4U05A

Homodimeric single domain antibody (sdab) against staphylococcal enterotoxin b (seb) s74a variant
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
130
structure length
130
Chain Sequence
MEVQLVESGGGLVQAGDSLRLSCTASGRTFSRAVMGWFRQAPGKEREFVAAISAAPGTAYYAFYADSVRGRFSIAADSAKNTVYLQMNSLKPEDTAVYYCAADLKMQVAAYMNQRSVDYWGQGTQVTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and mutational analysis of a monomeric and dimeric form of a single domain antibody with implications for protein misfolding.
pubmed doi rcsb
source organism Lama glama
molecule tags Immune system
molecule keywords Single Domain Antibody
total genus 32
structure length 130
sequence length 130
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-07-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4u05A00
4LDLB 3QP3A 1A2YB 4Y4FD 2XZCL 5EU7C 5FO8A 3CUPB 3WFEL 5FGBC 5HI5D 3OXSB 4XNZB 3ZL4H 3O2VH 1IL1B 2K7PA 1CICB 1W0WB 4YK4C 4BH7A 4M62H 2G75A 3IVKB 1MCNA 2JIXB 4FQCL 3BVNA 1MRFL 4U2YA 5SV4A 1QQDB 4L4VE 4NIKB 1CD1B 4Q9QH 5F71A 4JG0L 4NRXB 2HKFH 2JJWA 1FV1A 3EYVB 3S36X 5HHPB 4K71C 3STZB 3OAUL 2E6JA 3GDBA 2NW2A 2FGWL 4DGIH 5DVNA 3HAEA 1Q94A 3EKCA 4PRPA 5IBLC 2DTML 4OIAA 5AUMB 2X5PA 3K2UL 4XPGL 1OTSC 4H1LH 2NW2B 4NSKA 3CLFH 4YBQD 1T20B 3W9EA 4GW4B 3U7YH 5ICXA 4GH7B 3LSOA 3SE9L 4H25A 4KJYB 1A3QA 4QRPB 1HQ4A 2GFBB 4Y1AA 4I0PC 1IGIL 2NY5H 2VDQH 2BNQA 2BSRA 4MS8C 4NGHL 4FQ2L 1CFSB 5DT1L 3WNNA 5KBNC 2ADJA 4PLKD 2VDNL 4RAVB 3CGTA 3EO0A 4FTVE 3MJ8A 4X99B 1ZKAA 1CQYA 2AS5M 1TTGA 2PXYC 5IG7B 1FZMA 2HH0L 4CMHB 1JHTA 4AM0B 5KSBB 1U92B 2ADFL 1EXUA 2QSTA 3RHWF 5AYUL 4J3OC 5LCVH 5AD0B 2PYEA 1FNLA 2Z0BA 3HRZA 3MFFB 3MLPA 1T1WB 4GS7B 3QNZA 3JVGA 1DLHA 4WEBL 1P7QB 1TVDA 3RJDA 1IGJB 4WUUA 2C3GA 1DVFD 2OZ4H 3KYAA 3KLDA 5D6DC 1D7FA 3QYCA 2WP3O 3EYOB 3QFDB 4NQEA 2ZCHH 1DLHB 1JK8A 5J1SC 2C4XA 3S34L 2IJ0C 4Y8AA 1BEYL 5I16B 4PRIA 4XCEB 4JKKA 2NYYC 4WO4D 43CAB 3Q48A 5DMKA 2GT9B 5F3HB 5C0ND 5C0BB 4MAYD 1T2JA 3G6DL 3LEVL 2AABH 3P3YA 1OF2A 1JPSL 2G2RB 5DMIL 1ZAGA 1JGLH 2UZYB 4QT5A 2EDTA 3RA7H 3VXOA 4UT9L 5L88L 2XWBA 3AROA 1UACH 3H0TA 4GJTB 3LKPB 2AI0H 4IHOB 4X98A 5DFVD 1U8QB 4PJFF 1KXQE 2W0FA 4XB7A 5CSZB 2VXQH 3LB6C 3ARXA 2NNAA 4IDJH 5DJAB 1NJ9B 5E9DB 4H20H 1AE6H 4ZOCA 3IAGC 3PHSA 3FN0L 4S11A 3MA7A 3DRQB 4WWKA 3PWLB 3SDDA 4LU5L 1IE5A 4QHNB 3MTRA 4ZOAA 3RWDB 2CD0A 1J1PH 3RNQB 4P48A 1Z0NA 1MLCB 3VXPB 3RNKA 1I3VA 3QG7H 1OM3H 1RPQA 4N1CA 5DEGB 3UDWA 4WW2C 1N6UA 3VFPB 4Z9KB 1G7IA 1OARH 2DB8A 3NIFE 3DOSA 2ITCA 2IMNA 4UINL 3UBXA 3QH3B 1MRCH 4QTHB 2IQ9H 3KGRA 4M93C 3HR5B 4L9DA 2A6DA 3MJ7B 3O41B 3Q2CA 4BUHA 1N8ZB 4NKOB 4NP4H 5CFHA 2NY7L 5FUOL 2DM2A 2EZ0C 3RZCD 1BX2B 3GIVA 5KSVB 4J3TA 3SKUD 4OZGB 2Y72A 2EEBA 5I19H 1QHPA 2OYPA 4MD5B 3EAKA 4MA1C 5FYLL 2Q8BL 2AV1A 2Q8AH 1OQXA 5CIPB 2XRAH 1AXIB 1NCDH 2X4RB 4TSAH 3G5YA 3QI9C 1G9ML 1OLZA 3ET9F 5IM7B 3MC0A 5HHQB 1YUHA 1V05A 2GKIA 3EFDH 1Q1JL 3SJVB 1GPOL 4NZTH 1CU4H 3EO1B 3MRMB 3D39A 4UILL 3V4UH 1JTTA 3SJVA 4K7PL 2OX5A 1U92A 1GZPB 2YRZA 5E99H 2KQMA 1QFUH 2FL5A 5IB4A 4PP2B 3T0XA 1RUPL 4UDUB 5D7JA 2UVFA 32C2B 4PS4L 3RIFK 1G7LA 1VB9A 4FQHB 2ADGB 4RFNB 2VSCA 1NGPL 4H8WH 4URTB 3CFKB 4GMSH 3MCLL 1EZVX 4AY0A 5KW9H 2WBJB 4Y5VA 4Y5XA 3VXUB 5ABDE 1NBZB 2RCSH 2IEPA 4NM4L 5GS0L 4LHUB 2I9LA 3VXUA 3QQ9C 5IV2A 2WBKA 4JKWA 5E5RB 1BM3H 3VU2A 3WD5L 1I7RB 2EH8L 5EBWA 1FPTL 4LPUA 1G84A 3BAEH 4HWBA 4YHKL 5AWNL 5BV7C 1CK0L 1F11A 3I6GA 1MRDL 5GZOD 2EC9U 4U6TA 3EOAA 2YD2A 3QG6B 2ITCB 2EE9A 5TJWK 1YN6B 1QD0A 4OFPA 4NZRH 4OD2A 3VMNA 5C08B 2NLJB 4RMUA 5CKAA 4PLKC 2YPVH 1GGCL 2LABA 3WLWD 1N64L 1ZE3C 3TFKD 1HOCB 5I18H 1A7BA 2D0GA 4JKPL 2DIJA 1YYMH 3BP4B 1DBKL 3BQUA 3QWRD 5T5NF 3VI4E 3RP1A 3TBTA 1NGXB 4PLJC 5B39G 3DI3B 4Z7WB 4P49A 2BOBA 3CSGA 1A1NA 4QHMA 1NCWH 1LO2H 3VFTA 5F93C 1AD9B 2CKNA 4NQEE 3DNKA 2W60A 3GBML 1YY8A 4PJXE 5J7CC 1TZHB 3NACH 3EOTH 1O5DT 2DIAA 4QF1A 5CLTA 3T4AB 1GAFL 4W6XB 1QFUL 4OSUL 1CLCA 3QUML 2EDRA 4PJFA 5CIPA 3R06B 1UFUA 2ATKA 2JJSA 2VB5A 4HK0B 3TCLA 3C8KA 4NO0A 4UILH 1CVRA 1FL5A 3CDGA 3V6FB 4DFIA 5A2IH 4HULB 3H7BB 1HXYA 2JCCB 3GSNH 2H2PD 2PW2A 5HGBB 3GB7A 4BKLA 1JMXA 1K6QH 2Z31D 4KV5F 5JA8B 4EQ3A 3QNZB 1FZJA 2ZCKH 4XP1H 2QHLA 2BC4A 5IB5B 3P0VL 4NHCH 3HLAB 4Z0BH 2I9TA 5F7DB 1YEJH 3WKMH 3W2DL 1UXWA 2YWZA 3LKRB 3GSOA 2YBRB 3GMLA 1ZTXH 4OM1L 1OB1A 5KN5B 5GSVB 2HTLC 4FQJL 2QQNL 3GSVB 3DO3A 4P2QB 3DARA 4FQQA 4LVEA 4XNXL 2IANE 3PWVA 4JZNA 4P4KC 2QSCH 5HVHC 3LKOB 3ABZA 4PRHA 5C0EB 4P3DA 4HWEH 1A02N 4U6XA 3HMWL 4NWTH 5BW7C 3DUSA 1HEZA 4X6DA 1IAMA 5ILTL 4NFDA 1QFWM 5C9KA 5EBLB 1MFAH 5MHSD 4K3JL 3WFDL 5I8OL 1RUML 2EDYA 4WI7A 1ES0B 1NDGB 3P9LA 2VXTH 1I7ZA 3IDXH 3UMTA 2OXGA 1CF8L 1I7RA 3QDJB 4F2MB 1MWAL 4JY4B 1K9TA 3QJHA 5L8KB 4PJAB 1OPGL 3T3MF 3U7WH 3S3JA 1QO3B 2X70A 4OF6A 3I6KB 2DD8L 5GJSL 2WBWB 5JZ7C 1JZ5A 2EDLA 3RWHB 4Y5XB 1T1ZB 4JFZH 1HH6A 1NBZA 5T3XH 5I2IA 1U3JA 4JLRA 3C09C 4OV5B 4R0LC 2E9WA 5E1HB 1HYSC 3GI8H 4MJIE 4J4PA 4GAJL 4WI9A 4QO1A 4ZFGH 5IHZA 4U0RB 3BD3A 3LY6A 1W0VB 2CIIB 5C08E 4BFGA 3BEVB 3G6AA 1J88A 3MXVH 5C0AA 4KHTH 5KVDH 5KSUA 1M6OA 2BXYA 4XMLL 5HDOA 4TUKH 3ZTNL 4BELD 2WIMA 1FG2B 1RJZB 3DV6B 4S1RH 3CH8A 1RFDH 1XR9B 3WO4B 4XPFL 3PDGA 4EXKA 2XFXA 3BHBA 1G1CA 3WS6C 1L7IH 4QRUA 3EJZD 3GHEH 1F3DH 2HVKB 5FCSH 2Q3ZA 4OAWA 3G5YB 4CJ1A 3MRIB 1MAJA 2J8OA 4R7DA 3DV4B 4HJ0D 4P9HH 1N59A 5HHQA 5GGSB 4TUJB 3OAYH 4KRLB 2HLFC 4GBXD 5SWSD 1R0AL 2W1NA 1HXYB 4HLZH 5FGCB 4S1SL 2HA1A 5MP6H 1BVKB 4M1DH 1CGVA 4L29A 4TSBL 1U8NA 2KKQA 4XHJC 4JFEB 4LP5A 3R0MA 3HC3L 4Y2DC 5GIRA 3HG1E 4ZXBB 4L1DA 3RVVD 1FGNH 5IGXL 5F9AC 1U36A 4GAYB 4Z8FL 1J86A 3K8MA 1UWEH 1SBSH 4IRSB 2E27L 1RHHA 2ICEB 4I48B 1HI6B 1UB6B 1QBAA 4PJ9C 4ZODA 4HWNA 4MXVE 5GRUL 5SWZB 5FUZH 4PS4H 4OKDA 3IU4H 4GXUN 3O2DA 3FONB 3LKOA 5GZNC 2A9NL 1FJ1A 4PRHB 5C0EA 4Y5VB 3QUYD 3CSYB 5E99L 2OR8A 1RZJL 2HRLA 3DUSB 4X6DB 4ZO9A 1A6PA 4U1KA 4JRWA 5DQJA 5KVGH 3V4UL 3OKMA 1MCPH 2QKIA 4BSVB 1AIFA 4EQ2A 2HN7B 3C60D 6FABH 5JW4Q 3AAZB 4I9WD 4RFOL 5K9JL 5D96C 4M7JL 3Q6FA 1HXMB 1JI1A 3L3IB 2VDOL 1K5NA 4P9MH 5HY9A 3T65B 4GKZB 3N1QC 5D7LD 1HHKA 4WFGD 4JKLA 2B4CL 5GISL 4WTZG 4DAGL 4LLQB 1I1AC 4L4TE 1LK2A 3FCTA 1T2QL 3BDYL 3MV01 4L8BB 4HUVA 5IBTH 1LVEA 5L6YL 2NZ9C 3H9SE 4F9PA 4KMQA 2EDQA 1NC2B 5L8LB 5ID1A 1BQHB 4MXVF 3MRGA 3QWRA 3BQUD 3DX8A 1U8KA 4MJ6A 1S7RB 5JR1L 1RD6A 4R7NB 1BF2A 5EZLB 1P5UA 2W59A 3TZVC 4RIRA 1AQDA 2WK2A 2P4AB 1MELA 5H35B 1VEMA 5DQ9A 1VSCA 1T1ZA 3O6MH 1YMHB 1L0XA 2V5YA 3BPOB 4Y4KD 2EDKA 1X5GA 2NTFA 4BJLA 5IJKC 1P7HL 1RFDL 1JZ4A 5C0CE 3HN3A 4OB5L 4ZMAT 2I24N 4KI5F 3UTPE 1YMHA 1G9MC 1HSAB 1MFBH 5F1IA 4Z7WA 4KQ3L 2VAAB 4MDIB 1ROWA 1XAUA 4HFUL 1HCFX 3BKMH 4NO0D 3FRPA 1IEBB 3QI9D 5LAXA 2ATPA 4TNWF 4JO4L 2E6PA 1BFSA 1WT5A 4ODWB 4ZOBA 1JTOA 4YIQB 4NKMB 3WHE1 4LKCB 5HHMD 4PJ8C 2P47B 3QRGH 3U0PA 4L3ED 4MVBD 5IFJB 1KTRL 2AEQL 5ERWA 3VG0L 3CPLA 1V7MH 3MGOB 3WFDH 5I8OH 3MO1B 4P2RE 2YN5A 4LSPL 3CU1A 4MCYA 4HDIA 1AQKH 2DWDB 4GKSA 5J4MA 4FNLH 1D9KD 4DCQA 2OBGA 4P5TD 4LIQE 5IK3B 1P6AB 1MWAH 1MF2H 2YD6A 4D0DA 2Z91A 5ENWA 3A67L 3U9PL 4YFLI 2NXZB 4ZUWA 2CXGA 1MFCL 3AUVA 4XCCL 2NY1C 3HB3D 4GT7A 1MHEB 2BNUA 3O2WL 1NCCL 4K3JH 3P0VH 3E3QC 1R5VA 1DQQA 3P2TA 4HXBH 4XPAH 4P57A 5JOPE 2QQLL 5I1EL 3LKRA 2VLRD 1OTUD 1NFIB 2YPLD 4ELMB 1P7KB 3UTTA 3RDTC 4X9HA 5ANMA 5C07D 3AGVA 4CN6A 5JPMB 3VXMD 2HVJA 4LBEA 4JFPB 4Y89A 4TPRL 4YHIB 3IRZA 4ERSH 5I1AB 2GAZA 4U1SB 1S5IH 1IAKB 4KKCD 3ROLB 4MHHG 4JZJB 2DJUA 3V4PL 1F13A 1UH2A 3QFJD 5BZDA 3ELAT 4ODHL 3C2SA 3EOBA 4FQ2H 5BO1L 3B4NA 1E6JL 3PUCA 3VCLB 2DQFA 4R26L 1TZGH 3P4MB 2P48B 4R3SB 4ALAH 3ARPA 2UY6A 4FMFA 2C3VA 5A40E 3DROA 1NAKH 3O0RH 1QBMH 2UWEF 4HF5H 4UIMA 5IMMB 4FTVA 2X9YA 1FDLL 4MWFB 4R3SA 3V5DB 4JKPH 4KQ3H 1CGUA 4DN4L 1JHKL 3PV6A 1ZGLB 3CFJA 4OB5H 1RJLB 2LU7A 1TJGL 5I6XC 1JPGB 4XCFH 2OI9B 1FL6B 3TN0A 1XIWB 4LNVA 4CVZA 1JI2A 1H0DA 3SCMD 1B3JA 3BPCB 3NFPB 3QNYA 3MLYL 4NQVB 1BD2E 1N8ZA 4NKOA 1JIBA 4XI5C 4LOUD 1GRWA 1QG3A 3MV7E 4YZFF 1TCRA 2CKBA 5JR1H 4OI7A 2YD3A 2CUHA 4YNYA 3Q1SL 5FUCE 1QBLL 3U0PB 2J12B 3EW3B 3EYUL 1BECA 5SX4H 3QQNA 5FDYA 5IROC 1KG0A 3MV7D 3DXAE 4IBLT 3O9WD 2AV1B 5IFHH 3NZHH 5T1DL 5ACZA 1X4XA 3QXUA 4O51A 1NBQA 1MAKA 1MRDH 4L4JA 3SDDB 2R0WH 4NN7C 4HIEB 4Y8DC 2VKXA 4LEOB 4ODTL 3HI1B 2EO9A 2PTTB 4W6YB 4LLUB 5ENWB 1OP9A 3B3IB 5K93A 3MCG1 4OCLC 2F15A 3SGKA 3BP5A 3BDBA 4RX4A 5F7HA 1ZA6A 1S7QB 3RAJH 4OLVL 2WWKT 5F7EL 1AGFA 2C1OB 5HDQL 2LQRA 1D5BB 2E7MA 3U0TA 3H9ZA 2OR9H 1MCPL 4IRSA 4KXZH 1DBML 2DWDA 5ITBH 2WAHA 4JRYD 3PWNB 2VQ1A 1YNKL 4O2EB 4X4XB 4PGCA 5K33A 1V7NL 1ZLVH 4GMTH 5HYJB 3KXFA 4MX7A 1TIUA 4DQOH 1FQ9C 4WUUD 1Z6JT 3B5TA 3L3DA 4XVJH 2VQ1B 1NCBH 4F7MA 3UJIH 4NRYB 1WBYB 3QIWB 1G9MH 2BVOA 4AT6B 2CRMA 5FYJD 1EERB 3FN3A 5FHBL 1G6RB 3MFGB 2BVEA 4Y5XC 1C8PA 1DBJL 1YEFL 3UC0H 5I71B 1AY1L 3T0EB 2PYFA 2BVOB 4AT6A 2X4QB 4WFHE 4WTZA 4XBPA 2OLDA 2VIRA 4KTEH 2W9EH 4XWOD 1NCUA 1TVBA 3MGTB 4U1GB 1IQWL 3LKQB 1U8JA 4WW1B 4JB9L 3X3FH 3UYRH 3NCYP 3S4SB 4Z7VA 1MFEL 2BVUA 1RZ8B 2WM0A 1H5BA 5DGQA 1S9WA 3P4LA 1JNJA 3DSNA 1UG9A 2X40A 3WDIA 1UWXH 2EDEA 4JQXC 4XNUH 4NRZB 4RWYH 3T2NL 4JO2L 3PWUA 3STLA 3REWB 1AI1H 2VSDA 3MOBL 3QIUD 4DGYL 5JXAH 1BJ1H 1JRHI 4GXVH 4NZUH 1XGRB 4UU9A 4B5EA 3O3BB 4ZTPH 3C60C 1NGQL 1T22A 3V4VL 2D2OA 3WNPA 4PB9H 5HVFB 5HGGS 1F02I 1UJ3A 3QDAA 1FSKB 5JIIA 4KKAC 1IZJA 4LRNH 5DUBA 4QLRA 2PXYD 3O6FD 3K3QA 2Z92A 1T04B 5GRJL 2WIIB 5F6IC 4O58L 4HX1A 4X4YA 1GC1H 4J4PD 2VXQL 3QR2A 4E41D 2DLGA 2R15A 1MI5E 1Q0YH 3S37L 3SE4C 1V3KA 1XGPA 2BY0A 2W65A 4DW2L 3SHSA 8CGTA 1DQDH 2IBGA 4A2MA 3V0VA 5C0FB 4UQ3A 5DD1H 3G6DH 1RIUH 4MSWA 3BE1L 3RVWD 2B1HL 2RB8A 1EEQA 3L3HA 5BXFB 3O6ML 3WJJC 4ODUB 3NCFB 3N85H 4IRZL 1F6FB 2XWJA 3CJJA 1GGYA 4C59B 5B39B 4YFLF 1F6LL 1IM9D 2A6IA 5DMIH 5I15L 3O3UN 5JHLL 4P57B 3IFNH 3U36A 3ULVL 5CAYB 2OL3H 4LCWA 3IFPB 3W2DH 1P9MA 3KVQA 2W60B 1DUZB 1RZGB 4LLWB 1U3YA 3MRQB 4JPKL 2DLFH 4RAUA 3RPIB 3S35X 5DJ8B 5ITFA 1F3JA 1I7ZB 2VNCA 4GQPH 4YXLH 3RJQB 3LEXB 1VKXB 4D3CL 1YYLL 5CP3H 3CXHJ 3K46A 4F7MB 2AKRA 1SJXA 3IKKA 5IHUL 3HPLB 4LHUG 3KR3H 4N0FA 3MV8E 4MWFA 1SYSA 3RU8H 3T8XB 2ADIB 1DN2A 1FIEA 4RAVA 3QHFH 2GCYA 3BGAA 1MVFA 4NCDA 4JLRB 2CPCA 2DI9A 5EWIH 4AG4L 2R0ZH 4BQBA 3FFDA 4QOKD 2Y5TB 4KUZH 1N26A 5FCUL 3K2UH 4J4PC 4FFZL 3QJFA 4PRBA 3SY0A 3D0VA 4DKFL 3LHPH 1W72H 2XTJE 4KTDH 3SCMA 4GG8B 4FFVD 1JGVL 3SE4A 1MUJA 5JA9A 1H8SA 2CGRH 35C8H 4EI5B 5D96B 5E56A 3LN5A 3VFNA 1A6AB 1GOHA 5CZKA 1I4FA 4MNHA 1C1EL 3OBAA 1FNHA 5DUMH 5I18L 4R4FL 2GTWB 1RZKC 3D2UA 1G7MB 4LNRB 5K9OA 3D18A 1MI5B 2X4OB 1KEML 5TFSL 1Q9WB 3N9GH 2OSLA 3QB7C 3V95A 1AKJD 3LEYL 3MRIA 4R7DB 5J57B 4HIEA 3O6KL 3RBGA 2QHRH 3WNOA 1OAKL 3EYQC 1BWMA 1MCRA 1UH4A 5I30H 4FQCH 3WNMA 2Q1EA 3ROOA 3WFHA 4E41E 1OQOA 3MR9A 1YEDA 3UTQA 4BK4A 2IADA 4C83A 1FGVH 5GGRY 4WVRA 2BVYA 1A6VL 4PREB 1I85A 2LU4A 3EHBD 5C6TH 4NQCA 1J87A 4TRPL 2P8PB 3GMQB 2APXA 4WFEE 3RL1A 5E00B 1YEDB 3UTQB 1J8HD 5KJRH 4EUPA 1P4LA 4YO0A 3RPKA 1DQLH 3RTQA 2VR5A 3OZ9L 3O2DH 4Q6IB 4PLJD 4HJGB 1MFNA 1KN2L 5HHVH 2IMMA 3MUGB 1GXEA 5ADOL 2LFGA 1AGDB 3HZKA 3PQYA 5J13C 1YEEH 3ARGC 2XY2A 4G8EA 1HHGB 1PG7H 3MUGA 1JHKH 4N0UB 1TQBC 2FD6L 1DR9A 4OZGA 2F5BL 4X6CF 4CW1B 5J13B 5D1ZA 2CLZB 2XPGB 1I85C 4YHMH 1JGEA 3BIBX 1DCLA 3UJJL 3TBSB 4IMKA 1S78C 1HXMA 4G43B 3L3IA 4LCYB 1IAII 1KBGL 4J1UA 3WHXB 4KV5E 1RZ7L 4OGZA 4ZAKD 5JW3H 3L5WA 3PP4H 5IROA 1Q9KB 2V7HA 2Z35A 3P40A 5D1QC 4P99A 5BJTA 5D9SA 3VXME 3C09B 3ZSTA 3FFDB 3PWUB 1EXUB 3P9MB 4P3CL 4MQ7B 4WW1A 4MDJB 5F1OB 4PJ5A 5C0GB 2YPLA 4W4OA 4WEUD 1J0KA 2CRYA 3UYOD 1YN7B 4FP8H 3G5ZA 5I76A 3GMMA 4WV1B 4H1LG 3C6LC 1UB6A 4HC1A 3G5VA 4JHZA 4JREB 2UYLB 1CGWA 4LHQB 4F9PC 5DC9B 2HWZL 3T3PE 3FO0L 5KVFL 8FABB 3MYJB 3HZYB 4ZSOB 4XWOC 4KROB 3CFDA 4GG6E 2Y06H 3TV3L 4ETYA 3EYSL 4U7SA 5J89A 1HQRA 4FZEL 4LRIA 3MMEB 4WIQA 3SCMB 2P5EA 3IJHA 5J56B 2JKXA 1LEIA 3NA9H 4LLYB 3ARBD 2NTSP 4LKXB 2XQBH 5DUPH 4PJBF 2ILLA 1KJ2A 2LTQC 4BFEA 1B4JL 2C9AA 4QCIB 3LQAH 1KT2A 3LDBB 5D1QD 2D7QA 2PXYB 4FZ8H 2WQRA 3R0NA 3QUXB 2O5XH 3MACH 5C0BA 3FB8B 4POZC 3MV7B 4P2OC 5KTEH 1LO2L 3X14B 2E7CA 1FH5H 1EJ6A 5B3NA 1BIIA 4D94A 2IQAB 1BD2B 4OZIE 2QQQA 4KJWC 4Q97A 2EKSA 1CDBA 4QRRA 3V0VB 3SDDD 1X7QA 4UQ3B 2EXWD 4GW5B 4YHOH 3OWEA 2Y23A 1CIDA 5MERA 3DX8B 4IMKC 4MJ5B 2CRIA 3QA3B 3UJTL 3S36L 5CP3A 3WIIL 4LCWB 1EVUA 5EA0L 4M03A 3P0YL 2CSPA 1S9XB 4QHUA 3QG6A 1FNEB 3O6KH 2ZUSA 3O81A 2O5YL 2A6IB 2IPTL 2R4SL 3SKOB 1P7KA 1A5FH 3T08A 5HHXL 5E2WH 3TBWB 5C0BE 4OGYL 4PJHE 2CK0L 3ULSB 3QQ4B 4I4WB 4JFXB 1F2XK 3RGVB 7FABH 1F8TH 2WSKA 4IS6B 5DRZB 3U46A 4R2GD 4XP4L 2VLLB 3TBTB 2CDGA 2JELL 1Y18A 4WFGE 1U58A 3TVMC 1J18A 4M7KL 4YDLC 1U8IB 1EVTC 4M1GL 3LSOB 5F97E 1HE7A 1S78D 3WIFA 2XA8L 4IRJA 2AJVH 4RMTA 3TZVA 3KPPB 4XMPH 5IOPA 1IEAA 5ADPH 2XTLA 4PFEA 5IEHB 4AG4H 1H3UA 4NDMB 5FM4A 5CHNA 5ECJE 4EI6B 3W82A 5BV7B 3FO2B 4ELME 1QFHA 2X4SA 1FFOA 3LH2L 4EI6A 4P3WA 3HMXL 3GMLB 1N4XL 5C07E 5D7LA 1Y0LA 1A0QL 1JPFA 1JNNH 4QRPE 3LN9A 3QXWA 4LSRH 4WI5A 5GRXG 4N9GB 3D2UD 4FXKA 4G8GB 4JFFB 4HBQA 1DVFB 3O8XC 3SDDC 5SWZA 4F7EB 5C0RH 1PZ5A 5JDSB 3RUGF 4G80B 4N0RA 2VITB 5DI8A 3QO0A 2GEEA 3N1FC 5C09B 1EFXB 2HKFL 2P5WE 4OUOA 2YUVA 2ADGA 1QFWL 3VGBA 3ARDC 4WTXA 5JHLH 4K94L 3M45A 5FYKH 2VR9A 2WBJA 5F9JA 4WHDA 3L7EA 2GSIB 1NCTA 3N50A 3CVHA 1I8MA 3IJYA 3CDCA 1MOEA 4DN3L 4S2SA 5DJCB 5KZCD 3VA2C 5BZDB 2Z4QA 1JYNA 1RMFH 4FFYH 1NC4B 1HH6B 2OI9C 2P44B 4EUPB 3VW3L 3RTQB 3F8UB 1PZUB 1K5NB 3VGGA 1LEIB 2V5MA 3BP7B 2MHAA 5CEZD 4MNQB 4HUMB 3OKEB 4HPOH 5TGBB 1QSFB 1WC7A 3L9RB 4HK3N 4LLUA 3NTCL 3T1FA 5DUPL 4OCMC 5FFLA 5FYJL 5KVEH 1LILA 4L3EA 3DO7A 4ODXB 3PQYD 2D03H 2G5BA 5TDOB 1CICD 1B6DA 3TIDB 4UINH 2HFGL 4MNGE 3VFPA 4OV5A 1N6QL 3U79A 5KSAD 1FH5L 5L2KA 4K9EH 3DO7B 1OAYL 3QPQD 3L95A 1FAIL 2PR4L 5DJDB 1SJVA 3FZUC 4OTXL 4FZ8L 5IHLB 2HLFD 5I66B 3C5JA 1HHIB 4L4TB 1S7WB 4MJ5A 1U8PB 5INCA 2Q86B 4Y16D 4KJQC 1BGXL 1NGQH 5T1KB 3MBED 1KIPA 3IT8D 4HIIA 1NAMB 1FLTX 5IMKA 2P42B 1YC7A 4KJQD 5F1IB 1KJMA 5JIPA 1HDMA 5SX5K 2F5AL 2VZUA 5DD5L 3I02A 4IDJL 2I60L 4ZFFB 1O0VA 2F19H 3RDTB 1FYHB 5T1LB 3ULSA 2WLZA 3GSNB 1JGLL 4R97C 3QQ4A 1S9KC 2PN5A 1X5HA 4Z76A 4HQQL 3G5VB 2HWZH 3D85D 5ERWB 3S4SA 2PCPB 2Z35B 1OWRM 1KEGL 2H1PH 1FC2D 3NIGF 5BV7H 1CN4A 3RWCB 1HYSD 1JUFA 2YPLB 1ZXQA 5EC2A 2X89D 4XPHH 4FQLL 4QHLA 5I1IH 3PE9A 2F5BH 2FD6H 3O3DA 3B5HA 1EO5A 4LGPB 4YXHH 3R8QA 1PG7L 4MQTB 1KCUL 3MV8D 3QO0B 1EIBA 1HINL 1UXWB 2Y07H 5L8JB 1UWXK 1QA9B 1UM6L 3HZYA 3MYJA 4HGMA 3SDCD 4DKEL 4GRWB 1FFOB 2VC2L 3HG1B 2ZG1A 4P23C 2B4CC 4W4NA 3EYOA 1E4KA 5KOVC 5ADPL 4V1DA 3IDIB 2ESVD 2N7BA 2YXFA 1OSPH 1YY9C 4GRWF 4MCZB 1V7NH 5ANMB 3SKNB 3DUHA 4TRPH 4JJ5A 1NAMH 4UB0H 1TJHL 4M1GH 5IBUG 4OQTA 5ISZD 3C08H 4HS8H 4ONOA 3RVXC 3JTTB 5F8QC 3BIKA 3HMXH 3BXNA 2PTVA 4LARL 3AY4A 1H3PH 3CVIH 5H94A 2RFXB 2YRPA 4NM8L 4HS6A 1J10A 1KLUA 4KI5E 5LG1A 1DJSA 2AK4A 3QUMH 1S5HB 1T80A 2D4DA 1UKSA 5GSRB 1CLYH 1HIMH 3V0WH 2AJVL 3QWOA 2VDRH 1GGIH 4KY1H 3VXNB 2DQJH 4G8IB 1S9VA 3ULUD 4O9HL 5AEAA 1BD2D 5E1AA 2FDBP 2KUTA 3MV9A 3RIFF 3U2SB 4WU7B 1I1AB 2AVGA 1DBKH 5C0CA 1N0LA 3KPRE 4XCNA 4KKLD 2XTJC 2D7TL 3O0RL 4Y16A 1KOAA 2D9QB 3MV9B 5DEGA 2YPVL 3LAFA 4MDIA 4A2LA 1ZWIA 4N5ED 4L3EB 5KTEL 1A5FL 4NCC2 4P4KD 5JOFB 1IAIM 2G5BB 2QHRL 2Y5EA 1A1OB 3HRPA 3QDGB 4NSKB 4PRAB 4YDJB 5CINL 1YDPB 4NBYB 2HKHL 4OCRH 3V7MA 4QRUB 3QDJE 3ZE0F 1W0VA 4UT6L 3DI2B 2DF3A 2R2CA 4H0IA 4I0CC 3O4LD 12E8L 4LVNB 2ZUYA 2UWEA 3MGOA 3SN6N 4R4BB 1FPTH 4NQDE 2NX5E 5CILL 3OR6B 1F90L 3S5LG 2IANA 1BZQK 3TPUA 5KSBA 1KTDA 1A6WH 3OTTA 2AK1L 4U31A 4LVNC 4LL9A 5HVWA 3R8BB 2XG5A 4H1LB 2IANB 2OZ4A 4XNZC 3BH8A 5IR1B 3HCVB 4ODUA 5DS8B 5BO1H 2YBRA 4U1LA 1XT5A 4YEFA 1UXSB 4HAFA 4X9GA 5IJKA 1T7XA 4G80A 3KYMA 2VITA 3D3VD 3NIDF 3GSNA 2OTUA 4NJAL 4X5LA 3BYTA 4OCNC 2MCG1 5FM8A 1EMTL 4WJ5A 3L5XL 4NJ9L 4PB0L 3A6CH 4B50A 1WT5C 1HZHH 1I1YB 3UO1L 2CLRA 4JFYB 1TJHH 2NY0B 3TBVA 2QADC 3OKLA 5TE6H 4FFWD 5GGQL 5HYSG 1QNZL 2X44D 1KENH 2AJSL 1T1XA 2H1PL 3I50H 3H42H 4ZFZB 5AYQA 2EDFA 4XZUA 3KHQA 4OLWL 4HXBL 2L7JA 2VN4A 5EU6B 1NGYB 3SQOH 1NMCB 4J3WA 3QIBB 3SO5A 5HSFA 3I6KA 3MA9H 2YD5A 2OL3L 4LMQE 1P53A 4JQIL 3IKCB 2VDMH 4DKEH 5IVXB 4D0BB 4NYLA 4X6BB 2X09A 4L8DA 3UROR 4XC3H 4D8PB 5D2LA 1T2XA 5D5MF 5SV3A 3BKJL 2ICES 4D0BA 4F7TB 3OKNA 1E6OL 1ITBB 3O6LL 5GRJH 1FFNA 3Q0HA 1WF5A 4LSQL 4XAWH 4N0YL 4XWGL 5FGRA 4Z77A 3W11C 1XZ0A 3U1SL 3PV6B 2ARJA 4R0LB 4KMTL 1D5MA 4I3SH 4XNYH 3LQZB 1FFRA 2BRRL 5I66A 3P4OA 5IQ7H 3KPLB 1I9IL 4ODXA 4XCNB 5T33L 1BOGA 1QSEE 2R29H 3G6JE 2AV7B 3GNMH 4DGVH 2QSQA 4DW2H 4PRNB 1PLGH 4OCYL 4Q9CA 3FT2A 3PQYB 2VZ3A 3CSPA 2HFGH 2NPLX 3GK8H 5I8EB 5JXAL 5FAAA 5I0DA 1KC5L 3OGOE 4Y4KA 3ULUE 2AJYL 3HB3C 4Y5VC 1RU9H 4DAGH 4D9QD 1FG2A 1FL6A 3TN0B 4IM8A 2FX9H 2MPAH 3HI5H 2V5RA 3NFPA 5TDPA 5ALCL 2SEBB 4XBEL 1JF6A 1BIHA 1JPTH 4L29B 5T3ZH 1DE4A 4Q6YA 3NIFF 4NQXB 1EUTA 4R2GB 4U3HA 4JFEA 2P8LB 5J0BA 4PB9L 1JF1A 1L0QA 3AM8A 4K3HA 4PJBB 4WI6A 1MREH 2D9CA 1XGUB 5J11C 2AK4E 4LEXL 4GG6A 1AE6L 3G6JB 2CIKA 3TEUA 5KSAA 1B9ZA 1MIEH 5HGDA 4JQVC 4Z76B 4HWBL 1NL0L 1G9EA 3O3EA 3DETC 1ZANL 4ETQB 2A9NH 3OXRB 4XGZB 3IF1B 3PGCA 2GUOB 2V5TA 4PGEA 5A43C 4TQEH 2GITB 3AM8C 1JVKA 5C0RL 4DEPB 3SEPA 2B39A 1T6VN 3VFUB 1KEMH 3CFDB 5TFSH 2E7LA 4P9HC 2W9EL 4H88H 4QOKA 1FVEA 1P4BL 2E6QA 3OKKB 5DC4B 3FO9B 2ZCHL 5DK2A 4RMQA 1FNGB 4FQHA 3NN8B 2ARJQ 4JFFD 5HI3C 2VLRE 4S1QL 4UQ2A 1YEFH 3UC0L 1I9JH 4PGCB 2J6EH 3SOBL 5LVEA 3FO9A 3ZKMC 5C09D 5B3JE 5C07A 4S1SH 1FRGH 1WBXA 2WINA 3RY6A 5FGSA 1XGTA 1J1OL 3EIFA 5GGTL 3WN5A 2R2HB 5GS1C 3D39D 3MRCB 3KPQA 2EIEA 4X5XA 1Q9OA 1YPZE 4OZGE 5DEZA 2CKBL 4PJXF 4HW6A 4ZUVB 5KAQG 1G7QA 5EWIL 4EIGB 1BZ7A 1TVHA 5ISZB 4K3DH 4ORZC 3EDDA 3QIUB 4CMMA 3T0EA 2BVTA 3CCHB 4Y5YA 2EE6A 1IGCH 2GW5A 5I1HL 5C70A 1KCVH 2C3VB 3D87B 4LVOB 5IVXA 1M05A 4L8DB 4U7MA 1OGAD 2ZOLB 3IFLL 4EVNA 1XH3B 5BVPL 3DUUB 1IC7H 1S7XB 3LS4L 1S9WB 4G6ML 1UH3A 4JPKH 3W11D 5EU5B 1BJMA 5K9QG 1PX3A 3ZE0E 1I1AA 4R90H 3C6SB 2R1WA 4QEGA 4L8SB 1EGJH 5LAXB 1Y6KR 5JUEH 2EYRB 4YX2L 1WITA 1LGVA 4AL8H 1IGTB 4CVXB 2BOBB 2QSVA 5E8EA 4RGMC 1TPXC 5I15H 5J1AB 2CIIA 3IETB 2CR3A 3RZCC 2EO1A 1MCOH 5A1AA 1KB5L 1R5WB 4M48L 5EB9A 2X9WA 4PGDB 4XXCA 4DJMA 1N3NA 5I73C 5E9DE 2DAVA 2C4FT 4HMEA 1A2YA 4CVZB 1LO3L 2AJ3A 3CZFB 3T0WA 2NY4D 3HUJA 4LRNL 3C8KB 4NO0B 1I8LC 4JGUA 2DQCL 3JTSA 5T3ZD 3GI8L 2R2BB 3KPRB 5HPOA 2E7LC 4Z5RB 2BOCA 2QADD 1WAAE 3LD8B 3WIIH 4GBXC 2FEDD 5C0JA 2RR3A 4NDMA 1BBJA 1MJ8L 5HHOB 4OQTL 5DJ6A 1KTDB 4DN4H 1LP9B 3D69A 3BDXA 4PTTA 1L9NA 1ZVSA 1UC6A 2V17H 2HG5A 4K2UL 4X6CB 4XBGB 1OP3H 4IJ3C 1RZKH 1A6UL 3H9SD 1GC1L 2LV4A 1HHJA 1PKOA 1WSST 3K4DA 1RHFA 5D72H 3V2AR 4ALAL 4MSWB 4AIOA 4EN3D 3RL1B 1OD7A 4HAGA 2C1OA 1D6VH 2VUOA 5F1SA 2B7DT 3SKJH 4DWHA 4PJCA 5I1KL 5MENE 5EDXA 4TULL 2XWJB 1AXTH 4AENB 2PTTA 3HZVA 3TBWA 2IFFH 3JBG7 1WZKA 2WUCH 3CH1A 4X6EB 3TCXA 1H15B 4M6AA 3VD4A 5JOEA 5DFVC 1QLRB 1TENA 3UO1H 3IKCA 1HZHL 1XGTB 1HEZB 3MLSH 4P46D 4N0UA 3JV5A 1I8KA 3TT1L 5KOMC 1NEZB 5E24E 1E27B 4QOKB 2FWOB 2ITDA 1FFNB 2YKLL 4XVTL 1CTNA 1G0XA 4N0FB 1VFOA 2DMKA 2A74B 2FZ3B 5FECB 5DJ8A 4JY5H 4Z7NF 4NRYA 5I73B 3QZWB 2DKUA 1KNOA 1VFAB 1P1ZB 5ACMA 3NIGE 3KJ4B 1ZGLA 3I6LE 4F3FB 4KKLC 2HFTA 1RJLA 2YZ1A 1MFDH 1F58L 4Z78B 1YY9D 4Q9RH 3AXLB 4QGYA 4ZQKB 4LLVB 3GMPB 1CBVL 1S9YB 4P5KB 5C0BD 4Q7DA 1BFOA 5B8CA 4TVSa 4ZQKA 3LKQA 1A7OH 1XCTB 1AC0A 3NCYS 1KYOK 4MLSA 1FC1A 1VFBB 4P59L 5I17A 3VXUD 3NACL 5TF1L 2X4TB 1JZ3A 1GJIA 4TOYL 3BPNB 4KC3B 3T4YB 2YA0A 3SDXE 1M05B 4DQOL 1T5WB 2VXVL 3VFMB 5EPMB 1CGTA 3HZMB 4H8WC 2YSSB 1JWSB 3C6LB 1NBVH 3KHOA 3NZHL 5T1DH 4DOHB 4O51B 1LO5A 1PQZB 1Z9LA 5E5UB 1GGCH 3U83A 3ZMRA 5HVGB 3Q1SH 3H9HB 1J8HB 5IBLD 2A73B 1SMOA 1T0MA 3BW9A 2IGFH 3RGVC 1RV6X 3O4LB 4QCIA 3MCLH 3OMZA 1AGBA 1IBGL 3OF6A 2VL5A 4G6MH 1CE6B 3I85A 3LS4H 5T3ZE 4UTAL 4E41A 9CGTA 1CVSC 1XGUA 5BS0D 2YD1A 1MLCA 3VXPA 5E4EB 3VGDA 3SO3B 3BOVA 1FHGA 2BHZA 5CBAB 5I8CA 3HC4H 3BAEL 4YHKH 3VGAC 3IFOB 5DHYB 1I1FA 4M7LH 1I7TB 4RNRB 1RZFL 5A3IC 3MXWL 5GPRA 3BKCL 1D9KB 4MD4B 3O45B 4I48A 1G1YA 3ECBA 3FOMA 2J3SA 3J8F7 4PV9A 3H3KA 1I7TA 3QFJE 4WEMB 3RHWK 2HJKA 1QBML 1NAKL 4KK8C 3VGHA 1EV2E 1YMME 4OLZH 2OL3B 4GBXA 4U3CA 4L5FH 5SWSA 3C5JB 1A7NH 4RDQG 1Q1JH 1S7WA 2UZIL 5AZEL 4Y4HC 5H37G 4AIXA 2G75B 4JPVH 1C5CH 3EJYC 5GXBB 2EYSA 3GSXB 2LAAA 3QXAA 4OFYA 4UAOB 1QEWA 1TJGH 3ZYOA 3AS2A 4ONGH 2WZPD 2GJ6A 2F58L 2EDJA 1OAXH 3RPIA 2QEJA 5C09E 3CFBB 1FL3B 1TZHA 1F58H 2R8SL 4XI5D 1S7SB 1JWMA 3RWJA 4K7PH 2GSGA 4U1IB 4S10A 1KJ2H 1JZ2A 4FG6C 3THMH 1YEGL 2C26A 5E0QA 4R2GC 4YDIL 4OF8A 3W0WD 1YNTA 3ESVF 1TZGL 2P45B 4YHPB 4HBCH 4QOKE 1AHWB 1VCAA 4JRXB 5SWQA 5CGMA 4OF3A 2K3TA 4U6YB 2FEDC 3PL6B 5AAMA 1MIML 4JFHD 3VWJB 5CJXC 4A6YB 4ORGB 2JCCA 1AP2A 2R23A 1JV5A 4K3GA 5EO9B 3KYNA 2VJXA 4MYWB 1EFXD 5IGXH 1UCBL 3MJ8B 4X99A 4B41A 1CICC 2FL5B 3VCLA 4ORGA 1ZT1B 3GIZL 1GYAA 1VFAA 4DZBA 1UKTA 2NY3B 3BMWA 5MENB 1MCWW 4I18A 1EK3A 3ARDA 3MJ9L 2ORBL 5DD3L 2FJFB 1JCKA 1N3NB 5JW4N 4JDZA 3KPSD 5JZ7D 2EEDA 1LO4L 4LOUC 5KZCB 5MEQA 2EIZA 1IGJA 2RIKA 5DZLA 3IYLW 1F4WH 1X5LA 5TQ2L 1FAIH 4Z7OF 4GG8A 5E8EB 1MH5B 1KT2B 3FKUS 3S7GA 1QLEL 1N6QH 1AHWC 3MNWB 5ESAA 4OBSA 4XPFH 4PJHB 2B2XL 4JKMA 2AQ1A 4G7YL 1A6UH 2D03L 4PJGF 4RGNE 5F44A 4F8QA 3LIZH 5FOBA 3NIDE 2HTKC 4GS7C 1BQSA 2FIKA 4XMLH 1NUGA 3VI3F 3QG7L 1OM3L 1GOFA 1G7MA 4LNRA 3BVNB 5EOCL 5GGRB 1I9IH 5E4IA 4G7YH 3IXAA 1EPFA 4OFDA 5H2BB 2ZKHL 1Q9WA 3OHXA 5L2JB 1MJUL 3NGBB 5FO8B 1MHPH 3TIEA 4G8IA 1RMFL 2AEQH 3RNQA 5DJAA 3K74B 3ARUA 5I75B 2AP2A 5DD1L 1F4WL 3OPZL 4X7SL 1A6ZB 3CH1B 4X6EA 5EZOL 3ARED 2D31A 3RY5A 1SEQH 3SGKC 5AUMA 3O3AB 4M48H 1N5YH 3SPVB 3MA7B 1S7UB 4LSUH 3LN4A 2DD8H 2HFFA 3GZKA 1H3WM 4K94H 3WDJA 1KIUA 3CZJA 5CBAA 1T2QH 1A7RL 5I9QB 1YEJL 1ZHBB 5FO7B 4UT7H 3RWGB 3DVNB 2O26U 4HG4K 5D2LE 2B4CH 5GISH 4JRYB 3IDXL 1UCBH 4U33A 1HCVA 3IAQA 4CW1A 5D7SH 5IW1B 4P9ML 1T1XB 1A7PL 2AKRB 1SEBA 4F9LC 4JAMA 4P0DA 1YPZF 3MRHA 4Z7VF 1UZ8A 1BOYA 2HT2C 3RX5A 1PEZA 2CLVB 1V3LA 2HVKA 2JJTC 4JZJA 2HRPL 6FABL 3TJHD 5C2BH 1B0GA 1HDMB 3BO8B 3MFFA 5E2UH 1IKFH 1YPZB 3WHXA 2A74A 5CSBA 5KAQF 1NFDE 2OTWA 4I3GA 4WEBH 4H5SA 4KXZI 5F96L 3WEXB 3SGEI 4PJDE 3HE6A 5EOTA 3OAYK 4CL7A 1F4YH 5DJZA 1BVKA 4TSCH 1TJIL 2PCPA 5I17B 5FV2A 2PYEB 4PJ5D 3S96A 4YBLC 1T1WA 1FFPB 2B1AH 3KPLA 1K4CB 4JPVL 4JG0H 1SBSL 4P5KA 5AZEH 1BFOB 5B8CB 1V3MA 4KFZC 1OGTA 3UPRB 2APBA 3WV0A 1RJCA 1ZS8A 5D7IB 1I8IA 3ILPA 4MGXA 5CGYD 4KKBD 5CJXA 3TNNB 4F37F 1AP2B 2YEZB 4CN4A 5BRZA 1KLGB 5MP6L 4ODVL 3L5HA 1VADA 4L8CB 5T3XD 1CLZH 3KS0J 3P9LB 2H41A 1SYVA 2GJZA 4QXTA 1A7NL 4U1JA 5F89B 4XCYA 2Z4QB 4P4RA 2YA1A 2E27H 2WWMD 4AH2B 3MOAL 4P4KA 5GGRA 4NUGH 1KPUB 2KZ1B 4WCYL 3OV6A 2IGFL 1GIGH 5HDLA 5D1ZC 1CI5A 5GS0H 1MH5A 2LVEA 4M7LL 5I71C 5HD8D 5JLZB 3DRQA 2GK2A 5DVKA 1A9BB 4BYHA 3MACL 4XGZA 4P5TC 2Q76B 4KKNA 4LPWA 5BRZE 1T7ZA 5TGBA 1AH1A 3AMKA 5GS1B 2C7UA 4Y2DD 3AB0C 2R0WL 4YLQT 4OZHA 5JQ6L 3ECBB 3OL2A 1RJYA 1FN4A 4MJ6B 1JGEB 5CD5D 1HOCA 1U8MB 3MJ9A 4FZEH 1OL0A 1RUKH 1VHPA 5EU4A 5GS3A 4HS8L 4KI5C 4MA7H 4ZPTA 3I3BA 2JJVA 3B9VA 5L2KB 5IFAL 2R69L 1DLFH 4F7CB 1ZLSL 4OCXL 5J9PA 1UA6L 4NQTA 4DGVL 1DFBH 4JDVA 4PJEA 3ARGA 2SEBA 1DDHB 1MQKL 5F6IB 3KLHD 3PG2A 3DMMB 1WWBX 2GHWB 4EDWL 3S9DB 5FKAA 2IFGA 5ICZB 3T4AA 2A77H 1B2WL 1JF1B 4OJFL 4PJBA 1TETH 3PL6A 3C87A 4IRSD 1FSKC 2R9HC 4HIHA 1G7QB 2GSGB 3RRQA 5F7FA 1RAMA 3QRFM 3TZVD 1DN0B 3NCBB 1LQSR 3BQUC 5EU6E 4JN1H 3HRZB 4MXWH 5EU7E 1IGFH 1TPXB 4JM2A 1BFTA 3GJFB 1ZVYA 1P2CA 1EBPA 1I7UB 3I2CL 5IG7A 4HUWB 4YHLH 3FFCD 4P46A 4CADA 3E8UH 4I5BB 1E6JH 3DUUA 4WO4C 5IT2L 2HTKD 1NMBH 4Z7UF 3KDMB 2Z8WC 3KWWA 4G9FB 4G42A 3O3BA 5I1KH 3KLSA 1MFCH 2R39A 4L8CA 1XR8B 1CLOH 4A6YL 3TWCH 4GW1B 5DJYA 5D1XB 3GKWL 3L5XH 2G2RA 1Y0LB 4G9DB 4Y19E 4GW1A 3UPRA 3VG9C 1MCDA 3G5XB 3OX8A 3S35H 2DQTH 1EAJA 3ULUC 3QO1B 1OCWL 1X5YA 4F58H 3RIAF 3O6FC 2F53B 4KVNH 1L6ZA 1EFXA 3DVIA 4QRTB 1WBZA 2NX5B 4OZFH 1G7PA 3O2WH 4P2RA 5F3BA 5SX4I 5C86A 1MJUH 1BQHG 4U6XB 4H20L 5DA4A 3A0OA 3CUPA 1FGVL 1AFVL 1F90H 1IL1A 3OKEA 5J12C 4M43L 5DSCA 3JSSA 3QCTL 3TA3C 3QDGE 5FF6A 1HHJB 5F70A 5DJCA 3W5NA 3GJFH 1S5HA 2WQ8A 4L3EE 3U30C 5H35A 1J1PL 3VFSB 1OTSD 3VMPA 1U42A 3ESUF 1NMCC 2ZJSL 3U4BH 1KB5B 3C5ZB 1W2KT 2E9IA 3QEGL 2VABA 3BEVA 3G6AB 5C0AB 3UPAA 2AV7A 4JAMB 1PYWA 1IGTA 1FFQA 1INDH 1T83A 4F57L 2FH8A 2GTZB 2GYSA 2NMSA 2NY1B 3MBXH 4XMKL 3WD5H 3RWGA 2CH8A 2NXZC 4CKVX 5GS1A 5DD0H 1QFWH 3EJYD 5J6GB 3G08A 4I0PD 2RCSL 2VLLA 3LZFH 3QDGA 4PRAA 2EKJA 1YQVL 4U6VL 4JQVA 3CU7A 1QFOA 4G5ZH 1CXKA 4E0RA 1IILE 1CK0H 1X4ZA 3ARFB 1JNNL 1L0YA 4QWWC 5HXMA 4PJ8B 2NW3A 5A3ID 1J05A 2GJ6E 3JV0A 4F7PB 3NH7H 4Q0XH 3W0WB 2R2EB 4GAGH 1K8DB 3VDBA 5F1KC 4CADB 1JFQL 2ZSWA 4XH2A 3QSKB 4QXWA 3JWDH 3QJFB 4OF7A 4EKXA 1UEMA 4ZYKB 4F7PA 4Y19A 5B21A 1CIUA 3S6CA 3SJVD 2OK0L 4B0MM 2F74B 4XH2B 2DLTA 1CR9H 2WP3T 1QR1A 1JRHL 3QEQD 3K80A 1DN0A 1SBBA 3MBEC 2KBGA 5KSAC 3HLAA 1S7TA 5GJTH 4HKZB 1KPVA 4BZYA 5L0QB 1KJ3L 1UENA 5CMAA 5GS2H 3ALXA 1PG7X 3FN9A 1U8LA 3I75B 2I26N 2VDQL 3D0LB 2YD7A 4M7KH 2YD9A 1TLKA 2BK8A 4N8VB 1RUPH 4G8GD 2P24B 1NLBH 4GOSA 3QUKA 1WK0A 4PJEE 1JHLL 4APQC 2ZUTA 3H3BC 3H0TB 4J2XA 3CLFL 1PEWA 3PWJB 4YUEL 2Y7QB 4XTRC 3WFEH 1T0MB 1YMMD 4V2CB 3BZ4A 5C0DB 5BV7L 1ADQL 2FO4B 5GGTA 4X9IA 3PWJA 5JHDB 2LTQB 1B0RA 5A2LH 2X7LB 3IDYB 5FK9A 1Z3GH 4KZDH 3ZHDA 2BSTB 5C6WH 1UJ3C 4OV6F 5LWYL 3SCMC 2J8UA 2OP4L 4LAQL 1IBGH 3F12A 2XRAL 2PO6B 1QSFA 3L9RA 3T1FB 3FQNB 2M1KA 4G8FB 1MIEL 4RZCA 3OKOA 2H6PB 2BSTA 1KB5A 5F88A 5DRNB 2J8UB 4LCIH 4TSBH 3BP6A 4HK3J 2H2PC 1BIIB 3BZDA 4QXUL 4QRRE 3PDDA 3G04A 3MXVL 4PUBH 3AC0A 2Z8SA 1UQSB 1KXTB 4F57H 1D5IL 2X9XA 4GAJH 2D7OA 3Q5TA 5EU5A 4YXKH 2EYSB 1QFPA 4LPXA 3WNLA 4N9OB 3VFOB 4TOYH 5TF1H 3GSXA 4BQ8A 4HV8B 1LP9F 4CDHA 3GIVB 4JFZL 1H8NA 1QRNA 3U4EB 3PWPB 4MJIA 3EO9L 3MCKA 4PV8A 4PBXA 1IVLA 5EIIA 2P5EE 5FV1L 5L88H 2QLVB 3CLEH 1QRNB 4J1UB 3UX9B 2Z31C 2APWA 3F62A 3GJEA 3E6FA 2B2XH 5IFJA 4LCCC 2VTFA 3WLWC 1U58B 5LQBH 4ODSL 3O9WC 3U7AA 3CFCH 4KJPD 4OF5A 5GHWL 4H26B 3U4AA 2HJFB 2ZPKH 3GB7B 5CCKL 2YOCA 5C1MB 4M9PA 2MMXA 4QNPE 5IHBA 1NDMB 1FO0H 3G5ZB 4WGWB 4X80H 4CNIA 5DJ6B 5T3XL 2HJFA 3UPCA 3S5LB 5D4QA 1W0WA 2K1MA 4PD4J 5GJSH 4BH7B 1NGZB 4ZUWB 2AJZA 4P46B 2QQNH 2JIXA 3TT1H 2X4PA 1AGCA 5DK2B 1OB1B 1KLFA 1CDCA 5KN5A 2AABL 3NCJL 1T4KA 4HXAH 1JPST 3KNBB 4PJCE 4BZ1L 4M4PA 3IJSA 2XQYK 2VXTL 4U1HB 5E8OA 2JK5B 1MNUH 3FFCE 1T4KB 1MFAL 3BXNB 3K2MC 2VR4A 3BISA 3FRUB 3W0WE 2ED7A 3QEQB 5KS9A 4JHAH 3HMWH 4NWTL 3U36B 3IFPA 4TYUA 5EIQA 1RZGA 4PIRF 5CJOL 1HHHB 5IVZB 5CEYB 1NLDH 3RAJL 1NH6A 1CGXA 5FXCH 1VACA 1X5IA 4YHPA 5SWQB 5EUKB 3KS0H 1CFSA 1OAZL 3VFSA 3EOBB 1B4RA 5I2IB 4EXPX 1L7TL 1JV5B 4XHQA 1X7QB 2H2SC 4JN2A 3WKNA 3OAUH 4GW5A 2ED8A 5HI4D 5LXGH 5ESQA 5E5MB 4RQQB 4HZLB 4GRMB 5IHZB 2Y5TA 1XCQB 1IC1A 4LLDA 4LCCA 5ID1B 4NQCE 4TN9A 3JV4B 1MHCB 3QBTB 5E8DH 4CVXA 12E8H 1XH3A 4YFDB 3BP4A 1NCAH 3DX7A 4HKBB 4UT6H 2EIBA 2ZWLT 2K7QA 5DO2D 1N7MH 1RIVL 4R0LA 4UBDD 4XVSH 2I5YH 5BW7A 4MNHB 1D5MB 3BPLC 1QRKA 1OTTC 5EA0H 2BJMH 4NN6B 2CDGB 2HFEB 5GGSY 3QHZH 1RIVH 2XV6B 3DIFA 4M61B 3QDHA 1DEEA 3RUGE 1IZKA 1MRFH 1M1SA 1U2CA 1W8OA 4GKSB 4FG6D 3I3EA 4OZHF 3RI5F 3VD9A 5TQ0H 2DQDL 1KIPB 1SJHB 4PTTB 4NM4H 1F4XH 3ZO0A 1R3JA 1QYGL 4PRPD 3Q6GL 4Y19B 1QSZA 4X7DC 5L2JA 1W72L 4J23A 5LJYH 3PWPA 2XZCH 2O5XL 3MODH 3QXDA 3V8OA 2HT4C 5DJZB 3V0WL 3DGGB 3QUYC 2DDQH 4ZTOH 2Q6WA 3V6ZB 3V4PH 2X6MA 4ELMF 1FLRH 2PW1A 3BSZL 3BGFB 1MNUL 3QHFL 3FQTB 3KPSE 4UOJA 5ACZB 4LCUB 4OLEA 2CLRB 1A3LL 5FA4A 2DQGL 3BJ91 4HKJB 4M02A 2E7BA 3ZDZF 1P4LB 4YO0B 4OGXH 3NCEB 4C55A 2XT1B 1A4KB 3QHTC 3FB6B 4EOWL 2E8ZA 1HINH 2J6EL 4WWKC 3SOBH 3F7YA 2VDPL 3ZE2E 3DHMA 3MRRB 1WVZA 3OXRA 1F4AA 4LPCA 4J6RL 4HIXL 2J7LA 3UTTB 5IIEB 3BD5A 4XPAL 3QUYB 4WUKH 1QHOA 2MCPL 2VLRB 5JHDA 2A9ML 1AGCB 5D8JL 3RTQC 4PTUA 3HNTL 1TNMA 1EEUA 3CVHB 4UUJB 4HQQH 4HJ0C 4GRLB 1I8KB 3KJ6L 2H8PB 1UWGL 3F7VB 3MUJA 2Q8BH 2A6KA 1IEHA 5HVHB 4FQLH 3MLXL 3QFJA 1LK2B 2V2WB 2Z31A 4DVBA 3MRKB 2FECL 1AQKL 5FYKE 3B6SA 4GQ9L 4QTIL 4NN6C 4P2OB 5FUCC 1HSBA 4M7ZB 1C7SA 3MLTA 3T65A 5HY9B 3AMLA 4OZIF 3S3SA 4YXKL 2F54A 3QUMA 1CDIA 3UTSA 1DQTA 3HR6A 1EAPA 4PRDA 1RZIB 5GHWH 4M7ZC 5IMLA 1A7PH 3LKSA 3MLUL 15C8L 3F7PC 5EORH 5FGCE 1RVFH 5E9DD 2Q8AL 2A1WH 1EO8L 3OKDA 3CXDH 5DD5H 1LE5B 4Y4FA 2AJUH 4KK5D 4WU5A 2QL1A 3X12B 5SWSE 4OZ4B 5EORL 1EH9A 2FX7H 1YEHL 4WU5B 1XCQA 4OCSL 4LDEB 4C56B 5KSBF 4QXTB 1U8HA 2FR4B 5DDHB 1ACYL 1MCEA 1MJ8H 4OTXH 3GRWL 2PR4H 2I27N 1X5JA 4XHJD 3SDCC 1BJ8A 3F58L 3RDTA 5F6HI 5BMFH 5CEZH 2H26A 5J3HD 1X5FA 3QI9B 3PWPD 2DLEA 5DZOA 1XGYL 1AXSA 4X9BA 4I2XE 4JY6A 1MRCL 5CEXB 3MLZL 4XAWL 2YC1A 4PY8J 5I8CB 2VWEC 2GUOA 1F5WA 3EZ8A 5FHAH 5C0JB 1U8NB 1WWWX 1UB5A 1IAIL 4UT9H 1R3LA 2GY5A 3OJDA 3TCLB 4YIQA 4FMKA 3BT2H 1T0NB 2CIKB 5I30L 4OLUL 4M6NH 2EC9T 2GJJA 2EICA 2VRAA 2NXYD 4PP1D 1T03H 3V5HB 4AL8L 3WFZA 4UNVA 5I1JH 3BGFC 2BZDA 4XC1H 2C7UB 3IVKA 4JB9H 4XRCA 1JMZA 4TVPH 4LASL 5TQ2H 2BP3A 5IESL 3I50L 4PJAE 4NQSB 2EE3A 3FN0H 4HIXH 4UZGA 2R0LH 2AGJL 1BQUA 4LFHG 3KYMB 4KUCD 3IFLH 1XR8A 4YZFE 1A0QH 1J7VR 4LK4A 4NQSA 1OY3B 5DQJB 3KXFB 3ARGB 4WFHD 1UWGH 3K8LA 3L3DB 3VDCA 1QLFB 1IAOA 4PJDB 3EJJX 2DQGH 1NBYA 4LLWA 1KFAL 5EUKA 5EFIB 1A4KA 4K94C 3KPMB 5IW1A 3SQBA 3QIWA 2ADFH 3FT4A 1QEWB 2D0FA 3VE0B 5IWLA 4N0CD 4KVCH 4BZ2L 1N2RB 3S4SG 2NY4C 3PGDB 4NQDA 2FATL 3ILQD 5DFWH 3MV8A 5AAWA 4Y0GA 2UWEE 3P30H 4WO4A 1MAML 4ZUVA 5HDBF 2FLRT 3MLTB 1BZ7B 1TVHB 1ZT7A 3B9KC 1P1ZA 4NNPH 5F8RC 5F7EH 1ZLUH 4LLDB 2BNQE 2AQ3A 4HKXA 4AIZA 4QRPA 2AEWA 3RVUC 4JM2C 4JRYE 3WXVL 5D2LB 2JF1A 5KANG 5D71L 4NCC1 4FTVD 4OUUB 4NPYA 2R0LL 3F7VA 3QNXB 4H88L 2FJHA 4AIZB 2DM3A 4GUPA 2AXFA 2BJML 1WAAA 4NOBA 1OP5H 4DVBB 3U2SA 4Z0XB 5JXEC 3FT3A 3VWJC 3UCRA 1FYTA 1Q38A 3BIAX 4WHTA 5GZOC 1Y6MR 3PL6C 4IMLB 1M7IB 1T03L 1QP1A 4UIMB 1NUDA 4PRIB 4WW2A 4Z7UA 3KLAA 3VFGH 2DQDH 2P46B 3GSVA 4KDWA 2OM5A 3ARDD 4NWUL 1HSAA 1X3DA 5IMLB 4DFHA 4NQEB 4PLOB 1UJ3B 1F6AB 5EO1A 3IETA 1WTGT 1PQZA 1BREA 3G9VA 4KKBC 4ZO8A 1SYVB 3QULA 3RKDC 3MV7A 3IXTA 5AG9A 1U8QA 1JBJA 1SM3L 4G6KH 2NY6D 2NY5C 2VLKA 2VDRL 3MREB 1G7PB 1NJ9A 3S37X 4E0RB 3JWOH 1LD9B 5EPMA 3S36H 3IJYB 2XICA 4TNWK 2YSSA 1IARB 3F5WB 3RWIA 4XBEH 3WUWG 3X11A 5FA4B 1Q9LA 4M6NL 1R3HA 4QT5B 4PJ9A 4P46C 1OPGH 5JO5B 3BH8B 5IR1A 5E8DL 2X1QA 4IOFD 1JNHB 1PGRB 2AXGB 3QPXH 3X11B 1AFVH 5IEKB 2Q6WB 1Q9LB 2Z91B 2A1WL 5D6CB 3EYSH 2CUMA 4JHAL 3PXJA 1S3KH 1LK3H 2CMRH 3DVNA 1KELL 1BPVA 4EBQL 2XIDA 1IM9A 1QACA 2X42A 3EGSA 1OSPL 4PREA 3TJHC 2VXVH 3OAZH 3FQRA 3C2AL 3E8UL 5DRWA 4YHLL 3S35L 3KLHC 4GXVL 3QDMA 2DJSA 2JJUA 1CDGA 2BVQB 1A7OL 5I74C 3AFLA 2FHFA 3OJVC 4TVPE 4KK9C 1SJEB 1QLRA 4LBEB 4LIQH 1JZ7A 3BFOA 3LRHA 3F7QA 3EO0B 2VO5A 4JRXE 4YHIA 4F7CA 3TWCL 2ZOKB 4Z0BL 1FZMB 4U1KB 4UV7L 3ZKND 5DC0A 1G9NL 2ZCKL 1IEAB 4MA3A 3SGEH 4FQXA 3HHRB 3HE6B 5EOTB 2NW3B 5E6IC 2B0SL 3X3FL 1VKXA 3T0EE 5IT2H 4F80A 4AEHL 3DSFH 2DQEH 1OP5K 3IDJA 4ZUUA 3HNVL 4O2FB 5BJTB 2V2WA 4KTEL 1Z9OA 3HA0A 3MRBB 1YPZA 5JOPD 4P2QD 5D7JC 1WCBA 1XF1A 1A4JB 3DTXB 5HD8C 2H6PA 2VDPH 3SJVE 1BP3B 4WY7L 1N2RA 2HJLA 2A6JB 3AU1A 1ERNA 3SGJC 2DI8A 3NAAH 5JORB 3CFJB 5DLMH 4ISVB 2BSED 5EZIH 4QXGH 2WWMC 4AEIH 4JDTH 3IDGA 4FQXC 4O5LH 1JNLL 3QDJD 4PY7B 4G7VL 4IOIA 3KJ4C 4M1CC 3VXOB 2VE6A 3BWAB 3HUJF 5DZNA 4HUNB 5CJ8A 1NPUA 3EUUA 3H9HA 4U1JB 5F89A 3TT3L 2A73A 3P0GB 2V9RA 2NX5D 2DOCA 2CKBB 4E9LA 1BLNA 2VLKD 3O6FA 5JXEA 4L8SA 2FBJL 2UV3A 3MROB 4JANA 5CP7B 2CJUL 2HN7A 5DMGC 1MCBA 3O6FB 4JO3L 4U49A 4K7PY 5SX5H 3VI3E 1J8HE 1OF2B 3MJ6A 3DXAD 4GRLC 3BRFA 5J06A 1WISA 3V5HA 4I0KA 3BIKB 2DQUH 3ALPA 5HDBE 4QRTA 3BN9C 5DYOA 4FQ1L 2Z92B 1INQA 3ZKMD 2WIIA 2FSEB 4LKXA 3LQMA 1QUNA 5DWUL 4CNIB 1QSFE 5HHOD 2IPKB 3PDOA 2KZWA 3BP5B 3JUYA 5BS0B 3HZKB 3EOAB 4L8BA 1AGFB 5E00A 3TC9A 5IF0B 3FB5B 4L9LA 1GIGL 1JHLH 4BSWB 3VFGL 1S7VB 3TLRA 2Q76A 1S7UA 4IJ3B 1V8HA 2VOTA 4KHXL 2Q86A 3MUY1 3LEYH 3RDTD 3CDFA 1PFCA 3RIAK 3JWOL 4M7JH 4UOW0 3MNVB 4KY1L 4HV8A 1OW0A 2GY7B 2J1KA 3KPOB 2IC2A 3VA6A 1F97A 3B43A 3NZ8A 1OLLA 4ZXBD 3O9WA 3QWQB 1KF9B 3WE6B 1UM5H 2EDDA 5JOFA 1LDPL 2Y4SA 5D5MB 5E2JA 4DUXA 1J1XH 3BUYA 4FA8A 1H15A 2XWTA 3ARGD 4U4BA 4K07A 4JFFE 4BUGA 3D25B 4RBPK 1ORQB 5IKCA 2Y6SD 3VWJA 5DJ0A 1T20A 4D3CH 4PJ7B 5GRUH 1KPRA 2XY1A 1AD9A 4KVCL 3VD3A 4PRHD 4KI1A 5FCUH 2GFBA 5HYQA 1NQBA 2R1XB 1NCDL 5ESQB 1P7QA 1ZA3A 2JB5H 5HGBA 1JRHH 1VDGA 1X5XA 4MVBC 4PRBB 5E5MA 3RU8L 4PJEF 3CC5A 3TO2B 1BVZA 1CL7H 1F00I 1NEZG 4NHUA 3ULVH 5L9DH 3VRIA 3STLB 1TZIA 1FL5B 1UXSA 3DRTB 4R9HA 4MB3A 4X4MA 3S97C 1MHCA 5IW3A 4EZMA 1EA9C 5EG6C 4Q0XL 4FTVB 1I9RL 3IDIA 4XCEA 1R24B 3FT3B 3V5DA 5I1IL 2FATH 4PG2A 4JVPA 4U1NA 1KIRA 1M7DB 4LASH 3QEGH 2I07B 4RFEB 3VRJB 5BQ7B 1I1YA 5EC1A 3BWUC 1GL4B 1LP9E 1VFMA 4RRPG 2AEIT 1HWGB 2BC4B 5IB5A 1LD9A 3VDAA 5D7KE 3D0LA 5IB4B 3T77A 2RQ8A 2ZKHH 5D5ME 4S1RL 1QFWI 1RIUL 5EOCH 3A67H 5JPMA 4UT7L 1F6AA 5EO1B 4F7EA 1NC2D 4H0GA 4P2RB 5F3BB 4JFPA 4QGTA 3CFIC 1WZ1H 3INUL 5FKPB 3GSRB 5JPNA 1QSVA 4LCWE 3MBXL 2I60H 4ZG1A 5IWLC 4Y88A 5T5FL 1KG0B 5EZOH 1I1AD 3RWDA 4APQD 1MREL 3WXWH 5C08A 2JE8A 1CFQA 4IIQB 2APFA 3V6ZA 3ZKNC 1ND0B 3OR7A 4TNVK 5GGVL 3UEZA 2N1KA 4NKDA 2RAMA 3DGCR 5EBWB 4JZJC 4G3YH 5ALCH 1DQML 1W72A 1IFHL 1XZ0B 2MPAL 2XQBL 4QHNA 3QCTH 5IW6B 5DVOA 1VPOH 4Y2DA 5BZWB 4BFBD 5DRZA 3U46B 3HTLX 1CF8H 4QWWD 4DGYH 4YDJA 15C8H 5M94B 1AO7E 4JVUA 3RX7A 5CEZE 2LE9A 5CEZL 5LWYH 1NANH 3CNKA 3MUHL 5IF0A 1I75A 2VAJA 3WUWA 1NMAL 43C9B 1BEYH 5GGUA 3BYYA 1A1MA 3VI4F 4Y4HD 5ID0A 1B88A 4WNQA 4D0CA 4PJ9D 3PP3H 4KMTH 4V1DE 3CDGB 1CG9A 1NGWB 2IH1B 4LQ1A 1T7YA 4N0YH 1ZHKB 2E3VA 3VJ6B 4X6FA 4I0PA 5IBTL 4YR6A 2O93L 3LQAC 5TE4L 1G6RA 2XXCB 4IRJD 3KAAA 3U0WL 5D9SB 1NEUA 5EZJA 2AEPL 1NLBL 2NY6C 4U1LB 2OJZH 5K9KB 4H5SB 4OKVA 3TYFA 2UUDK 1GVIA 3B9DA 1LNUB 4FABL 3RVWC 3MA9L 2FEEI 4K7FA 2X10A 3V6FA 4WJ5B 3VXMB 3BRDA 2YPKA 4IOIB 5HYSB 4WI8A 4Q58C 4XB8A 4KWUA 4HBCL 3QAZC 1MQKH 1WLHA 2AJSH 5I6XB 3SDAB 2DMCA 2VH5L 5EU3A 1XCTA 4OCXH 3EJZC 25C8H 3UJJH 1D6EB 3MZTA 4A6YA 4ISVA 1DBBL 4LRIC 4N8VA 32C2A 1LDPH 5IUSA 3JWDL 1ORSB 2IG2L 1U6AH 4JO1H 2ED9A 3T0ED 4NQDD 2FNBA 3PWNA 1PZ5B 2WNGA 4XP6L 5JDSA 4KQ4H 5DQDL 4EIZC 2GI7A 1A3LH 1DL7H 4U1HA 3D2UB 3EDJA 2JCCF 4G9DA 3ARBA 4N0UE 5IB2B 4KHXH 3RVUD 5E70A 4ZOEA 2IH3B 4WUKL 2BX5A 4G9FA 4ODTH 4ZUTB 5GRYA 2F8XC 1WBXB 1U9KA 3WFBL 1DBMH 2BMKA 3WYRA 3QUXA 6CGTA 2EDXA 4KRPD 1PKQE 4LGSB 1OGAB 1N5AA 4OLVH 4N90D 1KCRL 2HLAA 5DWUH 1T0NA 5B8CC 2X1XR 3I9GH 2YN3A 1ZEAL 1C5DA 4X0KA 2YXMA 2YD8A 3P4OB 4NZDA 1ZT4B 3RNKB 3G04B 4OGYH 5DJ2A 5E2WL 3LKSB 1QO3A 2X70B 4U0QB 2WLYA 1RUQL 4RRPA 3MNZA 4ZTOL 3HE7A 1CICA 2EH8H 4YC2B 3ULVF 3MLWH 5ICYA 1CLZL 4HUKB 2PTUA 1U91B 3FQNA 4HZLA 1CZ8L 1QSEB 1IGMH 2DLHA 1GHFH 5CZVH 5GRVK 5DQ9B 4LQFL 1SMAA 4RDQF 3OR7B 1U91A 3TBYB 2BSSA 3U4EA 4BQCA 4Y4HA 4MJIB 4I4WA 3VXSB 3DX7B 4IDLA 4PJ7F 3RZCA 4H8WL 3VRLE 3HAEB 2C3HA 4PRPB 1VEPA 2P8LA 3E0GA 4JZOA 4GFTB 4HCRA 3FQXB 4K8RD 2Z93A 3J7HA 3ARFC 4D9RD 3VFRA 2VQUA 1PYWB 2I5YL 2M2DA 4IRSC 2XN9A 5E6IA 2XFXB 4XP6H 4LLMB 3PJSB 1N7ML 4I1NB 5EZJB 4YHYB 3VFTB 1CFVH 3KYKH 3MJ7A 3IU3A 3ZKSD 5IQ9B 3NABL 25C8L 5H37H 4I9WE 1M71A 4WUUB 3UTZA 4AQ1B 1HN1A 1XF2A 3ES6B 4OZFG 5C0FA 1ONQB 1K4DB 2J88H 3UP1A 2B1AL 3LMJH 1CE1L 4OM0L 4EEEA 3KG5A 5ILTH 4JCMA 5CHNB 3JXAA 1MHEA 3JV6A 3IDYC 1C12B 3ZDYE 2GIYA 1KULA 3VXRE 3WO4C 4OT1L 3P77B 4YHNA 1A7QH 4GRLD 1UM6H 1HI6A 3QEUA 1WEJH 5EUOB 1NFIA 1JK8B 1ZTXL 4OM1H 3L3GA 3FB7A 1FZOA 1VGEH 2R56H 3SDXF 2ESVA 3SKMA 3UZQA 4MJ4A 2W0FB 5CSZA 2F9BT 3TFKC 2CR6A 4GKZA 4G8GA 4R4NC 1ES0A 4X5XB 2VWEE 3D3VE 3TNNA 4B7IA 5D2NC 5DFTA 4GLRH 3JWDC 5EU6A 3MRFA 1KPVB 4P2OD 4MD0B 5BCAA 1KLGA 2ESVB 3HE7C 3SKMB 3OKMB 4DKDC 2QJDA 4NQDB 1IAKA 1B2WH 5DTFA 2CXKA 4P3DB 4FOMA 2IPUG 3FTGA 4LHUD 3HUJE 3CVHH 3VXRA 4NKDB 4IHOA 3IDNB 3I2CH 4N5UA 2O5ZH 4PJIB 4WI2A 5DTFB 3GSUA 1VPOL 4O02L 3UAJD 3H7LA 2XZAH 2OJEB 5HPMA 4PJXB 1MY5A 3HPLA 4FNLL 4MA7L 4PJIA 2ADIA 4AYFA 2PO6A 1RK1B 1RUAH 4OQTH 4NZJA 5DK0B 1EHLH 1DANT 1YEEL 3QA3A 3QWOB 4XVUC 5E6ZA 4C4KO 3BPNC 2DBLH 5TF0A 3BN3B 3E1F1 3GBMH 4M9OA 1BGXH 1DP0A 5K59F 2XQYG 1RZIA 4YPJA 4YJZL 1M6OB 5T5NG 1SY6H 2D7PA 2V2XB 2B5IC 4KKCC 1NC2A 2P5ED 3F12B 3MRGB 1TITA 4I2XB 4CDGC 1GH7A 3DXAA 3V4VH 1WZ1L 1MJJA 1KIQB 1AQDB 5IFAH 4Z7WF 3MRLA 1HKFA 4HCRL 3OJ2C 2Y36H 5FB8B 1N59B 4P2CG 4E5XB 1S8DA 4PJFB 5T1LA 1X5AA 1RUQH 4ONHB 5I1GH 1P5VA 4L1HA 3S88L 4Y4HB 1FCGA 2DQIH 1KV3A 4XP5L 3E6FB 3GMNB 5J6HA 3GSQA 3QI9A 5EUOF 2ORBH 5DD3H 3TVMD 4PUBL 3T0DA 3C5ZC 3D85A 3VXUE 1A1NB 3N9GL 2F74A 4FHBD 2LAGB 1U0QA 3WFHB 3EDKA 4POUB 4LCIL 5L9DL 1T1YB 3NPZB 3U30B 3QT2A 1BVLB 2KQNA 5EC2B 1XF3B 5A16B 4YGAB 2YR3A 4NN5C 3GHBH 4PGZA 3VGAB 5CSGA 4K3EL 5JORA 3SO3C 1CQKA 3T09A 2RBLA 4HEPG 2ZUXA 5DT1H 1H3XA 4QRPD 5GSVA 3CSYA 5HJ3A 5KANI 5IB2A 4TQEL 4JM4H 2DM7A 1J1OH 5GGTH 2UY7A 4U05A 3VWKA 1ADQH 3PP3K 4G9FD 4YDIH 3RVTD 1U6AL 4JO1L 4YK4B 4RMWA 4Z95L 3VH8G 2A83B 2BVPB 2ZCLL 3VG9B 1EEZB 3HI6H 1FGNL 5F7NC 1LDSA 3LS5H 5D1ZB 4LHUA 3MLRL 3LD8C 1P7QD 1RZFH 1NDGA 2E9JA 4KTYA 1XF5A 5IVZA 5CEYA 3QIBA 2RFXA 4BFIA 3QEUB 1KPUA 3P4MA 3V6OC 3VFVB 2DICA 5DJ2B 5F9WC 4NNYB 5GJTL 1D3CA 4Z8FH 4JJ5B 4N8VG 4L5FL 3KPNB 1ZMYA 3X13A 1YQVH 2A2QT 3HE7D 3GHBL 5IP4A 4I3RL 7CGTA 2OK0H 2GQHA 4JN2B 2DN7A 5F96H 2UZXB 5DJXA 1FZKB 4MAYB 1NL0H 2NYYD 2X4QA 4MB4A 1BD2A 5ETUB 1E28A 1X4YA 5D7JD 2Y25A 1F42A 3IS0X 4RZCB 4L4VD 5JMOC 4RA3A 4GAGL 3W81A 3BQUB 5FUOH 1INDL 1IC5L 2R29L 4BM7A 3OPZH 3HZMA 4P9HL 5IQ7L 3NCCB 3RVXD 1JWSA 3HPJB 4NO5A 1DZBA 1BQHA 4YQXL 3K81A 1U8KB 1D5XB 2FX9L 3R4DA 3BE1H 1LE9B 4MNQE 4Z7UE 4APQA 3DBXB 5B4MC 1HH9B 1UT9A 1OARL 2H26B 2ATKB 1I1RA 4OZIA 2EDNA 2FBOJ 4JGJA 5D2NA 4R4BA 3AREA 4Q9RL 4HF5L 4TUJA 4C57C 1NBVL 4XMKH 5DK3A 4XC3L 1YY8B 1A22B 5DDHA 4O02H 3GO1H 4MS8D 1PSKH 4N90E 4JQIH 3Q5YA 4NO3A 1QLEH 3JUZA 1KPRB 4O5LL 4MCYB 3FOLB 2VLKE 4K7PX 3SQOL 1JZ6A 3EYFB 4I3SL 4XNYL 1XGPB 2W65B 4RBPH 1OCWH 2DBLL 4F58L 4NC2B 3ZT5A 4HGWA 2C1PA 3ULUL 5GIRB 3ARFD 1EEYA 1LO4H 3HS0A 3JV6B 4LKCA 3IXAB 3MV11 4X4ZA 1P2CB 3MJ9H 3KNBA 1FNSL 5D70H 1P84J 4AJ0A 2BNRA 3TIEB 3GSOB 4YFEA 4M43H 1VGEL 3SGDI 1CXLA 3A6CL 3LIZL 5TE7H 2R2EA 5EO0A 1BBJB 1EMTH 3LRSB 4LSTL 2ZSWB 3DSFL 1A7QL 1FZJB 2EIDA 4JO2H 4NJAH 1YJDH 3MBEA 4PJGA 5GS0C 3FQRB 1FVEB 4TULH 2P49B 4KMLB 3HE6D 1NUFA 4GAYA 4X6DF 3EHBC 3LDBC 1NCCH 3VFWA 2R56L 1BBDH 4MJ2A 3VXRD 4RWHA 4LIQL 4JHBA 4F2MA 1DQJA 5HYIA 4RGMB 4OFIA 5KSBE 1RZKL 3L3JA 2AERT 4ZDHB 1SEBB 3WN5B 2ZOKA 4X98B 1C16B 1WICA 5HTSA 1AY1H 1WBZB 2NNAB 2NX5A 3A6BH 4TUOB 2VDKL 2EDOA 3T04D 2B5IB 1I8MB 1JGDA 4MHHI 4DKAA 5JXED 2DQFB 3ZHLA 1GZQB 2R1XA 1SYSB 4Y4FC 1CFQB 1LK3L 2CMRL 2J88L 4PTUB 2X05A 4XBPB 3WJLA 1E28B 1N0XL 1GGTA 3BP7A 1QYGH 1NKOA 1EUUA 4LVOC 3L6FB 3TH2T 3VH8A 2X7LA 1UYWL 1OT1A 1OSZB 3U7YL 4LHJB 2COQA 1INEL 1J1XL 1YYML 1VERA 5J1AA 3L6FA 1TCMA 3ETBF 2ZP0T 3T0AA 4KGJA 4G8FA 2R0KL 4I77H 1HNFA 2N56A 5INDB 1OOAA 1IC4L 4Y4KB 4O9HH 2HYMA 2FCBA 5JTWA 3C6SA 4PY7A 2W92A 3U9UB 4OFVA 4WFED 1IQDA 1ZOXA 2BFVL 4J3VA 4Z7UB 3MREA 5GRWA 1EJOH 5KSVA 4XXDB 1HNGA 3BPCA 1DFBL 3LN5B 4NQVA 1UA6H 3TF7C 3O8XD 4YGVA 2P8MB 3R1GL 4DUWA 5GS0D 1FVDB 2NY2C 1GGBH 5IMKB 1XF4A 1JGUL 2ZZUT 3C08L 3L3HB 3ARFA 5BXFA 3EYUH 4QRQA 1P84K 4LEOA 1TQBB 4WCYH 4C56A 4F15C 1MWAA 2BHUA 4PV8B 4PGJA 1ZHNB 4P5TA 5KVMC 2HAZA 1Q0XL 2CK2A 1GC1C 5DYOB 1LP9A 2ICWJ 3PGCB 3IFOA 5DHYA 5BVJA 4Q6IC 3WIHH 1ZEAH 1BVLA 2NXZD 3OXSA 1E4KC 4ODVH 1G7IB 3BESR 1IC4H 1D6EA 4QKXB 3QDMB 4HGWB 1W8NA 4P2YA 2BVQA 4FQIH 1EBAA 3HS0B 2LVCA 4PGEB 4JFYA 3ULVE 4AENA 1OAQH 1R3KB 4UQ2B 1P6FA 3NFNA 2GITA 1IM9B 3TO4D 4HMCA 1BAFL 4M8QB 4HFWA 3CIQA 4G7VH 5DRWB 2XPGA 1KEGH 5HYFA 4K71B 2A6KB 3GI9H 5FYJU 1CG9B 4JY5L 1U8PA 4NNXA 2Z31B 4HIJA 4KQ4L 5DQDH 4PJEB 4KU1A 2DTSA 2XACC 3X13B 3BZ4B 5C0DA 1KN4L 2Y07L 3L1OH 1JTPA 2VDKH 2EEAA 3QEQA 4CGTA 5SWZE 1GZQA 4BH8A 3JTTA 2X4RA 2AW2A 2VLJD 4M8VA 4XNQB 2YUZA 4RGNC 4Y1AB 5B38G 4MA8H 4OD3L 1YYLH 5GRZA 1X5KA 1YEIL 4XPBH 4X83A 2BRQA 4HS3B 3U82B 2VIRB 3CFCL 4F3FA 2OMBA 1I4FB 2WBJD 2XNAB 4NP4L 3HE7B 1U8OA 5HI4C 4KDTC 2OJZL 3CCHA 1WCBB 1F4YL 4Y5YB 2H2SD 5ETUA 3H2WA 1PW3A 4O4YL 2L0DA 2VE6B 3BWAA 4GO6B 1D5ZB 1U93B 4LP4A 2W9DL 5I1DB 4ZNCD 4MQ7A 3B83A 2JJTA 2EYRA 2FR4A 1S7RA 1GOGA 1FYTD 1RK0A 4P2RD 2H3NA 3EFFA 2DQHH 4PJFE 2H9GA 3ARBC 3UTPD 1FNFA 1IEBA 5FYJH 5M7QA 3NOIA 3FO1A 5DUBB 1HQRB 3NTCH 4LSSL 4GUPB 5CKGA 1DQMH 1AGEA 5DJYB 2IFFL 2H9GB 1DBAL 3O11A 1QSFD 4ZUTA 3ULUH 3FHQA 3WS3B 3T77B 1M7XA 4XWGH 1OAUL 4QRQB 1EEYB 4HDIB 5EOQL 1H3GA 3WFCH 4RNRA 3QEHB 3WS3A 2I9LB 4RGOL 1AXSB 5IV2B 1K8IB 3D9AH 3V52H 3DIFB 4PJCF 1D9KA 4MD4A 1Q0YL 3ARYA 5FYKL 4HD9A 2QQKL 4AMKL 2V17L 4K2UH 5H2BA 3GMOB 3DVGA 5BS0A 3HI1A 2CO6B 5C92A 3MYZA 1ZT4A 4XXDA 3TJEL 3FB5A 3LCYA 3QAZB 3VXTA 1UZ6E 4G6FD 5K59E 4UV4H 3MBEB 1INQB 1CD1A 5HHOA 2HT4D 5EN2B 3QDGD 3O4OB 3V6OE 3NFSH 3U1SH 2YD4A 5E4EC 3LPFA 3W39B 2ZUQC 3DYOA 1NBYB 3S34H 2D3VA 1J5OL 5T1LD 3HAEG 3B2VH 3ZLQC 5CD5C 5CUSH 1U3ZA 1BZ9B 1MCOL 2JK5A 2QTEA 2ZNWA 1Z5LA 4HUUA 3G6JF 2F53E 4Q6IA 2ESVE 1IM3A 4MAUL 2GAZB 4U1SA 3MRQA 5JW4M 1CXIA 3V7AE 1A47A 3ROLA 4HUUB 3WNKA 1KJ3H 1HHGA 4I3RH 3MRRA 5CD3A 4I13B 3WL9A 4P2QE 4OCWH 4PJ7A 4IOFC 4ZS6C 3PXHA 2BNQB 2BSRB 2VLJA 2VDOH 1J12A 4O2EA 4X4XA 5D1ZD 2IH1A 3VXRB 3PV7A 3QUZC 3WXVH 2UWEB 1LHZA 4MX7B 2NY5L 5FOJA 1YEIH 1IGIH 4UUJA 3SE9H 1AHWA 2P43B 4JRXA 1UVQB 5DMGD 1ZLVK 3H9YA 3NABH 3LKNB 1TZIB 3DRTA 4MXQC 4FN0A 3BZFB 3TYFB 4X9FA 1CFVL 3KYKL 2JCCE 3QZWA 4WUUE 4L8SC 1CXFA 1MIMH 5DHVH 5GS2D 1ZA3B 3KXFE 1T5XB 5CINH