA 1KACB 3EOYG 1BFOB 5D5MB 3UMNA 1DANU 1CFTA 2QKSA 1NH6A 3TLRA 3OAYH 2FJFA 3QUML 2F7QA 5JLZA 2AF2A 1E8YA 1O75A 2IALB 3PDDA 3G9VA 5FUOH 4EE2A 1RZGB 1EZVY 1XGRB 4OLUL 1H0DA 1D5MA 4WEBL 1OAKL 2GI7A 3VX0A 3H8NA 2EDQA 1F41A 2DM2A 3GTVA 3KAAA 5E2VH 5ICXB 1JHKL 3C5SB 4WW1B 5EOQH 3O0LA 3B2PA 3ISRA 1VEMA 4NCDA 2FWLB 2JVUA 3GJEB 3DXAD 1XF2A 2FB4L 1QX1A 4NZRL 4OZIE 5D71L 3UPRA 4H13C 3RWFB 3BQUC 2N0MA 3FNKA 4YZWA 4WEMB 4XB3A 3WFEL 4QOKD 4U1JB 3SE3C 1MLBA 5IEKA 5DLMH 3WDHA 2AHIA 4DUWA 5FECA 2ORBL 2X9ZA 4F15C 5AENA 2IOOA 3PWVA 4X6DF 2ENQA 4A04A 4MHHI 3PGDA 2IBBA 1QFHA 2WUBH 4G5ZH 3JYBA 5DFAA 1LDSA 3MLUH 4G8IA 1E7VA 4MNGA 2EVIA 1T1WB 4H8WH 4W9KC 2DYPA 2F8XC 2AI0H 4BK5C 3CVHL 1USQA 4LF3B 1EJOL 3ZQXA 5KBLA 3G5ZB 5ACLA 2R1WB 4V11A 3HUJF 1ZVSB 1MHCB 1A6WL 2R51A 3D48R 4K23L 4G7VL 2BVOB 3RWIB 5C0EA 5AVSB 5IHBA 5BVPH 3U6RB 4TNVF 1YEDB 5L2KB 2KLTA 2ENSA 2VO8A 5I0XA 3Q7JA 3ULVE 4S1SL 3V4VA 3LQAC 5FF6A 3B9VA 2YEZA 2YXVA 4UOJA 1Q8MA 2ZJSH 4PRPD 2IFGA 4PP1D 4HGWA 3FU7A 4BFNA 5DUJA 1T80A 1HINL 3Q1SH 1MREH 1MCRA 4LSSH 5DK0B 3S8GB 3FB6B 4Z3FA 4AEFA 1E0OB 4M3HA 3SDCD 3ULSA 5KTEL 3WCYA 3SO3C 2DQCH 2EZ0D 2RBLA 4AI7A 1YEGL 1EHNA 3N41B 4MNQD 3ECBA 3ARUA 4OCNC 3HN3A 2IQAB 3LY6A 1BFVL 3MLRH 4LEXH 4PJAF 2PWEA 3QUXB 1QLFA 1TVBA 2BIHA 3BYYA 4FULA 4MCMA 1DANT 5GGRB 1ZPUA 4KKBD 1WV7T 5I18L 5GGUB 3O6FB 2EC9T 4JFDA 1DFXA 1NCCH 4H1LB 4Q74A 3Q6GL 2ATKA 1ILSA 3LRSB 3DBXB 3SQBA 1PG7W 1WBXB 1EPFA 2H41A 3LEYL 4DZ8B 1AFVL 2PTTA 4PJGB 2CO6B 4OJFH 5CP7B 4L4TD 2A1WH 4MX7A 4KROB 4CGUB 3OPUA 3I6GA 4FFVC 4M9OA 4E5XA 2AQNA 2HJLA 3V6OC 4X6EB 1EHLH 3D0VB 3V5DB 4YGAB 4FXGC 4X4ME 4JFEE 4YDVA 1DN0A 3WFBL 3MA7B 1CICD 4MD4B 4PJXF 1Q9OB 1TPXB 1GW6A 3BUPA 5H35A 2UVEA 2BSSA 2YMOA 4H2CA 3SQOL 4HPYL 5CEXA 3VFTB 2X28A 4PIBA 5IGXL 1IBGL 1XGTA 2J8HA 3E3QC 4XN2A 5GHWL 5D7LB 5F7UA 5DGQA 4R7NB 4NZRH 2CMRH 1J8SA 3JUYA 5INDA 4UAOC 2KI6A 1ADQH 3QP3A 1IEAB 1Z5LA 5AAMA 1JYWA 2ZWYA 1HFUA 5EEYA 3PWNB 4KFMA 4N5ED 5E8PA 5HHXH 1FZKB 2YS4A 1UC6A 2CUIA 3OAZK 2X2YA 1BJMA 4IM8A 3PWUB 2PCXA 4CMMB 4TV3A 1QVOB 3P40A 3O8XB 5K93A 4XE5B 2YFOA 4F37F 3LS5L 4OI8A 3QUMH 4GMTL 4OGAD 4ZUSA 3QS2A 5JW4Q 12E8H 1NSNL 3CZEA 5DR5L 2WKGA 15C8H 1MCJA 4PCKA 5D1ZC 2WP3O 1CICB 1L9NA 5ESVA 2OX5A 4QXTB 5L0QB 4FNSA 5L4IA 3DPBA 2XX1A 5D1XC 1Z66A 1DQTA 4YHIA 5JTWA 5JXAL 3QNYA 4GKOA 5EO9A 3LXUX 1BEYH 4YHYB 4PJIB 2IANE 2DQUL 2ZWKA 3RJQB 4P5RA 2NYYD 4XODA 9PCYA 4WO4A 3ARGD 1P4LA 1WCQA 4GRMA 1AAJA 2PNDA 2R2EB 3IJYA 4IRJC 4JZJB 3G08B 1CDIA 1P0SE 1L0PA 5AOJA 1DVFA 3MN8A 5IJKC 3QZWA 4OB5H 4HWEH 3K80A 4RFEA 1F13A 4RVBA 3ASWA 3HMWL 2BOBA 5DJAB 4J12A 4YHMH 1TTUA 1BD2D 3ARVA 4N9OB 4RA0C 1JDCA 2FNWA 3IJ8A 4PW9A 4MZIA 3CSYA 3VTAA 2CA3A 4X9YA 5GQBA 4Y1AE 5LNGA 1X5HA 3AT0A 2O6EA 2CJUL 4Y1AB 3VSUA 1ZV2A 3I9GL 3RIAF 4ADJA 4K4KA 1FVCB 4NZ8A 4WI9A 1XHHA 4I9XA 3MRDA 3TEUA 2VDML 1TZIB 3A67H 1S78D 5LCVH 2VW6A 5TF1H 4WTZG 2H7WA 4YSRA 1OB1A 3B5GA 3D3VE 4X9FA 2HX8A 1FZJB 1JRHL 2GI0A 1KTCA 3L9EA 3ZYZA 1YEWA 3EFDL 4LU5H 4HA1A 4Y16C 2V2WA 2J1ZA 1OSYA 3FTVA 3MI6A 2L04A 1CZ8H 2JB5L 1GJUA 4K8RD 1BJ1H 1PY0A 1J0HA 1GC1H 2V4LA 2AXWA 2NYZA 1EFXA 3JQOB 4I89A 1OCWH 5FO8B 2XKSA 4O00A 2K9FB 5KSBE 3H4HA 5K5YA 2DH2A 1RIUH 4JO3L 2V9TA 1FZJA 3S4SG 4HH8A 4LCYB 2C9SA 5BJTB 1ZK9A 2WO4A 3EYOB 5IG7B 4X4XB 1B4TA 3QUKB 5IK3A 3UL4A 4NHUB 5FYKH 2XBTA 2YKLH 4PJ8B 3KPNB 3PIQA 3LCYA 1GRWA 3PPEA 4ONFH 4JY6A 5DGRA 1N70A 4ZQKA 1MRFH 3H9YA 4PRHA 3NABH 5HTSA 4PUBH 2Q8BL 5G4NA 4L5FE 5G5DA 1D5BA 1Q94A 3OKOA 2FBRA 4AVHA 4AEHH 3VI4E 4F8PA 3EFFB 1T1XB 3DXAB 3V5DA 3EF4A 1R24A 4NIYE 4P2YA 1HXKA 4HMDA 4G8EA 5FHBH 1WA0X 3FCSB 3TJPA 4DZBA 3RB5A 5CLWA 1YYML 1EO7A 2FIKA 1TTBA 3DX3A 4PJGA 2F68X 3L08A 5AW3B 3TU6A 5CJQH 1JXKA 3WD5H 4A6YH 3U82B 2AVGA 2ZPKL 5FIEA 4NQDE 2XFXA 2IBZX 4X8JA 3DRQB 2PWGA 2FYVA 4OSUL 4LFHG 1KWGA 1IZKA 5GGUA 2IMNA 1PZSA 4X6FA 3RGVB 5I1KH 5DO2D 2OX5B 1S7QA 3QUXA 5ESVB 1FV1B 1OXYA 2VDLB 4O5LL 1KJMB 3L3GA 4OLYH 4GBXA 1WFOA 1E8WA 2E9JA 4WGVB 5DJDB 3VXUE 1GGCL 4WZ9A 2IO5A 3S0PA 1PX8A 5DMIL 5E9AA 2O30A 3HNTL 1R3LB 2I9LA 5TQ0L 4Y89A 5KANI 3O4OC 3IJ7A 1S9YA 2E7MA 4UIKL 4AKOA 1KLUA 1U6AH 4C58B 1NBCA 3EYQD 1Z9NA 3E6FA 4LQFL 2DLGA 1RHHA 3RIKA 2Q7AA 1BA9A 4IBLT 1QRND 2ATPA 4ZFZB 5I8OL 3F58L 1WFNA 1UUSA 4L9LB 3RILA 3BAEL 5E8PB 3FOLB 2R1YB 5L8JB 1JFQL 3DVFA 2WLIB 4EUPB 4G8FB 1I3GH 1ZA3A 5ICYA 4UM9B 3QWNA 4EDXB 1IC4L 4GRWF 2ADJA 3R7QA 5CSBA 3VRJB 1M56B 1S7TA 4Y19D 1D7DA 4TULL 4LOEA 5EZLA 1NGWB 1OAZH 1U42A 4IJTA 5BPPA 2DL9A 4HKXA 3SOBH 3ZDYB 1OE2A 3ULUE 4OD2A 1FLRL 3GSQA 1S7XB 2XZAL 4HOMA 2GIMA 5I5IA 3LSOB 2XC8A 4U1GB 4FD0A 5ELIA 5I1GH 4E9WA 2ZCKH 4R26L 3WJJA 3FO9B 4S1DC 4U7SA 1EH9A 2WV3A 2WYZA 1IFHH 1UZ6F 3MLVH 4NUGH 1W0WB 3MJ9L 2V8LA 5I0ZA 5FPIA 5FCSH 3T0BA 2QFRA 2GCYB 2G9HA 4XNMA 2JCCE 1Z1WA 1C1EH 2LAGB 2W81C 3TIEB 1N68A 1X5AA 2G75B 2XG5B 3T4AC 3B3IB 3OKDA 1DQIA 4MD0A 3BVXA 5C0AB 2WZ6A 5PCYA 1YEJL 2KPWA 1KLGA 3G6AA 4LVHC 5FYKU 1CLOL 5CU5A 1KXQA 2HKAA 2NDGA 4PJXA 5CN3A 4Z0XB 2D7TH 3QPQD 1ZS2A 4IBZA 1DSFL 2XTJD 3MRLB 2Y7QB 4AG4L 3LKOB 1YSOA 4NJAH 5GSVA 5ICZB 3ALXA 4PJCB 5EOCL 3EKCA 4JDVA 4RGNE 4YNYB 2R8SH 3RE0A 3GIVB 3NJFA 3E9UA 4HCIA 2C3HA 2DBLH 1AGFB 2J20A 1VJSA 1C12B 1ZT4B 3MCKA 4ENEC 3OPZH 2RIKA 5I28A 2NQ3A 4P4KB 2D7OA 3T8MA 5LNDA 2WBJC 2NDFA 2VNCA 4MA1B 4UV7L 4K73A 4KI5D 2XWEA 1CDYA 1JGVL 2QQNL 1BSIA 4J2QA 3H7LA 3II2A 5KTEH 4F37K 4NRYB 1MREL 3L3OB 4GLRI 5CGMA 5FO9A 1PZBA 2IH1A 1RZPA 2X3CA 3ARZA 3CZJA 1W8EA 2ED6A 4LLVA 1PDKB 1ZV9A 4HWBA 4LCCC 4DKEH 1KIUA 4JKPL 3BVWA 5B1CA 2ZWNA 2N56A 2BNUA 4OCYH 2BC4B 5AAMC 2X05A 1HZHL 2UUDK 4LL1A 1NC2B 3EH4B 5C0RH 5DFTA 2GTWA 1KELL 4K7PY 2FR4A 2GUYA 3UTZB 3IK2A 4X99A 4NN6C 3EYVA 3WJMA 2MQ3A 3L5WA 2P4AB 3T04D 1T1WA 3LNHA 4KMLB 4Q6KA 1V8HA 4X9BA 3S34L 3DOSB 1B0IA 4YSPA 5DUPL 2NY7L 1RZJC 4FQQB 5SX5K 1P7QD 1FAKT 3WGVB 3OX8A 3DHPA 4GP5B 1RK1B 3TVMD 1WWBX 3KCPA 1FNLA 12E8L 1NSNH 1DQJB 3PFUA 3T65A 1FCCA 4OIAA 3M6DA 3EJZC 4QGYA 1TQCC 3DUUA 1SMOA 4FXKB 2YD8A 4PJ7A 3S88H 1MJJA 4XXDB 3VDCA 3TH3T 4GRWE 1TF4A 4YXKL 1CLZL 4JZNB 2WUCH 2J5LC 2HT2C 3N6YA 4JKKA 3KGSA 1M05A 5C0NC 2JB6A 4XPBL 2XACC 2Z1KA 4ONGH 4TF4A 1E27B 3JTTB 3FC8A 2F7RA 5T1KA 4BFGA 3B9EA 1Q1PA 2Z3FA 4HS6B 1B4JH 4L1TA 2HTLD 2IAMC 4NGHL 1P6AB 4Z7OE 5DUBB 5GRUL 1H15A 1ICTA 1P53A 2RFXA 5E8NB 3KPRB 3W39B 5IB4A 3ZDZB 1G9MH 4Z3TA 2YMXL 1ORSB 4HV8B 4J3TA 4BCZA 3IF1A 1NUDA 1WJ3A 2DMCA 2GFBA 4LRNH 3I85A 3KEHA 3KLAA 3SDDC 1HC1A 1OAYL 2J12B 3BMVA 3H9HB 3PNWA 2J25A 3RTQD 2Q3ZA 4HKBB 1T7YA 2Y2TA 3T77A 1DJZA 1KCWA 1OL0A 3W1ZA 1T04A 1Q1JH 3SE9L 5HGAA 1CF1A 2P28B 4NAQA 1MAMH 4WNQA 2YAFA 1F1DA 5A16A 4JM2D 5EWIH 2RGSA 2Y1VA 3MLXL 3MRIB 3QWQB 2LAAA 4KY2A 2YD4A 4PPTA 1AY1H 3MFFB 3GEFA 4GSQA 1A1MB 5JIPA 4CC1A 4HC1A 3T71A 2Y7OA 2CUHA 3H7BA 2X7LB 4LOUC 5LWYH 3CQFA 1MG3C 1H9VA 1MOEA 2JK5A 2OL3L 2YZ1A 3MBXL 2XQ0A 4WI0A 3UADA 1JZJA 3SDYH 1RZIB 2RB8A 3EYUH 1YAZA 4HK0B 1KBPA 3V5HB 4LDEB 1NZRA 4TQHA 3OHXC 3TP4A 3R06A 4MVBC 2OP4L 5D7JB 3BP6A 3TWCH 3WY2A 1LWJA 1PZUB 2HKFH 2XWBB 1TG8A 5FA4A 3BZ5A 2CCVA 1NBZB 1SJHB 4UDTB 4DCQB 4A7SA 1IC5H 2R39A 4Z7WB 1RJYB 4YLBA 3A4FA 2X2HA 3HA0A 5F7FA 4YXHL 1AG6A 3INOA 1GS7A 1HVXA 2HN7A 4I8DA 5IBUG 3H0TA 4E41D 5HVHB 2LE9A 2ZKWA 4QD2E 4KQ4L 3AACA 2AJXH 3GMQA 1E27A 3JTTA 1E9OA 5CN2A 3WNLA 3L4WA 4FI7A 4I18B 5E9DB 1NMCC 3OKYA 1UACH 4NQDB 4JFZH 5A6LA 4G82A 5D7LE 3QULB 3MOQA 3D0LB 1DLFL 3OF6D 4AYEC 4FG6C 1TCRA 5KSBF 1K4DA 3HPJB 4W6YB 4PJ7B 2XN9D 2JKXA 2VXVL 3DRTB 3MUZ1 5CZKA 4WUUA 4XRCA 4DKFL 1FSKC 3ZDYF 5FK9B 4Y5YB 2ADGA 4W9IC 1VFBB 1A6ZB 2OMWB 1R3HB 2RHEA 4AE0A 1NGPH 4PBWD 3KCPB 5DS1A 1TEGA 3TO4C 3NUKA 4HIHA 1QWNA 3QIUC 4J3UA 3L4UA 4ZUWA 4ZFGL 3E1F1 3GRGA 2MEJB 1NANI 1FRGL 2XFXB 2AXHA 4PJ6A 3QW9A 2AV7B 2AZAA 2B9AA 2YPVL 3K6NA 3QUZD 4JANB 4H88L 4N20A 5CKGA 5E2JA 3SY6A 2ZXBA 1OPOA 4WW2F 4RMUA 5LAPA 1TR7A 3RL1A 4ZMOA 2VAAA 4F2ME 4DN4L 3GKZA 4B9CA 4NDMA 5F93C 3WMSA 2O5ZL 3T6XA 3PGFL 3B3BA 2ZF8A 1PZCA 3NPSC 5F6HJ 2UZPA 5I17A 3N2JA 4R7LA 4ELKA 1FAIL 3W5MA 1WIUA 4JM2F 3PS6A 4WIQA 1NAKL 1XD1A 4XCCH 3AGVA 1FZMA 3D9AL 5EU7C 1ASQA 5EULV 2DPKA 4NWTL 4CRPA 2A5UA 5TGBB 2WSDA 5GS0C 2WQAA 4X6CE 1BBJA 3SE4C 4DEWA 1WO2A 3JTBA 1HCYA 3T0XA 1CUOA 3BKML 2HFEB 4JCLA 4QRTA 3U9UA 1A9VA 4IKKA 2YPLB 2D7QA 5T1JA 2VJXA 4MB4A 2WGXA 4N28A 4RBPH 5I1AA 5I0DA 3FHQA 1HU8A 1JTPA 3LPFA 4N0FA 3OGCB 4KKCD 5C3LD 3B9DA 1U91B 1DQLL 4KC3B 4FP8L 1F3DJ 2X6MA 5FKAB 3VGAB 5TQ2H 1LEIB 3K0YA 1KFGA 2B4CH 4Z7VF 4DQOH 1W8OA 3SKMB 4IU3A 3BZEA 3M88A 4R0LB 5BOJA 3V0JA 4HGKC 1MFDL 3EYFA 2IQ9L 1JPSL 4F15B 1JV5B 5C0CB 1LO4H 1ETA1 1T0NB 5H37A 3I6LE 5TJWK 3H6JA 4U1SA 1UFUA 3A6CL 5AQ0A 25C8H 4DAGH 1XFPA 4OFKA 5D6DA 2BNQD 3MOAH 4PJEE 3S35H 4C8XA 4NLAA 4G59C 5E9DE 5E24E 1ZV5A 2D7TL 4ZO8A 4K3GA 2HRPL 3IAGC 5KSVB 3CHXA 2MSPA 4I77H 2FJHB 4FGMA 3UCRA 1RZKL 4ZBJA 1MFNA 1WCBA 3QHZL 4KROD 5IMKA 4LCCA 2HX9A 1MPAL 3CFDA 3QJQB 4QF1A 4D0DA 4U6YA 2Z34A 4Y19B 1Q72H 3L2LA 3NZ8B 2WXPA 2K7PA 4UNIA 4F9LC 3NAAH 3AU1A 2EADA 2ICWA 3RWCA 3PP3K 4M48H 4KDTA 1ECYA 5HHPA 5D96C 4MDIA 3F7VB 1NMBH 1RSFA 3UTTA 2F53D 3D87B 1IFHL 3FUIA 4B9ZA 4M7LH 5JW5B 3MV9D 1TO5A 4MBRA 4RFOH 3ZMEA 5C8JA 3KPQB 4JQIA 1A4JB 1G9NL 2E8ZA 1BCIA 3K6OA 5D7IB 4ODSH 3V52H 5DMGC 4LPTA 5KSAC 2CGRH 3VTMA 5AOMA 2M8XA 3MRFA 5LGKA 3NEXA 4OCWH 5E8NA 3EBIA 1GHFL 3MRKA 1PFOA 4K15A 4XBEL 3W0WE 3BDYL 5J89A 4FZEH 5C97A 1HZHH 3F62A 1JGEA 2JB6B 4N6RA 4LSVH 4GY4A 1CYWA 3QORA 3VXME 2BRRH 2SEBA 2XTJE 3MBEB 4XNAA 5C6TL 3MBEA 4M7LT 3HR5A 1ZGLB 3DX8A 2RCSL 5F9DC 5DC4B 5LO7A 1N5YL 4EVNB 1ZA6B 4LBEA 3T4AA 3U6XS 4KROC 3R4RA 1TDQA 2IV8A 2F19H 5ETUA 1GKOA 4OD1H 4X6FB 3RGVA 4LSUL 4BHUI 1XGYH 1G4MA 4Z78B 1Q9LA 1LWRA 4A7QA 3W0WD 4APQC 5MP6L 2Z35B 3WJJC 3S5LA 1BIIA 32C2B 1R5IA 3OX8B 4XNYL 2ROYA 4X42A 3WXVH 2X70B 5I1EH 1A4JA 4RZCB 1NM4A 4H4NA 2HJFB 2AFNA 4NCC2 1ZRUA 2JIXA 5FYKD 3ULVF 4I0PA 1H19A 3EHBD 2WGNB 5EN2B 4F7EB 4Z0BH 4NHCH 4QYOB 3NZUA 3TBTB 4Q6IC 4NNXB 5GGRY 3EYQC 3KPRE 3UMTA 5J0BA 1ZEAL 5ESAB 4HJGA 4YLQT 4OV5B 4XNZC 3E8UL 2D3JA 5GPRA 3CK0L 5KANG 3MNZB 2XQBL 4KKLD 1NBVH 2O5YL 4Y4KC 2Q86B 3VXRB 2JJSC 4XCYA 1SY6H 3FSWA 2DWXA 2AABH 3ZKXB 5TE4L 5HYQA 3AS3A 3ECWA 1JMXA 3TC9A 3I6GB 4Z7WF 3O3EB 4O2FA 3Q8EA 4PHZA 4ZTPL 4R4BA 1A6UH 4PJAE 5IOKA 1QSZA 1ETZA 2WBKA 1NCAL 4QOKE 4DH2A 4ZMYA 4WJ5B 4HHAA 2CDFA 3ESPA 4M62H 4LEOB 5IMLA 3BW9A 5E6ZA 4Z7IA 2AQ2A 4M02A 3STBA 4XB8A 4ZW6A 4UU9B 5HHQA 3WSQL 4L3EE 1HHIA 1UJ3B 1CFBA 1N8ZB 1IGFL 3VCLA 2YSTA 4L8DA 3O0RH 1YPZE 5DHYA 4KNSA 4YDKL 3T4YA 1AGDA 1S9VA 3EJJX 2B3RA 1KGXA 3CBRA 5D4IA 3U7YL 4YSCA 3L3HA 5LB1A 3MRLA 4I4WA 2OK0H 1BVNP 1FPTH 4PTTA 1PTZA 1K8DB 4XGZB 4IMLB 4HH9B 4ESKA 5J4MA 4RAVA 5KAQG 3TT3L 3R7RA 3QIUD 3FUFA 4X6BB 4BM7A 4DP2X 3TO4D 3DI3B 4IJ3C 1NJ9B 5HHOB 4Y2DC 1IM3B 4YLCA 3KS0J 4I3GA 4XPFH 2DWEA 4ZUVB 3ZMRA 1OP5H 4BXSV 4YFEA 1JMZA 4YBHA 3SKOA 4QRAA 5CZVL 1D5IH 1P1ZA 5D72L 4ELKB 3HE7C 2OXGA 3X13A 3CSPA 2MOQA 4G43A 3QCTL 2A6DB 3MUY1 3RWHA 1U2CA 4GOSA 4YSUA 1YEKH 2E7HA 3FO9A 1FJ1B 1PW3A 2PYED 3O45B 4WI3A 1KGUA 4LRNL 1TVHB 2ZG3A 5D4QA 1B3IA 2DIBA 3PGCA 5BO1L 2YD0A 4DQAA 3EYSL 2IJ0C 3TJHD 2DW5A 1RUAL 1ITBB 1KYAA 1E4WH 2QPFA 2G5BB 1P5UB 5LBVA 1UWYA 2XHNA 2VL5A 2K9UA 4KPHL 4A7GA 1BJ8A 2XN9B 2VJ8A 1AZUA 1NAKH 4R4FH 1LEKA 4KO6