4AL8H

Structure of dengue virus diii in complex with fab 2h12
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
216
structure length
212
Chain Sequence
DVQLVEPGAELVQPGASVKMSCKASGYTFSSYWINWEKQRPGKGLEWIGNIYPGSGTVNYDDKFKSKATLTIDTSSNTAYMQLSSLTSEDSAVYYCTRGGSHAMDYWGQGTSVTVSSAKTTPPSVYPLAPGTGSSVTLGCLVKGYFPESVTVTWNSGSLSSSVHTFPALLQSGLYTMSSSVTVPSSTWPSQTVTCSVAHPASSTTVDKKLEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Analysis of a Dengue Cross-Reactive Antibody Complexed with Envelope Domain III Reveals the Molecular Basis of Cross-Reactivity.
pubmed doi rcsb
source organism Dengue virus
molecule tags Immune system
molecule keywords ENVELOPE PROTEIN
total genus 39
structure length 212
sequence length 216
ec nomenclature
pdb deposition date 2012-03-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4al8H01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4al8H02
5DS8B 3L9RB 1IKNC 5C0DB 3ZT7A 3D87B 5CJOL 4IRZH 4JAMB 4PLOB 2KQMA 1DANT 4ONOA 3F7VB 1L7IH 5GS2D 4QYOA 1IC5L 2VUYA 3KPRA 4BSVA 4N0CD 1JNNH 4LGPB 4XZUB 4Z0BH 3LCYA 3N1GC 1TFHA 4TRPL 4ODUB 2W59A 4QRPE 3RX8A 4NZJA 5TFSL 2AXJA 1QSFA 3LY6A 4TSAH 4NRYB 4GRMA 4PRAB 1RIUL 4NKIL 1WT5C 3LD8C 4WW2F 5E00B 3EO1A 2Y07H 1ZEAH 4OFYA 2C3VB 5B22A 1FAKT 1RURL 2X4RA 1EHLL 5GIRA 4ZMAT 1G9EA 3TV3L 4PB9H 1D5XA 3QJFB 5IVXB 2VLRE 2DQCH 1FNGB 2AKRA 1WEJL 4G6KH 5EOQL 4Y4KA 2BHYA 4HUUA 2AK1L 2HJFB 4U1IB 1UWEL 4JB9L 5ID0B 4LLWA 1NGWA 3RPKA 3VFOA 1H0DB 4OGYL 4LQFH 4X4MA 2J88H 1BHGA 4OZGE 5DQJB 2PCPA 5KN5A 1K3ZA 4FFZH 4WEBL 2QQNL 4H8WH 2NW2B 3L3GB 5T3ZH 1BLNA 1NFDE 1VPOL 1OTTC 1MQ8A 5HYJA 1PX4A 4M5ZH 4KJPD 5KOVC 3ULVF 1LE9B 1MFDL 1DBMH 1FRGL 1H8OA 1NANH 3G08B 3QULB 4K23H 3SE3A 2YD1A 3VA2C 4MXVE 3R0MA 1P5VA 3RKPA 3TJEL 4GRLB 4JN1H 4N68A 1RZGB 5ENWB 4PRNA 1RUAH 2NX5A 5DJYA 1K8DB 2DQUH 3SEPA 4Y4KD 5DVNA 1J8HD 5IIEA 1RVFL 3HNVH 4M48H 2OZ4A 4M03A 1U8NA 3LDBB 5DEFB 5JHLH 4QXGL 4TVPH 3LHPH 1QYGL 2GSIA 1RJLA 2WV3A 4P59H 4RA3A 5GGTA 4RGMB 3UTTA 2OMBA 3OZ9H 5EBLB 4UDUB 2DLEA 4U6HB 1KELL 1P84K 3LEVL 5KW9L 5E6ZA 4G80B 5D71H 4NZRH 5CIPH 2APBA 3QNXA 5EU6D 5FYJH 1RJLB 4NO5B 5F1IB 2NPLX 3FB7B 3H3KA 5DR5H 3VFOB 4ODXB 5KSBE 5DRWB 5D1XC 3VJ6B 4R7NB 2R2BA 2J8UE 2XPGA 3RGVD 4MLIA 4M3KB 1U8HB 2DQUL 1QZ1A 5C0AE 1OLZA 1NCUA 2W91A 2B1HH 3T08A 2DWDA 3PGDB 4XAKD 2UV3A 2P8PB 1XGQB 3ROLA 3FFDB 3SCMB 6FABH 1JJUA 1R5VB 3BQUD 4X6CE 3MRIA 2XV6B 4P46D 1M7DA 3EAKA 2OP4L 5EN2A 5A3ID 1BFOB 1C5DB 4KFZC 1FFOB 2HH0L 1K4DA 2O5XL 1BOYA 1NCNA 3SPVA 3DXAE 3EFDH 3FT2A 1G9MC 5SX4I 4CMMB 3QPQD 3KXFE 4EN3D 3V52H 3OB8A 3W39B 1C1EH 4MCZA 1S7UA 4QYOB 1GZPB 5IHZB 2IC2A 3HG1B 3V5DA 1FLTX 1KFAL 2VQTA 1S3KL 2V5TA 4MHHG 2G75A 4V1DB 1UWXK 3CC5A 4BFEA 1A6UL 1D3CA 4MJID 3TIEB 2L0DA 4U6XA 2Q1EA 1KCSH 3P9MB 3M45A 3ZTJG 5H94B 4YX2L 1Z2KA 4I3RL 4DQOH 3FQTA 2V17H 3ULSB 4J3WA 3QCVH 2GCYB 4JFDB 5IMKA 1MLBB 5CEXA 3OL2A 1EVTC 4YE4H 2GSGB 3Q2CA 3EO1B 4XXDB 2NMSA 3AS1A 3TA3B 4YAQA 1IGTB 2AV1A 1WIOA 3HMXH 4OLYL 2DKSA 3NZ8A 1T4KB 1WK0A 2A9NL 2ITDA 1EGJA 3TBYA 1KB9K 3EJJX 1NCDL 1ED3B 4NM8H 4HGWB 4MA7H 4ZUVA 3KR3H 5A16A 2NY6B 3KPPA 3RWEB 5EUOA 1S7WA 2HT3C 4JFEE 3QFJD 2LVEA 5EO0B 1LEGA 4PJCE 4TTDC 1UYWL 2DI8A 5DRWA 5C0IB 4JQXA 5DD5H 2VXTH 4PJFF 3P4NA 4XWGL 4OM1L 1S78D 3DRTB 1ZWIA 3GMLB 3IB4A 3EYFB 4L4TE 1BD2E 1XGRB 2NY3C 4LSTL 2BRRL 5ICXB 1J0ZA 1MCFA 1NC4B 2UZIL 3U30C 3ULUF 3QQ3B 5MI0B 1NC4A 2UZXB 2AXFA 2HJLA 1TQCB 4PJIA 2VZ3A 3MODL 1RK1A 3UTTB 3QWRD 3LEXA 3MV11 5HDBE 3MRHB 1R5WA 4PGBA 4ZDHA 3UBXA 5IJVA 1LO5B 3TO4A 2ZCLH 1J12A 4WWKC 3H7LA 1CGUA 2W65A 2WIMA 3VXMB 4AEIH 5IJKC 4F33B 3VFTB 1RAMA 3MREA 2EDLA 1IM9B 1JV5A 4OLZL 5J4MA 3AM8C 3C9NB 5F21B 4QRTB 1AC0A 4JZJA 4MAUH 4ONHA 3MBXH 1Z9LA 3WFDH 2Q76A 1IC7L 2WK2A 4B7IA 5BS0E 3G6JB 5JR1H 5C0AB 1V3MA 4W4NA 3RTQB 5JR1L 1U8MA 4NO2A 3L6FB 4IJ3B 3TBYB 1ZLVK 3BP6A 1N5YL 3U2SA 1J9CT 3QAZC 3T0EB 1BIIA 4M1CC 1K5NB 1MHEA 2ED9A 5CJOH 1QACA 3LKSA 4IMKA 3TFKD 3S88L 3OX8B 3N06B 2COQA 4KXZI 4LPYA 2WANA 3S5LB 1QO3A 2VSDA 5C08E 4U6YA 4J23A 4MD4A 4L9LC 3DUSB 1IC5H 1DQLL 3GMNB 1ZLWK 1H0DA 3VWKA 2B0SL 3O41A 4RBPK 5FUZL 1CYGA 3QIWA 3F7YB 4I0KA 3MOQA 1W0WB 3OAUL 4IIQB 4MJ5A 1JZ8A 3RZCC 1GGBH 3EKCA 2ESVE 4WEMB 2P44B 1DBBH 2YKLL 3MLWL 1BBDL 5I2IA 2J6EH 2ESVA 1TPXB 2A1WL 4X4XB 4MCZB 3EO0A 4WFGD 2EICA 3STZA 1PZUB 4JY5H 3GSQA 1BQHB 2Q8BL 1H3UA 4HWZB 2R0ZL 1E27B 1CD1A 3SE9L 4ZUUA 1WWCA 1U8LA 2J6EA 4FTVD 5E4EC 3ECBA 5IWLC 3B43A 3PIQB 5E08H 4D8PA 1U8LB 4XPHL 4DZ8A 4NJ9L 2OQJA 1YEJH 5C07E 5JOFA 4AEHL 5K33A 4FXGA 1I8IA 5ISZB 5D70H 5E2WL 4N0CC 1IGJB 4CJ0A 4OCYL 1MVUB 3C2SA 4H1LG 5ITBL 2EYRB 3V4PH 5E99H 3W9DB 5I73B 1S7TA 5DA4A 4I77H 3O11A 3TT3L 1H5BA 1X5LA 4S1DC 5AUMB 4ETQB 1URLA 4DFHA 3RVVD 1BZ7A 2V9TA 2APVA 3MRMA 3P0YL 3VFVB 2P5WA 3B9KA 3QNYB 3VXRD 4G80A 1LO2L 3C6LB 2DYPB 2VIRA 3VXUE 1JVKA 2XICA 3IDIA 3QO1A 4PV8A 5D7LE 5FHBH 3ZDYF 2CLZB 4XVJH 4MD0B 4XVSH 3EOTL 3MJ8B 1AFVH 4WVRA 2C1OB 4HAGA 3TH3T 4QXTA 3BP6B 1IAII 2UWEB 1IGIL 4Z7UF 1BVKB 4PRIB 5D7JA 1T1ZA 4J3OC 5T5FH 5HVHB 1IAMA 4FQIL 2HT2D 5E1AA 4FQIH 1CVSC 3MRQA 3ARRA 4HIJB 4R4FL 5BV7C 4H25A 4EXPX 1NCAH 4HEPG 4P2CG 2ITCA 4KQ4H 1E4XI 1SJHB 3K7UA 3BIKB 4HJ0C 1CLYL 4FTVB 3RY6A 1KELH 1ZVSB 4NQVB 3STLB 5F9WC 2WBJB 4P4KB 5DJ8B 5ILTH 4NYLB 1QFUH 1Q72H 2VKXA 3DYMA 3ARYA 3TPUA 3PDDA 3I6KA 4JRXA 4X98B 3KPSE 5JXEA 3X11A 4X7DC 3QISA 3G6AA 3TNMB 5IGXL 4XXCC 5ADOL 3V6FB 5HY9B 3Q48A 1KPUA 1MWAL 1G1YA 1N2RA 4IOFD 4JRYA 4QRUA 3QUXD 2PYED 1PFCA 4PBVC 4NN5B 2CIIB 2AEPL 4P3DB 1SEQH 3RP1A 4WFFD 3BEVA 1DTUA 4TULH 4P2QB 4PBWD 2YEZB 3SDCA 4M4PA 2HKFH 4N1CA 4LRIA 5CJ5A 5F88B 3SOBH 3KPLB 1NGWB 3EDEA 5JW5A 2I27N 2E8YA 4MNGE 4IDJH 1ODAA 1SBSH 3TN0A 1S9KC 4G43B 1MFEH 1H15B 1CN4A 2A6DA 1IEBA 1NMBH 3BZ4B 4H20L 1G6RH 1IGMH 1I8KA 2A0LC 2R0LH 3IJYA 4OCSL 2BY3A 4QRSA 4GO6B 6CGTA 4U4BA 3HPJA 1BBJB 3FFCB 1SJXA 2AJUL 1BFOA 3VWJA 1DBBL 1JUFA 3IRPX 1RZFL 4O2CB 3N0PB 3DO3A 4WI4A 3QIUB 1OAKL 4XXDA 3DVGB 4LDEB 5AZ2L 3QI9B 2YD3A 4PJDF 4WUKL 3DBXB 5I76B 3V4UL 4RX4A 2W0FA 5CGMA 4EJ1C 4WV1A 4Z7VF 1C7SA 1WCBA 2EZ0C 1KTDA 2F53B 1JNLL 5IHUH 2NLJA 3JV6B 3GMMA 5JOPE 3DARA 4X6EA 4M7KL 4WFEE 2C3HA 2QQLH 2H6PB 5T1KA 1FL3B 5DD1H 3X3FL 4P46C 1F13A 1JZ6A 4NQUA 1R3KA 4JAMA 4RWYH 4XCFL 2JJTC 5CZVH 4U6YB 4RFEA 1FRGH 4H26B 2RCSH 2HT2C 3L3DB 2O93L 3ILQD 4JFOA 3NIFE 4XP6L 4F9LC 5I1DB 4BZ2L 3SE8H 5AWNH 5FUOH 3U4BH 1CLZL 2X4PB 1FCGA 3MRKB 4I48A 2O5YH 1U2HA 5EOTA 5JOEA 3QEHB 4IDLA 4LPCA 1KGCE 5E2JA 5ANME 2ADGB 1L6XA 1F4YL 4GS7B 2ED7A 4IRJD 1AR1D 1YEIH 3QUZC 1B2WH 1FLRL 3DETC 4BQCA 4F58L 4XAKE 4QLRA 4G3YH 1S7SB 2Q3ZA 5HI5C 4OZFG 4WWKA 3SKJH 5IB3B 2EDTA 1ES0A 3WIHA 1EHAA 2D0GA 3PDOA 5K59F 4IOFC 3U30B 4HKBB 3ZDZE 3CUPA 2NY1B 2MWCA 3MNVA 2X10A 3H2WA 4U7KA 3UTQA 4QXTB 1QSVA 3VFNA 4H1LA 5JMRA 2H2PD 5DD1L 3X3FH 1T6WA 4P3WA 2H2SC 4WHTB 2HT3D 2GIYA 2CPCA 2D7OA 5I75B 5F7NC 1OQXA 1A3RH 5HYEA 1CK0H 1XGRA 1YNLH 4EKXA 5DJ6B 2I5YL 4RAUA 2X4TA 3MRNB 5ICZB 2VLJD 2WMPA 5L2KA 2OTUA 3MRBB 1AJ7H 4DKFH 2ICEA 2XTJE 3HLAB 5HPMA 5F89A 1CXLA 3RDTC 1N26A 3AY4A 1T89C 5ALCL 1T03H 5GSVB 3D85A 1F11A 3QAZB 3T0EC 1QUNA 1DBAL 4JM4L 4MWFA 2R1WB 4PJ7F 3O45A 2GT9A 5E8PA 5CP3A 2R0KH 3WSQL 2FO1A 3VFWB 5FIEA 5IVOA 3SDDD 4NZUL 1P9MC 1Q9KA 2LFGA 3O4OC 1UB6B 1YMHB 3DX9A 5KJRL 4ODBD 4UNTA 4KZEL 3SY0A 1FNAA 3EFDL 4ODUA 5E6IA 1CFVL 5FO7B 5HHNB 3BKCL 1GGCL 2IFFL 4DCQB 3MGTA 5IROA 4IMKC 1U3JA 3DX7A 1F2QA 4WWID 1A6WL 1AGEA 1D9KA 3C5SA 4XHJD 4HD9A 2Q20A 5A2LH 1BQSA 2CIIA 1BVLA 3NFPA 2XXCB 2VLRD 4ZNEA 2DRUA 4WJ5B 2QL1A 5JORB 4LKCA 1NPUA 3DVGA 3UO1H 1G6RB 4NZRL 1RJZB 1UACH 5I1HL 2F53D 3S36X 4P2OA 4YHML 3GM8A 4OFYD 3WSQH 1F97A 2FBJH 4OF6A 2NY7L 4NQCB 5BQ7B 2D31B 4MD5A 3EGSA 3TBWB 5DR5L 1RU9L 4BZ2H 1MJJA 4LNRA 4LF3B 3TYGH 3MR9B 4K3EL 3VH8A 1ZKAA 4G6JH 3QEGL 2FJGA 3FOLB 3MNZA 3T3PF 4OIBA 1ZS8B 4J12A 3VWJC 4R7DA 5CEYB 3DI2B 1HKFA 5C0CA 3IDMA 4WDIA 3HI1B 4E41E 5F1IA 5H37G 5SX4H 1LNUA 4L8CA 2D7PA 2F54A 3AGVA 5I8EA 1IGCH 3FB6A 4OF3A 5J56B 4J3VA 1VFUA 4X9HA 1XH3B 3O2WH 1WWBX 1X5HA 1VKXB 3UDWC 3FCTB 4U0RB 5IBLD 1CT8A 4PTTA 3KPRD 1G84A 4DGVL 3BP5A 4F2MA 4HWBA 3F5WA 1M05B 4GUPB 3OKDA 1S7VA 4W81A 4HBCH 2EYTB 1OTUD 4OI9A 3CD4A 1SJHA 5JHDD 4G8EA 1A6TB 4GW1B 4TN9A 2OL3A 4NJAH 3GSVA 5IHLB 2P46B 5IIEB 1X5ZA 4R3SB 1FFQA 4FQHA 2VDNL 1Q94B 4JR9L 5JQ6H 5SWSE 1S7WB 5LBSL 2ZUSA 4PJIF 4ODTH 4C56D 1CIDA 2VLJA 5C07B 2DM2A 2AEQL 1FBIH 1RUPL 1UWGL 1G0YR 3MRFA 5BQ7A 4DZ8B 2BRRH 1JRHL 1AE6H 2EE6A 2KZWA 4OQTH 2DQFA 4XTRC 5MHSD 4UBDD 4LKCB 5JA8B 3IETA 3UJTL 5FUZH 4ELKB 3QRFM 5HI3D 2CIKA 3TEUA 2P43B 4KKCC 3MLSL 2P5WB 4WI7A 5LJYH 3LQAL 1UH2A 4I0PA 2HVJB 1FL5B 3CU1A 5DVMA 1RZIA 5I75C 1A22B 1R3KB 3OKMA 5INCB 1T5WB 5IJKA 3T09A 1L6ZA 2QADD 3L5WA 5DTFA 1A9BA 1W0VB 3VXQB 3C5ZC 3F7YA 4LVHB 4QRRE 2Q87A 4ESKA 3GMMB 1XF2B 1T0PB 5F96H 4ZQKB 3JXAA 3TLRA 2DJ4A 5FYKH 2ENYA 4LMQE 5B3NA 4G8IB 5D1QB 2HVKB 1XZ0A 4WUKH 3SDAC 1WF5A 1YQVL 1AHWA 4NSKB 3GHBL 4ZTPH 3RL1B 1A7RL 2R23A 1WIUA 5J1TC 3EOYG 1NCDH 1KJ3H 3I6LD 4WNQA 5T5NG 4OI8A 3INUL 1EUTA 4PJAA 4L3ED 2QHRL 3MLZL 2YPLA 4HUMB 1XGQA 4WFFE 3KJ4B 5I17B 2V9QA 5D1ZA 4QF1B 4OCWL 5J1AB 1DN2A 4J6RL 2AS5M 1H3PL 3LZFL 3QQ4B 1EZVY 4KUCD 3X13A 3MA9L 1OHQA 3AFLA 1C8PA 5F71A 5MEPB 2BVUA 2Y5TB 4FFVC 1NAMA 4DK3A 3KPSD 1ADQL 4H5SA 1EEYB 5BZWA 2XA3A 5E7BA 3C60A 1B0GB 1MWAH 3LH2H 5DJ6A 4ELKA 35C8L 3IU4H 1PKQB 3VFGH 5EA0L 4PR5B 5SV3A 5IW3A 3MV01 3BWUC 3AB0B 3LPFA 3VFNB 4NWTH 4R2GC 1LK3H 1A1MA 2E27H 4P5MB 1DQMH 5IROC 3WHXB 4UV4H 3BOVA 3B3IA 4QHUB 1A02N 4P2YA 4Z8FH 5T3ZE 1J1PH 3NCYP 2C3GA 2VWEE 1JGDB 3BQUA 3OWEA 5IB2A 1S9YA 3C9NA 4R7DB 1UM5L 3IXAA 1ORQA 3ZL4L 4MJ4A 3QIBB 4U3CA 3OG6B 4OUOA 2EIDA 1VGEL 3T3ME 1NAKH 4XCYA 4L8BA 1Z3GH 4F15C 5DYOB 2EYTA 5GGVH 5T1DH 2NY1D 1TDQA 4GRLA 1NBYA 1QFWI 4YDKL 1OD9A 1ZOXA 5JXAH 2DMBA 4RMWA 1J1OL 4UB0H 5GRZA 5EOTB 3U7WL 1JIBA 2J12B 1MUJB 4P9ML 1KJVA 4P9MH 1UQSB 3HAEB 4D94A 4HGKC 3IFPB 4OFDA 4PJXB 5FHBL 4AT6A 3C5ZD 4YQXL 3QO1B 5IV2A 1L0XA 3EZJB 4UAOB 1ZGLM 1JPFB 4LCCA 3QDGD 2RFXB 1ZWIB 3GMLA 2P45B 1DLHB 1HDMA 2DF3A 4MDJB 4U0RC 1F90L 2HT4D 4NRXA 1U58A 3QJHB 3QNZA 1TXKA 4JZOA 1WAAA 2H32A 2EDYA 3GJEA 4NFDA 5HGHA 4ZYKB 2P24B 1KPRA 5L8JB 2AJVH 1EBPA 2BVYA 4UI2A 2IBGA 4KK8D 3KLDA 2C4FT 1PYWA 4WW2C 1DDHB 3ZLQC 1F02I 5FYLL 3FN0L 1QRNB 1GYAA 1J7VR 3RDTA 2NTFA 4XCCL 4LCWE 4G8FA 1CD9B 4HJGB 4MJIA 5IFAL 1GVIA 1G6RA 1NLBH 4G3YL 1UXWA 3SCMD 1JWUB 3MRDA 2VDOH 1MLBA 5GJTH 1J8KA 2B4CL 1YEFL 4PRPE 3BW9B 2XTJD 1HXMB 3ROLB 4TNVF 4NWUL 1BM3L 1JK8A 4M02A 1OSPL 2AJSH 2ICWA 1XF2A 3WL9B 2DD8L 3FQNA 4RGND 3V4VH 3IXTB 4YQXH 3GBNH 3MC0A 4RFOL 4IM8A 3HZYA 4XP6H 4C83A 3RIFK 4XNUH 3H3PH 3O9WB 3SPVB 4JO2H 5TE7H 4HCRL 1SHMA 2E5EA 4WW2B 4M9PA 4OLWL 4WI6A 2P48B 3CPLB 5FUOL 2WUCH 1M4KA 4YHOH 5C2UB 3LPGA 4D0DB 2P8LA 3T0EA 3LKOB 3DV4B 4KK9C 3PJSB 1R24A 1RZKC 2PN5A 4LLQA 1MREL 4WHDA 3NGBB 3OJDB 4F7TA 4TRPH 2R1WA 4HX1B 4FQJL 2FX9L 3HZMA 1MCPL 5LCVL 2FX9H 1UCTA 5IEKA 1DEEB 1YQVH 4M8QA 3IDUA 4GKSB 4YBQD 4K2UL 1DQML 2FLRT 5F89B 3HNSH 3QG7L 4LOUD 1UM4H 1LDPH 4YXKL 1TVHA 3S4SG 4G8EB 3FL7A 1YPZE 2LE9A 5DFVD 2JIXB 1U91A 3T0AA 2ZUTA 1ZHNA 1Z6JT 3W0WE 3MX0A 3BISA 5ERWB 1YNLL 3TBTA 1EUUA 3TWCH 1FZJB 3KDMB 4RFOH 4X8JB 2UZIH 3QCUH 5FECB 5ICYB 1TMCB 3CMOL 1MQKL 1BF8A 1RUML 4M62H 3MODH 1RUMH 4CNIB 4LCWD 5ABDE 3VFVA 1F4WL 2A2QT 3DX6B 3GI9L 5D7LA 2JTDA 2OJZH 1PX3A 2PKDA 1AXIB 4NNYA 4X7CC 3EYSL 3OPZL 1HEZB 2XG5A 2VZOA 1JYWA 2HKFL 5EIIB 2BFVH 2JB5L 2R4SH 4HIEB 4P23A 3KPSA 2IAND 3F12B 4Z5RA 4GQPH 1CGVA 2WQ8A 3EHBD 1K9TA 3D0VB 3J8F7 5C0BD 3LRSB 1EJOH 1FN4B 3QIBD 4KTDL 4BH8A 4B0MM 3VWKD 1IM9D 5JOFB 4XH2B 3QEHA 3QHTC 4F80A 3K81A 2DKUA 5GGVY 1P7QB 3ARBC 4XC1L 2V5SA 1U93A 4NN7C 2AAVA 3P73A 4QCIB 3BT2L 1NGXB 5ACZA 3O4LD 4R96B 1SQ2N 3BN3B 3D25A 5I1IH 3CFEA 4G8GD 3FO9A 3QRGH 2A73A 3IKCB 5IEHB 4PP1D 4UT7H 4HAFA 1QFUL 3MJGX 1YN6B 4M1GH 1J5OH 3FQWB 4LSQH 1NGQH 5BXFB 1A6AB 5D72L 3K80A 3Q3GB 3W11C 4UQ2B 2OLDA 2AV7B 5FK9A 4LHJB 5FYLD 3VG0H 3V0VA 2DBJA 4X80H 1NFDB 5GS0L 5CEZL 2X9YA 4NKMB 4HQQL 3QWOB 5J11C 3ZE1E 3SY0B 5HI3C 4FZEL 3U83A 1J0HA 5D9SA 1P5UA 1NC2D 2UWEF 2C3XA 1CXFA 1ACYL 4R0LB 2PTVA 2CMRH 1T6VN 1S8DB 4YWGL 1RQ5A 4NJAL 1NUFA 1CL7I 3EYUH 1P9MA 4KV5E 3SDXA 1CICA 3G5VB 5GRVK 5SWZB 2GJZA 4IMLB 4IS6B 1G6RL 3LKRA 3LPWA 4OKDA 3CVHA 2NY5L 3MV7B 4KKBD 4XWGH 3UTZA 4MCYA 32C2B 2OL3L 2X4QB 2OL3B 4O5LL 1YZZA 4U33A 1HKLL 3U9PL 1BD2B 1P69B 3SJVB 1MH5B 1AQDB 5A2JH 1RHFA 4ONFL 2DQDL 3IXAB 4KTDH 4N0RA 2FX7L 4S1QL 2BSRB 5J1SC 1PBYA 5CLWA 5B39G 3RKDC 4YPJA 5C0CE 3KPMB 2NXZC 3BDBA 1IGFH 4K7PL 4GMTH 1N2RB 5EB9A 4OCLC 1E4JA 4O2EA 2UWEA 5KW9H 4P2RD 2I26N 3O0RL 4LSUL 4HWBH 3G04B 3O9WD 3OR7A 4MA1C 1CFVH 3N50A 4NOBA 2IFGA 2EEAA 1MF2L 5D71L 5FUCE 3HUJA 2DYPD 1EHNA 4R4ND 5JIHA 1DQDH 3JUZA 1FGVH 5IF0B 2YPVL 2O26U 4YXHL 1EXUA 1YY8B 2BERA 3QCUL 5E5UB 1LWRA 1C08A 3P4NB 1RU9H 2IH3B 5CCKH 1JZ3A 1VFBB 2B8OT 3O3AA 2EIBA 4Y2DD 4LNRB 5ESQB 4OLUL 4PJ7B 2P5WD 5FCUL 3UEZA 1A7RH 3QEQA 4I9WE 1MCPH 5LCVH 4R2GD 1SJEA 1W72H 3CFIC 1FJ1A 2NXZB 1KXTB 1JWMA 4Y4FB 3SDXB 4A6YL 4LCCC 7FABH 3RA7L 5F9WB 3HI6L 1U95B 3LS4L 1EO8H 2WZPD 4PS4H 3UJTH 1RULH 4RGOH 3AXLA 2IH1B 5CD5D 4ZPTB 1MJUH 3B9KB 3RNKA 3PWVA 2Z31A 5L0QB 4Q9RL 1D6EB 1INDH 1U8PB 2OJEB 1D5ZB 2DAVA 5E4IA 1YNKH 1FIEA 4R8WL 2IALB 3LKNB 4I0CC 2RHEA 1CCZA 1C5CL 5IW1A 4HS3B 3TNNA 2YOCA 2W60B 3CZFB 1A9EB 5IFHL 2AJZB 5BXFA 1CE6B 2Y06L 5F3HA 3ME0A 1F4WH 4AYFA 3NABH 1A6AA 1KACB 2Z91A 3BQUC 3CFDA 3MRJA 3U82B 1XIWB 1P1ZB 4XP5H 4N8PA 1QA9B 3QFDB 5C09D 1I3GL 2MKWA 2R0LL 1A6ZA 2MPAL 4Y4FC 4HFWA 1I9RL 1PLGH 4LLDA 3P0GB 5EUOF 4HH8A 5HYQB 4KPHH 1MJ7H 4BKLA 3FFCA 1F3JA 2Q8BH 3L5XL 5DDHA 2WIIB 2BC4B 3D0VA 2Z8VC 3O6LL 2APXA 3KR3L 4PJ7A 2VDLH 3MRLB 3WNPA 4XRCA 4HCRH 3QEUB 3O9WC 2JCCB 5EZOL 4K7FA 2ICES 4R7NA 4JO1L 2ICEB 5GZOC 1KT2B 2V5RA 5FB8A 2E3VA 3PGCB 1KJMB 1L7IL 4X9BA 1AKJD 4RAUB 3P4OB 1SBBA 4K3DL 5L88L 2D4FA 3K2UH 4PTTB 5CZXC 1D6VH 3NH7H 4PJDA 4HIIA 3MNWA 3PWNA 3QBTB 1RZJH 4HKBA 5F7KC 1T04A 3S6CA 2A6KB 5I1JH 4YFLI 2F54B 5DJ8A 5IFJA 1I9RH 1AQDA 1CFNA 3CVIL 4DAGL 4K3HA 2H3NA 2PXYD 4LP5A 3AREA 1S7QB 5D7IA 5KSBB 3QIBA 1N0LA 3RTQC 1ZGLA 4L3CB 4LRNL 2NY5H 3OV6A 4M8QB 1D5IL 3B2VL 4FFYH 4L5FH 4NQDA 1A5FL 1WZ1H 3O8XA 5IJVB 3M1BB 5IVZB 2ZPKH 3MROA 3HPLB 1A7QH 4MXWL 3V79C 5DUBA 1BVKA 5D7JB 4Z7VE 4KHTH 4LCYA 5LXGL 2W9DL 2VLKB 2PUQT 1OWWA 2ARJA 4Y0GA 3QFJA 3SDYL 4NHUB 4YBQC 2BJMH 1MCEA 1Z9MA 3VFGL 1B0RB 2CLZA 4N0YH 1PKQA 4JFDD 1LVEA 3S37X 1MCDA 5DJCA 1BREA 4AJ0A 4OZGB 4NWTL 5HHOA 3KPOA 4Z0BL 5ESVB 3QP3A 1AGEB 3BUTA 3UZQA 1J11A 2FDBP 3BWAA 3W5NA 1OGAD 3MA9H 1T1WB 1KBGH 1QFOA 4YO0A 4QRPB 1V7ML 2F53A 4FXKB 3VXTB 1MHCB 3MA7A 4M6OL 4CVXA 1N6QL 4DAGH 3PWPD 1M71A 3QXDA 2B7DT 3W39A 3H0TA 1NC2A 1G7JB 5I76A 5SV4A 4XBGA 5J3HD 3HZKA 4HK0A 5DZOA 5I1IL 4JM4H 4FG6D 1T4KA 3CDGA 2FSEA 2WBWB 4PJFE 1SBSL 1A6VH 4DTGH 3QZWA 4Z7UA 3K1KC 1J1PL 5DQ9A 3BDYL 2FEEL 2NQCA 5JDJA 1T7ZA 1CFQA 3MBED 4NFCA 2XFXA 4U1NA 3I2CL 1UM5H 3BGFB 4C57C 5D6DA 2EKSA 3ULUE 3STZB 2WW8A 1EAPB 4XBGB 3O2DL 2UY6A 3O6FB 1Z3GL 5IQ7L 4U7SA 3WKML 4IOIB 4LPTA 4OBSA 1WBZB 2G75B 4V1DA 4N0YL 1G7MB 4M7ZB 1LEIB 4GG6A 1A0QL 1U58B 3HC4H 3QJHA 3QNZB 4S1SH 2OK0H 1QVOA 4X0KB 3B5TA 5C71A 3DSNA 4P2RA 4NZDA 4NBZB 2XKNB 2VISB 4PP1C 2YUVA 1F4HA 2HKHL 2FHBA 3QHZH 2OBGA 3X11B 3BGMA 3HAEG 4WHYH 5DURD 2M1KA 5EN2B 1CI5A 1F4YH 1F2XK 1F8TL 2DQJH 3V6OA 2V9RA 3KJ6L 1IVLA 2JJTA 3TCLA 3MACL 4J4PD 1FVEA 5TDNA 4ZS7H 3EZ8A 1MIMH 1U8QA 1BEYL 1V3JA 3LN5A 3SE8L 4M7LT 1PY9A 1CLOH 4POUB 4XP1L 2IQAA 1AD9A 1T2XA 4TSBL 4K3JL 5KTEL 3O6MH 4S1DD 1UA6H 2RBLA 2Y07L 4JPVL 3VI3E 1EFXB 4OCRH 3EBAA 5LQBL 1SVZA 5D5MF 4WGWB 25C8L 4H1LH 1T2QL 1UB5B 4DKAA 2FGWL 2QSCL 3AVEA 3NN8A 4HX1A 4WUUB 5B8CC 2HFGH 4HIIB 4KKBC 1UADC 4M62L 2HLFC 3EUUA 4CVUA 1AJ7L 4S2SB 4DKFL 3NFNB 4M7ZC 3EYOB 4KRPD 1LILA 5KSAA 4PRDB 2Z31D 4LIQH 5E8DH 4NT6B 3HCVA 4Y16D 2I07A 4PJHA 3PGCA 4JM2B 1JI2A 4G6ML 1TPXC 4EN3C 1GGUA 4K7PY 2NZIA 5BS0A 4ETQA 2BSTA 1UVQA 4CADA 3B9KD 4C83B 2F19L 2MTPA 1U8NB 1BPVA 2DQIL 3UX9B 1LE5A 1DLFH 1WFUA 1NMBL 4ZODA 3S98A 4I13B 1ACZA 1RUQH 3TPKA 4K71C 3VD7A 5GRVL 1JZ7A 5LGHH 5FXCH 3LS5H 1P7KB 5IQ9B 1EHXA 1JK8B 5FF6B 4YIQA 3TJEH 2ATKB 1EMTL 1ED3A 5GRJH 5D6CB 1WUNT 2WIIA 3C87A 5CMAB 5B8CB 1JGLL 1ZHKB 3FO1A 1F6FB 3DMMB 2DMCA 3G5YB 1CTNA 5KBNC 2ZG3A 4Y19E 5GZND 3UXFA 4Y5YA 3SKJL 4HFWB 5HGGS 1G7HB 2FECI 1YEFH 2OM5A 1AXTL 1UKTA 4ZFOL 1OB1B 4LK4A 4CJ1A 5IKCA 1CDUA 3T4AA 3VXSB 4TSBH 3C5SB 3KS0H 4LQFL 4OV6F 2XNAB 1G9NC 4E41A 1WFNA 1CGSL 4RMSA 2YD4A 4H88H 4JZOB 1MCQA 4N5ED 3SDCC 4ZFOA 5B4MC 4HWNA 5HGHB 1A3LH 2APWA 1ZAGA 2P5EE 4JQXC 1S7UB 4GG6F 2A0LD 5JPNA 2OJEA 3S9DB 3CXDL 2RFXA 3IDYC 2Z0BA 2PO6D 1T2JA 5J6HB 1IC7H 2HMIC 1RHHA 3TYGL 5HXMA 3ZDXF 1MHEB 4NKDA 3SGKA 2D2OA 3HE7B 4HUVA 2DLTA 1AR2A 3D39B 2X1WL 2A9ML 4D2NA 1E4KA 2WBKA 5A2KH 3I3DA 4O02L 1BECA 3U6RA 4EUPB 4JFXA 3W9EB 3CLFL 2FNBA 4HBQA 5EPMB 3BN9D 4LSQL 4ODSL 3GKZA 1U36A 3V8OA 3FHAA 4QGTA 3QUXB 1CFNB 3K4AA 1XR9B 4BQBA 3V8CA 5JQHC 2PXYB 4PJEB 4WU7B 1ERNA 3FAWA 2OTUB 7CGTA 5JO5B 1I7TA 1YN7A 5I1AB 5HGBB 1M05A 3QUKB 2DD8H 1GGCH 3V95A 4Y4HB 4WFED 5DD5L 2E7MA 4F7MB 4Q9QL 1QYGH 1A3QA 5E2UH 4FQQB 1XCQA 1ZHLB 2FJFB 4WWKD 4DKEL 2LU3A 3H9SB 2E6PA 1OGAA 1KIUA 1P84J 3QNYA 1B0GA 3RI5K 4ZAKA 2B1HL 3KPMA 2OJZL 4PJXE 5I1EL 3E8UL 4NQTA 5I1EH 5HI5D 3RWIA 3LQMA 1ZGLP 1HYSC 4TNVK 3AC0A 2R4SL 3HI5L 1Q9OB 1W72A 3KXFA 4HKJA 4UQ3B 4D0BB 5B38G 5T1LA 4ODVH 3QDGA 4U1HA 4BZ1H 3WDIA 5DK0A 2DQHL 5BS0D 3CMGA 2H2PC 3I85A 4MZ2A 3Q6FA 2AV1B 3G5VA 4FP8L 5SWZA 2D03L 1SY6A 1PAMA 3NZ8B 3BT2H 5LGHL 3L3JA 4J4PA 4C58B 3FRUA 4X7TA 2FYYB 3EO9H 4NO0D 3WS6C 1RZ8B 4L8SA 2R9HD 3JWOL 4JDZA 3FTGB 4Q74A 4X5WA 3L7EA 5GGTH 3CU7A 4P2OD 5D9SB 5C0NC 5GS1A 3BO8B 4E42A 2BNQE 1MFCL 2HWZH 5C09B 2PW2A 4ODSH 5CGYD 1H8NA 2F15A 3VGHA 2AV7A 1QEWA 3WJJC 3WUZA 3RZCD 4DCQA 1QOKA 1HNGA 1PVHA 4B5EA 3S37L 5FO8A 2ADFH 2OTWA 5ESVA 1LD9A 5CILL 3O2VL 3P0VH 4BFBD 3LIZH 3HKFA 3L7EB 4P99A 2DQFB 4C4KO 1A3LL 1K4DB 1CF8L 3BESR 3QUZB 4M5ZL 3SKOB 1MSPA 4JO3L 4CMHC 1AC6A 4JZNB 3DVNA 1RZFH 4R96A 1HN1A 4APQC 3BPLC 1JZ2A 4LSRH 3UYPA 3VFWA 1I7ZB 2GAZA 1WGOA 4Z6AT 3O8XB 3LRSA 4ODTL 1YEJL 1VADB 4X6CA 4UIMB 2FIKB 1HHKA 1R3IH 3U7AA 1FH5H 2PO6B 4GKNB 1XF4A 4EDWL 5MEOA 5HJ3B 1SJVA 3FN3A 3WLBA 4FG6C 5JW5B 3C8DA 4HJ0D 2O5ZH 3CH1B 4OM1H 1J05B 4D3CH 4NO5A 1LMKA 4LAQL 2DQHH 2IBZY 4ZNEE 5KG9B 4XCNB 4ODXA 3RGVA 3VFRB 3C5JB 4OD2A 1LO5A 1QTYT 4NT6A 4KKLC 5D2NE 2R2EB 4HV8A 2CK0L 1KXQE 2ZOKB 3BSZL 3LIZL 1EO8L 4GBXA 1D6VL 3FZUC 3NH7L 3U9UA 2I9LA 2IPKB 3VGFA 3FCTA 4Q9RH 2YKLH 3MLWH 5IR1A 4K8RD 2YD6A 3CUPB 2ORBH 1UWXH 3KHOA 5DD6A 5HHME 4BSJA 5I8KH 5D1XB 5FM4A 1MEXL 4MQXC 4S11A 4JJ5A 5I8EB 3KPNB 5F96L 4YZFF 3VWJD 3WUWG 1MCOL 4JR9H 3V6BR 1NL0L 3MR9A 3HMXL 3QG7H 3ARDA 5IEKB 4N90D 3BDYH 2Z92A 1FGNH 2R15A 4WUUD 2MPAH 1AI1L 1QPPA 1PZ5B 4OGZA 4GSDL 4V2BA 1MPAH 3DSFL 1CXEA 2FBJL 2MQCA 3MJ6A 4OGYH 5IBLC 3GEWB 1AE6L 4FN0A 3L5HA 1DBJL 1BWMA 4M7LH 2VDQH 4HUVB 3DUHA 3WFCH 5JHDE 4JG0H 3QDGE 2ZCKL 5HYSG 4PJCF 1PD6A 4K94L 2FR4B 4GAGH 3M17B 5F8RC 1FPTH 3FO2B 4XVJL 4HWBL 3TNNB 3UMTA 3L1OH 1C5CH 2NLJB 5I9QC 5AZEL 1YEKL 1CG9B 1RUKL 3OGCB 1H3XA 1H3TA 1D5XB 3IXTA 1FAIL 5FO7A 3E6FA 3GSOA 3T0WA 3BX7C 3MLYL 1F8TH 2BVOB 5F1SA 1CR9H 4HIXH 5I0ZA 3X14B 2B20A 2AQ3A 3WEXB 1HINL 1FVDB 4DGVH 5EU4B 3BVNB 2A73B 3IKCA 3GSNH 2A74B 4U1KB 5TF1L 5F6IB 2FSEB 3BVNA 3CDYA 3CFBB 4HBCL 4FQCH 3PHQB 4QHLA 3V6OC 4NBYB 1UEYA 3I2CH 3DTXA 3VWJB 4PG2A 4RIRA 1QRNA 4KU1A 4X5LA 5CMAA 5B8CA 1FN4A 4EOWL 5ILTL 3O45B 1MCWW 1OT1A 3U36B 4C56A 4RSVA 5TE6H 5C3LD 2NY6C 3SGEH 4W4OC 4TNWK 5FYJL 3RZWA 3CJJA 4HXAH 1NFIA 3OAYK 4PRHB 3O3UN 5FAAA 3KVQA 5E70A 3RWGA 3L1OL 1NBQA 3HAEH 4P3DA 3MSPA 1AGCB 1YECL 1YECH 1HI6B 1VERA 5EOCL 4EI5D 4GAGL 1OAQH 2XQYK 3CCHA 3CAFA 1QSZA 5E99L 1QO3B 5CWSB 3RIAK 1A4JA 5F7EH 1VEMA 1NBVH 3HAEA 4FQXD 4OFKA 3VI4E 3D39D 3GJFH 5SWSB 5E8NA 5MI0C 2XKUA 3ILPA 4Y4HA 4JLRB 2NR6D 3LKPB 3VFMA 4GRWB 3STLA 4U3XA 4P2QE 4P4RA 1DQJB 2W9LA 5LG1A 2AW2A 1FC2D 3MLVL 4WWKB 3TN0C 1PGRB 1WCQA 4JZJB 3H9SE 4JFHD 1FSKC 4ORGA 1EEZA 3RGHA 3O2DA 5HD8C 3BEWA 5DI8B 3TYFA 1RZKH 1XEDA 2VITA 4MCYB 5C8JB 4LRNH 2ZUQC 2H8PB 25C8H 1D5IH 2DL9A 4U0QB 4RAVA 3SQOH 1AXTH 4G7YH 3NA9H 1OCWH 4GW4B 4J8RA 3D39A 3QH3B 1KIPA 1OSZA 4ZXBB 1XGYL 2YR3A 3N9GL 4WGVB 2X4OB 1LHZA 4HS8L 4JB9H 4F57L 3GI9H 1AD0B 2BY2A 2ZNWA 2EIZA 5HGAA 3A67L 1EO7A 3P9LB 3SKNA 3FQRA 3EYQC 3RAJH 2GTWA 4PRPB 4XCFH 2BFVL 4NQCE 3UPAA 4GXUM 2CK0H 4OZIA 4UOW1 5AUMA 4PYGA 5DUPL 4YXLL 5FKPB 3WJLA 1QKZL 4GAYA 2MOVA 3WFHB 2V7HA 5FKAA 3WS6A 4PPTA 3L3KA 4WTXA 1P7HL 5K9KB 3UP1A 3UROR 4JY4A 4P2QD 5GRJL 1QEWB 5ITFA 3VMOA 1ONQB 3ALWA 1GZQA 3IDJB 4Y2OA 4HZLA 4ZUSB 3MJ9L 5B38B 5KANI 4HGWA 3C09C 3DYOA 2P8MB 3HR5A 4QRRA 4HF5H 3QRGL 3JTTA 2FYYA 2W0KA 3CFBA 4U1NB 2FRGP 1IGYA 3QWQB 1OWRM 3ZHDA 4NP4L 3QUZA 3JBG7 1HYSD 3QXVA 4N0UA 4HFUL 4I5BA 2XWTA 2CRIA 1GPOH 3ZKMC 4G6FB 1INQA 5IQ9A 2EH8H 2GJ6A 4XP1H 4X6BA 4HSQA 4U49A 3BKYH 1Z0MA 4GKOA 2A6DB 2UYLA 2VNCA 3IAQA 4JKLA 1DN0A 5GGRA 3L5WB 4FQXC 1K2DB 4R6UA 5DTFB 3QXAA 4EIGB 3O3BB 4YO0B 4H8WL 3MQIA 1HHHB 3RAJL 5M7QA 3MA7B 4CVXB 2PR4H 3VGAB 2NX5E 1FZOB 4JRYE 3P30L 4NFBA 5GS1C 4XHJC 4Y5XC 1IZJA 1HHJA 1U8KA 4P0DA 5GGUB 5C0DA 4YXLH 4CMMA 2R9HC 1RZIB 3LKSB 4GBXD 1U3HB 4WY7L 1FFNB 3TH2T 4KWUA 4JFED 3TT1L 1WEJH 4G6KL 1WVZA 3TN0D 3OXRA 5FECA 2CUMA 3HB3C 5DC4B 1B2WL 1ETZA 2EDEA 3GSUB 5F9OL 1DE4B 1HSAA 1RK0A 1R3IL 4TOYL 1TZHB 3MJ7A 4LLUA 1KIPB 4X4YA 1KJVB 2Z8SA 2X1PA 5CJ8A 3TPUB 2XXMB 5DK0B 5DEGB 1QFWH 3MRCB 4MDIB 5C07A 4EI5B 3I6GB 2YPKA 1EFXA 4TSAL 4V1DD 3BKYL 3H42L 2LV4A 3HNSL 1LP9B 2ZOLB 5DRNA 3UJIL 4XVUD 1TZGH 1TLKA 2V6HA 3RIAF 5LQBH 3D1MC 4F7TB 3ULUD 1S7RB 4W6YB 4XCCH 1MRDH 5E5MB 3U0PB 5EULV 1U3HC 5FOBB 1MFNA 1RK1B 3GK8L 5D72H 1A2YB 3NIDF 1JNLH 1CDCA 4DKEH 1T04B 3CDFA 1QBBA 4U1GC 5CJXC 2NZ9D 3O6KH 3GIVB 5TDOA 5IVNA 4OZHB 1MELA 3DRTA 2X40A 3EYFA 3DJ9A 3DVFA 1KJMA 4I3RH 3CSGA 1HI6A 4ZFZA 4L1HA 4C55A 3MGOA 2YS4A 4FA8A 1X7QA 3WE6A 3OKKA 3EJZD 3MXVL 4UIKL 4KDTC 2OX5A 2ZCHH 3TBVB 3G5XA 3H8NA 4NM4H 3RUGF 2FGZA 3P77A 1ND0B 4TUKL 5C7XL 1HXYB 1VADA 4X4ZA 5HHOD 4JN1L 5EU3B 3MRLA 3JTSA 1I1CA 4RIRB 3T2QA 5CJQH 2ZPKL 2GITA 3HMXA 4XP4L 5EDXA 2ZSWA 3JWDH 3K3QA 3S8WA 3UAJC 4ZTOH 1YUHB 3MYJA 1TVBA 4NRZB 5H8DA 1UH4A 5I1KH 4R4BB 5MHSE 4MGXA 3BXNA 1HH6A 4F58H 3DROA 1MHHA 2G9HB 3BKCH 3W0WA 4O4YH 4DVRH 4YGVA 1M71B 4CDHA 1E28B 3MLRL 1ZHBB 2X4NB 3C6SA 2V17L 4WU5A 5FA4B 3RY6C 1R3JB 3FFCE 4BUGA 3EHBC 4F37F 3C6SB 3DI3B 5L0QC 4PJ5E 5F3BB 3BD3A 5IMMB 3W5MA 2J88L 4LLMA 1TNMA 4X80L 4FQLL 1T5WA 4MD4B 2HG5A 5I30L 2FO4B 5T33H 4Y1AD 3VXRB 2WLZA 3VGBA 4O51B 2YUZA 1UQSA 1G9NL 4G9FB 5FA3B 4IJ3C 4KI5E 3VH8G 1N64H 4RNRB 2YD2A 1JHKH 2QJDA 3Q6FB 5D4QA 2AXGA 4JFDE 1KXVC 4PP2A 5C0RH 1IL1A 1KJ3L 1FFPB 1IQWL 5B3JE 5DYOA 4S1RH 3RHWK 3ARFB 5DMGD 5T1LB 3G5XB 4GSDH 1U3HD 1KC5L 3BPOC 4MVBC 4MQSB 5ALCH 1PJ9A 5IB4A 3TP4A 3A6CL 2UUDH 5DHXB 3FO0L 2MCPL 2LU4A 1G7QB 3PP4L 4QWWC 3D69A 4CAGA 1EXUB 2GEEA 5DLMH 1OW0C 1FYTA 1A8JH 4X6DB 1C08B 4F2MB 2H41A 4LLAA 1KUMA 3S3PA 4JDVA 4CRPA 5GGSY 3WXWH 5GRXG 3RVXC 3ARGC 4NZTH 2FATH 3QEQD 3JWOH 3D85D 2UWEE 4R97C 1YJDH 5I8KL 4YHNB 3EO9L 3K2MC 1A3RL 5F6HJ 4AEIL 3IGAB 1CQYA 4GBXB 5KVMC 1GGYA 2VL5B 3W82A 2DLIA 2AJUH 1H5BC 1W8OA 3E1F1 4M5YH 5C0GB 5CWSA 1KYOK 2ATPB 2H26B 5CS7A 4W68A 4JVPA 1FYTB 1F4XL 2K3TA 4E5XB 2Y06H 1RPQA 4OJFH 3ULUL 3D3VA 3VH8B 3VDBA 2EDHA 4HHAA 4UILH 4MX7A 3PP3K 3DRQB 2NY7H 4HH9B 2EDDA 1DVFB 2J1KA 3H3BC 4QF1A 4JO3H 3SDXF 3U36A 4I2XE 3PP4H 4ZXBD 2G5RA 3BPOB 3NIGF 3CDCA 3LKQA 3A6CH 4PS4L 4M00A 4MNQE 5EIVA 4CU8A 3GSUA 1FNSL 1GRWA 4JFOB 1IQDB 4LBEB 4D9RE 3KLSA 4LSPL 4N8VB 5L9DL 3RWJB 4CGTA 5K9OB 5DLML 4R0LA 3DYPA 4TUJB 4U1LA 1BLNB 3DOSA 4DN3H 2GSGA 3CCHB 1G7LA 3HZYB 5JPNB 5ID0A 3NCMA 4AEEA 4Y2DC 1YNTB 1KFAH 4Y4HC 5ETUB 2CKNA 3HG1A 1T66D 3I3BA 4YUEL 5A43C 2HTLC 3JWDC 1U8JA 3P4MB 1QP1A 1AGBA 1HNFA 4FZ8H 1P4BH 3FT3A 2W9EH 5KZCB 2HN7B 3JWOC 2M2DA 4UT6H 2WBJC 1UGNA 2DQGL 4AM0B 1J1XL 4GW5B 5E9DB 3VE0B 4OUUB 2EIEA 1N7ML 2ZZUT 4OZHE 4JKMA 2BOBB 5E9DA 3VE0A 5EUKB 1JWMB 3JZ7A 4Y4FA 1M7DB 2XTJC 4QWWD 4IRSB 4MA3A 4BH8B 5FF6A 4L5FL 4QRSB 2VDOL 4OV5A 4MJ6B 3AY4C 1CFSB 3ARGD 3STBA 4Y1AB 3KPLA 4CKVX 3X17A 1S7QA 5KSBA 5MP6L 1C12B 1N5AB 1Q0YL 5GRUH 3SE4A 5FCSH 5HDBF 5IGXH 1CBVH 2C7UA 2HKHH 3QHZL 5F6HI 3FB7A 4NCC1 4HIHB 4WO4A 1DR9A 5BZDB 4NQEE 4MS8D 5GGSA 2Y25A 3QA3B 3VXUB 3C8HA 4KVCL 3GHEH 5J13C 1IARB 4LHUA 2GUOB 1CT8B 5HDQH 1RD6A 4PD4K 5IR1B 2ERJB 1A7PH 2VL5A 4NNPH 5EZLA 4L9LA 4BSWB 2E7HA 3LKQB 4ODHL 4F9PC 3VGGA 2AJVL 4YPGB 4ENEC 4F8TA 3QIUC 1XMWA 3EYUL 4PG2C 2J7LA 2BCKB 2YMXL 3WS3B 2Q6WB 1CGTA 3EYVB 3CLFH 4QOKB 4YHZH 3BPNC 3IDXH 3HE6B 3KGRA 1TCMA 1ORQB 4YFLF 3SJVA 3VMPA 1J1OH 3TVMB 4APQB 1L7TH 2IF7A 4RFNC 2UZYB 4JFFB 4NP4H 5HHMD 3GDBA 1DUZB 3KG5A 2AK4A 1X6NA 2X89D 2D31A 4DGIL 3U7WH 3ZL4H 5HYJE 3TCLB 1MJ7L 1UM4L 1Q0YH 4F7EA 5BJTB 2IG2L 2VDML 1V7NH 2X7LB 3LD8B 4I77L 5DWUH 5F7DA 4TTGA 2VOTA 4XCEB 1U3HA 4PFEA 2C7UB 1MFDH 5KN5B 1HQ4B 3P0YH 2WWKO 4QRQB 4JY6A 2X4SA 5L9DH 3X13B 3E8UH 2YN3A 1LEIA 4Z0XA 4D9QD 2AKRB 4MNGB 4X6EB 5IB4B 3DUUB 1C5BL 1I1YB 1YEKH 2X4NA 2ZG2A 4Y1AA 3TVMC 2EDWA 1LK3L 1E6JH 5J1AA 4NO3B 2NZ9C 4MXQC 4PGEB 2IANE 2XWTB 1I7ZA 2GAZB 5IBTH 3RPIB 3NTCH 1Q9KB 2MMXA 1DBAH 2V2WA 2LU7A 3HS0B 4X4ME 3NBNA 3HE6C 3OKEB 5AAMA 4I8DA 5F1OB 4KJQC 3VRLE 3IJHA 1EV2E 3P11L 4MJIB 3IS1X 4BELD 3IVKB 2N1KA 2ICWJ 1G7PB 5HDLA 4GRMB 4M43H 4JHBA 2K9UA 4X4XA 1HOCB 4XMPL 3GSQB 2RQ8A 2CR6A 2F53E 5IB1A 3TN0B 3S34H 3ZT6A 1ZTXH 5K9JL 1BFVH 3GSWB 3VFPA 3UYOD 3WJLC 5IMMA 1WAAF 5HPMB 1WC7A 4NUJB 3KPSB 3KPRB 2VLKE 1KCLA 1NSNL 1RIVH 3WO4C 3WIHH 3B9DA 3GK8H 4QGYA 4XMKH 2BZDA 4DZBB 1Y0LA 2BDNH 5B21A 4XMKL 5D1XD 1K4CA 2DKMA 5DS8A 4N8CL 3BEVB 2AEIT 1MI5B 3RGVC 1OAUL 1EPFA 4ZAKB 5CILH 3RI5F 3OX8A 3HZVA 4G6MH 2B4CC 1QBLL 1JF1B 3FONA 3GI8H 1KNOB 5DC0A 5F7MC 1OAZL 5C0RL 2DQEL 3G6JF 4NNXB 3WN5A 5IV2B 1KEMH 1CL7H 4H1LB 5GGQH 4Q0XL 5LKNA 2VABA 4LARH 4LCYB 1ORSB 1KJ2L 3LQZB 3UBXG 3OAYH 3L3HA 5C9JA 5M95B 4WUUA 2JIXA 4TQEL 4PJIE 5ESAA 4JHAL 4PRID 4PJ5A 5IBUG 1ZTXL 3OHXA 5F7LB 4NN6B 2X70A 4EQ2A 1UA6L 5AZ2H 3BZFA 1YNKL 4G42B 5IOPA 3O4OB 4JDTH 2X05A 1N6VA 3D2UA 3TBSA 1AQKL 4WTWA 4KZDL 5IFHH 2MCG1 2DLFH 1WBXB 4OD3H 4MQ7B 2F8OA 2P7TA 2NY0D 2YSSB 2MHAB 3A0OA 4I9WD 3VRIB 5AD0A 4U1MA 1TJIH 4MVBD 1YY9C 3BGMB 3F6LA 2E9IA 1QFPA 3K46A 3OXRB 3FB8B 3MCKA 2EH8L 3TVMD 2YC1A 4KY1H 5IMLB 5KSAC 2YA1A 1J87A 5HDQL 3D2UB 2BHUA 3BH9A 3C2AH 4ODWB 3MRMB 1D7FA 5BZWB 1UZ8A 5E2UL 3D69B 3ZHLA 3U0TB 3CVHL 3QEUA 2JCCE 5EO0A 2PYFA 4BM7A 3PWLA 4JO2L 3C5ZB 2IBZX 4OAWB 4LVNC 3I6GA 3PGFH 4YDVB 4OTXH 4ZO8A 4X6CB 1RIHH 3D6GA 5FCUH 3EGSB 3IAGC 4PJAB 2HLFD 5DDHB 1CLCA 3I3EA 4PGZA 5GGTL 4MA3B 3GM0A 1NEZB 4G9FA 4LSSL 1GJIA 5LVEA 4G6AD 4PTUA 1NGXA 3CX2A 4NKQB 3U4EA 1EDQA 3DMMA 1KENH 4BZ1L 1QLRB 3FT4A 4Y16C 5IWLA 1KENL 4RX4D 2OYPA 3BKML 4J1UB 5DF0A 5E1HB 4ZUUB 3VRJA 1QBML 4PG9B 1Z9OA 4YHIA 4LLMB 3I50H 1T7VA 4U6XB 4HQQH 1PKOA 4IIQA 4MJ5B 3O0RH 5E8OB 1OM3H 3UPRB 1JHLH 1P4LA 1DBKL 3SDCB 1R3JA 1KBGL 3WXVH 5E8OA 2AK4D 4KY1L 5DJXB 1T0NB 3R0NA 2VWEC 3M17A 2APFA 3MV8A 4LHUD 1FL5A 5E0QA 1RV6X 4X99B 3VRJB 1OB1A 5T33L 4QRRD 1KPUB 3DROB 4QRUB 1FV1A 4OQ1A 1Z0NA 2EDJA 1CZ8H 3CMOH 4BZYA 2FEDD 2J8UA 1F4AA 5BW7A 2DL2A 1FFOA 4NHUA 4YWGH 1ZT4B 1IGYB 2X7LA 4TOYH 3D0LA 1P7QA 4MSWB 3PQYD 1A6PA 3FFDA 2O5ZL 4W6WB 2ZP0T 1CU4L 1R5VA 2VC2L 5KSBF 5L2KD 1E4KC 3S36H 1XCTA 4AH2A 5HPOA 1MCHA 2H8PA 3TFKC 4N5EC 4YDVA 3EJYC 5IHBA 2EE9A 4QXWA 1LDPL 4YXKH 5D2LA 1QG3A 1R3HA 2XPGB 1UXSB 3DO7B 2J5LC 4R3SA 3HE6A 4EI6A 5KJRH 4GAJH 4NC1E 4PJAF 1BVZA 5C0EA 2GJ6E 3W2DL 3WO4B 5EZIL 3VD5A 1DSFH 2HMID 1NGQL 3GSXA 4LSTH 4U1MB 2NCMA 1Y18A 1QFHA 3LEXB 3WFZA 5I18L 4PGJA 3G04A 4F7PA 3LB6C 4DEPB 3WNMA 3CX5K 3OTTA 3S37H 1A4JB 4J8RB 4ZFGL 3EW3B 4XXCA 2VN7A 2JCCF 2XKNA 2NTSP 3GI8L 1IILE 2C26A 5SWZE 3TO4D 1IAIL 3I9GL 3NCCB 2PTTA 3FHQA 1YEHL 1LNUB 4HIHA 3HUJF 4AEHH 2C4FU 1YYMH 5EH1A 1G7MA 1FNEA 4C4KT 4EDXB 2HA1A 4JRWA 1H3WM 4JFQA 2QEJA 5J6GB 2KH2B 4ALAH 3ALXA 5D7KD 4I1NB 5EUOB 2HRPH 3CVHH 5DRZB 2XWJA 4AENA 1JTPA 1ZXQA 3B9AA 3LZFH 2VR9A 3UJIH 2GYSA 2OI9B 1AHWB 4YNYA 4B50A 5SX5K 2IBBA 4JFZL 3T77B 3ZE0E 3OJ2C 4ZNCD 1B0WA 2RGSA 4MNQB 1RUPH 1UWGH 2AJXL 1C5BH 2FZ3A 4XPTH 3ULSA 1HHJB 5FYKU 5H2BB 5C0BA 2PYEB 5CLTA 1P4LB 5J89A 1IKFH 4U2YA 4O00A 1F4XH 5D5MB 2JK5B 4Z18A 5LWYL 1YQ2A 2CJUH 3MV8E 1WCBB 4NZTL 3H9HB 4Y5XA 4K2UH 4YDJA 2EDBA 2VDRL 1DLHA 1HDMB 2OSLB 1CE1L 3PABB 4G8GA 3QJFA 5IVXA 3RWFA 3SO3C 4ALAL 4LKXA 3AXLB 5FGCB 3VFSA 1FYTE 4UV7L 1QLRA 3FT4B 3RVUD 1BZ9A 3WUWA 1MCOH 4PJ9C 3NAAL 3MUY1 1CGXA 3FFCD 5CD3B 4ELME 2J8HA 5T5FL 2JIXD 5I0DA 4J4PC 2NY5C 4CVWA 4ZUSA 2FBOJ 5EU6A 4BJLA 5LAXB 2OK0L 3HG1E 4YDKH 2CH8A 3MLUL 3QDMD 2JELL 3SKMA 1RFDH 1W72L 1IT9H 4PJBB 3MOBL 3BDXA 4S0TD 5ESQA 3RY5A 1HZHH 1LE5B 1RJYA 1NBVL 2D9QB 1U42A 4EVNB 4HUWA 1RY7B 4NGHL 4P57A 1OTSD 1B6DA 2BX5A 1KEGH 3WN5C 5IT2H 1ZT7B 1X5JA 1F90H 3ARDD 3LN4B 3BI9X 2XA8H 1I3UA 3TIDA 1S9VA 2CKBB 4X7FC 4KJYB 4U05A 4I18B 1MUJA 3K8KA 3U9UB 2DWEA 2YWZA 1WZMA 4GRWH 5C6TH 1OP3K 5KVFH 2VLRA 3HUJE 2NY3D 4M7JL 3T65B 3LH2L 5FOBA 5GRYA 5I74C 1Q9WA 4LSDA 3C5JA 5C0FB 2OR9H 4HIXL 3UYRH 2FHFA 4L4VB 2HP4A 4U1JA 5DJZA 2VZSA 3GSNL 2H3NB 5IB3A 1G0XA 5E5RB 5DK2B 2NW3B 4S0SD 2YZ1A 4AQ1B 3BZEB 2QKIA 1FZKA 3LRHA 2ZKHH 2MQ3A 3HZMB 4G9FD 2CKBH 3W9EA 3T65A 2Q7NA 4AH2B 1CICB 1J1XH 5HBBA 3Q6GL 1XF5A 4GG8B 2H32H 4EZMA 4X9FA 2R23B 2IG2H 2VDMH 1S9VB 2CKBA 2BVQB 1NMAL 4I18A 1T3FA 4FFYL 3B2VH 2VQ1A 2ZOKA 1PQZB 4YHLH 2FX8H 2HVKA 2Y23A 4URTB 1XR8A 4ELMA 3WHE1 1WIPA 3RWDB 2XG4A 4Y7MA 3BHBA 3EOTH 1RJCA 4XCNA 1PY4A 2K7PA 5BZDA 4X6DE 1KTLB 3AB0C 3B8YA 4YZFE 1SVCP 4I3GA 5C6TL 1W0VA 1Y0LB 3D18B 2DLHA 4PJ9D 2UVFA 3BJLA 2DQEH 1K2DA 4HC1L 1WSST 2X9WA 3H7BA 2Y6SC 2DTSA 4RRPG 1N4XH 3PL6C 1LQSR 1I8IB 2HVJA 1IEAB 4ELMF 2X09A 1HOCA 4BFIA 5HYQA 3N1MC 3OKNA 3FRUB 2JB6A 2AGJH 2BXYA 4JPWH 4HDIB 1W2KT 2YBRB 3JTTB 1S5IH 1YPZF 3UYRL 3VFSB 2H2SD 1JHLL 4XMPH 1XIWD 3KYMB 5EC1A 1WZ1L 3C6LD 5BRZD 4PGEA 5CBEA 1IEAA 3CX5J 4NJ9H 4OKVA 2FIRT 2Y9RT 3ARDC 5I6XC 2CLRB 3SDCD 2BNQA 3F12A 3H9HA 4MNQD 1KB9J 4HS3A 5D70L 5E94B 2IANA 5I16B 2P47B 5EOQH 3UJJH 3AAZA 4WENB 5F7WC 3TT1H 4M61B 3OPZH 5DD0H 4KKAC 3QUYC 3RNQA 3T04D 5GGQL 2KKQA 5GXBB 4XB7A 5F9OH 5IF0A 2VQ1B 2VR4A 4AG4H 5FGBC 3MFGB 2PR4L 5FYJU 4PRDA 1AD0A 4NO0B 2CJUL 3DXAD 5F93C 5T3ZD 4UTAH 1XF5B 4GG8A 3FQUB 3MNVB 1YC8A 1BP3B 4FNLL 5ECJE 1ITBB 2R2CA 2NY6D 4PJ9B 4XP9L 3RUGE 3DRQA 3NCEB 1S5IL 4L3AA 1NCBL 1A7OL 4Q9BA 3C08H 3ARDB 1ULVA 3V6ZB 2AGJL 5IESL 2AEWA 2XWBA 2AK4E 4OF5A 3BP4B 3ARQA 4JJ5B 1NCTA 4WFHE 3V0WH 3KPNA 2XZQL 4OT1L 5CP3H 2C4XA 2BCKA 1T1ZB 4KQ4L 2CO7B 2WP3T 4FQQA 3KYOB 1S8DA 1AIFA 1IC4L 3QQ9D 3CLEL 4HLZG 1JGEB 1O5DT 5IM7B 4DKDC 2Y6SD 2YD7A 4NC2B 1DQDL 5E2TH 1MEXH 5FB8B 1ROWA 5AWNL 1AGCA 1WV7T 5TDPB 2LAAA 3PWUB 2VXSH 3MCLH 1B90A 3MGTB 3NACH 5D1QD 4AIZB 4KROB 3O6FA 2EYRA 1IBGL 2F5BL 1HSBA 4ODVL 5IKCB 4HT1H 2BC4A 4Q6IC 6FABL 2X4RB 1PKQE 1HH9B 4IEFB 5B3JF 5TFSH 1Q0XH 1QLFA 5LAXA 2P5WE 3MRRB 1GHFH 4EUPH 3MPCA 3V2AR 1ZT4A 3CFCL 4MMXC 3BFOA 4KAQH 1RJZA 3EYQD 4LGRB 2OQJB 2IWGA 1FDLL 1QSFB 5BVJA 4OGAC 1A21A 5DRXA 4FHBD 1BMGA 2OS7A 3QUMA 1FFNA 1Q1JL 4N9GB 4NQDE 5DMIL 3VI4F 3QUYD 1H15A 5E24E 1BFVL 5TQ2L 1U9KA 4W6XB 3O3EA 4Y5XB 3T1FB 4YDIH 3VXQA 4UINH 1XGUA 1IGCL 3O6KL 3RWHA 5E03A 1KCSL 5L2KB 1K85A 2I24N 3KLHC 1TJGL 1XR8B 4YR6A 3FRPG 3VXOA 3S5LA 2EC9T 3OR6A 3PGFL 2JJSC 3BYYA 5IEHA 4YE4L 4R4BA 2EE3A 3L3JB 4JKPL 5C86A 1EBAA 4X7EC 5ELIA 5T3XL 4AMKL 4N1EA 4K8RC 1JNHB 3C2AL 1BJMA 1ZHKA 2X4OA 3QDMB 4WRLA 2DBLL 4MQXD 3WO3B 5MEQB 5IP4A 4Z7WB 4RWHA 5CP7A 3Q0HA 1VFOA 2CQVA 1RUAL 4L8BB 2VDPH 8FABB 3IRZA 4KI1A 2YRLA 4UQ3A 1TIUA 1S7SA 1FIGL 3ZDXE 4KXZH 5CAYB 3WMSA 4XAWH 4HGMA 4XAWL 4ZFZB 3PV7A 3ARGB 5C70A 2FJFA 4ODWA 5IESH 1OGAB 2B1AH 4L8SC 5HSFA 4HUXB 4MNHB 1R5WB 4MAYD 4OF7A 5DMYA 1KCUL 1MOEA 1LP9F 4H88L 3QCTH 5L2JB 4Q2ZB 4F7MA 1NCWH 5L2JA 2ZUYA 1OGTA 1KPVB 3WJJA 3VG0L 4RCAA 3RQ3A 1U91B 2EH7H 3ARGA 5DHVA 4M93C 3CSBA 3PNWA 2FH6A 1I85A 4YC2C 2HRPL 2WSKA 4LCWB 2G60L 3MLZH 3SE9H 4PRHA 3BEWB 3ARWA 5E2TL 3ULUC 3KLAA 1GAFH 3PF2A 4IRJB 4HK3J 1QRND 1XF1A 1SM3H 2HAZA 3BPNB 4P4RB 4MJ6A 4FFVD 4MSWA 4XC1H 5HHPA 3G08A 2W0LA 3DGGA 1UXWB 1RVFH 1NL0H 3HNVL 4M48L 4LSSH 4YHKL 3BIAX 2FLBT 4NO0A 4XNZC 3ILPB 2ICWI 1TCRB 4P3CH 2A74A 4U1KA 4H26A 1JGUH 2ZWLT 4ERSL 1BOGA 2Q86B 1OP5H 4YDJB 3P9MA 1M6OB 4ZFGH 3BMVA 4G8GB 1QSEE 1HHHA 3L3OB 4G5ZL 4EIZC 5AAWA 3B6SA 2VDRH 4HUUB 3ULVH 4J2XA 4XGZA 4MJ2A 4ZYKA 1QQDB 3WD5L 1XGUB 2F8VA 1FCCA 5EU6E 1ADQA 1MAML 5LGKA 5KS9E 4X6BB 2VMFA 3V7AG 5IB1B 2J6EL 3RZCB 2X1OA 3GMNA 3VWKB 2F5AL 5HGDA 3I75B 1BIHA 4CDGC 4GH7B 3VXSA 4M93B 2FZ3B 3FB5A 3QWRA 4Z78A 1A6UH 2EEDA 3HE7C 4JDZB 3NVQA 3WIFB 5BVJB 4HJGA 2ARWA 2X1QA 4PB9L 4LSRL 2W9EL 1NANI 5JQ6L 4RDQG 3TF7C 4LFHG 2V2WB 3JV4B 5BRZB 3CGTA 1HSBB 4AY0A 3S36L 4NUGH 4UMGA 1P7KA 3PL6D 3EIFA 3Q5OA 1ND0A 3EFFA 2AJXH 2VXVL 1I7RB 4PJ8A 4CN4A 2D3VA 4MX7B 3MREB 4Q58C 3PWPB 3SBWA 3GSVB 4ONGH 3QUYB 2NYYC 1S7XA 3GB7B 1CDGA 2J3SA 5HI4D 1FNHA 2R69L 2IMMA 5KSUA 4OLXH 4ZFFB 1MRCH 5D2NB 1LP9E 43CAB 1S7VB 1HQ4A 4DGYL 5DJCB 3JWNC 4ZUWB 3V6FA 1KTRL 3PXHA 1ZANH 2LVCA 3BP7A 1REIA 1OSZB 4ZXBA 2VR5A 4ZS6D 3RVTC 1CFTB 3NN8B 1PG7L 2O61A 4Z7OF 1AIFB 5KVFL 2BY1A 1YDPB 3U7YL 1YN7B 5I1AA 4NQDB 1NGZA 1I75A 4Z7WF 3VD4A 2AK4B 4KKAD 2YD8A 1E4XL 4LSVH 3MV9E 3BP4A 3O11B 1JNJA 4GLRH 4KMTH 4PV9B 3QUXA 5DJZB 2ZOLA 4O58L 3U1SH 2IADA 2Y7QB 1A1NA 3DO7A 1NCAL 1IFHL 2AJSL 4QOKA 2P4AB 1PG7X 2DI7A 1HILB 2ED8A 4RA0C 3MRCA 5ISZA 3GMOB 2ADGA 4KH2A 4GT7A 5EO1A 5ENWA 3UTTE 1IL1B 2XT1B 3MLXL 2VB5A 1L7TL 3KYKH 2XIDA 4JLRA 3DMMC 4HCRA 3B83A 1AO7D 1JNHA 2QV2A 43C9B 4LHUB 4OGXL 3WIFA 3L3GA 4YHLL 3T4YA 1AGFA 2YXMA 1GIGL 1E6OL 1FFRA 5D7KE 5ID1A 1A7QL 4MXWH 1J0KA 4JFEB 2EDXA 3O9WA 2H9GB 1E0OB 3DX8A 2OP4H 3WV0A 5D7IF 4WV1C 3V0VB 5DWUL 1CR9L 3CC5B 1YPZA 2UYLB 4TVPD 1WBZA 2BOCA 5ANMB 3MLYH 3O3BA 1MIEL 3EFFB 2WQRA 3D2UD 4Q6IB 2BVTA 2NXYD 3NPSB 1MCJA 4J7RA 3NMEA 4LOUC 4OTXL 2PETA 4JPKL 5C09A 1CLYH 4HULB 4TUKH 3DETD 4B53A 3DBXA 1DEDA 4KDVA 1V7MH 2A6JB 4R4FH 2P5ED 5CD3A 3OB0K 4J1UA 4GW5A 1MRDL 3K74B 1TVBB 1KN2H 4UNVA 2JB6B 3RPIA 1UFUA 4HWEL 3L6FA 1LO4H 1EFQA 2IPTH 1E4XH 2I60H 3FT3B 4XNZB 3MLUH 3QXDB 5I2IB 3QSKB 2VE6B 1KCRH 1NC2B 3H0TB 4KVNL 4LEXL 1MVFA 1OAQL 3T3MF 1BAFH 1NGPH 3FJTA 4P46B 4OCMC 5KVGL 2Q3AA 1W8NA 2XY1A 4EOWH 5HHOB 3BRGC 1OAZH 3QHFH 3GHEL 3R8QA 3OQ3B 4YEEA 3BH9B 2D7QA 5JW4N 4ZD3L 5TPWH 5EOCJ 1A14L 4JM2A 4ZPTA 1PQZA 3T4YB 3RU8H 4OLXL 3X3GH 1B0RA 3D9AL 3RDTD 3IS0X 4HG4J 1CVRA 3NFNA 4LQ1A 1FYHB 4Z7WE 5KSVA 3OAZH 3M1BA 4JQIH 2NY2C 3TBTB 3HPLA 4QY8A 2DTMH 5LGJA 1N0XL 2D0FA 1N0XH 5C0AD 2YN5A 2JB5H 3VXNB 2VXTL 1X44A 1YEIL 4LARL 3SDDC 2PXYA 5DK2A 4NDMB 1A1NB 1OGAE 1IM9A 3OB0H 4XT1C 4XVUC 4L4VE 4HG4K 1EZVX 5E6YA 3MRQB 4MB5A 1AD9B 4HFUH 3JV0A 2QR0B 2YPKB 4PJ5B 4K9EC 4E5XA 2ZUWA 1FP5A 4L8DA 2HJKA 3TO2B 5LGJB 1IT9L 2WINA 2J5LB 1HWGB 2KBGA 4YEFA 5TDNB 2KQNA 1ZLUK 3HRZB 1UEMA 4D0DA 1P7QD 4K55A 1ZEAL 4JCMA 4KDWA 4AL8H 4ZPVA 3GBMH 2VXUL 1EIBA 1KLGB 1AXSA 1N5YH 4X6DA 4K94C 3I02B 5ISZD 3VXOB 5L2KE 5HGBA 1DBML 1KT2A 3ULVD 1I3VA 4M61A 3QB7C 3PHOA 3OBAA 3ZT5A 5JW4M 3MJ9H 3WFDL 3QDHA 5SWQB 1QVOB 5A2FA 3PWPA 2KZ1B 2JJVA 4WI8A 2CXGA 3W81A 1A7OH 4Q0XH 4AIOA 5HJ3A 3KYNB 3RWEA 4C56B 3WFBH 4YHKH 3GMPA 4RMRA 1JMZA 4TNWF 3MUGB 3LSOA 1KIQB 3QUMB 2CRMA 1INQB 1BGXL 5F6IC 2JJWA 4NQSA 4QO1A 4X6DF 1NGYB 5FFLA 4D8PB 3RL1A 3HR6A 2NXZD 1SMOA 1O0VA 4O51A 3ESVF 5EORL 4FNLH 3P11H 5FA3A 1OAKH 1U93B 5MENA 1JPSL 3FO1B 1EHLH 3DIFB 5DJDA 4HZAA 1BZ9B 4GRWE 5T1MB 2E7LA 3MV8B 1IEBB 3QEGH 1FG2A 2EXWD 2X4UB 3IJSA 3ZE2E 2CDFB 2JE8A 3P2TA 3ZKXC 1T5XB 4DW2L 2R4RL 5EZJB 2EYSB 4XHQA 4G7VL 2VKWA 1CG9A 2P5EB 3QIWB 5EZJA 2X4SB 1FVCA 1OCWL 4PJHE 4Z0XB 1E28A 5BS0B 4ELMB 3QNXB 3IFLL 1OTUC 1N59B 3MRNA 5ICZA 3FRPA 5I1GH 3BHBB 4PREA 2A6IA 2H9GA 5K9QG 1JGEA 5IM7A 3VGAC 3UO1L 5H35A 2KDGA 4GS7C 5DJAB 9CGTA 3QHFL 3D25B 1SYSA 1DJSA 5FO9A 4OLYH 4X8JA 3NZHH 4F7EB 5F7FA 3VW3H 1QLFB 1OPGH 2FL5A 2VDPL 1S9WB 5FM8A 5C7XH 4XH2A 5D6CA 3ROOB 3UBXI 4P4KD 4DUWA 1NCCL 1HK6A 1SJEB 4ORZC 4MXVF 3CSPA 4KKNA 3TVMA 1RULL 4RGOL 4UTBH 1JHKL 4LLVB 5EG6C 2PYEE 3RRQA 5ISZE 3ZKXB 3ARBB 3HLAA 4ZTOL 5I18H 4A2MA 4XPFL 3D3VB 1IAOB 4MLSA 1IQWH 1ZANL 5HTSA 2IH3A 1M7IB 2IAMD 2NX5B 5DJYB 2BSTB 4CADB 3VXME 1I9JH 4JPIB 4ZXBC 2J4WL 1K6QH 1DQJA 3V6OE 1K6QL 1XGYH 3OG4B 2E7CA 1A7BA 1UJ3C 2HJLB 3RUGB 2L7UA 5CSGA 4QHMA 5CFHA 1U3YA 3S35X 1V5JA 3U0WH 3O4LE 1VPOH 1QSED 5E6IC 1H3GA 2NW2A 4AIXA 2NYYD 1U8OA 5D2LF 3NCJH 1UZ6F 1VB9A 5HHXL 1BZ7B 5F72S 3C60C 1I1AC 1EEYA 1WISA 3QI9C 4EI6B 5BMFL 3VG9C 4XNYH 2VXUH 2F54D 2BRQA 1NLDH 4OLZH 4YDLB 1OPGL 2CLRA 4XP4H 3NGBC 1T20A 3VXUD 4XPHH 2A77L 5EPMA 4HMCA 3UTSE 4UDTA 3SGDH 3BE1L 3ARFA 3BPCB 4NC1C 2LQRA 5GZOD 3QO0A 1JGLH 3SBWC 2FL5B 3HE7A 3JWDL 3MO1B 4UILL 5C92A 4PIRF 4ONFH 3SKOA 4O9HL 3L5XH 4AM0A 4AZ8A 1JF5A 4LLDB 4X6CF 4MYWB 4XBPA 5DJAA 4G5ZH 4ONGL 1A6ZB 1DL7L 3R1GH 4PJBF 4WO4D 3HC0A 3OR6B 1KLUB 2UY7A 3ARBD 4RFEB 2FJHB 2X41A 4HPOH 1MY5A 5HGDB 4FFWC 4JRXD 5KS9B 1AGBB 1RZJL 4QOKE 1BBDH 5IB5A 3LEVH 1KPRB 4H0HB 1NAMH 4MA8L 3MLPA 2AABL 3AMKA 3S35L 5GS0C 1R6VA 5J7CC 4MHHI 4UUJA 1KN4L 2PYEA 4MS8C 5CBEB 5ETUA 5MENE 3MRGB 4ZOBA 2D0HA 3O2WL 4L8SB 5JUEL 3UDWA 1D5BB 3S3JA 3CSYA 1IKNA 1C5DA 1KCVL 1KG0B 4MNQA 1RFDL 3MXWH 2V7NA 3MXWL 4KMLB 3RWJA 3WFBL 5BO1H 2GITB 3P73B 1Z5LB 3CFKB 2JLLA 3GKWH 1J0YA 1BQLL 2CRZA 4QKXB 5BV7H 1GZQB 3IDJA 2CUHA 2XZCH 12E8L 4RMUA 1HXYA 4KROD 3H3PL 1S5HA 3D39E 5DURB 4UT9L 3D18A 2IADB 1U8HA 2W0PA 2ZCKH 1TZIB 4MAUL 3L3KB 4KI5F 3PWJA 5T1LD 3ESUF 3BSZH 4HJJH 4JN2A 1M7XA 3MMEA 2BDNL 2AEQH 4NNYB 5I9QB 4HPOL 1J88A 1FH5L 2GTWB 4OZGA 3HNTL 4BYHA 4U1GB 5HY9A 4O4YL 1K8IA 4QHUA 1I8LA 4NQED 4I0PD 3QPQC 3IFNH 2YD5A 4CL7A 1UZ6E 4I2XA 1WZLA 1KPVA 4M5YL 4JM2D 4WTZG 3NTCL 5I71C 5JNYA 1EFXD 1VFAB 4KK8C 2R0WH 3C6LA 5BO1L 2P7TB 1ZHNB 1N3NA 5I1CL 2F74B 3S7GA 43CAA 4XI5C 1HILA 2BNQD 1YYML 2VITB 4N0FB 4WW1B 5HYSA 1IAOA 3BPLB 4QEGA 4AMKH 1OOAA 3OHXB 1G9NH 1F5WA 3SCMC 5F44A 2E8ZA 1U8IA 4MXQD 5D2LB 5DZLA 2FD6L 1F00I 2LTQB 4Z7WA 5I17A 5ESAB 4DTGL 4U6TA 5E2VH 3GSNA 5GSRA 1HIML 5F9JA 4BSWA 2AP2A 3ZZ1A 3MNWB 1WBYB 2CR3A 5FO9B 4I2XB 1UG9A 5DA0B 1FORH 1Y6MR 4LAQH 3DHMA 3VXRA 4AK1A 1KC5H 1XT5A 1JHTB 4ZUTB 1INEL 1DUYB 4P2RB 1OAYH 2H1PH 1MCCA 2K1MA 4YR6B 4LAJH 2YWYA 5CD5C 5FK9B 1NCWL 1B4JH 2O5XH 1WC7B 4NNPL 1HINH 3VXSE 4M6OH 1NFIB 2N4IA 5GISL 3BGAA 2X42A 2ICWB 3LMJH 4X6FB 4OZ4A 1IBGH 4RISH 2AJYL 3VGEA 2VRAA 2WLYA 2VLMD 5DRXB 1T21B 2P42B 5AZEH 4I5BB 3TGXA 5I19H 5KZCD 3ULVC 1QSEA 2CDGA 5I19L 3TM6A 2WWMD 5GS3A 2RR3A 3RY4A 1MCLA 5EBMA 3K1DA 4R26L 5DFVC 1RMFH 1PYWB 4PJBE 5B38A 3MGAA 4NHCL 1BM3H 4HMDA 5LXGH 1WWAX 4ZQKA 1JFQH 1HCVA 3H7BB 3GJEB 2BVOA 5CBAB 3ARFC 2UUDK 1I1YA 1BQHG 4KHXH 1QQDA 5TPWL 4ZD3H 4PJEF 1NEZG 1X7QB 4B41A 2IALA 2E7BA 3B9KC 3MLXH 5I6XB 3KNBB 3OKMB 1DFBL 3JSSA 4LCCB 3IDNA 4JFYA 3HCVB 3D3VD 2YC1B 5IMLA 4XI5D 4JFZH 2RCSL 1BJ8A 1LO2H 1LO3H 4JKPH 4LPUA 4QTIH 3KYOA 1EMTH 3WCYA 1AFVL 3IDXL 4K3EH 4KRPB 3WNKA 5TE4H 2JKXA 4HLJA 3TJHD 4UTBL 1ZLSL 2VTFA 5HVHC 3VWKC 4UV4L 4FZ8L 4V2CB 3BUYA 1DUZA 4PGCA 3NFSH 5GZNC 4LEOA 4O2FB 1ZVSA 1D5MA 1E4WH 4EDXA 2GK0A 1KB5H 5AYQA 1XR9A 3AREB 3BQUB 3VFTA 4M4RA 4LNVA 1YA5A 2GJJA 3LN9A 3MFFA 5FM5O 3RBGA 1MPAL 1Q9WB 3DSFH 2FGWH 4MDIA 3ES6A 4IHOA 3LKRB 1KV3A 3P30H 4H0GA 4JKKA 4M3JA 1IAKB 4P4KC 4YFDB 3S34L 5DMKB 3LKPA 3R06B 3VFMB 3RTQD 2Q8AH 4G6AC 1VFAA 3DV6A 5KVDH 3DV4A 2MKLC 2BMKA 4LLUB 2X4PA 2QTEA 2AI0L 3VCLA 2AQ2A 4NKDB 1XGTB 3C60B 2C5DC 5JORA 1GIGH 4EEEA 4XNMB 4NQEB 2AK1H 4DVBB 3F62A 1FG9C 4KUCF 2IAMC 4WY7H 3VFRA 4Z7QE 4OQTL 2F58H 2VDKL 3KNBA 1NFDA 2PNDA 1NAMB 4TULL 5ACMA 1PEZA 1K4CB 5GGRB 2EDRA 3O3EB 3T1FA 3X12B 1ZE3C 3BN9C 1MIML 2H1PL 2B5IC 5DJ2A 3RVWD 4PYHA 4GKNA 5CP7B 1CFSA 3PL6B 3HI6H 3CFJB 1AKJA 5CHNB 3UTSA 4KTEL 3SGDI 4CW1B 4N9GA 2GJ6B 4U1SA 4HS6A 5D7IE 3BD4A 3QI9D 5EBMB 2VH5L 3QUMH 3D3VE 4JM2F 1NQBA 1FC1A 2Q8AL 3IJHB 2DTML 3CXHJ 4Q6YA 3RKDD 1NLBL 1JYXA 1OAXH 4LKXB 4LCIH 5IMKB 5JW3H 4G8IA 2F54E 1U2CA 3S35H 5DFTA 4ZO6A 4DGIH 3EDDA 1T0NA 3MBEC 5IW1B 3WIHL 4E41D 4KI5D 4Z95L 5EU5B 5TH2A 1YPZB 3BWAB 3V5DB 4R4NC 3FO2A 5I73C 3GBNL 1J18A 5J11B 3BO8A 5D7JC 3UTSD 1T22B 2G9HA 3W0WB 4OJFL 3OKOB 3UZVB 1UVQB 3O8XD 4XB8A 4PY7B 5KANG 4U1LB 4FQPA 4LSUH 4WO4C 3RNKB 2FEDC 3RL2A 1VHPA 1A7PL 5KS9F 4ZAKD 1DFBH 3N1PC 1TCRA 4TVPE 1DANU 1XGPA 1FGVL 3EYOA 5TE7L 5IW6B 5B39B 4ETYA 1XIWC 4FABL 4QOKD 1X5AA 4K8RL 5BVPL 4U6VH 2WINB 4JHZA 5L7XH 1YMMA 2A77H 3EJYD 1A47A 2M26A 3PDOB 3PDGA 5DJ2B 2DM7A 5I1KL 2OL3H 1J8HA 2B1AL 3PWLB 5DEFA 2Z92B 3OJVC 4JFFA 2QKIB 5JIPA 5D7IB 1RMFL 5EIQA 5DD3L 5CGYC 5E9DE 3TYFB 2YRPA 3ZHKA 1XF3B 5I8CA 3B2UC 5L8LB 2JF1A 3OKDB 5F9DC 3RWIB 1IRAY 4LPWA 5EWIH 4G7YL 2APTA 1U41A 4FS0A 4NPYB 4DWHA 1KEGL 3OJDA 3E6HB 4I3SL 2I9LB 1BFTA 2IPKA 4FZEH 3ZDZF 3B9EA 3VRIA 2XN9B 3QQ3A 3RUGA 4Z7QF 1FZJA 3CVIH 1ACYH 1IAIM 5E95B 4IIQC 3GGWA 1WWWX 5ACLA 1IZKA 2R56H 3KWWA 4XC3H 4HV8B 4JQVC 4OLWH 3DWTA 3T0XA 4JPIA 1X4ZA 2HLAB 4F37K 4G42A 1R3LA 4YX2H 5E56A 1VFMA 4IOSD 2M8XA 2HJFA 4U1IA 3QUYA 3Q5YA 1N64L 1G7QA 1KLFA 3LDBC 3ILQC 4P57B 5CEZH 4KUZL 5JMOC 2YK1H 5E4EB 2IJ0C 4UB0L 2Z93A 4Z7VA 2OZ4H 2A83A 4OZHF 2OZ4L 4M1CD 4XPFH 1MJJB 4PGCB 2CDEA 3NA4A 4TVPL 3REVB 3PHQA 4QHLB 4Z7NF 1RK0B 3IVKA 4OCWH 2VABB 4F9PA 3T2PA 3NZHL 4JO4H 1F3DJ 3QUZD 4I48B 4KVCH 1EGJL 1J0IA 4Y19D 3H42H 4PRAA 1QA9A 2W92A 3QFDA 1GGIH