4U05A

Homodimeric single domain antibody (sdab) against staphylococcal enterotoxin b (seb) s74a variant
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
130
structure length
130
Chain Sequence
MEVQLVESGGGLVQAGDSLRLSCTASGRTFSRAVMGWFRQAPGKEREFVAAISAAPGTAYYAFYADSVRGRFSIAADSAKNTVYLQMNSLKPEDTAVYYCAADLKMQVAAYMNQRSVDYWGQGTQVTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and mutational analysis of a monomeric and dimeric form of a single domain antibody with implications for protein misfolding.
pubmed doi rcsb
source organism Lama glama
molecule tags Immune system
molecule keywords Single Domain Antibody
total genus 32
structure length 130
sequence length 130
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-07-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4u05A00
1IM3B 4Q74A 3G6AA 5IHLB 2X9YA 5EUKB 3S36L 3TZVB 2E7BA 3DPBA 4Y1AB 4FFZH 1WC7B 1RZKC 2EKSA 2BY1A 3ZO0A 5DHVA 4Z7UE 4UNUA 3RWFA 3SOBL 2W0FA 2J12B 1PVHA 1C12B 5F1KC 4NHCH 2CJUL 2WUBL 2EE3A 3ARGC 5T1DL 5AUMB 4LCWD 5IHBA 4HMCA 3H3PH 1GHFH 5L88L 1FC1A 2DQTL 3BJ91 3BPLB 2FIRT 4DQOH 5GSRB 3ULUC 3GHBL 3MNZA 4KK5C 5TE7L 1NC2D 5MEOB 3NBNA 1ZGLP 1G0XA 4LLWB 4GS7C 3QEHB 3RQ3A 3P9LA 3RGVD 5I1KL 2WIIA 1CGTA 1D6VL 3WJJA 3ILPA 4X5XB 2FEEI 2XZCH 1ZVHA 1IAIL 2BVYA 3L95B 3CVIL 1FG9C 3G6JF 1BLNB 3QXAA 4J4PC 5GHWL 3T0BA 4B41A 1EUTA 4XVTL 3NPSB 4DW2H 1IBGH 5EU5B 5IBLC 1M7DB 5GRXG 5H2BB 3IDYB 3H3KA 3HKFA 1J1OH 5EU3B 4NQDD 5IMLB 2DL9A 2GIYA 4HF5L 5F6HI 2SEBA 4L3AA 1J88A 3V7AG 3QUZB 1OD7A 1TJIH 3MJ6A 1DUZB 4DN3L 5ITFA 4HT1L 5HHMB 4R2GC 4KK5D 3PP4H 3P0YL 5IMOB 4HUKB 2ZKHH 4UIMA 4UTBH 3T77B 1NL0L 3ZKXB 4KRPC 3WIHH 2XQYK 3WMSA 4QY8A 4X7EC 1OP3K 3U0WH 2GT9B 1E6JL 1KCSL 1D6EB 4M6MH 1WAAE 4G5ZH 3REVA 4R7NA 2VLLB 5HHOD 4JFXB 3IKCB 4JRYE 2FX9H 2ZCHL 4PJAA 4G8IA 3UPRB 5FKAA 3SE3A 3WN5A 3K2MC 2AJXL 5D2LA 3C8KA 2O5ZL 3U9UA 3NPSC 1FSKC 4U4BA 4OF8A 4QWWD 4KK6D 5DMGD 5CSGA 1A0QL 2ZNXA 2H9GA 3VXUD 5C0IA 2COQA 1MREL 4Y16C 4TUOA 5IOPA 4GAJL 3SDDA 2KQNA 3UJTH 5FGCB 1HKLH 2H6PA 4WGWB 4KUZL 1RULH 2NY6B 3MRQB 1CFTB 5ENWA 3DVGB 2VIRB 3BUYB 3O11A 2FX7L 3PWPB 5FYKD 3ARDA 4ODWA 1KLUA 5DLML 4L4JA 5C0CD 1NMCC 2HP4A 4MA7H 1UM5H 3VXOA 4LSPL 1NCNA 4XMLL 5HDBE 1Q1JL 1UXWA 2DQTH 3NABL 2XQBL 1N6VA 3BKCH 4HS3B 5CZVH 2Z0BA 1RUAH 3HC3L 1N6UA 3WD5H 3KLHD 4KKLC 3QSKB 4XCYB 3TYFA 4MAYA 3MREA 3VGFA 4GUPA 4P23B 5E03A 4PGZA 1MJUH 4HKZB 4UDTB 2YWYA 4BFIB 4EN3A 4LLDA 3IGAB 1J0YA 3C2SA 5IESH 1OWRM 3FB6B 4MS8D 1NBVH 3EOBA 1QO3B 3ARDC 5FYKU 1IAOA 3L3GB 2HVJB 3P0GB 1DR9A 4GW4A 2NTFA 1DBML 3HI6L 2R0ZH 3PWNB 4NO2A 4X83A 1MPAH 4PJBA 3MRLB 2IFGA 4EUPG 4K55A 1ODAA 1I7ZB 2FSEB 1PY9A 3BKJH 2ZCKH 3DVNB 4XI5C 1S7RA 5B3JF 4W68A 3VXQA 2L4OA 3CVHA 1XF4B 5BVPL 2F54A 4QXTA 1VEOA 3TIDA 4NZRH 4B7IA 1Z9SA 3O2WH 1QSEE 1HHHB 4HIHB 4F33A 3T0AA 4WFHE 5C3TA 1GJIA 3FT2A 1A6WL 4F37F 2DIAA 1NBYA 4OZFB 4R7DB 1IC4H 1NBZB 5K93A 3WSQH 4OV6F 4NQED 4KKAC 5DR5L 3IJSB 4P2RB 3MJ7A 4ODHL 1WWCA 5FV2A 1H3UA 2HT4C 3C09C 3WXWH 4OCWL 1NCBL 3LKPB 3K46A 1KIQA 1PX4A 3I75A 3AAZB 4X4ZA 3GJFB 4XPAH 4EDWH 1EFXD 4YR6A 43C9B 5EUKA 3ZL4H 5EOCJ 2F19L 2RJMA 1F3JA 3Q5OA 1W72H 5BRZB 2HG5A 5JR1H 4Z7WA 1XGQA 4JFYB 2MWCA 1QPXA 3ULVE 1WFUA 2E7CA 1ED3B 4XWGH 4OCNC 4S1QL 4MNQE 1A7PL 3V4PL 2WM0A 4NCDA 2XTJB 4Y8AA 3LKNA 4PGEA 1P84J 3TA3A 5J6HA 5B3JE 3BPNB 5H8DA 4XGZA 1MCPL 3UZVB 4PP1D 2NY3D 5KS9A 1A1NB 3TIEA 2HFGL 5C7XH 3BKYL 3EO1B 4PJ5D 1CK0L 1L0YA 1NC4D 1VHPA 5BQ7A 3RKPA 4MQSB 1RZ7L 1P9MC 1XGYH 5D5MA 2X1OA 3B2UD 4D3CH 5BO1L 5BMFL 5CJXA 5BZDA 1R3JA 3CSYA 3MROB 4LEXL 4ZDHA 5JXEC 3U7WL 2AXJA 3DWTA 5IFHL 1I9JH 4M5YL 3GKWH 5B38A 3LRGA 4FQXD 4OD3L 5IKCA 1GGCL 1KT2B 2W60B 3UBXG 3IJSA 3L5WB 1WK0A 4LU5L 1G6VK 3IDMB 3HC0A 1EEQA 2VRAA 2Y06L 3M17B 1JYWA 3Q6FB 3PQYA 2DQUH 4Z0XA 1A1OB 5E2UL 1U3JA 4BSVA 5TFSH 2Y6SD 2X4TA 3TLRA 2P42B 3O9WC 1B3JA 1U8IA 1MCCA 2OTUA 5CBEA 3TVMB 5FO7B 1KEGL 5LGKA 4I13B 1MUJB 5CLTA 2DN7A 4P59H 3BYTA 4NT6A 4NO3A 1T66C 5I1DB 5IBTL 3TV3H 5IOPB 4UI2A 1ZWIB 3TYGH 3KDMA 2R2CA 5HGBA 1G7PA 3LS5H 4GOSA 4XVUD 4NZTL 5K9KB 2ADFL 2EECA 3QISA 2XA8L 3QFJD 5D2LB 2E7LC 3GI8L 4JY4B 3GMNA 5I1LB 3CFJB 3MROA 3MCG1 1XCQB 1DQJB 1PG7W 1YY9D 1U3YA 4WU7A 2PO6B 1KIPB 4KJYA 5IGXH 4LARH 3TZVD 3HMXH 4DOHB 1T7ZA 1YECH 4PP1C 5DEFA 5IIEA 2GUOB 3LS4H 2X4QA 1I1AA 4KV5F 4POYA 3UEZA 3U4AA 3IAPA 1YA5A 1FG2A 3CFEB 2R4RL 3S97C 4TVPD 2DJSA 4OLZH 4LRIC 2PKDA 5ESVB 1FDLH 4HXAL 1H3PH 4HUXB 3CJJA 4PB0H 3QULA 3PL6A 5D7SL 3ZE2F 4YNYB 3HR5B 4X4ME 1K4DB 4XP5L 4MXWL 5GGRY 4QTIH 4LGSB 3LKOA 4NBYB 4JM2F 2Z9TA 2UVEA 3QH3A 3WSQL 3VXUA 1JE6A 3W9EA 2R39A 5D1XD 3KYOB 3RNKA 3CFBA 3G5ZA 2WLZA 4DKEH 5I16B 4DZBA 4ZTPH 1TZHB 4BUHA 4XVJH 5DZLA 1Q9OB 3ULVF 2XPGA 4RMRA 3ALXA 5ISZB 3VWJD 1JZ4A 1JBJA 1FH5H 5HXMA 1FFPB 4PTUA 4G9FB 2VXSL 3L5IA 1CQKA 4OCYH 4HIXH 3HNVH 1R5VA 4I4WB 1WICA 2DLFL 4OZHA 3QPQD 1FE8H 1RK0B 1P84K 5HHMD 2A6DB 3ZE2E 2JCCB 2IADA 2EIEA 2GK0B 2A77H 4RFNB 1LEIB 4FQJH 4P3DB 3BP6B 4RDQF 1RZFH 3BDBA 3WO4B 3QO0A 1HQRB 5F7MC 1F11B 1T7XA 2HFTA 2DQIL 2H3NA 2BSSB 2QKIA 2X70A 1YNKL 1G6RH 3JV5A 3DMMA 2OK0L 4KZEL 2X42A 1H9VA 1F4AA 4O2EA 1JGDB 2WSKA 3CSGA 4OFIA 3GMLB 3KPRA 3NCJL 4U49A 5EOQH 4N0CC 4JDZB 2MCPH 5CFHA 4HIIA 3DX8A 3SJVB 2E7MA 3RVVC 4N8CH 2P46B 1JF6A 1P2CA 1EVUA 2VDKH 1IAOB 2ESVD 1FFOA 2PXYD 3MLPA 1GZPA 2XKNB 3QFDA 4UINH 5IV2B 5K9QG 1RUKH 2NY6D 4RBPH 1NUDA 5KSAB 4OZHF 3LEVH 5GGRB 3CFCL 3OKDA 4U1IB 5MERA 5C0CB 4KJYB 1L7IH 1QEWB 2X7LB 2XZQH 4UDUB 3PGFL 5A16A 5IW6B 3HRZB 1T1WB 4NWUL 2N1KA 3RL2A 2R69L 3DV6A 2XKSA 3LQZB 4IMKA 4C83B 1QFWL 4MD5A 4LKCB 4PJXA 1ZVYA 3GO1L 3U0PB 4NFDA 1HH6B 1I1YB 3DYOA 1DQQA 4YDIL 4U6VL 4P2RD 5IB2B 4Y16D 1OQOA 5E4IA 2XIDA 5L2KB 5GISH 5FGBC 3TBTA 5ACZA 2VXVH 4KK6C 4K2UL 4XHJD 2G5BA 4KI5E 4QYOB 4R7DA 5AZ2L 4PV9A 5IEHB 3OGOE 2UY6A 3N1QC 4ZSOE 2XYCA 3O6LH 3UBXI 1RURH 2L0DA 3EYUH 2VXSH 4UQ2A 4YDVB 4JRXD 4PV9B 4Q0XH 5BRZD 5IEHA 1T2QH 2ZKHL 4CMMB 4FQLH 1MCLA 4NM4H 2EYSB 5E5RB 3LHPH 3FN3A 1FFNA 3S3PA 1FNEA 1OTTD 3BKJL 3OKKB 5ANMA 1A7NL 1ZHLB 4X9GA 4M61B 5IVXB 4JFFD 4E5XB 4ZXBD 3BEWA 1FYHB 2ED9A 1LO0L 5HDBF 5EUOB 5EN2A 1ZSDA 5C0BB 4ELKA 2OL3B 3HE7B 1G7JB 4KV5E 3UZEA 3C9NB 2NZ9C 1Z3GH 5A16B 4H25B 4D94A 4Y4KD 1AD0A 2RGSA 3O6KH 5FYKL 1UWGH 1NUFA 3CSPA 5FUOH 1BX2B 4LLYA 4LBEB 4LLQA 5IWLA 1CICC 1JF1B 1V3KA 2AJ3A 2PTUA 3HPLB 4WTZG 3WJLA 3DECA 2OP4L 4WI5A 1UB6A 4NO0B 5L88H 1J10A 3UX9B 4PJCF 4PJEF 1I1YA 4EBQL 1JZ6A 4PJ5E 2WUBH 5DUPL 2XWTA 2VDRL 5CD5D 5DLMH 3WFEH 2OXGA 4Q9RL 3MLRH 1AY1H 1I3RA 4PJDA 1TZIA 4ZPVA 4ZO9A 1P5VA 3V6FB 3Q48A 1FIGH 4JGJA 1VEPA 2JJSA 2IH1B 3BD4A 4IOFC 4LNRB 4ZFOL 1A14L 1FZJA 5HYQB 1FV1B 3SDAC 2RBLA 1HI6A 2CH8A 3CMOH 2X1QA 3LVEA 4MAUH 4NC2B 3MLXH 2QSCH 4GMSH 1XAUA 4AIXA 1MCWW 1J9CT 1M05A 1HHJB 1S7TB 4PJ9B 4P2RE 1MJJB 1QQDA 4I48B 4JHAH 4M6NL 5IK3A 1SBBA 3L5JA 4PJ7A 3ULUH 5HGAA 3G6JA 4YZFE 1NGQH 4NM4L 2FDBP 5I8OL 2C3GA 1MJJA 3RJQB 1MVUB 3BIKB 5FO9A 1GGIL 2GAZA 4JO4H 2UVFA 4Y5XC 4F7EB 4Y1AE 3TZVA 3VDBA 1A6ZB 1E6JH 4OCMC 1W0VB 5B8CB 1VADA 3IS1X 4NQXA 1WV7T 5KSUA 2Z35A 3QIWB 1WZ1L 3AREC 4LEOA 3H8NA 4HJ0D 1NL0H 3JTSB 3U46A 2XZAH 2ZWLT 4PV8A 4HK0B 1MNUL 4K8RH 1CZ8L 4S10A 3BE1L 4DN3H 2Z31B 3PL6D 4OIIH 2CXGA 4OGYL 3VGGA 2BCKB 5I18L 4NQEE 3OBAA 2QQKH 3KYAA 3H7BB 5IB1B 1INDH 1KB5A 4H8WH 4WO4A 2RCSH 3HLAB 4WDIB 1K4DA 4N1EA 4YO0B 2NX5A 1BQHA 3WCYA 3DOSA 2MHAA 5C6TH 1UYWH 4JLRA 3DURB 1DZBA 3N9GH 4FQHB 1HHIB 3JWNC 5GZNC 1JV5A 2P7TA 4JY6A 3MODH 2PTVA 3T2NL 1CFTA 4FFVC 3GFUA 2C9AA 3NZ8A 3QFDB 1WCQA 3VRJB 3QIWC 3GMQA 3GIVA 3IJYB 4HZAA 1HHIA 4FQHA 4HGMA 5AAWA 5TDPB 3D85B 3U83A 1R3IL 4E42A 3FO9B 4Z7WE 1YNLL 3QEUB 3GMNB 4GMSL 5C1MB 4M1DL 4Q2ZA 2PO6D 3VXME 3R06A 4KROC 5IBUG 4OB5L 4YXKH 1LO2L 2RHEA 3MBED 3CDGB 3S36H 4OZIB 4DGVH 1T2XA 3EOBB 2BK8A 2VXQH 1OGAA 1F45A 1U8PB 4Q9RH 1UA6L 5IUSA 3BE1H 3TBTB 5ACZB 4QRPA 5F7FA 1FJ1A 1QSEB 5EWIH 2ZUXA 3IFLH 3KPRD 1S7QB 3OF6A 1FL6B 3NCMA 4MAYB 4F57L 1U42A 4K3DH 3VXRE 1NFIB 4XNUL 3QUXD 4HIXL 4PJHF 3SE4C 1LDPL 4HJ0C 4LKCA 1ZTXH 5F6IB 3DX7A 5K9JL 5C9KA 4FOMA 3O2WL 3MRCA 4X6CE 5FM4A 5FECB 4L5FH 4ENED 2XT1B 1DN2A 1I7TA 3HI1A 3PXJA 4E41A 5DJAA 4I0KA 3BDXA 4G3YL 1WFNA 2WBJD 3O11B 5E2WH 2APWA 5HJ3A 4M9PA 2J8UA 5D6DA 3NTCL 3L3KB 4MLSA 5ECJE 1JGVH 1GH7A 5FOBA 3HTLX 1SY6H 4XNZC 1YDPA 4O51A 4JE4B 4KHTH 2V7NA 2VLMD 4V1DA 2J5LB 2BERA 4X98A 3IVKB 1A14H 3UTSD 1P5UA 2EKJA 3SDAD 5MP6H 2FLRT 1AY1L 4IOFD 4XAKE 3VGDA 4U6YA 3MLRL 1I8MB 4PS4H 4L5FL 3ZKQD 4QRUB 4ODWB 5T3XD 3AU1A 3EYUL 4AEHL 3V0VB 2I9TA 2Q76A 4GAGH 5IM7B 4AH2A 1EBPA 2B0SH 3OKLA 3P77B 4R0LC 4NRYB 2BSSA 4NHUB 5I19L 2VXVL 1F4HA 4ZOEA 3EAKA 4XMLH 3K80A 4RMQA 1RVFH 4QRRD 5BRZA 5DD0L 3MNVB 1YJDL 5JZ7C 1QLEH 4HFUH 4UILH 4YDIH 1EJOH 1L4IA 1X5YA 3BH8B 3ZHDA 2JELL 3C5JA 5KVFL 4Y5YA 4CVZB 4P5TC 2PN5A 4TSAL 2ESVE 3ARGB 3ALWA 5CP7B 2DBJA 1MELA 1ZA6A 2VXUL 2ADIB 4Y4KC 3S9DB 3VGAC 3V7MA 1DDHA 3DO7B 4ZXBB 4RMVA 5L7XL 3GM8A 4DTGL 4R4FL 2HJFB 3MLSH 3TJEL 2W9DH 1XR8A 3BJLA 4KRPB 5C0BD 2DQFA 4YEFA 2V6HA 2ARWA 5CEYA 1NCAH 4LLWA 2DJUA 1RZIB 4UT7H 3IF1A 5J13C 4Q0XL 4NUJA 4U7MA 5L2KE 4ZYKB 2LAGB 5CIPH 5DO2D 5E7FA 4C56E 4M03A 4GQ9L 4ODTL 5GJSL 4I0PC 4FRWA 5HHVH 3EO1A 1P7KB 4ONGH 3PDDA 3QWOB 4C58B 1CG9A 4I0PA 3UC0H 2BOCA 3TN0D 2J4WL 2YD4A 4OTXL 5HHME 1I1FA 2Y23A 3O3BA 4ZFFA 3VGEA 3AMLA 4GG6F 1GPOH 1QOKA 3I85A 5TF0A 4X4YB 5FYJD 4U2YA 4NPYA 2J1KA 1I1RA 5D7IF 2EDYA 5GGSA 4NQCE 3MPCA 5BRZE 1RI8A 4KKBC 1S7WB 1E6OL 1MCIA 1CE6A 3K4AA 4Z18A 2GUOA 4QHNB 3VFVA 4GKZB 3QZWG 3BMWA 4ZUTB 5LWYH 1KENH 2A77L 3ZKSD 5F1IB 3G5XB 1FORL 2XA3A 2XZQL 3VFVB 2OTWB 1M6OB 1LP9F 2X05A 1FRGL 2XZAL 1KIQB 4DVRH 2EDQA 4O02H 3CVIH 3O2DH 2SEBB 2OSLA 4JFFB 3H7BA 2CDEB 2VLRB 1F4YL 2VLJA 4Y5YC 1C12A 4ODVL 4JAMB 1KCVL 2VDKL 5LGJA 5TDOB 5K9QI 4JDTL 1FN4A 1FHGA 5DJ8B 4F7CB 2QR0A 3O2DA 3RNQA 3LKRB 1N7ML 5D7KE 4WTXA 3BXNA 4N0FB 3D69B 1AGFA 4GKSB 4MB3A 5MEQB 5BZWA 3JVGC 5C07B 3E3QE 1FVEB 4TTDD 5MEOA 4HHAB 5IHUL 5CJOL 3RP1A 3WXWL 4X0KB 1SYSB 2H6PB 4Y8DC 2AGJL 4RMUA 5CD3B 3LKRA 4EOWL 1CFQB 1UM6L 3C87A 4XCNB 3W9DA 3RDTB 2P5WE 1L0XA 1XF5B 1N59A 4I3RH 1H3PL 3C6LD 4TN9A 1R3HA 2OZ4A 2WP3O 1CGYA 5HY9B 3BO8B 1PZ5B 3RUGA 1FPTH 3RWCB 3RU8L 5J56B 4Q2ZB 2P44B 4MMZC 1A1MB 3CFIC 1D5IH 5B38B 4YIQB 1QYGH 3RUGB 4MA3A 3SKUD 4Z78B 4A6YH 1CD0A 1DTUA 5IT2L 3SDXA 2YRPA 1R5WA 4WENB 3VXRA 3S7GA 2HKHL 5BVPH 4RMSA 5EO9B 4JKLA 2KKQA 3K2UH 3FB6A 4PY8J 1OCWH 3MRBA 4M6OL 2C3HA 2ERJC 4HXBL 3O3EA 3U6RB 1DBBL 3LMJL 2CDGB 5JHDD 3FO2A 3PDOB 3U0TB 4LLMB 4R26L 4QRTA 3VWJC 3BQUC 1MOEA 1P53A 1TVHA 4DKEL 4M1GL 2FECI 1XCQA 1UKQA 2BZDA 3MV7B 4KKNA 5CJOH 3MR9A 1MPAL 3QNZA 2GAZB 1S9XA 3O41B 1I7UB 2FB4L 3F7PC 4WHYH 3ZT5A 4F3FB 7FABL 5AZEL 5J9PB 4WGVB 4MDIA 3MR9B 3VG9B 4ODUA 3V5HB 2V2XB 5JNYA 3SJVE 5HYSB 5KOVC 1FFPA 5D7IB 1TJGL 3T8XB 4XNMB 2WBJC 3VRJA 4DVBB 2QHRL 4FZEL 4LHUB 3OTTA 1QKZL 3IXTA 5KN5A 3L7FB 4G80B 4L9LB 2Z31D 3QBTB 1F3RB 3BKCL 2CO6B 4HUNB 3S37X 2Q20A 4DKFH 1EBAA 1VFMA 5IB5A 1OAZL 3EJZC 4M7KH 5C9JA 4HS3A 3L1OL 4HIIB 1T89A 4AIZB 2J88L 1KCRH 1ZLWH 3DX7B 1UA6H 1IARB 5MEND 4BSWB 5C9JB 1RJLA 2XV6B 4C55A 1RU9L 2O93L 2NY1C 3FOLA 5IB5B 4DK3A 4XPBH 1MIMH 1KPRA 1KJ3L 3P3YA 3HE7C 3VXUE 1KUMA 1ORQB 4NWUH 2W65B 2Z93A 4LVHB 1YN6A 1F4WH 4EN3B 4WUUB 1FAIH 5KS9F 2BHZA 2X4UA 3TV3L 5ITBL 3L5XL 3MLTA 2W65A 2Z93B 4JCLA 2BX5A 4U7SA 4CUCA 2Z92A 5IB3A 5DRNA 1BHGA 1P2CB 5INDA 3AS3A 3O4LA 5AAMA 4ZUVB 1QLFA 1QR1A 2YD3A 1C5BH 1AQDB 5I8CA 5E9DD 3O41A 4WRLA 3O9WD 5KVDH 1QLFB 5HYJE 4OI8A 3UPAA 4IIQC 4N8VB 3N85L 3ABZA 1G7PB 2BNQE 2DB8A 2R2EB 3CH1B 4MXVE 5I8KL 4HJGA 5MEPB 1RJYB 5B22A 4JPIA 3U30B 5EIVA 4P46C 4QRRA 2VL5A 1IKFH 3U7AA 3VDAA 3VFPB 1J5OH 4P5TD 2P5EB 2YD1A 5GGTL 2NY2B 3GSVA 1CL7L 3GSNB 3U9PH 2GITA 4BFEA 43C9A 3GMOB 1A7RL 4ORGB 1RMFH 4WI3A 4XBPB 3VH8B 2CKBH 4P46A 2LQRA 4EJ1C 3RVWC 3VXMB 3T0ED 5DD0H 1EZVX 2B1HH 4Y4FD 5A3ID 3X12B 1K5NB 2W60A 4HWZB 4RDQG 4YHNA 1P1ZB 3RZCB 3QP3A 3QUMA 1WZ1H 3U1SH 2B1AH 1TXKA 4W4OC 2AK1L 1ZMYA 4JN2B 4JFDA 2B0SL 2JJSC 3CXHK 3BFOA 1LP9A 4JFPA 4ODTH 4P2QB 1AFVH 1F4XL 3L7EB 3TPKA 1IAII 2I26N 2AV7B 3ARFB 1A7PH 3RTQC 3I84A 4ZTOL 1BOGA 2IANE 3CNKA 3B4NA 2VO5A 2VQUA 1A6TA 4JFDE 4LCWB 1MFBL 5F1NA 3WFBL 5E0QA 5T1DH 4GG6A 1YPZE 4FMKA 2H8PA 2W9DL 3MRKA 2WBKA 1LO4H 2ZUYA 3HE7A 1JHTB 2Q3ZA 1AQDA 1MVUA 5BCAA 1LWRA 4HKXA 5LGJB 4YGVB 4ODBD 4OKVB 4Z0BL 1I8IB 5IWLC 5KSBF 1LK3H 1Q9KA 3TA3B 4PRHD 5D1QC 1ZA3B 3CVHL 3H2WA 1VACA 2YN3A 4X6CF 5F1OB 1M4KA 1UEMA 4L4TB 1DBKH 1EH9A 2BMKB 4XVSL 5IESL 1EMTL 2OQJA 5ALBH 1WC7A 4O2CA 1ZV5A 4JHWL 1A4JA 5CGMA 4L8BB 1NAKH 1WT5C 3U7YH 4G6FD 2Q8AL 1C16A 1J1PL 3OL2A 2VZOA 3VJ6B 3D2UB 4ZSOA 4HK3J 3UJIL 4G8EB 4P4RA 5C0FA 3LKPA 5DVOA 3V6OA 1G7IA 1KB5B 1KTLA 4ZNEA 4FABH 4NPYB 5I75B 2E27H 4JHWH 2Z8VC 1LP9E 1UVQA 3QCUH 3JWDL 4NUGH 5HHOA 3SCMC 2B8OT 4W81A 4XB7A 3C8DA 1XH3B 4LF3B 4DKDC 3RY4A 2GJ6D 5BV7L 2CLRA 1LDSA 4P4KC 3GUTB 4MNGB 4Z7QF 4K7FB 4CADB 2HTLD 1KIPA 3TVMA 5CBEB 1K2DB 1JPFA 4JZJA 3L3JA 1Q9OA 4EQ3A 2E9BA 2AERT 3N1PC 5IMLA 4PJIB 3IFPB 3MRHB 1IM9D 3ZE1F 1SVCP 2C4XA 3PE9A 4UT9L 5L6YL 4ELMF 4RFEB 4MNQA 3W9EB 1S7SB 3D6GA 4GRWB 3U4BL 1R3LB 5KS9E 1Q72L 4MA8L 4XP4L 3ULSB 3NABH 2BJML 5D4QA 1JZ2A 3P4OA 3P4LA 1XF3A 2PW1A 3GBNL 2EDOA 3S5LG 3MOAL 2ENSA 3QRGH 1YMME 5CCKH 4GBXB 4HJJH 1RD6A 3THMH 1XF3B 2PW1B 1JI1A 1AI1H 3ARFC 1GOGA 3ZDYE 1JTOA 5T1LA 3NOIA 1TZHA 5E8NB 3JV0A 5GGTH 4ZD3L 4PJHE 4Y2DC 4OB5H 4MXVF 3H0TB 1IBGL 2QQLH 1IGYB 5ICXB 3KYKH 1IFHH 2JCCE 4ONOA 3OZ9H 4FG6D 1FO0L 2UUDK 2DMBA 2XZCL 3VWKD 4YXHH 1I9RH 3HAEG 1XIWA 3SGEI 5LBSH 1JZ3A 3IDGA 1UCTA 2F58L 2ZOKB 2FR4A 1OSZB 4DKAA 3D39E 1IGYA 2OX5A 1HXYA 3DRTB 4KROD 3PWPA 3WKMH 5IVXE 5FOBB 1L6ZA 2PXYC 5EZOH 1HINH 5ISZA 3P30H 1G0YR 4QHKJ 5FYLH 5KW9L 4PJCB 3ZDYF 2VC2L 2NR6D 1J8KA 1HXMB 5I74B 3QUZD 2EDTA 4HZLA 3RPIA 1CXIA 2D4DA 5DHXB 5B4MC 2XICA 2IFFH 3VFTA 1W72B 3LPGA 1BVLA 4YHPA 1CDIA 3K3QA 2H45A 3CPLB 4BZ2L 3LQAC 5JO5A 5CEZH 4KKCC 5KVEH 5IQ9B 5C0JA 1WFOA 5SWSE 4FFZL 4G8EA 3TT1L 1ZT7A 4R2GD 3QUKA 4LOUD 2I24N 2IBGA 4TPRH 1S7QA 1TQBB 5MERB 4GLRH 3ZTJH 1JPGA 4K8RL 4WEMB 5ESQB 3BSZH 3LCYA 2M8XA 1NLDH 3FONB 5D70H 5HVHC 1JCKA 4IEFB 3WFZA 2DQEH 5E2TL 4R97C 4TSCL 3QPQC 1J86A 1RIUL 4UTAL 3PL6C 2WWKO 4P3CH 3K1DA 4M7JL 4MQXC 4WNQB 3I50H 2VTFA 4LRIA 5J9PA 4I18B 3TPUB 2X4PB 1WJ3A 4UU9A 4H0IA 3MXVH 3OKOA 2Y36L 3NFPB 1A1NA 3KWWA 1S78D 1VESA 4H1LH 2MCG1 1I1AC 3B9EA 1QVOB 1YEDB 4OZGF 5F88B 4WI8A 2XXCB 4R4BA 1BFOB 1SVZA 5TDPA 5EBLA 3QQ9C 3MLZL 3WYRA 1S5HB 3HMXA 4U1KB 4I2XA 2YD6A 4MCZA 1FJ1B 3O3AA 4NFBA 4P5TA 3BRDA 4BFGA 5DTFA 5DMKB 1NC4A 3EJJX 4JDVB 1CGSH 1LEGA 4ZPTA 4HWUA 4ZDHB 2FJFB 3LMJH 3ARXA 1T1ZB 25C8L 4OQTH 2W9EL 3QXWA 4DJMA 1FDLL 4P23A 4K7PL 2D9QB 3M07A 3SKMB 4PJ5B 1RK1B 1A5FL 1T7YA 2IH3B 3ESUF 3G6DH 3WIIH 4APQC 4R0LA 1MJUL 2YD5A 4CRPA 4C59B 1V3LA 5BQ7B 5LVEA 4GRLA 4ZO8A 5DA4A 3LS4L 3RPKA 3HAEH 4XNZB 1HN1A 1FVDA 2VDLL 4YGAB 1UB5B 5DD6A 2O61B 5ICYA 3HMXL 3EYSL 2BCKA 3MRFA 5D1ZA 3RWFB 1HINL 3H6JA 1YMMA 1B2WL 3GGWB 5A40E 2CD0A 4YBQC 3ZLQC 2MTPA 4ELMB 1HIML 4FHBD 4LLUA 4CVUA 3MRRB 1AHWB 4RGOH 1JUFA 4PJXE 1YPZA 4NYLB 1HOCB 1DVFB 4JPWH 1SEQL 3OV6A 3TCLA 4R4BB 4X6BB 1NDMB 4HPOL 5T1KB 4M4RA 3B83A 2W0LA 2HT3D 4F7CA 4NRZA 5EU5A 5JW3H 3KG5A 5GPRA 1HQ4B 4NSKB 2PNDA 4JFZH 2GI7A 1T0NB 2AJVL 4H0HB 3DUUA 2PYED 2IQ9H 1JYXA 4ZXBC 3DYPA 3UO1L 3IFNH 5TPWH 5IW1A 3OKYA 4N90E 5HI3D 1PFCA 3BPCB 2DLEA 5C07E 3UTQA 4XH2B 3TA3C 5L8LB 4I0CC 1MCQA 4NZUH 4O58L 4EZMA 3HC0B 4HUVA 3K0WA 4X7DC 4AENA 2BVUA 1BVKA 1B0RB 4EI6B 3REVB 2YZ1A 2EIDA 5DWUL 1FL6A 5JXED 2KPNA 3N1FC 1T5XB 2XG5A 5DJ6A 2ITDA 4YX2H 1MRCL 4KTDL 1NFDF 4YHLL 2CR3A 4NC1E 4PTTA 2E6QA 4RZCB 4X9HA 2EYTB 4XVTH 4E0RB 4MNHB 3RUGE 4LCWA 1U2CA 3DHJA 5L8KB 4CADA 2HN7B 1MQKL 2V9TA 2IJ0C 4X6DA 1FL3B 1YEFH 5E2JA 2R0LH 5F97E 4S1QH 4ZUWA 3VFSA 1RFDH 4X8XA 1S9XB 3MNWB 1D5ZA 4Z7UA 5H2BA 3G5ZB 2CK0L 2A9ML 1R24B 3OAUH 1W72L 3ORJA 5E1AA 3SPVB 3QDGD 1MJ8H 3B6SA 3DSNA 3P2TA 3EYOB 5T3XH 4WO4C 1HILB 2Y5EA 4BH8A 2R23B 3L5HA 3DVFA 2AJ3B 3HPLA 5DJCB 2FZ3B 4Z7VF 1C16B 1MCHA 4G9FD 3CU7A 3RVVD 2FL5A 2OR7A 2B2XL 5E99L 4TQEL 1PLGH 4C56A 4J8RB 3T0WA 2LVCA 3CCHA 5KSAC 3HC4L 4UBDD 1F58H 4YIQA 4YK4C 3PABB 1MRFL 3AREA 4JPVH 4XBGB 1LNUA 1IEAB 3DMMD 4GAFB 2FEDD 4G6KH 4QGYA 3TZVC 3M1BB 1Q9LB 3NIFF 4QTHB 2NY5H 1Y18B 5I2IB 3F7YA 4RSVA 3SY0B 4CNIB 2ZG1A 1BIIB 4MJ4A 4RAVB 2ZJSL 2IPTL 1V7MH 2NW2B 4PPTA 1OARL 3MV7E 4Y4HA 3VXNA 1P7HL 4RGMC 4R96A 1SYSA 3G5VA 4CGTA 4HS8H 3IDYC 2DLHA 5ISZD 5KSVA 4KDTC 5HYFA 1HKFA 1NAMH 2EH7L 6FABH 2XA8H 4QKXB 3EDFA 1DEDA 5TF1L 3P0VH 3KR3H 1SEBA 3JV4A 3LIZH 3PWUA 1HEZA 1MJ7H 1AKJA 5FO9B 2NY4D 2B1HL 3FRUB 1EHLH 5ADOL 4WFED 5ID0B 4WUKL 1EEUA 3CX2A 5TE6L 2PTTB 1VCAA 4PJCE 1DSFH 3BESR 4HG4J 1IQWL 5KSAD 4XNQB 3FT4B 1DQLH 3D39D 4R0LB 2DQUL 1YC7A 4M93B 3SDDC 2VOTA 4GW4B 4RNRA 4OLZL 5CMAB 3L3DB 4Y16A 4UDUA 3NZHH 4D9QD 1C1EH 5I0DA 5AEAA 3GSVB 3GSNA 4X6FB 3MV8E 1U93A 4XNUH 4L8DB 3WJLC 4ZPTB 1WAAA 1F90H 1VFOA 3EFDL 4Z95L 5ESQA 1BQSA 4NFCA 1OGAB 4Y1AA 1S7WA 4PR5A 4PJDF 5C0ND 4X6FA 4OD3H 2AJVH 1X5HA 4Y16B 5I75C 3MLWH 5DMIL 3BIBX 1KJ2L 4D2NA 4ZFOB 1PQZB 4PUBH 1MRDH 1KB5L 2Y9RT 1EV2E 5SWQA 1OHQA 2JJWA 1XIWB 2MKWA 1MI5E 3LKQA 5IFJB 5IQ7L 3SY0A 5L9DL 2ZNWA 1JK8B 3F58H 4LCUB 1GXEA 3EZ8A 1NEZB 4DZ8A 2NY3C 3HHRB 3LN4A 5E8OA 1A0QH 5FCUL 2Z92B 4YHOL 5IB3B 1OAUL 3OKDB 3AROA 5TDNB 1KLFA 5DS8A 2EIBA 1WEJH 3QDJE 4Y19A 2WWMD 5JPMA 4WFGD 4WW2C 4ORZC 2C7UA 1FFOB 2VITB 2IANB 1K8DA 4V1DE 5DMIH 5C0NC 4PRNA 4P9HL 1OLLA 1NGPL 3CIQA 1CFSB 1MHEB 4LMQI 4U7KA 3QB7C 4W6WB 2ZP0T 3V6OC 3AXLB 5CIPB 4XPAL 1NQBA 3VFOB 1JPSL 2XRAL 3VXTA 2E9WA 3O3BB 4QRQA 4ZFFB 3GBMH 4YDJB 5F7DA 2YRZA 5ESAA 3INUL 3NACH 4KKAD 5DRWB 4XMPL 1N64L 4OGXH 3SKNA 5E4EC 4K9EH 1A6AA 3NIGF 1OP5H 4F7MA 2NCMA 1RV6X 4LASL 4WUKH 4GXVH 3HG1B 5BV7C 1DLFL 1ETZA 1NGZA 3HS0B 1NEZA 5T5NF 5FGRA 2O5YL 3MRDA 2HFGH 1U3HB 1KN4H 4MD4A 1ZT4A 3T65A 4JREB 5I1AB 1ZSDB 3TP4A 3LKQB 1D3CA 1JTTA 1CT8B 1IILE 4FQ1L 1PY4A 1UH3A 2OXHA 4MD0A 4RGOL 4OZFH 4M5ZL 1KACB 4M48L 5JIPA 4LRNL 5TE7H 3ULUF 4TNWK 3IDIB 4HPYH 4MJIA 5E5UB 1EPFA 3ILPB 4X5XA 2ZPKH 2C5DC 5D8JL 5B39B 2Q6WB 1CQYA 2BY3A 3WNNA 3DXAB 2GTWA 1G6RB 4UOW0 2IALB 4BYHA 4ZFGL 1MSPA 1QFWI 4G8FA 4RAHA 4WCYL 1OPGL 4YE4L 4MAUL 2G2RA 1A5FH 3AAZA 4OM1L 3M17A 3DBXB 4P0DA 3HC4H 4MS8C 4K3EL 2IPKA 4NQTA 2LVEA 3B6SB 1EUUA 4KMLB 1BVKB 5EA0H 3OAYK 3S35H 3P73B 2VE6A 3QPXH 1Z2KA 4Y4HC 3WLBB 4G43A 4IRSC 3P40A 1CS6A 4PRDA 2NX5D 3QIUC 3SDCB 3VE0B 2BNQD 2H2SC 3D3VA 5DJ2A 3RWJA 2W0PA 4WWKC 1K2DA 2O5XL 3OAUL 5DJYB 5EZOL 5MEQA 3LN4B 5E8OB 2QEJA 3PQYD 1F6AA 4UOW1 4D9RD 4BUGA 3C9NA 2CMRH 3IFOB 1FBIL 3LEYH 4FQ1H 1VACB 4MQXD 4WHYG 2EDHA 4M7ZB 3QDGA 5HI4D 5I2IA 3EJYD 1BGXH 5D2NB 5KANG 5HGBB 4L4VB 1PYWB 4P3WA 2VLME 5F96H 2R56H 4NNYB 1UJTA 4X7SL 2I60H 3MRPA 1IGML 4KTEH 2HFEA 1TIUA 1A7NH 3B9KB 1C5DA 1DL7H 1YEIL 2CUMA 1MWAL 2BOBA 2NW3A 4AMKL 3BPCA 4PJ8B 4DGIH 4WV1A 4QRPB 2NW3B 5FUCC 4L9LA 3OKMB 2FJHB 5JA9A 4NZUL 4O58H 1E28B 5JDJA 3R0MA 3QFJE 2D0FA 5EZLB 4WDIA 1JFQL 4KVCH 4NOFA 3U0WL 3LN9A 3B2VH 3OF6D 3QULB 3B2VL 5CZVL 1YUHA 3FT3A 3NH7L 4AL8L 5EB9A 5TPWL 2V2XA 1TJHH 3QWRD 5ESVA 5CGTA 1PX3A 1OF2B 4KRMB 3P30L 1NMBL 4P46B 1YEHH 4KQ4L 2JK5A 3QEQE 4MXQD 3ZHKA 2V2TA 4MZ2A 4BZ1L 2HRPH 2HN7A 4JM4L 1P4IH 3CZFB 5TQ0H 1T6VN 1DCLA 4PGDB 1JN6B 3VD4A 2AV1B 3JZ7A 3WDJA 5KBNC 3MRBB 5GGQH 2OR9H 4GRWE 4ZD3H 4OF3A 1CDBA 4PJ8C 3IDJB 5DJAB 5TQ0L 1AGCA 2OI9C 1EIBA 2FECL 4K3GA 4PUBL 3EKCA 4JKWA 4KQ3L 3AC0A 3GSRA 3VWJA 4OZ4B 3BVNB 3S37L 1B0GB 4L3CB 5C0GA 3FT4A 4NM8H 3FRPG 1VGKB 2GHWB 5T3ZL 4YHMH 1R6VA 4OM0L 1KJ2B 2VLJE 1A4KB 4AG4H 2VDOH 5DMGC 1KCSH 4P48A 1C5CH 1FNFA 3S6CA 3EIFA 1J1PH 3FRUA 1LO3L 2H3NB 1T20A 1U8HB 5EU7E 2DQDL 1ZHBA 4UAOC 3B3IB 3X14A 1F11A 1KTRL 4G8GE 1OP3H 3GSQB 3O45A 3UDWA 1CL7I 3EO9H 4GW5A 5DK2B 2OLDA 5IM7A 2XACC 5ICZB 3MJ8B 3MGTB 2JKXA 1WAAF 5DZOA 4BSWA 1XCTA 3T3MF 2DMKA 3NCCB 3KWWB 3PIQA 4JVUA 4OM1H 1O7VA 4BJLA 2V9QA 2VDQH 3OR6A 3UTPD 4X7SH 3CLFH 5FYJH 2XWJB 4NQVB 2HTLC 3ZTNH 1RUML 1U8NB 1DQDH 2VZ1A 4DN4L 3RPIB 4K3JH 5CEYB 5KANI 2J7LA 1H15A 3X3FL 1KTKE 2FBJH 32C2A 2NY4B 1JZ8A 1BPVA 1YN6B 1RHFA 4OLWH 4MHHI 2BHYA 5EN2B 4BM7A 1HXYB 4YAQA 2GQHA 3AS2A 4HIEA 1QR4A 3QUMB 1JTPA 1UZ6F 3ARUA 4P57A 1A4KA 4LGPB 4MCYB 3U1SL 3RBSA 5FHBL 2F8VA 1N2RB 3OPZL 3MZTA 3U30C 1MRFH 4HEPG 2L7UA 1ADQL 4O2EB 3NIFE 3FB8A 3CPLA 5C08E 3CDCA 4MNQB 1A7RH 2MMXA 4HCRL 3NFNB 2RQ8A 4OF6A 5HGDA 2AK4D 4OV5A 4PB0L 2R29L 4QYOA 1P7KA 1J1XL 4JJ5B 2K9UA 1E4XL 4X80H 4OT1H 4YBHA 4Q97A 3ARGD 5IB4A 3PUCA 4KZDL 3MCKB 2NXZC 3CDFA 5DYOA 2P47B 2K7QA 1IKNA 1UB5A 4JZNB 3MTRA 1A9EB 4XB8A 2FWOA 4KH2A 1ZHNB 5CWSB 2F8XC 1XR8B 3BAEL 5D8JH 1FCCA 5J3HC 1FN4B 5DJ8A 4JRXA 2ICEA 4Y5VB 5DEGB 4NJ9H 5KAQG 1ZLVH 1EXUB 5T3ZE 4JZNA 1INEH 1MQKH 3MODL 3RTQD 1BLNA 5E94B 5A2IH 1FNGA 4EIGB 2X10A 5IEKA 3MLVL 2VKWA 3L5XH 4Q6IA 2BSTA 4U1NB 4YHLH 4JANB 4Y2DD 1L6XA 2DQHL 2A73B 1NGXB 4ODXB 4DCQB 3TN0B 3A6CL 4AEFA 3SKJH 4Y4KA 1OWWA 1LEKA 4KJQC 2PYEE 3WXVL 1G9NL 1BBDH 2VH5L 3DXAE 3IDMA 3C09B 4M8QA 1DE4A 3EYOA 4FQPA 2FIKA 3WHE0 3RWCA 1Q9WA 1YYLL 3DUSA 1PYWA 5I1HL 2FIKB 5I1JH 3H9YA 1HZHL 2P1YA 1ZGLB 3SGKC 2BNQA 4AM0B 2MPAH 3D3VD 3IS0X 4JB9H 5J1SC 4FQCH 4GG8A 4CAGA 3IRZA 4J3OC 2VXTL 3SDCD 3KXFA 5DD5L 1IM3A 3T0DA 3G6AB 3HZMB 3V5KA 1WLHA 43CAB 4F7TA 4JVWA 4BK4A 3PGCA 2RFXA 5DJYA 2VLRD 4TUKH 3OMZA 5F7YC 4LEXH 1I9EA 3IAGC 3QUYD 1AD0B 4XHQA 2VZSA 3QDGE 3T1WA 2KH2B 4XNYL 2AJUL 1ONQB 3RNQB 5D5ME 4RFOH 3GSXA 4J3UA 5EPMA 1XH3A 1T2JA 5ADOH 1T7WA 4HDIA 4XRCB 5T5FH 4E5XA 4YHZL 5HHOB 2C3XA 1T04A 3GMQB 4EVNA 4Z6AT 3ISWA 1UM4L 2A6JB 3BPOC 4QRSB 4B50A 1YEGH 2YUVA 3DGGA 5D6DC 3QHFL 1TTGA 3QDJD 3ZKMD 4BH7B 4U3HA 1FVCA 5IFAL 4NUGL 2VQ1A 3QHZL 1I85A 3VD9A 2VDRH 2HJKB 3FN0L 2KZWA 5DUPH 5K59E 3DUUB 1BQHB 3O8XC 2YKLL 4JG1L 4JZJC 4X6CA 5SWZA 4EI5D 3RWDB 3NN8A 5EU4A 4AIZA 1A7OL 1WCBB 1K6QH 4D8PA 1C1EL 5GS0L 2PR4H 1HH6A 4U1SB 4P4KA 4RA3A 1D6EA 2VAJA 1NCBH 1MI5D 1JNHB 4S2SA 2DM7A 4M02A 4F9LA 2Q7YA 1FG2B 4NKMA 1J1XH 4TNWF 4ETQB 4FTVA 1K9TA 5CWSA 2EXWC 1H3XA 3RA7H 4D9RE 3SCMA 1ZVSB 4LCCA 2X09A 3PP3K 4PLKD 1LK3L 3MRJB 5EOCH 4M62L 1LO0H 1F97A 1YY8B 2GSIA 5M95B 1H5BB 1JGEA 1NFKA 1FZOB 2J8UB 3LIZL 3W11D 3GKZA 1ZK9A 4NWTL 4IDJH 1N5AA 3X17A 4JO1L 4TUOB 4EVNB 3A6OA 4OI9A 3C8HA 3VXQB 3R1GL 3LPFA 5D2NA 2J3SA 5CSZA 4RRPA 4HDIB 4XRCA 1BFSA 4LCUA 1VGEH 4OFYD 1MIEL 3N1GC 4OUOA 1SBSL 5E9DA 3CLEL 1ZLVK 3MO1B 1A9BB 4LHUD 3K4ZA 4FFWC 4NQCA 3B9KD 1KLGB 3L3JB 3UCRA 3TF7C 3IVKA 5C6WH 4P2CG 4PBVC 4JFFE 5DRNB 4M43H 3OGCA 4Y4FC 5A3IC 1X4ZA 3T0EC 1YEEL 2CXKA 4EDXB 3VFRA 3RU8H 1QBMH 4QT5A 5DJ0A 2DD8H 4OLXH 4HKJB 1JVKA 4HG4K 2L7JA 1PEWA 4HKZA 1ES0B 4QT5B 5DJ0B 3TT1H 4BFIA 1E6OH 3O0RH 2HMIC 4PLNC 4QCIA 3MBEA 5MENB 3ARBC 2NYYD 1TETH 4RNRB 1U8KB 5D7JB 4GAYB 2ENYA 1CDUA 4FXKB 2WK2A 2R9HD 2CRZA 3VD3A 3MRCB 4P46D 3MSPA 4JFHE 4OUUA 4LSUH 2A6IA 2AQ2A 5JW4M 3F7QA 5C0DB 2YD9A 4JN1L 1KC5H 2X89A 4CU8A 1UENA 3LB6D 3HRZA 4PRIE 3VW3H 3LEVL 3VFNA 4TTDC 3C5ZC 1WBZA 2VDOL 3QUXA 4D9LH 3M1BA 2B4CL 3E2HC 3JTTA 1CIDA 1KJVB 3WKML 3FN0H 3KPSE 4WHCA 5JPMB 1CVRA 3FQXB 3S37H 2R9HC 3I3EA 3P11H 3VI3E 2ZSVA 3SDDB 5I66B 2VMFA 3TO4C 4YUEH 5E24E 1XF4A 2FX7H 3PWLB 2EDRA 4E41D 3QJFB 3EGSB 5J6GB 4N1CA 4DZ8B 1OVZA 4KRNA 2O61A 1EA9C 3IU4H 1MREH 4UQ3B 4UV7L 3FQWA 2YMXH 4LSUL 4POZD 5CIPA 1P4BL 1VGKA 2DWEB 3FB5B 4HD9A 4UV4H 4J1UB 1RSFA 2NY1D 2R0WH 3O6FB 4OAWB 4V1DD 3BKMH 3NIDE 1NFIA 2EDDA 3B9KC 1GOHA 1PKQB 2JELH 4L3EA 4LSSH 5F6IC 2QSVA 3EDEA 3VI4E 2CKBA 1MRDL 3QI9A 2FJFA 2J88H 4LLDB 1G0DA 1NC4B 3AS1A 3KLDA 5DD3L 5GJTH 4YQXL 2A0LC 3UC0L 5EH1A 3GMPA 2EEAA 1JI2A 5D6CB 1JJUA 2VDML 1E27A 1IQDB 3VXSB 2DI7A 4APQD 4R3SA 4HWZA 4YHNB 3RZCA 2EC9U 4Y2OA 3FRPA 3RIAK 4M8QB 4IMLA 3E1F1 5DUML 1Q0YH 5CJ5A 4WUUD 4WO4B 1T5WA 1WIUA 4Q58C 1A2YB 4JM2D 4OD2A 3GMOA 3K74B 4UT6L 4G6FB 5A2JH 1J8HE 4NUJB 5SX4H 3HG1A 4ENEC 2GJ6A 3EUUA 2R56L 4HV8B 2CRMA 4I3GA 1MF2L 2A83B 2FB4H 3CK0L 4ELMA 1X7QA 2R1WA 2BSED 3VFMA 2LTQC 4KJWD 2XKNA 1Q94B 8CGTA 3TVMD 5KSVB 1UWEL 1GVIA 4N0YH 1FVCB 1ZKAA 2ICWA 1IEBB 1MWAB 1HSBB 1NGYA 3D0LB 5E8DH 1NAMA 1B0WA 3QQNA 2ITDB 3JXAA 1I7RB 1IM9A 4L4TA 2ZG3A 3FB5A 2P5ED 2GSGA 5T3ZD 1OP5K 3SBWA 1OAYH 4MNQD 35C8H 2J8UF 3EOAB 5DHYB 3SPVA 1R3HB 5JZ7D 1S7TA 1TDQA 2OZ4H 4I18C 2P8PA 3MYJA 3OHXA 1D7FA 3KXFD 1B90A 1G7MB 5DSCB 1U8PA 3DSFH 5CHNB 3WFCL 4JPVL 3CSBA 3SOBH 3BQUA 3OKNB 5F71A 5FGBA 3MUGA 4HC1H 3L3DA 2W9EH 3PGCB 4OZGA 3TH3T 4QHLA 1AE6H 4KKCD 1PLGL 4O2CB 5EFIB 4X9BA 5C0EB 3GI9L 1G7MA 5DSCA 3T09A 3H9SD 2G9HA 3JSSA 5CEZD 2GJ6B 1LE9A 5EDXA 4O9HH 5EO1B 1ZGLA 1DBAH 5TDOA 1S8DB 4U1HB 1SJEA 5GZND 3RTQB 3C2AL 1NSNL 1ZHLA 1EEYB 3BWAA 4XNYH 3KYNB 5I1AA 4YWGH 4HPYL 4I77L 5A2LH 4LVHC 4L4VE 3KYMB 3P9LB 4NC1C 4NO2B 3AMKA 1IAMA 4M5ZH 2BNRA 4KI5D 1IGCL 3HNSH 1R0AL 1MCKA 1A6UH 2OMBA 3V4VL 4LU5H 5BVJB 1CD1B 4QHNA 4DAGL 2EIZA 3O81A 2BDNH 4G8GD 3CAFA 3QDMD 4EI5B 1X5AA 1QSFB 4YPGA 2VLKB 3BO8A 3DYMA 1I1FB 1IEAA 3S34L 1MFDL 2BVQB 3NIDF 5DGRA 5DFVC 3AGVA 1QSFA 4DGVL 3QG6A 4P5MA 1AI1L 1MH5B 1OGTB 1EZVY 3WNMA 3WHE1 5JUEH 4XC1H 1NCUA 1J5OL 1F6AB 3TO2B 5JMRA 5DFWH 1HH9B 1T80A 5JORA 1NJ9A 4HQQH 3VXPB 1LO3H 1TVBA 3FHAA 3D69A 5IMKB 3SBWC 4MDIB 2VC2H 5T1MB 5I15H 3KYNA 2IQ9L 1WBXB 3MGOA 4OM0H 4MQ7A 1UFUA 4QXUL 3PP3H 2NZIA 5L6YH 1ZLUH 4QHMB 5EC1B 1XT5A 1WISA 5KTEL 3VFGH 3MJ9L 4U1HA 5KJRL 2XWJA 5FHAL 3MBXH 1PJ9A 4MQ7B 3BP7A 4N0UB 4PG2C 4J6RH 4MD4B 1TQCB 1TITA 3L9RA 3NA9L 3QDJB 5ITBH 3SJVD 2J2ZA 5ANME 3MMEA 1G84A 3RL1A 1JWUA 4Y7MA 2NPLX 3LDBB 1XGQB 4JFYA 5HYJA 1YDPB 1XGUB 3F7RA 4LDOB 4O51B 1UEYA 4KZDH 1RHHA 2Q86A 1AGEA 5JW4N 1GIGH 3HMWH 4HWBH 4YAQB 3KPQB 4PD4J 3I6GB 3B3IA 3X14B 3ZHLA 3PWLA 2R29H 2AABH 2AI0L 4KPHH 3EFFA 1JIBA 1U3HC 3JWOH 3WS3B 4LCIL 4P5MB 4HEME 1BBJA 3V52L 3OXRB 4ZNEE 4FN0A 1AP2A 3HPJB 3JUZA 3V0VA 1QLEL 4HFUL 4UILL 2I9TB 3MJ7B 1R5IA 1VEMA 5EU7C 2XY2A 3MV01 4GRLD 1RUQH 2F53E 4DAGH 5IJKA 4OZIE 1YPZF 1IC1A 2GJJA 3ARRA 1S5IL 3UBXB 3UXFA 5FK9B 1IGCH 3VRIA 5BZDB 3JWDC 3WL9B 5INDB 5D1ZD 1IC5H 5I1GL 3MJ8A 3QZWA 3MV8A 1R3KB 2XNAA 1X5XA 2VZTA 4X4XA 5KAQF 2C1PA 5MENA 3LRHA 1DBKL 2QLVB 1NGQL 5EULV 2AV7A 2V2WA 4IHOA 4D0DB 4PJEB 2V7HB 2DDQL 3ZTNL 3WO4C 3DO7A 2HH0H 5M7QA 3FOMB 5DEGA 2VLJB 3DVNA 1KJ2A 1FAKT 2X1XR 4TUJB 3Q6FA 2R0ZL 1UKSA 3OXSB 4I4WA 3W2DH 4XHJC 1HCFX 4E42B 3WNLA 4GW1B 1X5KA 4JG0L 3O4LD 1DVFD 4M7LT 3EO9L 3QI9D 1A6VL 3KPPB 3U82B 5HDQH 1AXTH 4F8QA 3O9WA 4ODXA 1F5WA 1F4XH 4PJFF 3BPLC 3OHXB 4DWHA 4ZS7H 3QDAA 5DT1H 2XWTB 4OAWA 3T2PA 1CIUA 1W8OA 1Q0XL 3S3SA 2YEZA 3O4OB 5DGQA 2AKRA 5JOFA 3KPSD 1CICD 3AB0B 1H3TA 1AO7E 5JXEA 5CSBA 4HWBL 5CJXC 3MRMB 1SMOA 1L7IL 3UJJH 12E8H 1P9MA 3T0EA 3F62A 1M05B 5E08H 4Y4FA 1H3WM 1OPGH 4KWUA 4U1NA 4YE4H 5I66A 3IU3B 5F89B 1D5XB 4NT6B 4XC3H 2OL3A 3DLQR 2V5SA 2HJLB 4JFDD 3N85H 4Z5RA 4JRYA 3RAJL 5EU6A 1EERB 5FXCH 4WW1B 4BSVB 3H42H 2FX9L 3OWEA 4X7TA 4F7EA 4IRJC 5LCVL 1NMBH 1T2QL 1G1CA 1F6FB 5D2NC 1FNEB 3OKKA 5I8CB 5JW4Q 2NYYC 5JIIA 4LIQE 3T65B 5DEZA 3FHQA 1RIVL 4PB9L 1PSKL 3Q3GA 2PYEB 2DQJL 3UZQA 1YYML 5IK3B 3FQTB 4P57B 1AR2A 1W0YT 4HQQL 3WE6B 3OAZH 5E6IA 4X6EB 1ZWIA 3ZE0E 2VITA 1FO0H 4XPFH 2Q3AA 3QWOA 4YX2L 4P4RB 2N7AA 3QEQA 4IRJA 5F7NC 4G80A 4OFDA 2ICWB 5CJBA 3UROR 5HI4C 5I30H 3PHOB 4FFWD 2X4RA 1L7TL 4JPKH 3S5LA 1CDHA 3U2SB 3QIWA 4AK1A 4OIIL 2CLVB 1BIHA 4QRQB 4F9PC 3Q6GH 4OLYL 4LPUA 3THML 1BOGB 5E1HB 3L1OH 4KJWC 1RZJC 2P8LB 3ARED 4PRPE 1NLBL 5L2JA 2QR0B 1B6DA 2Z31C 3O8XA 3IFNL 4KI5C 4PGCB 5IKCB 1QBAA 2H26A 1T1XB 2DI8A 3B9DA 3E8UH 1I85C 4HK3N 4EUPA 1WSST 1QKZH 1X44A 5T1KA 1MAMH 2FD6H 4I3SH 2R1XA 4Y4HD 3SQBA 1HHGA 3MRDB 1SJXA 4AT6A 1YY8A 1MUJA 2GSIB 1YN7B 4U6HB 3D0VB 5C09E 2VABA 3GK8L 3LD8B 5BOZG 1V7NH 3HFML 3VG0L 3ZE1E 1XGUA 3HB3D 3RWHA 1I4FB 4BQ9A 3FL7A 1CD9B 2PW2A 4YH6A 4HH9B 1F4WL 4R4ND 1LD9B 1HILA 2IG2H 4G8IB 4U1SA 5HGGS 1QSFD 3VG9C 3BP7B 4U3XA 4XPBL 2EDNA 1HDMA 5ERWB 1KB5H 1YY9C 1D5ZB 4Z7UB 4HH9A 2AEPH 3D39A 2W59A 2R2HA 4X6CB 3IYLW 2Q8BL 2D7PA 1CD1A 4N90D 3UTZB 4A6YL 3Q0HA 2VDLH 4LEOB 5KSBB 3MJGX 3FAWA 4M43L 1ZLWK 4JFQA 4A6YB 3BH9B 4GKOA 3N50A 1A3RH 5EG6C 2CSPA 2VIRA 3BUYA 3OJDB 4HWEL 5JNYB 1FZKA 2IADB 3GUTA 3H9SB 3IT8D 3D1MC 2Q8BH 5T33H 3WIIL 1A64A 2AEPL 5D7LE 1T03H 1GOFA 2ADJA 4LQ1A 5CZXC 4ONHB 3QEGL 5FM5M 3TH4T 3GBLA 4OFKA 4HFWB 5LGHL 3VFNB 4LAQL 3TT3L 4RX4A 4OGAD 4KHXL 2QSTA 3GIVB 1CGUA 3SJVA 1IQWH 2AGJH 4CJ0A 1KB9K 3WN5B 1D5BA 2O5YH 2WV3A 2YWZA 3OB0K 7FABH 4U1GC 1INQB 4JCMA 4X98B 3F7VA 2Y4SA 4HC1A 1UZ8A 1KXTB 5EBMB 4JY6B 1OY3B 5FKPA 4EEEA 1J8HA 4JZOA 3QIBA 3CFBB 3BEVA 3MV11 1CTOA 4GKSA 4WTZA 1XIWD 2M1KA 3MUJA 3ARBD 3GJFK 1JMZA 4XMPH 2Y1VA 3TIDB 3I50L 4HWNA 1AXSB 4M6OH 5E7BA 3WDHA 3PWPD 4PYGA 3VCLB 2OJZL 3O3AB 1VFAB 3GMRA 3HZVB 3QA3A 4L8SA 3OGCB 1DQQB 5B8CC 3RVXC 1DQTA 1I8IA 3VFOA 3VDCA 4HX1A 1OAXH 1BEYL 3QUZA 1VFAA 4POUB 1IZKA 2FHBA 1NLDL 4PG2A 4JG1H 1N2RA 2E9IA 3FMGL 5SWZB 4GRLB 1U8OB 2YS4A 3BVNA 4Z8FL 5IW6A 2R15A 3DMMB 1JWMB 1PAMA 3L3IA 2X70B 4LSSL 3EYVB 4PJHA 3GSQA 3O45B 5F7LB 1CD8A 1WWAX 3QNXA 5DRZB 2UYLA 3LQAH 3D87B 4POZC 2R1XB 1URLA 4Q9QL 1CK0H 1QSFE 1UACH 1X5LA 3CVHB 4XPTH 5DURB 3CXHJ 3RWGA 3HZYB 5F3BB 4OZGE 1CLZH 4RWYH 3NFPA 4DEPC 2AJSH 4J6RL 1N7MH 5KVMC 2NXZD 2VDNL 4PG9A 1FGVL 3VH8A 5F7WC 1FNSL 2W07A 3EO0B 1U91B 3V5DA 3VD7A 5JDSB 5FF6B 1ZT1B 5D72H 4IRSB 3QRFM 4RGND 4C4KO 4IMKC 2J8HA 4G42B 3IDJA 4NQDE 4QCIB 3STZA 4YR6B 1VERA 1F90L 4PJAE 2MPAL 4TVSa 2MCPL 2VL4A 4JJ5A 3D39B 3SEPA 6CGTA 1WZKA 1TQBC 3E2HB 5LXGL 5DJZA 4Z7OE 2QADD 2DLGA 3UDWC 4YJZL 3RWIB 1LK2B 1RZ7H 3TJHD 3UTQB 2WZPD 4FZ8H 4XAKD 3MOAH 4XCEB 3GBNH 1J0KA 3ET9F 2DQHH 3TCLB 3B9VA 3BI9X 3VXSA 1AXIB 4M7KL 4ZFZA 1TTUA 3FMGH 1X7QB 2R1WB 1CXHA 3MRRA 1I8LA 2X4SB 1PG7X 3LPWA 4XZUB 3PWJB 5HHVL 4BZYA 1HYRC 1RIVH 1KBGL 2AXHA 4J12A 3TIEB 2BVPB 4PRHE 4PS4L 1PG7L 5DVKA 4UT7L 5D72L 5DC9B 4CMHC 3O6ML 5FDWA 3FFCD 3REWB 3ZDXF 4M1CC 4RZCA 2QHRH 3BXNB 1WTGT 1WVZA 5C2BH 2M2DA 1VPOL 1SM3L 4I18A 4I77H 3TPUA 2CUHA 2BNQB 4AM0A 1P4LB 4JO1H 1NDMA 2B20A 3EYQD 4NWTH 1TPXB 3PXHA 3GSWB 2VN4A 2WUCL 4UNVA 4NQSB 3KPOB 1DBMH 3HI6H 5ALCL 5GSVB 1HHJA 1JHKH 2HT2D 3GMPB 4P2OD 4QNPF 3HAEB 3KPNB 4G7YH 3RDTA 3QFJB 5HHQA 5J4MA 3QG7H 5CHNA 3MFFA 2HAZA 1T83C 4PJ7F 4QTIL 4IRJB 5BXFB 5EIQA 3C08H 4OQTA 5CAYB 4WI4A 1EHXA 3T3ME 5DI8B 5GGVY 3T77A 3ZE0F 4H1LG 3S4SG 2ADGB 5C07D 4NQSA 5CKGA 3HNTH 3S35X 4Z0XB 2PYEA 4NBZB 5T33L 1ZTXL 5HHOE 3CD4A 3O8XD 2LTQB 5I19H 4OCRL 1IAIM 4OQ1A 5EIIB 5JXAL 3I9GH 4URTB 1QUNA 2YD8A 3RWGB 3HZYA 5EIIA 3QHZH 5F70A 1ZT4B 3JWOL 1M71A 1QA9A 5GRZA 4KPHL 2D7OA 5D9SA 2D7QA 1Q8MA 1JN6A 4G6ML 1KFAL 2OTWA 5C0IB 1YPZB 5FO7A 3VXRB 4FA8A 4LSTH 4JKMA 4OLUL 2UWEE 3ARPA 2DM3A 3TBSA 1EO8L 2DLIA 2E6JA 3AY4A 1MF2H 1KPVA 4ELKB 1LQSR 2HFFB 2O5ZH 3GEWB 2AJXH 2CLZA 3KPNA 4ZS6D 4XP1L 3U36A 3HR5A 1W8NA 3VWJB 2BVQA 2FGWL 3WE6A 1T4KB 4S1SL 4FFVD 3ZT6A 4D8PB 3MZGB 4JY5H 3ARDD 3GMRB 2HVKA 4HBCH 3WHXA 1XZ0B 2UY7A 5C8JA 2OM5A 2CIIB 2DQDH 2HFFA 3OKMA 2FJHA 1CF8H 2DBLL 4J3WA 5IROC 4PV8B 1I4FA 1RUAL 3HC3H 1T83A 5E2TH 5E56A 2HJKA 1KGCE 3ZYZA 4LSDA 3BEVB 4NNXA 3UO1H 1CXKA 4K94C 5IVXF 3KLHC 3BP6A 1F02I 1T21A 3BP4A 4DK6A 5GGUA 3R06B 1GZQA 4JFZL 4ISVA 4UB0L 5JUEL 1QFWH 2X4NA 4LCIH 2OS7A 1EEYA 1ND0B 3C6SA 5DK0B 4Q9CA 5D71L 2JIXB 3T3PE 2H26B 4UUJA 3U9PL 5IF0B 1RJZB 3DJ9A 4PY7A 3QHTC 5DD6B 1GIGL 1JNNL 4Z7VB 4QRTB 4M4PA 1UC6A 2P4AB 1CDGA 2YPVH 2G9HB 5IFJA 1GSMA 1TPXC 2BDNL 4LGRB 4WWKD 2NMSA 2WIIB 2EO9A 2IFFL 1EO5A 3QIBD 3MRIB 2DQJH 2MKLC 2HRPL 1MCPH 2V5MA 3ARBA 4GG6E 3HNSL 4GKNA 4R97B 1NCWH 3T2OA 3D5OF 5FHAH 3GSNL 3K81A 3RVUD 1JMXA 5DJCA 1C5BL 1B2WH 3CC5A 4I5BB 1XR9A 5FYJE 5IV2A 2F8OA 2NY2C 2HFEB 3MFFB 4GO6B 3MLYH 1G7LA 3BAEH 3IAQA 5C8JB 2CIIA 4QRSA 3QO0B 1X5JA 2X9WA 3EYFA 3UAJD 1HDMB 4PRIB 1Z0MA 1UWXK 2F19H 4D9LL 3QCTH 4UIKH 3DIFB 1W0WA 4R4FH 4IRZH 1AKJD 4IOSD 3OZ9L 4OFPA 1KC5L 4XC1L 1CFSA 4MLIA 1ACZA 1TJIL 4MSWA 5M94B 2BVOB 2ATKB 1V05A 1TETL 4HC1L 5JIHA 5D2NE 4QO1A 3T1FA 1UG9A 1NDGB 1MFDH 5KVFH 3P4OB 3SE8H 3SGDI 5D7JC 2DKUA 4UB0H 4BELD 3RBGA 4XCFH 3VFPA 2VISB 1M71B 1XF2A 4FMFA 4P5TB 2H32B 1RVFL 2W9LA 5GHWH 1GZPB 2G75A 4JFPB 2XN9E 5DQ9A 4DKFL 5IR1A 2CR6A 4LCCC 1K4CA 1ZLSH 3VGAB 4L3EE 4ZO7A 3RWEA 4JRXB 4K71C 1MHHA 1LK2A 1H8OA 2ED8A 1A2YA 4NN5B 3DX8B 4F9LC 1DJSA 1I7UA 1KG0B 3VXMD 4P99A 1XF2B 3KHOA 3X3GL 4HGKC 4OLWL 5T3XE 3S88L 4LPWA 4K8RC 4DQOL 2NLJB 2V7NB 1KCUH 1A21A 3ULUD 1AD9A 1F3JB 3ROLB 3FFDA 4RGNB 1MVFA 2X4UB 1AXSA 5TGBB 4O9HL 1AGDB 4WIQA 1KF9B 3HI5L 1DUYA 3D25B 1AGEB 4LAQH 3TT3H 3QUZC 2Q1EA 4HUUA 5J6HB 1EGJA 1W0VA 5B8CA 4LIQH 5ANMB 3H7LA 1RY7B 3AXLA 1OCWL 1DP0A 2DKMA 3LQZA 4C83A 4PJ9C 2R4RH 3RVUC 2EKSB 5IQ9A 2E27L 4MCYA 4NO0D 2H2PD 3BH8A 4E9LA 2R1YB 1KXQE 3I2CH 3QIBC 1F8TH 1FFRA 4PJEA 4XAWL 1CFQA 5CILH 2ZUSA 4TTGA 1RUQL 1D5IL 5GQBA 2ZPKL 1M7XA 2DRUA 2VWEE 1V3JA 1KJMA 3PWJA 1UM5L 2D7NA 4HV8A 1ZXQA 3CCHB 3Q5YA 3L7EA 4OFVA 3GRWA 3MV8B 1NJ9B 1Y0LB 5GIRB 1KXVC 2IAMD 3DURA 4NZTH 5AWNH 3LKNB 2NY0D 3UPCA 4MA3B 1SMAA 2GKIA 4KUZH 1LE9B 4LPVA 4NP4H 2E6PA 5C0RL 3NVQA 2EO1A 4JHZA 3BYYA 4QOKA 5IBTH 1S9WB 5HSFA 4M1DH 5AUMA 5K9KA 1BZ9B 4IRSD 4P2OA 2NY6C 2XTJE 4Z7WB 5T5FL 4PRIA 1U8QB 4U6XA 4UIKL 4AENB 1X4YA 1YNLH 2YA1A 1UQSB 4MXQC 3UYRL 3RX7A 1VPOH 1JF5A 4ZUWB 3VFSB 4XH2A 3V4UH 5HYSG 1HI6B 4OCXH 2Y5TA 4ZTOH 1ZE3C 3GBML 4ZOAA 4H8WC 4NZDA 5I1GH 2GTWB 5FUZL 5KVGH 4PJXF 1A4JB 5BW7C 1Z0NA 1TZIB 4ZPVB 4ZS6C 1NANI 3W0WB 3U4BH 5KZCD 4DVRL 3TO4B 2D31A 4K2UH 4U1MB 4YQXH 3QXDB 3GMMB 5K59F 1FP5A 3HN3A 1CU4H 2OL3H 5F9JB 3HCVB 2CO7B 4I8DA 4U6VH 1D5MB 1RQ5A 1AR1D 1PGRB 1MI5A 1S8DA 4NCC1 2H41A 5D93B 3WN5C 1T7VA 4L9DA 4PJ9A 1MFAH 3WFDH 3FFCE 2VSDA 3IFOA 2NXYD 1I3VA 3CDYA 4Z77A 1SYVB 1J0JA 4JEGB 2BFVH 1S7VB 4CMMA 4MQTB 5LXGH 1T21B 2J4WH 3BP4B 1MI5B 1MCBA 2BRRH 1E4WL 4N5ED 3L3OA 1DEEA 3WNOA 2W1NA 3S96A 1BIIA 1D9KC 4RAVA 3MLVH 1IEHA 5J1TC 1MH5A 3LEYL 3DETD 1TVDA 4Y2DB 4W6XB 4MJ6B 3IB4A 3BZEB 5HGAB 1S3KL 3IJYA 1I8KA 3WUZA 3GHBH 1N4XH 4HUUB 4TRPL 4F58L 4MJ6A 5I8OH 2ORBH 4LKXB 3BUTA 3FO0L 4LL9A 3I6KB 1UT9A 4N8VG 4XNXL 4I9WD 5JQ6L 1I3UA 4FNLL 1NMAH 4WV1B 4OGZA 4KK9C 5FYLD 4J4PA 4M62H 1JWSB 2O26U 4L8BA 4OZFG 4LFHD 5BZWB 3OX8B 3MLUL 1C7TA 3V5HA 4GH7B 2IGFH 1CLOH 1O0VA 4BSJA 1E4JA 2HVKB 3PL6B 3TCXA 15C8L 4B0MM 5GS2H 5GS0H 4TYUA 1U8JA 5D7LB 1RJZA 3EZJB 1NCDL 3SO3B 4WCYH 4GSDH 5DQ9B 2P24A 5TF1H 5GXBB 5DZNA 5FV1L 1JGEB 3FZUC 5MI0C 3IDXH 4PJBE 1PEZA 2E8YA 4PJEE 3G08A 2GEEA 3PWPE 2C1OB 1EHNA 2C3VA 2ZOKA 2EYTA 4FZEH 4RAUA 3TWCL 3SCMB 4TNVF 1LE5A 2QQNL 2HLAB 2JB6A 3WDIA 4K3HA 4NOBA 2W0KA 1NFDA 3QNZB 1PKQE 1JGLL 1T66D 2NQCA 5JPNA 2R2EA 1MFCH 2G60L 5JA8B 5I1EL 2VWEC 2G60H 3O6FA 1BF8A 2FSEA 2VZUA 3DX6A 1JYNA 3SDDD 4MD5B 5E2WL 1LD9A 4UU9B 2Y6SC 5GGVL 1MCWM 4U1LA 3ULVD 5C0JB 4PJ7E 1NBVL 1F2XK 1QR1B 4FQQA 4Q9BA 4UT6H 4PTUB 2ZUUA 1XFPA 4RIRB 4PJ8A 1CN4A 4HXAH 1G6RA 5C0CA 3NCEB 4Z7VE 4LSVL 3K2UL 4FQQB 2WINA 4HLJA 1JGUL 4QGTA 3G6JE 4WHTB 2XKUA 3IGAA 1BWMA 2KBGA 4NRYA 1CFBA 4Z77B 2VAAA 4FQXC 4JPIB 1Q1JH 4LHQB 2B39A 1U9KA 1ZA3A 1DN0A 4QRPE 3IFLL 4MAYD 4APQA 1JPTH 2CK0H 2EE9A 3LY6A 2ZSWB 4LARL 5J12B 1WBZB 3QUXB 5IROA 5IGXL 3KYOA 5TH2B 1I8MA 1N0XH 1FPTL 3RVTD 3IKKA 2EH8H 1N5AB 3WXVH 1HK6A 2P8LA 1JNLH 3MRNB 3UP1A 1WQVT 1ED3A 7CGTA 1A9EA 1IGFL 4KC3B 1PQZA 1EAPA 5CJ8A 5C0AE 2FEDC 3PGFH 3MNVA 1MRCH 3AY4C 4TSBH 3QJHB 4JM2B 3NA9H 3EJZD 4WV1C 2AXGB 3VFUB 3J8F7 1LP9B 1LO5A 5IJVA 1U6AH 5C3LD 4N9GB 3LRSB 1BVZA 4CL7A 4GFTB 5F9OL 3VXTB 1LEIA 2HTKC 2HA1A 1KJ2H 5C6PB 4JDTH 5HVHB 5GRJL 1KCRL 4CDHA 1AQKL 4I3SL 4HKXB 3GJEB 1UB6B 4NO0A 4L3CA 1B9ZA 2IH3A 4WFEE 4Y5YB 1U3HA 4GG6B 1NGWA 2BSRA 2OI9B 2X7LA 4FQIL 5GS0C 1BF2A 4YFLF 4H5SA 1BD2B 3N0PB 3AM8C 2XN9D 1DN0B 2DYPA 1E4XH 3GKWL 5FM8A 5F89A 2C26A 3PV7A 5LAXA 4LVEA 2BY0A 4OGYH 5IB2A 5I8EB 3S34H 1BD2A 5LKNA 5TE6H 2NY4C 5EZJB 2VKXA 4QOKD 3RDTC 2V17L 1HYSD 5A2KH 2AKRB 1P4BH 4OIBA 5JOFB 2ZOLB 4Z7WF 5SWQB 1KCKA 4PJAB 5E4EB 4OF0A 1VFUA 3HS0A 3U79A 2JJUA 3TJHC 2CGRL 4HUXA 4QHLB 4KU1A 3KDMB 1S9VB 2V7HA 2UZIL 2EDFA 3HNVL 4QF1A 3ME0A 4NN6B 1ZS8B 4OCYL 4HWBA 2YSSA 3D48R 3NGBC 4OSUH 5DRXA 1OP9A 1J05B 4MX7A 2FBJL 2NY1B 3P9WB 1M6OA 2VZ3A 2AS5M 5DRXB 4F15B 1EO7A 4JHAL 1PKQA 4L3EB 1S9VA 3MV9E 3DTXB 1JHLH 3DROB 2LU7A 3IDUA 3MLSL 1T4KA 3W0WD 1ORSB 4JO3H 4GJTB 3MLXL 5CKAA 4Y2DA 3MRPB 4WU5A 3WS6C 1R3LA 4B5EA 4KXZH 2ZUQB 4JN1H 3GJEA 4OZ4A 5ISZE 1ADQA 2HWZH 4S1RL 3GHEH 1CXLA 4JGUA 1IEBA 4TNVK 4S1DD 5SX5H 4L8SB 1F42A 3CX5K 2B2XH 5E99H 3D0VA 2Y5TB 2I07B 3S36X 1DFBL 2BC4B 2GW5A 3EHBC 2X4OB 4WO4D 5CJQL 1CBVL 4S1RH 3N06B 1I1CA 1S7VA 2FYYB 3D9AH 3D2UA 1TVBB 2BC4A 3WD5L 2P7TB 5F1IA 2N7BA 5LQBL 2NY0C 5I0ZA 1AGFB 5F7EL 1YECL 2ORBL 3HCVA 4A2MA 3SDCA 3KS0H 1M7IB 4YPJA 4P2QA 4JQVC 3NAAH 4WHDA 3PIQB 1CWVA 3TBYB 1GAFH 5FM5O 4HFWA 3KLAB 3VGHA 3O6KL 5FDWB 3QUYA 4TSCH 1X5IA 5HHNB 2EDEA 1Y6NR 3MRGB 4ZQKB 4KKBD 3X13A 1IT9H 2ICES 4M6AA 4X6DF 1DE4B 1DVFC 2ADFH 2GT9A 2VLRE 4R90L 1FRGH 3C5SA 3CK0H 4M93C 1KPVB 5EC2B 2ICWJ 5C0AA 1I9IL 1YEKH 5LWYL 3KPMB 4ZYKA 3SN6N 4NNPH 4JM4H 3V6BR 1JRHI 3UTZA 3GK8H 1BMGA 1UXSA 5KZCB 2FR4B 4NQDB 3ULSA 3QDJA 1N64H 5I1CL 1KPUB 2DQCH 2FEEL 1S5HA 1P7QD 1ZHKA 1BOYA 3O6LL 4AL8H 1U8JB 2YZ8A 3E8UL 3QQ9D 4RFEA 1ZLSL 3KXFE 1LDPH 1MFNA 4EI5A 3FO2B 3GSXB 3PDOA 1WWWX 4K3DL 4PP2A 5EPMB 4GQ9H 3U0TA 4ZUUA 1I1AD 2K1MA 3WIHL 5FYLL 5E8NA 5I76A 5IMKA 5DEFB 5IIEB 5FO8B 4XBPA 3EDDA 3KPRE 4P4KD 3PP4L 4ZG1A 4AJ0A 4GT7A 2WINB 2Z91B 4C56B 1I75A 5LJYH 2C3VB 1EX0A 2X1PA 4A6YA 1AGBB 1EAPB 4P2QE 5D1QA 4ALAH 3VH8G 3NIGE 4J3XA 5BMFH 4KMTH 1JK8A 2AI0H 3SCMD 3TM6A 1QFUL 2X9XA 4KTEL 5I76B 1HKLL 3BIKA 5AYUH 5SWZE 4X5LA 1XZ0A 1FZMA 4MA1C 5FA3A 4YZFF 3R0NA 3DIFA 3CFDB 3PWVA 4YHZH 2YUWA 3RGVC 4O4YH 1EVTC 4KTYA 5SWSD 4ONFL 2RIKA 3QCTL 5FYLE 1T22B 1H0DA 2IC2A 1FO0A 4LOUC 3NN8B 5EU4B 3ZKNC 1FL5A 1XF1A 4AEIH 3QNXB 5MHSD 1IGTA 2D7TH 2E3VA 3P11L 5FAAA 3B8YA 3MLYL 2PW2B 1RZGB 2DIJA 3HUJA 4RMWA 5I71B 4B53A 2A38A 3V0AC 4X0KA 1YJDH 3VFRB 4NJ9L 3WV0A 3STZB 2JF1A 4G5ZL 5HDLA 5GGSY 4W4OA 3B9KA 1C5DB 1JWUB 5EOQL 4H25A 3VD5A 1QRNE 3HLAA 4F37K 3DX6B 4G6JH 3BHBB 1ORQA 4ZOBA 5GS1B 1NBQA 2NY2D 4XCYA 3TYFB 3RY6C 4MJ5A 2EDWA 3KPLB 5I1HH 4NQVA 4OCWH 1RIHH 5F8RC 4A2LA 1X5ZA 1EDQA 1FNAA 1T5WB 1WTLA 1G9NH 4OUUB 5HVWA 5DUBB 3HI5H 1I9IH 1YEKL 5J1AB 4JFXA 1W2KT 1AHWC 1EFXB 4G6AC 4ZFGH 4LAJH 4DW2L 4EIZC 43CAA 4DUVA 3IXAB 1ZAGA 2F5AH 1S78C 3F5WB 5J1AA 1BGXL 2A2QT 5FK9A 3QUXC 2DLFH 3KR3L 3EBAA 5C0BA 1GGBH 3ARFD 4EDXA 1T5XA 1I7TB 3HI1B 4ZAKC 1CXFA 3W39B 1FIEA 5HDQL 2I27N 3G04B 3ZSTA 5EUOE 4JY5L 3FQRA 3CXDH 3X12A 3UTTB 1BWWA 1U3HD 5F7EH 4IDJL 1CGWA 3IDXL 1KN4L 3TESA 1HSBA 3D0LA 3TBWA 1RUMH 1IQDA 3W39A 4WW1A 4G6KL 3TN0A 4E41E 4LASH 5EOCL 2DS4A 1QSEA 1RZIA 4IBLT 1LO5B 5IJVB 1QNZL 3A67H 1II4E 1DFBH 5JW5A 4J2XA 3CMOL 4X4MA 5B21A 2YPLA 1XEDA 3ZZ1A 2Q6WA 4X80L 4F9PA 1E0OB 2WQ8A 5IEKB 4GXUN 3KPSB 1T89C 4P2RA 1YJDC 2PR4L 4L8CB 4CVXA 4BZ2H 1BQHG 1NUNB 3I3DA 3WFEL 2YPLE 2DMCA 4IRZL 4J3SA 5FB8A 2H1PH 5JQ6H 1T3FB 5D7IE 3QDHA 5E8EA 5C70A 2AXFB 3RZCD 2XQBH 2D03H 4PRBA 1UVQB 4F58H 1K3ZA 2VLJD 1MCNA 5LAXB 1U0QA 1DUYB 3D25A 1WFTA 3GSNH 3OKEB 2FYYA 1KNOB 1MHCB 3CFKB 4WI9A 4X7FC 4UNTA 4NDMA 2XTJD 4IDLA 2CKBB 2G5RA 3QI9B 4U05A 4ZXBA 4Y5VC 3V6OE 4QOKE 1JHKL 1OTSC 2F5AL 1BQLH 2FHFA 1KIUA 5FF6A 2AEQH 3PQYB 2F74B 4IJ3C 4RRPG 2RCSL 2P5EE 4P59L 5HGHB 2CPCA 1A22B 4WU5B 2AJUH 1RAMA 2GTZA 1A3LL 2A74B 4XX1G 4X4YA 3ULVL 2BFVL 4OGXL 4PFEA 1CR9H 3L5WA 1R5VB 2MQ3A 4HULB 3VMPA 1TZGH 5KJRH 1RIHL 3VFTB 2ZCHH 4L4TD 5DHVB 4FQLL 2P5EA 2Y7QA 1HEZB 3FN9A 1NCCL 1ZLUK 4QY8B 5CD3A 4JB9L 2BJMH 1J7VR 2VYRE 1KB9J 3EYQC 3QAZC 2VR4A 3O4OC 1QBLH 4NBXB 1OD9A 1TNNA 3IJHA 1FZJB 5HYQA 3NZHL 1S9KC 4GRMB 2CRYA 1J18A 2QTEA 1S9WA 4IOIB 3TO2A 4M1CD 3P4NA 5GRJH 4M5YH 5HD8D 3BQUD 3U7WH 1DANT 1CE6B 1S7XA 4FTVB 4XXCA 1ROWA 5I1CH 2GYSA 5C0DA 3K4DA 3V4UL 5D1ZC 2D7TL 4JFDB 1Y18A 4XP1H 1MWAH 4AMKH 2B5IC 1KELH 5F44A 3MX0A 3ZSSA 5IR1B 1GGYA 4OLVL 5ICXA 4NYLA 1OAUH 1H8NA 4GRLC 4YHIB 2QSCL 5C0AD 4LPCA 1BQUA 1GZQB 4GQPH 3P0VL 2DF3A 5C0RH 3QEHA 1LE5B 2YK1H 2X2YA 4WY7H 4G6MH 5IP4A 2DKSA 4KVNL 4X6DE 4KK8D 5E6IB 1A6UL 3DRTA 5H37H 2DICA 4N68A 3WUWG 3Q2CA 5I73C 5ID1B 5HI5C 3QH3B 3SDYH 4RGNE 4QXGH 1UJ3A 1KULA 3MO1A 3NAAL 4NQCB 1T0NA 4FABL 1IM9B 1B4JL 5GGSB 2DWEA 3M8OH 5JXAH 5IHZA 3GIZL 3WBDA 3HZKB 4MWFB 1OAKL 1M7DA 3WO3B 4HW6A 3C2AH 4L8CA 4DEPB 5IJKC 3RX8A 4YDLC 3QDMA 4RGNC 1EGJH 3K8KA 3BMVA 1I1AB 5T1MA 4OT1L 1CXEA 2XFXB 1ERNA 1YNKH 1H5BA 3ARWA 3C08L 4R2GB 5D1QD 3OQ3B 5GGUB 4NQUA 3VXPA 2J6EA 1NDGA 4GBXD 3QZWB 2PUQT 4PRBB 1PW3A 1GC1L 4JM2C 3UTOA 4RQQA 2NW2A 4Y4HB 3V0WH 1CFNB 4PJFE 1YMMB 3UMTA 3GSOA 4Z8FH 1JGLH 3I6LE 4Z7VA 3QUML 2DTML 2R2BB 4NKDB 1S7RB 1K4CB 5CBAB 1U8MA 3MGTA 4QRRE 3T4YA 3RIFF 3MQIA 2EH7H 5IVOA 4D0DA 1IKNC 3VWKB 3TWCH 4NZRL 2ESVB 2PXYB 3WS3A 5HYEA 3H3BC 5HGHA 5F9WB 1H5BC 3S8WA 3W5NA 1ZANL 1JPFB 4JZJB 3SO3C 3GDBA 3CGTA 1NBYB 1RIUH 4UTAH 5B3NA 4GKNB 1QRNA 4BH7A 3HRPA 3F7VB 4F33B 1QBBA 4AY0A 2Y07L 32C2B 5I6XB 3P77A 3OKLB 1P7QB 3NFSH 5HYIA 4U1GB 1BP3B 1W0WB 4PRPA 4AYFA 1P69B 3FQRB 4CMHB 3GO1H 2QBWA 4I3RL 5JO5B 3TNNA 1AP2B 1P6AB 4KHXH 1QVOA 4P9HC 5D7SH 4I1NB 1WBXA 3MGOB 4Z7UF 4GBXC 3NACL 4FTVE 5KOMC 2V2WB 4IHOB 2APVA 4U1MA 2WNGA 2HWZL 4HGWA 4ISVB 4RAUB 3F12A 4HAGA 4ZFOA 1K6QL 2C1PB 2KZ1B 4FQIH 4HWEH 3NGBB 1J0IA 1A3RL 3MLTB 1QLRB 4OGAC 3V6FA 3ARFA 1UCBL 3FONA 4UINL 2APTA 1VSCA 3GNML 1WIOA 5JMOC 4XX1E 5CZXD 3QYCA 2NXZB 1F4YH 4XGZB 3FFCA 3TBVA 2YD2A 4GS7B 4PRAA 3STBA 1U8MB 5E2VL 5CP7A 5EU6E 1VFBB 1E4WH 2F15A 1UM4H 5I1DA