4U05A

Homodimeric single domain antibody (sdab) against staphylococcal enterotoxin b (seb) s74a variant
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
130
structure length
130
Chain Sequence
MEVQLVESGGGLVQAGDSLRLSCTASGRTFSRAVMGWFRQAPGKEREFVAAISAAPGTAYYAFYADSVRGRFSIAADSAKNTVYLQMNSLKPEDTAVYYCAADLKMQVAAYMNQRSVDYWGQGTQVTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Single Domain Antibody
publication title Structural and mutational analysis of a monomeric and dimeric form of a single domain antibody with implications for protein misfolding.
pubmed doi rcsb
source organism Lama glama
total genus 32
structure length 130
sequence length 130
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-07-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4u05A00
1QO3A 3MLYH 1JCKA 2N56A 2OR8A 2EE3A 1TQCC 1JHTA 2E9IA 4YUEH 1RFDL 2UVEA 4FQQA 5I16A 4R7DB 2CIKA 1P4IH 5BMFH 1UWXK 3S96A 4YGVB 1YC8A 3NGBC 4KZEL 3TBSB 1BD2D 2DLHA 5GS1A 2AEPL 4CW1A 4HUVB 4J2XA 2VXSH 4HF5H 1CFVL 3VXRD 3Q5YA 2FIKB 4PG9B 1AC0A 1YQVL 3S37H 1GOHA 4IJ3C 3K4ZA 1QKZH 3TO4B 1EIBA 3S5LB 4NCC2 1J86A 4JVWA 4CADA 2GUOB 1D7FA 2CXGA 4AEIL 4ZNCD 5EU6A 3S34H 2RIKA 4HUUB 3QQ4B 5F7WC 1N8ZA 1EO8L 4RDQG 1MCPH 1FGVL 3JVGA 4JCMA 4P5TC 1KC5H 3MFFB 2V2TB 4Z0XA 5HYSB 2AV7B 1NAMB 1JZ7A 5T1KB 1ZHKB 1IGJB 4DCQB 2R2BA 1J1XH 4WO4B 1NMBL 1U92A 2BSRA 2NX5A 5CD3B 1I3GL 2VAJA 5E8EB 3RQ3A 1WEJL 3OKDA 4PG2C 3OKOA 1J8KA 5IBUB 1Q9KA 2YPKB 4X5XA 1SM3H 5I74B 4IEFB 1U58B 2HJLB 3BX7C 4FTVE 4S2SB 5D70H 4I3RL 3ZKND 1SJHB 3IDJA 2YN5A 3VMOA 3L9RA 2EIBA 5HPMA 2YBRB 3VWJD 1H0DB 5ITFB 4MZ3A 4PJBE 2JK5B 1KJ3H 1CT8B 1YEHL 3BZEB 2YEZA 1R6VA 2VKXA 4BZ1L 3C60B 4JQIL 4XCYA 4X9GA 2HJFB 2JE8A 2IG2L 1BVLA 3DXAA 1JI1A 3HI1A 2CUIA 4IRJD 1NCWH 4GO6B 4HLJA 1CXFA 4XB8A 5HDBF 5JW3L 4YPJA 2M1KA 3L3DB 2AI0L 4JFPB 4JZNB 4K23L 1A9EA 4NO0D 5DQJB 4XNMB 3CFBA 3G6DH 2HTKC 2R1XA 1OOAA 2P49B 2WANA 5B39G 1MI5E 2R23B 5DFVD 4WIQA 4OM1L 3PHOA 3BXNB 4JFXB 1GHFL 3VE0A 4KMLB 4G7YL 2PCPB 1BAFL 5T5FH 2VLJE 3UX9B 2I60L 5I9QB 3MTRA 3WE6A 3DRQB 2K9UA 5TE6H 2BSSA 4QXUH 2YZ8A 5TE4H 3RVXC 3DO3A 2UYLA 3QQ3B 2D9CA 2ICES 4PGEB 3L5WB 4PRAB 1NDGB 4NOBA 4Z7VE 1HOCA 2QKIB 4QNPE 3E6HA 2LABA 4HQQH 4LCYB 5JORA 1ZGLB 3HZKB 2A6DB 2PYED 2RFXB 5KSAC 5BXFB 3M1BB 2HFEB 1CFQB 5E99L 2A6KB 1H3TA 2Z31C 1OQOA 2ZKHL 1P1ZB 2XWBA 4M1CD 4XP9L 2F54B 4NQVB 4NZJA 2R2HA 2A6IB 1QNZH 3LZFL 3NFNA 2OS7A 3NN8A 2GW5A 1KEGL 2VLKD 4OZ4B 2FL5A 5JOPE 3AAZA 4U1NB 2AKRA 3O9WA 4FFWC 3T77B 4URTB 5IUSA 4GH7B 5HVHB 1R3LB 3GFUA 5ANME 1ZT4B 2OTPA 2EKSB 3FONA 3HE7A 4JQVC 1WWAX 3QEQA 2NW3A 1MVUA 1KUMA 1XGYL 3GSNH 5KSAD 3LKNA 1IBGH 1EEZB 3HA0A 1NCCL 2G75B 3BMWA 4IDJL 2PW1B 5DFTA 4U6VH 5T3XE 1B0GA 4P9HC 4ZXBD 1I9IH 5E8NA 4BELD 3TIDA 3OJVC 3RKDC 1WBXA 3EJJX 3A6BH 3M17B 3OX8B 5IBLC 3V0VA 2QR0B 5C09B 1FNEA 1ZLVH 4HH8A 1Z0MA 4JFOB 2FSEA 3QO0A 5F96L 2F58H 5EG6C 5I1EH 3U46B 5BW7A 1P7QD 1W72H 4U2YA 4Y5YB 5EUOA 4LP4A 4OBSA 1OGTA 1Q94B 1JHLH 2Y25A 3V4VL 4JDVB 4EBQH 1F6AB 4P3DB 5EZLB 4LVOB 4LOUD 25C8H 3EYOA 3ARFC 4HKBA 4Z7QE 1UB6B 3WJJC 1PBYA 5C0FA 1OGAB 1DQQA 1FG2A 1S78C 3HC3L 4D0BA 3WV0A 1CDHA 1JTPA 4F2MB 4HIIB 4RGNB 2AJZA 3N85L 4UV4L 1MRDH 2DICA 3U79A 3GM8A 4Z8FH 1IAIM 1T7WA 3UTPD 3FCTB 2NTFA 3P2TA 4HIHA 4QRRB 3MODL 3VMNA 4WTWA 4XX1G 5JW4N 2AQ2A 1YYML 1VPOL 3TGXA 3RVWD 2DQJH 3MA9L 4LSPL 3REVA 3BGFB 4UTBH 3FAWA 3MJ7B 4U3HA 1MCJA 2CK0L 4JQXC 2DI9A 4K3GA 4P59H 1J18A 4Z7UE 2BVOA 3HAEG 1DJSA 5HBBA 1DQDH 5FK9B 4PREA 2FJFB 5KZCD 1PLGL 1GPOL 2NQCA 1C7SA 3WD5H 3O2WH 2DS4A 4B41A 1K4DB 1FZKB 1DBAH 2X89D 3IXTA 4C54A 2C3HA 1XGRB 3QYCA 3VWKB 2VAAA 1UWXH 2CDFA 1BIIB 3GJEB 5EULV 4FABH 2WINB 5CMAA 4P4KA 4TULL 2G5BB 1YUHA 3BZFB 4M93B 3ZTJH 2YC1B 3OKEB 4X80L 2EH7L 5A2KH 4M6NL 3HI6H 3IFLL 4ZYKB 2GK0B 5C0DA 3RU8H 4GBXB 4KK5C 4PRHD 3ZE2E 3CUPB 1WIOA 4HWZA 4ZAKA 1OP5K 4BSVA 3D39D 1D9KD 5EU5A 4HBCL 4PS4L 2C3VB 4HD9A 1VACB 4M61B 3ZYJA 3WUZA 3SDCC 3UJTL 2DL9A 1ADQL 3ROLB 5I1LA 1EERB 3TZVA 4U3CA 4RFNC 4K7FA 4JDTL 3IJYB 4S0TD 1ZAGA 3BT2L 3OKLB 4NQCE 3L3HA 2CLVA 4NDMA 3R1GH 5F7MC 4K94C 5ESVA 4TSCH 1MAML 3OR7B 7FABH 1OTUC 1XF4B 1HEZB 1A0QL 3SDXE 2E7BA 2HYMA 2P8LA 1G6RL 5EIIA 4MA8L 4UOW1 4BKLB 4NKDB 4GFTB 1J05B 4LHUG 3HZMA 1MCBA 3F7VB 4I0PA 5FGBC 1MAKA 2WLYA 4XZUB 1UADC 1Z3GH 4MNQB 3SDCD 1MCLA 2LU4A 3S8WA 2FO1A 3B8SA 3O6MH 5D7LE 3L95A 3DBXA 5GGRA 3H0TA 3V5HA 4K07A 5ITBH 3TO4C 3BMVA 5F44A 1ZHLA 3NZ8A 3IF1B 4NN5B 4M1DL 5HHOE 3ULVL 1QR4A 4OAWA 2VKWA 4MD5B 3HC4L 3SDDC 1RFDH 3QFJD 4JFEB 3VXOA 1DFBL 3C9NA 3B2UD 3QCUL 5ICZA 1F3JB 4GXVL 5F3BB 3VH8A 4KZEH 5GQBA 4XBPB 5KSBE 2AEPH 4ZOEA 5LG1A 1CFVH 3UDWA 2ICEB 5I76B 4WO4C 1YQVH 3TEUA 5ID1A 4XVJL 4N0CC 4GQ9L 2A74B 4D0DA 5CEZE 5EBMB 3QO1B 5I74C 5DMYA 4M7LL 2HJKA 3MZGB 4AEIH 3ARRA 3QUZB 4R4BA 1DN0B 1MCFA 1Z5LB 3WLWD 1NL0L 1EO8H 3ARGD 4GAGL 4DTGL 2PO6B 1FGVH 4Z7WB 1Z9MA 1YN7B 4JO4L 2E3VA 5MENA 4KJPC 4L8SA 4OZFA 4NRZA 4N8VG 5E9DB 3U4EB 3C60C 4XXCA 3D0LA 2H9GA 3TYFA 1NMBH 5F3HB 4KK6C 5C70A 1I3GH 3GUTB 2FJGA 1WEJH 1HDMB 5I1JL 43C9A 5CP7A 3A6CL 3WBDA 2HT3C 2N7BA 4I3RH 2HKHL 3DX7A 2E7MA 4YBLB 5F1NA 2FX8L 4NCDA 4LMQI 2Z92B 5DRNA 4HT1L 4Q6IB 3RKPA 1KJVB 3K80A 1P69B 3BH8B 4Y89A 3JV5A 1YEHH 3CFKB 3MRPA 4BZ1H 4PJEA 1A1OA 4JQIH 3S36L 3P73B 4Y4FD 4LNVA 1FH5L 1AGFA 2IG2H 4C56A 1RZIA 4QXTB 2ATKB 5I9QC 4G8FB 3PABB 4GW5B 5JW3H 3SGDH 1DCLA 3ILPB 3TH2T 4CUCA 2AI0H 2D7MA 1LO3L 4K23H 4MWFA 3O11A 3OMZA 3TIEB 3O3EB 3GB7B 3G9VA 2VLME 1PQZA 1UFUA 1INQB 4KQ3L 4ZPVA 4PP1D 1L9NA 2C1PA 5KVDL 4K71B 3HHRB 4OM1H 3RWIA 4S10A 1GHFH 4G7YH 5HGBA 1I7RB 4TUJA 1BAFH 5IW1B 2I60H 4NZUL 2J8OA 5CJOL 5IKCB 3BP6A 3ARBD 2P5WB 4J8RA 3T2NL 1HH9B 3QXDB 2DQTL 2WQ8A 2P1YA 4NJAL 4Y88A 1F3DH 3MUZ1 3GK8L 4EUPG 4WFEE 3BGAA 3OR6A 2IJ0C 1U8MA 3RWGB 2DQUL 2O5XL 2GCYA 1UCBL 1DVFA 3P9MB 4WHYG 4U6YA 4XXDB 5E99H 1OWRM 1JGDA 3SO3B 2ZKHH 2EZ0C 4XWOC 3VXUB 1HILA 3RHWK 4XP9H 4OV5B 1TTFA 4LGRB 2JCCB 2C7UA 4JM4L 5JZ7D 2PXYD 3LZFH 3WFHB 2F54E 4XCEA 5E1AA 4XGZA 5IJKC 2I27N 1KEGH 4NQDB 3T3MF 1EHXA 2YD6A 1T2XA 4QWWD 4G80A 5HHNA 3MX0A 3LN5A 1JTOA 1FZOB 1S3KL 1A7QL 2CLZB 4XC3L 3WN5A 4LFHD 1S7SB 4Y5YC 5F7NC 3RY6A 1XGYH 3A67L 3GMPA 1PX4A 5DA0B 2P47B 4P46B 4AZ8A 4F7EA 1NCCH 1EFQA 4ALAL 4G6ML 4IDJH 3IDNA 3S4SB 1MPAL 3FO9A 3G08B 1SYVB 4APQD 3VH8G 4XNQA 5EA0L 4E42A 3RWHB 3GM0A 4RGNC 1QRNB 1J9CT 1IKNA 1KPRB 5C71A 3VFOA 1G9NC 2X40A 3SE9L 1JNLL 4KTEL 2AAVA 3VXNB 5F96H 5C09E 3GSVA 3HB3D 3FQTB 4KV5E 5FF6A 1TMCB 3OXSA 3VA6A 4ZUSA 3V4VH 3PDGA 4H1LB 4HUWB 2EO1A 1OP5H 5D7KD 1TLKA 3Q5TA 4JN1L 1J0HA 3O4LD 2EICA 2C1OA 2J4WL 2Q7YA 5ID0B 2BSED 3HC3H 4R0LA 3G04A 4JHWL 2X10A 1T0PB 2GQHA 1CD8A 1QR1A 3N85H 5JQHC 1H5BA 1P6FA 4X4YB 4UV4H 4RGNE 3VDAA 2DIBA 3RZWA 4ACPA 1U3ZA 3OV6A 4HS3A 3GSOA 4ZS7L 2BZDA 5DJ2A 1TXKA 5DRXB 4U6HB 2D7TL 3BZ4B 4WUUD 3MODH 3CH1A 4LSRL 2MMXA 4QRRE 1MH5A 5JW4R 3GMOB 3DRTB 3CFJA 1YJDC 4KKLD 5FO9B 1YYMH 2ATPB 3VWKC 1VPOH 2H26A 4N0FA 1L0XA 3RWFB 3MA9H 1CICA 4LSPH 4MQXD 1NANI 4WY7L 1K8IA 3L1OL 3TT1L 2WBJC 2CK0H 3RY4A 4D8PA 4G7VL 4M93C 4OJFL 1QEWA 1KIRA 3FQRB 1PLGH 3C6SA 4NC1C 1GPOH 1S7XB 2JJTC 4PJDB 4OD3L 3AU1A 5I8OL 4MCYB 4UTAL 5EU7C 3QNXA 2Y7QB 1U8LB 3KXFB 1UXSA 2CDEB 4HC1L 1F2XK 4JRXD 3CC5B 1UKSA 1N4XL 2VITA 3MRMB 3PG2A 3WCYA 4TULH 3PL6D 3GMLA 4OSUL 1R3JA 4X80H 2EH7H 5EO1B 3EBAA 3FFDA 5IMLA 4M6NH 3VFPA 3IFLH 2XXCB 5IB5B 1K9TA 1ITCA 5A3IC 3HNVL 4MB5A 5AZ2L 4NC1E 4HBCH 4KRLB 4PS4H 3VGFA 1OARL 5FB8B 2XN9A 5GS0L 1A4KB 3NIDE 3MRCA 3UJTH 1FJ1A 3ARUA 4IBLT 1ADQH 3ZYZA 5IB1B 4Q74A 4O51A 3VFUB 4JDTH 2FHCA 2NR6C 4I9WE 4EXKA 5EUKA 1QBML 4HH9B 4WJ5A 1LQSR 3BT2H 3ILQD 5INDA 2X4TB 2XIDA 1G1CA 1MAMH 2R9HC 3K8MA 4DGYL 3CVIL 2BNRE 3MLUL 2F53A 4Y5VB 1A0QH 5A3ID 5HYJA 1RI8A 4R4NC 5C6PB 4MA8H 3FOMB 5F9AC 3TBYB 3LKSA 4YHLL 3GRWA 5HYEA 4KXZH 1SVZA 5J6GA 3X11A 4MNQE 1MFNA 3VFVA 4P99A 2F19L 4JJ5B 3KLDA 4PJ8D 2WM0A 4YHZL 5B3JE 2APXA 4KFZC 1LK2B 5FYJE 5IVXA 3MRDA 4M1DH 4XAKD 1PY4A 1QOKA 2Z91A 3ULVH 3N0PB 3KPSB 2VZUA 3AGVA 1EFXA 2QEJA 1PZ5A 4PFEA 3HC4H 5C9KA 4LPYA 3AREB 1DFBH 3CDGB 1EUUA 3WL9A 1IEHA 2JIXD 2PO6C 3QCUH 4JFEE 4U7SA 3MFGB 4Y1AD 4GXVH 2N4IA 3F12B 4PJXB 4L1HA 4L8CB 2NY5C 4X5WB 3PHSA 1MJUL 2DYPD 3D2UB 4JG0L 3MA7A 4LRNL 2F8VA 1IM9D 3RAJL 2V2WB 2IADB 3F7PC 3I84A 3PWPB 4XVJH 1ZHNB 3O6FA 2Q76B 4GQ9H 2R2EA 4M7LH 3B9KD 2NMSA 4EEEA 1ND0B 2P5EB 3F58L 3D25B 1ZGLM 3ZE1F 4S11A 4PJCA 1NL0H 3H9SB 4NJ9L 4F9PA 1VERA 4GAGH 4XRCB 4DTGH 1FFNB 2GJZB 1FZMB 4JO4H 3T04D 4GKSA 4Z7WE 4G9DB 1NEZG 3I6KA 3ALWA 3VXMA 1KXQE 4LNRB 5E9DE 2XG4A 1EPFA 1PY9A 4Y16C 3RNKA 3QUYD 5I1JH 4GKOA 3G6AB 3MJ8B 1B0WA 3A6CH 1JGEB 1XF2A 5CEYB 5CSZB 2HKHH 5DO2D 5SWZB 3HZVB 4FQHA 2FX8H 4PJHA 4HT1H 3MRKA 3TNMA 4ELKB 3V6ZA 3BP4A 4FMFA 3ARDA 3P4MA 3QXAA 5LBSL 1YPZF 3DMMD 4G42A 3ECBB 4PJGB 2AABL 1W0VB 3QI9A 4K71C 4WHCA 2X9WA 3MV01 3S36H 1T03L 1Q9LA 1FH5H 2Q1EA 3W81A 3FT3B 4UDTA 1U8JB 1HHIB 1U93B 3MPCA 1CFBA 2ESVD 1G7JB 2MJWA 2HT2D 1T1ZB 4H25B 4XNZB 1LO3H 2ITDA 1MJ7L 3WDIA 4WWKD 4FFVD 3KPQB 4RQQA 5HJ3A 3ZTNL 3SGJC 3BPCB 1J1OL 3SDAD 5FA3A 3BEVA 4C83B 2OTUB 4KQ3H 3FJTA 5E6IB 5KVDH 5E8PB 3V7AG 3P9LB 3AS0A 2ZOKB 3SO3C 4LLWB 2GYSA 4NZTL 4MX7A 1FVDB 1H15B 5K33A 1RVFL 4NZUH 5CJOH 3T8XA 3X14B 3ULVE 3T2NH 3OKMA 1YN6B 3H9YA 4AM0A 1X5ZA 1RHFA 2DQTH 2P5WE 2RBLA 4NJAH 4NUJB 5EFIA 1OTTC 2RGSA 4CMMA 3RWJA 3GK8H 1KNOB 4TSAL 3FQUA 1DLHB 3RZCA 3PWJB 2A6JA 2IALA 4MCZA 2DQUH 2O5XH 2I9LB 1UCBH 1CS6A 2VISB 2XZAL 3AS1A 4U1LA 4PJ5A 1YMHA 3FQNB 3KPRE 3PGCB 2P8PB 1KGCE 3UPRA 1SY6L 3OWEA 1F90L 3QJFB 1MHPL 4OUUB 5JHLL 1WTLA 4LPXA 3VXUE 4JM4H 4G8EB 5DJCA 5E4EB 4OZGE 3HCVB 4WUKL 2WUBL 5AUMA 2JCCE 4WI2A 3J7HA 3G5XA 1RZ8B 4O2CA 1FYTB 4B50A 5IVXF 4M6OL 2BNUA 4NQDE 3NBNA 2BY0A 2AXFB 1BBDL 5IV2B 5K9QG 1B0RA 1S3KH 1A7QH 4XC3H 5FV2A 1D5IL 3OXRA 4HV8A 4PGCB 1BLNA 5I1GL 4HDIB 1R24A 4LCIL 3A67H 4MJ5B 3QIUA 4LCCC 4OLUL 2X6MA 1FSKB 4LAQL 4QYOA 4ALAH 4G6MH 2FO4B 1JV5A 1Z6JT 1MPAH 4J23A 3KYNA 2DM7A 1U8NB 2PYFA 5EA0H 4Y2OA 3QULB 1WFUA 3E6FA 3F6IA 3G5ZA 3SCMA 4UQ3A 2EO9A 4NQEA 1ETZA 1J8HA 2VO5A 1QRNE 1U8OA 3SE9H 1JNLH 1T21B 3QUXA 4KTEH 3MOBL 4G5ZL 2DM3A 2MTPA 4AG4L 3UTSD 4PJCF 4F9LA 3SEPA 3RL1B 5C0BD 1P4LB 2HAZA 1JNJA 3F7YB 1XR9A 4G8IB 2X4RB 4QRUA 2AXGA 1U8IA 2XTJC 4XMPL 1KPUA 4M8QA 4OIIL 1K8DB 4JN1H 2BVUA 5EPMB 2X4SB 1QSEA 4OF5A 2J4WH 4UDUB 1WAAA 4ZOAA 4I18C 4JHWH 1GH7A 4ZO6A 1EZVY 1XCQA 2Y5EA 5LAXB 3MREA 1XGTB 5GSVA 1JWSB 1C12B 4DW2L 1DQTA 1D5BA 1NC2A 2B1HL 3QHTC 4ZS7H 1N59A 2EXWC 1KT2B 4MJIB 1N5AB 4PJHF 2D7TH 2N1KA 4LSRH 5C0IA 1XF3B 1T1XB 5SWQB 2V7NB 3FFCA 2XTJE 4P3CL 5L2KA 4WY7H 5TH2B 3L1OH 3BN9D 2HP4A 3FB5A 4OCWL 1KCUL 5INCB 3TT1H 4FXGB 4G7VH 4P57B 3BH9A 4OJFH 2O93L 2BOBB 3EFDL 1A6UL 4L4TB 5FYJU 3MRFB 2VABA 2D0HA 4NN6C 1IC4L 2H3NB 3QUKA 4Y4KD 2PKDA 2MCPL 4N68A 1AIFB 4OUOA 2XWTA 4OD3H 1UWGL 5E2TL 4X8JB 4LMQE 4AYFA 1KTDA 5I8OH 4PJDE 4UTAH 3M8OL 4PYHA 1QO3B 1E28A 4M7ZB 4HC1H 1JHTB 2CJUL 3L7EA 1A2YA 4YO0A 1KTLA 4FQQB 5I16B 1R0AL 1N4XH 5D7IA 2CIKB 1F00I 3S96B 2GJ6D 1I7ZA 5DMGD 4DKEL 4OSUH 5L8JB 2C3XA 5GS1B 3DROA 1BZ7A 1J0IA 5FYKD 4Y5VC 3HNVH 5J4MA 5AZ2H 4GRWF 1G9MC 5AG9A 4L3ED 1OARH 3WXVL 4CADB 5GS0H 4J3OC 3S35X 3C2AL 3UXFA 4QHNA 4Z7NF 3IKCB 5EU6B 2AK4A 4XHJC 4KJWD 4H8WC 5IK3A 1N8ZB 2K3TA 5F7FA 1QBMH 4WFHD 4ODXA 4Z0XB 3VGGA 1H9VA 4DGYH 3EOBA 1EEYA 1G9EA 3CVIH 2R2BB 3MLUH 3IJSB 2DM2A 4GRLD 3ZKXB 1RULL 1U92B 2BSRB 2NX5B 4BH7A 3OAYK 3TYGL 1P9MA 2VSDA 4PLKD 1GZQA 3OKDB 3OKOB 2QSVA 1Q9KB 4X5XB 4YHLH 4HPYL 1MNUL 5I17A 3IFOA 3EYFA 4AIOA 3IDJB 3QISA 3V4UL 3L9RB 5HPMB 2F19H 4V1DA 2FR4B 3N06B 2JB5L 4YHZH 1NBVL 2Z4QB 1YQ2A 4MDJA 3QIBD 1KXVC 3O0RL 2YEZB 2W0LA 1CL7L 4XCYB 3UP1A 2OR9L 1T04B 2LFGA 1BVLB 1XAUA 3KPSE 3DXAB 4X6CA 4R96A 3HI1B 5HYQA 4HWNA 2AQ1A 5E8OA 2IQ9L 5K59E 1MJUH 4JG0H 1F2QA 4LRNH 1F11A 1A9EB 3BWUC 2AJSL 3RAJH 3ZYIA 1CDCA 4WFFD 3N1PC 3VU2A 4PJFA 3CFBB 2R1XB 1X5KA 5GRVL 3PWPE 4FRWA 2EDKA 1WAAF 3HRZA 5DJDA 3LDBB 1I8MA 2PR4L 3F58H 4LEOA 3PHOB 1D5XA 3OF6D 3VE0B 4NJ9H 1HXYA 4FFZL 3HS0A 5GS0C 2ZCKL 1DQJB 3BISA 4IRSA 3H9SE 3WE6B 5DD6A 4HEPG 1CXEA 4P2QE 3VJ6A 2IAMC 4IMKA 3ZYOA 2BSSB 4G6JL 1WK0A 3NTCL 2UYLB 5CGTA 5CD5C 1SMAA 3DX9B 5ESAA 4YJZL 3QQNA 1HOCB 5DF0A 1KACB 5A16A 3E6HB 4GKNA 1J0KA 5JORB 4JEGB 1A7RL 5HXMA 2H45A 3RTQD 5IB2A 3QB7C 2XACC 5C0CA 5T3ZE 4KWUA 4YHKL 1TZGL 2BJML 2XWBB 5SWZE 2R2HB 4OCSL 1WV7T 3NFNB 4GLRH 4NQUA 3NN8B 5LBSH 5DDHA 1GXEA 4ZSOA 3AAZB 5E6IC 2AABH 2AKRB 4ZNEA 2VLJD 1T03H 4PJGE 4OCXL 3LQZA 2ICCA 3QHZL 3OKKA 2B20A 3ZSSA 2W60A 3FONB 3HE7B 2HTLC 3KPPB 5CJXC 5D7IF 3QEQB 2NW3B 1MVUB 1IC7L 2NLJB 3LKNB 3DSNA 4AENA 1NUDA 3MLPA 1MJ7H 5JHDE 5JIHA 2ZUTA 1PYWA 2P42B 3ZTNH 1J1OH 1B0GB 1PGRB 4BFEA 5E8NB 3TIDB 1WBXB 3QNZA 5GRVK 1NLDL 3V0VB 1DTUA 3IFPB 1MHHA 1FNEB 4J3TA 3RJQB 2FSEB 3QO0B 4NZTH 3TA3C 1RVFH 5EUOB 2WLZA 1OGTB 2LVEA 1NGPL 1FVCA 1O7VA 3EYOB 1L0QA 5C0FB 1KJ2A 1DQQB 4TSAH 5H35A 1FG2B 2KKQA 4D0BB 3EHBC 2IFGA 3TN0C 2AJZB 3H9HA 2XZAH 4JJHA 1NSNL 3O3BA 3OKNA 1FSKC 3ARZA 2WWMC 4GS7C 1SY6H 3BD5A 3DARA 4ENEC 1F90H 2NTFB 1MHPH 5JHLH 4HIHB 5BVJA 4EKXA 4WUKH 2WUBH 4KRPC 3VD9A 4ODVL 4FQLL 4M6OH 5GZOD 3FB8B 4P2OA 4ZG1A 1EHAA 1U9KA 4Y4HB 5K9JL 2EE9A 1FYTE 3UBXI 4ZFOA 1BBDH 3REVB 2R29L 2IPTL 1L7TL 1D5IH 4ZUUA 5I1GH 3EHBD 1DEEA 4LCIH 1MFBL 1E4XI 4X6CF 2BVOB 2XWJA 1ZA6B 2A83A 4OLUH 4PJ9D 4F15B 4PREB 4LAQH 4PLJC 4WTZG 4MQ7A 1IC5L 1X3DA 2CKNA 3IXTB 3H8NA 3L3GA 1C16A 2VAAB 3MRJA 4WFGE 3MOBH 4G5ZH 4OLZL 3MC0A 1MREL 5CMAB 1JFQL 1CGUA 4AG4H 4P4KB 1E4KA 1YUHB 3QDMD 5FYKU 2MSPA 2CD0A 3ET9F 5HDBE 4KKBC 1OD7A 3IXAA 4R7NA 5IFJA 5KAQF 2EDBA 2E9BA 3EYSL 4G6AD 4XMPH 4ZO9A 5C0DB 4OIIH 4R97B 5F7HA 5I66A 3ISWA 3U82B 1MCWW 4HWZB 4ZAKB 4BSVB 4OZHA 5C9JA 5EU5B 1T1YA 5HI4D 4IS6A 1BD2A 5D8JL 3VD5A 5GIRA 2CO7B 2NY0B 4DW2H 5I1LB 5L0QC 3TZVB 3EJYD 4K7FB 4NHUA 2B1HH 1K6QL 1E6JL 4OM0L 1MY5A 2EEAA 3L3HB 2CLVB 4MJIE 4L8BA 4KKCC 4NDMB 3UZVB 4LP5A 1RUML 3KNBA 3W0WA 1VFBA 1A22B 3DUSA 4M7ZC 2IH1A 3L5IA 4W81A 5EBLA 1ZVSA 1TVBA 2P8LB 4P3CH 5EIIB 1AGBA 4OCWH 1KCUH 3GKZA 1G1YA 3HZMB 4I0PB 5HGDA 1A5FL 2NY4B 3DIFA 4HJ0C 4U31A 3OJDA 3NA4A 3X3FL 2J12B 3EFDH 1CGTA 5HGHA 4CJ1A 1A6UH 5A2LH 3L95B 1BECA 1S7QA 1IC4H 1UZ6F 3DBXB 5GGRB 2MCPH 3H0TB 3V5HB 1UWGH 5E2TH 3MV9D 5FDYA 3RNQA 2VNCA 2Z8RA 4ZUWB 1ZHLB 3M8OH 3NZ8B 2EDXA 2H2SC 3LN9A 4OAWB 4Z78A 2CJUH 4OKVA 5SV4A 3FQXA 3VXOB 3VWJA 1R0AH 3L3IA 3C9NB 4NN7B 1KN2L 4G6KL 1OTSC 2MKWA 5ICZB 4PGJA 5DRZA 3JVGC 4MNHA 3VH8B 4DKEH 1OAXL 2MHAA 2OL3A 3H7BA 3LRSA 4FHBD 3LKPA 5ESQA 1HZHL 4JGMA 1JYXA 3ZKXC 5DSCA 1CK0L 2EEDA 5DEFA 5ID1B 1XFPA 5D2LA 3UZQA 1HH6B 4IRJA 1A9BA 4D0DB 3WXVH 3H42L 5C8JA 2HJKB 3C2AH 2HKFL 4YBQD 3DSFL 4HAGA 5LVEA 4R4BB 4XVUC 3O81A 5DI8A 4NO0A 1BFVL 5EU6E 3THML 3GIVA 1ACYL 4MMZC 5E00A 1OW0C 2XG5A 5DZNA 1KLUA 1I75A 4X0KA 5DEGA 4EI5C 2DL2A 1FE8L 2KL6A 4YHPA 1NFIA 3GMNA 4K8RL 5MENB 4L8SB 4NRZB 4PGDA 3R4DA 4LSUL 3D0LB 1RULH 2H9GB 4N1CA 3TYFB 3TYGH 4I0CC 1KYOK 1T66C 2FJGB 4X9FA 1ZT7A 3Q5OA 4CMHB 3HI5L 43C9B 2NX5E 4JN2A 5CP7B 4HPYH 1MNUH 4HBQA 3DX7B 3V4UH 1YY9C 4PLOB 5F1NB 4XVUD 3VFWA 5DRNB 1LHZA 5CJQL 3I85A 3ETBF 4NSKA 2JB5H 1NBVH 3QWRA 3CDCA 1YEIL 1MCWM 4RNRA 2PYEA 2E6QA 1PKOA 3O0RH 2NPLX 5J13B 3MRPB 3E1F1 1CL7H 4PJEB 3RJDA 4EJ1C 8FABA 1A1OB 2OR9H 4D9QD 1AGFB 2DWEA 1RZIB 5I19L 1NDMA 3DXAE 1GOFA 2IQ9H 2H1PL 4Y5XA 2IQAA 5KANG 1JF1A 2VLKA 5T1KD 3UAJD 4NKIL 2D7PA 4K2UL 2EDHA 3H6JA 1HIML 4MWFB 3O11B 2AJSH 1F58L 3FN0L 2XQBL 1PQZB 3DJ9A 4OZHF 1FFPB 5KSAA 2C1PB 2PR4H 3PV7A 3RWIB 2AEWA 5JPNA 2W07A 5TE7L 4TUJB 4FFZH 4ZXBA 3R8QA 2ZCKH 1M7DB 2WIIA 2H32H 5GS2H 3BP6B 2GHWB 3QXVA 4J8RB 5C0EA 1BQSA 1GRWA 4G6JH 3LCYA 3IETA 3NTCH 1JHKL 3O9WC 2XZQL 5T33L 2NXYB 2KQMA 2R8SL 1MHEA 1P7QA 3OR6B 1U8MB 3MLZL 2X1PA 3UCRA 3HE7C 1KPVB 5IF0A 2GCYB 2ILLA 2IMNA 1A7RH 2R0ZL 3VGHA 2QADC 4HKXA 4U6YB 3RVVC 2BVTA 1JGDB 3SJVA 4YHKH 1TZGH 4OF7A 2BJMH 1HILB 3GO1L 2AJ3A 1Q8MA 4OLWL 4OCSH 2C7UB 4ZODA 5I8EA 1NAKL 5C0JA 4XCEB 5E1AB 4XGZB 1J12A 5E4IA 2BNQD 1K3IA 5GJSL 4G80B 5HHNB 3U6RA 3LN5B 4OCXH 3QHZH 4LIQE 5BW7C 4LSTL 3WN5B 2GSIA 1IC7H 3GMPB 3QEQE 4F7EB 1FC2D 4LEXL 4KPHL 3IDNB 3ARFA 1HINL 1MCEA 3WJJA 5B38A 1BQUA 2QV2A 4XNQB 4E42B 4CNIA 5D2LF 3FOLA 4HWBA 1NLDH 4YE4L 3QPXL 3VFOB 3O2VL 1H8OA 3T4YA 2GFBA 5HHXL 1EH9A 1FO0A 3PJSA 4LSSL 1U8QA 3ABZA 3GSVB 2XZCL 4KAQL 4WHYH 3T0EC 4XMKL 1XF5A 5FF6B 1ZLWH 2X89A 2EDEA 3OXSB 4ZUSB 1NGQL 2ZSVA 5EUOE 3QXTA 1NGPH 3WXWL 5I1DA 4CDHA 5IB3A 1T2JA 3DETC 3T0AA 4LLUA 2C1OB 3BDXA 4X6DA 2Q7YB 1EBAA 4R0LB 3G04B 1RIHL 3LV3A 3BRFA 1I85A 1QR1B 1VFAA 1H5BB 5T1DL 2Z9TA 1NSNH 3PWUA 4HS3B 4PRHA 4ZPTA 4JHZA 5H94A 3F6LA 3SPVA 3D39A 1D9KA 3OHXA 5BV7B 3IDYB 5FOBA 2VWEC 1MH5B 5F9WC 4OFVA 3CFJB 4ODVH 4FQLH 2VDKL 1D5MA 5HHMD 2NY2B 2H26B 5K9JH 1HXMA 4N0FB 1CICB 1KLFA 3TFKC 3MJ9A 1K8IB 2R29H 2IPTH 1L7TH 3TPUA 5JTWA 4D8PB 1F4XL 5DC0A 4FQIL 1MFBH 4NBXB 4X7SL 1QEWB 3SKUD 5D96B 1KIRB 1Z2KA 4LVHB 4R97C 1OGAD 1IC5H 1UKQA 3BQUC 3EDJA 3AU1B 5AYUL 4JKPL 1V3KA 3QNXB 3G5YA 3SDCA 4MMXC 2VWEE 1UXSB 4ODSL 1CQYA 3AVEA 1MJ8L 1ZS8A 4OLZH 4MLIA 2VITB 2V9RA 1MREH 2NZ9D 1JFQH 2MQCA 1UVQA 3GMLB 2YD7A 4U0RC 1R3JB 3FFDB 5IMLB 1WZMA 1B90A 3VFPB 3EYSH 2DBLL 1CQKA 35C8L 4E5XA 3QFJA 3TJHC 3R8BB 4RAUB 5KSBA 1X6LA 3MRBA 4I0PC 3WUWG 2NY4C 2XN9B 3L5HA 5D8JH 3MRCB 1FJ1B 3TVMC 4LSVL 1ES0A 4O51B 3RGVB 1ROWA 1KCLA 1K6QH 1E6JH 5HY9B 5EUKB 4OM0H 1X7QA 4AEHL 1IM3A 5E5UB 1UZ8A 5C1MB 2VDRL 4WJ5B 5TDOA 1RUMH 4HFWA 4N8CL 4KMQA 2FBJL 2Q86A 2F53B 4RMUA 4WI6A 2X1QA 5DLML 4EVNA 5HYJB 1D5ZA 3ARGA 4QGTA 5AWNL 4NN7C 2OZ4L 5EOCL 1B4JL 3LKSB 1A5FH 3LIZL 3HUJA 4HLZH 1QLFA 2ZCHL 3WNKA 5J6GB 3X3FH 3NAAL 3X11B 3UDWC 5ICYA 3D48R 3VFVB 3D9AL 3C8HA 2HRLA 4XT1C 3U7YL 4KHXL 5EZIL 1J7VR 5IVXB 5B4MC 5C2UB 4DN3L 3ULUL 3MRDB 3T3ME 2Z91B 5IJVA 2E6PA 3I6LE 1EFXB 2IWGA 1PZ5B 4L4VD 5D5MA 3D69A 2XA3A 4HGMA 3W5NA 1KN2H 3WL9B 5AD0A 4G6KH 1OT2A 3CZFB 15C8L 3EFFB 2WP3T 3MV8D 1OAXH 1EXUA 4L8SC 1HZHH 2JB6A 1JGVL 1A3QA 4XXCC 1CK0H 2GEEA 1BVKA 3CMOL 2YD3A 3BZDA 3O6FB 1L7IL 2DN7A 1AD0A 3D18A 1A8JH 2R2EB 3H42H 2HKFH 3DSFH 4PJCB 1BFVH 5KOMC 3THMH 1ACYH 3DURB 3DNKA 1CDYA 1IC1A 1FE8H 4GKSB 3F8UB 4K8RH 4R26L 4GAFB 3UJIL 1W8OA 3I6KB 4LASL 5MENE 1FP5A 1S7VA 1WFNA 2YXMA 4LSUH 4N8PA 4OI8A 3VXMB 1KIPA 1UENA 3RNKB 3HI5H 3Q6GL 2EIZA 4M7JL 4XTRD 1T4KB 1I3UA 3ARBA 4J1UA 4JFFE 1XF2B 4OD1L 3GSXA 1DUZA 1TNMA 4FQHB 1FNHA 3FL7A 3AS2A 5CJQH 3MRKB 3TNMB 3V6ZB 3ARWA 3NCEB 3BP4B 3ARDB 1YEIH 5EWIL 3P4MB 3D3VB 3QXAB 2Z8SA 3WS3A 4J7RA 1YMMD 2BHZA 3QUZD 3E3QC 1L6XA 3NCJL 2BC4A 2CRIA 3QI9B 1IZKA 4JO2L 1Q9LB 4PJEE 4QRPD 2LVCA 4HG4K 2VQTA 1DL7L 1CTOA 1CVRA 5I19H 2PXYA 4UDTB 3NA9L 2YPLD 4C56E 2H1PH 4U1IA 3KS0H 4NKIH 2CMRL 3GZKA 4K2UH 5LGKA 1MIML 4DFHA 2FGWL 1HIMH 2ITDB 1CF8L 2OR7A 1YNTA 5HJ3B 1F58H 4RQQB 4JREB 3FN0H 2XQBH 5FA3B 3BEVB 1TQBB 1XGUB 2J6EL 3MJGX 3PV6B 1CDIA 2EYRA 4U0QB 3T09A 4AH2A 1DVFC 1I8KA 1F4HA 4TVPL 4LLYA 4XAWL 5FA4A 2Z0BA 2B8OT 3E3QE 3CX5K 5TE7H 3EJZC 4APQA 4MX7B 4KK8C 3LEYL 3NCFB 4NO3A 1HYSC 3MRRA 3RWEA 2L7JA 2CRYA 4JKLA 4YDJB 5L2JA 1I1AD 4CAGA 4AM0B 4HZAA 2YUVA 1JHKH 5EFIB 2XZQH 3MNVA 3PGDA 4CMMB 5IR1A 5T33H 3FQUB 2R8SH 4IM8A 3RZCB 2A6JB 2IALB 4MCZB 3MLZH 1CLYL 1M05A 3WN5C 3LOWA 4U1LB 5I18L 3RY6C 2R0ZH 4NPYA 4PJ5B 3HUJF 2FBOJ 3UPRB 1YECL 3O4LA 3TESA 3GO1H 4P23D 3ZSTA 4M6ML 4OLWH 1VDGA 2ENSA 1NAKH 3DUUA 5HI3D 5HYSG 5I1CL 4K55A 5AUMB 3G5XB 2DB8A 4HHAA 5DUPL 4JZOA 1IKNC 5GJSH 1DLFL 2BNUB 4M48L 4WI7A 1B0RB 3N1MC 4Z18A 3OXRB 4HV8B 1J0ZA 1BLNB 5JPMA 1ZV5A 1R24B 4WUUA 4LSTH 5IBUG 3ULVD 3EUUA 1PSKL 4GMSL 5AAMA 2G2RB 4X9IA 4B53A 32C2B 4N5EC 3TBWA 1A64A 5D6DA 3QIUB 1M7IA 4I4WA 4LEXH 4QYOB 1T20A 4KPHH 1JV5B 1HINH 1ZK9A 3KYNB 1ULVA 3UEZA 4CVXA 2PYFB 5DJ8A 3E6FB 3TH4T 4RFOL 3G5ZB 1OAUL 4OQTL 3SCMB 4UQ3B 4NQEB 4OFYD 1ETZB 1J8HB 3PGFL 5DQDL 4YE4H 3QPXH 1U8OB 3O2VH 3O2DA 3QUXB 4JPVL 5HHXH 5D71L 1IAMA 4LSSH 2X4QA 4KAQH 2XZCH 1QUNA 5BV7C 4XMKH 4PJIB 3IDYC 1NGQH 1EGJL 1FNAA 1XR9B 4PY7A 4JRXA 2AXGB 1U8IB 3WXWH 1KPUB 4M8QB 4ZUVB 1P84J 1QSEB 4QKXB 3KJ6L 2I26N 4ORGB 4XB7A 3PL6A 1RIHH 4PP2A 1XCQB 5DJZB 4WV1B 4Y19D 1GL4B 5CFHA 5L88L 4P46D 3MREB 2H6PA 5GSVB 4K3JL 5F6IC 5T1DH 3T0BA 1C7TA 1AP2A 3ZE1E 1NC2B 4ETQA 3CCHB 4LVHC 1HK6A 4FQJL 4JFHD 5SX5H 1A3LL 2PTTA 1ZOXA 1UYWL 4HX1B 2VDKH 3WHE0 3WNNA 2CQVA 3FFCB 3O4OC 3BEWA 1AE6L 4P5MB 5L2KB 3PQYD 3FB5B 3MBXL 4MHHI 1F4XH 4FQIH 1L6ZA 3HE6D 3BH9B 4JPIA 4HJGA 3WFBL 4X7SH 2Y72A 4RWHA 2NZIA 1CBVL 1SVCP 2VABB 3QSKB 2X9YA 3QUKB 3SBWA 4Z77A 2XWTB 2A0LC 5AYUH 4JKPH 5A2FA 1KTDB 4OBRA 2A77L 3VGEA 1XZ0B 4GKZA 1YPZE 1BQHA 1E28B 4JVUA 1HYRC 4ODSH 3L7EB 1A2YB 4YO0B 5SWSE 4PJ8A 1MJ8H 1KBGL 1KTLB 2VDNL 2IBGA 5D7IB 1WWBX 2YHGA 5IBTL 4YAQA 5CJBA 5J9PA 3AXLA 5L8KB 1WICA 3DROB 3VXSD 1BZ7B 4N5UA 1PD6A 3LB6C 2DBLH 35C8H 4U1SA 4C4KT 1JZ5A 5JIIA 2JIXA 4KI1A 5IW3A 1CD1A 4Y1AA 4UT9L 4BUHA 5DT1L 2E7HA 2YZ1A 4L3CA 2BY1A 4QHNB 1FIGL 3BD4A 3IB4A 2XN9E 4LSVH 4DOHB 2AK4B 5EOTA 5D1QD 1IM9A 5IK3B 4QT5A 3P77A 4J12A 4AEHH 3VRIA 4NOFA 2VDRH 4ODXB 4F7MA 2NY6D 3B9KA 3KXFD 3EOBB 1EEYB 4N8CH 2Y07L 2FBJH 1N3NA 5DLMH 2VXTL 1X5XA 2QQNL 4BH7B 2F53E 4Q6YA 1GZQB 5AWNH 2OZ4H 5HYJE 5EOCH 1B4JH 2HT4D 3LIZH 1KCRL 2RB8A 5I17B 2ZCHH 2YK1L 1DR9A 3IFOB 5E1HB 3NAAH 5HDOA 3EYFB 3B43A 3SKNA 3ARVA 5FDWA 5J11B 1S9YA 1TTUA 3D9AH 5IEKA 4V1DB 3U7YH 3QUYA 1AGEA 4MA1C 3QPQD 4KHXH 2VR5A 5EZIH 3ZT5A 4MDJB 3O6FC 5DJXA 3BKJL 3ARTA 4DN3H 3ULUH 2APBA 3UTTD 1K2DA 4QXWA 5IVXE 3JSSA 2XY1A 2OM5A 4JM2D 4MXQC 1MWAA 3NIGF 5C0NC 1KG0A 4U2ZA 1Q38A 4F9PC 4X6CB 4R96B 3UPCA 3IS0X 5HYQB 4JFDD 3EDEA 5E8OB 1KJ2L 4RMQA 15C8H 1ZEAL 3DMMA 2ARJB 4PRPE 4YH6A 5FM8A 1F11B 1JGVH 5EDXA 3CMOH 5B8CA 4PJFB 4QEGA 1L7IH 2ESVA 4PIRF 3HRZB 5DJDB 4EDWL 1I8MB 3Q48A 1U3HD 1JNNL 2EYTA 4LEOB 2I24N 1D5XB 2MCG1 4WWKA 4B7LA 3B9AA 3SDAA 1BP3B 3HS0B 2K7QA 3JTSA 4PJCE 5C6WH 5E2JA 3F5WB 4IRSB 1AHWA 5DD6B 3VJ6B 1R3HA 4R26H 3UJIH 4LASH 5GZNC 5ESAB 1F6LL 3ARED 3VXME 4GKNB 3Q6GH 3SKOA 3JV4A 1B6UA 1VHPA 2UZYB 2LE9A 4M7JH 3JBG7 4XNUL 3PUCA 3D2UD 4ZDHA 1FN4B 3RL2A 5IB2B 3JWDL 4OD1H 5C0CB 5J8OA 4UAOB 5FGRA 1WJ3A 3SGJA 3MLVL 2D9QB 4JREC 4HPOL 5JDSA 4PJHE 4PTUA 4F7PA 1TQBC 2FZ3A 5EWIH 1ZKAA 4KROB 4ODUA 4XBEL 3KPRA 5DDHB 4ZSOB 2P5ED 3HPJA 3NCJH 3MV7B 2DLTA 4JO2H 5C08A 3B9VA 4PRIA 5C07B 3MGOA 2W60B 1DL7H 2AVGA 4OGYL 1QRKA 1F3RB 3NA9H 2EECA 1MFAL 2X1WL 4D0CA 2A2QT 2CMRH 4AENB 1MIMH 2FATL 2FGWH 2R0KL 1CF8H 3PWLA 1PYWB 1T1WA 1RZ7L 2J8HA 1QBBA 3GI8L 4KDWA 5F8RC 4M9PA 2J6EH 3RZCC 3QDGA 2GAZA 3CVHL 3U2SA 5DR5L 3QNZB 1KULA 4TVPH 3LKRA 4XAWH 4H0IA 3QUMA 1MHHB 3OAZK 4M5ZL 2EIDA 1AKJD 3EYQC 2APFA 3LEYH 2DWDA 1FVCB 3NCCB 3U9PL 4KUCD 5M95B 4R2GD 1KJ2B 4S1RL 1H8NA 5H35B 3UTSA 3CFDA 4GRWE 5I8CA 1CFTA 1CLYH 2HA1A 3H9HB 3ALPA 5DTFA 5I18H 4GT7A 4Z7NE 1JWUA 1QSFD 3QIUC 2D7NA 3O3BB 3NABL 3OKNB 3HR5A 4JHBA 4PJ5E 4R4FL 1YECH 3WO3B 3PIQA 4BSJA 2R69L 4ODBD 4GW4A 2E9JA 1G7HA 4M6MH 5BVJB 1P7KA 5FO7A 5I1CH 1DBBL 3MGAA 5DUPH 2QJDA 4QY8B 3SCMC 4EDXB 3R0NA 4BFGA 1KCSL 2I25N 1DLFH 4M48H 4P2OB 4XVSL 4ZFOB 4I13B 5JXED 3CDFA 4ZUUB 4JPWL 3KVQA 1DEEB 4NZRL 4GMSH 1PSKH 4F9LC 2XWJB 2A83B 5GGRY 4U33A 1LGVA 5JLZA 3OB0K 1VA9A 4MQ7B 3ES6A 5DD0L 4QTIL 5E70A 4R9HA 5MI0B 3MBEC 4I18A 4Z7OF 1CGWA 3BYYA 4RFOH 1C5DA 4UIMA 1OAUH 4OQTH 5D7JD 5IFHL 4LKXA 3PGFH 3L3GB 1C16B 3MRJB 5DQDH 5MEQA 4AT6B 4NQEE 1J8HE 4JPVH 4KQ4L 4Y4KA 5D71H 3FB7A 4JO1L 5E56A 3B4NA 5BZDA 1SBBA 1JGLL 1EGJH 3IXAB 4R7NB 5IFJB 1MUJA 5DHVH 4XBGA 5I66B 1VADA 4LHQB 3BPNB 4NQSA 4ONOA 2C5DC 4ZUTA 1AXTL 2UVFA 4OZHB 2GJ6A 5C9JB 4EQ3A 1T1YB 1QSEE 1CZ8L 2XQYG 4IS6B 1BD2B 3AB0B 3RUGA 1WAAE 3D1MC 5F7DA 5L88H 2YUXA 4K3JH 4XVTL 5J3HC 3UYOD 4NHUB 2OJZL 5J89A 3WDHA 4XWGL 4FQJH 4EI6A 3BRGC 4MVBC 4L8BB 1X4XA 1WTGT 3KNBB 3W0WB 4AL8L 1A3LH 1VFBB 4WVRA 3DUSB 1UYWH 2IH1B 1VESA 5EBLB 1ZVSB 1TVBB 3T65A 3E0GA 3TCLA 3JUZA 1AE6H 3FFCE 1AD9A 3MBXH 1KENL 4NBZB 3IDXL 1ACZA 2OMNA 2YD4A 5L2KE 5HGDB 3NGBB 1A02N 3DIFB 5CZXD 4R8WL 3OJDB 3WFBH 1XT5A 1U42A 1CGXA 5HGHB 2QHLA 1CBVH 2JJSC 4GRLA 4YGAB 5C7XL 1HHGA 4UMGA 1S7QB 5DJ6A 1B3JA 5TDNA 3GMMA 4HIEA 5T3XL 3RNQB 2DQCL 4NRXA 1N0XL 3W39A 2A77H 1ZHBA 3MO1A 2EDOA 5HD8C 3WFDL 3H3KA 5GGTL 4JCLA 4Z78B 4OKVB 3FQXB 3P4OB 3VWJB 1KBGH 2VDNH 3L3IB 4JY6A 5IBTH 5GXBB 2VR4A 1HN1A 5D7IE 1JIBA 1PG7L 5DRZB 4MNHB 3QIBA 1SBSL 5TFSL 4LLAA 4GSDL 2MHAB 2OL3B 3H7BB 3LRSB 3LKPB 5ESQB 1S9XA 3S4SG 4XNXL 3T2OA 5DSCB 2VJXA 3UTOA 4WRLA 4H0HB 5DEFB 4Z95L 3MRHA 5D2LB 1P9MC 5T1LB 1Z9LA 1A6VL 4UT9H 4IRJB 2AV1A 5DT1H 1A9BB 4P9HL 5C8JB 1T22A 1FIGH 4L4TD 5DMIL 5E24E 2VIRB 2XA8L 4ZS6C 5DI8B 4NO0B 3WNLA 3GIVB 1T89A 2AK1L 5E00B 2AK4E 4DOHE 3ZKQD 4F3FA 1KLUB 4X0KB 5DEGB 5E5MB 2Y6SD 4H1LG 2HH0L 1IRAY 3GMNB 4BYHA 4WGWB 4YK4B 4ZO7A 4PGDB 2Y07H 5DJAA 3OF6A 3K4AA 2BVPA 4N90D 2VXTH 2QQNH 5GSRA 3ROOA 1J11A 1XH3A 2Y06L 1ZT7B 3RI5K 5GGVY 4JN2B 2DOCA 2X4NA 1KCRH 3GBML 2YK1H 5D6CA 2FEDD 1SJEA 1FNSL 4I3SL 5FUOL 2FNBA 4HWBL 4LSQL 3VFWB 4JKKA 4JE4B 4NSKB 3OQ3B 4V1DE 3X17A 1FO0L 2HLFD 3BKJH 2PYEB 2YD5A 3RTQA 4OZIA 8FABB 5DHXB 3L7FA 3KYKL 1BHGA 1N2RA 4XPFL 4MAYD 2DWEB 4GXUM 1BFSA 4RBPH 3V4PL 1GC1C 1NDMB 4PRBA 4IRSC 3VRJA 1KJ2H 4X6CE 4Y5XB 4Q97A 2IQAB 1JF1B 5EC2A 1ZEAH 2IAMA 1IARB 4R6UA 1BGXL 1QFWI 2DQHL 1CGSL 4DK6A 3O45A 2ZG1A 3FHQA 2APTA 3SOBL 1JPST 4PJFE 4ZMAT 2ARWA 5DUBA 5KSAB 4EDWH 4LPUA 1JNNH 3VI3F 1TDQA 5JQ6L 3RUGF 1AY1L 4UAOC 5JPNB 3IU4L 4HS6A 4ZXBB 3QBTB 1DQLL 4U6XA 2WIIB 3TJEL 5C0EB 4RGMB 3ARSA 3IETB 2DI7A 2V2XB 5CGYC 1M7XA 1MHEB 1KCKA 3LQMA 5CJXA 1O0VA 2ZUUA 5IF0B 4XNUH 1B4RA 3F62A 3C5ZD 1ZTXL 2WP3O 3MZTA 3JWDH 2HG5A 4HKXB 5I8KL 4L9LA 3SJVB 4BQBA 1N0LA 4C57C 3RWCA 3V6FA 5C0CE 1ZGLP 2FEEL 1NGWA 1OL0A 3MLVH 2AJ3B 3BDYL 3RVUD 4HPOH 2EC8A 3B3IB 5I8EB 5C0JB 4MA7L 4NFBA 4XBEH 3QIWC 4I48B 4QCIA 5BOPA 3MRNA 5FUCC 1KB5L 4HXAL 2IH3A 4LPTA 4ZSOE 4K94L 3U6RB 2VE6A 4O02L 5DVOA 5JOFB 3G6JF 5F8QC 4OGYH 3TA3A 3ZDXF 3OB0H 2FX9L 1MFAH 3C2SA 4X4XA 5BVPL 3FRPA 1SJVA 2AJYL 3OKYA 2FATH 3NOIA 2R0KH 2UUDK 3ARFB 5D1XC 1UZ6E 4YHOL 1RZ7H 4RA0C 3EO1A 5B38B 4L9DA 3PDOA 3GI8H 4FG6D 2Y9RT 4FQ2L 5TQ0L 3PP4L 2Q87A 3P30L 3CVHH 3D87B 2GITA 3FOLB 1U3JA 3QIWD 4UB0L 5DR5H 5IHZA 5CEZL 5KZCB 4J3VA 4M5ZH 2LU3A 4LRIA 3T4YB 2GFBB 2FYYA 5FUCE 3K81A 3V5KA 1FO0B 3PJSB 1U8QB 5JMOC 4EIZC 1GJIA 5HI5C 1BJMA 1XF5B 1WCBA 4LHUD 2YMXL 2ZSVB 4LDOB 5ILTL 5IMMA 3U9PH 1II4E 5I1DB 5IB3B 1NAML 4P2OC 4TTDC 4X7FC 5D1XD 4LLUB 4S1RH 5D1ZD 4X6DB 5AYQA 3ZE0F 1CDJA 3LV3B 3QDMA 3QZWA 4DKAA 5HVWA 4PJBF 2LTQB 2R1WA 1VFAB 4W6YB 4KJQC 3RWDA 1XR8A 3NABH 3PWUB 4R4FH 4PRHB 4ZFFB 4P0DA 4ZPTB 5H94B 2R69H 3RGHA 2DDQL 3D39B 1D9KB 5HI5D 5MI0C 3BIKA 2P43B 5FOBB 5KN5A 4MQSB 1DBBH 1EEUA 1J87A 1D5MB 1KCSH 2X4OB 4XVSH 4P4RA 1HXMB 5GGSY 4UOW0 4JPWH 4P49A 2ZZUT 3TPUB 1A7BA 4NZRH 1VB9A 2QBWA 5DZOA 4LLVA 2E7CA 4ETYA 2WZPD 4K9EC 1P4BL 5J56B 5IMKA 4ONGL 1IAKA 1K3ZA 4G3YL 5CCKL 1MFDL 3HNSL 5DD0H 4QTIH 4WW1A 2R56L 3W11D 3AB0C 5IFHH 3SDCB 1N64L 3RVTD 3QG6A 1G0XA 3LEXA 5A2JH 1ZS8B 4KQ4H 4JO1H 3GSNA 5E95B 1UVQB 3MV9A 2OXGA 1UCTA 1HI6B 1JGLH 1U91A 4HKJA 1VKXA 3UO1L 1V8HA 5HHQA 1JF5A 4Y4HD 5DC9B 4E5XB 2C3WA 3QFJB 3KDMA 1EZVX 1T7ZA 2VZVA 1AXTH 4HUNB 2F8XC 5BS0D 5KSBB 1CZ8H 3HMWL 3MRBB 4OF6A 4OZHE 2DTML 7CGTA 2KQNA 4XI5C 1BD2E 3FT4A 4XVTH 1W72A 4J4PD 1ES0B 4UNVA 2ADIA 3MGTA 2OJZH 3FHAA 4X6BB 1X7QB 1IM3B 3CFEA 4XWGH 1RPQA 1UZ8B 1IGIL 1EV2E 1GCFA 2C4FU 2VLLA 3QP3A 5TDOB 3ZKNC 4AL8H 3OAUL 4HFWB 5DEZA 1C8PA 2R1YA 5I1AA 1FLTX 1OP3K 1WSST 2Q86B 3W0WE 1BEYL 1X9QA 4EVNB 3SDDB 1D5ZB 3ARGB 3VWJC 1MHCB 4P4KD 1KENH 3IDXH 5TDPA 3EOAA 5FV1L 1QLFB 1GZPA 4R8WH 5GS3A 2X4UA 4M5YL 1HHJA 5J06A 4XI5D 1FNLA 2AJXL 5ICYB 5C7XH 1HQRA 1LEKA 4R7DA 4Q58C 4ODWA 2D31A 4WNQB 4QHUA 1RJZA 1HKFA 4NNPL 1JK8A 5T3XH 2DQCH 3JV6A 4FA8A 3W9EA 1IT9L 1N0XH 2AP2A 4IRJC 3X13A 3GDBA 4YR6A 1U95A 4EN3D 2NY0D 1ZXQA 3WFDH 5GGTH 5IJVB 3TZVD 5KG9A 4Z7QF 5D5MB 3D69B 4PJAF 2BOCA 1OW0A 3S5LA 1CDGA 4LKCA 4EI5A 1PG7H 4NWTL 3P0GB 1SBSH 5TFSH 4GSDH 1EXUB 5DFVC 3DHJA 4HKZB 4YK4C 4YIQA 3KPTA 2JB6B 4XNXH 1A6WL 2Q3AA 5JW5A 1BVKB 4Z95H 1QFPA 4TN9A 4TUOA 1A6VH 1AD0B 3D18B 5D2LE 4P9HH 3KAAA 3FAXA 5TJWK 5DMIH 2XA8H 5GRUL 2VERN 5ERWA 1BBJA 4P2CG 4QRQA 5A1AA 5KVMC 3JTTA 2AK1H 5E8EA 5E08L 4NYLA 1G9NL 1MEXL 1P7HL 5MHSD 2HH0H 1SJHA 2PTVA 1CXLA 3TLRA 1S7VB 3ZKMD 2ZUXA 2E8ZA 2FIRT 1Y6KR 4M1CC 1KIPB 1WZLA 2Y06H 1JUFA 4PBWD 5FYLL 2EIZB 5ELIA 3S3SA 3WO4C 2JK5A 1CT8A 3GBMH 4Y5XC 3ARBB 4J1UB 5FCUL 4LVNC 1N6QL 1BZ9A 1DUZB 1FNSH 2FJHA 1BOYA 4I3SH 4MB4A 5FUOH 1E27A 4HWBH 4LSQH 4JFQA 2E7LA 1ZT1B 3MYJA 3O8XD 1FO0H 1CD0A 1FNGA 1BQLL 1KLGA 3WS3B 1JZ4A 2DQFA 2QQLL 4HIJA 2PYEE 2BC4B 2JLLA 3KYKH 2P46B 5IGXL 3VXTA 1YJDL 4XPFH 2AEIT 5J6HA 5IFAL 3V4PH 4ZXBC 2G5RA 4L5FL 5IP4A 3S88L 4L3AA 4U1IB 1G6VK 3DHMA 2UUDH 2P4AB 2BNQA 4RGMC 1BGXH 2DQHH 1CGSH 2VLKE 5L8LB 1DBJL 1YNTB 2P7TA 3SOBH 2EYRB 1ZVYA 3D85D 5CLWA 1HKLL 1AI1L 4AH2B 1I8KB 2GTWA 4LLYB 5JQ6H 5FA4B 1AY1H 1UM6L 4Y8AA 4LOUC 4LGSB 4JDZA 3IU4H 4YDVA 4APQB 3ORJA 3KYMA 4HZLA 4LCYA 4NO3B 3OGCA 1DQLH 3MRRB 3RWEB 1T5WB 2X44D 3TJEH 3WNMA 5C0AD 2HFEA 1LO4L 5L2JB 3U0WL 2VMFA 2XOTA 2FWOA 3FRUA 3MNVB 3K4DA 3PGDB 2PETA 5DJ0A 5IR1B 1A1MA 5F7UA 5JUEL 1XEDA 5ACMA 3S98A 4BFIA 3T4AA 1M05B 4E9LA 4BZYA 5HYIA 4NPYB 1ZTXH 5FHAL 5I8KH 1NUFA 5EO9B 3RVWC 3O4LB 3SJVE 3LN4B 3BDYH 3DVIA 2EYSA 3QR2A 3FKUS 3DUUB 4MA7H 4JGJA 4YDKL 4JZOB 5FYJL 5TF0A 1KB5H 4HXAH 1WITA 1QTYT 4K94H 4O02H 2J7LA 4C58B 5JPMB 1TIUA 2EXYD 3T0EA 4WUUB 3UTPE 3KPLA 5LQBL 5D72L 2FX9H 3CAFA 3GBNL 5BVPH 4CU8A 5M94B 2AJYH 1VFMA 1M7IB 4I4WB 1T20B 1FDLL 2NXYD 5IHBA 4YHOH 3WFCL 2CUHA 1UM4L 2DI8A 4FQ2H 5TQ0H 1TPXB 3PP4H 4F33A 5DJ8B 2Z8VC 4P3DA 3P30H 1I85C 2LTQC 3MLTA 4XPHL 5DK3A 4UB0H 5IT2L 5CEZH 5CBEA 3JWOC 3AROA 3VI4F 3OG4B 3N1QC 3ZL4L 3KLHD 2NYYD 1OGAA 1PFCA 2X4QB 4CVUA 3V52L 4JANA 1D9KC 4HIIA 1LD9A 2YMXH 2CGRL 1RUQL 5ILTH 3GI9L 4PY7B 4JRXB 3B83A 4BSWA 2NY5L 2ICWI 2VQUA 3SO5A 1NAMH 4JRWA 3JZ7A 4K8RD 4AQOA 2WBJB 1EJOL 3PL6B 4HEME 4PP2B 4X6DE 2H6PB 2UY6A 3SE4A 1NPUA 4LLMA 1AP2B 4POZD 4ETQB 2ITCA 4P9ML 3BQUA 2DDQH 4PRHE 5F1OB 4TSBL 3D39E 1OP3H 3T2QA 2PTTB 1WZKA 2V7HA 1Q72L 4NM4L 1KEML 1P6AB 3BEWB 5EIQA 1PG7W 5TQ2L 3IVKA 3VGAB 3V6BR 2D4FA 3MRLA 4JPIB 2GT9A 3T0WA 4HJGB 2BNRB 1P4BH 1W8NA 3KG5A 4ONGH 4JZJA 4RZCA 4G3YH 4M43L 5CCKH 2ZOLA 3IRZA 2DTSA 1MFDH 1UT9A 1LILA 3D5OF 3HNSH 1I1FA 4HCRL 5J12C 2G5BA 4Z77B 3LY6A 3B2UC 3KS0J 4F7TA 2R56H 4RAHA 4D3CL 2F74A 4GKZB 1QQDA 1BQHB 3TVMA 2LU7A 3P4LA 1N64H 4XP6L 5HTSA 1LO0L 4PJ8B 1XCTA 3SN6N 4L8DA 1H3XA 4YAQB 5J9PB 3AXLB 4YXHL 3UO1H 5H8DA 5CWSA 4HUXB 4CN6A 2VLRD 1KF9B 4L4VA 1CICD 4U1SB 2F5AL 3WLWC 5F6HJ 3IT8D 3ARGC 3BYTA 4GG8A 3QFJE 4DQOL 1CD1B 4Y1AB 1NKRA 3HMWH 5J1SC 2DTMH 2Q3ZA 3MV8A 3NACL 4S1QL 1NCAL 3BI9X 4RMTA 5EOTB 1IM9B 3CFCL 4KZDL 4QT5B 2XTLA 3P77B 4IIQC 1LWRA 3DVGA 3VRIB 1NKOA 3SGEI 3RFZC 1IGIH 4KK9D 4F7CA 1U2HA 3PXHA 4F7MB 3B9KB 3OAUH 1BFTA 4LPCA 1N3NB 2C4XA 3BPOC 1BEYH 2DF3A 2VXVL 1NQBA 2DKSA 2HMID 2CUMA 3LPFA 3I02A 2PUQT 2HN7A 2ZNXA 1GAFL 4M5YH 3HUJE 3FTGA 3SKNB 2H2PD 4GJTB 2AJXH 4MD5A 5FDWB 4Y4FC 4BQ6A 5IEKB 4NNPH 1OAKL 3QUYB 1AGEB 3K8LA 4JFFA 5DJXB 1IT9H 4IOIA 2ICEA 1K2DB 3RGVD 3IGAA 1MWAB 4KKAD 4KC3B 4G9FD 3T3PF 1KG0B 5D5ME 2V5RA 2XQYK 4AMKL 3QO1A 5ABDE 4NWTH 5IESL 4OF8A 1YMMA 3DMMB 4PP1C 3DI2B 3DWTA 5HVFB 5D93C 2XNAA 5EO0A 2UV3A 1A6WH 4QRPA 3G5VA 3UBXA 3IDIA 5B8CB 4Y16B 2R0WL 3OTTA 4AIZA 5I71B 1R3IL 2YPLA 2DJUA 2ESVB 1DE4B 3KPOA 1PW3A 3ARBC 3NVQA 2EYTB 5CILL 3KLAA 5GRUH 4HMDA 2NY7L 3SDAB 1S8DA 5E08H 1G9NH 3TBVA 3JTSB 4D9LL 1AHWB 1MEXH 2MQ0A 1IAII 3LQAC 1R3HB 1YEDB 1K4CA 1PVHA 3FZUD 5T5NG 4KI5D 4W4NA 4Q6IA 1KJVA 4NGHL 3V0AC 5FYLH 4PGZA 3WNPA 2PXYC 5JZ7C 3DV6A 5FCUH 4ZDHB 1I1AA 2ZSWA 3RL2B 1N6QH 4BH8A 1CYGA 4XPGL 4CKVX 2D7OA 1OHQA 4JFZL 1OT1A 4KRNA 4QWWC 3WKNA 4ELMA 4MD0A 1QSVA 4PTUB 4F7PB 2FZ3B 1YC7A 2F5BL 2X7LA 4ODUB 4XCNA 1W0YT 1BQLH 2Y5TA 3ILPA 3KPRB 1G6RA 4PV8A 3HPJB 5DK2A 2QQLH 3DECA 3LMJL 5FUZL 5KS9A 1OY3B 5C08B 1Z9OA 4JKWA 1CCZA 4PRIB 3EO0A 5IGXH 1YJDH 3QQ9D 4P23A 3MGOB 5I1KL 4IHOA 5IFAH 4APQC 4OZGB 5IQ7L 2EDRA 4L5FH 3CPLB 3S88H 5LXGL 1Y18A 4QOKD 1A4JA 4D0CB 5E2UL 3HG1D 4BZ2L 5MP6L 3M07A 1DBJH 3PWLB 3HKFA 1I7RA 2EDQA 1T1WB 4JLRA 4YHNA 3HB3C 8CGTA 4YFEA 3QDGB 4FZEL 2GAZB 5F71A 3U48A 5CBAA 1HKLH 1AI1H 3U2SB 4O9HL 4BQCA 1A7OL 5LJYH 4O5LL 3NFSL 1CFNA 4DUXA 1UM6H 2ZG2A 4M6AA 1DANU 2OCFD 2OSLA 3D3VD 1FORL 2DWDB 5CP3H 2CRMA 1U41A 4OFYA 1LO4H 4XXDA 3GHEL 3QI9D 3VXQA 3U0WH 4G8GA 2FECL 1NBZA 2BXZA 3S9DB 3ZT6A 4OV5A 1H8SA 5I30L 3UTSB 2OQJA 3CFDB 5JUEH 5IW6A 5EC1A 5I8CB 1CFTB 5DFWH 5DTFB 3EGSA 1WFTA 4ONHA 1I8LA 5AG8A 4TTGA 2DQDL 1G9ML 1IJ9A 4LCCB 1JWUB 5D6DC 4KKLC 5FHAH 4DFIA 4QLRA 3RDTD 3PIQB 5D7KE 5JR1L 4D2NA 4MQXC 1RK0B 4GW4B 4KKNA 4EQ2A 1G7HB 1S7SA 5FAAA 3O4LE 2OI9C 1F45A 1P7KB 1TPXC 4H8WL 5FO7B 4Y19A 1VFUA 4YDKH 3NMEA 4P46A 4OZFG 3I6GA 5FYJH 4X8XA 4PD4J 3FMGL 3G08A 5I1HL 4XNYL 2YKLL 3ULUD 3WIFA 1YEKL 5FXCH 4XMLL 3RWHA 3UROR 3BUTA 5LQBH 1S5IL 5D72H 1OAYL 2B39A 4WUUE 3GBNH 2CR6A 4PRNA 5JLZB 2XTJB 1DBML 5BRZD 1CU4L 1FDLH 4JPKL 5DVNA 3ES6B 5CSBA 3RBSA 3PQYA 3FQTA 3WFCH 5FYLE 5ACZA 1UM4H 3PL6C 4I18B 2LAAA 3HE6A 2WIMA 4UT7L 1C5DB 4UIMB 4XPHH 5IT2H 2ARJQ 4LKXB 5MEQB 2MFNA 3HLAB 3ME0A 3UBXG 3ZL4H 3BKCL 3NIGE 4Y4KB 3FB7B 3V52H 2X4PA 1X5GA 1HNGA 2UWEA 1X44A 1YPZA 4POUB 5BZDB 1EX0A 2CGRH 4JY4A 1RUQH 4D9RD 2BX5A 3GI9H 4M7KL 1MUJB 5SWSA 3O3DA 4GW1A 1S7RA 2NY5H 2DJ4A 4XBGB 4JRXE 1VADB 3CXHJ 4HLZG 1KN4L 2CIIA 2VZ1A 4NQSB 4ZUTB 2HLAA 4FOMA 1IGTA 1KCVL 2GJ6B 3VGAC 1EJOH 1D6EA 5C0GA 1BJ1H 1OCWL 3ILQC 3RUGB 5F7DB 4KVNL 3VXSA 4CVZA 4WI8A 4RRPA 4NN6B 4FQPA 5T3ZL 5DJYA 5D4QA 5LCVL 5GRWA 3SBWC 4P9MH 4EI6B 5IWLA 4ELMF 5H2BA 1JF6A 1YDPB 4TSBH 1PDKA 1FHGA 3QAZC 3MRQA 5EU7E 4U1MB 1A7PL 1Q72H 3QUXD 5D1QA 3T65B 4NM4H 1M6OA 3TCLB 1KEMH 4PJ8C 2E8YA 4WDIA 5KS9F 5TQ2H 2WWKT 1RZJC 1AD9B 4UU9A 5K9KA 4LCWD 3O6KL 2CKBA 1R5VA 2YR3A 4WI5A 3KXFA 3TF7C 1JPGA 1XIWC 1F8TL 5F9DC 5IMOA 1AH1A 4GRLB 4M43H 1HHGB 3KR3L 1QSED 5DJ6B 3CNKA 5TDNB 4HCRH 1NBYA 3GMMB 2NNAA 4HIEB 4ESKA 4NRXB 3W39B 4D3CH 1FL6B 3ULVF 2RHEA 1ZHBB 4HMCA 3MO1B 2EC9U 4WEMB 4XP6H 4PR5A 1RZGA 1LO0H 1JZ2A 2BSTA 4JY6B 3NZHL 1OAZL 4TVPD 4U05A 5FB8A 2YD1A 5IB4B 1GGIL 1NMCB 3QIBB 1KB9K 4YXHH 3UTTA 3LAFA 1S7UA 1QLRA 3B9KC 1XIWD 1MRFL 4JM2A 3VFMA 1CD9B 1S9XB 1I8IA 4XAKE 3C8KA 2FD6L 2F5AH 1R5IA 4DVRL 3E2HB 5FM5O 3IDMB 3MRHB 1KIUA 2XY2A 4JFDA 4DQOH 1H3WM 2Y36L 2C26A 2AV1B 1FCGA 3MNZA 4L1DA 4PRPA 4Y1AE 4KMTL 3NACH 1T22B 4I77L 4S1QH 1NCAH 3CFCH 4HS8L 4KZDH 1RJCA 4F3FB 2DJSA 3QUYC 3UC0L 3F7RA 4NRYA 2YSSA 3EDFA 1FL5B 3BIAX 2QQKL 1U3HA 2ADFL 1CDUA 5DXWA 5IVOA 4UQ2A 5DO2C 1JP5A 3QEUA 2BVPB 2VXVH 3LS5L 5GSRB 3ROOB 1R3KA 1XH3B 4KGJA 2W59A 4P2QB 3PP3K 4WTXA 5D6CB 1GAFH 3DMMC 1UQSA 1R5WA 4RIRA 1SJEB 4ZO8A 4QTHA 1YNKL 1OAKH 5B8CC 4M00A 5DC4B 5I71C 3EYUL 2DKUA 3DYMA 3K1DA 5MEOA 4MA3A 4OZIB 4MB3A 2HT2C 3L7FB 4M7LT 1BMGA 3NFPA 4NZDA 5BQ7A 2RCSL 1F4WL 1N2RB 4WWKC 4FFVC 2E5EA 1CGYA 4U4BA 3SDAC 4IOSD 4OCNC 1LO2L 4PRBB 1IKFL 4AMKH 3VRJB 1AHWC 5EC2B 3LVEA 2IAMB 2UWEF 3ZDZF 5IESH 2P5EA 3BGMA 1AJ7L 2GSGA 2EDNA 3O45B 1N5YL 1AQDA 3UTZA 3C6LD 4H1LH 1MRCL 4XRCA 2VB5A 2R0WH 4XPBL 4MXVF 4HC1A 3U4BL 4Z7OE 1R3IH 4P2RD 2FRGP 1F4YL 1QBAA 4XPAL 5DUBB 3W9DA 4JRYA 2ESVE 5JHDB 1QD0A 2DMKA 5CILH 2E27L 1HCFX 4MZ2A 4FXLA 1I3VA 2NY7H 4HS6B 4TRPL 4D9LH 3LEVL 4U6XB 1DZBA 4LPVA 3IAPA 1HSAA 1BX2A 1AKJA 2IAND 1FGNL 2P24A 2XZZA 3MLSL 1TETL 1FAKT 4NGHH 1LVEA 2ICWJ 1WLHA 3F65A 4H5SA 4U7KA 1UACL 3NCMA 2HG5B 4XPGH 4L9LB 3RWCB 4JFZH 3V6FB 1JPTL 1NGWB 4JO3L 2EE6A 3DO7A 4Y8DC 2X9XA 2ADGA 1HHIA 2F5BH 4ZTPL 2EDYA 5E7FA 4QCIB 1QSFA 4OLYL 3MRNB 2DLGA 4NT6B 1CG9A 3LMJH 5FUZH 2IH3B 4LBEA 4DGVL 2VE6B 3BPCA 4KY1L 4ZOBA 1UC6A 1GGBL 5C08E 3QWOA 5I1KH 1Q9WA 1JPFA 4PRIE 3TA3B 5IQ7H 5LXGH 4X4XB 5E2UH 4KH2A 3V8CA 4BZ2H 5I1IL 5MP6H 4MS8C 1RUAL 5JXEA 1CLCA 3EO1B 4JM2F 1URLA 1FFQA 4O2FA 4FZEH 2VC2L 3TN0B 2GITB 5IHZB 3QDGE 2E6JA 4O9HH 3PHQB 1A7OH 2H41A 1X5FA 3P40A 4NUJA 2D03L 3NFSH 4O5LH 2CDGA 3MRGB 2A1WL 2FYYB 4GS7B 3V5KB 2NY3D 4PUBL 2R4RL 1I1RA 1WCBB 2BCKB 1FORH 4U1GB 4KRPB 5D7JA 5IMMB 5I73B 2DKMA 3GHEH 3MV7D 2XKSA 1DUYA 3IDGA 5JMRA 1MCOL 5C07D 1VGKB 4MS8D 2ED9A 3KHQA 1IEAA 1RZKC 5I30H 3QDMB 3QZWB 1EDQA 5J7CC 3UTSE 2R1WB 2DQDH 1G9MH 5C0BE 2YUZA 3VXPA 1XR8B 2VUYA 5IV2A 3V8OA 3U9UA 5JR1H 3BN9C 3GSWA 3MBEA 4OFDA 3BIKB 1CN4A 4H8WH 5KN5B 4S1DD 4QHKJ 2AXJA 4PJXF 2HFFB 2LV4A 3FMGH 4Y4KC 4XNYH 5I1HH 5ISZD 2YKLH 4HJJL 1YEKH 4XMLH 5BCAA 4LLVB 1JMZA 1S5IH 4RMWA 1OAYH 3LKQA 4TNWF 1UJ3C 5IMKB 1IAKB 2YS4A 1M71A 1DBMH 1CU4H 4JPKH 2KBGA 1ZLVK 3EYVA 3GMRA 3RL1A 4WW1B 5LWYL 5DMGC 1P4LA 4UT7H 2JELL 5B39A 2X4RA 3QG6B 1A21A 4NKQB 5L0QB 4AK1A 3LEXB 5EPMA 3DLQR 3BKCH 3WLBA 2EKJA 1VFOA 3GSNB 4O00A 3MV9B 2OTWA 4YEFA 4NHCL 1JWSA 1U91B 4M4PA 3ARQA 1Q9OA 4M7KH 1X5AA 1CTNA 5HHQB 4IOFD 4KJWC 1KN4H 3KDMB 1H3PL 1KCVH 4NC0B 4YHML 2X70A 3RIAF 1FYHB 4RGOL 1OCWH 1TTGA 2GJ6E 5F88A 4KVNH 4PB0L 1MLCA 4CW1B 1QZ1A 3FT4B 3QDJD 3RUGE 1W72B 2JJSA 2Q20A 3OGOE 2WK2A 4GRLC 3WFZA 1LMKA 5T3ZH 2ADIB 3MGTB 5LCVH 4KUCF 1ZLSL 5FYKE 2IBBA 2C9AA 3VCLA 3VFRA 3CFEB 5HGGS 4PLKC 1MVFA 5CEXA 2VLLB 3EOYG 4E41D 2R1YB 5I1AB 1BJ8A 2OXHA 1A7PH 3OG6B 4OGAD 2VZTA 3STZA 5IQ9A 4X8JA 1ITBB 5HSFA 3EOAB 3O6KH 4LIQL 1IFHL 1DP0A 1SY6A 1GZPB 4RCAA 3QIBC 1NANH 1NMCC 1TVHA 2X4UB 4WFHE 2BVYA 1HHJB 1LE5A 1F8TH 1LEIA 3IS1X 3FT2A 3HRPA 4YPGA 1HQRB 2ID5A 2NXZD 3KR3H 3LRGA 1LEKB 3KHOA 4ODWB 2D31B 4QHUB 1RJZB 3ZMRA 1JK8B 2YXFA 3E2HC 3JV6B 1NMAL 3W9EB 3IYLW 3X13B 3D0VA 4YR6B 3AFLA 1U95B 3BE1L 4RISL 4BFBD 1AXSA 5KG9B 2BOCB 3SGDI 1T89C 3G6JE 2MPAL 4FQXD 3NZHH 1OAZH 4M62L 4LKCB 4EI5B 4RDQF 3ZDXE 1GGIH 5CHNA 4JAMA 3W0WD 4U3XA 3IKCA 5J1AA 3KYAA 1MRFH 5L7XL 4YIQB 4L29A 1CVSC 2FD6H 5C6TL 4MAYA 4OIAA 5JW5B 4DVRH 3KWWA 2YRPA 4TUOB 2Y36H 3ARXA 3ULSA 4KMTH 2AEQL 1U0QA 4ZOCA 3IJSA 4I77H 4G6FB 5ERWB 1BBJB 4QRQB 4Q2ZA 3NH7L 4HS8H 2GKIA 3JTTB 4YC2C 5C3LD 4NYLB 5JA8B 5EU4A 2EDJA 4FTVD 4WFFE 3UC0H 3LKOA 4UINL 1DSFL 2QQKH 1HHKA 2ADFH 3RTQC 3M45A 5JDJA 4EXPX 1NGZA 3MUJA 3LS5H 2FR4A 2BRRL 1QHOA 2Z4QA 3ZE0E 4P5TD 1JUFB 3GEWB 3KPMA 2VXUL 5KSUA 1MAJA 1I3RA 3HAEA 1BIHA 1BZ9B 2YA1A 1T04A 2FJHB 1E27B 1EK3A 2P8MA 4JFQB 2IEPA 2QSQA 4X7TA 5T1LD 1YNKH 3MYJB 1M1SA 5HDQL 2COQA 3EYUH 1K5NA 1PKQE 1FNGB 1KLGB 2BFVL 3C5ZA 2DQFB 3GSRA 4HIJB 1BVZA 5GGUA 4OZIE 1F6FB 2RCSH 1F4WH 3VXTB 4UV7L 4B7IA 1INEL 5J6HB 5FHBL 5GRYA 1LO2H 1AFVL 1MI5D 4NFDA 3BP5A 1IKFH 1HHHA 2BNQB 1AJ7H 2P44B 2FL5B 1N5YH 3O9WB 1HQ4A 4OQ1A 5DD5L 1MRCH 2P7TB 1DQJA 4XPBH 3U4BH 5CS7A 1F4YH 5FOJA 4XPAH 1JTTA 4H88L 2GTWB 2QADB 1AR1C 1D3CA 1GSMA 3DX9A 4L9LC 2E27H 5CGMA 4XHQA 4JDZB 4YDVB 2HTKD 3QWRD 3KYMB 4HZLB 4TRPH 3UYPA 1JI2A 3LEVH 3OGCB 3Q1SL 1MLBA 3QIWA 5FKAA 1F4AA 1OAQL 2JJWA 2W9LA 1IAOA 3FRUB 2FWOB 1FGNH 3R06A 5DJ0B 3MLSH 2I07A 1TETH 5F9JA 1A1MB 2JKXA 4LHUA 4BFIB 4Z76A 3T4AB 5JOPD 1NUGA 3V7MA 1UACH 1FNFA 3RVXD 2R0LL 1OD9A 1AR1D 4ONFL 5GZOC 4DK3A 5D1XA 4PTTA 4HKBB 1VENA 1JPTH 5D1ZA 1KSRA 2ED8A 3KPPA 4JO3H 2B5IC 3J8F7 2EYSB 4HW6A 4XH2A 4YX2L 4JFYA 4NM8L 4ZTPH 2NLJA 2YPVL 4UILL 4Y2DC 4OLYH 5BJTA 3N1FC 4PJ9C 2Z31D 5T3XD 4DGVH 4QO1A 4LRIC 4KY1H 3QHFL 1GGBH 3QEHA 3T0EB 2MWCA 4U6TA 3KPLB 2CR3A 4U1GC 3MNWA 3IFPA 5D2NA 5I73C 2KUTA 5HHMB 4FFWD 5I1IH 1WBZA 1CXIA 4GOSA 1RUAH 1CLOL 4F33B 1H3VA 2VC2H 2YRZA 3MLTB 4YQXL 3KPNA 4OCLC 1JN6A 3EOTL 4Y2DD 3BWAA 5CBEB 2D03H 3SJVD 4G6AC 3CD4A 2A1WH 2AJVL 4PJAE 1AO7A 4PUBH 4JANB 2R4RH 1IEBA 4I8DA 5EZOL 3RKDD 3STBA 1LD9B 5HI4C 4DKFL 4QRSA 2C4FT 5F9WB 5IBLD 2KZ1B 4NC2B 1X4ZA 4N8VA 4BSWB 1FFOA 1MCOH 2CDFB 3EJYC 2AJUL 4N0UA 3BOVA 4GUPA 5K9OA 1KOAA 1WZ1L 1OQXA 3QDME 5ETUA 4M03A 4OKDA 4WHDA 3FB8A 4Y4HA 1M4KA 3S6CA 3ARFD 4LLMB 1FLRL 2H32A 5I75B 5F21B 5CIPA 1B2WL 2BVQA 1S78D 2ITCB 3BQUB 5BS0A 3QXWA 2NY1C 5KAQG 2RQ8A 1ZA6A 4JG1L 4OFKA 4LF3A 2P48B 3VXRA 4J4PA 2V7HB 4KXZI 1KELL 2AS5M 4WCYL 5IIEA 3MXWL 4XC1L 3IVKB 1T7YA 5KTEL 3DGCR 3E8UL 4HJJH 3MRLB 3B9EA 3CU7A 2FB4L 5IG7A 2ZCLL 3QCVL 2GT9B 4U0RB 2BVEA 3WIIL 5ESVB 4HUMB 3BD3A 4LDEB 4JZJB 3OAYH 3OSKA 3CMGA 4RZCB 5LKNA 1E4XL 2I9TA 2ZOLB 1J10A 4EIGB 1I1FB 4NO2A 4F7TB 1E4JA 5LWYH 2NY1D 1I9EA 5E7BA 2F74B 1QQDB 2JELH 4X9BA 3TVMB 5FM5M 4N9GA 1X6NA 3ZDYF 1XCTB 4L8DB 4MHHG 4RWYL 1MOEA 2GY5A 2XKNA 3MV9E 4NHCH 4EN3A 4YBQC 3S97C 5CWSB 2GJJA 2CSPA 4L4VB 4XCCL 1FZJA 1DDHA 1ORSA 4NQCD 4YWGL 3VG0L 4EUPA 1H3PH 3SKMA 3DTXA 1Y6NR 4N1EA 4GG8B 4YHMH 3TH3T 3DVFA 1UXWA 1CLZL 4RGOH 2XPGA 3MV8B 4YHIA 4PB0H 4IRZL 2D2OA 3GMQA 4KK5D 3T0DA 5GRZA 3BFOA 4PGBA 1ZLSH 4UT6L 3DVGB 5GGVL 1I1YA 4F7CB 5I15L 5DVMA 4YZFF 1RQ5A 5D7LD 1IQDA 3PNWA 5CUSL 1NC4D 4M1GL 5C0RL 2Z93A 3I02B 4L4JA 4ZUWA 3WHXA 4LIQH 2HN7B 5HHOD 1IFHH 1OTUD 3FTGB 3CSPA 3IU3A 3RIFF 4DZBA 4OZFB 1Q0XL 3KJ4B 2YWYA 5HYFA 4WU5A 1T7XA 1NMAH 4JFFB 2BY3A 4K3DL 5KVGL 5EUOF 3UMTA 3Q2CA 2BERA 3B5HA 4IOIB 3BE1H 4RISH 3UAJC 3QFDA 4X4MA 4NQXA 5IM7A 5IVZA 5JNYA 2YA2A 3IGAB 1NGYA 3TM6A 6FABL 3BKML 1MCCA 5EB9A 2MPAH 3O8XA 5CEZD 1HH6A 3TO4D 43CAA 2CPCA 4M62H 5GJTL 1G7LA 1YMMB 4V2CB 4U1KA 5L7XH 2XNAB 5EO0B 4LVEA 3SDDD 1L9MA 1T83C 3IAQA 5C6TH 3MRIA 4QRPB 3G5VB 3L6FA 3IDIB 3UBXB 4D9QE 4C56B 4W6XB 2WWKO 4AIZB 3SGKC 2YPLB 1S9VA 3K0WA 3KPOB 4NUGL 3WS6A 5MEPA 2AEQH 3KLAB 4WO4D 3VI4E 1OM3L 5CZVL 3NH7H 3VFSA 2E7LC 1S8DB 1PX3A 3TBVB 4N0CD 4UINH 2XFXA 3D85A 4DAGL 1DSFH 2VOTA 1EHNA 4ZPVB 2AQ3A 1K4CB 4GMTL 5BV7L 5AAWA 5E0QA 4OFIA 1JJUA 1QLEL 3BKYL 4RFEA 2BRRH 4PV9A 2K7PA 5HGBB 3MV11 2QL1A 3IKKA