4AL8H

Structure of dengue virus diii in complex with fab 2h12
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
216
structure length
212
Chain Sequence
DVQLVEPGAELVQPGASVKMSCKASGYTFSSYWINWEKQRPGKGLEWIGNIYPGSGTVNYDDKFKSKATLTIDTSSNTAYMQLSSLTSEDSAVYYCTRGGSHAMDYWGQGTSVTVSSAKTTPPSVYPLAPGTGSSVTLGCLVKGYFPESVTVTWNSGSLSSSVHTFPALLQSGLYTMSSSVTVPSSTWPSQTVTCSVAHPASSTTVDKKLEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENVELOPE PROTEIN
publication title Structural Analysis of a Dengue Cross-Reactive Antibody Complexed with Envelope Domain III Reveals the Molecular Basis of Cross-Reactivity.
pubmed doi rcsb
source organism Dengue virus
molecule tags Immune system
total genus 39
structure length 212
sequence length 216
ec nomenclature
pdb deposition date 2012-03-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4al8H01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4al8H02
3FHQA 4KXZH 2X4NA 1KEGH 4LU5L 5C6TL 1QSFD 5F9WB 2C1OB 3MRDA 4DEPC 3QXVA 4TVPL 1ZTXL 1LE5A 5ALBL 5F1SA 5I8KH 5HPMA 4HLZH 5EBMA 4LCWE 4LCUB 4O2EA 5CIPH 5J9PA 4F15B 4YE4L 1NDMA 4D3CH 2VSCA 4X7CC 2H6PB 3C60A 3JWDC 1MJ8L 2FGZA 4P49A 4UI2A 1AY1H 3BQUA 3VI3E 5ADPL 4HIEB 4MD4B 5TDNA 4HBQA 2ZG1A 4FABH 4IMKA 1JPFB 3KPTA 4PJDF 3EYOA 4DGYH 5C0IA 2OR9L 2PYEA 5FYJD 4L3ED 5IK3A 4YNYB 2CDEB 3AS0A 3RVUD 3EHBC 4PP1D 4TVPE 2R56L 1BQHB 4KJYA 3D0VA 3P9WB 2P8MB 1T0NA 4JRYB 3P9LB 4M1CD 2GJZA 4P3WA 4PTTA 5DJ0A 1CF8H 4OLWH 3ARGD 5CEXB 5FUOH 1D5BB 2X1XR 2I25N 2J88L 1T4KA 4GG8B 4YDKH 1VFBB 3HZYB 1QLFB 4P4KD 2BVEA 3FT4B 5E0QA 5BRZB 4WFFD 4JPVL 4K8RH 3MV7B 3NA4A 4Y2DD 3UROR 5ISZB 4M62H 3ZO0A 2DMCA 2JIXB 5IB3A 5IP4A 5EA0L 4O5LH 3IFNH 1BREA 3C5ZB 4FA8A 5I17A 1XGTA 1C08A 3VFOA 1AGFA 1RZJL 5CJOH 3INUL 4PJXA 4YXKL 4YUEH 1D6VL 1UM5L 4JFDD 5CJQH 5JIKA 3QCTL 3U9PH 1IGFH 2XWTA 4EVNA 4Y5VA 4YGVA 4MJ6A 1AIFA 1TPXB 3PGDA 3RY6A 3UX9B 3PDOB 5EU6B 4N8VG 1PY9A 2FLBT 2PW1A 1UWGH 2BNRE 5ACZA 5J6GB 5FYJU 2XKUA 4WHDA 1MNUL 5KVEH 3O6FB 1J05A 2R2CA 5D1XD 4CRPA 2P8PA 3MGOA 1ZLWH 4PRHE 1OGAE 3Q2CA 4LSTL 5GRVL 3VI4E 4M3KB 4UILL 4A6YA 4N0UE 1I1CA 2X09A 4JO4H 3C2AL 5MENA 1JWUB 1RULH 2EH8H 4Z77A 1OOAA 1JYVA 3OKKA 2HFGH 1DBAH 5C08A 5IMMB 5J6HB 2DMKA 1ETZA 3U36B 1EPFA 5HGHB 1P7QD 5K9KA 5FYJL 3KPQA 4NOFA 5F44A 2VDNH 1PEZA 1QSFE 5FYLD 3NCFB 1RSFA 2CIKA 1WCQA 4I0CC 5CJXC 1QEWA 4ODUA 1YUHB 3MLSL 3SDAC 4PJ5A 2QKIB 4PUBL 4W70A 4AG4H 4JVPA 1FVEA 3IDIA 1Q1JH 1C5CL 3LQZB 3QQ9D 2N7AA 1WITA 4NIKB 4Y16B 2W0PA 2FJFA 4XNUH 5T3ZD 5T1DH 1WTGT 4EIGB 3O8XA 2YEZB 2IG2H 5L88H 5HHOA 3F12B 5J06A 5K9QI 1H3UA 1DUYA 1JHTA 2IPUG 3QO0B 5DDHA 4ZS7H 3S5LB 1RZ7L 3LB6C 3HR6A 5DURB 1AD9B 1RZ8B 3PWUB 4PJBE 1KELL 4ZAKA 4L8BB 1KPUB 3GJFK 3T3PE 3QCUH 4WFEE 2VZTA 4U7MA 3GIZH 2Z8WC 1LEGA 3LKSA 2DI9A 2AJ3A 4KKAD 1AO7B 4OCRH 1SMOA 2IAMA 4I0PD 3HPJB 1AFVH 5FO8B 1A1OB 3FO2A 5DQJB 3KS0J 4J3XA 4ZPVA 4CN4A 1CGWA 4JM2F 3T4AA 3IDMB 5TGBB 1INEH 2R4RH 4XX1G 1G9NL 1MH5B 4FXGB 4LLAA 1K6QL 5EPMA 3RQ3A 4PJEA 3RVVD 1OSZA 4P2OA 4WFFE 3O2WL 1JZ5A 3ARRA 1Z3GH 4DKDC 3B6SB 4X6CA 3MMEA 3KPSA 5HYQA 4JFOB 1HHGB 2FBJL 4P46D 3HC3L 2IPKA 4JDVA 2ID5A 2YC1B 2IWGA 4JFDE 2JLLA 4I3SL 3QWRD 3TIDA 1A8JH 4DZBA 2A73A 3MA9L 1LO2H 4JFFB 1WFNA 4UAOB 1QFUL 2J5LB 3CZFB 3GJEB 1IGCL 5HDQH 5FYLL 3ARED 4QGYA 4Z7VF 4IS6A 2J8UB 3QRGL 5KG9A 1IAMA 5ECJE 2YHGA 1AHWC 1I3RA 4PJHA 1I7ZB 2GTZA 3RZCD 5J57B 5LBSL 5DFVC 2A2QT 3PJSA 4LPYA 4JFPA 4OGZA 4HSQA 3KPRD 2V5SA 3SE4A 5D5MA 2GUOA 1AD0A 4ZDHA 5T3ZL 2CGRH 2ICWJ 4PJ7B 4UZGA 4OLXL 1KJVA 4QOKB 4XMPL 3DJ9A 5FFLA 4J3WA 3SKMB 3L95B 2DJSA 3PL6A 4M93B 5KN5B 1G6RA 3MXVL 4GXVH 3KHOA 5ESAB 4AM0A 4MD5A 5HYSG 4NCDA 3VCLB 4NNPL 4MCYB 3ULUF 5HD8D 4PYHA 3WCYA 2SEBA 2GK0B 4GJTB 2EIBA 5ENWB 4KRPD 5HGDA 5B39G 2D0HA 3BEWA 4K3JH 4KAQH 1VEMA 1RMFH 1U6AL 3MLXL 1IC1A 3QUZB 5F89A 3UAJC 2WBJB 1I75A 4J8RB 5DJDA 3RHWF 3CU1A 3DXAA 3WL9B 4EI5B 5TPWH 3QDHA 2QSVA 3ULSA 4K9EL 4U33A 1MPAH 3ZYIA 5IM7A 4MDIA 1CK0L 3TWCL 1I8LC 4FQ2L 5DEGA 3V4VH 4PJ8B 4HUWA 1WFTA 2HLAA 1VKXA 4U3XA 1VENA 4QTIH 4IRJB 2VJXA 1FNEB 4KKNA 1XF2A 3PABA 4JY6B 4NO0B 3TBYB 1E4KA 5T3XH 1NCAL 1CE6B 5JO5B 5I1HH 1RVFH 3F58L 3GSQA 4PBWD 3V6FA 2J8UF 1E4JA 2A6KA 2Y7QA 4J1UA 1KXTB 3HMWH 4KRNA 1VGKB 1XR9B 4XCCL 4KMTH 5BV7L 5LQBH 1HKLL 5SWQB 3SGEH 4HKZB 3DI3B 2R23A 4YFEA 3MCKA 4LVEA 4WI3A 4F7EA 1G6VK 1EO8H 4TTDD 1MRFL 5C0RH 3EFFB 3DURA 5F9DC 3GRWH 1QPXA 1CVRA 1P9MA 3SOBL 4OB5L 4YX2H 1FBIL 4XBEL 1A3LL 2E9WA 3TVMB 1GPOL 4G8EA 1LNUB 5CD5C 2B2XL 1JRHI 5KAQF 4NQVA 2D2OA 1L0QA 1W72A 4DKAA 4K7PL 1MAJA 2ARJQ 4KFZC 5ICZA 4RGNB 5KANG 3BH8A 2J6EH 4YHNA 5CZVL 1U8QA 4PJGA 3WJJA 3ZE0E 3BGMB 3L6FA 4YHOL 3I2CH 1GAFL 1ZLVK 5TH2B 2CK0H 3C6LB 3SGJC 3I75B 5FO7A 3P4MA 2L7JA 1ZEAL 4OZFG 4QXUL 1NGZB 3MLTA 4YDVB 1NBVH 4XC3H 3HR5A 5IG7B 1FE8H 2YPKA 5DUBB 4S10A 4AT6B 4PV9B 1OY3B 5EZLB 4QWWC 2HLFD 1K8IB 1A9BA 3MRJB 1F8TH 2W0KA 4MNGA 5T5NG 5I74C 1MCJA 4XPBL 1J9CT 3CFJB 3L3DB 3K80A 1XF1A 4MX7A 2VXQH 4UDUB 4EXKA 2VE6A 3U30C 4OD2B 4QOKE 2YD7A 5F6IC 5IVXF 2IFGA 4XGZB 2NY7H 2P5EB 2VNCA 4GRWB 1DLHB 2ESVD 5IBTH 1U3HC 3BPCA 3NVQA 3FZUD 3F6LA 5T1LA 2IQ9H 5HHQA 1IARB 2NLJB 1FQ9C 5TE7L 4RRPG 3BP4A 4I18C 5E00A 1N3NA 1QSEE 5AD0B 4M03A 1MFBH 3ARPA 3K0WA 5MEQA 3L7EB 2ZSVB 4JO2L 3MREA 5DI8A 2D03L 2XZCH 1T83C 4KUZH 1IGIH 4JM4L 4NQED 4WV1B 5ACMA 5TE4H 1D5MA 3MJ8A 5C0BA 1G0XA 2VXUH 4HGWA 5DUPL 4AY0A 3KWWA 3P4LA 4XNYL 2R1WB 3VRJA 3LS4L 1YJDL 5EO1A 3VD9A 5B39B 4QRPE 1T5XA 3GMPB 4EQ3A 4Z0BL 5EU4B 3T1WA 4L8SB 1J8KA 3EKCA 5J1TC 2VDOL 2DIBA 1O7SA 4L3CA 3GMNA 1KENH 4JQVA 1CLYL 1K8DB 4LOUD 3PP4L 4XC1L 2R2BB 3FOMB 5DRNA 5D6CA 4F2MA 4YDIL 5IEHA 4RMVA 4MXWL 4DCQA 2Y07L 2Z35A 3NZ8B 2BJML 4LVHB 4F9LC 4KDVA 5I71B 2W91A 2A9NL 4JVUA 3UXFA 1H3XA 5IMOA 1FFNB 2XT1B 1KG0A 1KIRA 5E56A 1VFUA 3ZZ1A 1KCLA 1J18A 4HCRL 4MGXA 1U42A 3AS1A 4I9WD 3CXHK 2VXTL 5EG6C 2VXSH 4YIQA 1RJLB 5ID0A 4I5BB 3HE7B 3MRKA 4X80L 1UA6L 1NC4B 5EFIB 1RZJC 5FA3B 4DN4L 2OTWB 2YOCA 3D3VD 4WUUB 1GCFA 4C83B 4JKWA 4BSVA 4X98A 3BFOA 4BFEA 5DEZA 4GRWF 1IAIL 3BRDA 1YPZB 2JJUA 3ARBA 2HKFL 3RVWC 3VFNB 4WDIA 4PJAB 4ELMB 2BOCB 2IGFL 4LKXA 3QQNA 2G60L 3Q6FB 3ZE2F 3SGKC 4ONGL 4KKBD 5CKGA 1FH5L 4L29A 3MOBH 2L7UA 3FFDA 4KVCL 4Q6IA 5JOEA 4R90H 4KHXL 1QBLL 1S7WB 2FH8A 1FAKT 2IC2A 4ZUTB 3UJTL 2ESVE 3FQXB 4DKFH 1JWMB 4BQBA 3RVUC 3H3PL 5D1QB 2IQAA 3FO0L 2Q76B 4PP1C 2CKBB 5HVHC 3MGTA 4M1CC 1WCBA 4LPCA 4CMMB 2AGJH 1RJZB 4U4BA 2IPTL 1FZKA 3V52H 2YBRA 4LF3A 4KJQD 5I0DA 3MLVH 3REVB 4WU7B 3IDYB 1WAAF 3EYUH 2AP2A 4NHUA 4Y7MA 3GMOB 4I4WA 4P4KC 2Q8AL 3UYOD 4WW2A 2XZAH 3PQYD 5FHAL 5FF6B 2P8LA 4Y2DC 1MCFA 1UWXH 4JG1L 5H94A 1DL7L 3B9VA 3BMVA 5F7MC 3MRNB 1EUTA 2NNAB 3U0WL 1INDL 3SBWA 3MUZ1 5DR5L 3MRLA 3BIKA 5FGSA 3A6CL 4P3CL 4BZYA 1BX2B 3MV8D 2OJEA 1F4WH 4C56A 4FP8H 4NKOB 2CDGB 3C08L 1NMCB 3ILQD 5CMAB 3WXWH 1HINL 1G9NC 3QXUA 5LGHH 4PJAF 4ELMF 5C2UB 5IHZA 1MFAH 1KCSL 3QIBB 2HVKB 3O6ML 1EEYA 3OKDA 1MHEA 2DLTA 2ZUSA 1LO4H 3L3GB 4OJFL 3QFJD 1RZIA 1R3KB 1CDCA 3EDFA 2Y5TB 4XXDA 5GRJH 3HAEB 5GISL 3TYGL 5E8NB 3BT2L 4Y2OA 4OIIL 5IMLA 4HGKC 2C3WA 2W0LA 4HH9A 2CK2A 2YZ8A 2XNAB 3TN0D 4LLDA 1A3RH 3AS3A 2C9AA 4L8DA 3DX7B 1F4YH 3VXOB 4Y4KC 3BH9A 2ED7A 1WT5A 5MI0C 3QQ9C 3OF6A 1E28A 1B0GB 1A21A 2XN9A 3BGAA 5EUOA 4XPTH 5K9OB 4E5XB 3T0DA 3VE0B 1H5BB 4NCC2 2VKWA 1KIQB 3ZYJA 2D7TH 2DICA 1TVHB 4OI7A 3B4NA 4ZFOL 4WI6A 4L1DA 1U8OB 5DVOA 3MX0A 1YPZE 4KZDL 3DSNA 2B0SL 3VFWA 1NLBH 1UXWB 3WNPA 4UINH 1Q38A 3T0XA 1QSZA 2FHCA 2FB4H 1RHFA 5F7EL 2JJTA 1KN4H 4F33B 1W2KT 5DD1H 2BNQE 1YEEL 1AGEB 5D1ZA 4KKAC 4I0PC 1XH3B 1NCBH 4HAGA 5D9SB 1S7SA 3BP6B 2HFTA 3BZ4B 3QT2A 3O3AB 1TJIH 3B5GA 4U05A 1NFIA 3ES6B 1TDQA 3MXWL 3PQYE 2YPVL 3IF1A 3IU4L 1GGCH 4F58L 1ZWIB 3QZWA 4OZHE 3QEGL 4K9EC 2YD9A 4OM1H 4FFYL 1F11A 4P46C 2HKHL 4YFDB 4GSDH 1MJUL 1PQZB 2HVJB 3MNZB 2PUQT 4JHWL 3MV8E 1HNGA 3QO1A 1U92A 4OKVB 5FA4A 3PXJA 1CLOH 1X5FA 1S78D 3LEYL 5CFHA 5I1CH 2VIRB 4Q2ZB 1XFPA 1JCKA 1BQUA 3DROA 4ODTL 3AREC 2EXWD 1SYSA 4G6FB 4H25A 4LCIH 4IOIB 1S3KL 1HQ4A 3QWOA 5FKPB 3O6LH 2R0WL 3TO4A 4ODHL 2K7QA 4D8PA 1OAZH 5BV7C 3GNMH 2XWJB 1F3JB 1QNZH 1MFDL 3O9WA 4Z7UE 2DLGA 2NY3B 3W9DB 1IAOA 2Q8BL 4G6JH 3D69A 4GRMB 2EEDA 2VUYA 1S8DA 4NT6A 4XVUD 5DD5H 1CTOA 3SKOB 2I9LB 4ZUSB 4KQ4L 4NN7B 6FABH 3QDMD 3MBEA 4RWYL 1R5WA 2JB6A 2XQYG 4P5TC 4R96B 4WFHD 2F9BT 3QUYC 5B21A 1HEZA 3I9GL 3RKDC 4DK6A 5HD8C 5HHVL 3G5ZA 3RGVA 3VGHA 4MAYB 4ZUWB 3GMLA 1A6VH 2ZSWB 3QUML 4GW5B 3IDJA 2XA8L 2BOBA 5C0CA 4JRXA 2DRUA 4NZUH 3P0YL 2E9BA 1OPGL 2WWMD 1T1WB 4FS0A 4WU5A 2KKQA 3RWCA 3LDBC 3MCLH 5HTSA 1A7PH 3VMNA 4BFIA 1P69B 5GRWA 4DK3A 4Q6YA 3UTSB 3MNVB 4ZXBD 1FFQA 1C5BH 3FB7A 2EH7L 1MI5D 1VA9A 4XPAL 2VZSA 5CIPA 4NC1E 1BBJB 1MEXH 4LHUB 1MFEL 2GSGA 4I77H 1UH3A 3NGBB 4S2SA 43CAA 4OM0H 3MACH 2O5ZH 3WS6A 3GSVB 2F53A 2VLLB 4Z78A 3QNXA 1J1OH 3RWEB 1DBML 3D25B 2B5IC 5H37H 2RBLA 4Y4HA 1VHPA 4C4KO 4K71C 3QI9B 1LWRA 3S3JA 3PWPA 4NM4L 1S7VB 1PG7H 1AE6L 3KPMA 4TTDC 5JLZA 4N1HB 3B5HA 3W0WA 1A4JA 5A16B 5DZLA 5KW9H 2CLRA 1O5DT 1BWWA 5D7LA 3VFGH 2H32B 2X9XA 3GMRA 3S37H 1I8KA 4YQXH 3DMMD 1KGCD 5F97E 3LKNB 3DPBA 1YJDC 2PO6D 3CIQA 4JGMA 3FHAA 5FOJA 4RAVA 1WIOA 3MJ6A 3O3EB 2BRRL 4N0FB 5CGYD 1C5DA 3SE9H 5MP6H 2HFFA 5IV2A 1B0RA 4GRLD 4OLZL 4ZNCD 1CXLA 5GS2H 2ITDB 1ZVSB 3JVGA 1FP5A 5I16B 2KZWA 4JDTH 1JFQL 3QDME 2DQCH 4CU6A 3SGDH 1FN4B 5EOTA 4WFHE 3WO3B 1RUKH 2P42B 1J88A 4XWOD 4MJIE 5C0EB 2FSEA 1XIWC 1KJ2B 4CVZB 4U3HA 3GSXB 4YZFE 2HLFC 3VXMD 1BJMA 2JF1A 3MOAH 3N1PC 4QHMA 1B2WL 4MD0A 5H35A 4XBGA 3U79A 3QA3A 1CL7H 3CXHJ 4FXKA 2R1YB 4U1SB 3FN3A 4WTZG 1EAJA 1DQDL 1UH4A 3GI8H 3T0BA 4XNQA 3RWHA 4PRIA 2BVPB 1BGXL 4PV8A 3EAKA 1QQDA 2G75A 3N06B 4QHLA 3AFLA 1UJTA 4LU5H 5C6TH 4YHYC 3FZUC 3T2OA 2E27L 1EEZB 2OQJB 1ZTXH 2R0LH 1OVZA 2VDRL 4Q7DA 5ALBH 5IQ7H 3IKCA 3MRFB 1BD2A 5CBEB 1EJ6A 1FSKC 2DLFL 4XH2B 4YE4H 1KNOA 3NOIA 3BN3B 1IC7L 3IGAB 2X4NB 1MJ8H 5B22A 4OF6A 3MRDB 5E9DB 1KLGA 4ZFZA 1B9ZA 3HG1A 1LE5B 5AUMA 3EJJX 3RIFK 5HSFA 5HPMB 4JLRB 4KZEL 4O2EB 5J9PB 1UYWL 1FZJA 2IALA 3X3GL 5F9OL 2RGSA 3C60B 1EXUA 3BQUB 4U1JA 5TDNB 4P2RE 1K5NB 5GJTL 3V8OA 2GAZA 3AXLA 3SKUD 2AABL 4LIQL 2I24N 3EYOB 2D7OA 1MCWW 1N26A 2GQHA 3T0ED 5C0IB 1D9KA 2PYEB 1FJ1A 2J88H 5IK3B 5D8JL 2Q20A 3BP7A 1F02I 1M6OA 1ZT1A 2C3VA 4X5LA 2RQ8A 2WP3O 5HDOA 4KJYB 3D0VB 4JPVH 1T0NB 5DJ0B 4KTEL 2GJZB 4PTTB 5LWYL 5M94B 4C58B 3MUGA 5EA0H 2NY6B 1YNTA 3HUJA 4E9LA 4MLIA 1YNLL 2EIZA 5HI3C 1SYVB 1T4KB 1RZJH 3INUH 2V6HA 4YXKH 2BX5A 1UM5H 4GBXD 3QCTH 2YZ1A 3VGFA 3UCRA 4K07A 4Z7QF 6CGTA 3LEVL 5FYKU 3WIHH 1F3DJ 1N8ZB 3ULVF 5IB3B 3AY4C 3UJJL 3EJZD 4MNHA 3OGCA 2DQFA 3ARFD 1B90A 5I17B 1XGTB 1SJVA 1C08B 2QQNL 1MNUH 1QSVA 1AGFB 3VFOB 2BXYA 3NN8A 4PJXB 4JB9H 4YXHL 1CN4A 4KKBC 3RPIA 3VXME 4YC2B 4EVNB 3DHMA 4Y5VB 4YBLB 4XP1L 4LSTH 4MJ6B 4UILH 4U31A 1AIFB 3PGDB 1L9NA 3B9DA 2PW1B 5ACZB 3C2AH 1JF1A 4KUCF 1BOGA 3GBML 1E6OL 1YECL 4L9DA 1J05B 4LEXL 1J1XL 2P8PB 3QNYA 1RD6A 3MGOB 1DVFD 2XRAH 3LRGA 1YN7A 5FYJH 5CKAA 4FQXD 2BVOA 5FAAA 4A6YB 2EIEA 1WFOA 5ID1A 3MZTA 5F7NC 4XPHL 3RNKA 5FECA 3UPCA 4M1GL 1CE1L 4NNYA 3T0WA 5GGSA 5J12B 5I6XC 5D2LE 3MLSH 4Z77B 4PUBH 1G1YA 2EDDA 3OKKB 2G5RA 5C08B 1XF5A 1ZANL 1JHKL 1T7VA 4KJQC 2CR6A 1C5CH 1ETZB 4E41D 3TZVD 1Q9OB 4P9HL 3TT3L 5K9KB 1P7HL 3KPQB 3D0LB 2Y1VA 5EZJA 2CIKB 5EIIA 1CGXA 1YC8A 1QEWB 2EICA 4ODUB 4LRIC 3FB5A 4PJ5B 5FGCB 5LGJB 2EDOA 5F7UA 3HZVA 1FVEB 3IDIB 4MMXC 4P59L 4OF5A 1JGVL 3TV3L 1RIVL 2BY0A 1BHGA 1KELH 2FJFB 1DQML 1RJYA 3O81A 1EVUA 3O8XB 4XCYA 3OQ3B 2X1PA 1DUYB 1JHTB 3ILQC 4MCZB 3T0EE 4NN6B 5AAWA 2OZ4L 5DDHB 2ZNWA 5E9DE 1G9NH 1K6QH 3MLZH 3MRIB 1WWWX 2IFFL 3STBA 3O2WH 1LEGB 1PD6A 3ARZA 5E8EA 3LKSB 3I6GA 2AJ3B 4C57C 1FGNL 2IAMB 1IQWH 5DXWA 1J0ZA 5C0AD 2B39A 3FO2B 3NIGE 4ZPVB 4APQA 3T4AB 2VTFA 5E70A 5IOPA 3IJHA 3KPPA 3CFKA 4JGUA 2YA1A 4PJEB 3MA9H 1OSZB 1OT2A 4P2OB 3TYFB 1QFUH 4RGMB 4AEEA 1I1YA 3TN0C 2RCSL 1BECA 1IGCH 3MMEB 3KPSB 3OB0H 1FC2D 1BFSA 1PSKL 1NGPL 5FYLH 5HYQB 5IT2H 1MREL 4XT1C 1DN0A 2IPKB 1IQDA 4JDVB 4LLYA 3QRGH 5DTFA 1HHJA 3TIDB 5E24E 4MB4A 4DZBB 1NUGA 4PG2C 2A73B 4YPJA 3D9AH 1I1RA 3ARXA 5LBSH 4YHIA 2J6EA 3U0TB 2A6DA 2AJYH 3AM8C 2DQIH 4HW6A 4IS6B 5T3ZH 5HJ3A 4FMKA 4OLXH 4PJCA 4XMPH 2NTFA 4GAYA 5DJCB 5KG9B 2X89A 1ORQA 1I3RB 4PJHB 2GTZB 3FKUS 5F7LB 4ZOBA 1SY6A 1FNLA 4H20L 3PJSB 3VXTA 4JFPB 3RHWK 5CEZD 2XOTA 1KYOK 5TF1L 1L9MA 5D5MB 2GUOB 1AD0B 2X41A 4ZDHB 1U93A 2OJZH 1BFTA 4NC1C 1KJVB 1UEYA 3CLFL 1OTSD 1XMWA 1KB5A 3S4SG 1U6AH 3PL6B 4DKEL 3MLXH 3MV7D 1G6RB 4AM0B 1A6ZA 2DYPD 4MD5B 5EC2A 2ERJC 3DOSA 3RIAF 1B88A 1QPPA 3QEHA 4GQ9L 2SEBB 4J4PA 4K9EH 5HGDB 2AEIT 3BEWB 4X6DE 1CK0H 5GJSL 3TWCH 3Q1SL 1CDBA 3TEUA 4NO5A 4CU8A 4ONHA 5F89B 1I9RL 4HC1L 4JM2D 5DJDB 3DXAB 4PJEF 3ARDD 1S78C 1NCAH 1KPRA 5IM7B 4MDIB 3F58H 4X6CF 2EXWC 2AJVL 5DEGB 1FZMB 2WLZA 3BESR 2HLAB 1VKXB 3N50A 3C6SA 4HIXL 2LVCA 4P3DA 4KGJA 1XF2B 3OL2A 3PABB 2YR3A 2EE6A 5BV7H 3LRSA 1HKLH 1FVDA 2E9JA 4FOMA 4LHJB 2QR0A 1JPSL 3FO1A 3BJLA 5SWZA 5EORL 3FQUA 1SJHA 3V6FB 4XVUC 4IIQC 3ZT5A 2A6KB 2Y7QB 4J1UB 5KSVA 3PV7A 5L6YH 1HDMA 1A22B 2HG5A 3I6KA 3O4OC 5IFJA 3SOBH 4G3YH 5CEZL 2C4XA 4OB5H 2R23B 3MCKB 1FBIH 2JJSC 4XBEH 5D5MF 4F7EB 1A3LH 3H7BA 4Y16D 3GBLA 4K7PH 4LLWA 3DURB 3TCXA 1JNHA 5CZVH 1DCLA 2EDTA 4RX4A 1F13A 2WWMC 4YHOH 4ZPTA 5KS9A 4YEFA 1QFWM 1ZEAH 1ZS8A 4G8EB 2D9CA 1IVLA 1FIGL 2VQUA 4OIAA 4QXUH 3ULUD 3Q5TA 1W72B 4Y19E 4ZXBC 5ICZB 1J8HA 5CEZE 1AO7D 1X5JA 3BH8B 3BIBX 4YHNB 1U8QB 3L6FB 3RBSA 1NDGB 4CN1A 5FO7B 4PRNA 4NBYB 4Y1AA 1KCRH 3A6OA 4JO3H 3GJFH 4YDJB 4XPBH 5DHVA 3VXUA 3T8XA 4RMQA 5GRYA 3MLTB 5J7CC 1TMCB 1TVBA 5EH1A 3HR5B 4D0CA 2VISB 3WFZA 3NTCH 3F62A 2C1PA 5FM5M 3CFBA 3Q3GA 1A9BB 4MNGB 2Z31A 5LKNA 4YAQA 3PF2A 4RWHA 4MX7B 3VXSE 3VD4A 1ADQA 2VE6B 2CUMA 4UV7L 5TE7H 1P4IL 3FMGL 4G8IA 5L7XL 4XCFL 3G5VB 1F4HA 4LP5A 4JO2H 2C3HA 4ZSOE 4OCXH 2D03H 5KVFL 3OAUL 4JM4H 1LO5A 2FR4A 3BPCB 3T09A 2FJGA 1TQCB 2FIKA 2WBKA 5DUPH 1NCNA 5T1LB 5HHQB 4DQOL 2PO6C 4MHHG 1YJDH 1D7FA 1ZT4A 3D48R 4X6EA 5E00B 1N3NB 4PYGA 2AK4E 4Z0BH 3VXNA 5CGYC 2VDOH 3MREB 4GRLC 5DI8B 3AMLA 3MYJA 4TNWF 1CLYH 3PP4H 3VMOA 4B7IA 1D5MB 4XC1H 3MJ8B 5C0BB 1EDQA 1G0DA 4R4NC 4HGWB 3RAJH 1HCVA 3KWWB 3VWKD 4YDIH 4JFHD 4MA1B 3ULUL 4MXWH 1UM6L 5GGTA 2Y07H 5EO1B 2BJMH 3WFEL 3ORJA 1LP9A 3X17A 1QR1B 1T5XB 2A9NH 5I1IL 4L3CB 4NZDA 3R1GH 4XWOC 4JR9L 4MZ2A 3OKEA 1WISA 4PJGF 3QISA 1F5WA 3QXAA 3ZKND 4ALAL 5I1GL 3PWNA 2YUWA 3QUZD 1P5VA 4HCRH 5DRNB 4GMSL 5D6CB 4F2MB 1QRNA 3SDCC 5I75B 4DCQB 2Z35B 4L4TA 2DQEL 1RURL 1T2XA 3NAAL 4NFCA 4EI5D 5C1MB 4X80H 1UA6H 4HWBL 5IMOB 3JUYA 3N9GL 4DN4H 3O4LD 1KG0B 2X10A 1KIRB 3IDXL 4PJ8D 3EZ8A 1QD0A 3SDXA 5I8CA 2FDBP 4IRJD 1IAIH 3DETD 4YIQB 4NO0D 5ID0B 3KYNA 3MRKB 4NKMB 5CJXA 3AB0B 4A2MA 2IGFH 3SDAA 2J3SA 1NMBL 4H8WH 5D7IA 1A2YB 2QADB 4PG9A 3RA7L 4RFNB 4BSVB 4C55A 1PLGL 3FQRA 2Z8VC 1FH5H 1P84K 4XHJD 4HJGA 3QEQE 3ARBB 1CU4H 3JTSA 4KVCH 4WDIB 3WHE0 2QSCH 3ROLA 1C12A 4LKXB 4KHXH 3OZ9L 1QBLH 4ODWA 3WNMA 1BZ9A 1NAML 3UJTH 1UG9A 1KT2A 4PGCA 5IJKC 5DJXA 2EYSA 1FG9C 1PKQE 2IADA 4L29B 4PFEA 4MQTB 3FFDB 4I3GA 1KULA 4Q6IB 3WN5A 4UT6L 2IPTH 4NJAL 1FNSL 2HH0L 1WBZA 4JREC 3S35L 3L9RA 1WFUA 1NGXA 3HS0A 2FZ3B 3QJFA 4P9HC 4TOYL 3T0EC 3ZTJH 3FT3A 1A64A 3Q6GH 1UGNA 2IQAB 5SX4I 1IEHA 5FCSH 2Q8AH 5FHAH 3MGTB 1WCBB 4JG1H 1DP0A 1IKNC 1L6XA 1TZHA 1DL7H 5FGBA 3X11A 1Q0YH 1FZKB 2YBRB 5L2JA 3C6LD 3F8UB 4LF3B 5D7JC 3VJ6A 5F7FA 3D85A 5GIRA 1OAYL 3U0WH 1INDH 4KMLB 2F54D 5DR5H 4NHUB 2X1WL 4I4WB 3A6CH 4WW2B 1TZGL 4DTGL 2P8LB 4L3AA 5H94B 5L8KB 1QFPA 1ZOXA 1ZLVH 1VADA 3RWFB 3C08H 4EOWL 3EJZC 3MLWL 1MLBA 5DVNA 5F3HA 1JVKA 1N5AA 2HT4C 2W59A 1HINH 1YEIH 1DSFL 5EIVA 1IEBA 3Q0HA 4XPFL 1KCSH 3MRCA 1AHWA 3UYPA 3BIKB 3O6MH 3TNNA 2OJEB 5L2KE 1XGYL 4OJFH 1NFKA 3KR3L 1DBBL 3O3DA 2MNUA 3G6JA 3LS5L 4POZC 3O4LE 4FN0A 5GGRA 3REWA 5DJ8A 4Z7NF 4NHCL 5GISH 1I3UA 3TYGH 3KHQA 5IHZB 1NMAL 3BT2H 4JJ5A 4OIIH 2NXYB 5EO0A 1BBDL 1EEYB 4Y4FD 4ELKA 5GHWL 1JPST 1RZIB 5SX5K 3CVHB 1QYGL 5IHBA 3O3UN 5M95B 4XXDB 2VLJA 3GKWL 1VEOA 2QTEA 3V4UL 3CPLA 1F42A 3SEPA 3TZVC 1VACB 3EUUA 4HH9B 4OLUL 3QB7C 4LLDB 3OAYH 1ZLUH 1DANU 4L8DB 4G8GB 4AJ0A 1G7IA 1U8KB 3BH9B 3LKOA 4KZDH 2B0SH 1E28B 2XN9B 4X4MA 1BIHA 5F7EH 2B1AL 5FHBL 4O2CA 4XB8A 1KYOJ 4WW2F 4G42B 4D0BA 5JR1H 1CDIA 2UWEA 4N68A 4OSUL 5HDBF 1T03L 3VFWB 3BJ91 1FIEA 2X4TA 4PR5A 1AC6A 5E8DL 2DL9A 3GGWA 4UT9L 4NWTL 3RJQB 1XCTA 3LN4A 3HE7D 2YPVH 3IU4H 4F58H 1DFBL 1NC4D 2XFXB 2OL3L 3VG9B 4XX1E 3QEGH 5E6ZA 3B83A 4N0CD 2FL5A 4WUUD 5IBUB 2R8SH 4LSSH 1S7SB 5JXAH 1Z0NA 2Q87A 5IVNA 2HKHH 4U6YA 4HKJA 1Z9LA 1MJUH 2F54E 4I2XB 4JCLA 2BDNL 4WEMB 4LSVL 4AENB 1HOCA 1NFIB 2NY1B 4UQ2B 4JHWH 3QZWB 3QDGE 3MV11 1CQKA 1Q8MA 3LEYH 5AZEL 3V7AE 1F6FB 4ODTH 1SQ2N 1F11B 4WGVB 1S3KH 2UYLA 2OTPA 5CP3H 1CBVL 4NP4L 2R0WH 4UIKL 4WRLA 1EHLL 4JFXA 4ODHH 2HWZL 4Z7OF 3A67H 3QO1B 1U92B 4JAMA 4M5ZL 4TUJA 3UYRH 1MFDH 4QXTA 1T2QL 2ZCLL 4NRYA 2WV3A 4M6OL 4LSPH 2P48B 2Q8BH 2ZG2A 4PJFF 4KMQA 2DM7A 2Y36L 1SYSB 4H25B 2X9YA 3SGJA 5E99L 3C5SA 1UZ6E 1HQ4B 3QWOB 5MEPA 5F7DA 3TO4B 4KQ4H 4D8PB 4RWYH 4U7KA 3O9WB 5MHSE 3I9GH 1JZ8A 1IAOB 5EUOF 5E95B 4D2NA 1N59A 3D69B 1YZZA 1EJOH 4DFHA 1S8DB 4LCCA 5IEKA 4NT6B 1OTSC 1MOEA 3MPCA 3IDUA 3MRMA 3QUMH 1NCUA 2W9EL 2XA8H 2H45A 3MBEB 4MHHI 3UC0L 4GAJL 1U0QA 2H1PL 2AEQL 3P0YH 1R5WB 3FCTA 2R69L 2JB6B 4AYFA 1OPGH 5E5RB 3RGVB 2YWZA 5ANME 2ZUQB 3Q5OA 2B1HH 4C59B 1VPOL 1U3HA 3HKFA 5AYUL 4LEOA 3IDJB 5KZCD 3TM6A 4PRAB 2BOBB 5C0CB 4WHYG 3W11D 5E03A 1O0VA 5HYJE 2YPLD 3S7GA 2E7LC 1KPVA 4JM2C 4TPRH 3TBSA 4I18A 4XPAH 3CDGA 4WU5B 5D2NE 3ARDC 4WTWA 3RWCB 2W1NA 5DEFA 2NW2A 4X4XA 1A47A 4TSCL 4FQQA 1I1AC 4X9GA 3U46A 4GOSA 2VWEE 3BE1L 4G8GE 1BAFL 1NBYA 3FB7B 3JV6B 3L3HA 1DBMH 1MHPH 2VDML 3OKMA 4HQQL 5CIPB 4EDWL 4M61A 4FQIH 3BPOB 4S2SB 43CAB 4NM4H 4M4PA 2F53B 4Z78B 3QNXB 2ZPKL 4L8CB 4LPWA 3G9VA 3RI5F 5FUCC 4Y4HB 2BNRA 2ITCA 5DRWA 1A7RL 5JXED 2H9GA 3DX9A 4GKOA 2J7LA 3PWPB 3GMQA 5E2JA 2KH2B 3HI6L 4PRHA 1OGAA 3KPMB 4EEEA 3W0WB 1I85C 3HTLX 1A4JB 4N0UA 2JE8A 2EE3A 2BRRH 3QUXC 3NCBB 4OLZH 4I2XE 4OCNC 5D7LB 4HIHA 4UOJA 3GMRB 1I8KB 1N64L 1JPGA 2QLVB 4DFIA 3ULUC 5J1AA 5DQ9A 4NO3B 4HDIA 5HPOA 1QSFA 4RAVB 4MWFA 1S7TA 3B8SA 1C5DB 4EUPA 3CLEL 1IJ9A 4DZ8A 1B0RB 2NX5E 5IV2B 3RVTD 1S7RA 5D93C 3SGKA 35C8L 1B3JA 4QXGH 1I8MA 3N1QC 3S3SA 2WUCH 1B2WH 5KOVC 1JYWA 5EOTB 3DHJA 3FT2A 2EYRA 2YXMA 1G9EA 1DQDH 3SO5A 2FSEB 5ERWA 1Y6NR 4WFGE 3WIFA 1BGXH 2VR9A 4JFYA 4QHMB 4MD0B 4XBGB 3S36L 3QA3B 5DD0H 4PJBA 4FXKB 2E27H 2J5LC 2GSIA 4OCWL 4JJHA 2YK1L 3E3QE 5EC1B 5IBLD 2DLFH 4XNQB 1RZKL 2H6PA 3RWHB 2H3NA 4PRIB 1KEGL 4PV8B 1IC7H 1QQDB 2XKNA 3S96A 1EFXA 3SPVA 1EV2E 5DFWH 1JGLL 1FCCA 4HFWA 3S9DB 5JW3L 4LLUA 1A4KA 3ZT7A 1U58A 4Y2DA 3IKCB 2G5BA 4HJ0D 4I48A 4KZEH 1BD2B 5D72L 2O5YL 3EOYG 3T08A 4M8VA 1UYWH 5E7FA 1KNOB 3X3GH 1BQHA 5F9OH 1VEPA 2VC2L 3H9SE 2ZNXA 4JFDA 2P8MA 3QXWA 4JRYA 4JZJB 4KXZI 1BOYA 1KLGB 3VWKC 1IGJA 4ZFZB 4BH8A 5CEXA 3HG1B 2I07B 4UOW0 3BPLC 5AUMB 5GJTH 4DGYL 4XPGL 2AABH 4JEGB 4LIQH 4MAYD 3QAZB 4X7EC 1QFOA 2VZVA 1FZJB 2R2HA 4ORZC 2IALB 3FT4A 1YEFL 2RAMA 4M48L 3N0PB 5CD3A 3ZKNC 4TTGA 1EXUB 4U1JB 3FN9A 4OLWL 5GS1C 3BD4A 4NQDD 2MCPL 2V7NA 1NC2D 5CAYB 2GAZB 3AXLB 2W9DL 4EI5C 2VDKL 1YNLH 1D9KB 1FJ1B 1FAIL 4ODSL 5BO1L 1NGQL 1M6OB 2A9ML 3UTSD 1ZT1B 2C3VB 4M62L 1P7QA 3LEVH 4LKCB 3BEVA 3IFNL 4H1LG 3UJJH 1YNTB 5CJOL 3HUJB 1EA9C 2AJXL 4HZLB 4YUEL 4XP9L 2G9HA 2EIZB 4Y4KA 1XF4A 5IUSA 2ADIB 3MJ9A 1TQBB 4XP1H 4XVJL 1WIPA 2BFVL 5GZOD 1UWGL 2JK5A 3QPXL 5E4EB 4XHJC 4F80A 4PB9H 1N0LA 2W0FA 5JQHC 5KVEL 5B38A 4MNHB 1HYSC 3OGCB 2DQFB 1A0QL 5IMMA 5DF0A 2X4RA 2F8OA 3GBMH 1E6OH 1YECH 3NN8B 4LEXH 1PKOA 1J1XH 3PWJA 3RPIB 5IMKA 3GFUA 4XP6L 2GJ6E 1QA9A 3VFMA 1MSPA 1ITCA 2A83A 4XPHH 2EH8L 3VWJB 4M1GH 1CE1H 3P0GB 1JF1B 2X1QA 3SKJH 2H2SD 3DUHA 1BOGB 5T5FH 5DJYA 1EX0A 4I0PA 1JHKH 5CSGA 4GG6E 3QNYB 1XGQA 4RBPH 4P9HH 1YN7B 3TT3H 2BNUA 3MZGB 1A6UL 2BVOB 4CBPA 4PIRF 5ID1B 2BY2A 3RNKB 5GPRA 5FECB 1I1FA 1LILA 2Q86B 3F12A 4NNYB 5GGSB 4AG4L 4R2GD 5GGRY 1QKZL 5I2IB 4QGTA 1XF5B 2PF6A 3KLSA 1BVLA 3PWUA 4P46A 3TV3H 1JGVH 2CLZA 1RIVH 5J1SC 3K1DA 3BWAB 3KYOA 5EZJB 4GFTB 5EIIB 1DQMH 3V5DA 2IG2L 3PHOA 1NUFA 3B43A 3FB5B 4ZS7L 4FTVE 4FQ1H 3HZVB 3AREA 4K2UL 2Y06H 5JPNA 3HUJF 3HCVA 2B4CL 4JKLA 2VQTA 1H8NA 3OB8A 1P5UA 3W5MA 5GRZA 3TESA 1RJYB 4NQDE 4P2CG 2IFFH 3HLAA 1P53A 1XZ0A 5CHNA 3GKZA 1FGNH 4XCYB 1SEQL 2DQGL 5HYIA 4HMEA 3BWUC 4HD9A 3STLA 3U2SB 1GGBL 5HI5D 2EDLA 4XBPA 4W81A 3GJEA 5TDOA 2Q1EA 5J89A 4Y4FC 1RK1B 3QXDA 2ZOLA 5E8EB 3I6GB 2RCSH 3TPUA 1CXHA 4B7LA 4P5TA 2CXKA 3QUYA 1PSKH 1NGPH 5I8OL 1MREH 2V9RA 1MCWM 4APQB 1WZ1L 3IJHB 4PLJD 5IOPB 5CSZA 3KPPB 2FX9L 3CFKB 3ILPA 4KUCD 5A3IC 3EO9H 4LRNL 1I1YB 2X7LA 5EOCL 4R9HA 5FGRA 2F5BL 1CDJA 1FVCA 1HHHA 5JDJA 4QOKA 1AGCB 1CFTA 2VITA 1IQDB 4LLYB 3C60D 5DTFB 1HHJB 1GZQB 3BQUD 3JZ7A 4FFWD 2EZ0D 4H20H 4YHIB 3RIAK 1FORL 3F6IA 3K1KC 2A6DB 5TF1H 1P4BH 5F96L 3QIUA 2PYED 5D2NC 5HJ3B 4XAKD 1QSEA 3WLWC 4PJCB 4HUUA 2NTFB 1J87A 3CLFH 4GAYB 4MJ2A 1ORQB 1Q0XL 1RK0A 3H9ZA 1DTUA 2VWEC 3VXTB 2VZ3A 1SVCP 2DBLL 4GQ9H 4BFBD 4QRPA 3ESVF 1U93B 2VDPL 1FLRL 1JGDA 4N0CC 1G9ML 1CFSA 3Q1SH 4Q9QL 2O93L 3PIQA 1KB5B 2Z91B 3V6ZA 3NFSL 4N8CL 4HEME 1A6ZB 4PLOB 1I9RH 1YA5A 4JPKL 5EC2B 3TBYA 2ZJSL 2JTDA 3QEHB 1VFAB 4N90D 3GM0A 2GJJA 4O9HL 1TETH 3CDFA 4N9GB 3F65A 1JMZA 3BVNA 4HBCH 3MLYH 2QQLL 4QTIL 1CDGA 1U2CA 2AJVH 4EDXA 5H8DA 3ZHDA 1OAKL 3HB3C 4NO5B 4ONHB 1S9YA 3H3BC 3K81A 3FRPA 4HIXH 2OMBA 1DDHA 3L3JB 1BIIB 1WUNT 2NY5H 5KVDL 3VGBA 4HMDA 4Z7QE 1KPRB 1JPSH 3MRRA 4QHKI 3KPNA 1G1CA 3RDTD 4YK4C 1S7UA 2ADGA 3C6SB 4P3DB 1NEZB 3X14A 5LQBL 3NPSC 2WIIA 5MEND 1R3HA 4DOHE 2EDFA 2Z0BA 1KCVL 1KTKE 3LRSB 1FVDB 5CEZH 2QR0B 1XIWA 3FO1B 3VGAB 2NYYD 5SWZB 3FQUB 1SJHB 2XWBA 5T3XE 3RWGA 3GRWL 4MNQD 4Q74A 3K46A 1EMTL 5KSVB 1LDPL 5T1KA 1HDMB 2DWEA 3I6KB 4FQHB 5IFJB 3LVEA 2X1OA 1CFVL 3I3DA 3VH8A 1EGJA 3SGEI 3WBDA 2ADJA 1FIGH 2ESVA 4K3EL 1E27A 1CXKA 4X4YA 1T80A 3W11C 5DUBA 4M6AA 4YBQD 3G08A 1OAUL 1SBBA 5HHOD 2HJKA 1K8IA 1DE4A 4ZPTB 1T1ZA 5KS9B 2Q7YA 3E3QC 4EBQL 2P46B 1WGOA 4ZAKD 4DEPB 1TNMA 1J8HB 4LAJH 2C4FU 5FIEA 1Y6KR 2IAMD 2YRZA 1CFNA 1IEAB 3W39A 4HT1L 4RSVA 3VFUA 1F4XL 2X9WA 1UEMA 4PRNB 5TE6L 4KK8D 4Y1AB 1TLKA 2UZIL 4H88H 3B3IA 2PETA 5DHVB 5EULV 3VXUB 3T8XB 4A6YL 1RIHL 2EDBA 5EB9A 1CIUA 4UV7H 2GT9B 1TVBB 3KPSD 3L7EA 2NY7L 4D0CB 4QRSA 4DUVA 4TQEL 3STZA 5L7XH 2AV1A 3IDGA 4XCFH 4LMQI 1A1MA 1RZKC 3LSOA 2C1PB 4U1MA 2OR8A 1X5HA 3Q3GB 2VAJA 4FQPA 5JXEC 5KVFH 3OAUH 4Y8DC 2R1WA 4YAQB 5JHDE 3CJJA 2WINA 4V1DD 1MJJA 5IB4A 3DUUA 4G8IB 4DUXA 3LPGA 4NM8H 5TE4L 1DQQA 1HXMA 4KHTL 4OFDA 5LCVL 3UPRA 1B4JL 2FR4B 1LO5B 2FJGB 2FIKB 3VXQA 2XI9A 3TT1L 3E0GA 5I9QB 5AAMA 3BUYA 4FMFA 3DGCR 3ULUH 1UM6H 1CFBA 2XG4A 3V9FA 5MENE 1ZT4B 4X6EB 1FFNA 3WFEH 4KGLA 3AY4A 4QRUA 3PHSA 3VXNB 5I1IH 4QRTA 3RVTC 2MMXA 2VZOA 4YJZL 4QCIA 5KS9F 4KVNL 1MLCA 1CICD 1CXIA 4GMSH 4MNQE 1WJ3A 1CD9B 3EYVA 3RU8L 1LP9B 1QVOA 3NAAH 2OTWA 5IESL 5I1DA 4HWBH 5JW4Q 3LAFA 3N9GH 4C83A 3UTTD 3WFBL 3IDXH 2PXYA 3DSFL 2RFXA 5EU7E 3QXAB 1YPZA 3PWNB 2M26A 3OHXA 2FLRT 3DXAD 4L4TB 2GIYA 5C07E 4XXCC 1TNNA 2BNQA 2XXMB 5IBLC 5ETUA 4EN3D 3SDXB 2FECI 5I8CB 3O0RL 3AVEA 2OYPA 1MCBA 4ZUVA 5LGKA 2J4WL 1NJ9B 2RJMA 1NLDH 4X9BA 3KYNB 3PQYA 4LASL 2Z9TA 1KJ3L 4LRIA 4ZFOA 3SDAB 5DT1L 3FQXA 4OZHA 1A9EA 3OZ9H 3MUY1 3J8F7 1NAMH 2DKUA 4RMUA 4UDTA 4PG9B 1T5WA 3DRTA 2Q76A 3FQRB 2IMMA 2LTQC 2D31A 4HJGB 4OGXL 2V5YA 1BM3L 5GGUA 1OAQL 2UZYB 2BSSA 5HGGS 3SDYL 4UT6H 3SJVD 2C3XA 3MV8A 3AC0A 3ROLB 4MS8D 4HAFA 1C12B 2PCPA 2DQJL 2WLYA 1FNSH 2HH0H 4DKFL 3S35H 1BZ9B 4MAYC 3QHZL 4OGYL 5B3JF 2MQCA 4Z9KB 1VCAA 2FATL 1KT2B 5DJXB 2EYSB 3BRFA 4W6WB 2IADB 5J3HC 2MQ3A 3V7MA 4V1DE 4WI7A 2AGJL 2P5WD 1G6RL 3WN5B 1N6VA 1ZVHA 4M7ZC 1WBZB 4JVWA 1FYHB 1LP9F 1NGXB 3HS0B 3QJFB 3FT3B 1OAYH 4D0DA 4R4FL 2VLRE 4R3SA 3RX8A 2XZAL 1U95A 1FHGA 3CVIL 1TZGH 3TN0A 4DTGH 1M05A 1TZHB 4EOWH 4OFVA 3X11B 2X70B 3MLWH 5L2JB 5K59F 2MFNA 1MJ7H 3VJ6B 3D85B 2B4CC 2HVKA 3GK8L 1DSFH 5CP3A 4GQPH 2MCG1 5GZOC 3SDXF 1DZBA 2HP4A 3KDMA 1DBBH 4V2BA 1VADB 1MLBB 5F3HB 2Y4SA 4KI5F 5IW3A 1QBBA 3IJSA 3LS5H 3UTTE 4H26B 1LQSR 4NHCH 5DK0A 2XNAA 1NMAH 1IEBB 5D7KD 4R0LC 5D7IF 3MRCB 1AHWB 5CGTA 2YWYA 1BBDH 3TNNB 3EDJA 2ZG3A 5GHWH 4KKCD 1ZLSH 3EFDL 3O3DB 1H0DA 3G6JB 3OJDA 5DRXA 2XQBH 4HEPG 1QYGH 5F88A 5ADOH 3CC5A 2H2SC 4WVRA 3BYYA 5GGRB 1CZ8L 3OG4B 3G5XA 3ALWA 3V4UH 4WCYL 3QUMA 3K74B 4JJ5B 1TCRA 5EO0B 4OLUH 1ORSA 4E5XA 1GIGL 4QXWA 4ELKB 2V2TA 2ARJA 4OAWA 1F4YL 1E4WH 3H42L 4LK4A 3VA6A 5BOPA 3I6LD 4R2GC 4PRPE 2VLJB 1GGUA 1V8HA 3CPLB 2BVTA 4TN9A 4XPTL 3S6CA 5F70A 5KJRH 1AGEA 2B1AH 3SJVE 5KTEL 3ALXA 1CGYA 2EE2A 3BP6A 3QDJD 1G7IB 4MJ5A 4M4RA 3P73A 1NANH 4K7PY 3ES6A 4F8QA 3MJGX 5E8DH 4BSJA 1JV5A 2D7PA 1KN4L 4UTAL 4NWTH 1KTRL 2CRYA 5CZXD 2P5WE 3WUZA 4O2CB 1H3PL 2OL3H 3PP3K 1NCBL 1JWSA 4D0BB 1G9MC 2UWEB 2UY6A 3MA7A 4XCNA 2X4TB 2HVJA 2D9QB 4GRWH 4PR5B 4AQ1B 3GGWB 2BDNH 4LSVH 4IIQA 1XCTB 3LN4B 2EO1A 3QDMA 1W8OA 1TIUA 1X5ZA 3T2NL 2FL5B 5AZEH 3IFOA 4LCYA 4GSDL 2OK0H 4EUPG 4MJIA 2ZCHL 2JJSA 4N8PA 4HKJB 1GGIL 4PLJC 3C8HA 1CBVH 3ARBD 4NP4H 1HOCB 2XWJA 4UIKH 1EHLH 5C6WH 1CTNA 2HWZH 3RKPA 4HKXA 2ADFL 3HMXA 1GRWA 4M5ZH 1T2QH 2E9IA 2ZCLH 1KFAL 4M6OH 5E1AA 5JW5A 1N5YL 4JHBA 4P0DA 2V5RA 3CX5K 2Y36H 4HK3N 4U0RC 5E99H 1AI1L 1UB6A 4OQTA 5I1JL 2UYLB 3C60C 4JFXB 2QQKL 3AAZA 4R96A 1R24B 2EZ0C 4ZXBA 4JAMB 2AJUH 4QXTB 1RZGA 4NRYB 5K9QG 4ZUWA 4GKNA 2GYSA 2VKXA 1HNFA 5DD5L 5I1AA 5SWSB 1BF8A 3C5SB 5MEPB 5INDB 3NFNA 4MVBD 5F7DB 1FGVL 2W9EH 1IC4L 3VXRD 4HXAH 2D7NA 3UC0H 4RZCA 4GAJH 2H1PH 2I5YL 3AS2A 2AV7A 2R69H 4IRSD 3ZMRA 1KUMA 1N59B 2R9HD 2ZP0T 4LCWB 5DJAA 4LCCB 5IEKB 3FFCE 1VPOH 1H8SA 2AERT 4WNQA 5AYUH 5HGAA 3MRMB 5HHMD 5DJ6A 3D2UA 5I74B 1BQHG 3VDCA 4AH2A 3FCTB 3HNSL 4KV5F 4P2RA 3QDJE 1GGTA 4LPVA 1U3HB 1C5BL 4LEOB 4ZD3L 5H2BA 1RV6X 1F90L 2GI7A 3BE1H 3RY6C 1BAFH 3B9KC 4C56D 3C87A 2PO6A 4I18B 3CDGB 2VDMH 4HQQH 4NKDA 4EDWH 3QQ3B 5DEFB 3NABL 3PWVA 2NW2B 4X4XB 2H2PD 1S7VA 4FQQB 3ABZA 3RDTC 1OP5K 5AG9A 4P2QB 4JQXA 1OHQA 1NBYB 5BS0B 2YD6A 3L3HB 1ACYL 4OZGF 4X5WA 1S9VA 2JJWA 3OKMB 1S7QB 4CVUA 4OZFH 4M61B 1UT9A 4AIXA 3NIFF 4AMKL 1BFOA 1Q9LA 2NYYC 5DD3L 1LEKA 3VXMA 3HI6H 3M8OL 5SV3A 1ZVYA 1R0AL 5CLTA 1V3LA 2NMSA 4Z7NE 3SDCA 2W65A 3VFGL 1DQTA 3QFDB 4J6RL 3SKNA 2VLKE 1NKOA 4YQXL 5DRWB 2ITCB 1EHXA 3PDDA 2H9GB 3DX9B 1N64H 5CCKH 1MVUA 3VG0L 5EU7C 5I73C 4URTB 2YSSA 4PRHB 4ZS6C 3T77A 1OGAB 2EKSA 1YYML 4G43B 5MP6L 2CLVA 3I50L 5GS0D 5C0EA 4NQCE 4QT5A 3CLEH 1NH6A 1KJ2A 3NIDF 4YBQC 3VI3F 4HIHB 5D2LA 35C8H 1JPGB 1YQVH 2FBOJ 3O45A 3TLRA 3KXFE 5J1AB 5DQ9B 2R1YA 4ZAKC 1FPTH 3VXRE 1T20A 2YD8A 3GEWB 1QSFB 5CILL 1WIUA 4MWFB 3RZWA 1S7TB 4JQIL 5D1ZD 5IHLB 4QRRE 4DZ8B 4IEFB 2CQVA 1S7RB 4NSKA 1I8MB 3JBG7 2FYYA 3L5JA 4JN2A 4RCAA 1A6WH 1GH7A 4XNZC 3X12A 5CJ8A 3S5LG 1CL7L 4KK8C 2NY1D 1TZIA 3UJIL 1CR9L 5HHME 5IJKA 2OQJA 3S36H 4DGVL 3MRFA 5SWSE 1BP3B 2EYRB 3UBXA 3NZHL 1K4DA 4C54A 2YK1H 1S5IL 5ERWB 2EC9U 2BHYA 4P23C 3WIFB 1RZKH 3IGAA 5GXBB 3T0EA 5IF0A 3MUJA 4JFYB 4L3EB 5E9DA 3K7UA 2D0GA 1JGLH 1CFQA 2R0LL 2DIAA 4PJBB 5IQ7L 5JW3H 4WI9A 2GSIB 3OMZA 4JLRA 2I27N 4BUHA 5HVHB 3EYQD 1IKNA 2HMIC 1GC1L 5D72H 2O5YH 4YDLC 3TJHC 1G0YR 5D7JA 2X6MA 1J0HA 2H3NB 2X5PA 1U8IA 3TO4D 2XKNB 5A2IH 5TFSL 2VC2H 1EFXB 3PDGA 3S96B 5ACLA 3SPVB 1K5NA 1Z9OA 4HFWB 2OXGA 5FO9A 4DAGL 4LLUB 1A4KB 3O9WD 1U58B 4Y2DB 4XPGH 1XT5A 2G5BB 5F71A 4I48B 4WO4D 3BKYL 3BOVA 2OZ4A 4JHAL 1EERB 5E6IC 5GS0L 4L4VE 4FFZL 1YEFH 4JFED 4M48H 4JFDB 4KKLD 4P4RA 2EDQA 1ZLWK 1H3TA 1ZKAA 2DD8L 2FGWL 4PJFE 1CICC 1RUAL 1IGJB 2YD5A 2MCPH 3E1F1 5E8PB 3RIFF 4BH8B 1U8LA 2UV3A 3RGVD 1SYVA 2W9DH 2VDKH 1VSCA 4WI4A 4P2QE 2R2HB 1FAIH 4ODSH 5BO1H 1NGQH 5BS0E 2A9MH 5CD3B 2C7UA 3OR6A 1N8ZA 5C0CD 4JRXD 5EUOE 3SDDD 3K4DA 5HHPA 1FNGA 4ENED 4HGMA 2V7NB 2LU4A 2MWCA 4F37K 1V05A 5BW7C 4L5FL 2AJXH 5LXGL 4XP9H 2VH5L 4NZTL 4W6YB 5KAQG 5K33A 4YH6A 3CD4A 3WIHL 4EN3C 3TZVA 1PBYA 4XVJH 2BFVH 1P7QB 3ESUF 2FX8L 3QPXH 3BEVB 2N56A 4HUVA 1IILE 3HE6D 5EO9A 1A0QH 5B8CA 4JB9L 4PJBF 2G9HB 1LVEA 3HA0A 3T3PF 4WWID 1VESA 3CSYB 2IH3A 4Y4KB 1XF4B 4S11A 5MI0B 1VFOA 1EZVY 3O2VL 3NH7L 4X6DA 2F53D 4XP6H 4X8JA 2JK5B 5DK2A 1I9JH 2JCCE 2W0FB 5B38B 4Y4HD 3SE8L 2X4RB 4MS8C 3BZFB 3PHQA 1Q9OA 2XRAL 2BC4A 3TFKD 3PWJB 5IMKB 3D0LA 4R97C 4OUOA 1QA9B 1QFWL 4NQSA 2XTJD 1A6UH 3VFMB 2A83B 3W0WD 4ZTOL 1VDGA 3TA3C 3LQAL 5LGJA 3FRPG 2AK1H 5D7LD 4BJLA 5E08L 1QKZH 3VFVA 2BXZA 2R1XA 5DJYB 4I0PB 5J11C 1CDUA 1XGQB 1MRCL 2QQQA 3LCYA 4NCC1 4MB3A 2BNUB 4FXLA 3VFTA 5E94A 1OARH 4HC1A 4RMTA 1I1FB 5C9JB 2HYMA 1J0KA 4MCZA 4NBXB 3K4ZA 5FYJE 4L3EE 1TXKA 5KBNC 1BVLB 4BKLA 3QNZA 4K2UH 2MPAL 3MSPA 3MRIA 2IF7A 1YMMD 2HT3D 4P46B 1X4XA 2CLZB 4JFEE 1H9VA 2B4CH 3KYOB 3T3ME 3EDDA 3MGAA 2HRPL 3V5DB 4G9DA 3QEUA 3PHOB 4UBDD 2DQDL 1HHIA 3P11L 3S98A 1RUPH 1ZSDA 4J3TA 3GSRA 2L0DA 4GUPA 1SEQH 3AREB 2DQGH 3MLZL 2FEEI 5JPNB 3HCVB 3TYFA 2W38A 5A2FA 1GGBH 1MAML 1IQWL 4Y19A 2CO6B 2VZ1A 4R4BA 5BV7B 3HLAB 1XZ0B 4R26H 5CHNB 4B5EA 5TQ0H 3KPRB 5I8OH 5CP7A 3UTOA 1PGRB 4PRID 4Y0GA 3UO1L 1WZ1H 2WP3T 3EOAA 2FX9H 3STLB 4XBPB 3WFHA 5TDOB 3U0TA 5ITFA 4LRNH 5EOCH 3QXDB 5IT2L 2ZOLB 4JKPL 3IXTA 2X4UB 2JKXA 2DYPA 2F5BH 3TPUB 4G6ML 4P5TB 3QUYB 5DJCA 1JI1A 4QO1A 3CX5J 4N5ED 5CJ5A 3CMGA 5CSZB 4FZ8L 1FC1A 3TC9A 1XAUA 3D9AL 4TVSa 3E8UL 3ILPB 3L3KB 4WEBL 3DV6A 2X7LB 2AJYL 4D9QD 2DQIL 1FORH 3VXSA 2E7LA 2X40A 4HUXB 1FVCB 5F96H 1HHHB 3RWIA 1CFTB 2QL1A 3ARDA 2VITB 2ENSA 3ME0A 3LDBB 4ZSOA 2ATPA 2EIDA 3D5OF 1Q0XH 5FYLE 2XTJE 1I1AA 3CK0H 2MHAA 5ABDE 1S5HA 2EDKA 5CZXC 5KVMC 2DBLH 2OJZL 4X6BA 5KSBE 3QIUB 1UXSB 1J0JA 4ISVA 1Q72L 2VDPH 1QSEB 2AK4A 1FLRH 3A0OA 4HUUB 1U2HA 4J3OC 4M02A 2AI0L 1G9MH 3W82A 1YY9D 1GZPA 2EXYD 4Q9QH 1NAKL 3NFSH 1RK0B 3WDIA 1FG2A 4N8CH 1T21A 3WLBA 4M7KL 5T3ZE 4DWHA 3EYSL 4JPKH 5ILTH 2PNDA 3UTPD 1PEWA 2E7MA 2ZJSH 4ZG1A 5F8QC 4PJ9C 2B5IB 4QRPB 1UKQA 4GLRI 1S9XA 4O9HH 1JGDB 1FZMA 3C9NA 4K71B 3WEXA 1MCCA 1JNLL 2QQLH 1CFSB 3PIQB 1YMME 3V6ZB 4BSWA 4XTRD 1BJ1H 3ZE0F 1OAKH 2CDFB 1JHLL 2KL6A 3G04A 4FQLH 1I85A 5KVDH 5TQ2H 3MBXL 1AJ7L 3IVKA 3QUXA 5KSAD 1JPTH 2ED8A 3BVNB 4TUKL 1HSBA 4EDXB 1S9YB 4EZMA 5GGVL 1DDHB 2ZZUT 2XTLA 4DN3L 3F7YA 1KCVH 2E6PA 3V79C 1L7IL 1M7DA 1A7NL 2E8ZA 4ODBD 2V5TA 4PJ7F 3MRRB 1RZFL 3KPNB 1S7UB 2ADGB 4YHLL 3IB4A 5L6YL 2WMPA 3KYMA 4L9LA 3X14B 1EMTH 1IGYA 1LDPH 1KB9K 2WIIB 1LE9A 3MODL 3QEQA 1R3HB 4G3YL 1G7MA 2PR4L 4GT7A 1CFVH 4IRSC 2YN3A 2A38A 1XIWB 3UP1A 4GW1A 1CS6A 1PDKA 2XWBB 2E6JA 4K3EH 3RWGB 2Y9RT 4M6ML 1BEYL 3BD5A 3KPRE 5T1KB 1PG7X 1PKQA 1K85A 4D9QE 2DWEB 4MA8L 2X2YA 4UT7L 1NDGA 3L1OL 1OAUH 3VH8B 1OF2A 4G9FD 4MMZC 5FDYA 1CVSC 1KXVC 2ADJB 4EBQH 3KLHD 5C09D 4YDJA 3S37X 3SBWC 3RTQD 2GCYA 2ESVB 1E27B 4LDEB 4YHYB 4X4YB 2VISA 4GKZA 4X9IA 3G08B 5FV1L 2HJKB 4HT1H 1DE4B 5DHXB 3EJYD 4O02L 1T1ZB 2Q7YB 1NAMA 1ZA6A 2BSRA 1KCRL 1FSKB 1K4CA 4JO3L 1F4XH 5TE6H 2H2PC 2UZIH 1FYTD 4MQXC 1FFOA 3U7WL 2EE9A 4PD4K 2NY0C 4A6YH 1BFVL 1CGSL 1RIHH 3NTCL 2J1KA 3G5VA 3IS1X 4MXQC 3VWKA 3W39B 1CFNB 4TRPH 5C8JA 4TQEH 4DVBB 2I60L 3C09C 4APQD 2EDNA 3VGEA 1U3ZA 3VFUB 4P2YA 3U6RA 1OLZA 3M07A 4ONFL 4M43L 3B3IB 1JMXA 3CX2A 4Y5YC 3EOTL 3V6BR 5GS1A 4NJ9L 2VDLH 1GC1C 1ES0A 4QRSB 4OCXL 4RMWA 3STZB 2AV1B 3IDGB 1MAKA 3WNNA 5L2KA 1A1MB 3LSOB 5I19L 4KHTH 4U1MB 4NQXA 5LCVH 3O4LA 1B4JH 1J12A 2HT2C 4K3GA 3HAEG 4KWUA 2DDQL 3TT1H 1ZGLA 3HI1A 2WINB 4OGAD 1QR1A 1OTTD 1ERNA 1MJJB 5IB4B 3BO8B 3DUUB 4N5UA 5E8OA 5GS0C 1DQQB 1HXMB 1OW0A 1Z2KA 3UPRB 1MCEA 3RAJL 3ROOA 3D3VB 3D39D 3VXQB 1EBAA 5CBAA 5IHUL 4JKKA 1W0WB 4KVNH 3BUYB 5ESQB 4LLVA 3L7FA 3RU8H 1MWAA 3AU1A 4QRUB 2HTLD 3R1GL 5D1ZC 5IESH 4PLKD 1YEDB 3WFBH 4QRTB 2AW2A 3DSFH 3W2DH 5F7KC 1OP3H 2CO7B 4QCIB 1MLCB 2CMRH 1UJ3A 1JUFA 4NKMA 3EYVB 5F7HA 1QVOB 1A2YA 3RP1A 5I1DB 4J4PD 3CMOL 3GSOA 5JPMA 3DO7B 4G9FE 1N0XL 2PXYB 3NA9L 4KTDH 5C09E 2RFXB 3ZSSA 3O0RH 4GO6B 5DJZA 4HG4K 3OHXB 2J4WH 3HFML 5K93A 4MSWA 4CDGC 2VZUA 4FQCH 4H8WL 4LASH 3EYQC 1YEHL 2Y72A 5I6XB 1KJ3H 2BNQB 1UWXK 5DT1H 3BRGC 3BUTA 1HI6A 2XYCA 3OAZH 5ETUB 3VD3A 1PW3A 1FRGL 4MDJA 4IDJL 4WEUD 2Q3AA 1CU4L 1FYTE 3IAQA 3KJ6L 4ZUVB 4OGXH 3BHBA 2F54A 3G6DL 1BM3H 1CG9A 1IAII 2QSCL 3SO3C 3WNLA 1OAQH 3IU3A 1O7VA 1WBXA 4H5SA 3SDYH 3PQYB 3O9WC 2DIJA 4LGPB 3QDGA 2FZ3A 4ZFOB 2DQJH 4OZHB 1A9EB 4KJPD 3ARUA 4WO4C 4UDTB 1ZHKA 1KLFA 1T5WB 3QHZH 3DRTB 4OGYH 2Y6SD 2FATH 4LLMA 3GO1L 4LNRA 2D31B 1PAMA 3CH1A 1B6UA 5GGUB 3LQAC 3B2UD 2OL3A 1G6RH 2BSSB 4Q9CA 5LAXA 3ARGC 5J0BA 1SY6L 3MV8B 1F00I 3PGCB 1F45A 2PCPB 4UU9A 4NQEE 1MIMH 3E6FA 3Q6GL 1IMHC 3BW9A 4R4FH 2MKLC 1W0VB 2X4SA 2Z93A 5E7BA 1D5XA 25C8L 1KB5L 3CVIH 4LARL 4M9OA 3SDDC 4NNXB 1ZHLB 4QRQB 1Q0YL 4Y4FA 3RWFA 2WIMA 4ENEC 1BF2A 4RX4D 3FTGA 4Q9BA 5ITBL 3OPZL 2Q7NA 4Z7UB 1ULVA 2BY1A 4LPXA 4P5KA 4D0DB 3GK8H 3D39E 2BSED 4R3SB 5HYSA 1U95B 3N1FC 2OI9C 4I3RL 1J8HD 2C26A 1A1NA 1QLEH 2GHWB 3TN0B 1YPZF 2K1MA 3MRHA 1M05B 5IR1A 2AXJA 3HE6C 3E2HC 3O11A 1YEIL 5HYEA 5D1XC 3RFZC 4HK0A 5ANMA 2AEPL 4I9WE 2WZPD 1C16A 2OCFD 4QNPE 4XVSL 1QUNA 4NC0B 3U7YL 3CVHA 4DGIL 3KDMB 3ZKXB 3EFDH 5HYJA 1T7WA 3D3VE 4HV8A 1LO3L 3IJSB 1XGPA 4GKSA 4WJ5A 1T22A 5D2NA 1CZ8H 4PY7A 3X13A 1VACA 4LHUG 4WCYH 5DK0B 3ZDYF 3EHBD 2Z31D 4OZHF 2A6IA 3EDEA 3AGVA 4X6FA 2VABA 1OSPL 1GIGH 2XTJC 5K9JL 4G8GA 3LH2L 1H0DB 3DECA 3H42H 1U8KA 1R5IA 3OJDB 4I13B 4NYLB 5DRXB 5F88B 1SMAA 3CC5B 4X9HA 3BSZL 4XNXH 3G5XB 3QUMB 3BKJL 1TCRB 5F93C 5MEOB 3DUSB 3H3KA 4QHKJ 2IH1A 1ORSB 4Q0XL 1DBJL 1FZOA 2ARJB 2V2TB 2AJSL 4OAWB 4G42A 2ERJB 2LAGB 5KTEH 5FM8A 1C7SA 2QSTA 3WD5L 4OFYD 1JN6A 1RIUL 3I84A 4PGBA 3KPOA 5DMYA 5GRXG 4Z8FL 5JMRA 4UTAH 5DJ2A 2XFXA 4EIZC 1A7OL 1R5VA 1U8MA 1TJHH 4UBDC 1H3PH 5JR1L 4OZIB 5IW1A 2CKNA 3WE6A 4MJ5B 1M7XA 4I2XA 3M17A 3P73B 4HPYL 4AENA 2WAHA 4UQ2A 1FFPA 1JV5B 3RVVC 1QRND 4GXUN 4L4TD 5AYQA 3PXHA 3CU7A 2R8SL 4LSSL 4M7JL 4WHTA 3T2NH 1JWSB 5JMOC 1EAPA 4OZFA 1AXIB 5JXAL 3MA7B 1OT1A 4XCNB 2NX5A 2WANA 1EVTC 5JIPA 2ZCHH 4HS3A 4AIOA 3BDBA 1GGIH 1FO0L 3C8KA 4KI5D 4IIQB 2I26N 4FZEL 4B50A 2ADFH 3QDMB 2BHUA 1ADQL 3O4OB 4MYWB 1KFAH 1N5YH 3IFOB 4LCYB 3KLDA 2AQ2A 2IAND 1PZUB 4MJIB 4N5EC 1AI1H 1YN6A 5I1JH 3RZCC 3A67L 3HNTL 3QFJE 2QQKH 3UYRL 4LSPL 4HKXB 3ZDZE 3CFEA 5JW5B 5E1AB 4XP4L 1WLHA 3QQ4A 5F1IA 4HX1A 1UB6B 1NBQA 5EBGA 1FGVH 3I02A 4RRPA 1IC4H 2FEDD 3AAZB 3IT8D 4YXLL 1KB9J 2I5YH 4ZXBB 1AXSA 1R3LA 5GGTL 1RZGB 4KU1A 3DGGA 1EJOL 1IGTA 4WIQA 4GKNB 4KRPC 4ZQKA 2E7HA 5F3BB 4U6XA 4KRMB 5I1AB 3EOBA 4HUMB 4PRAA 3CFIC 3OXSA 1YY9C 3NFNB 2EXYC 3H9SA 4RZCB 4NN5B 2XACC 2AV7B 3HNSH 3V0VA 1MRDL 1NGYA 2B1HL 3ARWA 4PY8I 4IRZL 3D85D 1RUML 1TVDA 3BGFB 1A6PA 3GSNL 5DJAB 5JXEA 4WNQB 5HGAB 2A1WH 4XB7A 1TFHA 4ZD3H 2YA0A 3JV6A 4XTRC 3OKNA 2W07A 3D2UB 5DJ6B 3CNKA 1F90H 1IRAY 4TPRL 5BZWA 4J3VA 1IFHL 4K7PX 5EDXA 4PTUA 4AH2B 4RQQA 3GDBA 4G6AD 4P2RB 5DD6A 3RL2A 4JPWL 1NCCH 3OXRA 3PGFL 5KSAC 3NABH 1IM9A 3K8KA 3ZL4L 4L8CA 5H2BB 4LSRL 4EJ1C 3MTRA 1A6TB 1MHPL 4PD4J 2PO6B 4YZFF 1ACYH 1QBMH 4KK9D 4FQIL 4NKDB 4OF8A 1NFDE 2HFEA 3PWVB 4GRLB 5C2BL 2ZUVA 4ESKA 4N0YL 4AMKH 3H7LA 5DD3H 3QIWD 3M8OH 5J56B 4OZIE 4U49A 4PJIE 1R0AH 2R2EB 4XP5L 3P4NA 4X5WB 4J6RH 1S9VB 4WWKA 2ED9A 5CINL 5D7IE 4LBEA 2N1KA 3FB6A 5J13C 2ICCA 2IANE 5IROC 4NO3A 3VG0H 1BFOB 1Q9LB 4W4OC 1LEKB 2BHZA 3TH2T 3VXMB 1YYMH 2GJ6A 1OAXL 3IAPA 5DMGD 3SDCB 3I50H 2EDXA 3EO1A 2W65B 5C0JA 3SKNB 4M7LH 4XXCA 5I1LA 1UCTA 1UM4L 2BP3A 4HHAB 1VGEL 3OTTA 4OV6F 1MVUB 4RIRA 4GG6A 1UCBL 4KI1A 3RTQC 2YSSB 4V2CB 5JZ7D 3T77B 2EKSB 1ODAA 4UQ3A 2CLVB 3U4EA 5CILH 2KDGA 4JQIH 4FQJH 2CD0A 4QT5B 4QXGL 3ZKMD 5D2LB 3OG6B 2WUCL 5BQ7A 4M3JA 3O45B 4PBVC 4D9RD 3UJIH 1CR9H 4HLJA 1MIEL 3QJHA 4DGVH 1T20B 1J1PL 3KS0H 4OFIA 2UUDK 4ORGA 5EC1A 5I1EH 3NZHH 4WUKL 2AVGA 1S5IH 4NSKB 4APQC 5FKAA 4FTVA 4JN2B 2FYYB 3X12B 5DD0L 3T0AA 4TNVF 1SVZA 1E6JL 1TZIB 4HG4J 1MI5E 2VQ1A 2IBBA 3DNKA 3GIVA 1CLCA 3V4PL 4H8WC 4D9LL 4Z76A 1DLFL 4FFVD 4NQDA 3UBXB 1K4DB 3LKPA 1NC2A 5L0QC 1MHCA 1GC1H 4JREB 4JZJA 3T0EB 4YHML 2RHEA 5IF0B 5TFSH 5JUEL 4YHZL 5HVFB 1CFQB 1R6VA 2I07A 4ZTPH 5FYKD 3DVIA 3TPKA 3M45A 4OGAC 3TNMA 4DAGH 1OTTC 2D3VA 2LABA 3BPNC 1NCWL 1RI8A 5I15L 3BKYH 4JHAH 5D7JB 4LOUC 5GS0H 2CIIB 2EDWA 4FFZH 1DEDA 1U8IB 5DLML 4OLVH 1I7RB 2WW8A 1JJUA 4CAGA 1UVQA 1MCLA 3WUWB 2DD8H 2FGWH 5A40E 4JPIA 1RUAH 5FO9B 1IT9L 5GRVK 4NRZB 2RIKA 3SCMA 2HJFA 2DF3A 2AXGA 2HTLC 2EYTA 4RMSA 4NQUA 2ZCKH 4PLKC 1KGCE 2FD6L 1ZT7A 4LKCA 1HIML 4P4RB 5D2LF 4R0LA 3MNWB 1ZGLM 4HMCA 3UTZA 3R0NA 5CUSL 3MV9D 2ARWA 2C3GA 3W81A 1U8LB 4HZLA 1EBPA 4L5FH 5LXGH 2QEJA 5DMKA 4YBHA 1BZQK 4J4PC 2VH5H 4NZTH 1J0IA 1G7HA 2ADIA 2C7UB 3OR6B 1OWRM 3OWEA 1QR4A 4LIQE 4TVPD 5TF0A 1XCQA 5HHPB 2FX8H 1FNGB 5JA8B 1PX3A 1KBGL 3U83A 5C92A 3IFPA 2CXGA 1JP5A 1T0PB 4CDHA 4OD1L 3O2VH 3NH7H 4PB9L 1MCSA 3TZVB 3VWJA 3WKNA 2E7CA 4RGOH 2DQTL 4TULL 4HUVB 5EO9B 4HWEH 3EGSA 3VU2A 5B8CB 5FYKL 4M6NL 3SE8H 1KIUA 5DFTA 3T65A 4G7VL 4KJPC 2IH3B 4X6DB 5HGBA 1QFWH 2Y6SC 1QFHA 4X8JB 1FL5A 2Q86A 5DK2B 4ZTOH 3NIGF 4NZRH 5IIEA 1I3VA 4QF1B 3SKJL 1EUUA 5I2IA 3B2UC 4AEIH 5T5FL 3LQAH 2BNRD 5E08H 3PHQB 4KROD 2BC4B 1RHHA 1G7LA 3KYKL 1MRCH 3BWAA 1UADC 4Y5XC 4OZGE 2J12B 5IFHL 4NQSB 1OGAD 4PGZA 2OP4L 4O00A 4PRDA 1HE7A 3NIFE 3MYZA 3KNBA 3VFVB 3HI5H 1PG7W 2NXZD 3FOLA 2R1XB 3UBXI 2CSPA 3OB0K 4QEGA 1A5FL 1I9IL 2MPAH 2OTUA 2BSTA 4K7FA 3VFTB 5E94B 2ENYA 3S3PA 1SEBA 2HRPH 3RVWD 4XVTL 4M1DL 2DQDH 1ED3A 4FQ1L 3P11H 4X7TA 5KVGH 4JG0H 2Y06L 2ZUXA 4BKLB 4WW1A 3QNZB 3U2SA 2APTA 2H41A 4PJXF 1IZJA 4L1HA 1WZLA 3VRLE 1RK1A 3NIDE 5EOQL 4HIJA 1MAMH 2P45B 3MV9E 4FNLL 4G9DB 3QEUB 5ESVA 3HZKA 1HHIB 1ZSDB 1EH9A 4ZFGL 4CKVX 3GSRB 4GUPB 4HS6B 3UO1H 3BI9X 1YEKL 3GRWA 2Z31C 1DBKL 3WIIL 1OCWL 3B2VL 4X6DF 1A7BA 4WFED 4R4BB 4Y19B 4JKPH 1AGCA 1WZMA 4G6MH 3RUGE 4YFLF 5CP7B 1GZQA 1X44A 15C8L 3IYLW 5HHNB 1EFXD 3EOAB 1ZHBA 3EO9L 4FZ8H 3E8UH 4M8QA 3H8NA 3WFHB 5I9QC 4PLNC 5ITFB 4WEBH 4Z7WE 2DM4A 4CMHC 1EZVX 3IXTB 2DYPB 2CPCA 1ZHNA 1YY8A 2Y23A 1CD0A 3FN0L 3KVQA 4JRYD 4LLQA 3NCMA 2NY4B 1X7QA 4H0IA 3L5WA 2ILLA 3DV6B 3CGTA 1P4BL 4NBZB 1JYNA 2R29L 5JHDA 1BPVA 3B9KA 2UVFA 3U82B 3VXSB 3LY6A 4JM2B 3HHRB 4K23L 1MCRA 3RWIB 4IJ3C 1Q72H 3UZQA 1YYLL 3ARDB 4E41E 2Z91A 5BRZD 2AI0H 4JE4B 4PJDE 4GW4A 4ZSOB 2ATPB 1T89C 5GSRA 4NOBA 5ISZD 3RDTA 1NAKH 2DN7A 2JIXD 1I1AB 5EBLB 5HY9A 4R8WL 2H26B 2MHAB 3C5ZD 4M7KH 1VFAA 3EYSH 1S5HB 4YFLI 4X6BB 4K3DL 3UDWA 4N9GA 2YUVA 1H15B 4ISVB 2AK4B 4FG6D 1CYGA 2BVYA 3OBAA 4RA3A 1JNLH 1GZPB 3FAXA 5EU6D 3TBTA 3L3JA 1FG2B 1AKJA 1BIIA 1T21B 3WLBB 4NUGL 1JHLH 4KI5C 3ETBF 1Y18A 2WBWB 2CR3A 3O6FD 4MNQA 4Z7VB 5DS8A 5CEYB 1TETL 4LP4A 2DMBA 3MBXH 1AJ7H 4HBCL 3MLYL 4MXVF 3U4BL 1EIBA 1S9XB 4Y4KD 2E6QA 3C9NB 3WEXB 7FABL 2O5XL 4TUKH 4BSWB 1NEZA 1UQSA 5F7YC 2NY5L 4MLSA 3G04B 4WTZA 4LVOC 5GGVH 5D96C 5C0AE 4OCSL 4DN3H 5BXFB 4TSBL 3IVKB 3QUXB 3QG6A 1L7IH 1A7NH 1L0YA 5DQDL 5C07A 2FEEL 2WWKO 1V3KA 1RZFH 1HSBB 2GK2A 4WHYH 4YHLH 1J86A 4PJHF 4PP2A 4FQHA 4LSUL 1UWEL 2FEDC 1HQRA 4MA7L 3MODH 3WN5C 2PR4H 3F7YB 2LAAA 3GB7A 1M7DB 5IGXL 4Z18A 1IBGL 5D93B 3QULA 1KCUL 3B8YA 5DUML 3F5WA 2E7BA 3KYMB 4M6MH 1BEYH 4L9LB 1JI2A 1IGYB 1LE9B 1INQA 3QEQB 1G7MB 4MA8H 4UT7H 5GRUH 4JY5H 3LPWA 5FGBC 4HXBL 3L1OH 3LMJH 3P3YA 1GHFL 3BKCL 5DURD 3BMWA 3MLRL 4GW1B 1X3DA 4P23A 3IETA 4OV5A 3DLQR 4JRYE 4A2LA 5IKCA 3KJ4C 1MCPL 3G5YA 3V7AG 4CNIA 1IEAA 1PKQB 3WO4C 4V1DA 4G6AC 4DJMA 1OF2B 4O02H 3R0MA 2VR5A 1JTOA 4OI9A 5JOFA 5CZKA 4ZNEE 4LSDA 5BRZE 3SQBA 3MV7E 2GCYB 5IQ9A 1AGDB 5ISZE 1U8PB 1YDPA 2VLRA 4G5ZL 3U7WH 2GT9A 3MJ9L 3F7PC 3BN9D 1JTPA 1HH6A 2P24A 1BFVH 1CGSH 4GKZB 1P6FA 3UMTA 3LD8C 4BZ1L 2HAZA 1IC5H 4KK9C 4RA0C 2I60H 4OIBA 4B0MM 1NAMB 1ZA6B 2BSRB 1K4CB 5E6IA 4JFFD 4H88L 5TDPA 5EU6E 4ONFH 4M43H 1FFOB 2DKMA 3QIWC 3EOTH 4G80A 1CICA 3VWKB 5C7XL 4NJ9H 4OQ1A 4P5TD 5I76B 3QUYD 3RKDD 3BPLB 5C8JB 1NBZA 1MY7A 1Z9SA 5I19H 2VYRE 3RGHA 2P1YA 3DMMC 3U6RB 3UTTA 3QBTB 2ZOKA 1VFMA 4N8VB 2DDQH 3FRUA 5L9DL 5EN2A 1V7NH 2LV4A 2X4QA 5DA0B 5GS1B 5DMGC 4NM8L 5JQ6L 2YMXL 2DB8A 1ES0B 4QOKD 5DVMA 5BW7A 5L2KB 5JNYB 1PFCA 5GSVA 2EDRA 4NQXB 3O4LB 2DJUA 1RQ5A 4Z7VE 1T0MA 2FHBA 5IHUH 4EN3A 1ZGLB 3HI1B 4F9PC 5FUCE 5JZ7C 1IKFL 3QIUD 5E8OB 1QSED 1ZK9A 1B0WA 1DUZB 3ZKMC 3H0TB 3WNKA 3GBNL 3ROOB 4PRPA 2WBJD 5E2VL 4ZO8A 4P57A 1FNHA 2FWOB 4G8FA 5CBAB 5GZND 1HZHL 4LLVB 3U9UA 3L7FB 5IVXB 1WWBX 1MWAB 3AU1B 3CDYA 4HIIA 4QRPD 2VSDA 4IOFD 3CMOH 3SJVA 2LE9A 1JRHL 1N0XH 3L5XL 3ULUE 3NA9H 1I7UA 3G6AB 1NJ9A 4X0KA 1OB1B 3V0AC 4U6VL 3P30H 1UJ3B 1AO7E 1JUFB 3HFMH 4HWZA 1WBYA 1TCMA 4XI5D 1WQVT 3PWLA 3TA3A 2P5WA 4QKXB 3TIEA 5A2KH 4FFVC 4CGTA 1YEHH 3VXPA 3GSOB 4NFBA 4L4JA 4OCLC 5JPMB 3GSWA 3OKYA 3O2DL 5IBUG 4J2XA 5DJZB 1JK8A 2DKSA 1FRGH 1NLDL 4IDJH 3TBVA 3T0VA 3KJ6H 3G6DH 3OKOA 4MSWB 3TP4A 3UZVB 4P5MA 3I3EA 2OBGA 3QZWG 5DGQA 1JYXA 3ZHKA 4OBRA 2NW3A 1HI6B 4JFFE 3LRHA 1T7YA 4OLYL 4M5YL 2W60A 4MDJB 3GO1H 3L5IA 4H1LH 3BHBB 2F54B 1CGTA 2EDHA 1CG9B 3IU3B 1WBXB 1KTLA 4H5SB 2J8UE 1SY6H 3QDGB 5FB8A 1FL3A 4S1RL 3TVMD 3QH3A 1XIWD 1YEJL 1G7JA 3LEXA 5CLWA 3H2WA 1ZHKB 3L5HA 4LCCC 1A7QL 1T3FB 4LLMB 4U1GC 4LNRB 4RGND 3DARA 1KLUA 25C8H 3CH1B 1KB5H 5T1KD 1EEQA 4R7NB 4LARH 2OL3B 2X70A 4LVNB 1EK3A 4PJ7E 5LAXB 1FLTX 3LIZL 1I7TB 4UU9B 5ITBH 3OPZH 4JY4A 2EDYA 3E6FB 4GBXC 1SHMA 2WSKA 2NCMA 3NCYS 5CWSA 3BW9B 4IHOB 1AQDA 2X4SB 4JFHE 2Z93B 1Q94A 1D5XB 2APXA 2MKWA 4I3RH 5T1MA 4Y4FB 4WHCA 2KBGA 3ARFC 4YR6A 1JE6A 1H3VA 1MJ7L 3OAYK 3FTGB 4H26A 2B20A 1G7PA 1ZLUK 3S4SA 4MZ3A 4P5KB 2AEPH 1NUNB 1RPQA 5HYSB 3FFCA 4QY8A 1BWMA 3UTQA 5HBBA 4XVSH 1A1NB 3U7YH 2P5ED 4DGIH 3MRHB 3U1SH 5IR1B 5E5UB 3TGXA