4AL8H

Structure of dengue virus diii in complex with fab 2h12
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
216
structure length
212
Chain Sequence
DVQLVEPGAELVQPGASVKMSCKASGYTFSSYWINWEKQRPGKGLEWIGNIYPGSGTVNYDDKFKSKATLTIDTSSNTAYMQLSSLTSEDSAVYYCTRGGSHAMDYWGQGTSVTVSSAKTTPPSVYPLAPGTGSSVTLGCLVKGYFPESVTVTWNSGSLSSSVHTFPALLQSGLYTMSSSVTVPSSTWPSQTVTCSVAHPASSTTVDKKLEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENVELOPE PROTEIN
publication title Structural Analysis of a Dengue Cross-Reactive Antibody Complexed with Envelope Domain III Reveals the Molecular Basis of Cross-Reactivity.
pubmed doi rcsb
source organism Dengue virus
molecule tags Immune system
total genus 39
structure length 212
sequence length 216
ec nomenclature
pdb deposition date 2012-03-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4al8H01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4al8H02
3QO0A 1I8LA 3FJTA 1G7HB 5F89A 5DJDB 3UROR 2AQ2A 1WQVT 1U6AL 4G9FA 1IJ9A 1QBLH 4M7ZC 1U8JA 4KZEH 1MRFH 3CFBB 3CDGB 2GJ6E 3I84A 3R1GH 3GK8H 5JOEA 1AI1H 4CL7A 4RAHA 1L0QA 5LJYH 5BQ7B 5ESVB 3WO3B 4YFEA 5E08H 4NT6B 4GJTB 3VXUD 4QRPB 1NEZA 4OFYD 4KK6C 3MV9E 2BERA 1NSNL 4FABL 4PJCF 7FABH 4QGTA 4GG6B 1UCBH 1OW0C 1ZHKB 1LEKA 1JN6B 5ID1B 3CFCL 3NIFF 2MQ3A 5MERB 1RUML 4JQVA 4JFEE 1BMGA 1S9YB 1VFBB 5D2NC 1WV7T 4X5XA 4DOHB 2NYYC 1RVFH 4PJHA 5D5MA 4XP4L 3WNPA 5DGRA 2RQ8A 2J8HA 3ARPA 4FQIL 5F9WB 4KTDH 1R5VA 4KHTL 1DQLL 1MCHA 1RZKL 5CD3A 5C3TA 3MBED 4KPHH 3MV7E 4OCLC 3I6GB 3QXAB 5E70A 4X8JB 4XXCC 1N6UA 1LNUA 4C4KT 2ERJB 4OLXL 2A83A 3P11H 1FBIH 3I85A 4XWGL 1BZ7A 5CZVH 4J7RA 4KI1A 2WLYA 5C08D 1SVCP 1CTNA 4P99A 4XCFL 5EBMA 3MRMB 3BGFB 3L3OB 3O4LD 2MNUA 1H3XA 4ZFGL 3QDJB 4LFHD 2BVPA 3Q6GL 1RJYA 2GK0B 2P49B 4UQ2B 2FH8A 5CWSA 4HWZB 3OX8B 1QFHA 4YO0A 1ZWIA 3WUWG 1DP0A 1NLBL 5EU4A 2YK1L 3GIVA 2Z4QA 1V3JA 2BJMH 4ZXBA 3V7MA 1CD1A 2HN7B 3LKPA 3HMWH 2GITA 3UBXA 2V5RA 4PGCA 3WN5A 4CADA 1KLFA 1EIBA 4MNQA 4E42B 5KVEH 1K5NA 1DUYB 1MFEL 2CQVA 2VLRB 4M93B 4MHHI 4MA1B 4AH2A 4A2MA 1XGRB 5HI5C 4WU7A 1GCFA 4ZUSB 5BRZB 3RNQA 4X7TA 1Y18A 4UTBH 3O3DA 2PXYC 4Y88A 4U1KA 5ALBL 1DTUA 5I30L 2NY5C 3QEGH 1WSST 4P0DA 1G9MC 1F4XL 1WAAF 2GT9B 5I1HL 1UA6L 3ZDXE 3DSFL 2CGRH 5I0ZA 4KU1A 4LU5H 1I8LC 3Q6FB 4JFHE 5EPMB 2R2CA 3OSKA 4HXBL 1E28A 1E4XH 3BPOB 4JFDE 5KSAA 1RIHH 3UJTL 3HE6B 3TV3L 2LAAA 3ARFD 2CKBB 4OFDA 2BC4A 3ZL4L 3SDAA 3QWOA 4NNPH 2FJHA 1YEDA 1QSFD 2XWBA 1X5AA 1N26A 1BBDL 1K8DB 1A7QH 5EZIL 3ARXA 5I17A 5T1DH 3CC5A 4R4ND 4WO4A 3FO9B 1SYSB 2VDOH 2VABB 4QO1A 4WIQA 4NKMA 1S7VB 3MRRB 4KV5E 4H8WH 4WNQA 4YHYC 2IPTH 2E3VA 4LSSL 4H0GA 5DR5L 2C1PA 2F19H 5D7IA 4JQVC 1G9ML 2ZCLH 4HMDA 4P2RD 4Y4FB 4YWGH 3IJHB 3TH3T 3V7AE 3NGBB 3C9NA 1A1OA 2WUCL 4N5ED 4EN3A 5I6XC 1J1OH 2XPGB 2E27H 3BW9A 1K6QH 3UTQA 2P4AB 4GW5B 4Y4KB 4ZOCA 4FZ8H 4H1LG 4MD4A 1KYOJ 3QUMH 5BS0A 3PDDA 4MCYB 1CS6A 3WJJC 3LDBB 5L7XL 2H1PL 1AXSA 2OM5A 3DJ9A 4XMLH 5HGBA 1OAQH 4N1EA 4JFEB 4X80L 3S6CA 3BSZL 3HZYA 1JYVA 4NCC1 3LH2L 2BCKA 3PV6B 4WDIB 5DD0H 3MXWL 5EN2B 4YPGB 3ZKND 3JTTA 2EE3A 3LKQB 4YNYB 5GRVK 2RGSA 3BQUD 4L3EA 4OZFA 1SMAA 4JFPA 4G8GD 4H25B 1NANH 3JWNC 5GISH 5HHOD 1KBGH 5GRXG 1SQ2N 2OR9L 2QQNH 2WLZA 5ESQA 4GKSA 3ZHDA 5AUMB 3CH1B 3LHPL 4ZXBC 1WBXB 5GZND 4NHCL 3D2UB 4MD5B 2O5XH 3WN5C 4OCSL 5IOPA 4WHDA 3MRGA 4NPYA 4OD3L 4J3WA 5B3NA 5E94A 5BVPH 3VD4A 4WFFE 4ZFFA 2OJZH 3HNTH 3VCLA 4HKBB 2N4IA 3D1MC 1M1SA 3VXUA 3PWVA 3LPGA 2DOCA 2HG5A 3F58H 3BP5A 4OFYA 1WC7A 1P2CA 1H3WM 4KMTL 4K23L 3SN6N 2I26N 4JO1H 2FR4A 3QA3B 4TTGA 3CVHA 1HINL 4OF0A 3EDJA 2W65B 3ZYOA 4OGXH 3FQWB 4XPGH 2RJMA 1R24B 5TE7H 1TQCB 1TQBC 4X6CA 4Q6IB 2J1KA 5IM7B 2XZAH 4YLQT 3SDAC 1D5BB 1RU9H 5EA0L 3PDOB 4D9RD 4UDTB 3RGHA 5MI0C 4PJBB 3QCTH 1YEIH 1Z5LA 1XGTB 3MBEA 5DD6B 4GW4A 2DD8L 4WFGD 3TNNA 4YDIH 4S11A 5C9JB 1M7IB 3AU1B 2J4WH 5FYJD 2Y5TB 5I1LA 3HKFA 1MJ8L 2DWDA 1UACL 5I8EB 3IU4L 1BQHB 2X4TA 4DGVH 5I76B 5C3LD 1QBBA 3QXUA 3K2UH 2KKQA 2A9MH 5C08A 4PGEB 2C1OA 2FZ3B 2WZPD 5DJAA 4J3SA 4NHUB 4YHKL 2NY4D 4XNYL 3O4LA 5INCB 1BIIA 1T03L 1I3UA 3QUMB 1HHKA 1CXLA 5ITBL 2OX5A 1KFAL 1R5IA 4XNMB 1YY9C 3ILQD 1KPRA 4EN3C 3FL7A 4JM2B 2VDPL 2UY7A 4X6DF 3Q5OA 4XGZA 5F96L 3N1GC 1PG7L 5H35A 3DVGA 1IC4L 5I1JL 3TO4B 4OLWH 4ODWA 3V4UL 3T3PE 3RPIB 3G5ZA 4F15C 3V0VA 4NC1E 1EPFA 5T1KB 1CG9B 2APBA 4KQ3H 4ZOBA 1D9KD 1I3VA 5GGVY 2DTSA 2J8UE 4UT9L 4C59B 1INDL 2EDLA 4HKZA 3K8MA 2VB5A 3BH9A 2H32H 4GRLB 4LSDA 3HI5L 4HS3A 5DMJB 4O2EB 4LDEB 4RISL 3DETD 3QHFH 3HC4H 3FRUA 3V5DA 1ZS8A 3MRFB 4JFQB 4RDQF 3BP7B 5GSRA 3MLXH 5C6PB 4O2FB 4MXVF 3VI3F 3ARFA 1RZ7L 2EDDA 1F6AA 4QWWD 3QG7L 1FNGB 1FO0H 1QSFA 5HVHC 1CFTA 5A2LH 2R4RH 1ZGLB 3C08L 3LIZL 1Z0MA 2DDQH 3QDMB 4IBLT 1MQKL 4QXGH 3QQ3B 4JY6A 3L3HB 2B1HH 4U6YB 5HDBE 5IFHH 5KOMC 4K94C 4X4XA 4MDIA 3EYOA 3PXHA 3LCYA 3T0EE 4G9DB 1BVKB 1LEGA 32C2A 3CK0L 4MNHB 2P5WD 5IGXL 2N56A 4NM4H 1JYXA 1A47A 3A6OA 4P2OB 5F7KC 3UTPE 4P2RA 2IBZX 3VGAC 3G6JF 1DEEB 1A6AB 2AXGA 3D69A 1RZJH 1T04B 3HNSH 1QLFB 2GCYB 3CX5J 4NRYB 3HZKA 5GJSL 2IFFL 3MBEC 5J12C 4G8EA 5FYLL 1NGQH 3MRCB 4NZTH 2EKSA 3KPSD 4R96A 2W9DL 5GGTL 4PRHD 2X7LB 5J1SC 3EJYD 4K94L 5AD0A 3QIWB 2Y07L 4J1UB 3VH8A 3BQUA 4ACPA 4CKVX 4LLWB 1YMHB 5C0AE 3GFUA 3CVHL 4G8GA 1V7ML 4N8VA 5BJTB 5EOTA 5HHOA 5HHME 1T7ZA 3VA6A 3SJVE 5EZOH 1DZBA 1JPTL 4LHUB 2EDTA 2VE6A 1GOFA 5C8JA 2YD1A 4QHLB 5EC2A 1ONQB 1B4JH 5CCKH 4D3CL 2VH5L 1MFCH 1NJ9A 5TF0A 5CIPH 1NC4B 3EGSB 1JF5A 4AL8L 5MENB 3MRJB 2H32B 4GAGH 3GM8A 2R15A 4MB5A 1VSCA 3FQNA 3AB0C 3PGFL 3IF1A 5EBGA 1BX2B 3DX6B 1JPGB 3DUUA 1N4XH 3FT4B 4JE4B 3O4OB 3ZTNL 3EO1B 5IMMA 3M1BA 2GSIA 4YHLL 3TJEL 1TJGL 3JWOC 1FNHA 2X1OA 3P77B 2AK1L 5J11C 4CVWA 5IHZB 4QY8A 1BQLH 1E4JA 3VXSE 1LP9A 3PWJB 4HWEL 1FO0B 2JCCE 1A6VH 5HY9B 1F90H 3AY4A 1DR9A 5A3ID 1UXSB 4TUOB 3PE9A 1AIFA 1Q0YL 5BO1H 1CBVL 3SY0A 2GEEA 3ARFC 3FB7B 3NABH 2MQ0A 5GGQL 1FAIL 1NDMB 3O45A 4U6TA 3S4SG 1EVUA 3WFCH 3DRTA 5I15H 3AS2A 4BQCA 5F97E 4R4NC 4XPAL 3WHXB 3L3KA 1KPUB 3QNZB 3KPLB 4LCCB 1PLGH 4HKXA 4PREB 5LBSH 3ROOB 1D5IL 5CINL 4LGRB 1QR1A 1H5BB 1IC7H 5HTSA 1S7XB 4JRYE 3JWOL 1HXYB 3I75A 1AJ7H 1ZXQA 2UVEA 4K55A 1KLUA 3CFJB 3ESVF 4L9LA 1SYVA 4N5EC 4UTAL 3WKMH 2V7NB 1LO4L 3HUJE 3LPWA 4Q9QH 3RAJH 3ARQA 2EYSA 4HLZH 1T2QH 2CJUH 1KGCE 4MDJB 1XF4A 1F58L 2EDEA 4RMRA 1HQRB 1F00I 1S9WB 1GGYA 4PJBF 1NKOA 3M8OH 3U0TB 3CXDH 1UWGH 4Z7QE 1IE5A 4HIHA 5I8OL 2C3GA 4KRPB 4I0CC 1D9KA 4U3HA 3RVUD 3ZKNC 4JZOB 2X4RB 3E2HC 3BQUC 4E5XA 4PY8J 3SOBH 5C09E 3DROB 3VXTA 2DQIH 4B7IA 3MA9H 4QXTB 4WI4A 5CIPB 1NCAL 4X4ME 3HRZA 3D0VA 5MHSE 4U1LA 1SY6A 3STLA 2WIIA 2AS5M 5FYKH 1YC8A 5ANMA 3GSNH 3BRFA 3NACH 4XMKH 3WLBA 2F53E 4W70A 3LS5H 1NAMH 2VZ3A 2FLRT 2DQHL 4JM2F 4CJ0A 5SWSE 5GZNC 3L3GB 4NQDD 3CFKB 5FGSA 3ZYZA 4GKNB 4XPFH 1J0IA 1CFVH 3W5NA 3DO7B 4IRJB 3UTTE 1GGIH 3DPBA 5HHMB 1R3JA 1M05A 3ORJA 1YMMD 5FM8A 4V1DD 2QEJA 1NUNB 1FNAA 3FB6B 1NH6A 4L5FH 4MXQD 2X4UA 4H88H 1IEHA 3ALPA 1FC2D 4FXKB 2DJ4A 4FQHA 3O3EB 2ATPB 3OPZH 4LASH 5LXGL 2VDMH 2XZZA 1MIML 3D9AH 4OCXH 2IAMD 2VLKD 1GGTA 4FFVD 5JNYA 2P5WA 3TBYB 4XRCB 4HUUA 3VFOB 4HUVA 2ATKA 5DTFB 5D8JL 4OAWA 3AY4C 2DI9A 4FOMA 3TBVA 3QHTC 2FX7L 4K3EH 5EORL 3NCBB 1YECH 4UAOC 1NFDA 2AJSH 4YHIA 1EHLL 3DTXA 2YOCA 4WW1B 5FGCB 1B0RA 4LLYA 4J8RA 3PJSB 1JWUB 4RMWA 4CMMA 1HI6A 4Z7UE 5CEYA 1P7HL 4WFHD 2DF3A 5J56B 5DEGB 2BFVL 3KPSA 5EG6C 3EDKA 4PRHA 4LCWE 4LPUA 4PJGA 3SE9H 4RGMB 4YIQA 3MV01 5FUZH 1DBAL 1QRNA 4ODUA 4GMSL 3GSOB 2XTJE 5DJ8B 5FHAH 2AEQH 4XPBH 1XR8A 3RVWD 4DEPC 4PJ7B 3IDNA 1QQDB 2NY4C 5F9OL 3TNMB 1JZ5A 1MPAH 3D85B 4QHKI 4GXUM 5E2TH 3EYQD 1KJ3H 1QBAA 3ARGB 5HHVH 2EDFA 3NN8B 4LRIA 4L9LC 3KDMA 3ILQC 3G6AB 2EICA 4NCC2 4TPRL 2AJXL 5JOPE 1HHIA 1MJ7L 3HZVB 4GQ9H 1F11B 1FFPB 4YXHH 2VNCA 4Y2DB 1IRAY 2M26A 3WNKA 2P8LA 4RRPA 5AYQA 1NL0L 3QXWA 1FL3A 3GSXA 5ICYA 2P48B 3GBLA 4YFDB 3KS0H 3WLWD 4U1SB 2BNQD 1D9KC 4JB9L 5FYJL 2PW1B 4LPYA 3MRDA 2Y06H 3KYAA 3OWEA 1DANU 4XCCH 3GSNB 4D0BA 3HAEH 2O5ZH 1NAMB 3DETC 2VJXA 1R3IL 5GS2D 5B39A 2YC1A 5FKAB 3H7BA 1BJMA 1IGCH 4JEGB 3RA7H 3QFDA 5EZJA 3D3VB 4EOWH 3AUVA 5CJQL 4KTYA 4WU5B 4LLAA 5F7UA 4L29A 3TA3D 4LEOB 1A0QH 1H3VA 4P4KB 3UC0L 2BHZA 2XQBH 5FHBH 4QWWC 5C0EA 1JWMA 3TZVB 4ONHA 4R6UA 3BZEB 3VFVB 5TQ2H 5F3BB 4BK4A 5B8CB 3HNVH 1BHGA 3M45A 5ADOH 2DIJA 3KWWA 5IQ9A 3NFPA 1WCBA 2N1KA 3CCHA 4LSQL 3V6FA 4DTGL 1AR2A 1MCLA 3O41B 3MLUH 4Y4HB 1P69B 3S35L 3LRHA 3UEZA 2AK4E 3FB5B 5H2BA 3UTTB 3GMOB 1S7QB 1T7VA 3KPTA 3VGHA 3QZWA 1TPXB 3VGDA 8FABA 4M62L 2DKUA 4F7TA 4FFZL 3MCLH 2YHGA 4XCNB 4P46D 4MAYD 5EZLA 4KKBD 4FQ2L 1A7NH 1OSPH 5ECJE 3X3GL 5ID0B 3PIQA 1UWXH 4X4ZA 3IB4A 2KPNA 5DK2B 4MA3B 2A6JA 2VDNL 1JGDB 2BVOA 4Z7WB 3EJYC 3OKMA 2R2HA 5IUSA 4HC1H 2ICEA 4PJXE 3S34L 3IDMB 4U1JB 1A6ZB 3P40A 4JFFB 1CGXA 3FTGA 1NCBL 4KXZH 2R1YA 5L9DH 1PD6A 4YK4C 1EUTA 4ZTPL 3QPXH 5D1ZD 2YD9A 1T4KB 4Y1AA 3IETA 1U8LB 3QIBB 5DDHB 5IK3B 4LRIC 3LSOA 4M7JL 3FO1B 1D5MB 2CDGA 1IQDA 1MFBL 1IARB 4PRNA 2OYPA 5D70L 3MXVH 2OTUB 1OF2B 4JHWH 1S5IH 5DQ9B 4YR6A 4JREC 1BM3H 5MEQA 4Y16B 4NQDA 1HEZB 1W8NA 5T3ZE 4NGHH 2OMBA 3HAEB 5D1XA 1MNUL 1BJ1J 4PRAA 3FO2B 2EO1A 1VFAA 5DC9B 3CZFA 3RWIA 1YMMA 4LHQB 4V1DA 2RR3A 4JAMA 4GSDL 4FQJH 4OF7A 5SV3A 2EE9A 3TBWB 5B38G 4NKDA 2GTZA 1DANT 3PNWB 5DGQA 3HZMB 4HIXL 2GUOB 2HKHH 1N0XL 1L9NA 4E41E 3B6SB 3JTSA 4CVXB 1N6QL 1MCPL 2IAMA 2Y9RT 3MREA 3MLSH 3C5SB 2VLKA 3RU8L 4BFIB 2GHWB 1EBAA 2UWEA 2V2XB 4MGXA 3S5LB 3O6MH 4QYOA 5A16A 2ENSA 1NSNH 3NIDF 5C0IA 5A3IC 3HB3D 5F1OB 2M8XA 1JNLL 3OKOA 2EDRA 1Z3GH 4CW1A 3QUYA 4C83B 1CF8H 1KACB 3SO3B 3S3JA 1S8DA 3RL2B 3F6LA 4YBLB 5C7XH 2PKDA 1U58A 3EOAA 4ODXB 1HSAB 2XYCA 5IG7B 1PVHA 1KXVC 5DUBB 3U7YL 1BJ8A 3JV4B 4YHOL 2D03H 3OGCA 4KHTH 2AAVA 4FMFA 1RZKH 5JLZA 2X4OA 4FTVB 3SE3A 4HFWB 1GGUA 5SWZE 4F7PA 3QSKB 2C3HA 2GAZA 1AQKL 1B90A 1UM6L 5H94A 5TPWH 4QRSA 3S9DB 5CMAB 4LCUB 3W9EB 1A2YB 3X11A 2AV7A 2P5ED 2XFXB 2J12B 2DYPD 5I1GL 4ZFGH 1KIPB 1KV3A 1JYNA 4XH2A 3DV4A 3SDCD 4NQSA 1OGTB 4WWKB 3C6LA 1QRKA 4LBEB 2EEAA 1C12B 4WUUD 2A0LD 4MA7L 2EE6A 4OLYL 5D7LE 4QRUA 4M1CD 4B5EA 3FRPA 2ZOLA 1NLBH 3D0LB 4RGOL 4OSUH 2FB4L 1OP3K 1UB5B 3LQZB 1DN0B 3E6FA 1W0WB 1FSKC 1UVQA 1ORSB 2OQJB 3RVUC 1RFDL 1UJ3A 4NRXA 2CKNA 3RKDD 1JMZA 5ADPL 1INEL 4HUNB 4NZRH 1NGXA 1MELA 5JOFB 1NPUA 3WSQL 3VXMB 4PJ7F 2DQFA 1S5HA 3F7VA 2FX8H 4PB0L 4E0RB 1H9VA 5L2KD 4U6VL 4A6YA 3AREB 2FHFA 2ICCA 5EC1A 2Q1EA 3JV6A 3V0WH 4P5KB 1BREA 4ZTOH 1F4XH 5I1HH 1YPZA 2QTEA 3A6BL 4JRXB 1J1PL 1A64A 1A6UL 5ILTL 4KWUA 5DVOA 5E8PB 4F2MB 3TIEB 4OF3A 4PJ9D 2VLMD 1WJ3A 4HJGB 3TBSB 5IMKA 3MUZ1 5T33L 3PQYD 3ZL4H 1T0PB 4HX1A 4MXQC 5EU3B 3T65B 4P57A 4J3UA 1KLGA 5GGRA 1KTLB 1BBDH 1Q9OA 5KW9H 2IAMC 4OIIL 2PETA 4Z77A 3ZHLA 1ZT7B 2YA0A 4JDVA 4FFVC 1YY8A 4NDMA 4BQBA 1ZANL 2JB5H 4OQTL 4C58B 2ZUXA 4WY7H 1MEXH 1ZHNB 4R2GD 3RZWA 3EOTH 4LSSH 1EFQA 4P46A 2JB6A 4NO2B 4OI8A 5CZKA 1CFQA 4V2CB 4R7DB 2W91A 1SJXA 5FO9A 3C2SA 1T22B 3DYOA 2WUCH 4JJHA 3VFSB 5IKCA 3W82A 1P6FA 3GMQA 2X5PA 5BZDB 5CS7A 2FHCA 1M4KA 2HTKD 4LLVB 3SE3C 3PV7A 5L7XH 2H1PH 1S7SA 1TVHA 3RNKB 1Z9SA 4XNXH 3SCMD 2OJEB 1J18A 3BSZH 1I3RA 3RVWC 2FJFA 3LH2H 4O9HH 2WQRA 5D1ZA 3MXWH 3EYQC 4L4JA 4DCQA 4IDJL 1PZUB 1OAXH 3I9GL 2XWTB 1JF1B 4GKZB 3QJFB 1ND0A 1LO0H 5EO9A 1JRHH 3QUKA 3BWUC 3BIBX 4UQ3B 5T1LD 1J05A 4NN6C 5EUOA 5IW6B 3UPRB 1MHPH 3V6OE 4I4WA 3RHWF 3IS1X 3SGDI 2PR4L 1CZ8L 4OB5H 4OFIA 4LOUD 12E8H 2JELH 5DA4A 3UTZB 4DFHA 5F44A 1QVOB 3DXAE 3LHPH 3VXNB 3G9AB 4YAQB 5EU7C 3WLWC 3I6KA 4F58H 2PF6A 5IHUH 5JIKA 2M2DA 3U2SA 5EOCL 1UJ3C 4Z7WF 2YS4A 3O3BA 2HT4D 4UI2A 4B7LA 3DNKA 3B3IB 2Q8BL 4RWYL 1C1EL 3RP1A 4LAJH 1D6EB 1R5WA 3QNXB 2FIKB 2I9TA 3QISA 3EFDL 5DK0B 4KMTH 3NZHL 4MMZC 3GUTB 4M7KL 3GI9L 1RIUL 3MNVB 1BOGA 2DLHA 2Q7YA 1G7JB 3TA3C 1Q9KA 3QNYB 1HINH 3QFJB 2ITCB 5JQ6H 5KS9B 2ITDA 2YPVH 5J6HA 4AT6A 1XIWB 1LDPH 3KXFD 4M1DH 2EYRB 1UB6B 1JGVH 4QF1A 2UY6A 5EA0H 5F7DB 2EDYA 1BQSA 1MLCA 1T1WB 4JPVL 2B8OT 3VFTB 3PABA 2CRMA 2WW8A 3CMOH 1FNEB 2K9UA 1ZVSA 4GXVH 3GIZH 2R23A 2X4NB 4ODHL 5GSVA 2DBLH 3HR5B 3IU4H 1NBYA 2YD6A 1U8NB 3UXFA 4HPYH 5A2JH 1NGPL 1VHPA 5C86A 3LV3A 1S7RA 5CEXB 4A6YL 5JHDB 2P5EA 5GRVL 4P46C 4YHKH 4JZJA 4MAYC 1NUFA 2DYPA 4HT1H 4KKBC 4FN0A 4YHPA 1KN4H 2IADA 4ZO7A 2APFA 5IMOB 2A6IB 1T2JA 4FQXB 5T1MB 3C09B 5AZEH 2A77L 5EIVA 5F96H 2J3SA 3MSPA 1CT8B 4NUGH 1MFDL 3REWA 1VB9A 4BZ2L 4I8DA 1NCDL 3GGWA 1DQQA 4NN7C 5KG9A 2DB8A 2JTDA 1RAMA 3VFWA 3IXTB 4MLSA 5D1ZC 4BSWA 3KPMB 3OR7B 4NNXA 1R3HA 5D9SA 5JXED 4KDVA 4AEHH 3MMEA 4DWHA 3FCTB 5L2KA 1RUQH 2Y5EA 2MCPL 3GMRA 3I02A 3GRWL 4JQIH 4HUWA 3NA9L 5MEOA 1JK8A 2EDBA 5EO1B 3NOIA 2X4QA 5HYQB 2F58L 3M17A 5C0BE 3EHBD 3MBXL 4PJ9A 1YN7A 3WIFA 4L4VE 1YYLH 2ICWI 4TVSa 3PQYA 1DUZB 6FABL 5E0QA 1I1AD 2R2EB 3SDXE 3QG7H 2R39A 3X13A 5JW5B 3LKNB 1QLEL 2X2YA 3AS0A 1G1CA 4RQQB 5AAWA 3PGDA 1OL0A 3SE8L 3CIQA 1IGTB 3QWRD 4M61A 2JIXB 3O6LL 4PJFE 4PJEE 5HDOA 1F8TL 4OBRA 3TBTA 5KZCB 3T1WA 4O2CA 1GJIA 1ZLUK 3VXQA 2J5LB 1T1XA 4MNGA 4M6AA 4PRPE 4WI3A 5CKAA 3ZKQD 3HB3C 2BZDA 4U1NB 4FQCH 4OKVB 4F7CA 3AAZA 1NMCC 2YSSA 3MROA 3UBXB 4NQEE 2VMFA 3C87A 3MRPB 4ODSL 1W0VB 2HFGL 3E3QE 4NJ9L 4MAUL 3A67L 1N6VA 2NY3D 5F3HA 2ESVB 3TVMB 1G7QA 1AD0A 5F1KC 5GJSH 3BN3B 4LK4A 2IFFH 1VFUA 1YEKL 2YXFA 4YZFF 3FFCD 1A1NA 5I1DA 4TSBL 3PDGA 5FYLH 5ENWA 3V4VH 3SCMA 4LQ1A 5GGTH 3BPNB 5HVWA 1IGFH 4ZUVB 1IEBB 2V2WB 1ADQA 3AS1A 1ORQA 3V5HB 5KTEH 5B3JF 5K93A 2Y07H 1TQBB 1QFWM 4Z18A 5FEBA 1OD9A 3PHQB 2YUZA 1U0QA 1M7XA 4JZJC 5T1LA 2ARJA 2YMXL 1C5BL 2D4DA 1V7MH 4H1LH 4NRZA 3FFDB 4I3SL 3D25A 3SDCC 2YD7A 3ZTJH 1U92A 2VZOA 2H3NA 1OTTD 1J8HE 2A0LC 4M1CC 5J1AA 4D3CH 1TJHH 3FZUD 2VH5H 1JHKL 2NLJB 4UB0L 3LKSA 5BOPA 4XVJL 4EI5B 3UP1A 5E6ZA 4Z7VE 4AL8H 4HHAB 4BSVB 1EJOH 4JCLA 1MFNA 4QHNA 3RKDC 2HJKB 4JFXA 3TEUA 3L9RB 3WUWB 2P45B 4QRPD 1T1YA 3BP6A 3AXLB 3FO0H 5LVEA 1YN6B 3CSPA 2O93L 5FB8B 2VQ1A 3B5GA 2YA2A 3RUGB 4XAKE 2IMMA 1TZHB 4M9PA 1OAZH 1GZQA 2YUWA 2X9YA 4XMPL 1AD9A 5EB9A 5EFIB 3OV6A 3TJEH 2DQTL 2I5YH 2AKRB 5BV7L 2AK1H 5GGSY 4OCMC 3UYOD 5HVGB 4HWEH 3MR9A 3MUGA 5EULV 1OLZA 5JDSB 5KN5A 5TDNA 2D31A 1MHHA 4PJ9C 1DBKL 3KXFA 1MI5B 4F15B 1CBVH 1RY7B 1TVBA 2DLGA 5GGQH 5DO2D 1YEFH 2UZIH 3P0VL 3THML 3ULUD 1FAIH 2AXFA 2VSCA 4DZBA 4Y0GA 3VG9C 2PYFA 4QHUA 3KYOB 4HIJA 4N0FB 2HAZA 3B43A 3PGCB 1QR4A 1AKJB 3HG1B 4TNVK 1ZHLA 2HYMA 3IVKB 1KCVL 4L8DA 3UTSB 5CINH 3WD5L 4D9QE 4X0KA 2VOTA 4R2GC 5CBEA 1F6FB 4F57H 3QDJD 2YPKB 2ZUYA 3E6HA 3MNZB 4Z95L 1HHJB 1AY1H 1WBYB 2CXKA 4OM1L 5I2IA 5FFLA 4KDTC 4AYFA 4N0UE 5IOPB 3F12B 4WRLA 4LVHB 1U3YA 1PSKL 3SDDB 5HVHB 5KS9F 1TJIH 2EDNA 4M6MH 4NFBA 4G43A 1LO4H 4GAYA 5ESAB 2XWJA 1A9BB 1TCRB 1HNFA 3NCFB 2HTKC 4RFEB 1JPST 5I73B 5FOJA 2VLRD 1LGVA 1M6OB 2JJTA 3B9KD 3SCMC 4JZNA 4QCIB 4PRBA 4PTTA 5FIEA 5CEZE 5I8OH 1RULL 4H1LB 5BRZD 1KCLA 1P84K 5E5MA 4R90L 1A7RH 1E4WL 3VH8G 2V7HA 4X9IA 4ODTH 5JXEA 1D6VH 1Q8MA 3QI9B 5F88A 2AQ3A 2FO4A 4N8VG 3FAXA 1QLRB 4I2XE 1NCAH 1OHQA 1AGFB 1AGDB 1ZSDA 4QRQB 5LKNA 1V8HA 3VFNA 2BNUA 4L4TE 4LARL 3BRGC 4YHNA 4LOUC 5GRJH 3MBEB 4L8CB 3HE6D 5DD5L 3BP4A 3H6JA 1MCWM 3L3IB 4X5LA 4LLUA 4HBQA 1GRWA 4K3GA 5L88L 2GKIA 2R29L 1KB5A 1I1AA 2VUYA 3MA7A 4P59L 5CEZH 5C08B 2HT4C 2WIMA 4NKOB 3T4AB 3BO8B 2ZZUT 3KHOA 5K9OB 2C7UA 3IJSB 5T5FH 1A8JH 2A73A 2I9LB 3WNLA 2B7DT 4AIOA 2Y4SA 1KTDA 5CKGA 1MIMH 3B2UD 1EFXB 1GPOL 1BGXL 1T3FA 1VADA 5D5MF 1QOKA 1JWSA 3QBTB 1AO7B 5IF0B 4KQ4L 2YEZB 4PYGA 4KC3B 3RWGB 1VESA 1G1YA 4I0KA 1KJVB 5EORH 1S3KL 2ZCHL 5I1CL 4Y4KD 3VMOA 3AB0B 1NLDL 2B0SH 5ERWA 1N5AB 2X4SA 3BZDA 3WDIA 3KJ4C 3OKLA 1HILB 2CIKB 3NVQA 4U2YA 3FFCA 4JFED 4DKEL 3MNWA 4NO0A 1U8QA 4MB4A 4TVPE 3WE6A 4BJLA 4WEBH 2BFVH 2XXMB 3KHQA 4MX7B 3RIFF 4XNQA 1J8KA 5KJRH 1OARL 4DW2H 2MPAL 1AGCA 1K8IB 3PWLA 4GMSH 3VXPA 3GMLA 1YNLL 3DRQB 3H9SE 2DLFH 5CJXA 2VXTL 2Q20A 2OSLB 1CGUA 2UUDH 3O0RH 1G7HA 5ICZB 5DJDA 3O2DA 4WJ5B 4NYLB 5EIQA 5L6YL 2Y36H 3D6GA 5JTWA 4X7DC 1PEZA 1A7BA 4PUBH 2AJXH 4K2UH 1MJ7H 3WNNA 3CFBA 5GRWA 1HZHL 3CDGA 3QCVH 4OGAD 1HCFX 3W9DB 3DV6B 1L6XA 1OAUH 5BQ7A 5ESVA 1X3DA 3IAPA 5K59F 2MCG1 4NJAL 4PJDE 4N0UB 4NT6A 4QRPA 1VEMA 2J6EH 4JB9H 1E4XI 5JXEC 3GJEB 4GG6A 1ZHKA 1JN6A 3MLVL 5ID1A 2HLFD 4DVBB 3BIKB 3MJ9A 5MERA 4J3OC 3VW3H 1S9YA 1VFBA 3QDGB 4LAQL 4UT6L 2WP3T 2JJUA 5GIRB 3WKNA 1ZHBB 3QEHB 4QTIL 5DJZB 3EHBC 2ORBL 2C9AA 2IWGA 4WI5A 1FIEA 1YYML 1WWAX 4WHYH 4EZMA 1I1AC 5E2WH 1V05A 3VI4E 4I3RL 5DYOB 4TRPL 2XNAB 3I6GA 2QQQA 4JFHD 3QXAA 2FRGP 1CLOL 1QFUH 4X8JA 3UO1L 1P53A 2VLJB 4DN4H 1L0XA 1K2DB 4HGKC 2R9HD 5M94B 1NFKA 3ZE1E 3RUGF 4KRNA 1ITCA 3MV8B 3NIGF 3MRMA 3L7EB 3L3OA 5J4MA 4DTGH 3BJ91 2ZNXA 3QDJA 4EIZC 2GK0A 4UQ2A 3O11B 2WBKA 1JZ2A 1UQSB 1FCCA 4HWZA 4D94A 3OX8A 4JM2D 2NY3C 1UM4L 4NM8L 3ILPB 4M62H 1F2XK 1QHOA 2HN7A 4FQ2H 4MJIE 1KB5L 3TO4D 4D8PB 3ARYA 2WWMD 4M7LL 3X3GH 4E42A 5DEZA 1NANI 4JHAL 5FV1L 1DUYA 5KAQG 2VLRA 3RGVB 4Z5RB 5T1KD 2AXJA 3B9KA 3NPSB 5FDWB 3KG5A 3OKYA 1XGRA 4ZUSA 5BRZA 4R4FH 2ID5A 4GRLD 2AJZB 1P7QB 1BQUA 1X5ZA 4X7CC 3GSQB 4OZHB 3CH8A 5CJXC 5GQBA 1NCBH 4EDXB 1JZ3A 4S2SB 4ZTPH 2GT9A 1MCBA 3MRNB 5GJTH 4WI2A 4PYHA 3BOVA 3Q6FA 2ZUUA 5EPMA 5FF6B 2ZG3A 5L8LB 1ZLWK 4OLUL 2NW3B 1OTTC 1MFBH 3O6KH 1A3RL 3HE6A 3D39E 3FZUC 3BX7C 1UT9A 4PS4L 4LLMB 4KHXL 2YD8A 3OKDB 5H8DA 1U93B 4NNYB 4KUZH 3QDMD 4JFOB 1K8DA 2R56L 1MNUH 4X4YB 1SYSA 3FO9A 3RX5A 1P1ZB 2VABA 2OZ4H 1S7VA 5I1IL 3PP4H 4GSDH 3MRRA 5AWNH 4HIXH 4UIKL 1EMTL 1N0XH 2ZKHL 5IHLB 2LVEA 1MCOH 5C2BL 3GSRB 3V9FA 1MCPH 2VDKH 1FL6B 1P6AB 4P2OD 4OD2B 5HDQL 4U3XA 5I8CB 4Y4FA 3IJHA 1G0XA 5CJOH 2XPGA 3VXRE 1G6VK 2RAMA 3F7YB 4GW5A 3O81A 4Y4KA 3P30L 5F9WC 5K9KB 2FDBP 1SEBB 5DO2C 2RB8A 4MCYA 3TPUB 2XN9E 4WENB 3ULUC 1KYOK 4FRWA 4JN2B 1B4RA 4JFEA 4ZSOB 1PZ5B 4IRZH 2VN4A 2ERJC 3GJFK 3PV6A 4WDIA 1NMBL 5I1AB 3BESR 4JCMA 5EN2A 3QIWD 4XVSH 1BEYH 4YPGA 5F7HA 4M6NH 3LKQA 2EH8H 5A2IH 4YNYA 2EECA 3S4SB 4YEFA 1JMXA 3BGFC 3WFZA 4K9EC 5IVXE 3MJ9L 4H25A 4HGWB 4BQ9A 3NCEB 3Q1SL 4N0YL 1VENA 4LSPL 4LHUD 4XBEL 3ETBF 1LVEA 2QHLA 5IVZB 5AUMA 2R0LH 3CH1A 4LSUL 1NC4D 3EYSL 3FHAA 5I1GH 3D2UA 4MD5A 4H5SB 1OAYL 3ULUL 1UKQA 3TGXA 1T5WB 4M93C 2QADB 4MA1C 2V5MA 4MA7H 3B9KC 1CDHA 4OLYH 4S10A 3RI5F 4HKBA 1T89A 2FB4H 2HRLA 3CMGA 2LVCA 1FGVH 4U1MB 4UU9B 3JSSA 5HYJE 3MLWL 3ULSB 5JXAH 2G60L 4MJIB 3V7AG 3QA3A 2IQ9L 1P5VA 4K9EL 4HUMB 4X9BA 1OP5K 1L7TL 2W65A 5T5NF 3RL1B 2CSPA 3BAEH 2C26A 1R24A 2Z93B 4J8RB 4O00A 3H3PH 1OQXA 4PB0H 5D2LB 3MCG1 4Z8FL 1ZVYA 3HE6C 4NUJB 4U6VH 5E99L 4Q6IA 1NGWB 2VXUH 5IM7A 3WXWL 1AQDB 5IB3B 1D5BA 1MH5B 1U3JA 2XY2A 3PDOA 3ZDZE 4UDTA 3A6BH 4PJBA 1J1PH 5BVJB 1A6UH 5DD6A 1XGTA 1NBQA 1TTFA 1EEUA 2V9RA 3U6RB 3MLRH 1RK1B 5TE6H 2Y23A 5C9JA 1M7IA 3DURB 3H9YA 1JNHB 3AU1A 4X6EB 4W6WB 1CR9H 1KC5L 2XRAL 2EH7H 5I76A 5I8EA 4IRSB 2VQTA 3KNBB 1WVZA 2BNRE 3RWFB 2ZSWB 4PGEA 4J2XA 2FZ3A 1KG0B 1QBLL 2HKFH 3B2UC 2PO6B 4NHUA 1OTUD 3OKNB 4LNRB 4OIIH 1MRFL 5INCA 3QUMA 3R1GL 3U79A 1AI1L 2VRAA 1PX4A 4XNMA 4OQTH 4JM2A 4Y4KC 2JK5B 1BFTA 3T0ED 5SX5K 1MCFA 4TSAH 5FUCC 5JUEH 3TO4A 2NZIA 5F6HI 3FOMB 3RPIA 1R3KB 2BSSB 4WI8A 2F5BL 1WIPA 1CG9A 5T1KA 4KRPD 4HW6A 3L5WB 3IDIB 2FHBA 3EOYG 5L8KB 2DLEA 3GSUB 3BH8B 4OQ1A 4X6FB 1AGBB 4GRLA 5CZXD 4HFUL 4O2EA 1XCTB 5F7EL 2APXA 4L29B 3QT2A 4JR9H 1J1XH 2COQA 4MWFB 1VACB 5E2VH 4AIZB 3D48R 3MRFA 4JFQA 3BP7A 4IDJH 4KPHL 2OK0H 4OFPA 4O2FA 4PRIB 3P11L 1FBIL 2PCPB 4OGAC 5DT1H 1FNGA 2PR4H 5I9QB 4IRJD 1VA9A 1ZGLA 1T5XB 5HHMD 1XGYL 4LVNC 3QDMA 2XKUA 4R3SB 1T89C 1MIEH 2P7TB 4ZPTB 5LGJB 1MRCL 3QQ3A 3CSYB 3L3HA 4U6YA 1TTGA 3OJMB 2WQ8A 5E8NB 1HWHB 4ZD3H 4CN1A 4L3CB 3G04B 1VDGA 2PYEE 1ZA3B 3IU3A 4G9DA 1BVKA 3ULVE 2HLFC 4MNHA 2BJML 1MJJB 4OZHF 3VFUB 1PKQB 4YFLF 2Q8BH 4P2OA 3T2OA 5C0CB 3TESA 3CLFL 1TQCC 1DEEA 2IANB 1A6AA 4M00A 5I1EH 3EFDH 3F7RA 5KVEL 4Q6IC 3DHMA 3NZHH 5JPMB 4M7KH 5D2NE 3GI9H 2H2SD 1T04A 1QLFA 2GCYA 3QCUH 4K3HA 4NRYA 3DVIA 4H8WC 4UTBL 3OZ9H 4OUUB 1FSKB 3ZE2E 3VXSD 3CX5K 3HE7D 5HHNB 3MRCA 1U8PB 3QEGL 1CTOA 2X7LA 1WBZB 4LU5L 2R9HC 3T3ME 2J2ZA 3BRDA 5DMGD 4G42B 3P4LA 3QIWA 4JPVH 4J1UA 4WVRA 1Q72H 4LLWA 4TULH 1YMHA 5BJTA 3ARGD 3R0MA 3ZE0F 4MQSB 4RIRB 5J1TC 2NXYB 4LHUA 1CLZH 1MCSA 1VPOH 2W38A 4QHLA 1ONQA 1A7QL 4JM2C 3O9WB 1QKZL 3QEUB 4G6KL 4Y2DD 2VDOL 3ARVA 3NH7H 1LQSR 1NC4A 2F54E 3EGSA 1DDHB 3LEVH 4JRYD 3O2VL 3OXSB 3PWPE 2IPTL 3MRJA 3TO4C 2H32A 2WWMC 2VXQL 4OF5A 3FQXB 1CGVA 3NZ8B 2F19L 4QOKE 3MREB 2ZCLL 2NX5E 1BX2A 3DX6A 3UJIL 1C16B 1N7MH 5FYKD 1JPGA 3FT4A 1KGCD 3BGAA 4GRLC 3EO1A 1J1OL 1NCDH 3GMMB 2JF1A 3P77A 5IHZA 1J87A 5KSUB 5C07E 3PWJA 1DJSA 1BD2E 1FO0A 1HSBB 1CDGA 5HY9A 3HS0B 1UXSA 1IC5H 4P4KD 3VFRB 3GRWH 4G9FE 1NDMA 1P4IL 1DSFH 5HHXL 2F58H 5MHSD 5ACZB 3K8KA 3B9VA 2Z8WC 5GISL 3WHXA 1KBGL 1KPUA 3QNZA 5FYKU 3KPLA 4LCCA 4ODVH 5HBBA 1BFSA 6FABH 4PREA 1LHZA 3ROOA 5SWSD 1H5BA 4OZGB 1S7XA 3O8XB 4Y4HD 3SE8H 1HXYA 3VRJB 4LLQB 3O6LH 2B39A 2Q86B 3OQ3B 3VRLF 3UTTD 4P2OC 4F8TA 2O5XL 3CFJA 1S9XB 4YHMH 3DARA 1UH4A 5B38B 3NBNA 3U4EB 5K9QI 1JJUA 1IAKB 2OJZL 2V7NA 4GAFB 2DQDL 5D2LF 2BX5A 4TYUA 4PJHE 3T0EA 2YRPA 4MDJA 3CDCA 2BNQB 4GXUN 3N85H 1JFQH 5TF1H 1HQRA 1IMHC 4PR5B 1S9WA 2HFGH 4NJ9H 1YA5A 3QEQB 3U0TA 1I7ZB 4JO1L 3VU2A 5MEPB 3BDXA 3DUSA 1F4YL 5FCSH 4OGXL 4L1DA 4XPGL 3AS3A 3QIWC 4KKLD 2ZUTA 2ADGB 4JZOA 1CE6B 2X4RA 4KI5E 3V6ZB 3TIDB 4TSBH 3DROA 3NCCB 2FLBT 4MJ6B 4P23D 2XZAL 4QXTA 5CIPA 4NO3B 4OD1H 1NAKL 3QIBD 3TA3B 2KBGA 5ALCH 3VJ6B 5F6IB 3VDBA 2BVUA 1UGNA 3V4PH 2L0DA 3WYRA 5C0RL 3WHE1 3MGTB 2J4WL 4Y16D 3L3GA 2YMXH 5IB4B 3CFKA 4JFYB 5E8OB 4DGVL 4GKNA 3J8F7 5DRZB 5KVFL 4JGUA 3K2UL 4FQ1L 4MQTB 4EEEA 5TQ0L 1WFUA 4IRJA 3DO7A 4HV8B 3LS4H 4PJ8B 2DQEH 4FNLH 4PP1D 5ACLA 1A6PA 3Q3GB 3FB6A 3DGGB 4MNQE 3ZO0A 4XVJH 1MWAH 4FXKA 3CXHK 1J5OL 2P42B 2ATPA 3O3EA 5KVGH 5JW3H 5I74B 5DZOA 4JHBA 2ZUQB 4QNPE 4GAJL 1KIQB 2VQUA 3TBYA 3KPRB 3NTCL 4XRCA 4MAYB 1WZLA 3VFOA 5DTFA 1J9CT 1UH3A 4NC1C 3KR3H 2DM4A 4QXUH 3K7UA 5D1QD 3TYGL 4Y19B 4OLWL 4YEEA 2V6HA 4XMPH 4R7NA 1IAIH 35C8L 5BV7H 3V8OA 4WW1A 3NMEA 3AGVA 3PJSA 1JWUA 2R0WL 2AJUL 1MREH 3MZTA 2BRRH 1Q38A 5DEGA 4NN7B 5IB5B 3HC4L 4U31A 2MWCA 3P0VH 3GSOA 3MLXL 3VFGH 3ZT5A 5DJ8A 2HVKB 1RZJC 5DQJB 2EIZB 3K3QA 3L95B 5J7CC 4OI7A 4M8QB 4PJ7A 3TNMA 1OTUC 1QQDA 3D85A 5KANG 4ZQKB 2PTVA 5SWQB 4IIQC 4MA8L 3ARGA 1FO0L 1QYGH 1UJTA 3NN8A 4HS6B 3UDWA 5D7IE 3G6AA 2R4RL 2DDQL 5DURB 1XGQB 3K0WA 3HZVA 1V5JA 1F11A 1FFPA 4QXGL 4Y2DA 3T0EC 2B1HL 5IFHL 4OM1H 4M5YL 4WWKD 2VWEE 1HDMB 4KXZI 3RPKA 5BS0E 1L7IH 3HMXL 3WIIH 1MHEB 2VR9A 4NM4L 4KRPC 2HH0L 3C2AL 3EAKA 1KEGH 4U1SA 1JI2A 2P8PA 2PW1A 1DN2A 2VZUA 3L5JA 4J3TA 1FNSL 1FQ9C 3GSNA 1X5XA 5CZXC 3RJQB 1RZJL 3O3AB 1KJMB 2FL5B 1NAMA 5DJXB 2BOCB 3HNSL 3VXMD 2X1WL 5FA3B 4PJAB 4L3EE 5FKAA 4PD4K 2V5TA 5C70A 4U6HB 1NMCB 1UWEL 2KL6A 4Z7NE 3TYFB 3VGFA 3B4NA 3ARED 3D3VA 1NGQL 4M9OA 4NZTL 4WU5A 1P4LB 3ZHKA 2A9NL 5JO5B 4LEOA 3UTOA 4P4KA 4DJMA 4JRXD 1IGIH 3TZVA 4HWNA 3BZEA 4LARH 4IRJC 4R26L 2XA3A 3K4DA 4X4MA 3VFVA 2D7PA 5F3BA 4K8RH 1JZ6A 5B8CA 1KJ2L 1QFWH 3EDEA 4K71C 5L88H 1A02N 4C55A 4MLIA 4N9OB 3S3PA 5CCKL 4GG8B 3O41A 4JDTL 4KZDH 4Y4HA 3EDFA 5BV7B 3PF2A 4JZJB 3FB5A 3IAQA 5EBLA 3O6FB 3UTTA 4DGIH 3GMOA 1S7QA 1QTYT 5TE4H 3SDCB 2ARJQ 2G75B 4EJ1C 5CD5D 1KIUA 2VXSH 1FL5B 4WUUB 4XCNA 3DOSA 2H2SC 1DQJA 3B2VL 1YUHB 5ISZB 4X6CE 3U7WH 4OF6A 2KH2B 3B8SA 1N4XL 3GEWB 3HE7C 5ID0A 4GRWF 2AJYL 1KXQE 1S3KH 2C3WA 2E6PA 4RGMC 4MA3A 2VZSA 1JGDA 4Z7WA 1A6VL 5DMGC 3IAGC 3IDMA 4RMVA 1A6ZA 5EOCJ 3QB7C 4JFFA 4Z0XB 4XP9H 1RD6A 3GB7B 5BO1L 2B5IB 2C5DC 4OZGF 1A14H 3NABL 4FG6D 4P23A 1T4KA 1U8LA 3QIBA 5DDHA 3ARGC 5IK3A 4N90E 1K3IA 1D5MA 3FO1A 4HS8L 3O4LE 3UJJH 3WFCL 4QHKJ 4MS8D 1YNLH 2OTUA 1OF2A 3U0WL 4Y2DC 4J3VA 5SWZD 4JRWA 4G7VL 5DQ9A 4Y16A 3GO1H 1HEZA 4BZ1L 1J86A 5LBSL 1QNZH 4HXAH 5L6YH 1SJEB 2DRUA 3HAEA 3FO2A 1OLLA 4NZJA 1AJ7L 4TQEH 3IDUA 1B0GB 1HZHH 3TBWA 4AK1A 3PNWA 3HZMA 2GUOA 3EKCA 3WKML 4IOIB 4P3CL 3B6SA 4CVXA 2X70B 3GMNB 3RAJL 1FVDB 2YD2A 3T0AA 3C5SA 3QXVA 1T2QL 2CJUL 1UM5H 2V17H 4BFIA 2V2XA 2D7MA 3S5LA 1AGEB 3EZJB 5E95B 3HPLB 3PL6B 5D1QA 2OL3L 4RFNB 3GMPB 3M8OL 4KTEH 1Y0LB 3WIHL 5KSBE 4HCRH 4P4KC 4C83A 5D93B 5GGUB 3RL2A 3MFGB 1EAJA 1XIWD 3MJ7B 4EVNB 3SOBL 4ODXA 1HSAA 5IG7A 5B8CC 2DQIL 4QTIH 3DHJA 3JV0A 4ZUUB 5DUBA 2ORBH 3Q5TA 3JV4A 4S1SL 1YYMH 5GS3A 1G9NH 1YEHL 4FTVA 4X9GA 5FYKL 4HFWA 3K46A 4W81A 4TRPH 4XP6L 3NACL 4XMKL 1GAFH 1CLOH 4Y4HC 3LS5L 2VERN 3WFDH 4PGDB 1TITA 5CMAA 1LE9B 2HT2D 3RZCB 1CFVL 1TPXC 3H8NA 1R3LB 4LCUA 3MTRA 3T2NH 3W9EA 1A2YA 3QDAA 2OP4H 1Z9OA 4P2QB 2XFXA 4P2RE 3EFFB 1CDIA 5DRNB 1KIPA 4LSVL 4L5FL 3H7LA 4H88L 1TZGH 4MJ5B 1OGTA 1XFPA 4HC1A 2LABA 2AQ1A 4WWKA 1DBBL 3HCVB 4FQXD 1C12A 2IBGA 2VDML 4XT1C 5EBWB 3D9AL 4OCXL 1A5FH 3D0LA 4NM8H 1ES0B 1RJZA 1UB5A 2BSTB 3LQZA 2BK8A 4KK5D 1OTSD 4I48B 1DN0A 2LU7A 1W0WA 2W0KA 2NY0D 1ORSA 2OQJA 4KKLC 2VAJA 1HH9B 1JVKA 5DXWA 1JRHI 1YECL 4U6XB 3QXTA 2AJSL 3NCYS 2QQKL 3C6SB 1G7PA 4P23C 5JOFA 4EKXA 3QIBC 4LRNL 4M43H 4RZCB 3VXMA 1WK0A 5IEKB 1T6VN 5EUOF 4E0RA 3E8UH 5HHOE 3AREA 2JJWA 3CSBA 2Z31D 4Y16C 1F3DH 5FUZL 1HCVA 4JRXA 5E8PA 4F2MA 5FHAL 4OLUH 5EU6B 3TIEA 2AEQL 4CVUA 2E7LC 3INUL 2E9JA 4PP1C 4HJGA 3TBSA 3H42H 4JVWA 1MPAL 5EU3A 2QLVB 4KHXH 5E2TL 1KJ3L 3T65A 5HHVL 4Y5XB 2Q3AA 1KTLA 2JIXD 5KZCD 4YXHL 1ZT7A 4G80B 2DQUH 2NZ9D 3BMWA 1AP2B 3KLSA 5D7KE 1VKXB 5I1IH 4WTZG 2BY2A 4PJAF 5DHVH 5D1QC 4UIKH 1U8KB 1ZHNA 1LP9E 3LRSB 2X05A 3P9LB 4NO2A 1MCNA 3SO3C 5HDQH 4JVPA 4YBLC 5K9JH 2Y06L 3W0WE 4M48H 4R7DA 4PBVC 4HWBH 5HYSG 1T22A 4GLRH 4QTHB 3VFSA 2ESVD 1GGBL 3ZSSA 2O5ZL 1X5KA 2A38A 4ZFOB 3TVMD 3KYMB 3P30H 5BZDA 2UZXB 1G7LB 4NC2B 4GFTB 4JPIB 4LLVA 4UV4L 2VDLH 3RA7L 5DMIH 5E5MB 5KSBB 4PY7B 3RNKA 1NFIB 4EOWL 4UILH 3T08A 2OJEA 2EO9A 1XZ0B 4WTWA 3WNMA 1UENA 2A1WL 1A0QL 1NMBH 2BP3A 1BLNB 2VL4A 1ACZA 2XQBL 3Q48A 2A2QT 3WL9B 2XWTA 4Z76A 2HJFB 1JF1A 3SKNB 4GKZA 5E8DH 3QJFA 1AE6H 4M3KB 1D5ZB 1I1RA 1CLYH 1MCJA 4UQ3A 4RDQG 5IW6A 1HXMB 5KVMC 3UPRA 4N0YH 4WWKC 3CU7A 1FLRH 2NTFB 4N1HB 2ICWB 1PBYA 4TTDD 3UTZA 4Q9CA 3BXNB 1QVOA 3G9VA 3T77B 3MLUL 3N1MC 4LSUH 3VXNA 4YAQA 4EI5D 5IVNA 2G2RB 4OLEA 3X12B 3RHWK 3B3IA 2VZTA 1I9RH 5CILH 2IPUK 5DWUH 1CVSC 3CUPB 1D6EA 2ED7A 3MOAH 3QNXA 1Q0XH 4NKQB 2FECI 5DK0A 3QDHA 5DLMH 3AREC 3GUTA 2B1AH 4NO5B 2BHUA 4YXLH 3TM6A 2G60H 3MNVA 3OG6B 4PJIB 1G7JA 1AHWC 1FFOB 4K9EH 3QNYA 5F70A 5ANME 2P44B 1L7TH 2O26U 3QFJA 1ZLSH 2ITCA 3EYVB 1RK0B 5KS9A 4YDJB 3MRHB 4HC1L 3L5XH 4S1DD 4YBQD 2UZYB 5F71A 2VLLB 1XIWA 3BDYL 2EYRA 1UB6A 1MHCA 3QPXL 3WXWH 2NY7H 5F7DA 4AM0B 2BSED 1XEDA 1T1WA 1X44A 5DHVB 1IM3B 3L3DB 2D7QA 3VFTA 1O7VA 3QUZB 1FNEA 4DK6A 3MXVL 5IW1B 4LKCB 1S5IL 3MRIB 3T0BA 2X4NA 1AKJD 3HG1D 5GGRY 1KC5H 2XRAH 1BM3L 2GSGB 4OM0L 4AENB 3HR5A 3UTSD 1U8NA 1SY6H 1JI1A 4MQ7B 5CEXA 3R06B 4NGHL 5CD5C 1CGWA 5JHDA 4YHZL 1X4XA 1FYTB 4POZD 3HFMH 2I25N 4U0QB 1CFSB 1NFDE 4FQJL 1RZKC 1OPGH 2DKMA 3SDDD 5IMOA 2HKHL 2A6IA 5FYLD 4FQXA 5T1MA 1GGCL 2Q7NA 1A4JB 3MLSL 3EZ8A 5B21A 2E8ZA 1X7QB 4YQXL 5BOZG 1JNJA 1CT8A 1RZGB 3EOBA 3O6ML 4TUJB 4PRHE 4C57C 1U8IB 1YEJL 3BEWB 4PJGE 1OAKL 4OV6F 2LU4A 5T3ZL 1FFQA 1QRNE 3JWDH 1Z3GL 3IXTA 4UIMB 3W0WB 2GJJA 2F5BH 1XGUB 5E6IB 4FG6C 3KPMA 3OR7A 5DA0B 1CF8L 2FEDD 1M71B 1OP3H 4JQXA 5DQDH 3PWNB 5C7XL 4C56B 3FCTA 3QI9D 3G6DH 2P43B 4HFUH 4MS8C 5F7EH 4BFGA 5BZWA 4U7SA 1JHTB 2K7QA 5FGBC 2D03L 2Z31A 4GBXB 4LSRL 4DKAA 5EO1A 2FBJL 3WJJA 5HYQA 2YXMA 5SX4H 3SDYH 2JLLA 4POYA 1PQZB 4QRTB 3UZQA 3X14B 3IDXL 1DUZA 5F7WC 5INDB 2D0GA 2R2EA 3MYJB 5TPWL 2Y7QB 5JW5A 3LKNA 4RQQA 3IDYB 3S37H 2WUBL 4OCYL 4J4PD 1XGYH 1IGTA 2JIXA 3KAAA 3IJYB 2YRLA 1U95B 1MRCH 1T66D 3IKCB 5IROA 1G7MB 1R6VA 1CU4L 1E6OH 3V8CA 4MZ2A 1OCWL 1U8MB 2DM2A 2VDRL 1K4CB 4FFWD 2EXWD 1EFXD 1F4WL 4ALAH 4U1NA 3QG6B 4OSUL 4OKVA 5DJ6B 1AO7D 3C8HA 5EOQH 3OAYK 1BOYA 2ZNWA 4XBGB 1JHLL 3MRPA 4ELMB 1W0VA 3CLFH 4XAKD 1XIWC 2AI0L 4PLNC 4NZRL 2ESVA 1T1ZB 3B9KB 3W39B 3TVMA 2X1XR 2PTTB 4XCEB 2FX8L 1U8OB 1FP5A 4OZIB 1IGYB 3OBAA 1IT9H 4ETQB 3U48A 3V0WL 5ETUB 4RCAA 3BZFB 3ALXA 3MRLB 4GQPH 5E4EB 4ZTOL 1BQHG 4ZUVA 4X98B 1IEBA 2V2WA 2HT3D 3BUYB 3V5HA 2HT2C 2O61B 1WEJH 4BUHA 3PHQA 1I9IH 4ORZC 4K3DH 4RAUB 3IT8D 4OKDA 3FFDA 1U3HB 2O5YH 1IAOB 4FQXC 4OZ4B 3C09C 5KW9L 4P4RB 1QKZH 2NLJA 4G6KH 3QHZL 1T0MB 2AGJH 4FQPA 4KK5C 3TC9A 1OTSC 4EI5A 4HLJA 4HPOL 1NGYB 2OTPA 3O2VH 4HHAA 2JB5L 2NY0C 2ZG2A 4BSVA 4OGYH 4WY7L 4GRMB 1MEXL 2HJKA 3EOTL 3L9RA 2GJ6B 3WUWA 2VXQH 3AXLA 1BF2A 1YN6A 2EZ0D 2YD5A 5FB8A 4HUKB 3RUGA 1Y6KR 3UJIH 1TZHA 4JQXC 2RCSH 4Y1AE 5EFIA 3MV9B 2AKRA 2P46B 4MVBD 3QDGD 3T0DA 2K7PA 2Z31C 3RVVD 5HI3D 3PG2A 4URTB 5CEZD 5CSGA 5JDSA 4XNXL 1Q9LB 4NQDE 1V7NH 1I75A 1MI5A 3ZDYF 4O9HL 4ENED 5IHBA 3DI2B 1OAXL 5FAAA 4F7EB 1YMME 4V1DE 3V6OC 1P4IH 2ICWJ 3KYOA 4N0FA 1LO0L 5HHXH 3PGCA 3ARTA 1JRHL 2VLJD 4RMSA 1Z2KA 3K8LA 3TO2B 4MXWH 2CMRL 2NZ9C 2J5LC 1MHPL 1AKJA 3HG1A 3MV7B 5AYUH 5IROC 1DBJL 4OB5L 4OIBA 4JKPH 4P5MB 3IVKA 2VLKE 5F9AC 3UTSA 5TH2B 12E8L 3MV8D 2JELL 4U33A 3RQ3A 4AMKL 5DD1L 1UZ6E 1F4HA 2YPKA 4LCIL 2UWEE 1CICB 3MNZA 4R97C 2E9BA 1HHJA 1FPTH 1WBYA 4F58L 4PJIF 5IHUL 2A6DB 4DGYH 3OTTA 4DFIA 3F12A 4YBHA 4GOSA 3WJLC 3SDDA 3RY6C 2DQDH 2YWZA 5GGTA 4LVNB 5L2JB 2Z8RA 3TVMC 5ESAA 1I8IB 1QSEE 1A9BA 1TCRA 2W59A 4WFHE 1GZPB 1N3NB 4ZODA 4RFEA 4K7PH 4BFEA 3RGVD 1M6OA 3FT3B 4LEXH 4PGJA 3EO0B 4QCIA 3VRIB 5JDJA 3BPNC 1X5HA 4MSWB 5IP4A 4Y89A 4H1LA 1F4YH 3BI9X 5JQ6L 2YPVL 1EDQA 1P7QD 5JHLH 1JUFB 4YFLI 2CDEB 3QI9A 3IYLW 1LDPL 4M1DL 4X7SH 2R0ZL 3AMLA 4OJFH 1JGVL 1QLRA 3B5TA 1FH5L 3B5HA 1NAKH 1AGFA 1AGDA 4QRQA 2SEBB 3RWDB 1HE7A 1U36A 1G6RL 3LN9A 4FP8H 5F1NB 3CMOL 4L8CA 4TTDC 4GXVL 3L3IA 4JDZB 3RJDA 2CK0L 3GIZL 5C0RH 4EI5C 4XVTH 1I9JL 4APQD 1L9MA 3PP3H 2DBLL 4JFDB 1V3LA 4HPYL 5KVFH 5E56A 5EU7E 4WV1B 2GJZB 4FQ1H 1KCSH 5TQ0H 1MAML 4HK3N 3PHSA 4J4PA 4NKOA 3T4AA 3BO8A 3Q2CA 4GG6F 1EVTC 4HK3J 5K9OA 3OAUL 4HT1L 3IJSA 4Y5VB 4XP5L 1CK0H 5ELIA 2I9LA 1KN4L 5TGBB 1J5OH 1CD8A 3LKOB 4FS0A 3G08B 1EFXA 4RA3A 5AZEL 4GAJH 4X99B 1K9TA 5LG1A 2H9GB 2IPKB 1AO7A 3NTCH 5IF0A 3MV11 4NUGL 3G5YB 3WDHA 2YEZA 3OB0K 3RWGA 5DI8B 3T2QA 1KJVA 4S1DC 3TYGH 4HAFA 4YBQC 1S9VB 1YPZE 4ZPVB 3ULUF 7CGTA 5FYJU 1N64H 1N5AA 35C8H 5KBNC 1NGZB 1Z6JT 2AABH 3STZB 1HILA 4AEHL 2CIKA 2R0WH 2AJUH 2LV4A 3P4MB 4OLZH 1RUQL 3QIUD 4JLRB 4JQIL 4MX7A 3C5JB 5BMFL 4Z7OE 4QRRE 1K8IA 2J88H 1IFHH 3DVFA 2DMCA 2FECL 2P47B 3DRQA 5C9KA 1YYLL 4POZC 5GRUH 4OLVL 3QAZC 2OSLA 2YUXA 4K7FB 4MA8H 1UH2A 3RIFK 5ICZA 2CDFB 4WJ5A 4NYLA 4LVHC 3SDDC 4OCRL 4ELMF 5EIIB 5JIIA 3BD3A 4FXLA 1DFBL 3LKRB 3MRBB 3W9DA 4M5YH 3DV6A 3G5XB 5I73C 3IU3B 1CN4A 2QADD 1X4ZA 1I3GH 2HTLD 4OZIF 2YRZA 2VTFA 4N0UA 3HMXH 4FQCL 3UX9B 3DMMD 2HH0H 3C2AH 4QXWA 3SHSA 4UUJB 4IOFD 2R1WB 2FEDC 3AFLA 3GJEA 1FNSH 2QR0B 3QI9C 4MJID 4DVBA 3BIKA 4HJ0D 4DAGH 1CGSH 3QDGA 4BKLB 2XV6B 2W9EL 2K3TA 3ET9F 3SE4A 1UWEH 4B41A 5GIRA 2W1NA 4F7MB 1ZHBA 2IFGA 4PRDB 3QEHA 1HOCB 1ZMYA 5DJZA 3V4VL 3MLPA 1IGFL 2A9NH 4PV9B 4NWTH 2HJLB 2OBGA 5DJ2B 4YXKH 1RHHB 2Y1VA 5DYOA 5KTEL 2XNAA 4I2XA 3R8BB 1CXFA 4R26H 4J4PC 1MY7A 3KPPB 4O4YL 3HLAB 3TH4T 3O2WL 2VLJA 4R0LC 1KJ2H 1K2DA 3BE1H 1T66C 4IRSD 3ES6B 1WISA 3VMPA 4MYWB 1X6NA 5A43C 2GI7A 3MV8A 4FFWC 4JKWA 2EXWC 2PO6D 1PYWB 3L7EA 5D7JB 4CNIB 2VZVA 1TJHL 4JDTH 3RDTB 3ZSTA 3KLHD 5IBUG 3KPQB 2IALB 3O11A 2WP3O 4L8SB 1UQSA 1RUKL 2G9HB 1EJOL 3KPNB 5H37G 3QQNA 3ILPA 3FO0L 5E2UH 4EXKA 2OI9B 3TWCL 1ACYH 4R4BB 3B2VH 3CPLB 2ED8A 1EZVX 1IKFH 4XAWH 1OAZL 4D8PA 4P3DB 4XPTL 4RMUA 2WSKA 4U4BA 2GFBB 1WZMA 4CMHB 3MACH 1PJ9A 4Z5RA 2AJYH 4HKJB 2I5YL 3RGVA 5IMLB 5EO0B 3S97C 2H2PD 5FO7B 2CH8A 5FDWA 5LWYL 4Z78B 3OF6D 2HT3C 3U9PL 2AJZA 1P7QA 3GSQA 4OZHA 2XN9D 4UZGA 1QPXA 4OCWL 4EDXA 2J8UB 2MHAB 4S2SA 3RFZC 3MRNA 1Z9LA 1YEFL 1LO3L 2UZIL 5FF6A 1FZMB 2P5EE 2EE2A 4HS8H 3DO3A 2NW3A 2HLAB 4PRID 3U0WH 4QRRB 4LLMA 3SPVB 4NP4H 5DRXB 3OKDA 2J6EA 2G5RA 4G7VH 3WV0A 4BZ1H 3P9WB 1U93A 2Z92B 4NNYA 1KCKA 2G5BB 4JFOA 3ROLB 4FXGA 1T83A 2RBLA 4PTUB 4F57L 4X4YA 3CLEH 1XF5B 4LPWA 1P1ZA 2EZ0C 4MMXC 1AY1L 5IBTH 4L8BB 2FATL 1ED3B 4IIQB 2H8PB 1TJIL 4M6ML 4P3CH 1IGMH 3GSRA 1FL6A 4MVBC 2BHYA 4NC0B 4OD2A 1TCMA 5C0CD 3T0EB 5D96C 5I8CA 4KGJA 5L2KE 3SE4C 3RVVC 5HI3C 2IAND 3WFEL 4ZO9A 3BPCB 2OL3H 4YX2H 3TN0D 3F7YA 4JJ5B 5J9PB 2HFEB 3WIHH 3ZDXF 5HYJD 5K9KA 1KJ2B 1KCRL 2IJ0C 1SEBA 1RQ5A 3DUSB 3TPUA 4ENEC 5E7FA 4KY1H 4PJ5E 2VLME 1A7RL 4JN2A 4ODTL 1HWGB 1IM9D 1D6VL 4ZSOA 3F62A 5J06A 3PQYE 1YJDH 1PZ5A 3CVIH 4K07A 1YNKH 4NOBA 5I1AA 2KQNA 1A6WL 2NNAB 4Q0XH 4JY5H 4S1SH 1FZJB 1YEHH 4M5ZH 3S4SA 5GRJL 4XP6H 1I7TB 3VG0L 1G84A 4NQXB 5J6GB 4HGWA 4MNGE 4XZUA 3DX7B 4KV5F 1I4FB 2ZJSH 1QSVA 4H20L 2NXYD 5F21B 4NSKB 3LN4A 5C0AB 3U36B 4PFEA 3WFBH 2OTWB 4NQVB 5CEZL 1ZKAA 3O9WD 5CGYD 5IVZA 2YZ1A 5B22A 3SJVB 2FWOB 4H5SA 4KJQD 4LSVH 2H26B 2B20A 4K71B 5T5FL 2VN7A 4KH2A 2IPUG 1DBBH 5FO8B 1T5WA 3RGVC 3RX8A 3EUUA 3NPSC 4DKFH 1CDCA 3DMMA 1HHGB 1IL1B 2R4SL 4HZLB 2DTMH 4U1MA 4UU9A 3MO1B 4D9LL 3CAFA 4KFZC 3BYTA 3ULSA 3NFSL 4PJCE 4MJIA 1LEIB 4R7NB 1NCTA 3BHBB 1MFAL 3BUTA 2B0SL 3FOLB 3N1QC 2QQKH 3NIFE 2P8MB 4IJ3B 3RI5K 3RL1A 1P5UA 4LRNH 2VL5A 2VO5A 2Z93A 3MLZH 5D2LA 1T21B 4LIQE 4NUJA 3VXSB 3HE7B 5IJVB 1NGWA 4WEBL 1IGJB 1SEQH 1XR9B 4NBZB 2JCCB 1AQDA 4N0RA 3LD8B 2OZ4A 1MH5A 5IB3A 4APQC 1FNFA 5KJRL 4DW2L 5BVJA 3VA2C 3IDGB 4Z0BL 5DEFB 1RMFL 5TDOB 3HAEG 4Q9RL 1T83C 3U6RA 1RK1A 5IBLD 3INUH 2DLFL 5HYFA 3DURA 1JNHA 4X6EA 1RHFA 1TMCB 2EDHA 4IRSA 4NWUH 3O0RL 2FGZA 1FIGL 3KNBA 3RWFA 2DM7A 2Y36L 2ZSWA 1FG2B 1KG0A 2OL3B 3N50A 3O8XD 3F65A 1N2RB 4PUBL 2PO6A 4HULB 4K2UL 3OKNA 4LNRA 1EHAA 4XB8A 3QCVL 5DFTA 4XTRD 3RX7A 2QSCL 4JRYB 1OAUL 1BBJB 3OB8A 4ZOAA 2JK5A 3FMGL 4WI6A 4EUPG 3KJ6L 4WEMB 3ULVD 1X6LA 4GUPB 2EIDA 2J6EL 3H9HB 2P8PB 1FN4B 3HUJB 3KXFE 3MUJA 5EDXA 3QEQD 3FOMA 1R3KA 2BSSA 3I50H 1LILA 3KYKH 1GGBH 3QIUC 1SM3L 4UV7L 3L5WA 2OXGA 3IDIA 3VW3L 4MCZB 2R2BB 2FYYB 1EEQA 3LRGA 3OF6A 4RGNE 3GSUA 3BH8A 4UV4H 4X6FA 1AGBA 2MSPA 1LK3L 1MF2H 1XCTA 4AG4H 2AV1B 2XN9A 1DVFB 3BT2H 4PJ5B 2XQYK 1YEGH 1QG3A 2A1WH 2KZWA 1PAMA 4MWFA 1MLBB 3ZLQC 1VACA 4AIZA 1JCKA 4N8CL 1WAAE 1WUNT 5C09B 5E2WL 5JMRA 1TNMA 1SBSH 3F7QA 5CBAB 4DZ8B 5E8EB 5GGVH 4K3JH 2ZP0T 1QFUL 4PRIA 3VGBA 3CFDB 2CIIB 4DN4L 5EWIH 2PCPA 2F53B 1B6UA 3DX9B 2CR6A 2LTQB 1T5XA 5SWSB 4PJ8D 2QADC 1MUJB 3TT1H 2HTLC 4R3SA 2P7TA 3QH3B 4ZPTA 5LGJA 1ZLWH 3DMMC 1CXHA 3CSYA 4KVNH 3GSWB 5E8NA 4L3CA 5EBLB 1EO8H 3G04A 4IOFC 1Z0NA 5IEHB 4JG1H 1ZA3A 3T3PF 2ZUVA 3PWPD 4H0IA 2YN3A 4NZUH 4HJ0C 4G6FB 3TLRA 3KPRD 4HH9B 5E7BA 3R8QA 1MJJA 3VFUA 4BM7A 1DQJB 1EO7A 1PKQA 3OKEB 3S36X 2J8UF 4IEFB 1ZAGA 5C0CA 5F93C 3MRQB 4Y19D 4RBPK 2IANA 3HHRB 2CRZA 5C71A 2QV2A 3VE0B 4AZ8A 5JPMA 4F37K 1MCCA 2Q76B 5FCUH 2EKJA 5J13B 1YC7A 2F8OA 1XF1A 4PJCB 4R4FL 4WW2B 3OHXB 4PB9L 4XX1E 3MOBH 4OUUA 1EJ6A 2B4CL 5HHNA 5IQ7H 1U8PA 3BDYH 1B3JA 4P23B 4Z7UB 5GJTL 1WBZA 2X9WA 4IRSC 2Q3ZA 2XXCB 15C8H 4G42A 2JJSA 4OQTA 5C0FB 4LCWB 5FV2A 4ONGH 3O6KL 2PO6C 5HDBF 1PDKA 2OXHA 3KLHC 5F8QC 2XTJB 4OM0H 4QHMB 2AXHA 1C08B 4RIRA 2KZ1B 3GJFH 4YH6A 4KUZL 1QFPA 5DURD 4KGLA 3DIFB 3O9WA 3QEUA 4YHZH 1DE4B 2OZ4L 1DDHA 3PP4L 2NY6B 1RURL 3L5HA 3OXSA 5I19L 5TFSH 5AWNL 1ZGLP 3ZKXB 5F7LB 3FQXA 1MCOL 4DN3H 1GGCH 3NZ8A 2H2PC 2VDKL 4OBSA 3FFCE 3DWTA 4YQXH 1JPSH 5F6HJ 5JW4M 2XG4A 5FECB 1C16A 4S1QL 5CJOL 1CFNB 1EGJL 3IFOB 1YEJH 5IFAL 1OAKH 3GMMA 3GNML 5D1QB 4IS6B 4J23A 4TNVF 5T3ZH 4JANB 4O58H 5KSUA 2AVGA 2I60L 5HDLA 1EXUB 3U30B 2XZCH 4YDKL 1SVZA 4WFED 4LHJB 1HSBA 4JPKH 4HIIB 3HS0A 2FGWH 4LMQI 3PHOB 4XNZB 4AJ0A 4IRZL 4KI5D 3UAJD 3VFRA 2DAVA 4XVSL 1BEYL 4LSRH 5IT2L 4M6NL 5I9QC 2FBJH 2EH8L 3VWJB 4YDVB 1OP5H 5IV2B 5ACZA 2DQCL 1FJ1B 5DUMH 5CSZB 3MLYL 3IDXH 2P24B 5KVDH 5DJ0B 4QRPE 3GM0A 1FDLH 1IAII 4OZGA 2WUBH 2YBRB 4OCYH 2R0LL 1RJCA 3O8XA 1U2HA 4D0CB 3VRJA 4LLQA 2A74B 2Q86A 3P4OB 3O6FD 3HA0A 5FKPB 2IMNA 5C0ND 1S9XA 4LGSB 1CU4H 5F1SA 4MNQD 5B38A 1OCWH 3JBG7 1KXTB 4Q74A 3U4EA 1CDUA 1IAKA 2AK4B 2VDRH 1F4WH 3TN0C 1TZIB 4GH7B 5ISZD 3RKPA 1RJZB 4DOHE 1GYAA 1H8SA 4X6DE 4XBPB 2JCCF 4ZNEA 1FRGH 1FGVL 2BNQA 1JHLH 1MOEA 1XCQB 1FVEB 3VFPB 1WZKA 4PR5A 5JXAL 3BKMH 3QEQA 1I7ZA 2AI0H 3SKMB 1X4YA 3QQ4B 1DBML 1UYWL 2F5AH 1G7PB 5MEPA 1ZTXH 2XKNB 4KJYB 1XF3B 3BAEL 3GJFB 2JJSC 2ADGA 4ZMAT 3H3PL 1CE6A 1GIGH 5SX5H 2BDNH 3V6ZA 1OWWA 5KSAD 3TIDA 2VXUL 4IM8A 2WV3A 4MJ6A 3TJHD 4NO3A 1BAFL 4PJXB 1AHWB 3TA3A 3VJ6A 2DIAA 1DL7L 2NXYC 3H0TB 4UBDD 1RSFA 3O9WC 5CGYC 3MLRL 5TE6L 3BKYL 2D7TL 4WO4D 4JM4H 1XF2B 2X4PB 3MGTA 1CR9L 4ONFH 4MXVE 3VI3E 2EH7L 5IB4A 4KJQC 4JFYA 4B53A 5E8OA 2CO7B 5DRZA 3ZKSD 4HH8A 3HUJF 1H15B 4HV8A 3EO9H 3ARBB 4NN5B 4PJ8A 2HKFL 3DX8B 3Q3GA 3DGGA 1NEZG 3QHZH 4U0RB 1CXIA 2AJVL 2VLRE 4HPOH 1F5WA 4DVRL 1MVUB 5HPOA 4Z7QF 5D71H 5BRZE 2KDGA 1KIQA 3IGAB 3KPRA 1KPVB 3GRWA 4MAYA 4TSAL 4WI7A 4E41B 5JUEL 1HH6B 3PL6D 1CL7H 4Y19A 4K8RD 5DHYB 1QFWI 1UEMA 3G6JE 3ME0A 4XP1L 1HHHB 2D9CA 5ABDE 3S37X 2LAGB 3FQUB 1WFNA 1QBML 2C4FU 2UVFA 4LVEA 1JGUH 5GRZA 3KLDA 4L3ED 3QUXB 1J11A 5C0GB 5IBLC 2W07A 3OAZK 5IB5A 4JR9L 4ZFZB 1J1XL 4G6MH 1EH9A 5E2VL 4ZDHB 2OK0L 3X3FL 4Z76B 1CD9B 2HVKA 5DQJA 2EIZA 3O8XC 3L95A 2Q8AL 4M8QA 4ZQKA 4BFBD 3MJ8B 5DT1L 5SWZB 2CMRH 4XTRC 5SWQA 3T04D 4IDLA 1MJUH 1KB9J 4I77H 1DBJH 3QJHB 4HS6A 3RZCD 5DRWB 1BZQK 2WANA 1MCQA 3OJDB 4YPJA 4P2QD 2NY2B 4DQOL 1XGQA 4WHCA 4AMKH 5DD1H 1MIEL 2VC2H 4LCIH 2CKBH 2E7CA 5DVNA 3ULVC 2XICA 3UBXG 4XVUD 4ZD3L 3CFEB 1HDMA 4WW2F 4MD0B 5DVMA 1GC1H 1NDGB 5FUCE 1IEAB 1MHEA 3UPCA 4L9DA 4HD9A 4CGTA 1NBZB 5D7LB 4Z7UF 1JPFB 5EH1A 4AEIH 4ZS7H 4X6BB 4XPHL 1SJHB 5I1EL 4X6DB 5HYSB 1N8ZB 3O3AA 1KJMA 5HD8D 2FL5A 5DJXA 2BOCA 1NCWH 1CDBA 5FA3A 4KROD 4PJAA 3QCUL 5HGAB 5F6IC 4U6HA 4ZYKB 3HPJB 3OZ9L 2Q6WB 3TYFA 3BZ4B 4IMKC 5IW3A 1FVCA 1P4LA 3WEXB 1AC0A 1EHNA 1H3PL 2R0ZH 5E00B 5JO5A 1MHCB 1JYWA 1GSMA 1FH5H 3KS0J 1MWAA 3ULVL 2XA8H 2CLZB 4UMGA 4CVZB 3U9UB 3FONB 1G6RH 5EU6D 4FZEL 1Q72L 3L6FB 3F6IA 4N90D 4PJ8C 2BMKB 4KUCF 4TULL 3SGJA 4KAQL 1W72L 2CK0H 1A3QA 3GHBH 1I9JH 3OR6B 4HIEB 5E9DE 2HP4A 1N0LA 2H6PB 3IS0X 1D5XB 2I24N 1CLZL 1VPOL 3EBAA 4R8WL 5I74C 2ZUQC 4CU7A 2XI9A 1MAMH 4GG8A 3GBNH 1ZEAH 3NH7L 3S8WA 1T7YA 3LEVL 4HEPG 3O6FA 1GHFL 3OAUH 2DWEB 3ECBB 2R0KL 4XP5H 3RWJB 4BH8B 5FM5O 1FORL 3SDCA 3GKZA 5KOVC 2G75A 5IR1B 3FT2B 2OR7A 4M3JA 3T09A 1FL5A 4WUUA 4BUGA 2Q87A 1YUHA 3K2MC 5ISZA 2C4FT 2I27N 1UXWB 1N7ML 3VWKB 3EOBB 2NY0B 5I71B 5DD3H 1IAIM 5MP6H 1A7PH 4PBXA 4PJBE 5D7SL 5FM4A 3G6JB 1LO2L 3SKUD 1E27B 5FUOH 1CDYA 3MJ6A 4Z0XA 1IC5L 4OZFG 1G0YR 3GB7A 5BZWB 5CHNB 4U1IB 1L4IA 2Z31B 2YZ8A 1X5YA 4IHOB 5BMFH 1DSFL 5CSBA 1B0WA 1KEMH 1BZ9B 4LLDB 4PG9B 1CXEA 1DLFH 4JPWH 4K7PX 4I0PD 4ODVL 4OLVH 2DM3A 3ISWA 3K80A 4XCYB 1I1FB 3BMVA 1SJEA 4OCRH 3C60B 1FNLA 1P7KB 2NY5L 4G3YL 1I8MB 1DFBH 4CDHA 4KRLB 1PY9A 1B0GA 1QA9B 4YHML 1LE5B 4G8FB 3DXAB 4IMLB 5LQBH 4IOIA 4U2ZA 2X70A 3GMNA 1FVDA 3W11D 4R97B 4M1GL 2ADIB 4I13B 1QACA 3L1OH 4KDTA 4PJXF 3N85L 1JFQL 5TF1L 3ZTJG 1G6RB 1AGEA 3HPLA 3WHE0 3PL6A 3GMPA 1YQVH 1A1MB 1Y0LA 4KI5C 3UAJC 2JJVA 1JBJA 3TFKD 5GGUA 2A6KB 2GIYA 3FN0H 2W9EH 3MJ7A 4EVNA 2GQHA 3SGJC 4ZUUA 1C5CH 4OD1L 1SMOA 5ALCL 3QDME 4J6RL 3V6BR 3HC3H 2VKWA 2FSEB 3QUZD 3V4PL 4XC1H 5ITFA 2EYTB 5BV7C 2V2TB 4O4YH 4LFHG 5C0DA 3O6FC 2NY1B 3O2WH 4PGDA 5C0NC 4GLRI 1LE9A 3NA4A 3RZCA 4GKOA 1R3LA 2R1XB 1QUNA 3LS4L 4P2QA 1FYTD 2DQEL 4FNLL 5E9DB 1WZ1H 2E5EA 3EFFA 5DRNA 2DQJH 1U9KA 2RIKA 4JN1L 3DGCR 1MWAL 4WUKH 3MCKB 1V3KA 4MJ5A 3MGOB 5HJ3B 3BPLB 3LOWA 3HCVA 4HEME 1RUKH 1PX3A 1K4DB 1DLHB 2I07B 5D7KD 5B4MD 1S78D 5EBWA 5D6CB 5KVGL 5JW3L 3K1KC 1KOAA 1ES0A 4JG0L 4YDLB 2BSTA 4MHHG 4I48A 3TWCH 4UT7H 3C8KB 3KR3L 4QXUL 3NCYP 1HH9A 3FQTB 4XPTH 1VEPA 4U6XA 1X5JA 5KSAC 4WTXA 4LNVA 3W0WD 2B5IC 4I18B 5BXFB 5E6ID 1IAIL 3C6SA 3TJHC 4M02A 2PUQT 4WWID 4I3GA 1B88A 5LWYH 4RZCA 5IEKA 2ZG1A 5DSCB 4TSCH 1BFVL 3KGRA 4C56D 4ISVB 2W9LA 1MREL 3U9PH 2BRRL 1FFNB 4UBDC 5T5NG 4E9LA 1UC6A 4WO4C 4OCWH 3TCXA 4P9HH 4NFDA 4GBXD 1JTTA 1LO3H 1EX0A 1OB1B 1CE1H 1BP3B 3K81A 3VFGL 2Z35B 5EU6A 5IB2B 5MENE 1L0YA 3IRZA 3P9MB 1J0ZA 1A21A 5FK9B 5C0BB 1QYGL 1I1CA 4Y5XA 2NXZD 4L4VB 1INQB 1O5DT 2VWEC 4U1GB 3SDXB 4G80A 4HCRA 2ADFH 5GS0H 1AP2A 2WBJB 3EYUL 1VKXA 3QAZB 2FATH 4PJEB 4PJFB 4PV8B 3PL6C 4RFNC 1U8KA 3VD7A 4K8RC 3LRSA 1L7IL 3WIIL 2HFFA 3IFPB 3T8XB 4YC2C 5FOBB 3P9LA 1KEGL 4M7LT 2ADJB 4GW1B 4PRPB 5D93C 1E6JH 1G7IB 4QTHA 3WFEH 4ERSL 4NQEB 4ZFOA 3KYMA 1OWRM 5I18L 4ZAKB 1BVZA 1KCRH 1KN2L 1G7LA 2BRQA 4JPIA 2XQYG 5IJKA 2RFXB 5KSBA 4PY7A 5I75C 1NFIA 3SGKA 1XZ0A 3VXOB 5J3HD 4HQQL 1BFOB 2CUHA 1A6WH 5LCVH 1CIUA 1BLNA 1NKRA 5DJCB 1ZT4B 1M7DB 1IGIL 2X40A 2VISB 3WL9A 1TVDA 4W6XB 3RZCC 2HJFA 3SKNA 3UPAA 3I6LD 1D5ZA 2FX9L 5CFHA 4K8RL 5HHQB 2IG2H 3VG0H 4P9ML 1QFWL 1HXMA 2AW2A 3CX2A 4XC3H 1U3HD 3AMKA 4I0PA 4XVUC 4H20H 2NTFA 2ICWA 4PP2B 5KSVB 2VIRB 2DJUA 3BXNA 4ZUTB 3T77A 4KZDL 3QWRA 1JV5B 2G2RA 4JO3L 4DGIL 4R0LB 1J8HB 3U1SH 2CLRB 3X12A 5JIHA 5TE4L 1FLTX 1IBGL 3FKUS 5AZ2H 2GJ6D 1I7RB 1V3MA 2VXSL 4LQFL 4Z7VB 5HD8C 2W60B 3N9GL 1J12A 1MCEA 3GKWH 3MZGB 4UDUB 3RWHB 5A2FA 4KROC 5CP3H 4OTXL 3CUPA 1CVRA 3U7WL 1JGEB 2R4SH 4CN6A 3OXRB 4HMCA 1A9EB 5SX4I 4D9LH 1A4KB 4X8XA 1BJ1H 3RTQB 3MV9D 3NIDE 4NO5A 3NFSH 4N8PA 2AP2A 1U91B 4PJIA 1MFAH 1FFOA 4ZUWB 3EYFB 5JQHC 1HIML 5JORB 1QRND 3EYVA 2WWKO 1RK0A 4YDJA 3MRHA 1FV1B 2DN7A 3W2DL 3OJ2C 1OGAE 1J10A 2VLLA 3RIAK 4XP9L 3B9EA 1A14L 2ZPKH 5DVLA 5JA9A 1F4AA 4AM0A 4ETYA 5FA4B 5FDYA 5GXBB 3HI6H 4Y5XC 5DHVA 1IM3A 3L3DA 1TTUA 3L7FB 3UJJL 3JUZA 4Z0BH 1IQWH 1RMFH 3QUZA 3QR2A 3WBDA 5CGMA 4Q9RH 4I5BB 3BKCH 3MJGX 1I7UB 4LKCA 5IW1A 1GVIA 5JR1H 4N0CD 3MRIA 3D5OF 3MV7D 2GSGA 3GO1L 3QULB 4AENA 5CLTA 4HWBA 5EU5B 1FIGH 2J8OA 2XKSA 4MQ7A 1QNZL 4HXAL 3R06A