1ZXKA

Crystal structure of cadherin8 ec1 domain
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
98
structure length
96
Chain Sequence
SWVWNQMFVLEEFSGPEPILVGRLHTDLDPGKIKYILSGDGAGTIFQINDITGDIHAIKRLDREEKAEYTLTAQAVDFETNKPLEPPSEFIIKVQD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion
molecule keywords Cadherin-8
publication title Type II cadherin ectodomain structures: implications for classical cadherin specificity.
pubmed doi rcsb
source organism Mus musculus
total genus 18
structure length 96
sequence length 98
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00028 Cadherin Cadherin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.60 Mainly Beta Sandwich Immunoglobulin-like Cadherins 1zxkA01
2OMZB 1WUZA 2YSTA 1WYJA 2WBXA 2OMWB 3QRBA 3LNDA 3MVSA 4AQEB 1EDHA 3FF8A 4AQ8C 5CO1A 3Q2WA 4OY9A 3Q2NA 4AQ8A 4ZMNA 4ZMLA 5KJ4A 3LNEA 2A4EA 2X2UA 3FF7A 4AQEA 1Q1PA 3Q2LA 2WCPA 3LNFA 2V37A 4ZMPA 4APXA 2WD0A 4AXWA 2A4CA 4ZMQA 3K5RA 3K6DA 2OMXB 2OMTB 3LNGA 1NCIA 4ZMYA 4QD2E 3K5SA 1ZVNA 4ZMTA 5JYMA 4NUPA 4ZT1A 4ZTEA 1L3WA 3Q2VA 3LNHA 1FF5A 4ZMXA 4ZMVA 5JYLA 4ZI8A 1ZXKA 2O72A 4XXWC 2QVFB 4NUMA 4AQAB 2QVIA 4ZMZA 4XXWA 2EE0A 4ZMOA 3UBHA 2OMUB 1SUHA 4NQQA 2OMYB 4AQAA 3K6IA 5DZVA 2OMVB 3UBGA 1OP4A 5CZRA 3UBFA 3PPEA 4ZMWA 2YQGA 1O6SB 4NUQA 4APXB 4AK1A 4AXWB 1NCJA 3LNIA 1NCHA 3K6FA 2WHVA 1NCGA
chains in the Genus database with same CATH superfamily
3JVGA 5E4OA 2DQIH 2OMZB 4F80A 1MY7A 5SWZB 4DN3L 5IF0A 1RFDL 2G3ZA 1N0LB 4G5ZL 4GPVA 1CLYH 4U49A 4ZAKB 1IC0A 5I1HH 4I3RH 1B4LA 3HZ3A 3PWNB 1KGJA 4RQQB 1QOKA 3ECBB 3WY1A 5ALCL 1G7IA 1RL1A 1R9FA 1WFTA 4QXUL 5ENWA 4A6YH 3T0XA 1QLRA 4MD4B 3CZEA 5EO0B 4XN4A 4AE1A 3FOMB 3UBXA 4KV5E 5EHFA 3CUPA 1VENA 4FQJL 4UINH 1I1YA 2YGQA 3DVGA 4BFIB 3BP5B 5ABDE 2WLHA 1KT2A 2XI9A 4OFKA 8FABB 4NQEA 3ULAB 4HIIB 1LD9A 2XY1A 3KPNB 1XCTA 3EYVA 5DQDL 1YEDA 3BUQA 3NK3A 3DKHA 2DMCA 3KS0H 1CGSL 1IU1A 3D1MC 4GRWE 4CL7A 3GSOB 4IHOA 2EAEA 3MNDA 2X41A 3OZLA 3DX6A 4ZDHB 5BO0D 4D0CB 1YPZA 3QAZB 3N43F 4ZYKA 1XH0A 1HE7A 3GO1L 3VXMB 5IMKB 1OGAD 1UWFA 3F01A 4GG6A 2Y5EA 2WBJA 2A9AA 2WC7A 1P7QD 5IKCB 3STBA 3AT8A 1QA9A 5J11C 3QDJD 3TBCA 1G1YA 1N64H 4R7XA 3SO5A 3M7FB 4G6FB 2BY2A 4FZ8H 1FNHA 2C8NA 2BNQA 4XC1L 3VFSA 4ATTA 5K93A 1KTKE 1HYRC 3S3PA 4GIAA 2AAVA 3ZYOA 2VR9A 1XH1A 1EA9C 4HSAC 2XPGB 4ETYA 2XQ0A 3D5OF 2NY2C 2QQKL 4GW4A 2VLKE 1ZANL 5I76A 3T8MA 4J1UB 2B9AA 3OSKA 5T1MA 3TNMB 5FA4B 2R51A 5I75C 5FGRA 1SOXA 1WIUA 1DN0B 1AACA 1T7YA 1A9EB 5FB8B 2YRBA 4PJXA 2XZQL 4XCYA 1PW3A 1MI5A 4GG8B 4F93B 3PQYE 3ROLB 3W5NA 2X4UB 4YX2H 5TF0A 4WGKA 2WVVB 4UM8B 3V6OE 1HQRA 4PRHB 4QRFA 3CPLA 5FGSA 3ULUD 3DX9A 4HCFA 1T0MA 5JXEC 1M1XB 1R46A 5DURB 3BQUD 3PWPD 3WJMA 1H8SA 3ABGA 4JFHD 2ZP9A 4YHPA 1J05B 4AIEA 3HMXH 3IGUA 1U6AL 3GSNH 3H6AA 1KIQB 1SEBA 2XWZA 3L3IB 4WK2B 4JN2A 5JW3H 4PJHB 4S0HA 3CH1B 1X4YA 5FUCE 3WEAA 3GSQA 4NBXB 5I1CL 2VABB 3WY2A 1NAMH 4RVBA 4LEOB 1IIKA 3OR6B 3I84A 2MCAA 3GMLB 2Z7WA 3KPPB 2WANA 3LPPA 2VNCA 4FLOA 4MA1B 2UV3A 1XCXA 2X28A 3JUYA 4PJ5E 3G6AB 1ZEAH 4Q56A 1INQB 3VI3F 1KLUA 1KENH 4OQTA 3W2DL 3V0VA 3U6XS 1YEWA 1HAWA 3JUZA 1J88A 1KJMA 2ROYA 3QWQB 1DDTA 2NTFA 5BRZD 4FABL 4R84A 3ULVF 2XFXA 5C0JA 1KMGA 5HP5A 1FFPA 1D7BA 1KIUB 3Q2NA 2PO6A 3G6JE 4XNQB 4M7KH 4HULB 1NFIA 3K6SB 1YN6A 4ZMLA 1G0DA 2YOAA 1J1XL 3RKPA 4Q9CA 4J6IA 3FCTB 4FRWA 4Y4HB 2N01B 3K6OA 3Q6FB 1TJIL 3DNKA 3QUMH 5EPMA 5J1AB 1QR1A 2VTFA 5KBNC 4LFHD 2VUOA 3PNWB 1D9KC 1JGDA 1JPFA 1X5YA 4HBCH 3TO2B 3PABB 4AYGA 2I24N 4N9GB 1I75A 5IR1A 2WOBA 3PF2A 3QJSB 1KDJA 5DK2B 4S2SB 3O3BB 4NGHL 4WVRA 1CFVL 4Y9CA 1NCNA 1BQUA 5DYOA 4EDXA 1VF5C 1WDAA 4ISVA 4P5KB 1KB3A 2AJXL 1A4CA 2FATL 5HDLA 3O9WD 4UIKL 3AY4A 4F33A 3DOSA 3PJLA 3VXRE 3QDMD 2A74A 2GJ6D 3KLLA 3CZFB 3RI5F 3V7AG 3VU1A 3QFDB 2V9UA 1MCSA 5H35B 1W72B 4F57L 3I9PA 1T6VN 3ZTNL 4RSYA 3M45A 2J6WA 4M1CD 1JXFA 4P46A 3VD9A 1F86A 1GJUA 1NM4A 4WHDA 1P2CB 2OSXA 3TCLB 3DXAD 3W0WA 1RZFH 4NZDA 3WSQL 4JGJA 5FYJU 5KBLA 1XZ0A 4L8CB 2AJZB 2VDOB 2ED7A 5DZJA 1KLGB 2VR8A 3WTVA 3K2UL 4DN3H 5HHPA 2F54D 3A3YB 1RFDH 3WIHL 4QAWA 4FEIA 4W9CC 2DJSA 2ZQKA 4HFWB 4TLUA 3P0GB 5HJDA 4JY6B 4PJBB 3KLDA 3UZEC 2OYKA 4XVOA 7TAAA 1ET7A 1HH6A 4OFVA 1S7TA 5ALCH 1GRWA 1SUHA 5I74B 4LARL 4TVUA 4V1DA 4MJJA 1V3JA 3DDGA 3H9SE 4M48H 3U9PL 5ICYB 3OXRA 4YSUA 2NY5L 4Z76A 2EIDA 5CJ8A 3TWYA 5I6MA 1OL0A 2R2EA 3GT6A 5D7IA 4G7RB 5DK0A 2OULB 4FJYA 4AYDC 1DVYA 4ZMWA 4ACPA 3RGVA 3X11A 5DHEA 5DQDH 1ZHBB 1MNNA 5DEFA 5DRNA 2EKSA 4M5YL 4Z3HA 3ELQA 5JQHC 1PDKB 2X89A 2BSTB 1CT8B 4WW2A 2BERA 3W3BA 3MCKA 2BP3A 3PG2A 4KX7A 4QRPB 3OMNB 4PJFF 4N6RA 3N40F 3GO1H 2J2ZA 3RVVC 1XR8A 1V7ML 4LNRA 1A2YB 4QI3A 1HWWA 2V2XA 2A7BA 4CRPA 2GUOB 4Y19A 2J20A 5AW0B 1MAML 1AQKL 4XC1H 5DRWB 2Z31A 3O8XA 1R5VB 3BDYL 4HDIB 2CIKB 3U1QA 4KGLA 1R3LA 2ZNWA 3DO4A 2UZXA 2QQKH 4EVNA 1ZV9A 5HJGA 4NBZB 1ZANH 2E46A 3HG2A 1EUUA 2ESVE 3N0PB 4N2DA 1XGTB 2V5TA 1S7XB 2AP2A 3HFFA 3MRDB 4R97B 4Y1AD 4Y4FA 2DN7A 4WI3A 1A5FL 3ARFD 5FCSH 4QRTB 4PJEF 2XZQH 2ED9A 2A83B 4N0CD 1I7RA 4PVMA 4I0PA 3LN4B 5GGVL 4H26B 2DJMA 3C9NB 4YZFE 1GOGA 3TT3H 3BKJL 3C6SA 3PL6A 4ZBJA 2BWDA 3MV9B 3EJSA 2FYYA 2NY0D 5L7XL 1G9NC 4RGNB 3AUVA 1L9PA 4OI9A 3KL5A 4ZSOB 1DEDA 5IVZA 5IW1B 1U6AH 4ZO8A 2OSWA 4YDMA 3P1VA 4P59L 2X70A 4I2XA 1GR7A 1ET8A 3RIAK 4KJQD 4M6NL 4PJ7A 4WGWB 3CFBA 5I1CH 3W39B 3N41F 2BRQA 3ZE1F 3QIWC 2COVD 2VC2B 2Z9TA 3VXNA 5IJBC 2X0UA 4DP7X 5ID0A 1NDMA 3QUZB 1SYSB 3MX0A 4Y16A 2AXHA 5D9SA 1JK9B 3SDAD 2FJHA 4ZNEA 3LQZA 1YYMH 3QG7L 1BPLB 5D7SL 4B41A 2GIYA 4KVCH 4KXZH 3W2DH 3IMSA 1MHCA 4FABH 3TO4C 4XBPA 3CC5A 1NOFA 4L4TB 4XB7A 1FORH 3QQXA 4LLQB 4JREC 4IRZH 4BSWB 5T3ZD 1CFNA 2JSFA 1LEKB 3ZPDA 1FIGL 3LKPA 4JQIA 4BYHA 2NXYC 5LG6A 3VW3H 4GMTL 4GRLD 3UBGA 1NPUA 2VMFA 4HWNA 1HTYA 1NANH 2EH8L 4HIXL 3RE0A 4UOZA 5C0FB 2WXOA 4G1EB 5E03A 1TJIH 2VDML 1GZHC 1FL3B 4IKLA 5TQ2L 3UBFA 1LK2A 1N5YL 3F64A 3U0TB 5E4EC 3RTQD 1N5AA 5A43C 1ZTXE 2Y7NA 1MWOA 1K2DA 3V9FA 2RCSL 4ECNA 3NTCL 4CMMA 3O3EB 4W81A 1CFVH 1WF5A 2FZ3A 4U7MA 2BFGA 3TPUB 4F58L 2WQWA 3W81A 4YPGA 5F2FA 1WGVA 1XXFC 3EYFB 1T1XB 2CQVA 3F58L 1PCSA 4FMFA 4UIKH 4FI7A 1U92A 4ZX6A 4MAYB 3QCTH 5E1AB 3ZGIA 4OD3H 2DQGL 4PYHA 4U1JB 3BUTA 4F57H 5F1NA 1PZCA 2VAJA 3HVNA 3L6FB 4QHKI 5TDOB 3ZTNH 1RZ7L 1H8NA 4KXZI 4POZD 3BPOB 3ZDXF 1F00I 3CBRA 3O2DL 1CCZA 3EOAA 1U30A 1HE8A 3T2OA 3RHWF 2Z93B 2ZZUT 4JO1L 3SSGA 1S3KL 2YMTA 3S4SA 5F93C 3K2UH 3CHRA 1NANI 1OANA 1F4XL 3FFDA 5IV2A 4PJAE 4I1NB 1P6FA 3GTVA 3IMUA 4E41D 2VN6A 2EZ0C 3TBWB 2ITDA 2WBJC 3NIFE 1F4WL 5KZCB 4KROB 4O5LH 5ABAA 4EIUA 4LARH 1FZKB 2BSCA 3VFVA 1TCMA 1E30A 2X4RB 3O81A 3P30L 4LOUD 4ONHA 3W37A 3GDCA 3GHBL 4JFZH 3U9PH 3HJ0A 4N26A 2EXWC 2NY5H 2GK2A 2LFGA 4APQC 2L3BA 3BDBA 3ISRA 3PHQA 4EN3A 1V8HA 4U31A 4XBEL 5ADOH 2A9NL 3HN8A 3C5ZD 3KPRD 1NFKA 4M5YH 5J0BA 1JZ3A 2Q76B 3AS0A 3VCLA 3L9RB 4M3KB 3AITA 3EHBB 1QFWL 3IKKA 3CSYA 4WSJA 2UYLB 4U6XB 3V9CA 4NO2B 3NESA 6FABL 3T0EA 5MEQA 1EQWA 2JIXD 1XAUA 1V7MH 3VWJB 3FSAA 1GYCA 3A6OA 3OAUL 4OCMC 2GI7A 2IPKA 3ZHNA 1CG9A 3HE7D 2V33A 3LV3B 1CU4H 1A7RL 3QPKA 2YWZA 4HHWA 5C0DB 1NAKH 4GUCA 3BDYH 3AREB 4HAGA 5KS9F 3GB7B 3NPSB 1MHPL 4P3DB 1TCRB 4JDVB 4KXCA 5ECJE 3VDAA 4CN1A 4YLBA 4IOFD 4PJDF 4OLZH 3T3PF 3Q44A 1CURA 2LE9A 1A6UL 3H54A 1K8IB 1T83A 1DEEB 32C2A 3QDGE 1S7QB 2WY3B 3T6QC 1MFCL 3CDZA 5ISZA 5GGVH 3ZVVA 1XF4A 2GSIB 5E9AA 3Q3GB 4FP8L 3BKJH 3UTSA 4BFRA 3MAWA 4CU8A 4OF5A 2WKLA 3QXWA 5L7XH 4EQ2A 1BMWA 4PJ8A 3WG7B 4HT1H 1QG3A 5FR3A 4ILDA 1RUKL 2YGNA 4P59H 1CF8H 5ITBH 5EIIB 2BSEA 4TF4A 4PJEB 1U8OA 4M1DL 4DFHA 3KBHE 3O41B 4M6NH 4GS7B 1JWUB 4MJ4A 1WICA 5L4JA 1Q9WA 2ED8A 1V3MA 4XP6H 5IB3A 2ADGA 3WO4B 3ZGHA 2APBA 1KB5L 5FUZL 4HHAA 2WUBL 1W8NA 1ZA3A 2CGRH 3SCMA 1NFDF 4UM9B 5D7SH 1FZMB 1BZOA 4HEPG 3K5RA 1KTLA 3RJOA 5ES4B 3PDOA 4KQ4L 5C7XH 2AJ3B 2A74C 3SPVB 1GZQA 3PPSA 3N41B 3BAYA 3P2BA 3TA3B 3F12B 3GJEA 4JHAL 4I48B 1FIGH 1SGKA 1T04A 5ACZA 1J5CA 5C07A 3D06A 4BKTC 4K23L 3WIFA 3OBAA 4MNGE 3ALWA 3U9UB 3MLXL 2D03L 4P46C 2CLZA 5TQ2H 5ERWA 4KITB 4FYQA 1AQHA 4NO0D 2J7LA 3RZCA 2V7NA 2HKHL 3Q2VA 4LVEA 1BMZA 5I1KL 1G7LA 1MW2A 4O2EA 4PVLA 1VACA 4KV5F 4ZUUA 2RCSH 3C2SA 3QUGA 4L2LA 3NTCH 3QK0A 1DVUA 3JV4A 3TZVD 2EABA 5E9DD 4HCRA 5CF3A 3GJFB 3R4DA 2VZUA 2D31A 3F58H 3QIBA 4HK3J 3JWNC 4GRWF 1EEZA 3IRPX 5C8JA 1G7QB 4GG6E 2CKBA 4L3EE 3DECA 3TN0D 3F5WA 3S6CA 5DLML 1I1AB 4KBPA 2DQGH 3QUYD 3OLEA 4PLOB 1NZRA 4ONGH 1RZ7H 3HPLA 2LV4A 4OLWH 1ZY9A 3L13A 2COQA 1U93A 1M71B 4MWFA 1GS6X 3HW7A 5IK3B 2QDVA 1HILA 4U0RB 3RPBA 3VWKD 5C70A 3MCLL 4YHKL 3DX7A 4JO1H 2XA8L 4FJZA 1PX3A 2WWMC 4NPYB 4WW2C 2KZ1B 2YN5A 3I9AA 5JHLH 3CVHB 2XG5B 5HDOA 4YNYB 3MLRL 4Z7UF 5B1JA 2OYLA 5IESH 1IBFA 3OKKA 4PHZA 1F4WH 3H42H 2WIMA 4MYPA 1T7ZA 3RKDD 5FUOL 3NQIA 2KZKA 2J6EA 1IGIH 3GHBH 2WB1A 5JIIA 4AMXA 2KPWA 3KPLA 3P77A 3O8XC 3AW5A 2RTTA 2R23A 3L1EA 3BN3B 3RWFA 2AXFB 2KERA 3GEWB 5JHDA 2A9NH 3CWGA 4Y4FC 2ICWI 1IZKA 1AMYA 3QI9A 3ME0A 1MFAL 2X88A 4JM2F 2HCZX 4J8RB 5K9OA 2E7MA 4KJWD 3C12A 2VL4A 4OZFA 2HRGA 4WZ9A 1I7TA 2XACC 1F4YL 1QFWH 3DBXB 6FABH 3WDJA 15C8L 1TR7A 4U0QB 3ZDYE 5C1MB 4TUUA 1DANT 3C8KB 3H1ZA 4A7UA 1GJIA 5TPWL 4KX8A 3OAUH 3LKNB 5IVXE 1TMQA 5KSUA 1A7RH 2R69L 4AYFA 3I50L 1K9TA 1KLFA 1HEZB 1OE3A 2XQYA 3NDZE 4JN1L 5DEGB 5EV7A 3MOAH 3VD5A 3ULUH 2X4NA 3I75B 1AQ8A 1BX2B 2UWEE 2APSA 1IBBA 1MHPH 1RSFA 3QSKB 5E2TL 3G6JF 4ZX4A 4BZ1L 4B3VA 5JDSB 4N5UA 4W6XB 4F24A 3L9EA 3HVDA 1V54B 2FSDA 3K7UA 3SYCA 3RUGA 1S9WA 4KNSA 4Y16C 4U1MA 4WI2A 4XNBA 1TO5A 1EAPA 4G70B 3H7BB 1R6VA 4LGPB 1MFCH 3ZHFA 1CXFA 1C8QA 2XBZA 4U1IA 2WYHA 2R7EB 2A0LD 1N10A 4PJGA 4NRYA 1AC0A 4FP8H 5KS9B 4PW3A 3CXFA 3IFPA 2PYFB 1KXQE 4J27A 4XCNA 4R0LB 3X13B 3NJIA 3UZQA 4ZFGL 4XP9H 5I9QC 1SJEB 1XIWD 4HKZA 2CK0L 1RUKH 2Z8SA 5EBGA 3T3MF 4GIPD 1B2WL 3QO1B 1PPIA 3MPCA 1QFWI 2DQHL 4UAOB 3CU7A 4TSBL 3UYRL 5LJYH 4WO0A 2Q1EA 1AC6A 2AK1L 4FHJA 4UOJA 4Z5RA 2G60L 2X1WL 4YHIA 5FO7B 3W0WE 3MRFA 4MB5A 1KB5H 3VD0A 4C83A 3FCSB 4YSEA 4KY2A 1MEXH 1H6FA 1PF3A 3LZOA 1CO1A 1WITA 2WUBH 3Q2CA 1DLFL 4F7PA 3B6SB 4XVJL 1SDAB 5E6IB 3KH4A 3ZTJG 5L0QC 4DKFH 1CPUA 2YPVA 5CSBA 2BX5A 3SDDB 1EEYA 3NZHH 4KQ4H 5AFAA 1KCWA 2P8LA 5AOMA 4M7ZB 3CE1A 1SHMA 4XR8C 3EIFA 1LEGB 5EIIG 4JHAH 4V1DE 1IAKA 4PWKA 2CJUL 4NB7A 3WNLA 3T6VA 3RWGA 4K23H 1HKLL 4JDEB 3W5MA 4URTB 2HT3D 2D03H 1CGTA 3EO1B 1WISA 3MLXH 3Q01A 3HUJB 1JNNL 1WEJL 5AW6B 5SWSD 4GJTB 4HPYL 4OLVL 1ZA6B 2G2RA 2HKHH 3U2SB 1BBJA 5ETUB 1E9QA 2WCPA 4Z7NF 1T2JA 1A4JB 4JZOA 4DTGH 2AXJA 3DK2A 4XVUD 1P6WA 5LGYA 4APXA 5HDQH 5E8NA 3NJMA 1T4WA 4GSUA 2DYSB 3L5IA 2A9CA 3VO0A 4K15A 1CE6A 2VDPB 2I7OA 2Y2WA 1RY7B 1CC3A 2LABA 4ZUSA 2W88A 1HDMA 3FB7B 4LLUA 4Y19E 5CP7B 4MJHA 1Q9KB 3WN5A 5D1QD 4LDEB 1VERA 3N04A 1HXYA 2X9WA 4K7PX 5F7KC 4EN3C 1GMIA 2ARJB 2HPOA 5E94B 3EGXA 5HTSA 2AV7B 3UTPD 1OAQH 4L18A 4NZ8A 1BZ9B 4U1KA 2C9RA 1BBDL 4YHKH 3M7OA 3LKQA 4GRWB 3DC0A 3R7RA 4FXGC 2NY1B 2HLEB 4I4WA 5KSAD 3L4YA 3NRQA 4TL4A 1DJXA 3GKZA 5CN3A 3T0EC 3QYCA 5C09E 1Q38A 4KDVA 2E9JA 3II2A 5FUOH 5B22A 1ZJBA 1AGEA 3FPYA 4HJ1A 1N2RB 4M5TA 5LVEA 5AL8A 4YHNB 2FJUB 5CLXA 3MRIA 4LCCA 4E68A 1NIBA 5F3BB 4MA3A 1AY1L 2Y0SA 3OMAB 3P54A 1G7MA 1YY9D 1MH5A 5DZVA 4A2MA 1I4FA 2Y06H 2VLKB 3DSNA 2WXQA 3GMPA 1NA8A 3KVPA 4NT6B 2A9MH 1AIFA 2YXVA 5HGBB 3NCYP 4L1HA 3CZGA 1NIFA 2WQSA 1P84J 3MUGB 4TL5A 3DIVA 2GJJA 4UOW0 5I1EL 1MFAH 1A3RL 4UTAL 4JPWL 1QKZL 3PWUB 4QDGA 4DFIA 4DQAA 4ZS6D 5EWIL 1E28B 3PQYB 3HHMA 3M1BB 1F4YH 4ZNEE 5GGTA 5E8DL 4Y0GA 1WUZA 3ZE0F 4MXQD 3IRCA 2G3XA 1JN6B 15C8H 3UJJL 4JVUA 4DOHE 4JY4B 2DQDL 4HZAA 3MC0A 5TPWH 2GG1A 1B9KA 4RDQF 2E8ZA 5F7MC 5D6CB 3NEEA 5HYJA 3G5XA 4Y4KC 2R69H 3WFEH 4KRPB 3I50H 3O3DA 4OUOA 5DI8A 4JN1H 5CEZL 1WBYB 4WIQA 2NNCA 4GBXA 5JNYB 3BPLB 2BVEA 3H0TB 1MCFA 5E2TH 1S9KC 1WAAF 2XG4B 4BZ1H 4U2ZA 1CD0A 1T7VA 4NZUL 2L7JA 5LB1A 5J6HB 4RA0C 1F58L 2VERA 5D1XD 4KO7A 4PJ5B 3S37X 3ZTCC 2XWBA 2H47C 3POHA 2BHYA 4JHBA 5KG9B 3Q1SL 3SCMC 4BV1A 3HS8A 5PCYA 1OTUD 3LHAA 5FKPB 2OR7A 5E51A 1TJGL 4UOW1 4IBVA 2DMBA 3RB5A 2HRPH 2H26B 3D05A 4U1SA 3VRJB 1OAXL 3G6JB 4ZZKA 1N6QH 1MIML 3MGOA 2IQ9L 2YPLD 1IEAB 3ARQA 3IJYA 3CN0A 1FC1A 3CFQA 3T9WA 1H9DA 4YFLF 3F7LA 1PIFA 2V17L 3BPCB 2DQHH 2EEBA 1M6OB 3UYRH 3X14B 3HJEA 1O9VA 1KNOB 3VM5A 3ZSSA 2AK1H 2UY7A 4B9GA 2HVBA 1WWBX 3RZCC 2NNFA 2G60H 4N85A 5T3ZH 2W9LA 4MB4A 5EUOF 1DE4B 3QZBA 3CD4A 2DMHA 5JYLA 3UTZA 5BS0D 2WINB 4WUKL 1TKWB 3FO0L 2NQ3A 3BW9B 2QVFB 3ZZQA 4AQAB 1DLFH 3MRCB 2Q20A 4XVJH 3QIBC 1Z32X 2B59A 4NUJB 4A2HA 4A2DA 4KK8D 5F7DA 3AGWA 5CS7A 2DYPD 2WTPA 1J8HA 1NEPA 3H9HA 3L5XL 5FM5O 1ERNA 4EEEA 4E41A 4PJAF 4B9JA 2VYRE 3RLSA 2CJUH 1KGCE 1VZGA 4KKAD 1BM3H 1T20A 1I1CA 2CO6B 4JRXA 5EBLA 5C92A 5AW2B 3RWDA 4C56E 3DX8B 4MD0B 2H2PD 1NBZA 1Y7VA 2IALA 4J3UA 4HUVB 1JPEA 4O02B 1JNNH 1WEJH 3GMQB 4HPYH 4OLVH 1UM4L 3AG2B 3HCVB 1SOSA 3P4MA 4HUMB 5EDXA 5H37G 4HKJA 3QWRA 1SXCA 1YQ2A 5CBAB 1FFQA 2D7NA 3GBDA 1OQOA 3DGDA 3BWAB 4FL4B 1LEIB 4PB0L 3IDIB 3KPRA 5C7ZA 2D7MA 4J3OG 4FZEL 1UM6L 5EO9A 5B1JC 4KKBC 2YFNA 4RZCA 4ZFFB 3T0EE 1K5NB 5KJ7E 1KELL 2ZCHL 2H32B 2PWDA 5CEXB 2F19H 4NOFA 1O7DC 4JZNA 3H9SB 1RZ8B 3PU7A 5J11B 1RUAH 1E4XH 3ULUC 3O0LA 1NMAL 1OKEA 3HC0A 3QJHB 5IP4A 1MJ7H 4N20A 5GGQH 1E27B 4OF7A 3WEXA 1C7TA 1NCCH 5I1IH 4TTGA 1BBDH 5AKVA 2CGYA 1JHTA 1E9PA 3QI9C 5CJXA 1O0VA 5I75B 1NIEA 1OSZB 1R3KA 1EHNA 4KUCF 5B39A 2E56A 1CFMA 1JYWA 2FGZA 3IFNL 2ZX8A 2WYTA 1SN5A 4M8RA 4TNVK 2QPDB 2YAHA 5ISZE 5TE6L 5E1IA 3GRWA 4GY4A 2XIDA 5ID1B 4I87A 1X7SA 4P5MA 3UTSE 2EE2A 3EGDB 2FX8L 3GD1C 1AANA 1AY1H 1E6JL 2L7UA 1UT2A 3RWCB 1E8YA 4GAYB 4O2CA 1D5IH 2ESVB 1CDYA 4UMGA 2OCFD 4M8VA 3VXQA 1GC1L 1LO3L 3TEUA 2XIIA 5I0VA 3OKEA 4L9LB 4YBQD 4Z18A 1EWHA 5HVFB 1E4XI 5B3SB 1QKZH 3OKNB 2CRMA 5CEYA 1G0XA 3H6JA 3FO9B 1JZ6A 5C0EB 3LEYL 1THCA 2CCVA 1WJ3A 4K3DH 1KXTA 2P7TB 1AGBA 1YEIL 3BAEL 5E8DH 2A6IA 2AV1A 4EPSA 1LE5A 1IIIA 2RA1A 2DQDH 3U36A 2C5DC 5B1CA 4G8IB 1QUNA 3F04A 1R3JB 3TIEB 5J3HC 4JFSA 2MOVA 3ZTDC 1U2HA 2CZNA 4YBHA 3L4WA 1V05A 3HTLX 5C07E 1WS8A 3UDWA 2MCMA 2VGLM 5AZUA 3DVNB 5IFAL 1H8LA 1T2XA 2X6AA 4UILL 5LBSL 2P9RA 2ZE0A 2PR4L 4PJ9B 1D9KB 1KXHA 3FYEB 2AXWA 1F58H 1P9MA 5C9KA 4HJEA 3S97C 1PYWB 3UEQA 2FR4B 4NPJA 3MLTB 3Q1SH 4JLRA 1D5MB 1TZIB 4NQXB 5HGDB 3L81A 4NRXA 2AQNA 3UCRA 4BEIA 1WZ1L 5KYXB 4H20L 4EUPG 3AAZA 2J73A 1K3IA 1F11B 4R4NC 1OAXH 1YEKL 3C5JA 4Z6AT 5BOZG 3UROR 2IQ9H 1AVAA 1QHQA 5HD8C 1JXJA 1GIGH 4Q9QL 1U58B 3D39A 4QTHA 2CJSA 4GO8A 4F91B 1N4XL 2V17H 2X4PB 5C2BL 4LCWE 1MXDA 1U8MB 5IUCA 1CTOA 3NT0A 4OZHF 4JW3A 4TVPE 4GG6F 5D7LA 4PFEA 4GAGL 4P4RB 4KRNA 1UQSB 3BVUA 4LVOC 1J9TA 2FGWL 5C0AD 4JG1L 2VUYA 2BY1A 1A1MB 3F7YB 3FT3A 3IDYC 3IGAB 2CHWA 3LQAL 1YO4A 1JRHL 2ADIB 5TJWK 1BVNT 1E5UI 3ZRSA 3NJHA 4F7EB 1AFVL 1IKFL 1W0VA 1R19A 1Z5HA 4HIJA 5IHBA 3MBWB 2Y5TA 5TGBA 1HWHB 2NT0A 4OTXL 3L5XH 4JFED 1EO5A 2YAEA 1OF2B 2OW7A 5E5LA 1FFNA 4JMNA 1O7DE 2XPZA 2YWYA 3EYUL 1JGIA 4LEEA 4XBGB 1XGPB 3GBMH 2MCG1 1MCRA 3HBPA 3SBQA 1QAWA 3SGEI 1VDGA 3CPUA 5JHDE 3UACA 3CSGA 1QRND 2F8VA 2K3HA 4NN7C 3V4VA 4EXPX 4XH2B 2IJ0C 3ZT7A 5DJDA 4FZEH 1NCBH 1ZXKA 5HHMD 2ZX9A 4KY1L 3MV7D 4OV6F 3EOBB 3NIFB 1MCWM 4M8UA 2VDLH 3SBWA 3K6NA 4RAUA 1OB1B 1BIIB 4JFXA 4G42A 4JFPB 3MRMA 5F89B 3RFZA 2VSCA 1IUZA 4LCCC 1MFVA 2X3BA 4N0UA 4PUBH 5BUAA 5CHNB 2BIPA 1DN2A 3CZUB 4PRIE 2OMBA 1CUOA 2V5YA 3H2PA 4B27A 4HMEA 1ODUA 3VU2A 1YYLH 5IVXF 3DX2A 3QIUA 1A4KA 2PTTA 5EORH 1O7VA 2X10A 3PCYA 3NFNA 4YDIH 3T4AB 3VYPA 3MTRA 4YHLL 3COOA 3PXJA 2OXGB 1TTUA 1T4KA 1NUDA 1BQSA 2UWEF 3HBQA 3IFNH 4HFUL 3FQTB 4N3UA 1JVOA 2ADJB 2ZAIA 2Y4SA 5GGRY 2P5EA 1F3JB 4Y5VB 3RDTD 1BQHB 3WENA 3QJTB 3FHAA 5KVFH 2UUDK 3L1OH 3GSWB 3IVKA 4HYTB 2UUDH 1FAIL 2FX8H 3LKOB 2GSGB 4KOCA 4AEHL 5FDWB 3HC3L 4GSRA 1ED3B 3EDFA 3B2XA 4Q52A 4JHZA 5EUKA 1RLBA 4GRLC 4YGVB 5IBTH 1OP5K 1WSST 3FH7A 4NQVB 1LO3H 2BP0A 3CV5A 3MA7A 4G8GD 1OP5H 2KQMA 4LKXA 3QDGB 5FYKU 1IJ9A 1I31A 4F8OA 4PRAB 2VR5A 4P2QD 1Q9OB 1DTUA 3RVXD 1FE8H 3WIAA 4K0OA 1YEIH 3BAEH 3KWXA 3CK0H 4JKPL 4PY7B 3KVQA 1SXZA 1B3IA 5K9QG 3LPWA 2VDKL 2Q87A 1YUKB 4EI5D 1GAFH 3ATFA 5E99L 5EO1A 2DL9A 3DROA 4FC3E 3SDCD 3BIKB 1X3DA 3AABA 3WS6A 1MCPL 3TBBA 2ZYSA 4K9JA 3I9GL 4LIQE 4M6OL 1UZGA 1DJGA 2GUYA 1BZEA 3VH8B 4HWEL 3OKLA 4Z7WF 4UILH 5LBSH 3QJFB 2D7TH 1NC4D 1MNUH 3S34L 3L3DA 1TFPA 4H1LB 5DMKB 3K1DA 2PR4H 3MNWB 5JPMA 2YQBA 4POZC 5ESAB 3DUSB 3FT4A 1GZPA 5G5DA 4PBDA 3V52L 3B9EA 1MFDL 4GKOA 4XN7A 4OFDA 1XSKA 2MPAL 2BS71 2VZ3A 5IF0B 4HZLA 5BMFL 2H6PA 1BCIA 1PEWA 5DHXB 3UC2A 1ND0A 2VWEE 4HS3A 4OFYD 1HL9A 2AF2A 4YHYB 5LWYL 3EUUA 1TLMA 3Q8BA 4WFGD 1A6WL 1GY1A 3WDIA 2DQJL 4FQXA 1YEKH 1G7IB 1NGZA 2X7LB 5ENWB 4Q9QH 2XXCB 2ERJB 5C2BH 3UBXB 3CUPB 2J88L 2OA9A 2AQRA 3DVGB 4N0FA 5ITFA 1AGDA 1SMAA 1KT2B 1IEHA 4GAGH 4RDQG 4WSKA 4N2GA 5D7JA 5DMIL 3QA3A 1XCTB 3EYVB 3HG1D 5CZRA 4JB9L 4WO4A 2QJDA 1FPTH 1Z66A 4JG1H 4FX5A 2PCFA 3DHPA 3TA4D 4IHOB 5AD0B 2BSRA 3IU4L 4ALAC 3F85A 3DX6B 3BWSA 3LZQA 1JRHH 4L29A 3P3YA 1MG3C 4RFNB 3B5HA 2RD0A 4KJPD 2E4TA 3QNYB 2IEPA 4GG6B 2OSYA 2WBJB 2E5EA 3ZRFC 4IRJA 4OTXH 4MVBD 1QA9B 5FYLE 5B1KA 3KG5A 1F56A 5A1AA 5DHVA 1XT5A 4FNPA 3O4OB 3D0VA 3FU8A 3M1OA 3LQMA 2H41A 3VFSB 3ZDWA 3GXMA 2VXTH 4GAFB 2DAVA 3E6HA 4A7TA 1KTRL 2HAZA 1PLAA 3FMGL 4G43A 2DMGA 4KOBA 4PWFA 1CXIA 1U2YA 2WXLA 3TV3L 1SF5A 3G08B 3VUAA 5CJXC 5HYFA 3IEAA 1MFNA 2UXGA 2XVGA 3IU3A 3O6ML 5A2LH 3NUKA 3JWDH 2NUPA 4B96A 4M1GH 2NY3C 1CGVA 2J8HA 4XCYB 1E4WL 4FNTA 3U25A 1S9XA 4JRYD 4P2RE 1HQRB 5TDNB 3CPLB 5CZVL 3DX9B 1T0MB 3V0JA 3WJMB 4JCWA 4L1TA 4YLCA 1H9VA 4M03A 5HYJE 1RZPA 5DTFA 3EFFB 1N7ML 1S7WB 1JRHI 4BZ2L 2R9HD 3LRGA 5DUPL 2NX5D 4JN2B 3PWVA 4P04A 1E7VA 1QFWM 5AEAA 2W07A 5EH1A 3GSQB 3KWVA 1DVXA 2WXJA 1VEMA 2QKIC 1FVDA 2ZWNA 3R19A 1NBQA 1OGTA 3MCG1 4XWOD 3RIKA 4WKZB 3W82A 3NA9L 4YHLH 4AYMC 4KI1A 3NK4A 3R8QA 4HFUH 3FU3A 3K81A 1KLUB 2XWTA 3WE1A 2FK9A 3ZDYB 3V0VB 2P5PA 1NJ9B 4JNXA 3VG9C 1KJMB 3I02A 4WDIA 4HAKA 5C0JB 1ET5A 1G1CA 5A7BA 1FFPB 5LXVA 1B9ZA 4FQCL 2YAQA 1SJVA 2QSVA 2PO6B 5C86A 1NFIB 2DY2A 2F5AL 1H6EA 1YN6B 5HYSB 5SWZD 3ARDB 3HC3H 3DHMA 3UDWC 5EOQL 1YEEL 4L1DA 3V0WL 3FAWA 2YPLA 2UWEB 4QTIH 4W4NA 5EPMB 4ZAKD 3F2LA 5F71A 2BH0A 3K71A 1QR1B 1TXKA 1U8JB 3T0AA 4NWUH 1JGDB 1JPFB 2OTWB 1RU9L 2NW2A 4F1ZA 4KRLB 3VRIB 5IR1B 4CDGC 4K7PL 1MCHA 1RURL 1JMZA 2IH3A 3D50A 5D2NA 1H3TA 1BQHG 5DYOB 3UIYA 4EDXB 1FAKT 2BXYA 3MACL 4JKPH 4HEMA 2WMPB 4ISVB 4GP4B 4M29A 2VXUL 3T0VA 1I9EA 1T5XB 2X53A 2VDKH 1I1FB 3B7UX 2J8UA 5BS0A 3V6FA 1N59A 3D0LA 1KJ2L 4X80L 1T0OA 4F33B 4CGUB 5E99H 1J8HE 1MCPH 4IOSD 4XNUH 5HVHC 3I9GH 5D96C 4M6OH 4XPFL 2TRHA 2XV0A 2APXA 3LPFA 2TAAA 3U46A 3KDPB 4JRXE 4TQ8A 2HKFL 5AAWA 4P46B 2ZP0T 3S34H 3VXMD 1O6VA 3VXOA 1BVNP 2C4XA 3W0WB 5DJZA 1V7NL 1IB5A 5CILH 3LZLA 1XZ0B 2KYIA 3V52H 5E2VL 2HT4D 2MPAH 4G6FD 4OGZA 1NKGA 4W9ZA 4EDWL 3UX9B 2QPUA 2GT9A 2H3NA 4HJSA 4HWBL 3FQWB 5LWYH 3FUDA 3KYOA 2BW5A 4ELDA 2E59A 5LGKA 1A6WH 1NCUA 3L9BA 3NFSL 1KCSL 1S7TB 4W9GC 2YRZA 2MQGA 5DF0A 5EZOL 4V1DB 5FWQA 1JTPA 1E65A 3VH8G 4L1LA 4N28A 4FMKA 3WL9A 2BO0A 5I5JA 3OXRB 4H1LG 3OB8A 4HKBA 2ZKWA 4OD1L 4Z76B 2J88H 4L9DA 2R2EB 2UY6B 5LBVA 4PPTA 3CJJA 5DK0B 2ZUWA 3RGVB 3FQUA 3X11B 3IKCA 1NCWL 3S48A 1JDCA 4PRHD 1C16A 4JB9H 5DEFB 2EKSB 5EEZA 4HUXA 1OK0A 3GXNA 3KGUA 3OM3B 3MCKB 1ZVSA 2LVEA 4JFFA 2IH1A 4JQXA 5F8RC 4N87A 3SJVA 2V2TA 5GSVA 4IGBA 3NSDA 4N6RB 4ZI8A 3IF1B 1JF1A 3HG4A 3SBWC 2J1WA 2I85A 2Y6SD 1VGKA 3MNZB 1XR8B 3UBXG 3S37L 3RFZC 3IE9A 3WXWL 4DEPC 3O6KH 4U33A 4Y19B 2H4EA 5EF1A 2EE9A 2OP4L 2Z31B 2B8OT 1LWRA 2BHFA 3LRHA 1ETZA 2UZXB 4EVNB 2VDQB 3FMGH 2NYYD 3FTXA 5ANME 3BZ4B 4JM0A 3MJ8A 3CFDA 2W9DL 4LP8A 1JTOA 2VXSH 1HZKA 1HC1A 1JAEA 1LM8V 2WSDA 4M62L 2IFFL 2VH5H 5E1GA 3UABA 4MJ5A 1NCJA 3BYTA 3ZKND 1I7RB 2XTLA 2EC8A 2NCEA 2VXQL 4I0PB 2OJ1A 2QR0A 3CFEA 1KBWA 1KPVB 3C6SB 3ORJA 1DQKA 1DZ0A 1XGZA 1NQBA 3AXLA 3PL6B 4KK6D 4M8QA 5CCKH 1G7JA 3DURA 3MODL 2DLFH 3QRBA 2FYYB 2FWSA 4LDLB 5GHWL 4XMKL 3LEVL 2CNZA 3NP4A 5IVZB 1ZLEA 1G0YR 5CAYB 4BZ2H 4MZIA 1TETH 2Z8WC 3KGTA 1FN4A 7PAZA 5BRPA 5GJTH 5GS1A 2PWGA 4A2FA 2GTZA 1SY6L 3BPNC 3FT0A 4O4YH 5HGAA 3P3RA 2BVOA 2G5RA 5F1IB 1NDMB 1OGPA 2WGXA 3MX0B 3G5YB 4ANVA 3BP4A 2FJHB 4FFYL 4NS0A 1HH9A 2EJ1A 3LQZB 1K6QH 3UIZA 4DOHB 3L4ZA 1MHCB 4AUYA 3GMNA 2VZTA 3AXHA 3SOTA 4XBPB 3CC5B 1KEMH 12E8L 2MH4A 4TUOA 4FQCH 3WS6C 1YQVL 5FWRA 4R2GB 1CFNB 1PQZB 1LILA 4TQPA 2F5AH 4M3JA 5J12C 3LKPB 4FYSA 5KWYC 4QRRA 1CL7H 3D39E 4V2CB 1YEEH 1AD0A 3BKYH 3WIHA 1LK2B 5JPMC 5D7LE 1JE6A 2YN3A 3BSZH 1N5AB 5D71H 3ZHDA 43C9A 2O61B 1K2DB 2OAAA 3EXJA 4CMMB 1MCDA 3BJ91 4D3CH 3HFML 4Y9GA 4Z9KB 3IJ9A 2HWZL 4GAAA 4Y7MA 3MACH 4OIAA 4YPGB 1ZGLA 3TWCL 5L0QB 4FQXC 5CJQL 5HYSG 1KJ2H 1NEUA 1R5IB 4D8PA 4J4PA 4PJIA 2KC0A 4HLEA 2EXYD 5F1NB 5FO9A 4QRPD 1C1EL 1KOAA 3ZHLA 3MUZ1 1ODAA 5IIEB 3UMNA 1XAKA 2P42B 1M7DA 5D1QC 4OCRL 5D7JC 3EOAB 4WO4C 4RMTA 1A1NA 1G87A 4RAHA 1V7NH 4GXVL 4F7KA 1SEQL 4DWHA 1J5OL 3I6LD 4MQXD 3ZKMC 1CL7I 3S4SB 4A55A 2CUHA 4EIGB 3MUY1 4G9DA 2R8SL 3FFDB 3GMMA 5IV2B 4EDWH 1EBAA 3G9VA 1QD0A 3NSXA 4HWBH 4UZGA 5KSAC 2QLVB 3GXPA 2ITDB 4KZEH 1UWYA 3NFSH 1KCSH 3GI8H 3PP4L 4LBEA 4PV1C 2D3VA 5EZOH 4OJDH 1P84K 1J0HA 1NTDA 2VERN 3LNDA 3U4AA 3FNKA 3FHQA 4C56B 1KCUL 1QZ1A 4OD1H 4NCC1 1NBYA 3M17A 4YR6A 3PHQB 3IXAA 1PG7X 5F3HA 4GKSA 1FNFA 1ZKAA 4ODUB 1U4EA 3VM7A 1I3GL 3IXTA 3HAEH 4RGND 1OTSD 3L2LA 3V5HB 1IGTA 3FTGB 1NUGA 1AYRA 3LNFA 5KYWA 3S35L 2IBBA 3B8SA 1JZIA 3I3DA 4QAMB 1TQCC 3KWUA 3T65A 1NGYA 3CSYB 3T0EB 5FA3A 3JWOC 1PSKL 4ZS6C 3WE6A 3FZUC 3I6GB 5B4MD 3TIDA 5D4JA 1OEZW 1P7KA 3VTMA 2P5EE 1S9VA 1BW8A 2WIIA 4XAKD 2LGNA 1OQXA 2IPKB 2ZUSA 3WXWH 5DRXB 1CG9B 5FYJD 3F6IA 4M4PA 2OP4H 2G5BA 3FHEA 1Z9OA 3MRBA 3QO0A 2W0PA 1GA2A 4NKIH 4A66A 2MJWA 2Q0ZX 3JSSA 1BLIA 1ITCA 1PZ5B 2VRQA 5EZJA 1F2QA 4FA6A 5J4MA 1X4ZA 5BV7L 2IDQA 1X5JA 3K5SA 2OSLA 2BNRA 4QKTA 4NFDA 4XO9A 4L4TD 3AS3A 5KYYA 4AMWA 2W9DH 2ZTBA 1DBJL 3CN2A 4N2EA 4X98A 2VLJA 3QXDA 4JFDA 4NCDA 5CGMA 2IFFH 4YDNA 3BVWA 1U91B 3TJEL 2VXQH 4FHKA 5D1XC 5ISZB 1MFUA 2R29H 1XF4B 3WFBL 2RJMA 2VDNB 1NLBL 1QI5A 4PG2C 3UTSB 3P9LA 3ZU8A 4X6DA 1BM7A 1SRDA 1DQQA 5GHWH 4XMKH 4PJ8B 2JB6B 5DXWA 2KI6A 3NCCB 1QI3A 1TFHA 1PZ2A 4XMPL 4ZUWA 3EADA 1U8OB 2WNWA 3MGAA 2VDRL 4F3FB 3TJHD 2DZEA 1SY6H 1L0YA 3DJRA 1GPOL 2ADGB 4KK5D 4X6CE 1RJLB 3UTQB 4AV0A 4NYLA 1XVSA 4MAYD 3QYMA 1NC4A 2ATPB 4JGUA 4HHAB 1WO2A 4E2OA 3VD1A 4R4FL 5D2NC 4FFYH 4H8WH 3APMA 1ZA3B 3SCMB 3X3FL 35C8L 3DRQA 3NQKA 2X5PA 3PHOA 4BGLA 2CAKA 3PDOB 4HUWA 4OCXL 4PREA 3V0GA 4ENED 12E8H 2WVSA 3C2AH 3L3KA 4OLEA 4LDCA 3FN3A 4XE5B 1GZQB 4D0BA 1LK3L 4BBWA 3O2DA 1T04B 1RUQH 3ZL2A 5C07B 5L9DL 2PNDA 3VE0A 3HEIB 3V0FA 5J6GA 4L8BA 5AAWC 5HHVL 3G3LA 1P6AB 2XV2A 4TNGA 3I74A 5AVXB 5ERWB 3D85A 3B2UC 2DLIA 2H2PC 3RZCB 2V7NB 4D7PA 5KZCD 1KSRA 4KROD 2ROXA 1G7LB 4N2BA 4O2EB 5DVOA 4AVIA 1VACB 5EN3A 5T5FL 4CVZA 4ZUUB 5IY5B 2QLYA 4JGMA 4O58L 2VSDA 2V9TA 4BELD 4OZGA 2HWZH 3T6ZA 3F8UB 2DPKA 4X7SH 2ZOWA 3TWCH 4BA0A 1AQDB 1FNSL 3WY3A 4H4NA 1PMYA 2VITA 3OV6A 2HFFA 5C8JB 4FQ1L 2CKBB 1IC1A 3F5WB 4NN6B 1C5BL 2P43B 2BW4A 2DIAA 4KXBA 2Q5BA 3ILEA 3VFUB 2W60A 2V3FA 3SYQA 4LCWB 4CC4A 1KPUA 3NSJA 1C1EH 1S7VB 1JNLH 2EXSA 3HPLB 3I3BA 5GRYA 1LE9A 1WAEA 5I18L 3EHBD 5C2UB 1U93B 1FHGA 4FNUA 4RFEA 2M26A 5BUGA 1UKQA 5D8JL 2H9GA 1RZJC 1NH6A 4GXVH 2NDGA 3VWJD 4BHUI 2C1PB 1ECZA 1G5AA 1SEQH 2EYRB 3H2QA 5AW4B 1KJ3L 3B3BA 1I8KA 1UB6B 4JQXC 5ACMA 5C3IA 2BIOA 2R8SH 4MKMA 2CD0A 4PI0A 1UCBL 2WXGA 5JORA 2AS5M 3ARED 4KNTA 2X0VA 1JPGA 3OKKB 3L3HB 4HU8A 3CDYA 3PP4H 2QHRL 3QPQD 4MMXA 4OGAC 2W94A 3MJ9L 2IGTA 1UH4A 3E38A 4EKJA 3QYNA 4LSDA 4B7IA 4AK2A 3KEHA 4AC4A 1BHGA 3KPLB 1KCUH 5AWNL 4LE8A 4AGQA 2EDJA 2R23B 3NJKA 1AH1A 3ARSA 2DD8L 1TENA 2GK0A 1PKQA 1MLBB 1MWAH 2Z91A 4RCAA 1FQ9C 4TMPA 1OTTD 4CDHA 3QWOA 1SMDA 3QXUA 4POYA 3RWFB 4MQSB 1MCIA 5JHDB 3S4SG 5EEXA 4B9CA 4OCWL 1ZDSA 2NX5A 4YBLC 2CHXA 1I3GH 2ZT9C 1DANU 3E3QE 1M9SA 4S1DD 1LWJA 5D4QA 1D6VL 4OZFB 3S35H 1I8IB 4YBQC 5DVKA 5FX3A 3DUUA 3OZ9L 4JZJC 2C9QA 3HHSB 4DZBA 2KLTA 5BOPA 2CJTA 1IGMH 2EDMA 3QNZA 4U3SA 1KB9J 3VXUD 1I3RA 4EZKA 2OX5B 5KSUB 1P4BL 1UJ3A 1ZT7A 2I5YL 3A4AA 3E8UL 3ZIMA 2NUTA 5AOIA 1KLFB 4PRIB 1EHLL 2WCGA 3UCQA 5AVWB 2IV8A 4HXAL 3K80A 1GGTA 2X4NB 1OCCB 4UM9D 4ZZFA 9CGTA 5GS1C 4TKWA 3US9A 1IEBB 3BHBA 3E0GA 5BV7H 2WZAA 4ZMNA 1NMCB 1UTDA 4Z95L 2QSCL 3G7TA 4Y1TA 1BQKA 1A7OH 1DBJH 1DSYA 3TA3D 3UZVA 3A6BL 1EAPB 1KBPA 4RQQA 5CLYA 3ECBA 5GRWA 5JZ7C 3TJEH 1OXYA 4S2SA 3WKYA 4NRYB 4WHYG 3MMEB 3MBEA 1L3NA 2NY6D 5T1KA 3CFCL 3WFBH 3Q06A 2CLRA 2QZ5A 4M3HA 4XX1E 4XCNB 1F42A 3MUHL 3UZQB 4X6BA 4BFIA 1W72L 2DM2A 4HKZB 5FW7A 3CSPA 3EBHA 2CM6A 5DD3L 3C6LA 2JH2A 2Q3AA 2FD6L 4JG0L 4XMPH 4XTRC 2F15A 3X1GA 3LAFA 2UZIL 1FLRL 2VDRH 4MSWA 3GSOA 4Z5RB 3ZN6A 3R1GH 1QTYT 4YHIB 4NQCA 2W92A 2VDOL 3MRQB 3IWVA 3MRFB 3E2HC 5GZOA 1MCOL 3S3BB 3RILA 2LTQB 2DQFB 4WQOA 3OPUA 1I1AD 4ZUTA 3FULA 2ADFL 5IMKA 1A9VA 2YA2A 1QFUL 4YDLC 1Q8MA 4F7PB 4DN4L 3DGGA 35C8H 1TT6A 2ZX5A 1DVSA 3WNPA 2O5ZL 2JLLA 1EEYB 3GIVA 4OCXH 1ACYL 5EULV 4N25A 5DC9B 4UQ9A 2IDTA 2P8LB 3B7SA 1ILUA 2LOEA 2MOGA 4KKPA 4GKZA 4LGRB 3ESNA 1HT6A 1IAKB 3WTUA 3II1A 1T03L 5L9DH 2A6DA 3RWGB 3UBHA 1T80A 2YAOA 1GYVA 2KQNA 2QMKA 1CYGA 5EU4A 4QHLA 1P69B 3UC0L 4LSRL 2B3IA 2OMXA 1JVLA 3WFZA 5JXAL 5INCA 3MLYL 3V6BR 2OPCA 3AGVA 1E9QB 4P0DA 4LVOB 1GS8A 5T5FH 3T1WA 2X4UA 2BIHA 4JZOB 1WQVT 4O58H 5L8LB 1A65A 2BJML 4H7VA 3IDYB 4JFFE 3SJVE 1M1XA 1RKRA 4APXB 5E8NB 1HNYA 1RZKL 1FNSH 3CLEL 3SO3B 4JO4H 1CE6B 1URIA 4FQ1H 3L3IA 3FONB 3Q9PA 4FTVE 1IE5A 4U4BA 2ZOTA 5FOBA 1I8LA 5GZND 4PJHA 1BVKB 3VB8A 4UV7L 4AYID 1HDMB 4LLUB 4LLVB 3L7FB 3W9EA 3WN5B 1F13A 2P8PA 3UJTH 2P80A 1MQKL 1DO5A 1HXYB 4AIZA 5I18H 2VN7A 5DA4A 3FTYA 2HUHA 3EGXB 3KPSA 4LQFL 3KPPA 3DLQR 1B6DA 1ORQA 3OX8A 1XSIA 3D2UA 5D8JH 4U1KB 5I23A 2MCPH 5KJ4A 3LKQB 8CGTA 1KJ3H 3K4ZA 2EVGA 2BZCA 3HMWH 3UL4A 4I4WB 1MFBL 4NN7B 3QEGL 2JB5L 2C9XA 1A02N 1UCBH 3DOHA 4C4BA 1ZK9A 5MERA 4AIXA 1O75A 1R4XA 5CFHA 2QHRH 4TUKH 3BUIA 2Y7QA 4TNWF 4Y4HA 4G8EB 4YDVA 3S3SA 2NT1A 2YUZA 4NNXB 4UYQA 3RDTC 1L0QA 3MRIB 4LCCB 5AWNH 3VA6A 3PNWA 3GBNH 1G7MB 4X4ZA 1MH5B 2DD8H 2YZ1A 5F88A 3IJSA 2VC2L 5DK2A 1AIFB 4QGYA 4OCWH 1PFCA 4UT9L 2HP4A 2HN7B 4H8WC 4P5KA 2F74B 5LCVL 1D6VH 5CR8A 5IQ9A 2L7QA 5CSGA 1RULH 1TU2B 2WQ8A 4DPCX 4BZYA 3OZ9H 4P2RB 4RX4D 2ATKA 3CZFA 5I1DA 3L4XA 1QSFA 3KM1A 3QFDA 3RVXC 2WJ7A 2IOMA 5H35A 1IC4L 2YEZA 3RVTD 3ROOB 2SODB 3APDA 5HYJB 3G5XB 1IVLA 2I5YH 5GIRB 1WA1X 3E8UH 3O3DB 3WKPA 4PS4L 4M5ZL 1EHLH 3TCLA 4EI5C 4QRRE 1OF0A 2OYMA 5B3NA 4GBXB 5EOCJ 2CBQA 1REIA 4JQVA 2W38A 5E6ID 2C7UA 2JKLA 5AW5B 4F7MA 1G6RL 1KLGA 3SDDD 1PCXA 4J3OD 2WB7A 2WN2A 3VD4A 2QSCH 4LKCA 1L0PA 4OZFG 3PAZA 1BFVH 4D0DA 2GPZA 4G7SB 3A6BH 4JY6A 1CD8A 1M6UA 2DQUL 2XWBB 3P4OA 1WA2X 4ZW7A 4M6ML 4HIPA 2N7BA 1QHOA 1VHPA 4HGKC 5DRZA 5C6WH 4N2HA 2XQYG 1HS6A 1LMIA 1N8ZA 2WLKA 3ZDZF 1W72H 3RX7A 1RUMH 3IJYB 3RNQA 3K72A 4H5SA 4MS8D 4WLCA 5DD3H 4FXTA 4JG0H 4AQEB 2FD6H 1EZUA 1BFOA 4PS8A 3VVWA 1FLRH 2FQFA 1L9TA 2VQTA 4NXKA 3HR5A 1YEJL 2VDOH 3RY6C 4NAMA 3V9EA 2FECL 4M9PA 1QACA 4K07A 1KG0B 4LK4A 1QW9A 3MO1A 5C0IB 2ADFH 3HLAA 3FDWA 4J3SA 1OOWA 1L0XA 5DC4B 4DN4H 4HK3N 2DDQL 1FNEA 3FTZA 7CGTA 2IGLA 1KFAL 1ACYH 3GHPA 4PBVC 3UEZA 2C3VA 1J8HB 4IIZA 1R5VA 3H9HB 1KN4H 2CIKA 2CDGA 2QGBA 2PPEA 1T03H 4CC4C 1T20B 2NY1D 3FSOA 4JRXB 4MVBC 2XETA 4KX9A 5EBLB 1XGTA 3KWTA 4DGWC 3D7PA 2CXGA 3KH3A 3QQ3B 1NBZB 2IALB 4TUJB 1UURA 3UC0H 5GJSL 3P4MB 5JXAH 3TOPA 4HKJB 5IHWA 2A83A 1A21A 3TM6A 4KMTL 2XWDA 1E5BA 3LN4A 4IBTA 2BJMH 2YMOA 4MBOA 4JX0A 3AVEA 3DVFA 3SE8H 4AVJA 3QJVB 3TBSB 1GW0A 3MV9A 5EO9B 2IWGA 4HEPA 1RZKH 4RZCB 4ZSOA 1FL5A 5E6SB 2XT1B 4MMXC 1A6PA 2NXZB 2X1QA 4GT0A 2VMJA 1T0PB 1AXTL 3AQDA 4JZNB 5DWUL 1MCEA 3KEDA 5DZOA 1SXAA 1OW0A 3U7WL 2FJFA 3HC0B 1MQKH 4YDJA 3SPHA 1BYPA 4UTAA 1X44A 3PQYD 1WZLA 4LQFH 1PGRB 3DJSA 2Q8AL 3SGJA 3WEXB 3DUHA 1GHFL 3QUZA 3ESUF 3VG0L 1JHTB 1E9PB 3REVA 1IAIH 1OP4A 3QW9A 5IFHL 5GRJH 1R3KB 3MYZA 4K2UH 4YMPA 4KRPD 2VLJE 3QEGH 4X8JA 2RQEA 2JB5H 4MHHI 4XWOC 1A8JH 2NY3B 3V0EA 4LLQA 1EHXA 3V4PA 3EO9L 1AMXA 4DPBX 4L0PB 3MRNA 1HCYA 4NLHA 2XY2A 3LN5A 2AEOA 3DJZA 3QZPA 3BH8A 5LN8A 4O9HL 4PWEA 5AOLA 3STZA 1UJ3C 3CZSA 1WHOA 4PRDB 1FL3A 2CCWA 1WFJA 4NX0A 4L8DA 3VI3A 4UOQA 3U0TA 4B9ZA 4AKPA 3DPDA 2WXHA 3KBEA 3F84A 3NYKA 2QQLL 1MF2H 5ANMB 4TQHA 2VC2H 1LP9E 3ABZA 3GXUB 5E5RB 5FYJH 3VXQB 4KNQA 4QRUB 3OKEB 2CMRL 1VRSA 2R56H 5LCVH 5MHSE 4K3EL 5CEYB 5D2LF 2QFRA 4LSUL 1XF2A 1KXTB 4HF5L 2EKJA 1AGBB 4UI2A 5LAXA 2A6IB 2YSSA 2AV1B 4X6CF 2X9YA 1LE5B 1E5CA 3GRBA 4XPGL 2A6JB 3MLSL 1IAII 2VM3A 1QUNB 4D9RE 3K8LA 4PS4H 1IM9D 3C6LC 3OVUB 4JVPA 1PAMA 2ZP8A 1NGQL 4Z7OE 4FMVA 4F20A 1G6RH 2QKSA 4WNQA 3FB6A 3QAZC 5GZOC 3GINA 3NOIA 3OJVC 4KKNA 3V4UL 4U3HA 3EFDL 4JLRB 4PH8A 5HPMB 4M93C 1XD0A 4AG4H 5A2BA 2IBGA 1CGXA 4NRXB 2E8YA 5DO8A 2IANA 4A38A 2HT4C 5JLZA 1T2QL 4OZIA 4XP4H 2HVKB 2GBUA 2PWEA 3D48R 1EGJA 3TP4A 2Z0BA 2YRPA 3AAZB 2Z35A 3C5JB 1PY0A 2N1TE 4DJMA 2JELL 3D39B 4QTHB 1CFQA 2IADB 3BUPA 2LW3A 4HC1L 2WLLA 2ZUUA 3E6FA 1BG9A 4BFNA 2CDEB 1TOXA 2LLGA 2YD3A 5D7LB 3JTBA 2EDEA 1EV2E 1YEJH 3W38A 3SD5A 3JT2A 5BVJA 4U6XA 3H9SD 2YBGA 2AHIA 4PLKC 3FT3B 1OCWL 3CVHL 3S0PA 3WTSA 3KW7A 4LESA 4C4UA 2DDQH 2J72A 3O3AA 5KAQG 2E6PA 3WBDA 1JDDA 3CGTA 4OGXH 4HIJB 1VSCA 1KFAH 2NY2D 3LXUX 2Y5TB 1DL7L 1F3DJ 5TGBB 4B0MM 1ZDQA 4GOSA 4D9LL 3B7RL 4S0TD 4PJFA 5AVZB 1J9RA 3MLVL 4J23A 1FFNB 4CGTA 1MRDL 4TLKA 4P3DA 1Q90A 2EDOA 4JDVA 2Y25A 3J27A 3EH3B 1TG8A 2HJFB 3QFJA 3Q48A 3GIZL 1PKQE 2RIKA 1M2VA 1CVSC 3KPTA 5DJXB 5DVNA 5GJSH 1DEEA 1ANUA 1RHHA 5F9JB 3NSYA 4BFEA 2AQSA 4PGZA 3IFLL 5JXED 1I8AA 4KMTH 1WFIA 3FTVA 5TFSL 3V4VB 3Q3GA 5FCUL 3RX8A 5A2AA 1FUNA 1AO7A 4FYTA 3HN3A 1HFUA 1U8QB 3EDKA 3T04D 3DTUB 3ZYZA 2ESVD 5ECGA 1UD5A 4K3GA 4RAUB 2HTLC 4Y4HC 3BCDA 3LN9A 1IBYA 2FNWA 4JFXB 5DFAA 2FBJL 4UTBA 5DWUH 3H85A 4PJEA 4V2BA 3VFRB 3O41A 5DLLA 4DEPB 4KK6C 3U7WH 2IC2A 5I8EA 3SIKA 2YS4A 3T2NL 2K3TA 3TS8A 4FXKA 1ZE3C 2Z6FA 2Q8AH 1FLTX 1NINA 1Z7JA 4JFVA 1TVHA 3QIUB 3N55A 2PTTB 1XH3B 1Q0XL 3VG0H 3OJDA 3NFNB 5IFHH 2NR6A 3KGSA 4WY7H 5EIVA 1NGXB 3QXAB 1CDHA 4J8QA 1T4KB 2J25A 1ES0B 2AJ3A 4JDTL 3SPVA 1IGYB 4RIRB 5C0BD 1N6UA 1OT1A 3ZTJH 2AJSL 3NBNA 2P5EB 1T5WA 3BGAA 3UO8B 2DKSA 4O9HH 1ASPA 4PJ9D 2XWCA 1D9KD 3U9UA 2FX9L 5CP3A 3IVKB 1EJFA 2ZONA 4X83A 4MCZB 3OJ2C 4J2QA 3SE3A 1IJNA 3EW3B 4XPHL 4JQVC 1KCBA 2QQLH 3C60A 1G5GA 3Q5YA 5AENA 3V5DB 2XV3A 4AEIL 1TQVA 2BP0B 3MA7B 4NQCE 1OSYA 2CMRH 4IQHA 3QRGL 3SN6N 4LKXB 4I9XA 3VGGA 1QYGL 1YJDL 1A6AA 5F9AC 4UNVA 2WQVA 3LY6A 5IGXL 2JFCA 4YSAA 1WLHA 4YSQA 3FCGA 4LSUH 3P3UA 2GTQA 2NY4B 2F54E 4HF5H 3C09C 3IDJA 5JPNA 3QAQA 1D2OA 1TMCB 4XPGH 4AC2A 1UD3A 3MLSH 3VSTA 2V8LA 5EO1B 1EZSA 3DROB 3DVIA 1OWWA 2BWQA 1M71A 3WMQA 3X17A 2X2JA 5J12B 1FC2D 3A47A 1QEWA 4LU5H 1PLCA 2CA3A 3OKLB 2EXYC 1NGQH 1VFBB 2APVA 3U4KA 4N1EA 4WCYL 4X6CB 2C26A 3APNA 4N9OB 4L0ZA 2XG5A 1YNTF 5G5DB 5C0NC 5CJ5A 4CILA 3V4UH 3GJFK 1ECYA 1I85A 3BAWA 4AMKL 3GJFH 5FFGA 5A6MA 5MP6L 3Q2LA 2QQNL 1T2QH 1ND0B 1X5XA 2P24A 4HS3B 4R9HA 1P7HL 1T7WA 1U3ZA 4H88H 4R5TA 4ADJA 2ZAGA 4F37F 4OJFH 1MRCL 4FQXB 2GFBA 3BGMA 3GSXA 1NGZB 5L8JB 4XN5A 4MNQA 3WTTA 2JELH 2Q8BL 2O6CA 4YQXH 2AXFA 4LCYA 5FM4A 3Q8AA 4MB3A 2WWNA 1W0WA 4HC1H 3GDBA 5ITFB 2E9WA 5B7FA 2EP6A 1J87A 3KPSE 3N5AA 3OKMA 4J8RA 4PAZA 5D7JB 3QA3B 3RIAF 3BZDA 4X4MA 4WO4B 3VXPB 3BZ5A 3RVVD 2R59A 3INOA 4Q58C 4UQDA 1EFQA 2PCFB 4AEFA 1D7FA 2HFTA 4G1MB 1OCWH 3CVHH 1TYEB 3LH8A 4TV3A 4G7YL 3FU0A 3OF6D 4WI4A 5F0MB 4L29B 3C6EA 3WOVA 4RGNC 1ZLWK 2DI8A 1OTSC 3LKNA 4LRNL 3OHMB 1JTTA 2PW1A 1BSIA 1ZLWH 4E0RA 3BZEA 3RHWK 3V79C 1NC2A 5I26A 3FO2A 3TX4A 1JERA 1HEZA 2CIIA 4IRJB 1KCVL 4D9LH 5I5IA 3LD8C 2DBLL 3MLVH 5DHVB 5B4MC 1MRDH 1NAMB 3D0VB 2FHFA 2PN5A 4U1LB 4WEUD 3TEWA 2AI0H 3BIBX 3HOGA 1X5GA 3SGJC 3E6HB 3QUZC 1OAZH 4G43B 1E5YA 3IFOB 5E2WL 1V5JA 1ACXA 4GQRA 5HHOA 3MRRA 2R7EA 2ZNXA 3IU3B 1UACL 1PZ3A 2XZZA 2NUPB 5JHMA 5FCUH 5KS9A 1TEGA 1ZMYA 2PYFA 2R1WA 2FYVA 3DO3A 4R0LA 3X13A 1DQML 1TQCB 1S9XB 4PJDA 3KYKH 1SJEA 2ENQA 5F70A 2WP3O 5DMGC 2ZXBA 3LNIA 1NMBL 5E6RB 4WW1A 5I6PA 1QSFE 4XWGL 2FBJH 3VFPA 2ZKYA 5KVEL 4Q6YA 3MI6A 3V0DA 2OL3L 2W1NA 4TOYL 3QDGD 5HI3C 5FHAL 2WBXA 3N40P 3ULVC 3T2NH 3KLQA 4Q8BA 4JHWL 5SWQA 3FCSA 2J5LB 4L1SA 2W07B 3E1ZA 4ZG1A 3NABL 1BAFL 3GLEA 1Q0XH 1LO0L 3HBZA 5F7HA 3CFUA 1OGTB 4GQQA 4NKMA 3TJHC 4IBLT 2YO3A 4BH7A 4K9EH 1TJHL 4UQIM 4JO2L 1M7UA 2WO2B 4CADB 4Q9BA 3MA9L 3JYBA 4AL8L 2AC0A 1ZJAA 1MJ8L 3ZE2E 4JHUA 3RBSA 3I02B 4WDIB 4YO0A 2WTOA 3GSRA 3ZLQC 1G7HA 2FX9H 2X3CA 2HTKC 4A2EA 3FU9A 1NFDA 1R3IH 2PLTA 4ENEC 4L5FH 4CSTA 5FGCE 1BQRA 2WXIA 1G9ML 5HY9A 5A3IC 2PYEA 4XPHH 5ETUA 3TURA 1L9SA 2OMTB 2JVUA 1ASOA 3EXLA 1A4JA 3K71B 2EIJB 3LNGA 3QR0A 5BVPH 1MCJA 1HU8A 1CLOL 3L17A 1R0AH 1Z9SA 4FQLL 4Q2ZA 3KLAB 3NJNA 1Q0YL 5H37H 2NW2B 4W1TA 5J57B 1B4RA 3QRGH 4YK4C 3ARBA 1QYGH 1YJDH 2F2HA 1MY5A 1VPOL 1AHWB 1SHWA 5IMOA 4R8WH 2WNXA 5IGXH 5F7FA 4UNUA 1QLEL 5I0XA 4J3OH 5CJOL 3FB7A 4MX7B 3OHXA 1CZ8H 2J8UB 1IC5H 1Q9KA 2RBLA 4NQED 1N59B 4LLWA 3D0LB 1BYOA 2O72A 3IETB 3KYAA 2CK2A 4XAWL 1KTJA 2G9HB 1F18A 4Y2LA 1JDAA 4DVBA 5HJ3A 3H4FA 4IYKA 3U46B 3ARZA 4O02L 1JHLL 3FBQA 4YOKA 5CD3A 2ENSA 3FQXA 1U2CA 3ATAA 3FSVA 3AG4B 4RAVB 2R27A 1WGOA 4WCYH 3VXOB 3DI3B 4JO5A 3KVDD 1TF4A 4RDBA 2WBJD 3EHBC 1NCAL 1KN2L 2OR9H 4GMSL 4UYPA 2ZXWB 2IDSA 5CIPH 3VWJC 1XGYL 3EF4A 3PREA 4KQ0A 4AMKH 3HC2A 2BNQD 3BZFA 1L6PA 1XB6A 2EEDA 3RL2B 2QQNH 4DPAX 6PCYA 2H3NB 3CMOH 4Q0XH 1N2RA 2VDPH 5DR5L 1CLZL 5IOKA 2D7PA 5BQ7A 1AJ7H 1HCFX 2EEXA 3DBSA 4RFOL 1MRCH 2OCCB 5F3BA 2EXTA 5F7WC 1XHHA 3AREC 4H0LC 3NPSC 2YJQA 2VLKA 2Q8BH 4MYWB 3QPQC 3T0DA 4Z7UA 1O9WA 1JPTH 3OD3A 2FJSA 1J86A 3MUGA 5AOKA 2ISDA 1MI5D 3TF7C 1V27A 1SFDA 4GRWH 3FQUB 1K4DA 4LVHC 3UAFA 1MIEL 1C16B 4FNQA 4I77H 4UNTA 4HUXB 2XZAL 1OTTC 1YG9A 2XKNA 4K7FB 5IB2A 3GHEH 1KB9K 2O6DA 4ZXBA 5A2FA 5IZ7A 1ZVSB 2DB8A 4DK6A 4G7YH 4JFFB 1X7TA 2IH1B 3SJVB 2V2TB 2RQ8A 2X2UA 3VXSA 4IGBB 2UZYA 1CBJA 3VSVA 1JF1B 1Q72L 4I5BB 2CHZA 4IMLA 4EUPA 4H8QA 2ZKHL 1BXAA 4FTVB 4X0KA 5CEZE 1MKFA 5E8OB 4JM2A 5L4MA 4E36A 3BXNA 2EDBA 5EU3A 1HIMH 2DBLH 4GS7C 3DMMA 5DHYA 4P5TB 1JZ2A 3JV6A 4ABQA 1RMFL 3RB7A 4B7LA 4GAJH 3VI3E 3W57A 1PZSA 1JD7A 4FXKC 2K6YA 3SDXE 5CLZA 1BLNA 1ETZB 2IAMB 4X7FC 1MJUL 2ORBL 4PJ5A 5ESQA 1SN0A 1W2KT 1M1SA 3MRGA 4K73A 3AT0A 5KG9A 1OOAA 5E2WH 4WRLA 4FG0A 2NR6C 2VLME 3MFFA 3BH9B 2B7DT 1CBVL 2G4GA 3CFDB 1HHHB 2PO6D 3GGWB 5DS2A 1UACH 1U3NA 4MAUH 1ZLSL 2PP7A 1KPRB 2H26A 4MJ5B 4BUGA 4DGVL 1LP9F 1HXMA 4NBYB 3G6JA 5GSRA 1JGVL 1DQMH 2FBRA 2R4SL 4FFTA 2ZJSL 3EJRA 1IEAA 3MBXH 4WJ5A 4X4KA 3E7JA 3U7AA 2QR0B 3CFEB 4BCXA 3O6LH 4JFUA 1NMBH 2Q86A 4M8QB 3OQRA 4X7DC 3DURB 4LSQL 1M6OA 2HKAA 1THAA 4AM0Q 1KNOA 1KYOJ 4TOYH 1YHPA 1XXDC 3GSUB 1BZ8A 1D2PA 1HHGA 4KKLC 2CO7A 3SE3C 4PU2A 1E3FA 4P99A 1DE4A 1FN4B 1VEOA 3C60C 4FYRA 4JHWH 5DZNA 3FU5A 1HCVA 5GS1B 1T1YA 3TNNB 3QWNA 2GTZB 2ZUQB 3RPKA 4P05A 1JZ4A 4AQAA 1TZGH 2BVOB 2E9IA 2OTUB 2YR3A 3F6LA 1TJHH 5B7EA 1X9RA 4JO2H 3MR9A 4N8UA 1INEH 4P2OB 4CC1A 4Z7OF 3BP4B 3VXRA 1HH9B 3MA9H 5KSVA 1X9QA 4AL8H 2MNWA 5JPNC 4QRBA 1I1AC 1O6SB 3TCTA 4P46D 2IANE 3HS0A 3AZUA 4OZIE 2ZUVA 4FDWA 3W0WD 4TUOB 2HA1A 1A14L 2OKMA 4IKIA 1U8PA 2H1XA 3L95B 4QRRB 3NZSA 5JMOC 2DS4A 3D51A 3FH5A 1G9MH 4F7TB 4YIQA 3D0AA 2WWKO 5K59F 1SLXA 2O5XL 2DF3A 2R0KL 3A6CL 1XEUA 3BWAA 3RBGA 4AV5A 1HX0A 1QEXA 4NM8H 1LEIA 1CLOH 1UA6L 3IK2A 2DQTL 4EAEA 3VFGH 3E2HB 2WXMA 4V1DD 4FE9A 2W0KA 3OR7A 1VPOH 1I85C 1YNLL 4XCFL 4UMSA 4BFFA 2OFQA 9PCYA 4BH8B 2N1KA 5EF0A 2NY7L 1QLEH 3VGFA 1B0GA 3WJLC 1RPUA 5CJOH 1ZGLB 3V4LA 4UZSA 1TZHA 2OZ4L 4CJ0A 2TRYA 3RGVD 4D8PB 1B4JL 4XAWH 2IOOA 3HI1B 1U8HB 2WWMD 3GPEA 2X6VA 4PJFE 4R90H 4IKKA 4ZMQA 3PFUA 3H8NA 2XXGA 4O02H 1JHLH 2A77L 3CFIC 3UTOA 3IYLW 4WENB 4N2AA 3QFJE 1M7DB 1R3HA 3ULUF 3L3JB 4NC1C 1VESA 1CDJA 3K8MA 4CSZA 3B9KA 1KN2H 4Y89A 4GMSH 2FB4H 3WLWD 4GKNA 4KXAA 4Y19D 4ZMTA 4G9DB 4N2CA 3GMMB 2FUTA 2Z31D 3U1SH 4ZT1A 4FFVD 1AO7E 3RAJL 3LXAA 2H32H 1CLZH 2E7DA 4NHCL 2VKWA 1EAJA 3IDGA 4Z3FA 2F7QA 2OMNA 2YD7A 4RFOH 4LBEB 2ZAHA 3BT0A 2JCCF 4Y4FD 3CLWA 3RWCA 1UOWA 4CNIA 1WFUA 2CHNA 5G4MA 1S6NA 2ESVA 4DP8X 4RRPM 1NBYB 3R4RA 3KL3A 5B7MA 4KO9A 5C6PB 3IXAB 4L9LA 2JKWA 3AWFA 5F3HB 5GS3A 4I0PD 1Q9LB 5C08A 4GKSB 2XN9A 4K9EC 1JV2A 2OMUB 3PL6D 2WLMA 5C0EA 4GO9A 3S88L 2XZAH 4YHML 2G3NA 1BPVA 3IXTB 3GYRA 4U4IA 1X6LA 1EXUB 1EZLA 4DGYL 1IGTB 5FF6A 1EANA 3LVEA 1GMEA 4R0LC 1Q72H 3O0RL 3T65B 1NGYB 4NKDA 1EDYA 2ZKHH 3ZE1E 5EOCH 1HESA 1GW6A 1P7KB 2NLJA 3OL2A 1S9VB 4L48A 4ES8A 1G9NL 2OI9C 2WIIB 4E9XA 4ZW3A 1U33A 3B1TA 3IMVA 3K4AA 5DSCA 3SGKA 3S8GB 2EUWA 4WEEA 1ESOA 4PIBA 2G5BB 4HD5A 3MRBB 3VTAA 4PJ9A 4ZFOL 1MN4A 5EZJB 1Z3GH 1N18A 1MJUH 2WOYA 4D7BA 2X4QA 4EBQH 1DVZA 2OSLB 1S7SA 5GGVY 5JIPA 1TZIA 4NQXA 5HGDA 4NNYB 1R75A 3PYCA 3ARRA 3OKOA 4QF1A 4R2GD 4X98B 1V3LA 2GABA 2VLJB 2Z1KA 3D52A 3SDDC 5KYXA 4BQCA 4K3JL 1ZLSH 2P26A 2VZVA 4G7QB 4DGVH 4DSYA 1WAAA 4OM1H 3U9WA 3CDCA 1ADQA 1JGVH 1SMOA 2R4SH 3DYPA 2ZJSH 5F9OH 4BRVA 1JHKL 1NCTA 4I3SL 4A6YL 1U58A 4MRCA 2WW8A 4Z3TA 3SKJH 2GJPA 2VDMB 4LL9A 3P9LB 4LSQH 5I8OL 2W8CA 3ARWA 1DQQB 4Y2DA 3CFKA 4P4RA 3RA7H 4FFZL 2A4CA 1UA3A 1UQSA 3EJQA 4ZUWB 1JZEA 3OXSA 1LP9B 1SPDA 2HYMA 2NZ9C 4OH2A 4A37A 4DK3A 5K9QI 3S98A 1EO8L 2E4FA 3NIGF 2HMIC 3ARBC 3EJZC 5JQ6H 1N19A 4U1GC 5J13C 3L9YA 3K2IA 4ODWA 3RVUD 3U79A 2QHLA 2XKSA 3MUUA 4NFCA 1UKSA 3ZDXE 4NP9A 2JTDA 1INDL 3DRQB 3I6KB 3OHXC 1OF2A 5EUOA 2Q6WA 4OIFA 1EVTC 3PHOB 3LRSA 4FZ8L 5K39A 4HUWB 3HRZB 4PREB 3L3KB 1YEHL 2IGFL 1YMMA 4GXUM 4WI8A 4D0BB 4QO1B 4XBGA 3UADA 3UOAB 1A14H 1ID5I 1DBKL 5AALA 3ZYJA 4ZOCA 4MNQE 3TC9A 5AB0A 3ZZLA 1M9WA 2PWHA 4XNMA 4L8BB 1IBGL 1GKEA 4Z7OB 1E4HA 1BOGB 3ARXA 4XNZB 5C0CA 2X40A 2R0KH 3B9DA 5BJTB 3D85B 4I0CC 4JE4B 3KR3L 4PJAA 5FV1L 3KZ8A 4J7RA 1UA6H 2DQTH 5KOVC 1VADB 3NSFA 4X4ME 4CVZB 2LLNA 2EILB 4BWTA 2XDHA 4XCFH 1QABA 1YNLH 4N90E 5GGRA 3TBTA 4Z3GA 1OB1A 3MZGB 1BIIA 1YC7A 3S8FB 2OR8A 3EBIA 4XZUA 4EN3D 4S1QL 4JJHA 2C3HA 2YQGA 3OTTA 3PUUA 4K8RC 3GSNL 2VITB 2HFFB 4FFWC 2BOBA 1P7QB 5CHNA 1B4JH 4K71C 4Y1SA 4H0GA 4QLRA 4MLIA 3BOVA 1JZ8A 3ZRCC 4W9FC 2W60B 4ANXA 4WHCA 3P3SA 2CDFA 2IPUK 2ZUTA 1KPUB 3PIQA 3IJ7A 3WGUB 3CN4A 4PWIA 5DJ0A 1JUFA 3TTSA 4NENB 4IM8A 5HDBF 4DH2A 4ZNCD 5I66B 4R96A 3LTVA 3T0ED 1AZUA 2VIRA 3NJLA 4RFEB 2H9GB 2ZCLH 2Z34A 5AUMA 5FYKL 3T1FA 3Q2WA 1WFMA 2P5WE 4XO4A 5H2BA 3FN9A 3ZR6A 2ADJA 4ZXBC 4DUWA 5HHOE 1KENL 2WN3A 1I8KB 3KJ6L 2X4SA 3QUHA 3UYOD 2V5RA 2A6KB 5JORB 4DGIH 1NCDL 3RAJH 3WKML 1WS7A 1RLWA 3T77A 4KRPC 1JWMB 1JPGB 4PJDE 4JM2C 5DJ8B 3FU7A 3T3PE 5FDWA 4EZLA 4ICXA 4OCNC 4RSVA 2AQ2A 3BQUB 4QYOA 3QUML 4YFLI 2XKUA 3IPFA 2BHUA 3PUCA 2VUKA 2WZ6A 3FN0H 5KOMC 5I71B 1RZIA 3NIDE 1H5BA 1PY9A 1PKQB 2GK0B 2B1AL 4HW6A 5ISZD 3QWOB 3QDGA 2XWJA 3U4BL 1C12B 2CSPA 3WFDH 2ZOUA 3UTSD 5AG9A 1IKOP 4RMBA 3GZOA 1D5ZA 4PW4A 4PJ8D 5HJBA 3FRPA 4DGYH 4N2IA 1CD9B 3UH8A 3WTXA 4OM0L 4OQTL 2R1XA 4P57A 4HH8A 2BSED 3BIKA 3DUUB 4DZBB 2BDNH 4XHJC 1QWHA 2ZUYA 4DZ8A 3QNZB 3FPXA 4PP1C 1CFBA 4U3SB 3VH8A 5INDA 3JT0A 1FRGL 2PWFA 1UJ3B 1N26A 2CBOA 3GFUA 2NUTB 3D34A 4BE6A 1NFDE 1NBVL 2DWTA 1BEXA 2WXFA 5KBMA 3RIFK 5I5MA 3DUSA 3SCMD 2PYEE 3BHBB 2G4EA 3FRUA 1UASA 4WTQA 4ZPTB 1CXHA 2YXFA 4TS6A 4BKSC 4AW7A 4TNEA 5IMMA 3BEWB 3UZVB 3QNFA 3HI6L 4K3JH 5C07D 5CZKA 2WWOA 1IQWL 5EBWA 4Q14A 3U83A 5FLVA 4F92B 2X7LA 1XB8A 2EINB 1JHKH 2JNZA 3HS0C 4I3SH 3MBEB 4Q4EA 3L1GA 4M48L 4TSCL 5T1KB 5CM1A 1PIGA 1E4KA 2CLRB 3V0HA 4MNGA 3RZCD 4F2FA 1MRFL 5I8OH 4HJUA 1EIBA 2WJ5A 2AITA 3QP3A 4X6BB 3RWJA 4YSDA 3QNXB 4FFZH 1D5XB 1AGFA 4C4KO 3DTXB 3C6LB 2J71A 1ZSHA 5DUBA 4H1LH 4MSWB 2F7RA 5AD0A 4FL4C 3HNVL 3QIBD 3T6XA 3X1BA 1K4CA 2R4RL 4NQCB 5I16B 3FB5A 5CCJA 1EO8H 1EX0A 1F3DH 4PSRA 3QNYA 4ZK8A 4ZUTB 2R83A 4L3EA 4OZHA 2F54B 4PYGA 2GI0A 4LT7A 4M93B 3FCBA 1OVZA 4MQ7A 1INDH 3DGGB 4TVPD 5AB2A 5GXBB 5J89A 5K1JA 2P49B 1VJSA 4XN9A 4TNVF 4X4YA 3GIVB 3NAAL 4W9EC 1YEHH 2IGFH 1URZA 3V2AR 2C9SA 3FOLA 3GF8A 4GKZB 3B4NA 4CAGA 1DBKH 3TTYA 2ICEA 3D87B 5DD0L 2A6DB 5ESVA 2B2XH 3JZ7A 3G08A 1CYWA 3KCWA 4Z7UE 1IBGH 5EU4B 4N86A 3VD3A 4QHLB 4KKBD 2HPTA 3HC4H 2OMXB 3KR3H 5INCB 3E9UA 2AW2A 3EH5B 2JI1A 3PGFH 5TDNA 4NJAH 3TT3L 2WYIA 3APCA 4JRLA 3VXSE 1OSEA 2JJSA 3U48A 4S1QH 3LPGA 3EFFA 1S7WA 2JTYA 5JHDD 1MG2C 1RK1B 5FOBB 4LAQL 5DDHA 2CNYA 4NWTL 3QI9D 2PABA 3IGLA 2IOIA 4I1RA 1MW1A 5BNXD 3W9EB 1H3GA 2YK1L 2HJKB 2P8PB 3STLA 4DAGL 2VDQL 4AIZB 4L9LC 1KTBA 4W9KC 4WKZA 3KPSB 1SYVB 5KANI 2A9BA 2EH7H 1ORQB 3OX8B 1XFPA 3D2UB 1MHHA 4HV8B 4XNXL 2N0MA 1BWMA 1HK6A 5FYKH 1YYML 3UBXI 2QPSA 3CX5J 1PD6A 1FDLL 3EO0B 4KVCL 3SDXF 3ARFB 3KJ6H 1NJ9A 5LXGL 4PR5B 5IVXA 3MYJA 1FORL 3NCJH 1NCDH 4IRZL 3WKMH 5MERB 4XRCA 1E67A 1PX4A 4FN0A 5HYSA 3VW3L 3ARDA 4LO9A 4LSPL 4PJ6A 2Y7QB 1UXWA 5I1LA 5DFVD 3SGKC 3PGDA 3QQNA 2UWEA 4YDVB 1G7PA 5TH2A 3A67L 1U8JA 4PJ9C 4TM9A 2OTWA 2WSKA 1C08A 2B1AH 3MKGA 5F88B 2WNKA 4U6HA 3VRIA 3U4BH 3IJSB 5KYUB 1UUSA 3MVSA 3BD5A 4DO6A 1WH0A 4Q9RL 5F6HJ 3QZNA 4JFOA 3T3ME 3PHSA 2WMPA 3EDDA 5J3HD 2V3EA 1T5XA 3FBKA 1I1FA 1KYDA 2XOTA 4N8CL 1FGNH 3P69A 4OM0H 1KXQA 1OAUL 4OQTH 5IQ9B 1J11A 3CHSA 1AGCA 2DI7A 2I60L 2O93L 2KZBA 3QCTL 4OD3L 1LQSR 2ATKB 5DS1A 5I1DB 3EJYC 1FFOA 1P4IL 1QSFB 4E9VA 4G82A 2YEZB 4ZQKA 2WUCH 3B5GA 1A7QH 5K9JH 1FRGH 5EA0L 4WSGA 4R7NB 4Y2DC 5DEJA 1I7ZA 1KEGL 3UERA 1NBVH 3PJSB 4ELME 2NTSP 5AZ2L 2YD8A 4OZIF 4OBRA