4AL8H

Structure of dengue virus diii in complex with fab 2h12
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
216
structure length
212
Chain Sequence
DVQLVEPGAELVQPGASVKMSCKASGYTFSSYWINWEKQRPGKGLEWIGNIYPGSGTVNYDDKFKSKATLTIDTSSNTAYMQLSSLTSEDSAVYYCTRGGSHAMDYWGQGTSVTVSSAKTTPPSVYPLAPGTGSSVTLGCLVKGYFPESVTVTWNSGSLSSSVHTFPALLQSGLYTMSSSVTVPSSTWPSQTVTCSVAHPASSTTVDKKLEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Analysis of a Dengue Cross-Reactive Antibody Complexed with Envelope Domain III Reveals the Molecular Basis of Cross-Reactivity.
pubmed doi rcsb
source organism Dengue virus
molecule tags Immune system
molecule keywords ENVELOPE PROTEIN
total genus 39
structure length 212
sequence length 216
ec nomenclature
pdb deposition date 2012-03-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4al8H01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4al8H02
2J4WH 4N9GB 3BYTA 4H25A 1J05B 2X4SA 2E9BA 2V9TA 5KSBF 1MI5D 1JMXA 5D5MF 3NCYP 1ZV5A 4LCCC 3TCLB 1DSFL 2FYYB 4K8RH 3SQOH 5CEYA 4FFZH 4MHHI 1ORQA 5I6XC 4R0LC 2FEEL 3QNXA 2R2BB 4TSAL 5HHMD 5C92A 3U1SL 1JFQH 3PHQB 3RWGA 4LF3B 1MRCH 4D0CB 3QCVL 3TVMC 4YXKL 4WWKA 3TNNB 1QLEL 2X89D 3O2VH 5GIRA 5HYSG 3C08L 4JO1L 4PJGA 1CE1H 5BOZG 4DZBB 4MJIB 5I1LA 1BJ8A 3BX7C 1XGQA 2CDEA 3DRQB 4OTXH 4JFZL 3STBA 4K3EL 5HD8C 2FBJL 3B8YA 1IGIL 3DO7B 3HG1D 4JDTH 2FH8A 1P7KA 1DBMH 5CILH 3FO2A 4O5LH 3OKMA 4JZNB 1NFDE 3QIUB 4FG6D 2AAVA 5CD3B 1WLHA 5BS0B 2IJ0C 3UBXA 4PB0H 1INQB 4RIRA 3UCRA 1VKXB 4M43H 3A67H 3UTSA 2V2XB 4I18A 5MI0B 4DK6A 4FQXB 2J4WL 1QSEA 5BVPL 5EU6B 5IT2H 1SEBA 2FIKB 1FNEB 3BIAX 3BI9X 3WIIH 4X6DB 4BUGA 3EO0A 4X6DA 4BH7B 3WDIA 3QDME 4M00A 1CFQA 2ZUYA 4G6FB 1PY4A 2NY3D 2FGWH 1EJ6A 1JMZA 2ITDA 5HJ3B 3SDAC 1HXYB 2XZZA 1AXTH 5D1XB 4H20L 4DN3H 4HWEL 5DI8B 2NXZB 3MRRB 1MHEA 5J1SC 1FYTA 3VG0L 1MCQA 4NGHL 4RFOL 4U3HA 4NRZA 4XWGH 2FECI 2EH7H 2E5EA 4JM2B 5HY9A 3WFBL 4PGCB 1BD2D 4QRPB 3QDJE 1NFDA 4QT5A 1WT5C 2NW3B 5ILTL 4KKNA 2XN9E 4TVSa 1Q0YL 2YBRB 5FOJA 2VUOA 1A9EB 4NBZB 4R8WH 4WI4A 4AG4L 3UZVB 1SBBA 3HUJE 4XAKD 4YHPA 3ISWA 3NCBB 3RPIA 1CLOH 4ZSOE 1IGML 3CFIC 2I24N 1NLDL 4M1DH 3BE1H 4OIAA 4LSRH 4R2GC 1XT5A 1V5JA 3O3UN 1HSBB 4X4MA 3HLAB 5B4MC 3BJ91 4PGBA 2C1OA 5I1GH 5C0CD 3L7EA 1CXFA 2VISA 4P4KC 5A3IC 3TFKD 5CZVH 5EC1A 4X8XA 1YMMB 4QRSB 3V5DB 4BQ8A 2EXYC 3OAZK 3CVHL 5CEYB 3LS4L 3MNVB 1H3TA 1AY1L 1FFPB 1RHHB 2J3SA 5CLTA 4HT1H 4QRQB 4EQ2A 3C87A 2I5YH 5I8EA 4IRZH 1OAZL 5MEOB 4FTVA 1CF8H 5IQ7L 3G6DL 1Y6KR 2GYSA 3MRJB 3O6MH 4X80H 1AIFA 5D6CB 1RJLB 5MEPA 4D9LL 1JNHA 4LAJH 1MCWW 3GSWA 5CWSA 1LO0L 3G08B 1FL3A 2L7UA 1U8NA 5E6IB 4FQXD 3RPIB 2VLRB 3NFNB 1OD7A 3FFDA 4P2YA 4ZAKD 2G9HB 2V7NA 4IRJA 5SWQB 1V7NL 1D6EA 2ZSWB 4PYHA 3MJ9L 1BD2A 3FB5A 4U6YB 3UX9B 3B4NA 1J0JA 4LGSB 1BVKB 3GM0A 5AYUH 3GB7B 1A1MB 3I02A 3RIFF 3PGDA 4Z76B 4GBXC 2CRIA 4MQTB 4PV9A 1QA9A 5IVXF 4DN4L 1HOCA 4AK1A 4FMKA 1N26A 1T7WA 3DYMA 1CDJA 3IFLL 3X14B 1LEGB 1LNUA 1FHGA 5JOEA 1NANI 3ILQD 5JPMB 3QHFL 2AJZB 1FZKA 1A6AB 3QG6B 5DRWA 4MX7B 4PY8J 4NRYB 5D7JD 1T5XA 4ERSH 4OCSH 2X4SB 2G5BB 3SE4A 1RZKH 4B53A 4DGYL 4X9FA 1UCTA 2VAAB 3VFWA 4J3SA 3CK0L 3S36H 2EDTA 3IFPA 3JVGA 5C7XL 2BFVL 3EDFA 1HILB 1UCBH 1MF2H 3BO8A 2F74A 4KJQC 4RMRA 1EHAA 4URTB 4JO4L 4HPYH 4KK8D 1U8OB 5KSUA 5AD0A 3CSYB 3MGOA 3CFCH 1A4KB 1KTRL 2XN9D 3KJ6H 5KTEH 3TC9A 2YOCA 5D6DC 3VW3H 2VRAA 3TCXA 1NMCB 3KHQA 5GS0D 1N8ZA 5IHLB 4YR6B 5D7IB 3G04A 2EEAA 5SWZD 3RU8L 4LKCA 1EUUA 1KIQA 5EUKB 5DJ2B 1NCCH 5HHME 1XGRA 1EO7A 4DZ8A 4Q6IA 5LAXB 1MFEH 1MFBL 1DZBA 4ISVA 3HC4L 4JFHE 2XXCB 3P11H 3STZA 4JHBA 1X5LA 3IDNB 4FQXA 4FABL 4GMSL 1CXLA 4PJ7F 4KJYB 1IAOB 2IQ9H 3BZFB 1BQLL 1N5AB 2LQRA 2VXVH 4LSPH 4E42B 2YUZA 4OBRA 4EOWH 1H5BA 4HV8B 3HNSH 4PRHD 2X89A 3EYOA 4FTVD 2UY6A 4I3RH 4OF3A 3QQ4A 5JZ7C 1MVFA 3BHBA 4JCLA 3LQMA 3MNWB 4M93C 4NM4H 3CLFH 3HR6A 3HN3A 5ICYA 5IROA 5JIIA 4ELMF 1HI6B 1M4KA 1OARL 4HUVA 4N0UA 3LS5H 4FOMA 5DYOA 1RZIA 1RZFH 2OR8A 1A0QH 5IFAH 4LLUB 5ESVA 2FO1A 4HPYL 4DKFH 2F53A 5CS7A 2G60L 3SKNB 4QHNB 1MI5A 2BFVH 3O9WB 5C0AB 4WW2A 4R90H 3SGDI 5I75B 1GOFA 3CK0H 1WWWX 2NTFA 4GO6B 4KJPC 5L88H 3IDGA 1CTOA 5I74C 1QPXA 2IANE 4WJ5A 2EYRA 2ADGA 2RHEA 2H6PB 4MS8D 3TM6A 3PJSB 2J5LC 2VDOL 5LGKA 4K3GA 4JFFE 3ZL4H 4KKBC 4IBLT 1UA6L 3PIQA 3GUTA 4QWWD 1R5IB 4ORGA 4XC3H 3NFSL 1DLHB 3BT2L 3VFGH 1B0RB 4PJ8D 5CHNB 1UZ6E 3BWAA 3QUML 3DLQR 2FATH 3IDGB 4XP5L 1NKRA 1SEQH 3QH3A 4JFYA 4ZXBC 1DN0B 5DMIH 3SDCD 4WVRA 4WCYH 4NQTA 5T33H 3GSVB 4YGVB 1NDMA 4TUJA 1E6JL 1MAKA 4FQQB 5JPNB 3VXRD 1NAMA 4XMLL 1Q0XL 4WW1B 1ZK9A 4WWID 3IDIB 3QXDB 2YRPA 3Q5TA 4KTEL 2R1YA 4YHML 2OJZL 1IKFL 3LKRB 1OWWA 1MPAH 1EFXB 1E27A 2VZOA 2ADIA 3VFMB 3I3DA 1JGUL 4K94C 3RDTB 1L0XA 4UQ3A 5MHSE 1R5WA 5EC1B 4S11A 3QDJD 1W72A 4KMTL 4HIJB 5I1JL 1ETZA 2VZVA 3FQTA 2GHWB 3JV5A 4ENEC 1CN4A 1IARB 1QLFA 2IANB 2H26B 1L7IH 3KPTA 3QPQD 4AQ1B 1IC4H 3MRBB 1ZANL 5DRZA 2BX5A 3SDXB 2D7OA 5DD1H 4YHZH 4H1LG 3PNWA 2HFGH 3TZVB 3PWPB 3EOAA 1P7HL 4GW4A 2Z35A 4JGUA 1HQ4B 3S35L 3IJHB 1IMHC 2Y5TA 4ODXB 4LQFH 4DKEH 2PCPB 1CYGA 2C7UB 1MCNA 1TETL 3T77A 1F3JA 5EOCJ 5LQBL 1PG7L 3HE7C 5FF6B 2OYPA 3GMOA 1S5HB 4F9LC 4LCYA 4CVZA 2HLFD 2JB5H 1TJGL 2BNRE 2NY0C 2R56L 1J8HA 4NQED 3O6FB 3QWOA 2JJSC 5DDHA 1MRFH 2L0DA 3O4LB 5DDHB 1NGXB 3TBYB 2QR0A 3EAKA 1YN7B 2A6JB 3HAEA 5B39B 1GGCL 5INCB 4U7KA 1DE4A 4LVHC 2ID5A 1WEJL 2P5WB 4NQSB 3LSOB 1Q38A 1CIDA 4K8RC 4WTZA 5FHAH 1KJMA 3BRFA 1MHCB 3CZFB 4XPBH 1RD6A 3ULSA 5DJYB 1MHPL 5E00B 4G3YH 4OFPA 4P2RE 3MGTB 1N4XL 2ZCKH 4UDTB 2YPVH 3ES6A 3C6SB 2HVJB 2V6HA 4RCAA 1I9RH 4Z0XA 5KSBB 4NZRL 5F72S 1X4XA 3RKDC 4ZNCD 1N5YL 1CXEA 1XZ0B 2XWTB 2OZ4H 3C60A 3NTCH 2R69L 4QTHA 1ONQA 4HS8H 2CMRH 2FX8L 3D39A 4OF7A 1OP5K 1RY7B 3T0EB 4LVOB 4PJEF 3QQ3B 3WMSA 3AXLB 2CK0L 1LGVA 3KYOA 5EWIL 2WNGA 3MBEA 4NO2A 1GC1L 4NO2B 1RZIB 5AZ2H 5I15L 3QZWG 4OTXL 5LCVL 1LP9B 1PKQA 4QTIH 5IW1B 3RNQA 2JB6A 4UOJA 1MNUL 2DBLL 2V5SA 4NFCA 2NQCA 4ZUWB 5I17A 2DYPD 5CJXA 4GUPB 4MQSB 3W9EB 4PJGF 1YUHB 4G8FA 4XMPH 4DEPB 4PJ9A 2XTJB 1JUFA 3BDYH 3OJ2C 3TH3T 2PW2B 1AI1L 1A7PH 4QXGH 2DBLH 5SX4H 4Z7UA 1LE9B 3FT4B 3K80A 5ADOH 2QJDA 1LO2H 2ITCB 2DQCL 3BKYH 3H42H 1HH9B 1T1WB 1HH9A 1T1WA 3KYOB 4E0RB 4I5BA 1ZGLA 3KYKL 5FGCE 2WW8A 2GTZB 4GRLA 2CMRL 2FX8H 4YC2C 5D93C 4PLKD 2A38A 4PFEA 3QI9C 3ZTJH 2E7BA 4UT6H 3TBSB 4I4WA 4GUPA 3TIEA 3W9EA 3RWIB 1AQKL 2YC1A 4U1SA 4CNIB 1M05B 5KVGH 4KJQD 1P9MC 4UILH 3IRZA 5D2LE 5I8KH 1YPZA 5GGVL 5J6GB 4KRNA 3PWPD 1D5MA 3LKNB 3INUH 3SE4C 5HHOB 1IGYB 3ZDYF 5CZXC 1JP5A 5DURB 1U3HB 3ZYIA 4GJTB 2CIKB 1UYWH 2V2TB 4U6VL 3PJSA 2VDMH 4NUGH 3GIVA 4QHKI 5I2IB 4JZJC 4D94A 3BGMA 4F3FA 1OAKL 4PJAF 2B1AH 4WUUD 2UVEA 3UYRH 4G80A 4J3WA 1CDHA 3GJEA 4MA8H 1P84J 2YK1H 1BX2B 1L4IA 4LLQA 1N6QH 4JY6A 3CD4A 3SDCA 5GSRA 3VXQB 3VE0B 5IEKB 3P4OA 4QTIL 1CR9L 3D5OF 4DFHA 4Z78A 4B7LA 3PL6C 4O9HH 4O2CB 3TBSA 3ARZA 4GAJL 2B4CH 2N4IA 4RQQB 1JZ8A 1TQCC 2DJUA 2NZIA 3NN8B 3PV6A 3ARGA 3RWJA 3VXRB 3PGDB 2ZCLL 1IGYA 3AVEA 1QR1B 3TBYA 3ZYJA 3PQYB 2XIDA 3IDJA 2OP4L 1NAMH 4UQ3B 2MTPA 4N5EC 3DO3A 1HE7A 2W9LA 5AAWA 3RWEB 3O45A 3W39B 5E5MB 1IQWH 1KJ3H 1U93B 1Z5LA 1TCRA 1GRWA 3B5HA 1BVKA 1CWVA 3DURA 4OAWB 1OAXL 3DRTA 4ORZC 5ESQB 5I1LB 2VLKB 3R8QA 1BJ1J 2X44D 2WP3O 3GNMH 5DZOA 4BZYA 3CH8A 4F33B 4BFGA 3MRQB 5DFVC 2OXGA 1S9XA 1F4YL 2YSSA 2WM0A 3F7QA 1QBMH 4JPWH 4JVUA 3ULVL 5ITBH 1QBAA 2BMKA 4WUKH 1AQDB 2OTUB 2J88L 1IKFH 3DMMD 4MD4B 3Q3GB 1JNHB 2R0KH 4Q9RH 1QRNB 4PJ5D 4Q9QL 3GMRA 2GJ6B 1R3KB 1Z5LB 1WVZA 4TPRH 4PB9L 5DK0A 2R1XA 2YUVA 4EJ1C 4JG1H 4K23H 2BNUB 4WCYL 5C9JA 2CKBA 1CGWA 1EV2E 1QYGL 5DS8A 3EOBA 4M1CC 3FQRB 4UTAH 1FL6B 4ZUSA 2F5BH 4LF3A 1IT9H 3WN5B 1OTTD 2H9GB 3O2WL 3X12A 4YWGL 5DD0L 3OAYH 1IBGH 2IPTH 4HW6A 3QB7C 5GRUH 2VQ1A 1O5DT 4RDQF 1G7JB 1MSPA 2ARJB 3QUYD 1W8NA 3NPSB 4EUPB 2GCYA 2E9IA 3L9RA 3X3FL 4G6AD 2DKMA 1BM3H 4UINH 2Q1EA 3K4DA 2FO4B 4AJ0A 1E4KC 3SKJL 4QF1A 4GKSB 4JJ5A 2AEIT 1JV5A 4YZFF 5KZCD 4Y4HD 5HI5C 4L29A 5EZLA 4OCRH 1T20A 5C0AA 2MJWA 3BQUB 4PV8A 3EZJB 3IB4A 3P77A 4N0CD 1I7TB 4JANB 1NL0L 3GBNH 4JHAH 3PQYE 4MA7L 3RL1B 4HMCA 3WUWA 1IGCL 1HHGA 1RVFH 1CFSA 3TT3L 5BV7L 4EN3D 5JORA 1OGTA 5GGSA 3DETD 4UTBL 3FQXA 5D8JH 5BS0A 4J3OC 2IPKA 4QCIA 3O41A 1KCLA 4D9QE 2MNUA 1FAIH 4BH7A 3ECBB 2ZWLT 1MLBB 3V0AC 2AXGB 12E8L 5FYLL 5FM5O 2AP2A 5EU6A 2NX5B 1IAKB 4M61B 3MODH 2HLAA 4ZAKA 3BOVA 4G6JL 1JNNL 1MCPH 2DM7A 3E3QC 4KI1A 1FGNH 4WV1C 5L8JB 1MFBH 1MFEL 1SBSL 3WNNA 1FN4A 4HULB 2EE6A 2FECL 4QXUH 2FSEB 3P9MA 2GEEA 1YEHH 4AT6A 3DTXA 2EIDA 1KYOK 1J1XL 4Y1AA 5D8JL 3WSQL 3S88H 3VGEA 4P2RA 2GT9A 1G7LA 1CFSB 3MV8E 5D2NC 3QNZA 2HFFA 3KPSE 5E1HB 4B7IA 2HLAB 4ZAKB 1JNLH 1VSCA 5I1AA 2H1PH 4FFWD 4HIIB 4Z95H 2VABA 4BSVA 5E4EB 2AJVH 2NY2D 3LS5L 3DV6B 1VESA 3VD5A 3JXAA 3E3QE 5CKAA 1HH6A 1FH5L 2ESVA 5ADOL 3ARDD 2WIIA 3CXDH 1VPOL 4QXGL 3I02B 1QSFE 2BNRD 4DVBA 4OUOA 3RVTD 3KPLB 2AXHA 4KKLD 4C55A 4P57A 1UM6L 4JFFA 4QY8B 3KPSB 2H32B 5F3HA 2AJZA 4WHCA 4FMFA 2G75A 2Y36L 3VXSE 2GSGA 1Q94B 1JNNH 1MCPL 5DJCB 3QHFH 4KI5C 3C60C 1OLZA 3NZHL 3OKDA 2XFXB 5C0DB 4DTGH 4YEFA 5E94A 1N0XH 3PHOA 3IXAB 3VFWB 12E8H 1CG9B 2VMFA 3RWHA 1T89A 2MPAL 1FAIL 2OTWA 3HPJA 2F9BT 1YY9C 2W38A 3U6RB 4KC3B 1MRDH 3MRKA 4KTYA 2OJEB 1N5YH 1OB1B 1QYGH 3FO2B 4JREC 4F7PB 5JPMA 1MJ8L 1FPTL 2VLRA 3NFNA 3MV8B 3VJ6B 4KWUA 4OZIF 2F54A 5H8DA 1GGUA 3CFCL 5GXBB 3MV11 2PETA 1C12A 4M93B 2EXYD 1RJLA 3U7WH 2NY6B 1O0VA 1VACA 4XZUA 3RZCB 3P4MA 3V5KB 3QFJD 1SJXA 3Q6FB 4M1GL 5IVOA 2OQJB 4HCRA 1I1FA 4PUBL 3TN0B 2NY6D 4YHYB 1OAZH 4XNYL 5HHXL 3VA6A 2HWZH 2H8PA 2X9YA 2HTKD 1FQ9C 4XX1G 2R0LH 4JFXB 1S9XB 5M94B 4NN6C 1F13A 4UU9A 5TQ2L 4ESKA 4XNYH 3T08A 5DJDB 4HGMA 2GI7A 3K2MC 2HG5A 3FCTB 4L4TE 1A7NL 1J9CT 1SJEA 4KROC 3WLBA 1G7PA 2EIEA 1VACB 3MX0A 2R2BA 3K8MA 5D6DA 4X4YA 1UM4H 1OQXA 4HKXB 3WFHB 2JJTC 3U0WL 3MLYL 3BKJL 2YR3A 2CR6A 4LSVH 4XAWH 4PJHF 1PZUB 3UTTE 3IU4H 3D69A 1BREA 4N5UA 2VH5H 1MRDL 3LKOB 1OLLA 4XRCA 1IAOA 5GJTL 2LTQB 1I9IL 2MPAH 3DUSB 1KLFA 3TLRA 1SYSB 4H1LH 2D31A 3IS1X 3PL6A 2XRAH 2NY3C 2WUBL 2KUTA 3JWOL 1TVBA 5EU5A 1TVBB 4Q9RL 5DJ2A 1U8HB 3WIFA 1U92B 2ATPA 1NC4A 4RGNB 3V52L 4KDVA 5DZNA 4MJ6A 1CLYH 3C6LC 3SKMB 5JW4Q 4HUKB 4HUMB 4S1RH 4WW2C 3B9AA 2D7TH 1KPVA 4TULH 5B39G 3HAEG 3QWQB 4KXZI 1OAKH 4X6FA 1OAXH 2GCYB 1S7VB 4OZGE 1QR4A 4NCDA 1HHJB 2BCKB 3CU1A 3KPMA 3PV7A 3PL6B 2AJVL 5C09B 1Q0XH 1QSEB 4XBGB 1PD6A 3PWNB 4OLVL 2O93L 3QXWA 2FLRT 2NY5H 3OXSA 2W91A 3C9NB 1X4ZA 1D5IH 2E7LA 5KVDH 2G2RA 3MV7A 2VXQL 3D39E 5ACZA 1MUJB 3QIUA 1T0PB 3T0EE 3F8UB 2FSEA 3P9MB 3BGMB 1T22B 1U92A 2ATPB 2G9HA 3V6ZA 4C57C 4QXTB 2PO6C 2WWKT 5D7SL 5SWSD 1VFUA 5JHDD 1JF1A 4M61A 1K8DA 3BZDA 4DTGL 1HKFA 2FNBA 5F9AC 4NO0A 1NMBH 1JPST 3UMTA 4IM8A 5IHUL 3QO0B 4G5ZL 4LFHG 1JUFB 5FECA 4HS6A 4YHPB 3PABB 2IMNA 1TVDA 1G7QA 2QHRH 4IOIA 1T22A 2FGWL 4JO1H 3BD4A 5F1IB 2DYPB 4W6YB 4XVUC 5E6ID 4UI2A 4JM4L 5GRXG 1S9WB 1KT2B 2YUWA 3FQWA 43C9A 2Y72A 4I5BB 1U91A 3CXDL 5HXMA 1KJ2B 2IBGA 3F6LA 4OGYL 4R7DA 4NQEE 2MQCA 5E4EC 1JYXA 2VDRL 4OD1L 1QPPA 4ZUUB 4I77L 1KCRH 5F7EH 3P9WB 2R9HD 1D5XB 1Z3GH 3E8UL 4H26B 3MUZ1 2CRMA 5E8EB 5L2KE 3I9GH 1HINH 4UNTA 3DI3B 1CL7H 4WEBL 3N50A 4X6BB 3CUPA 2WUCL 4L1DA 2QEJA 3R0NA 4YIQB 4XT1C 2IAMD 1OAUL 1QSVA 4GMSH 2RFXB 4LBEA 3OKDB 5C0DA 1KB5B 1PDKA 4L3ED 5F7UA 3E6HB 4TSBL 1WEJH 2XV6B 3T77B 4U1KA 3NFPB 2Q86A 3HPJB 1FYTE 3WXWH 1UZ8B 1AXIB 3LKQB 4UTBH 4UB0L 5BRZB 2AEWA 3OJDB 4HJ0C 2DM4A 4NZJA 2ZG2A 1KB9J 1S5IH 3KJ6L 5J57B 3ULUD 1J5OH 1U8HA 2NY7H 4KJWC 5E1AA 4OLYL 3WL9B 3TP4A 5DGRA 1P7QB 2H2SC 4NDMB 5IQ9B 4QXWA 2DI9A 2O5ZH 4N0YL 2C7UA 1CDBA 3C6LD 1JPFB 2BSTA 1DSFH 3K2UL 3MV9A 3NCYS 3QHZL 3S34H 4JPWL 4XCCL 4HWNA 4TTDC 4LMQI 2WBJA 3D69B 4LHUA 5JQ6L 1W0VB 4G8EB 4RGMC 1QSFA 4KV5F 1BVLA 2Z31A 4O2FA 1SEBB 5JMOC 1LDSA 4Z7WF 1XIWA 5SWSE 1GYAA 1XIWB 2CJUH 5BV7B 2R0WH 1K5NB 2DQDH 1ZVYA 3ZLQC 1U8OA 5KSUB 2CDEB 5D96C 4TULL 5C6TL 3EOAB 1WBZB 3FQUA 3KLAB 4S2SB 3FFCD 2IQAA 1BF8A 1V7NH 4JO2L 2LFGA 2GTZA 2A83A 4HS3A 2JB5L 1QFWL 5DMYA 2X4RB 3VRIA 2CKBH 1I7ZA 3EYVA 4NO0B 1OWRM 3U82B 4ODUB 1T03H 5ESAA 1ERNA 2WINB 1R0AL 4HQQL 4RAUB 3EGSA 4NQCD 5TE7H 2PW2A 1UKSA 3DPBA 1UT9A 2Q3ZA 3O8XC 4G6ML 4JM2F 1IL1B 3HFML 2DJSA 4Z5RB 5ITBL 5J9PA 3N1PC 1XZ0A 1T89C 4QEGA 5I1IL 2N1KA 3TZVC 4JQVA 3MLPA 4Y8AA 4U33A 4Y2DB 2YA2A 4JRYB 4OZ4B 5CZVL 3QIWB 4LSVL 1ZHBA 4PRNA 3UYRL 5C86A 2H2PD 5EN2A 4HUXB 1NFIB 3CVHB 4ELKA 4PGCA 5BRZD 2B20A 3BSZH 1ZMYA 5A16B 1UWXK 2RCSH 1G7IB 2R15A 1I1CA 3RGVC 4GW1B 3BD3A 4UV7H 1H3PL 1HINL 4JFHD 4DCQB 4P9HH 1NAML 1WZMA 2HWZL 3T2PA 1S7WB 4KROD 2DQJL 3AB0B 2OJZH 3BHBB 4OV5B 5B4MD 5D1QD 4A6YH 2IH3B 5HYQA 4OKDA 4JFDA 4HQQH 2P24B 1GHFL 3QXVA 4APQA 3V5HB 3SGJA 2NZ9C 4E0RA 2DQTL 3P73B 4Y1AE 5DYOB 1OAQH 5IFAL 2E7CA 5FCUL 3UC0L 3KYMA 5C8JA 4QRPE 1IE5A 1OGAA 1YPZF 3QEQE 3ARGC 1RUML 5E08L 4J23A 4XP9L 1KIPB 4G8FB 4UB0H 2BNQA 3KJ4B 3VFOA 3LIZH 5GZNC 2Q7NA 4HKJA 4I3RL 5CZXD 5HGHA 4OB5H 4ETQA 4NT6A 4BKLB 4NN7B 4P2OD 3RL2B 4LRNL 4YEEA 2UYLB 3Q5OA 4G9FA 5DRNB 5E2VL 1MCSA 1X5FA 1AQDA 5D7SH 1U36A 5HHQB 3INUL 2WUCH 3ALWA 2X4TB 3FQNA 1ACYL 2W0PA 1BFVL 4LKXB 4U7MA 4P5TB 2KKQA 5IB4A 3ES6B 2HTLC 2ZG1A 2YPVL 2NX5E 2Z93A 4JQXA 1AGFB 2P5ED 3ETBF 3G5XA 2IALB 3H0TB 5CJOH 1OP3H 1MHPH 7FABH 4GG6F 4PTTB 1ORSA 3MGOB 3ZT7A 3RVTC 3MRIB 4X5WB 1RMFH 5JPNA 5C0ND 2DL2A 3KR3H 4OD3H 1AHWB 2R4RH 1N8ZB 4FZEL 4L9LC 1VADA 4PJ7E 1U8MB 4L8DB 3MCLH 4LLQB 1DVFD 4IRSC 4HKBB 1IQDA 2XKSA 3N06B 4QXUL 1FL5B 5DRWB 1MFAL 1K4CA 3QDMA 3MYJB 4AYFA 2D7PA 4XNZC 3UTTD 4XCYB 4U0QB 3E6HA 1WSST 3CFDB 5J4MA 2FHBA 3MRIA 8FABB 1SJVA 3OZ9L 3QRGH 5JXEA 3C5SA 2C5DC 4G7VL 3GI9H 4N5ED 3G5XB 1P2CB 3IAPA 1A5FL 3VFVB 3OKLA 3FB7B 2HT3D 3K74B 4Q9BA 1UQSA 4JRYA 5HYJA 3BUTA 1MCOH 4X4XA 4WFEE 2XQYK 3I3EA 4HBQA 3W0WD 3M07A 3VXSB 3EO1B 4ZFZB 1HSAB 4M6ML 2BNUA 1KG0A 4M9PA 4HCRL 3NA4A 5CWSB 1TZHA 1SY6L 3OKNB 2IADA 2UV3A 1BWMA 2NY5L 3UAJC 2P46B 2IBZY 4Z8FH 3DURB 3ARFD 3U4AA 3OKYA 4BH8B 4DJMA 5F3BA 5H94B 4P0DA 2Q7YA 1FO0H 1BGXL 5C0FB 4MLIA 3KXFE 4P9HL 1MCWM 5CEXB 5MENB 3VXSA 5JW3H 3BXNB 3KLAA 5C3TA 2GJ6D 3FJTA 5D2LF 3GMQB 3QQ9D 1RU9H 1TLKA 1EO8H 3SCMB 1EMTL 4LHUG 5DJ0A 5FYKL 1J86A 2CUIA 1T1XA 2IPTL 2E7LC 1ZEAH 1MREH 3PDGA 4D9RD 3BKMH 4HIEA 3RVVC 1FV1B 1KG0B 3DI2B 2JJSA 4LEXL 1DQJA 4K94L 2OS7A 5DJ8B 3LDBB 2GUOB 4UTAL 4WV1A 3U4EA 3CXHK 4UIKL 4MXQC 3H3PH 5KSBA 2XQBL 3U7YH 4ZAKC 3FAXA 3KS0J 5L2KD 1NLBH 2JF1A 3TA3C 1IM9A 5FUOL 3B3IB 3GI9L 4PS4L 1PSKL 1I3UA 5H2BA 1UH3A 5BZDB 4JM2D 4LSQL 5CINL 4YDJA 1NFIA 3CVHA 4ELKB 5FA3A 5FA3B 5HHOD 5EOQH 4Z6AT 3QXUA 5HVFB 1QFWH 3VXNB 4IRZL 4U3CA 4DVRL 2ZSVB 4OZ4A 4LLVA 4N1CA 4MB4A 5CBAA 5ANME 1D5MB 3LKNA 1AY1H 1AD0B 1T3FB 2FHCA 5FDWA 5FOBB 5FOBA 2HKHH 3S3PA 3MCLL 1QBBA 4CNIA 3SDAB 3RX7A 3UTPE 2FLBT 4ZS7L 2GUOA 4MGXA 1JJUA 4FA8A 1JWMA 4R4ND 5KSBE 1A0QL 5DQDL 5J11B 5BVPH 3K46A 3O3DB 5JO5A 2YRLA 4LASL 2DWEA 3MA9H 1FPTH 5KS9E 4GW4B 3F7VA 2EDHA 2J6EL 4EKXA 3UZQA 4G80B 4F8TA 4UIKH 4MAYA 4U1LB 3REWA 3ECBA 1FG9C 1MJ7H 2A6DA 5EBMB 3VXNA 1KSRA 2RB8A 4X8JA 4PP1D 3VFMA 3L5IA 1DLFH 4L4VD 3OWEA 3BKML 3BQUC 3NFSH 3TO2A 2VDQL 5DRZB 3T3PF 2BVOB 5E7FA 1U0QA 1OHQA 4AM0A 3MODL 4C56B 5HI3D 2A0LD 4FTVB 4JFPB 5IMOB 3R06B 3F5WB 5JW5B 1YYMH 4X7SH 4RDQG 4FFWC 4NN5C 3FQNB 5DUMH 4BM7A 4ODHH 1Z6JT 4XNXL 2HJFA 1IJ9A 2VISB 2XA8L 2VLJE 1J05A 3ZDXF 1J1PL 2FD6H 2WLZA 4LPXA 1EVTC 5ETUB 3PHOB 4HGWA 3ROLA 1A3RH 5JLZB 1H3WM 4QGTA 7FABL 1FLRH 3S98A 2ILLA 4BSJA 1KV3A 3ZE2F 1DN0A 5DA4A 4CVXA 2YUXA 1HK6A 4JQIL 3ZDYE 3MZTA 5ECJE 3KPSA 3JTSB 4NQVB 4YH6A 2E27H 1IQDB 2ICWA 3D3VD 1AXSA 2YEZA 2P8LA 4XNMB 3VWKA 1BM3L 1A7OH 5JUEL 3AXLA 4O58H 4Z0BH 1FNLA 5J12C 3RKDD 1P69B 2W9DH 1PG7X 4PJEB 4HD9A 1OTTC 3TYGL 1DQML 2P5WA 4NC0B 4MD0B 4NQSA 5F9JA 3DX6B 3TCLA 3VXTA 5FF6A 3FB6B 2L7JA 3MXVL 2NNAB 4B5EA 1PFCA 4V1DB 3OKLB 1H0DA 4B50A 1XR9B 4XP9H 1BEYH 1Y6NR 3MNWA 3BYYA 1PG7W 1IL1A 3O6FD 4U49A 3DUUA 2FJFB 5KN5A 5GS2H 3O8XB 4UQ2B 5HI5D 4Z95L 1R3LB 4YHOH 1J11A 2XG5A 4MCYB 1KPRB 3LZFL 3G6JE 3B2UC 5D1ZA 1TZGH 3P9LA 4FFZL 1G9NH 3DUSA 1JWSA 4QRTB 2HTLD 3QWRD 2F15A 1YEJH 1F4YH 4PRIB 2V5TA 3S35X 3T09A 5DZLA 2KH2B 3ULVF 1ZLUH 2PYEE 4F37K 1I1RA 2BVYA 3QIUC 3WLWC 4Z7NF 2R2EB 1PEZA 4PRPA 1I1AC 1KPUA 1EAPB 1U3YA 4X4YB 3NA9L 4LSRL 5GS1B 5J13C 1XGRB 1INQA 3O2WH 1UB5A 2ADFH 3VH8G 1LP9E 5HI4C 2VXTH 1IT9L 3PGCA 4MZ3A 3DBXA 5DMGD 5C0CB 5I1DA 5I1IH 2BHYA 5TQ0L 3V9FA 2DLTA 3QXTA 3ZE0E 1UFUA 2YZ8A 1MWAB 5FDWB 5JHLH 1MEXH 4C59B 2BZDA 1OTSC 2NY2C 4XBEH 4EUPH 3F58L 2UZIH 3TWCH 3JWOH 4PGZA 1V7ML 4PG9A 1X7QA 1R0AH 3RQ3A 4HZAA 1TNMA 3KLDA 1ZEAL 5IOPB 2NXZC 1TPXB 4KY1L 4YDJB 2AERT 2P24A 3L7FA 5GGUB 4CU6A 5JA9A 1AGDB 2BVQA 2ADGB 5T3ZL 2BOCB 3SDCB 4OGAC 1U42A 3ULUE 3UBXG 3TN0A 3CDFA 1NQBA 2DD8L 1FIGL 1FZOA 4IRSB 3MMEA 5JDSA 3FOLB 4Y4KA 3GMPA 2R2HA 2H3NB 3SDYH 3BZEA 5IBUG 5E03A 3ET9F 4X6DF 5C0BA 1ZXQA 1CICA 1CXKA 3HZKA 1AJ7H 1GGBL 2B5IC 1Q72L 4EDXB 4Y5XB 4NQCE 4GG8A 4E41D 4I2XA 1NCAL 1N3NB 3B5TA 3H7BB 4O5LL 4D9QD 2Z8WC 1LD9B 4KKAD 4L8BA 2Z8RA 4G7VH 4QOKB 4OF0A 4P3CH 3Q48A 3WNKA 4RFOH 4X6BA 4JDVA 1S5IL 4NQDD 5DK2A 5DJ6B 4U6YA 3JBG7 2FWOA 3DMMC 3BPCA 5I1EH 2K7QA 2BMKB 2YMXH 1EBAA 3DX8B 3F12A 4NBYB 5D2NA 4Y2DC 3MXVH 3QUXB 4Q0XH 2XWTA 2VLKA 2Y6SC 2Q3AA 1RZJH 1NEUA 4Y16A 3MJ6A 1DQMH 1RZKC 5EO0B 1BWWA 2XG4A 1D9KD 1NUNB 1RK1B 3DYPA 3HR5B 4RMUA 1OAUH 5B8CB 4GBXD 3SKUD 3MJ8B 4LPVA 4JN1L 1RQ5A 3QEQB 2DLFH 1DLFL 5T5FH 2FJGB 5JW4N 4LCUA 3BGFB 2MKWA 1G9NC 1INEL 2OZ4L 2QQKH 2VDPH 4QRRB 1RIVL 2PF6A 1HHIB 2XTLA 3L1OH 2PXYC 3OPZL 4ZS6D 3BWUC 4ONOA 3MRDA 3LQZA 3BIKA 1K4DA 4JDTL 1U3ZA 4UUJB 5DUPH 1I3GL 4OLVH 3MV9E 1KULA 1NGWB 4JZJB 2IMMA 2PYED 3QJFB 3QPQC 1XR8A 4MZ2A 3VWJD 3EZ8A 3WS3B 3S9DB 5KSAD 2BY3A 2X40A 3FQXB 5DHVB 2JCCB 3WSQH 3D2UB 5KVFL 2EE3A 3LKQA 2VIRA 3CFKA 1X5GA 3MRLB 1MCFA 3C08H 1PGRB 3IDXL 4X0KB 4XCEB 4M5ZL 4BZ2H 1SBSH 2HA1A 2UUDK 5BMFH 3L3OB 3BVNA 3LMJH 5F9JB 4G6JH 3HZVB 5AZ2L 5I15H 5DD3L 3OAYK 3O8XA 3TH2T 4TUKH 3DETC 3RRQA 1CDGA 2V2TA 3BQUA 1VFMA 1W0YT 3MRRA 3RGVB 2GIYA 3LN5B 4NP4L 1IM9B 4YBLB 4F57L 4LLMB 2E27L 2H41A 2VR9A 2ITDB 4DAGH 4HUNB 2PTVA 3K3QA 4HIXH 2DQHH 2DQFB 1M05A 2GKIA 3PGCB 3N1MC 4QOKE 3S37L 1OL0A 3OX8A 4XAWL 4OCXL 4I9WD 4GRMA 3IRPX 4I77H 1FNEA 2NY5C 5I0DA 5DQDH 3MLYH 3AY4A 5IW6B 3UJTH 2GW5A 5TE6L 4KPHL 3DRQA 2Z91B 2Q20A 3BPNB 1IC5L 4Z7UB 1LE9A 1X5KA 7CGTA 4JM4H 3S96B 3T04D 4JFDB 5I1JH 1OT1A 2YPKA 5HGAB 1RJZA 5IESL 1TXKA 4JKKA 5CMAB 5HDLA 5AUMB 3PQYD 4GT7A 2X4PA 4D3CH 2X4PB 5ACLA 5DF0A 1JGUH 1I7UB 1BLNA 2CLZB 3QIBA 5L6YL 4ZOEA 3V52H 1R6VA 4MA3B 3KYMB 3UDWA 2HJKA 3ILPA 2DTML 3KPNA 1G9MC 4LSQH 5CINH 5GRUL 1TJIL 2VDLH 1XGQB 3TZVD 4OKVA 4WEUD 1I3VA 4RX4D 5IV2A 2OR9L 4IRJC 2EYTB 5HHPA 3MRMA 4FQPA 4UNVA 4GRMB 2XQBH 3CFEA 3RVXD 5JHLL 4WJ5B 4JN2A 3MRKB 3K8KA 2GTWA 5DMIL 4F33A 4G42A 2LAAA 2VXQH 4JG0L 4PJ8C 5ACZB 2WK2A 3AS3A 3NVQA 4WW2F 1S7SA 3ULVC 5FYJE 1G7HA 4YE4L 2M1KA 4XPGH 4HK0B 3MOQA 1N0XL 1RPQA 1LD9A 1FNGA 1LWRA 2IF7A 2W0KA 3KPRE 3LPFA 5F9DC 4Q9QH 4GRWF 1A7NH 1EEYA 4UBDC 5F7YC 3NGBB 2VDOH 4MQXC 4HDIB 2WWMD 4HK3J 4IOSD 4O2CA 4PR5B 2XWJA 5DHYA 1MFAH 2EZ0D 3TO4D 5HHXH 2NY3B 1ZA3B 3C5SB 5LWYL 5E70A 3AM8C 3I6KA 5DVLA 5D1XD 5MENE 3V0WL 1GIGH 1I8KA 4M1DL 1I1AA 1FC1A 2BVPA 3RNKB 1VB9A 2D9QB 1AGFA 2AV7B 3QEHB 2Z8SA 4Q2ZB 2PCPA 5JXEC 1UH2A 2NR6C 2VDNH 2W65B 4YDKL 4LKXA 3C5ZB 5I9QB 3QFJB 4P5TA 5HGHB 1CD9B 3MYZA 4N8CL 2I26N 3VD7A 3B6SA 3QUMH 2GAZA 4ONFH 4EVNB 5JOFA 2I9TB 4AIZA 4OBSA 4YHZL 4X9GA 3SN6N 1T6WA 1NKOA 2R2CA 2BSTB 3RI5F 4GAJH 5FYKH 4LLDA 4JGJA 1FDLL 4LRNH 3RVWD 2Y36H 1SJEB 2Y5TB 5T1MA 4M5ZH 5D9SB 2APWA 4CN4A 3GFUA 5IHZB 3IKCB 2PO6B 3V6OE 2P7TA 1SHMA 5INDA 2C4FT 5C07D 3HMXH 1B4RA 2P48B 1YMMA 5DD6B 1JWSB 1A64A 4QRTA 4FXGB 3CDCA 3NGBC 2R4RL 2VN4A 1UM5H 5A2LH 4M1GH 3HCVB 4NWTL 3SGEI 3AAZB 4H0HB 5TE6H 2HJLA 2OI9C 1BQUA 2NX5A 1UKQA 3UROR 1FORL 3GBNL 2BNRB 1QA9B 5LGJB 2A1WH 1TQBB 1JL8A 3HC0B 4YHIA 4OI7A 3QAZB 5DLML 5C8JB 5TE4L 1ACYH 3UPRB 4UV7L 5FDYA 1DUZA 3GGWA 3WFZA 5HDOA 4XC3L 4XZUB 4P49A 2NW3A 5EO9A 4P9HC 1BQLH 3KYKH 1M7DA 4JKMA 3THML 3N1FC 2I27N 3WIHL 3ZL4L 4HBCH 5IFHH 4L8CB 1P4LA 1P4LB 5ANMB 1P6AB 4PV9B 5FM8A 4ZDHB 4ODWB 1S7VA 1ZVSA 4CADB 3NCJL 5IK3A 1XR9A 3BDYL 5E6ZA 4LPWA 4RMSA 4FFYH 2IH1A 3RU8H 5HJ3A 5FO8B 1AO7E 1F45A 2FJHB 3L9RB 4V1DD 4CU8A 2NCMA 5DUBB 5FCUH 3UC0H 1XEDA 3VXPA 1RVFL 2C26A 4ZUTA 3MV7E 1G6RL 3OB0H 2HH0H 1HEZB 1S7TB 1BFTA 1JNLL 2K1MA 3U9UB 3Q5YA 1T03L 3SOBH 3DX7A 2FEDD 3L1OL 3OPZH 1A1OB 5CJOL 1FFOA 1EXUB 4KMQA 5D7KD 1FVDB 2D4FA 1RIVH 3QDJB 1QLRA 3PE9A 2NTFB 3VGDA 2DTSA 1DP0A 1J1XH 4PJ5E 4XAKE 4LLYA 1RJZB 3LV3A 4L3EE 3SKJH 1V05A 3LKSB 3EDEA 3MV7B 2VO5A 4C56A 5I8OH 1JZ3A 1MCCA 5JHDE 4XI5D 1BQHA 4NQUA 3MRHB 3MLUL 5EOQL 1JBJA 2M26A 4EQ3A 1U6AL 5FYLH 5FEBA 3GRWH 4IMLB 2H26A 1ZLVK 5FK9A 3SDDD 3HC3H 4N1EA 5JOFB 1W72B 5E8PA 3LV3B 4U0RC 5KANI 1CGYA 3LRHA 2AEPH 3AREB 1QLRB 1EIBA 3ARGB 1D5ZA 4M8VA 1P7QA 3U0WH 4K7PY 4UIMA 1NCTA 3MACL 4MNQE 2DQTH 3DARA 3SE8H 5BJTB 1XF2A 3OG4B 2R0KL 1UXSA 2DTMH 1EEUA 1MEXL 3P4OB 4LQFL 4LARH 3CLEL 4IHOB 2E6JA 2UUDH 4Y19B 5KANG 4Q2ZA 3PWVB 2QQLH 2DMKA 3ARQA 5EUOA 3O9WD 1SVZA 5CHNA 5HYEA 3A0OA 1MAML 5D2LB 2APBA 2WV3A 2LABA 4LNRA 1CFBA 1CICB 3GMOB 3CSGA 1HOCB 2CJUL 4NUGL 3B9KC 3X14A 1RUPH 2APTA 4XPGL 4ZFGL 2GSGB 1CLOL 3WFDH 2YEZB 4XNMA 3C8KA 1T5XB 1J0HA 2OLDA 3GBML 3CZJA 4R0LB 1JIBA 2YXMA 3E8UH 4UT6L 4MS8C 2ZCLH 1RZGA 3B5GA 5FKAA 4BYHA 1IRAY 1LO0H 2NXYC 4NP4H 4CW1B 1KNOB 1IC1A 4X80L 2CLVA 4S0TD 4TUKL 3T4AA 4OM0H 3RP1A 4LDEB 3NZHH 5D1QC 2VLKE 5J1AB 1KGCD 5J9PB 1JGDB 3QUXA 1A7PL 5LKNA 2MKLC 5AAMA 5KSVA 4RRPA 1TDQA 2KDGA 1UM6H 4R0LA 1EFXA 3BP6A 3KPRD 5AG9A 4BELD 3HUJF 4BH8A 4GRLC 4MQXD 5J89A 4KPHH 2W9DL 4J4PC 4ZFOB 3E2HB 1OPGL 4O58L 4LOUC 4P46A 4TSAH 1VFBB 1IEAB 1ZT4B 1S7QA 3MLSL 5IB3A 3TNMA 4I2XE 1YUHA 4C4KO 1WICA 3NTCL 4HUWB 5GGVH 4G8GD 5KSVB 3EJJX 4IMKC 1AQKH 4Q6IC 1U8IB 4Z7VB 5HYJB 1BFVH 2EO9A 2X70B 2HT4D 2D0GA 3UYOD 1N4XH 1DLHA 3IAQA 3SKOB 3T8XA 2O5ZL 3RGVD 5EBWB 4XH2B 5I71B 3B2UD 5E2VH 3BW9A 2VR4A 4MCYA 1FVEB 2X4UB 3VFRB 4J7RA 1KUMA 4PP2B 5KSAB 5GS0C 4CU7A 1PJ9A 1F3DJ 3T0DA 3GMPB 3VXUA 1AI1H 2VLJD 1WWAX 1BEYL 2JCCF 3UTSB 2BVTA 4X0KA 3EJYC 2YK1L 1YPZB 2X09A 3LIZL 2V2WA 4Y4FD 3MGTA 5J6GA 4EUPG 3HNTL 3RWDB 4LSUH 1K8IB 3L3GB 1EEZA 2R29H 4TSBH 2BVUA 4HUWA 1OP9A 1A1NB 3OG6B 1W0WA 1V3LA 3QEUA 5ITFA 3QEUB 5ITFB 3OBAA 4RSVA 4PGJA 5F6IC 5GS1A 3QPXL 4ETYA 1CD0A 4HUVB 5K9OB 3BH9B 2R69H 4LPUA 1J0IA 4PG2A 3U30B 4XWOD 3UZEA 2VWEC 3PWJB 4OCRL 1INEH 3S35H 4YDKH 3E2HC 4QHKJ 3EDJA 3MA9L 4N8VG 1D5IL 2X41A 5CILL 4LLYB 1QRNE 2PN5A 1GGBH 4U1JB 4G3YL 5GGRY 2YPLE 2CUHA 2Q87A 4BFIB 3VI4F 1ZGLM 3UYPA 1DDHA 1WT5A 4RFNB 4GG6B 3MRHA 1FE8L 1G7HB 5EU7C 3MRJA 1DBKH 3I75A 2X9XA 4ZXBB 1U91B 4OF5A 3SJVA 1G0DA 3PDOB 5BW7C 4RFEA 4AEHL 3ZZ1A 1VEMA 3RDTA 1MRFL 1CFTB 3VDAA 2R23B 2JKXA 5I17B 4G5ZH 2DIJA 1YECH 1EJOH 4DVRH 3TVMD 5DJ6A 4LP4A 1GAFL 3V6OA 3ZDZE 1B0RA 1DCLA 2J8UA 2XKNB 3OL2A 1TJGH 4K7FB 1FZMB 4YDLC 1ED3B 5IVNA 5E1AB 4QOKD 1KENL 2IPUG 1I8IB 3GZKA 5I9QC 3QXAB 2B0SH 1NGZA 1F42A 4V2BA 5C0AE 1KTDA 2AK4D 4Q7DA 1UJ3A 1E0OB 1WFOA 5EPMB 3VXMD 3HI6L 2VLJA 4Y5XA 1UXWA 2XPGA 4J6RH 5F93C 3ZO0A 3ZE1E 1KIUA 1Q72H 3IU4L 1FZOB 3I6LD 1SQ2N 4NPYB 4NRYA 4QLRA 5F7NC 4D0CA 3UTQA 5D5MB 4M7ZC 1AJ7L 3Q6FA 3M17B 5C6TH 5L7XH 1XCQB 1UM4L 4LK4A 1MREL 4P9ML 3NPZB 3QXAA 1ORQB 1QD0A 2QSTA 3G6DH 3UEZA 2VSDA 1L7IL 4CUCA 1ORSB 3QYCA 1U8PA 3DOSA 3KNBA 3H9SE 4G8GA 5JW3L 4X83A 2Y6SD 4PRBB 1F6LL 3G5ZA 2F5AH 1RUQH 1HDMB 5HDBE 4RNRA 5EFIA 1KTDB 3GHEL 1QFUL 3MRGB 4OM1H 1FH5H 5GSVB 3MJ9A 3PP3H 1SMOA 1TQBC 5DVKA 1U2HA 4XCNA 1PZ5B 3SDAD 2B4CL 2EDQA 2GK2A 3HCVA 4XBEL 1J5OL 1EFXD 2IEPA 5E9DA 4MSWA 5K9JL 1BECA 4LNVA 3QA3A 1V3MA 4DOHE 2AXFA 4LVHB 3GSXB 4O51B 2VNCA 1H15B 4AIZB 1MHHB 1ZHKA 4F2MA 3FO1A 1OD9A 3HNSL 3C5ZD 3H3BC 1A5FH 3U0PB 4PJHA 2W0FB 4LSPL 2VYRE 5I76A 4LLDB 1FBIH 3O3BA 1TZIB 3TYFB 2ICEB 3VWJC 1T66D 4KQ3L 4ODVL 5ISZD 4LPYA 3WUWB 1RZ8B 5ERWA 4KI5E 1RZ8A 5ERWB 2CGRH 3O45B 3W39A 4JRXE 4Z0BL 3BKCL 4WNQA 1QSFB 3DHMA 5ICZA 1A7OL 5JUEH 3WYRA 4L5FH 1RFDL 1MHHA 4C83B 5KVFH 1KEML 1RZ7L 3VFOB 3VWKC 1EGJL 3D6GA 4OZFG 1VPOH 1FO0L 4OQ1A 1LVEA 2DB8A 1JK8A 3KLSA 5CP7B 4PJXE 4L3CB 4EDWL 1YY8B 3MBEB 2H1PL 1QEWB 2XZQH 3P73A 3IJSB 1MCJA 1CXIA 4PJHB 1T2XA 1KXQE 1UCBL 3B9KA 5IEHB 1KJ2H 3MCG1 1CE6B 1UM5L 3RA7H 3JUZA 1SEQL 4ZFZA 4XP5H 5IKCB 3SKOA 3T8XB 3QDGD 3CFKB 3MRLA 1MCOL 5LG1A 2IAMB 4JY4B 3BPCB 2QHRL 4FFYL 1FVDA 3VFGL 4U1MB 5B38G 3SHSA 2KQNA 3VXMB 4OD2A 4Z5RA 3CFEB 4KMLB 3EIFA 5GRVK 1OP5H 4OLUH 2Z92B 3ARED 2Z92A 1WWBX 4NHCL 3B3IA 5HVHB 3QQ9C 3O2DL 3GJFA 5JOPD 1BOYA 3NIFF 5EOCL 4LPCA 2PNDA 3JWDC 4X6EA 5D5MA 1L7TH 4JFFB 1YJDL 3ESVF 5CIPB 4FZEH 4PJDA 4R90L 1WF5A 2PTUA 1C5CL 3O3AB 3WBDA 1EZVY 3C2AH 2J8OA 1WFUA 1CE6A 3V5DA 1FLRL 5E6IC 3EYSL 1PYWB 3U1SH 5FGRA 5JLZA 5F89A 2CXGA 2D2OA 4K7FA 3V0WH 3O6ML 1ED3A 2JIXA 1D5ZB 3FZUD 5JIPA 2ZP0T 3IDYC 1YYLH 4TVPH 3D25A 4ENED 4G42B 4YJZL 1QBML 4OCSL 1ZLSL 2CDFA 5BXFA 4XTRD 3LVEA 1UVQB 4YDLB 3BSZL 5HYSB 4NWUH 1TMCB 3LEYH 3V5KA 3RZCA 1SMAA 2FB4H 1WBXB 4J8RA 3WHXB 1TCRB 3NN8A 2A6KA 3PV6B 5C0CE 4KXZH 4ZTOL 1AE6L 2IAMC 4P23A 4L4VB 1GGTA 5L8LB 5FKAB 4HWBA 1J12A 2YPLD 5D7JC 4YE4H 1RHHA 1ETZB 1FIGH 3FQTB 5D7LA 3TT1H 3KGRA 3MJ9H 5IJVA 1D5BA 2J6EH 1IFHL 2DM2A 1NGXA 5KTEL 5HVHC 2FEDC 4DUXA 1AR1C 3T0AA 4ELMB 3O3DA 4JHAL 1ACZA 1V7MH 1ZANH 3T0BA 4OCWH 1PX3A 4Y19E 5DJCA 1EMTH 4ZS6C 4D8PA 3BO8B 1YQVL 3O6FC 2WBJB 3BPOB 1MELA 5LWYH 1RU9L 4HT1L 4HSQA 5DC9B 2I5YL 1HHKA 5T3XD 4JM2C 4OZFA 2CRYA 4D2NA 4X6DE 3CVIH 3QWOB 3B9KD 1F4AA 1YEIL 4J4PA 5TDOB 2X4OB 3KS0H 3REVA 4KGLA 3V4UL 4UDUB 4XC1L 3H9SA 5AG8A 5BZWA 5I8CA 4RGOL 3IFLH 5BV7C 3ZT6A 5H2BB 4W68A 1CVSC 5BZDA 5C0IA 4PS4H 5C0GA 3U7WL 4FFVD 3G6AB 5L7XL 3BD5A 2D0HA 1J0ZA 4ZFOA 4HFUL 1CGXA 3HA0A 4OZGA 4R2GB 3S7GA 1QVOB 2ZKHL 2GY5A 4OCNC 5IMLB 3MUJA 4PJBA 3QP3A 4OF6A 4XCCH 4UILL 3DJ9A 2AW2A 4R4BB 3I84A 1UWXH 4S0SD 3ZTNL 5EU4A 1SY6A 4R2GD 5IB3B 4JN2B 4WW2B 4I0PA 3OXRB 5ISZA 5IFJB 3V6BR 1E28A 4PB9H 3A6BL 2NYYD 1J88A 1ITCA 4JRYE 2JK5A 4NGHH 2ICEA 1HZHL 4FZ8H 4JO3L 3H42L 5F7WC 5FIEA 4P5KA 4HWEH 3RZCD 2DICA 2H32H 3IDXH 3LS4H 5L0QB 3D87B 3AMLA 1JHLH 2LU7A 3VD4A 3QT2A 5DO2D 1T0MA 4XMKH 1FV1A 3T3ME 2Y1VA 4PLNC 4P4KD 1A3QA 1QFHA 1QLEH 3TYGH 2MFNA 1T5WA 3MBEC 4J12A 1FE8H 3WIIL 2R0WL 2OSLA 5DEGB 1EZVX 2LVEA 2AV1B 4Z8FL 4KJPD 4PLOB 43C9B 1SY6H 3L3HA 2DQUH 5GRYA 1JPSL 5FUCC 3EKCA 3VXPB 3EYFB 4HS8L 1CL7L 1S9KC 3U46B 3A67L 1Q94A 3PWUB 1KIQB 5EUKA 3F62A 1J0KA 4GG8B 1MFNA 5FO8A 2DQHL 3S96A 5JDSB 4MAYB 1R3IL 4U1LA 4X6EB 1T83C 2QQKL 1BZ9B 5B8CC 5CSZB 2CH8A 2YPLB 1DBML 1A3RL 1A7QL 1NFDF 3V8OA 4ZQKB 5IM7A 2V5YA 3MRPB 3EJYD 4BSVB 1D9KC 35C8H 5JR1H 1W72H 3KPMB 1BJ1H 5EIIA 4Y19D 1CR9H 2P8MA 5K9KB 3K81A 2LV4A 2XI9A 3KPLA 3SO3B 1HXYA 3VGHA 2MQ0A 1Q8MA 1F2XK 1YYML 4X7SL 1A3LL 3U0TB 4OFDA 1MNUH 1Q9WB 3WEXB 1GL4B 2VJXA 4MCZA 3L3DA 3TZVA 1HWHB 1MRCL 3Q6GH 1IGCH 5HVWA 4KK5C 1NPUA 1KTKE 3DSNA 3BZEB 5E2WL 3AAZA 2EKJA 2XKNA 1QO3B 3WHXA 3QNZB 1F3JB 3QULA 1GOGA 4POZD 3MJ7B 4FXKA 1CDUA 2Z93B 3FCTA 4HGKC 3S36L 5M7QA 2WWKO 3J8F7 3SJVD 4NZRH 1YN6B 3HE7B 4U6XA 5C0EA 5TF1L 1F90H 3T0ED 3PNWB 4KRPC 1P6FA 2RCSL 2DQUL 4EI6B 2VDRH 1IZJA 2FBJH 3S37X 1OPGH 5E5MA 3ZSTA 1WBXA 4J8RB 4R7DB 1LO4H 3HZMA 1F4WL 1XF5A 3AROA 1Y0LA 3KXFD 1LK2B 4Y5VA 4MDIB 4LCIH 1Q9KB 5IJKA 4ZMAT 4PRPE 3O2VL 4KTDH 4GKNA 1MPAL 3AS2A 5IHUH 4PRHB 4P23B 4PRBA 4OLXH 4U1GC 3KPOB 1C08A 5K33A 5TE7L 1G7PB 2P5EE 2WUBH 2J1KA 2R8SL 3P4MB 4XMLH 4WU7B 5GRVL 1F6AA 4ZUTB 1DQTA 1F8TL 1UB6A 1OTSD 3QCUH 4MJIA 2Z4QB 4QGYA 5GJTH 5F9WB 4ZO6A 1ZOXA 3MLVL 5C08B 1NCAH 1G0XA 3ZTNH 2OL3L 4Y4HB 4G7YH 3DVGA 4QF1B 1CBVL 3VWJB 1PKQB 5IW1A 4U1KB 3VWJA 3AU1A 5SV4A 5EOTB 2YN3A 3C6SA 4KQ4H 4PLKC 1P1ZA 1F3RB 3QO1B 3D3VB 3RGVA 4UZGA 4YUEH 3UTSE 4Y4HC 4QHUA 5FGSA 4PGEA 2VE6A 5TPWH 2A9ML 2P8LB 4HUXA 3VWKB 4J1UA 1LP9F 1BD2E 3KPOA 4RGNE 4XTRC 1DUZB 4PJAB 1JPTL 3D48R 4M62H 4F9PC 2CLZA 4GG6E 3CLEH 5T3ZH 4MD0A 3DHJA 1CLZL 2JCCA 2QKIA 1U41A 4QHNA 2ARJA 4U7SA 3CNKA 4RWHA 1G9NL 2X4QA 3EGSB 4PJBE 2BC4B 2CPCA 3DIFB 4GBXB 4X6CA 5A43C 2HJLB 2HT2C 1VENA 4IS6B 4OLYH 4BQCA 5LVEA 2EE2A 2PXYD 4M6MH 4PY8I 5GZOD 4XP6L 4O9HL 3RIAK 1DEEA 2APVA 5LGHH 3EYUL 3K4ZA 4FXLA 4BFIA 3OTTA 3QUXD 5HGDA 4HPOL 4TSCH 4BFEA 1ZLVH 2IPKB 4QCIB 3DXAA 3VG9C 3RTQD 3PUCA 3RDTD 1OT2A 1HYSC 2IBBA 4Q9CA 1QFPA 3BMVA 3G9VA 3QULB 3HMXA 3WDJA 3VRIB 5IP4A 3O3EB 5IT2L 1QACA 3HZYB 3P11L 2NY0B 2V5MA 1YNKH 2P42B 4E41A 4U1JA 1CDCA 4D9RE 5SX5H 3TBWB 3LKSA 4Z7UE 5C0EB 3CX2A 4M43L 4WHTB 5I6XB 5D71H 3SBWC 3ALXA 3DX8A 3O0RH 4PJXB 4UNUA 3RWDA 4MYWB 3C9NA 4U31A 2G60H 5L8KB 1F11B 2UYLA 2ZSVA 4HDIA 4K2UL 1G6RH 3JSSA 5DRXB 3BKYL 3IJYA 4G43A 4MDJB 4HK0A 3OAUH 3I3BA 1U95B 1ZVHA 5J11C 2V2WB 3WXWL 2D7NA 3V6OC 1REIA 4XMPL 1MCBA 5DUML 1CGTA 4CL7A 2XOTA 3X11B 1QR1A 1JRHL 4FQ1H 4PR5A 2W59A 1CXHA 5JIHA 5DXWA 4Y4FA 1P5VA 2BSRB 2C3HA 5EIIB 1A4JB 1NMBL 3FFDB 5F88B 1CDYA 3VFPA 2VSCA 4R4FL 2FX9H 4PJAE 3MJ8A 3MQIA 2D4DA 4LMQE 1T2QH 2ADJA 2DQGL 5EFIB 4MA1B 1RULL 1KJ2A 5C6WH 5EOTA 5TE4H 4H26A 2ENSA 4MA3A 4L9LB 4U2ZA 2EDLA 2V7NB 5E08H 1YNLH 1SYVB 1EA9C 3RA7L 1FFPA 5BV7H 1AO7D 3P0VL 1OSZB 3MRQA 1UJ3B 2V7HA 4LASH 4MVBD 3ARBD 3E6FA 3MRMB 4W6WB 4CJ1A 4I1NB 4JO4H 4Z76A 4CDGC 4EDWH 3A6OA 3RL2A 3QUZC 1QRNA 3WKNA 4OSUH 1PQZB 4LLWB 4ALAL 1J1OL 1VDGA 1Y6MR 1K9TA 4Y0GA 2F54B 1T6VN 1R5WB 3HMXL 5DD6A 4JDZB 4JDZA 3MR9B 2H8PB 2BOBA 3CVHH 1JI1A 4R96A 3RIFK 3CH1B 3KPRA 2FWOB 4UINL 2AK4B 1GJIA 5IMLA 5KVEH 1FDLH 3BKCH 2PYEB 2WQ8A 1XF5B 3DRTB 3HG1B 1MOEA 2BY0A 2VDQH 3QNXB 4LSTH 1PBYA 4Y5XC 4EI5D 2V7HB 3TPUB 5J56B 5BO1L 5F97E 1NLBL 5IMMA 3N0PB 2GQHA 3FQUB 5HGAA 4R97C 1JGDA 4K3JL 2LE9A 3H3PL 3HAEB 4LCWD 4MNQB 4FRWA 5FO9A 3HFMH 4OZGB 5K93A 3QI9D 1QVOA 1HYSD 4KJYA 2E6PA 3DROB 1YEDB 1B0GA 2BVPB 3RNKA 2JJTA 3O4LD 2HT4C 2EH7L 3VWKD 1HHJA 2BCKA 3D3VA 3CFDA 1IC4L 4EN3C 3T65A 3D2UD 5KS9B 3GHEH 2J88H 2APFA 3L3OA 1K4DB 1OSPH 4P5MA 4NZUH 1EAJA 4OJFH 5TDOA 1RUQL 3ULVH 2VZ1A 3HE7D 2R0LL 3PP4H 4ZTPH 1UEMA 3DV4B 3WKMH 3GNML 3RI5K 3WS3A 5FYKD 2F53B 5HYFA 3RX5A 2DQDL 1UB5B 2WINA 1BIIB 1MLCA 1OY3B 4JFED 1IGMH 5F1NA 4YWGH 4AH2B 4ZOBA 4HXAH 1YMMD 4BJLA 5TJWK 4WGVB 1MWAA 1Y18B 2PO6D 5T33L 1X6NA 4HFWB 5IBLD 1I8MB 2OP4H 2FHFA 5F44A 4D0DA 1IEBB 2ICCA 4XB8A 3T1WA 3PWUA 5MENA 1U8QB 3ZDXE 2FZ3A 4K07A 3BKJH 2Y23A 3TO4B 3L5XL 5BJTA 4MJIE 3OR6B 3SDDA 4NQDB 5EIVA 1A22B 2VQUA 3NBNA 4GAYA 5DHVH 2ED8A 2YPLA 3CFJB 5IQ7H 4ZUVB 3SCMA 4EXPX 1AD9A 3ILPB 3UBXB 1T21A 5L6YH 2ZSWA 3GSVA 1DTUA 5BCAA 4I3GA 1K3IA 4HZLA 2ICWJ 5DJ8A 3JWDH 3QCTH 4YAQA 2IBZX 3FT3B 3TH4T 3R06A 5D70L 5D72L 4QYOB 3W5MA 1IC5H 4YXKH 4M6NL 3U6RA 5T1DL 5MEPB 1C7SA 3KR3L 2R9HC 3O2DA 3M8OH 3HS0B 4NO3A 4OD3L 2VDML 5K59F 2OBGA 2DDQH 1NBZA 1VEOA 4QHLB 1RMFL 2AVGA 3CCHB 4WDIA 3H9HB 1RZFL 2QTEA 4K9EL 4TNVK 4JVPA 2W9EL 3PWLA 2XFXA 3TO4A 1QBLL 2HRLA 2BOBB 3QDGE 2VZTA 1GZQB 4M6OL 1BJMA 2BNQB 2H3NA 3UPCA 2YKLL 2MCPH 3BWAB 2A73A 3GSRB 4NKMB 5TGBA 3HE6D 1B4JL 1FNAA 4JFOB 1AKJA 2A9NH 1UENA 5HPMB 1OGAE 3WFBH 3VMOA 2DMCA 2CKNA 4G6AC 1HH6B 3RVVD 1IKNC 5GRJL 5L2KB 3MSPA 1H5BC 3EYQD 1OAYH 4PG2C 3EO1A 2R0ZH 1N3NA 2YD7A 2AJ3A 1MFCL 1URLA 4OZHF 4N9OB 5FXCH 3AMKA 3ZT5A 5HHVL 1UADC 3S4SA 1X5JA 2A74A 3CPLB 1FZJB 1LO5A 1AD0A 4ORGB 4Y89A 1JTOA 3G6AA 4C83A 1OOAA 4X5XB 4JVWA 1FP5A 1JFQL 4QRRE 3HUJB 1T2JA 4NKIH 1PX4A 1I3GH 3LY6A 1UEYA 3ZKXB 3ARRA 4PJDE 5CP7A 1P1ZB 5BW7A 3MRBA 1M6OA 2FH6A 3VFTB 4HEME 4MD4A 4N8VB 1KIRA 43CAA 5EORL 1CU4L 3U7AA 1XFPA 3GEWB 2MCG1 4NO5A 3HC0A 4UV4L 5EZIL 5E99L 3O6LL 1KCVH 2ZCKL 3CGTA 3SBWA 1JPGB 1XF2B 2ATKB 5SWZB 3LKRA 1S8DB 1BZ7B 1SJHB 1IGIH 1VGEH 1YA5A 1X9QA 4M7LT 4NKOB 1WAAF 5FV2A 4KKCC 1JWUB 2R2EA 4FXGA 3HAEH 3FRUB 1KPUB 2XN9B 2W0FA 4R97B 4D0DB 4NQXB 4U1HB 3LB6C 1K8IA 5ID0A 3SY0B 1RUMH 2P5EB 1H15A 2XT1B 4HH8A 3G5ZB 5JXED 3BQUD 2R56H 3ZYZA 1NANH 1C1EH 1HHGB 2F8XC 4PJAA 3MFFB 4P5TD 3O8XD 5HHNA 4OLEA 1WBYA 5JNYA 4LLVB 2EDXA 2PW1A 1OAQL 2XRAL 3QG6A 1A6AA 2CK0H 5C0IB 4PJCF 1R5IA 2XY2A 4DGVL 2F74B 5DSCB 1PYWA 2QV2A 2AJUH 2QADB 4LQ1A 3SDAA 1DVFA 3T0EC 4YXLH 4K8RL 1TJHL 2R4SH 2DQJH 3IDMB 3DROA 2HRPH 1RUAH 1QSZA 1F58L 3BAEL 1I9RL 2YWYA 3TJHC 5ELIA 5C0RL 5SX4I 2CIIB 2VKXA 5GJSL 2VITB 4A6YA 2IG2H 3EJZD 2EDJA 4JHWH 3S5LG 1NAMB 2Q6WB 2VE6B 3PIQB 4KV5E 1D9KB 1G7JA 4G9DA 4KRPB 3EO9H 1IBGL 3BEVA 2C4XA 1TFHA 5EO9B 3MOAH 3CMOL 2YWZA 4ONHB 1J18A 3ZKQD 5JQ6H 1GXEA 4NKMA 1JV5B 3BPOC 4M7LH 4R7NB 4Q58C 5T5NF 4HHAA 4KGJA 4LARL 1ZVSB 4CADA 2YS4A 4HZLB 3K2UH 4E41E 3PABA 4G9FD 4KROB 2EYTA 5IMOA 1H8OA 2GY7B 1D9KA 2I25N 4KHTL 4GW5A 3KVQA 3NAAH 4OIIL 4P2OA 4P59L 4XNUH 5KG9B 5D6CA 1I8LC 4PJ7B 3BDXA 1A6VL 1YY8A 4HJJH 3W2DH 5DHXB 1NBZB 2VLKD 5CSZA 4GAYB 4YK4B 3B2VL 1CTNA 4RAVB 2HMIC 3KYNB 2FZ3B 4HMEA 1OGAD 3VGFA 4IJ3B 5MEQA 4Y1AB 3GSUB 1GZQA 1ND0B 2DRUA 2A6DB 1EPFA 3PDOA 4IIQA 4X99A 5FGBA 5FK9B 2YBRA 3FMGH 3H6JA 5I1AB 2AV1A 5HDBF 4PJ7A 4OUUA 2BVOA 1KJ3L 3MLTA 1U8KB 2O5XL 1KNOA 3NCMA 4QRQA 2DJ4A 1E6OL 4OGZA 5HGBB 2CXKA 3RBSA 2AEQL 2Y9RT 1YEKH 4S1SH 5DTFB 5B22A 4AENB 2ADIB 5TH2B 3HZMB 3RWHB 2YD8A 2ZJSL 1K8DB 1KXTB 5DWUH 4NKOA 4UOW0 3L95B 4R6UA 5J3HC 4KDTA 5GZOC 3I50L 4M4PA 1QHOA 4ZPVB 4RGND 1M71B 5F6HJ 2NY7L 4IRSD 4G8EA 3BRDA 3BN9D 1CZ8H 1IGTA 4OGYH 3RWFB 5BVJB 1RUKH 1A8JH 4J3UA 4HMDA 3JV0A 5E8DL 2OMBA 1RIUL 1AFVH 2IALA 3H0TA 5DJZA 3U0TA 4L8DA 2BOCA 1TVHB 2P4AB 3SPVA 3NCJH 1MI5E 5D1ZB 2AK4E 5DD5H 4D8PB 4HAGA 1VFAA 1MJUH 4R3SB 5LCVH 3VFUB 5ICXB 4X5XA 3QEQA 3WIHH 1JZ5A 3HC4H 1FVEA 1KTLB 1TENA 1HKLH 4PY7A 1YEDA 2AGJL 5DFWH 1LO5B 1UACL 4E5XB 4WEBH 1UZ8A 2EYSA 1KB5L 3FFCA 5E8OB 5TDNA 4YPJA 3U36B 1KFAH 4ODTL 2LU3A 4X6CE 3WHE1 3SE9L 2Z8VC 3C5JA 3NIFE 3JTSA 4JQIH 3KNBB 4G6KH 4DKAA 1Z3GL 4POUB 1Z0MA 4EI5A 3WIFB 3NOIA 5CGMA 1FO0B 5KAQF 2GJZB 2BSSB 5DJXB 4CMMB 4OLZH 1NGZB 3ZHLA 2ZCHH 4DFIA 1QSFD 4LHUD 1DFBH 1N0LA 2GITA 1FAKT 1I7ZB 1XCTB 2IFGA 3EYVB 3W9DA 2AK1H 2OI9B 4HAFA 4DUWA 4XNXH 4U1SB 2Y5EA 3QWRA 2XTJD 2HYMA 1NMAH 3OXRA 3SDXE 2CKBB 1T4KA 2VXUH 5CEXA 4LCUB 4S1RL 1YY9D 4YX2H 4I48A 4R4BA 1TQCB 2ED7A 4QHMB 3U36A 2VC2L 1I9EA 3U2SB 5EWIH 5IK3B 4PBWD 3TV3L 4WY7L 1I7TA 4X7TA 3FT4A 3D39B 4XP4H 5F6HI 3MBXH 1KJMB 5LQBH 1NCCL 1ZAGA 3MLWH 4CMMA 2F5BL 1Z0NA 2VKWA 4XHJC 4CVWA 4W4OC 3GI8H 4R7NA 2HVJA 2P5WD 3HI1A 4JAMA 3HZKB 3G5VA 3QEQD 3VXOB 6CGTA 1C8PA 4MNQD 3ULSB 4L3EB 5F89B 4TPRL 3PWNA 1B88A 1IZKA 4W6XB 4M7KL 5GRJH 1U3HD 1EHLH 4QXTA 4F9PA 2FR4B 4Y4FB 5DI8A 1JRHI 1F11A 3WO3B 4L4VE 1JHTB 4PJIF 2VLJB 2HT2D 4KUZH 4NQEB 2MCPL 1CLYL 2AI0H 3GJFB 4MB3A 2R1WB 1EUTA 3DTXB 3O9WA 1MWAL 5DHYB 3AFLA 3FZUC 1G6RB 2MHAB 3VI3E 4OI9A 4KTEH 2Y07L 4NJAL 3VXUE 4PJFB 3T2QA 3U83A 1OF2B 3M1BB 1L9NA 1CK0H 3BVNB 4Z78B 1PG7H 2EDNA 4ZQKA 5IM7B 1JTTA 2UVFA 4OCYL 3WHE0 1U3HA 5BQ7A 1NEZG 4RMTA 2IWGA 3ULUC 4XHQA 1WITA 1OQOA 1WZ1L 2YXFA 4NM8L 5CZKA 3TVMB 4PJXA 5I71C 1QP1A 2HFGL 1I3RA 1MIEH 3TGXA 1ND0A 1FRGH 5DD1L 4KDWA 2GFBA 4QNPF 2A0LC 3ROOA 3WFEL 4YHLL 3MJ7A 5C0NC 4XWGL 4L4VA 1ZGLP 1NUGA 1H3UA 2F54E 4V1DE 5BQ7B 4OUUB 4NUJA 5ISZE 1BAFL 2AXGA 1BBDH 4MXWL 4PREA 3LQAC 3HUJA 5TQ2H 5A40E 5I8EB 4JRXA 4IIQB 5I16A 5J6HA 5CBEA 4PRPD 5EUOF 1ZA3A 4OGXL 3IS0X 3QZWA 3NIGF 2PXYA 4XBPB 1WUNT 1HDMA 3PG2A 1ZHLB 4H5SA 5I1GL 3MUGA 1JPFA 1F6FB 2WP3T 3VG9B 2BP3A 3GMMA 3LEXB 3PXJA 4PJGE 3PHQA 5IF0B 3RWGB 1TZIA 4H25B 1A02N 2VL5B 3AS0A 4NC2B 3RAJL 1UVQA 1NLDH 1CK0L 5DEZA 1HXMB 4DGIL 2QADC 5IEKA 1A1MA 1E4XL 3S88L 2AXFB 1OW0C 5EIQA 4DAGL 1QHPA 3C5JB 4JR9H 4FQJH 4F7TA 3KHOA 3CFBB 2Y25A 4NZUL 3T65B 5KS9A 4MJ4A 4ONGL 4RWYH 3IGAB 3V2AR 5BRZE 4LBEB 1BF2A 2DQCH 3IJSA 1A9BA 5CGYC 5BMFL 3RVXC 3WNOA 4Q74A 2BNQE 3ME0A 2G75B 3CPLA 3LH2L 3DWTA 3BESR 1U2CA 4NZTH 1NCBL 2DQEH 3QRFM 4YDVB 2EIBA 5DVNA 2E6QA 2J2ZA 2NTSP 1Q9KA 2QHLA 3TT3H 4JPKL 3MLWL 1NC4B 4L8CA 2EXWD 5C2BL 1BVZA 3D18A 1MH5B 4IIQC 5ESQA 4LSTL 3MO1A 4JZJA 3QO1A 5DUPL 2PR4L 2V17L 3OGCB 2W1NA 5ALBH 4LAQL 3VXSD 1OARH 2HP4A 4X9HA 5ICYB 5KVEL 2CK2A 1R24A 1A2YA 5GQBA 4Q6IB 4H1LA 1RAMA 2GJZA 3J7HA 4XPHL 1YEHL 1QTYT 3AUVA 4DGYH 2BRRH 4P4KB 3HI5L 2H2SD 6FABH 5IHZA 3CX5J 4RGNC 2YN5A 1EH9A 1Q9LA 3QFJA 5AEAA 5T5FL 3RNQB 3S36X 1NBQA 3OAZH 1OGTB 1ADQL 3BZFA 4JN1H 1N5AA 1BQHG 2HN7B 4HIIA 3X3FH 5JA8B 3RUGB 2AJYH 5ESAB 5GZND 3B9EA 5FHAL 1NFDB 1U8JA 3BP4A 1U8JB 3LN5A 2EDDA 3C8HA 4U6TA 4XGZA 1NCDH 1E28B 1LK3L 4OI8A 4FNLL 4HF5L 4QTHB 4Z7QE 3FT3A 3EDDA 5I76B 2O5YL 2HG5B 5EA0H 1IKNA 1GGCH 3SY0A 4AT6B 4LHJB 2IQAB 1LO3H 3HE6B 4UDUA 2ZOKB 1YNLL 5EU6E 4AL8H 5I1EL 5I1HH 3VE0A 4MQ7A 1H3XA 2BDNH 1X5YA 3NACL 3O3EA 1T3FA 2J5LB 2NW2B 1E4WH 2VN7A 2XWJB 3B83A 5HY9B 2JLLA 4KHXL 3DX7B 4X7CC 3QEGH 3UTTA 4LCCB 1NL0H 4R4FH 3LD8C 4CMHC 1XF4B 3MLZL 1OF2A 3M1BA 1U8QA 1TETH 4OV6F 2FIKA 5GHWL 3L3GA 1CFNA 3EJZC 1CD8A 5D1XA 1FVCA 2BY2A 1XMWA 1I8MA 1OB1A 1C5DB 3LQAH 1S7WA 4KK5D 2NLJA 1UWEL 3D3VE 3VMPA 4ZFFB 5EBGA 1JHTA 5CD3A 3V7AG 4GXVL 1RIHH 3TIEB 5DRXA 5HHMB 5D2NE 1P84K 3CIQA 2Y4SA 1N2RB 1DQJB 4Z7NE 4DN4H 4PJFA 4HH9A 4NN5B 3L3DB 3BE1L 3IU3A 4OQTL 4P2RD 3T0XA 3KXFB 3L95A 5HHOA 4Y1AD 4KRPD 3TF7C 4KVNL 4XVSH 3P3YA 3HS0A 4F7EA 1Q1JH 3GMLB 3F7YB 4GS7C 1AP2B 2NMSA 4ZG1A 5IJVB 1EDQA 1FNFA 4YAQB 4R8WL 4AQOA 5IMMB 3DGGA 4GSDH 5CJ5A 4OZGF 5D2NB 4K23L 4XVJL 1A21A 3EFFA 3MLXH 4U6HA 5ILTH 4JGMA 4KY1H 5D93B 3GSWB 1CI5A 15C8L 2C1OB 4EEEA 4G9FB 4I9WE 5D5ME 5ID1B 2JCCE 5FO7B 3KPQB 4ZUVA 1DQDL 1AXSB 2VDKL 5IF0A 3VG0H 4MNGA 1S7RA 3QUYB 4KI5D 4NRXB 5FKPA 5KS9F 3UTQB 2ZG3A 1UKTA 3LPGA 4WENB 2QLVB 1G7LB 3RPKA 3H2WA 3S3SA 1EX0A 1N6QL 4QRSA 5EDXA 4MA8L 5I73C 8CGTA 3T3PE 3PQYA 5DK2B 5HDQH 3QUKB 3F7YA 3EYQC 3ILQC 1CQKA 4NHUA 5FO7A 3W2DL 1LE5A 3GMMB 3LEXA 3MRFA 5CSBA 5ADPH 2WQRA 5C0GB 4OT1L 4NNPH 5DJXA 3IAGC 2O26U 3CH1A 3VFUA 1A6TA 2PO6A 1KELL 2H32A 5F3HB 3QHZH 4PB0L 1KPVB 3KPPB 5F7MC 3QUYA 4HFWA 2VIRB 1NAKL 5F3BB 4AM0B 1XGUB 2CLVB 5E9DB 5HYJD 1KC5H 1WIUA 4DW2L 1P5UA 4XBGA 3VRJB 3NCCB 4NN7C 1S7XB 4AIXA 4GS7B 3HZVA 3FHQA 3WL9A 4G6FD 1KEGL 1LO2L 2Q76B 1INDH 3H9SB 2VITA 3HE7A 3UJJH 1TVHA 1X5IA 4KQ4L 1DQQB 1XH3A 4X4XB 1T04A 3RY4A 3WIHA 1HWGB 4JB9L 2X6MA 3D2UA 3C8KB 4RIRB 1VKXA 3FTGB 4IHOA 5FYLD 3IJHA 1KYOJ 1YEFL 2B1AL 2ESVE 5IB5B 4ZFOL 5GS1C 3MLVH 3DBXB 5I1DB 3CX5K 2IQ9L 5KW9H 4LVOC 4IJ3C 3VXME 3HRPA 5KSAA 4NKDB 3TJHD 3DO7A 5IMKA 4FG6C 4ODUA 4GFTB 3ZE1F 2D31B 2NY1B 4JKWA 4KZDL 5F7LB 3QR2A 1WISA 2NLJB 1RJYB 4Y7MA 5DJDA 5I75C 1KOAA 2DKUA 1AKJD 3DXAB 1CVRA 5LXGL 3HE6A 2FR4A 5FYJL 2B4CC 2KQMA 2IPUK 4KVNH 4WU5B 4WUUE 1ZS8A 5F7EL 3N9GH 2Q8AH 3HHRB 4WNQB 5JORB 4HKXA 1G1CA 3WFHA 2JB6B 3FT2A 2DLIA 4XPBL 2KPNA 4JFZH 4ZO9A 5DQJA 5JXAH 3WNLA 4LIQH 1MF2L 3G5VB 4ISVB 3U9UA 3VXOA 2VL4A 4H8WH 1PAMA 4IDJL 4P99A 2DMBA 2H2PC 4QKXB 3L3IB 4GBXA 4X6CB 1W0VA 3FRPA 2OK0H 3HNVH 1WIOA 5I1KH 1I4FB 2IH3A 5HYQB 1TCMA 4TNWK 3EFDL 5IGXL 1DBBL 1OTUC 2JIXD 5AUMA 4M7JH 4UV4H 5FECB 3ARDB 1XGYH 5GHWH 3UJIH 2BNQD 1WWCA 1D6VH 5DJ0B 4BZ1H 4MNGB 4JRXD 4XPTH 1SM3L 2X7LB 4BK5A 1AO7A 3BEVB 4GKOA 4NQDA 3IDUA 1XGPA 4AZ8A 3LHPL 3WUWG 2ZPKH 1A6UL 4JFYB 4DKEL 3WCYA 2VXSH 4APQD 2NY4C 2CR3A 5F96L 3FONB 4HHAB 2XY1A 3QO0A 3BUYB 1NCBH 2DQEL 3BUYA 2G2RB 1XIWC 4K7PH 2ARWA 5DC4B 3L3JB 5I1KL 4WUUB 2DWEB 4L4TB 3B43A 3ZKSD 4HF5H 1B9ZA 4L8SC 2J8HA 3KG5A 2XXMB 5DO2C 5KG9A 1ZHNB 2ZOLA 1T80A 3ARFB 5E5RB 4RA3A 1DL7L 3RIAF 1XGPB 4KAQH 1CF8L 4DWHA 4YZFE 4ZO8A 4WI2A 3AS1A 3CCHA 4JKPL 4DOHB 4JFEA 3I2CL 4J3XA 1A6WL 3MMEB 5FYJH 3JTTA 4ZNEA 4JR9L 1T1YA 1ZSDB 1I75A 4HKZB 3IDYB 1U95A 3WE6A 3F6IA 3F5WA 1AHWA 1AGEB 2MMXA 1B3JA 3TA3B 2K9UA 4HUUA 1S3KH 4LCYB 3I6LE 1PY9A 2EYRB 1KXVC 1GGIL 4P3DA 1GPOL 1KCSL 4NQCA 4MNHB 5L9DL 2PW1B 3RZWA 1G0YR 3MRDB 3H9YA 3T2NL 2EC9U 3MA7B 5A1AA 3O4LA 2DYPA 3BP5A 2VH5L 5EH1A 3VU2A 1NUFA 4MNQA 1YEFH 1JGLL 3PGFL 5I73B 1QFWI 2FATL 2AKRA 3QI9A 4AEFA 1LK2A 3SEPA 3GSNB 3BT2H 5JHDB 4PJIE 4CVUA 1GVIA 4S1QL 1KEGH 4O02H 4Z7WA 2SEBB 1NEZB 2SEBA 1A4KA 1EO8L 5JW4R 4J3TA 4GRWE 1Z9OA 1FO0A 3D18B 2FL5B 4NT6B 4PP1C 3IETB 2D3VA 3FO1B 2ZNWA 3IKCA 4ODSH 1JYNA 2AKRB 3QI9B 5D1XC 1B2WL 1JGLH 3PGFH 4PJGB 1Y0LB 2A74B 4E5XA 3MA7A 5KJRL 1PW3A 5CLWA 3MLRH 4HWBL 1N6VA 3MV9D 4HWZA 5AD0B 1S8DA 5JW4M 4FQIH 4GXUN 3OB8A 1TTGA 1NMCC 3C6LA 5FYJU 1F00I 4O2EB 4GW5B 4P2OB 1S7XA 4MVBC 3X3GL 1LEKB 1NSNH 1NGQL 3REVB 4NNXA 2H9GA 3ARBA 3DV4A 1CS6A 1H8NA 5CP3A 3VD9A 5F9WC 3CFBA 4NM4L 1NCWH 1FG2B 3WKML 2ICWB 4PLJD 1NC4D 1N59A 5F7FA 2NXYD 1NBVL 3BH8B 4OF8A 1S78D 4P5MB 4LHQB 1AH1A 3RL1A 4EUPA 4NDMA 1OCWL 4P46C 2DQIL 2X4NA 3QRGL 1R3LA 1KGCE 3TN0C 5IBTH 4OLWL 4H8WC 4O02L 4FABH 2NYYC 1B0GB 1UWGH 3ARVA 2QKIB 3MTRA 3NIDF 1T20B 4GRWB 4V2CB 2C3VB 4Z7UF 3DSFL 2YA0A 4YDVA 3JZ7A 4JQXC 1CE1L 4Z7VA 2AK4A 3IF1A 5DS8B 3V6FA 3OR7A 3VGBA 4LL9A 4I48B 2P49B 1FVCB 3LDBC 1P7KB 2AJXL 4YBQC 2BVQB 4WI3A 5L0QC 4OCYH 3H9HA 4XP4L 1YMME 1B90A 4M7ZB 1S3KL 1HCVA 3KPNB 4IRSA 3LEYL 3V79C 5GRZA 3OR6A 3U9PH 1RK0B 2YD2A 1KF9B 3O4OC 3CLFL 3SGDH 1QQDA 5FHBH 5IB4B 3RWCA 1IAIM 3RWCB 1JGEB 2RJMA 1ZLSH 3SKNA 3L7FB 1K2DA 2VXVL 4LU5L 2Q7YB 3TBWA 2D0FA 5ABDE 4PREB 1FN4B 2Z91A 3RUGF 3L3IA 4C4KT 1BFSA 4YPGB 5T3XE 3NH7L 3T0EA 4Y16C 1KT2A 3FQWB 3QEGL 3RWEA 1ZHLA 2E9WA 4H5SB 5ICXA 1N2RA 4WO4B 4X8JB 5AYUL 3WV0A 1QNZH 3C2AL 4KK6C 1YEEL 4PJDB 5SWSA 2I9LA 5EB9A 5I1HL 1Z9SA 3F7VB 3P40A 4F7EB 2WBKA 1LO3L 2O61B 2O5YH 4AH2A 1WV7T 4MA7H 1I1YA 4FQ2L 1FJ1A 3TO2B 1FSKB 1JWMB 3OSKA 5E2UH 2E7MA 1L6XA 4OLUL 4LGRB 3RDTC 3RJQB 2NR6D 1XGTA 5I30L 3S4SG 3I6KB 2CIKA 2BXZA 4YGVA 4U6XB 4PTTA 3G6JF 4XP1H 3H9ZA 3TBVB 4MCZB 3SDXF 3MV9B 1IGFH 1MCKA 4M5YL 4Y19A 1R3HB 1MQKL 2F53D 5EU3B 1CD1A 2OK0L 3P0YH 5FM5M 1UXSB 1IGTB 4JFEB 4PJ9C 5ALBL