4U05A

Homodimeric single domain antibody (sdab) against staphylococcal enterotoxin b (seb) s74a variant
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
130
structure length
130
Chain Sequence
b'MEVQLVESGGGLVQAGDSLRLSCTASGRTFSRAVMGWFRQAPGKEREFVAAISAAPGTAYYAFYADSVRGRFSIAADSAKNTVYLQMNSLKPEDTAVYYCAADLKMQVAAYMNQRSVDYWGQGTQVTVSS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Single Domain Antibody
publication title Structural and mutational analysis of a monomeric and dimeric form of a single domain antibody with implications for protein misfolding.
pubmed doi rcsb
source organism Lama glama
molecule tags Immune system
total genus 32
structure length 130
sequence length 130
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-07-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4u05A00
1QKZH 3LZFH 4QXUH 3ARFC 5TDOB 1YECL 2H3NB 3F58H 3T2NH 3O6FB 3T4YA 3QDMD 1U58A 3VXUA 3DXAD 5DJXA 3RRQA 3WN5B 3GJFB 4PJ5B 3S3SA 1JPFB 4ONHB 5FGBC 2I07B 5E9DB 4FFWD 4XRCA 4AG4L 3V4UL 5JOPE 5KVGH 1J5OL 5D1XB 4GXUM 4WO4C 3TN0D 2VDQL 1NBVH 3ARFB 1B0RB 3MRDB 5DWUL 4ZAKA 2C1OA 1D5MA 2Y06H 4MJIA 5IHLB 5HHMB 4BFIB 1S7WB 4DN3H 1OAUL 2JELL 4NCC2 3MJ8B 5BS0E 3PP3K 2AK1H 4GBXA 1JHKL 4HAGA 1UQSA 4X6EA 5GGSY 3FO0H 1JTPA 3LV3A 3U2SA 3WLBA 2O26U 4WO4B 3ZSSA 4LLWA 4MJID 3LN4A 5E2TH 2QSTA 5LVEA 5H37H 5DUML 3M1BB 1IMHC 5CIPB 5KS9A 1EA9C 4P4KB 2HKHL 4RAUA 1JGLH 3VXRE 1MJ7H 2VDLH 1UEMA 4G8FA 4LAJH 4XP4H 3WCYA 5AZEL 1KG0B 1FH5L 4PJCB 1BQHA 5JR1L 5I8CB 3L3KB 3MR9B 3V5HA 1MY7A 4LVNC 3L1OH 2HFEB 1WISA 3RVVD 3K4ZA 2X2YA 1P84K 2ICWJ 2H26A 5FECB 5DQ9B 2A6KA 2OI9C 3G5VA 1F8TH 1GHFL 4KJPD 5EO9B 2YPLB 3U9UB 4XAKD 4GXVH 1IGIH 5E2UL 4OCRH 4PPTA 4UIMA 4E41A 2VDOH 1QFWM 3GSRB 3QBTB 3E8UH 3GMRA 5GS0L 2OJEB 1SEBA 2OI9B 5I71C 4LLQB 1FVEA 5FM5O 2FHCA 1Q9WB 1HH9B 1B4JL 4PJXA 2DD8H 3QXUA 2BJML 4PS4L 1F4AA 1FL3A 1ZKAA 4Q9QH 2W9EH 4HUKB 3S37H 5I1LA 1XGRB 1O0VA 2W0LA 3CDFA 1X5AA 2IQAA 4HFWA 4YDVA 1FVCB 3C2SA 5I71B 3HHRB 2FR4A 3GK8L 5E94A 1FGVL 5GGTH 5HJ3B 3O81A 5EZJA 3B3IB 5BZWA 1RK0A 1JPSL 4X4YA 2LU3A 2R1XB 1A7QL 4U1JB 3IDXL 2IBZX 4YHKH 1JGDA 2WBJD 4F7TB 1JRHH 5KANG 4OTXH 4XH2A 4OUUB 5HDQH 3NPSC 5FV2A 1P1ZB 1RULH 1S9XA 5FF6B 4MAUL 4GG8A 1BZQK 1IAKA 4U49A 5E03A 3V52H 1BFVH 3KJ6L 1LD9B 2QADB 2Y4SA 5IHZB 2KZWA 4H20L 1DZBA 3GSVB 4U2ZA 4L8SA 2X4SB 4Y7MA 3QPXH 5K9OB 4APQC 3QIUD 5F9WC 4OZIF 3K3QA 4K23L 4ZYKB 4IRZH 5IESH 3O0RL 1ZVHA 3H0TA 1WEJH 3VFUB 5ICXB 3ZYJA 3NZHH 2X1OA 5F3HA 5I1EL 3ILPB 5GSRB 4DWHA 4J8RA 1CDHA 1N6QH 3DV6B 2AJVH 3RVXC 3WLWC 2HLFD 2AK4A 4CU6A 4H8WC 3EO1A 4E0RA 4AT6A 4O2CB 5DI8A 1RUPL 3SGEH 3HC3H 2OK0L 1U36A 2QQQA 2COQA 2QR0A 2NLJA 4ZNEA 1ZEAH 4Y5YC 1BQLH 2AK4D 3ZKMC 2DQJH 1K5NB 3V0VB 1E27A 3UBXG 1JPST 3HS0B 2PYFA 2DI7A 2ZCHL 4IEFB 3TA3C 1W72B 3QDGE 5C9JA 3O11B 3G9VA 3GSWB 4NSKB 4WHDA 1ZT4B 3I9GH 2DWDB 5SWSE 1KIQB 1AGEB 4Y5YB 5JUEH 1IM9B 2DQTH 1EVTC 5DO2C 3W2DH 1NFDB 2D7PA 3EOYG 4XXDB 1UYWL 2V5RA 3FO2A 4NZTL 5HSFA 3UBXB 3HE7B 3BQUD 4K7FB 4XCEA 1INDH 1RUQL 3ZE2E 2MJWA 4NYLA 5AYQA 5GJTH 1RK1A 3DHJA 3MZTA 1VENA 1NC2B 5IQ7H 4MA3B 1KN4H 5MEOA 3QNZB 1KJMA 4R8WL 2HRPL 4OGXH 1NCWH 1AXSB 3JTSB 2UWEF 4X9IA 1B3JA 1DQML 3HZVA 2F9BT 1Z9SA 2X4NA 1MFAH 2EDEA 4X8JB 1ZHBB 3VD4A 3HPLA 3MLSL 5L2JA 1WITA 3RKPA 5D1ZC 3FO9A 4YXLH 1SYSA 1GH7A 1KLGB 3FZUC 5KSVB 2I9TB 3IRPX 2BMKB 5AZ2H 2P43B 1OD9A 3I3EA 4FQXD 3BPLC 3P40A 1A0QL 5DXWA 1AE6L 1MPAL 4BJLA 1RHHB 4Z7OE 4WY7H 4YHNA 2IQ9H 4KRMB 1I3GL 1RJZB 3B8YA 4EDWL 2J8UF 3CU7A 4NKMA 1LP9F 1U93A 5E8NA 3BPLB 1HINL 1CICC 2XACC 2ED7A 1NGZB 5HHOA 3TBVA 1UXWA 4NP4L 3MJ9L 3D3VB 4MNQE 1P84J 4E5XA 3GM0A 3O6MH 4Q6IA 5HI5C 2BHZA 3OJDB 4PR5B 3T65B 1KB5B 3RVWC 3TT1H 3LKOB 4G8EA 3ULVC 2CDEB 4R90L 1AD0B 5JPMB 1WC7B 3LKRB 4WHYH 1GGIH 4OD2B 2B4CL 2B1AH 4NQDE 5FUZH 8CGTA 1MH5A 1CICB 2MOVA 4PGJA 4YDLC 1CD1B 5KANI 2VDMH 2B39A 2AXGB 3A6BH 4L4TB 3KPLB 3KWWB 3IU3B 5ACMA 3TO2B 3TBWA 3OL2A 5LQBH 2IG2H 1WZ1L 4POUB 4MXWH 3C6LA 1MWAH 4R0LA 1F3JB 2UY6A 4KKBC 1J1OH 3GRWH 3QUZA 2YMXH 4OZGB 1MCLA 4G8IA 2B0SL 1HYSC 1N6VA 3TBTB 3HCVA 1I1FA 2V9TA 3ARVA 4ZXBC 4YDLB 4GG6A 5FM5M 2XWBB 4F33B 1EH9A 3B6SB 3FT2B 4U2YA 3OXRA 3C6LD 4UAOB 4LARH 3QUZD 1RVFL 4GAJH 4R96B 4XAWL 3MOQA 2GT9A 3VFMB 3EJJX 2EYRB 2E6PA 3DRTB 1SYVA 3FONA 3X3FL 5IV2B 3S36L 2BSTB 3MA7B 4MZ2A 3LKQA 5KSAA 4Q74A 5TF0A 1EFXB 3BZFA 1UVQB 4FP8L 4FQPA 4UQ2B 2QTEA 4Q6YA 3VXME 3DO7B 2VLKA 3I6KA 1IE5A 1ES0B 1II4E 3EGSA 3CSPA 1PVHA 5KSAD 4CMMB 4UDUA 1NFKA 1NCCH 3P73B 4PRNA 4YDIL 2GSIB 3FT3B 4WI6A 2VKXA 1G9EA 3QISA 4U7SA 1S7XA 3H7BB 5KVFL 1WCBB 2Z8RA 3WD5L 5C0EB 3PQYD 5DJAB 2B5IC 1X5JA 4X9BA 4I0PC 3ARSA 4S0SD 5ANMB 2Z91A 1BD2E 3HR5B 2H2SD 3SY0A 1DQTA 5CEYB 4HWBH 4NZUL 3KNBA 1FN4B 5EUOE 4XPHL 3MCLH 1E28A 1P4LA 2ZCKL 1I1AA 4Z78B 1ZT7B 4HF5L 2B5IB 1A22B 4I0PB 4U31A 3P9MA 3KPSE 4WUUB 5CSZA 1TQBB 2NTFA 2UWEA 1M7DB 1R5WB 2VLMD 4OZHB 4RGNE 4K7PH 3T04D 3UTTE 4WNQA 4EDXB 3S8WA 4BH7B 3WO4C 2EYTB 1FSKC 1IC7L 4MQXD 1Y0LB 2YD9A 3GKZA 3LIZH 2BOBB 3K1KC 4QRPE 3Q48A 4I48B 2E7LA 3GNML 1M6OB 3HI6H 1R24B 1CK0L 1XF3B 5F9DC 1V7NH 3GFUA 1DQDL 4KRLB 5MEQA 3WO4B 2Y07L 5D9SB 3OBAA 4I18C 3WL9B 1DQJB 1NAMA 4C56A 4OGAD 3DTXB 3U4EB 1JMZA 4OV5B 4FQIH 2J8UA 2G60H 1LP9A 4I5BB 3RVTC 3T1WA 3EFDL 3DJ9A 4AEFA 5HGAA 2OYPA 4F58H 1Q9OB 3W81A 2AW2A 4RISL 2BSRB 4HS3A 3ET9F 4C56D 4KVNL 4I18B 4LKXB 3CCHA 2IFFL 1QSED 1MNUL 2Y9RT 5T3ZH 3C2AL 5DJ2A 5E99L 1X6LA 3PIQA 1XF2A 4HW6A 3NIFF 3PP4H 4HV8B 5ITFB 3RDTD 5GSVB 4NQXA 3QDME 1A3LH 2HN7A 1BM3L 2IANA 4ZPVB 4XP1H 1RY7B 1MRDL 1UA6H 5CJBA 1X3DA 2AV1A 3O6LH 4YBLC 2Q8BL 1CS6A 4M48L 4JN1H 1CFSB 3V0AC 4JDTH 5E5RB 2MHAB 1JYNA 1C08A 3FMGL 1HXMB 3L3IA 4PGCA 2AABH 3VXUE 4R4BA 4XMKH 3P4MA 1ZE3C 5L88H 1DTUA 2EIZB 3TYFB 4OCXH 5CCKL 5EULV 4U1MA 4YBLB 5J0BA 4RA0C 4ZOCA 1K6QH 4JO1L 2XXCB 4HUUB 1DCLA 4YHZH 5KOVC 4MJIE 4J3XA 5FO8B 3O4OC 2NYYC 3BVNB 4LRNL 4U3XA 3FN3A 3FO1B 1IGJA 4NM8H 2YN3A 2BNQA 1PG7W 4WU7A 3TVMA 4OD1L 4WHTB 4APQA 2NY1C 2JJTA 2NX5B 3DVNA 4MB4A 1K85A 3D0VA 2V5TA 4PP2B 5JXEC 4GRMA 3VFPA 3FFCA 4KI5F 3MJ7A 5KS9E 5TE6H 1XR9A 2DQUH 2WQRA 5I74C 4Z77A 3JBG7 3PV6B 3V8CA 4N0FB 3MMEB 4HXAH 4Y16C 4YFLF 3IF1A 5EWIL 2DM2A 3PGFL 2J8HA 2NY1B 5DMKA 3RX5A 1HE7A 1YYLH 4H88H 5H2BA 5JMRA 1HCVA 1GL4B 1I7TB 4Y4KA 3WKMH 3BGMB 5E2JA 1QO3A 1KBGL 4KK5D 1KEMH 4XNUH 3WHXB 2VOTA 3DX6A 4KJYB 5I74B 4Y4HA 1F6LL 4OZFG 5E6IA 3G6AB 5D7KE 1I8IA 3QIWD 4Y4KD 4HPOL 3JUZA 3QO0B 4E41E 1QEWB 3RY4A 4JPKH 5L2KB 4EN3D 3K2UL 3IFNL 3GMOB 2BRRL 4JO2L 1WBZA 1OAQH 1PW3A 1U9KA 4TSBH 4M62H 3TA3A 4NQED 4LLMB 5E6ID 1OAKH 3MLRH 2NW3A 1RZJL 4F9PA 5L0QC 4OZFB 4PJXE 2R4RH 2WLZA 3EJYD 2OQJA 4XC1L 4R4ND 3O3AA 4OF6A 5J1TC 1GZPA 4JM2C 1QLRA 1AGBA 1AC6A 2JCCF 2GAZB 2FJFA 1FNEA 3PWPB 1D5XA 3CIQA 4HQQL 4Z7VB 2OZ4A 1N3NA 1KC5H 4HK3J 1CQYA 1KIPB 2GTZB 3U7WL 4QCIB 3R06B 3ARXA 5L0QB 4JRYD 2G9HA 5EBGA 2RGSA 2DIAA 1D5ZB 5IFHL 4LIQH 4C57C 4OCLC 3MC0A 5ID0B 2J7LA 3VGAC 1Y18B 2X9WA 5TDNB 3WXVL 3DV4B 3GZKA 2FZ3A 1B4RA 1K9TA 1MAMH 3M17A 5T1MB 3ZDYE 1HQRA 2ZUXA 3MBED 5D1ZA 1KCUH 1W0WA 1YEEL 3BT2L 1R5VA 1K8DB 1GPOH 4JZOB 4FNLL 5CP3H 4JO4H 4D9RD 1KPRA 4PUBL 1CLOH 4JFDB 2V6HA 2AERT 5IB3B 2X05A 1RZ7L 3HE6D 3G08A 4LKCB 4MGXA 1YEKL 5BXFB 2EKSB 3WFEH 4CN1A 2VISA 5GGQL 3BIKB 4PJ8D 3T3PF 2XN9A 4JQIH 2OXGA 4J3SA 1DQQA 2CGRL 5I1HH 2Y36L 1MELA 1HYRC 3MRFA 5F97E 5CZVL 5I18H 3RU8H 3GSXB 2XKUA 1X5LA 3MBXH 1RUAL 3O6KH 4QXTB 4ETYA 4AIZA 3IXTA 5DEGB 3JTTB 3L5JA 5I1DA 1S9YA 4M6NH 5GPRA 4NQSB 4LHUD 2YZ8A 3CZFB 4IOIA 4HXBL 2VXVL 3CC5A 4GRWB 4OM0H 5J13B 3P0YH 5FAAA 1S9WB 3ARDA 3ULSB 3RIAF 1PSKL 1UM5H 4LCUB 43CAA 4GQ9L 1EXUA 3O3BB 2G75B 1YY9D 3SKJH 5EU7E 1J05B 4Z7QF 5J11C 2XRAH 1J8HA 3QRFM 2AK4E 3GBNL 3UYPA 2HTKD 5T1KD 4FQJH 3GKWH 3CK0H 3LKNA 2HJFB 4LSPL 1FPTL 3MYJA 2VZUA 5CBAA 4ZOBA 1IGFH 1QSZA 3HC4L 4JG0H 3K4DA 4OLVH 1JN6B 2PO6A 3FT4A 1Q9KA 1A9EB 4ZNEE 5CJQL 5FYKL 1ZA3A 2X6MA 4P23C 4W6WB 5J11B 3MRQA 4ZTPH 4XVSL 1A4KB 4HPYH 1RQ5A 3DYMA 2VWEC 1RHFA 4Z0BH 4FQLH 1MQ8A 3ULUC 3JWNC 2E27L 4HT1H 4TQEH 4FQ2H 4TTGA 3HB3C 4ZXBA 1R3IH 5F72S 4LSRL 5JTWA 1DL7H 2KQMA 3BW9A 5HI4C 4P23B 3UJIH 3QI9D 1X7QA 1LK2A 1FFOB 1B6UA 2V7NA 3ZTNH 4S2SB 2CIIB 3U9PH 2ICWI 4DVBB 4KI5D 2FO1A 2ICEA 3MRHA 3AROA 1FV1A 3NA9L 5I9QC 4C4KT 5AG8A 1MJ8L 4MAYA 4ZDHB 1QRNB 4M7ZC 2AV7B 3LRSB 4HHAA 5MHSD 1KEGL 2C4FT 3DECA 3SQOH 5FB8A 4XX1G 1FO0H 2KPNA 4NDMB 4G8GA 1ZK9A 3NACL 5DRZB 3SBWC 3S5LG 4RNRB 4HH9A 3P4LA 1GC1H 4TOYL 4M7ZB 1XGYL 1XMWA 1TJHL 1T7YA 2W91A 1IBGL 3UTZB 4EJ1C 4YHOL 3FRUA 2JCCA 1T0NB 3IFOB 3KR3L 1VKXB 2ADJB 1JUFA 2DKSA 4HK0A 1FFNA 2XWTA 3H7LA 2CXGA 3BP4A 5FKPA 3ZKXC 4F7MB 2FNBA 5E8PB 3S5LB 5JQ6H 2PN5A 3DIFA 2DQDH 3T0EC 2Z35A 1OWWA 1I8KA 4TN9A 3G6JF 5HHOE 3VWJA 1FRGH 4HWEL 5DUBA 5E2VL 4IOFC 2DWEB 2IF7A 2CIKA 3GHEL 1QFHA 4LSDA 2F74A 2NMSA 4NN5C 3OB8A 2VB5A 2OJZL 4LPYA 4J6RL 4JPVL 1F6FB 1Z3GH 4KJWC 4MCZB 4ONGH 4E42A 5IEKA 3FL7A 2AJUL 1QP1A 2HVJA 3VXSD 4G6FB 3OKKB 2V2XA 4GMSL 1A6ZB 3ZDZE 4C54A 5B4MC 4NN5B 4KRPC 4WI9A 2V9QA 1VGEH 2AJ3A 2DQHH 1OP5H 1KN2H 4Y2DC 1C5CL 1OTTD 5I76A 4GO6B 5TGBA 1QLFB 3E3QC 4GG6E 3W9DB 4PRIB 1PX3A 2XFXA 3EYVB 4AEHH 4ORGA 3W5MA 2NY4C 1Z2KA 2NY2D 4L4JA 2FJGA 2BXZA 1GRWA 1YY8A 2CKBH 2VLLA 3CSGA 4KRPB 4JO3L 1XIWD 4Y2DB 1C7TA 3AUVA 1NGYA 4GW4B 5DHYA 4WDIA 5DJDA 1CTNA 4PJGF 1CZ8H 1T1YA 3VXTA 1E4XH 2NY4B 3BGFB 2VLKE 1BWMA 1T21B 4OUOA 1V7ML 1MFBH 5EOQL 2H32B 3U36B 4HKXA 3B9KD 2ZCLL 3CSBA 5GIRA 4DGIL 2P46B 3ME0A 4B7IA 4H1LG 5HD8C 2P8MA 1KUMA 3TM6A 3RFZC 1CGSH 1S7TA 2A0LD 3BUYA 1FNSL 1Z5LA 1TIUA 3MUHL 4DGYL 4C58B 3GJFH 5C0JB 4GXUN 4EXKA 2Z93A 3IS1X 3L6FA 4I13B 5JLZA 1D5IH 1MLCA 1UB5A 5T5FL 2XTJB 1BX2A 4PG9A 3SGJA 1EEQA 2VLME 2GK0A 2XWJB 3GBMH 4QHLA 3IFLL 5F1NB 3BAEH 4H1LB 3VCLA 3OKOA 3HUJF 4FFYH 2V5MA 4PJ7A 2A6IB 3RWJA 4M3KB 5I19H 1QSFA 4DKDC 1BVZA 4ZFZB 1ZLWH 4UUJB 3HNSH 3IFPA 2UWEE 2Q76B 5EBLA 4K3DH 1HHGA 1Q9LB 3EOTH 3WDHA 2XQBH 4J4PC 1LDPL 4Q2ZB 5CIPH 2DLGA 1JHTA 5E8OA 4X99B 5D1QA 3K80A 3TNNA 4Y16A 5J1AA 2LABA 3AAZA 4ODUA 5C6TL 5I1KH 1TXKA 5JHLL 4MD0A 1OCWH 2Y6SD 3VWKB 1U3HA 2EE6A 1PQZA 2I9LA 1DUZB 5J3HD 1IAMA 2YBRA 2BVTA 3IAPA 2R2HB 3HKFA 1TENA 3TIDB 2BK8A 4CDHA 4C56E 1SJVA 3QEUA 2GJJA 1RSFA 1WIPA 2EEAA 4LEOA 3KLSA 2J8UE 1LP9E 1M05A 1U3HD 1WT5C 3WIHA 1ZVSB 5IF0A 2MPAL 4PRDA 1W2KT 2FL5A 1G6RL 5IBLD 3SJVA 4HBCL 3CVHB 3SE8H 1MJUH 1FCGA 4P2RB 3G6JA 2ZJSL 5D2LF 5EDXA 3BWUC 2EE9A 4ODXA 4NC2B 3VFWB 4G5ZH 2AJSL 1QYGH 2R15A 2VABB 4D0DA 32C2B 5B3JE 5GRWA 3F7YA 3RPIA 5JDSB 1EZVX 2DLFL 3T2QA 5AAWA 4JM2A 1HSAB 5DC9B 1L0YA 4U3HA 1IC4L 4UT6H 2YK1H 1U8LB 2F5AL 1QVOA 2R0ZL 3GO1H 4FOMA 1T80A 4N5EC 4PRBA 2IANE 3G6DL 5MERA 1F6AA 3LOWA 2JJWA 2FIKA 3BSZH 5IVZA 1YC8A 3TIEA 5H94B 1F4XL 5DSCA 5HYIA 4HDIA 3IETA 4X7SL 5DGRA 1P5UA 1Z6JT 2HA1A 4WW2A 6FABH 2AQ1A 2AJXH 2OL3L 1ONQA 2VDNL 3BRFA 3ABZA 1NGPH 2HT3D 1JCKA 3RKDC 1BLNA 3N1QC 5T5NG 5EZLB 3MXVL 5MP6L 2BNRA 4PY7B 2XIDA 3LS5H 4LCWA 2F5BH 4HSQA 4A2LA 2D0GA 3HZYA 5E70A 5ETUB 5ACLA 1IEAB 4PJGA 3L5XL 4XPBL 2BNQE 2R56H 5BVJB 3L3DA 4JFQA 4BSWB 1RIHL 3ARBD 5MEPB 4RWYH 4I9WE 3BKJH 1F3RB 1IQWH 1HIMH 4RWHA 4I3SL 4KZEH 3MRLB 3FFCE 3D85B 3OR7B 1EMTH 2C3XA 1CXHA 3QULB 4L8DA 3EYUL 4X7EC 5CWSA 3QFDB 3DURB 3FQTB 5ESVA 3V8OA 3FAXA 1I8MA 2A1WL 4K3HA 1VACA 3VXNB 3CFJB 5D7LD 1CBVL 1HSBA 1JPGB 4OQTA 4HZAA 3LN5B 5I6XC 3NCJL 1DANU 3WFDH 3QXVA 5AEAA 2P1YA 3RWIB 3FQWA 1KTLA 3HUJA 4ZS6C 3DGCR 1U8OA 1DUYB 2ZSWA 3CX2A 2PKDA 2F19H 4KHTH 1CWVA 5IM7A 3JUYA 4KTDL 5DRWB 1LK3H 4PG2A 5JW4R 1X5IA 1RUMH 1FAIH 2QEJA 3QJHA 5SWQB 4H8WH 4K71C 4U0RC 5EIIB 5SX5K 5BZDB 5I6XB 2VZOA 1WZMA 2B2XH 5B8CB 4RAHA 5FV1L 1W72H 1EFQA 4LNVA 5KVDH 2WNGA 1J18A 5F7MC 1JF6A 1FFRA 1AR1D 2BCKA 3GI9L 3MV8B 2D7OA 1W0VB 3JWDH 1BGXL 5HGBA 1CLYL 1CD8A 5BV7L 6CGTA 4J3WA 1FFPA 4U0RB 4QHMA 5LKNA 4MJ2A 2I60L 1JFQH 1AC0A 3ILQD 1K4DA 1MHEB 5C0BA 2FIRT 4HGKC 5GGRY 5EO0A 3PABB 2PR4L 3C8DA 4AEIL 2IJ0C 3TT3H 4F8TA 5JHDA 3AMKA 4OV6F 3EO9H 5SWZB 4OI8A 1A8JH 4P2QB 3S6CA 4RIRB 1BJ1J 1T22B 1A6AB 5LG1A 1KPUB 2HWZL 4G9DB 4LVOC 3L3HA 3TZVA 3LH2H 4EI6A 3ROOA 5LAXA 4JFYB 1FBIH 3HZKA 4ODTL 1HHIB 3BHBA 1E6OL 4CVXA 3C8KB 1OSZA 4NRYB 3STZA 1G1YA 1Q0YH 4K94C 1NEZA 3UX9B 1I9JH 4JFHD 3WHE1 3RWEB 3QA3A 1DSFL 5KJRL 5BQ7B 3KXFB 5IOPA 4I0CC 3O4LA 4BQCA 1GGBH 4U1NA 5DQDL 3CMOH 5IROC 4XP6L 5IVNA 2Z31A 4NQVB 1JZ7A 3AREB 1JE6A 3C6SB 2EH7L 4KUCF 3TYGH 2YZ1A 2AXJA 3KPPA 2PETA 2XZZA 3ZE1F 2EDXA 4NNXB 4L9DA 3MLTA 1NCBH 3FQUA 4M6OH 1A2YA 2Z31D 3IRZA 2N1KA 1EGJH 1XGQB 1J8HE 4PJAF 3BP5A 1JF1A 1QBMH 4RBPH 1FYTB 4JVUA 3VD7A 4KQ3H 1KB5H 1MFCL 2BVOB 3C9NB 2JK5A 4I8DA 4Z7NF 4JB9L 4D8PA 1ZOXA 2GCYA 2JF1A 4ZSOB 1EIBA 5FK9B 4U7MA 1RZKC 4UBDD 2C3VB 4ZS7L 5EOCH 1KPVB 2VO5A 1FE8L 4UQ3B 2F54D 3O2DH 4OLEA 3JV4B 3P4OA 4PY8I 1G0XA 1CU4H 3ULVH 2A73A 4EEEA 3D1MC 5E5MB 5H8DA 4KI5E 4R3SB 1I3RB 3MNZA 2PYEB 4WWKC 5IFAL 4LPXA 5A3IC 3KYKH 1DFBH 4Y5XA 5GZND 4HC1L 5DD6A 1BFTA 2X4OB 4L8BB 1T83C 2P5WA 2BOCB 3D69A 4XMPH 1ZHNA 3WS6C 4YAQB 4PV9B 1K3IA 4Z6AT 5CEXA 2R29H 5E1HB 4OCNC 2J1KA 1GZQB 3LQAL 3MGTB 1VERA 1L7TH 3NFPB 4GKZA 2OSLB 4MD5A 1EEZB 3CX5K 1J12A 3VXOA 1F11A 1G7PB 25C8L 5CBEB 2D03H 3RNKA 3QFJD 4LQFH 4R4FH 4XBPB 2UYLB 5GISL 4JN2A 1LGVA 3MNWB 1SVCP 4YPGA 4JHZA 4G8GE 1OW0C 4PIRF 4Z7UB 3BIAX 1T20A 3WE6A 4PGDB 5GGSB 4OIAA 4YFDB 4JHWL 5DFWH 2F58H 5C0AA 1VSCA 4PJCF 2JCCE 1N5AB 2EICA 4JFFB 4JZJA 5AYUL 4B50A 4HMCA 1Y6KR 4GKSA 4PREB 1RJYB 1SJEB 1YEJL 4XBEH 5DFVD 5C07B 3V4UH 1J5OH 1MIML 3P2TA 1IQDB 4FG6D 2VDQH 5C0CB 4WFGD 5IBUG 1FZOA 3SQBA 2NXZC 5GRZA 1OAUH 4G80B 4M03A 2JELH 3UP1A 3WJJC 3ZYZA 3HNVH 4OIIH 1U8JA 1ACZA 3Q1SL 3T4AB 5EN2A 2DDQH 2FHFA 4PTTB 2DTML 4TRPL 4GUPA 1IL1B 2CR6A 3F12B 2AEQL 1MCOL 2GY7B 5GRJL 4YO0A 2EH8L 3UYRL 2NXZB 3GMQA 4RMUA 1KTDB 1JGVH 1A7OL 5DUMH 5IBUB 4HK3N 4LASL 2ESVA 1EERB 2HFFB 3VFSB 4WFED 1TZHB 2FX8L 3BDYH 3QQ3B 4TNVK 2H6PA 5FEBA 2R0LH 2MWCA 4G7YL 1JWMB 1PLGH 3RZCB 1UWXK 2R1WB 4U6YB 4HJGB 1RJLA 4GAFB 4QKXB 4K55A 5GGVH 3BO8B 5F7HA 4LLUB 2PXYC 1LO0H 4XCFH 1MFEH 2ESVD 3QHTC 4O51B 2YSSA 4HUVA 1JV5A 2AEPH 1MCPH 5GRXG 3CFCH 3LZFL 4QXUL 4YGVB 1H15B 3QJFB 3F58L 1YNTB 3T2NL 2B8OT 4Z7WF 3AU1A 5CGYC 2X4PA 4PTUA 3BN9D 4Z7QE 2PXYB 4ZUVA 1LQSR 3KYAA 3EOAA 4PP1C 5KVGL 3FTGB 1EHLH 4PLOB 4LK4A 3QUKA 5GS0H 5LXGH 4U33A 1INEH 3D39B 3IAQA 1NBVL 2BY3A 5EU6A 1HI6B 1T3FB 5D96C 3MRMB 3WFHA 5ILTH 4DN3L 3NH7L 5I17B 4HMDA 1QD0A 3PHQB 3MV7A 4XVJL 5DTFA 2AK1L 2XG5A 4BSVA 3FO0L 2UV3A 3CPLB 3SDXF 3ARQA 4LLYA 1UH4A 4LCCA 3DX8A 5E2TL 12E8L 1MCIA 2BVQB 4JJ5B 2F53B 5D96B 5LCVL 3GK8H 1FGVH 3MV7D 3F7RA 1QR1A 2OL3B 4GRLC 5EA0L 2I5YH 1JGLL 3VG0H 3HTLX 3P9LA 3FB5B 4XP4L 3H9HB 3T0XA 3P77A 4JDVA 2OBGA 4N1CA 2X41A 3O6FD 3L1OL 1AKJB 3RWDB 4PJ7E 4BFIA 4IHOB 4M7KH 4PJ5D 1QSFE 1ADQH 2HTLD 2J12B 5HYQB 3F5WA 4ELKA 5D1XD 4KROC 1IGIL 3GB7A 2ZUVA 1H5BB 3ARFD 4AQ1B 4MDJA 2VDOL 5HHMD 4XBGB 3E8UL 4ODVH 3QIBA 1G9NC 4PRAB 4U6XA 4B7LA 4P4KA 1BZ7B 1MCBA 2Y5EA 5E6YA 3M07A 4MVBC 1PG7X 2DD8L 1NFDF 3SO5A 4WHCA 3SKOA 1UH3A 4YFEA 4Q9QL 2W9EL 4H25B 4Y19A 5I1EH 2HJKA 5I1IH 1AGDA 4YNYB 1HNGA 3HZMB 4P4KD 5EBMA 1D9KC 1IKNA 3SDCA 4FXKB 1R3JB 1BBJA 2X4QB 4PV8B 5GGTL 1U8QB 5A16A 3SJVE 4Y19D 5DK0B 3WEXB 3HRZB 2D7QA 2FEEL 1CFQA 3G6JE 4X83A 4J23A 4HG4K 4YHKL 5KSBB 1XCQA 4OFVA 1U95B 3AY4A 1JRHL 5J89A 2YPLD 4UNUA 1YMMA 3UDWA 2GUOB 4LCIH 4IM8A 4OTXL 5K9KA 5HDQL 3CX5J 1W8NA 3CFBA 3QUMA 4OZFH 3EO0A 4NUGH 4X6CB 4F7PA 1R3HA 3RTQC 1RULL 3KPRB 4X6FA 2D4FA 1XCTB 3FB7B 4L3EA 2Z8SA 4WJ5B 3ARYA 3DUHA 3VFTB 4JHBA 5JIIA 3DPBA 3SE3C 4OCMC 1XF5B 5IW1B 5F9JB 2ED8A 5SV4A 4PGBA 4XXCC 3IDIA 3QPXL 4QRRB 2BX5A 2GJZA 5IWLA 1P9MC 3RTQB 1XT5A 5F7EH 4NC1C 4IRZL 4NNYA 5FUOH 5IESL 3ZT7A 4KJQD 1WEJL 1YEHH 2BNRE 2CRYA 2W65A 4L29B 4Z7WA 2HG5B 4R8WH 2HRPH 1R3KB 1TZGH 2YUXA 1IT9H 4LPVA 4LCWE 3D2UB 1INQB 2ZG3A 1N6QL 2AJVL 2PTTB 4PJIA 4D2NA 3B2UC 4PJGE 4PLJC 3MLSH 1MCDA 4TUOA 1S7RB 2BSSA 4RAVB 4Q7DA 2YD7A 5ADOH 1LD9A 4UV4H 5IROA 3B5HA 4FQQB 3B2VH 3HC3L 3S4SB 5JMOC 1RZ8B 3MRJA 1VGKA 3GSVA 3QDAA 1ZEAL 1BQLL 2X4SA 2DQJL 4YHMH 5C0IB 3SDXA 4JFEA 3SKNB 1A0QH 5TH2A 4K9EC 4OZGF 4GAGH 1S7UB 5DJ0B 1AY1H 1R3LA 4URTB 4GRWH 1KFAH 2QADD 2DKUA 1I3GH 1G9MC 1MHPH 4QNPF 3I9GL 4ZPTA 3HPJA 3SKMB 2EE3A 3OV6A 5LBSH 4JFED 5GSRA 5SX4I 5HY9B 4YBQC 4JFPB 2DQTL 1G7HA 3TPKA 3W2DL 5I16B 3ORJA 2OR9L 3T0AA 1F5WA 1UJ3C 3L3OA 2DB8A 1LWRA 2HFGH 1J0KA 3HUJE 1WAAA 4QOKB 4O2CA 2F8OA 1RZIA 5GJTL 3L5WA 2NY7H 1ULVA 5FYJU 4H5SA 4WI2A 5IW6A 2IH3B 1R5IB 4PLKC 2UVFA 1KN4L 5D7JC 4PB9H 2QSQA 1K5NA 4TNWF 4WEMB 3TP4A 4OGXL 1NCWL 1UJ3B 3OB0K 1CDCA 3O9WA 3B4NA 3QEQA 2XKSA 3DMMC 3MRKB 3F7VA 1W72A 3O11A 1X5YA 4HULB 5FGSA 3OKLA 5C8JB 5F9AC 5CEZE 4YXLL 4RMQA 2P8PA 3BPCB 3WLWD 4GKNA 5ACZA 5D7JB 2KDGA 3MUY1 3DMMB 5C0BE 3IJSB 1T1WB 2ZUTA 2E9BA 4XAWH 4LAQH 4K7FA 3TLRA 5JHDE 4EIGB 3QT2A 4FHBD 3ZKMD 2DQIH 4WY7L 3S36H 4XCYA 2IQ9L 3ZT6A 4RFOL 4TUJB 3G04B 3RHWK 1UKSA 2RR3A 4L8CA 4DQOH 2X7LB 3HE7D 1KLUA 3JTSA 4OZHF 4QT5A 2GTWA 1QFWH 2VE6A 3BUTA 1FL5B 1NC2D 3O6ML 5DO2D 1ZXQA 4LF3A 2HVKA 3FFDB 3PP3H 4S0TD 3TT1L 2WINB 3C60C 1I4FB 1C16A 1GGIL 3O4LE 5HDBF 1MJJB 2B1AL 5FUZL 1NBYA 2C26A 4YZFF 3C08H 2VDML 3RQ3A 3A6BL 5K59F 1A9BA 1NGWA 1RHHA 4NZUH 2OCFD 5LQBL 5E24E 4MNGA 4MXWL 3RY5A 1MWAL 1J1OL 3IGAA 3GRWL 3C60B 3Q5YA 5HGDA 3T2PA 2YMXL 3LQZB 4DGVH 2WM0A 3KS0J 2ZUSA 1BVLA 2C3WA 4CMHC 1F42A 3PJSA 5CAYB 1DVFC 4P2OA 2CQVA 5I73C 3FZUD 2CJUH 5F1OB 1ZS8B 4PR5A 1A4JA 5GS3A 2ICES 2VZVA 4QGTA 2CDEA 5FKAB 1WC7A 4CMHB 3I75A 5ENWB 3D3VD 1Y6MR 4HG4J 1DVFB 2AXGA 4X6BB 3S37X 3BXNA 5I73B 3KWWA 4IRSC 1RURL 3IU3A 3TO2A 1YYMH 3DO3A 1YDPA 3DHMA 3REVA 3KYNA 3RGVA 3E3QE 3QZWG 1IEBB 1CICD 3Q0HA 1CDIA 1ORSA 5DMJB 1H3UA 2AJZA 4QXWA 4EBQH 1U8MB 2P5WE 4IRSB 3RGVD 2ZOLB 1NPUA 5CD3B 4KKAC 1AR2A 1FAKT 3QFJE 2EYRA 2AI0H 3WS3A 4HWBL 4G7VH 1MNUH 3C2AH 3QZWB 4NO5B 3MCLL 4P9HC 2ADGB 1YPZB 3GIVB 1U92A 3FN0H 1LO5B 5HHQA 2H32H 3D18B 2K7PA 3DO7A 4V1DA 1F2XK 4OZ4B 1JYXA 1DEEA 4LGRB 2P5EA 1AXIB 1I7UA 1BAFH 3U1SH 4CMMA 3K81A 4P46C 1LE9B 1EFXD 4DVRH 3FT3A 4TPRH 5BJTB 2E5EA 2A83A 1CR9L 3QQ4B 2FGWH 1I9IH 2KL6A 2L4OA 4A6YA 4DUXA 5A40E 5DC0A 5CGMA 5C0AE 3LIZL 4AL8L 4QRSA 1NMAH 2VL5A 2PW2A 4JANA 5DYOB 1EVUA 3AS2A 5GRYA 3HI6L 1JTOA 3ZKND 1ZMYA 5I8EB 5CLTA 4P46B 4KDTA 1V7NL 4F3FB 3SDDC 5CCKH 5CZKA 2BNUA 5IGXH 3O8XC 1A3QA 4H1LH 5EC2B 1F4HA 4JO1H 1ZGLP 2ARJB 5AUMA 3VRIB 3KLHC 2VDKL 4DW2H 2NY6C 4FQIL 2G60L 3EFFB 4O4YH 4PRPA 1HKFA 3SDDB 4F58L 4UINH 4OZHA 3O8XB 4S11A 4C83A 5CINH 4OQ1A 2GJ6A 3AS0A 4GAYB 5EU5A 4I0PD 1F45A 5T3ZL 4LCYB 2BVEA 5LGJB 2ESVE 2NY6B 4WUUD 5GJSL 5ID1B 5IQ9B 4XTRC 3PP4L 1JWUB 1ITBB 5GGVY 3UPRA 3NMEA 4Z7VF 5DD0H 3E6HA 1D9KA 4DJMA 3MROB 3WSQH 1T2XA 15C8L 1KBGH 3TBYA 1T03H 1UA6L 1T89C 3O6LL 3HMXH 4ZUSB 3PHSA 1WFNA 4JN1L 4JDTL 3IDGA 2ENSA 4FQHA 2QBWA 4GH7B 2AABL 4FZEH 4LSVH 5D6CB 3CVHH 4ZUUA 5K9QG 2DM4A 4AENA 2VDPH 2FBJH 4XMKL 4XWOC 4YQXH 2J8OA 2GI7A 3UC0H 5L88L 3BWAA 2PUQT 4U3CA 1EO5A 2BRRH 2DMKA 1LILA 4KHXH 4QF1B 1K6QL 3TH4T 1KT2B 5EU6E 2DM7A 2QQKH 5FM4A 2ITCB 1RZJH 4QWWC 3MRGA 1MVUA 5GRVL 2D7TH 4UT9H 4CAGA 4M93C 4NQUA 3MV7E 4X98A 4Y5VC 4Y4FC 4NM8L 4WGWB 1ZWIA 3O3DA 4PJ9B 5GS0D 3H9ZA 1KXTB 5I2IA 3RVTD 5IFJB 4F7EB 5DS8B 1P9MA 3JV6B 2XPGA 4PJFF 3VXQA 2ORBH 3DX7A 3QEHA 4YGAB 4B53A 2MHAA 3X14B 4O2FB 2YWYA 1U91A 2IALB 4GRWF 4M93B 3ARGA 2YN5A 5TE6L 3BEVB 2DQUL 2GSGA 4Y5VB 5MENA 4Y4FB 4P5MB 1AI1L 3S35H 5KBNC 5C6PB 2EIEA 1IVLA 4HXAL 2F15A 1YYLL 4H88L 5E1AA 5HYSA 3WKML 4UNTA 5DRXB 5I75C 1KEML 4KMTH 1U8NA 3BT2H 2APVA 4XNUL 5FO8A 4HIEA 4YHLH 5J9PA 2JIXA 1T1ZB 3BVNA 4KDVA 2QHRH 4WVRA 1BVKA 3CDCA 3QCUL 3V5DB 2XG4A 5GGQH 3W5NA 3QG6B 1ZA6B 1HHJB 1ZHKA 4JPKL 5I75B 2OTUB 2Y36H 5HDOA 3CDGB 2EO9A 3FQRB 3OAYK 4HUXB 3EZ8A 5F7YC 4J1UB 4PP2A 4JDZA 4NO2B 1OAQL 4TSBL 3CZJA 1BFOA 1M4KA 1OAKL 3MLRL 2CK2A 2AVGA 4XHJD 2EKJA 3QXTA 2GKIA 4IIQA 2NX5D 1OTUC 1JWSA 2R4RL 3KPMA 1QQDA 1LO4H 1TMCB 2NZ9D 4W4NA 3UTPD 5KW9L 4OCSH 4Y19E 1PSKH 3E0GA 1PAMA 2VH5H 4X5WA 4DTGH 1NDMA 2DQCH 2O5XH 3KLAB 4GQ9H 5EIVA 5HGHA 3WHXA 1A5FH 3U0PA 1KC5L 5CJOH 4AK1A 2WP3T 3HFMH 1UWEH 2NY1D 1JZ3A 3WNMA 4F15C 1QFPA 4HS6B 5DJYB 3TPUA 4GJTB 5JXED 1MAKA 4LIQL 3RI5F 3QDGB 5L2KA 4CW1B 5INDA 1CF8H 1QA9A 1YMME 5D2NA 1U8PB 5SWSB 5T3XH 1MAML 1AP2A 2IAMB 3U4AA 1KCUL 3RL1A 4F15B 1GPOL 5C0RH 4GS7C 4CNIA 5L2KD 4JO4L 3DUUB 4OJFL 1CLOL 1YUHA 3KDMB 1T7XA 4PJBF 4LSRH 5DT1H 4L3EE 2V2WB 1MFNA 3HC0B 3WFEL 1MCNA 1V3JA 4JQIL 5I1HL 5JORA 3SCMC 3QB7C 1CGWA 4RX4A 3H6JA 4NO0B 2CLZB 3R06A 3MBXL 3O6KL 4PBXA 2E9IA 1DLHA 4KQ4H 2WWMC 2NNAB 2APBA 4ZO6A 1J1XL 5F88A 3BP6A 3BPNC 3PWPD 1BOGA 1JZ8A 4Z7WE 3P0YL 5TDNA 4RX4D 2BHYA 3S3JA 3SCMB 4FZ8H 3X11B 1F3DJ 1UM5L 1LNUB 1ED3B 3V6OC 2KQNA 2M1KA 4K7PX 5E56A 3SKJL 3BD4A 4YHYC 1K8DA 1OT2A 1VHPA 2Y5TB 4PJIE 2XRAL 4JHAH 3CLEH 1FCCA 2DTSA 4NT6B 4JFDA 2CDGB 3PWVA 4FQJL 2V2TA 3GKWL 5IB3A 3BPNB 3CK0L 3UAJD 5K9QI 3NACH 2O93L 2HLAB 4WTZG 4DZ8B 2EKSA 1IGFL 4JG0L 2VERN 4OLVL 1WLHA 4GW1A 2Q6WB 3TO4B 4AQOA 5FOBA 4YHYB 3SDXE 4JFEE 4JFDD 4JFXB 1Q38A 4K94H 4ODSH 2X1XR 4ZTPL 4HPYL 1S9VB 4RMVA 5KN5A 5D4QA 2FEDD 4GFTB 4FQLL 4PJFA 4Z0BL 1NANH 3IXAA 4ZFOL 5DK3A 4HT1L 4DOHE 4TQEL 4FQ2L 4MNQB 1QR4A 1R3IL 2VXSH 1B9ZA 1S9WA 4YEFA 1DL7L 3LSOB 3VGFA 3UJIL 3CVIL 4IMKC 4MJ6A 2G75A 3WUWB 3QWOA 3MACL 4NQDB 4GMTL 3ZTNL 3WXWL 5E2VH 3U9PL 4PJDA 2ZKHH 4XNZC 3MJ9A 43C9A 5GS2H 1WAAE 2CD0A 5DJZA 2HJFA 4XB7A 3GHEH 1IGMH 4P5TB 3OF6A 1NQBA 5F7FA 2GHWB 1WUNT 1P4IH 4IMLA 4U1LB 3MFFB 4YWGH 1JN6A 1TETL 1NCAH 4J6RH 3FQNB 3C5ZC 3MO1B 3SE4C 3BZ4A 1A1NA 3EYQC 3B9EA 3SDAC 4KKCD 4NN6C 1A4KA 5IB4B 3QEQE 4FQ1H 4XNZB 4Y1AA 3OF6D 1A1MB 1NKOA 3DRQA 3V6FB 2FO4A 3KHOA 1EEYB 4GMSH 5T1LB 4X9HA 1FC2D 1FO0L 2IADB 5CZXD 5EPMB 2IFGA 1TJGH 3A6OA 2BERA 5D93B 3MRCB 4QTHA 4HZLB 1RZKH 3DUSA 3C5ZB 4LP5A 1CLCA 2LU4A 3VFRB 3F7QA 3TBSB 3HLAA 5DA4A 4NN6B 1A6PA 1NFDE 4RQQA 2X4TB 5EOTB 1E6JH 1V3LA 1CL7I 3RL2B 3RVUD 1JK8B 4MJ5B 3VXMB 1WK0A 5INCA 3VRLF 5CJXA 3S88H 4P23D 5B21A 4PGEB 3VDAA 3MLZL 4KU1A 5ESAA 5J57B 1BMGA 5FHBH 1CI5A 3OJVC 5A2LH 3AVEA 3IAGC 5D5MA 1QRNA 5JQ6L 2EC9T 4NQTA 5L8JB 3QUXA 3HB3D 2YA0A 1S7SA 1IGTA 1WCQA 3OGCA 2O61B 5EIQA 4CJ1A 1B0GB 3VXPA 4RRPG 1FRGL 2V7HA 3ESUF 5BS0A 3FB8B 1RV6X 2BP3A 5IB5A 4NDMA 1BD2B 1QRND 1UT9A 1PFCA 2ATPA 1KXVC 5F7DB 5IIEB 4QRQA 4PJBA 4RGNC 5EUOB 1Q72L 5F9OH 4DGYH 1Z3GL 5DQJA 4CU8A 1P5VA 1T0NA 1CFTB 1EBAA 4ONGL 2ADJA 1TQCC 4AH2B 5EH1A 1MHCB 4MNGE 3KPSB 1AGFA 1JGEA 4L3AA 1TJIH 1ACYH 3BESR 1VGEL 2DQHL 3UTTB 4RGNB 3U0TB 3X12A 5GS1A 3TCLA 2FD6H 3RWCB 3SGKA 1TQCB 4F2MA 2ZUQC 4M61A 4QRPB 2GITA 3QXDA 1GGTA 3LEXA 3LN9A 1TFHA 1IJ9A 5TDPB 2CKBL 1NSNH 4Z5RB 4NUJA 1NJ9A 4MZ3A 3PL6C 5A2JH 2PNDA 4NFCA 2FH8A 2H9GB 5L8LB 3DLQR 3VJ6B 1P7QA 5C6TH 3STBA 2ZUQB 3SGDH 4G6AC 3BH9B 2J6EH 3X13B 2NY5C 5HTSA 3FB6B 4DK6A 3P9WB 3OAZK 3FRPG 3FN9A 1MFBL 1K2DB 3VE0A 1FP5A 5FA3B 1T89A 2QKIA 2ZUWA 4U1IA 3CFKB 1WBXA 5C1MB 3THMH 4CUCA 2YA2A 4L9LC 2W60B 4ELMA 2GQHA 3NCYP 4G6FD 4IOFD 4QNPE 1YN7A 3MLUH 5D8JH 1MI5B 5DRNB 1TVBB 4F7CA 3R1GH 3IT8D 5CHNA 5BRZA 4WCYH 3MREB 5C2UB 4WUKH 3TNMB 4L9LB 3QDMB 1KNOB 1D5IL 3O41A 1J10A 4PRID 2R2BB 1SY6H 4R7NB 3MLVH 1XEDA 2R2EA 5DA0B 3QNYA 3GBML 2DL9A 3BAEL 5DVNA 2ATKB 3W11D 4KRPD 4V1DE 2F5AH 1C12A 2R0ZH 3LKSA 4MQ7A 4XNQA 5I19L 5I8KH 3SHSA 3HNSL 4ZAKC 3T4YB 2P5EE 1U58B 1P4BH 3VXUB 5DJXB 1I1RA 1EAPA 5I30H 1EJ6A 1F4XH 2NY4D 4IRJA 1AFVL 4K3DL 3TWCL 4GBXC 4PLNC 2BDNH 4OLXH 3EOTL 1D6EA 4MQTB 4XRCB 5IW3A 4KK8C 1EHAA 5LJYH 2K1MA 5EUKA 3QWQB 4ZAKB 2C1OB 1D5MB 4QGYA 1MF2H 8FABA 5DD3H 3TH2T 4NM4L 1OCWL 3B8SA 1OPGH 4ODHH 3RVVC 4XI5C 4CKVX 4GBXB 1UQSB 2EYSA 4HIHA 1BQHG 4X6EB 1RU9H 1KCVH 2C4XA 3LV3B 4ONOA 3U2SB 3S97C 4KJPC 3LKPA 1BREA 2WMPA 2XNAA 4LLWB 5F1KC 1MCKA 3LN4B 1FL6A 4WV1C 1S8DA 2DN7A 3L5XH 2D31B 3I6LD 4LU5H 4PRPE 4S1SH 5KS9B 1RIHH 2XTJD 1ZHLA 1XGUA 4OZHE 4RAUB 4NKDB 3SE8L 4BM7A 1MJUL 4M43H 4G8FB 2OP4H 1JGUH 2AKRA 2GJ6E 4G5ZL 1BQHB 1NCDH 4HBQA 2VLJA 1QYGL 2VXUH 3MRIB 4X99A 3V5HB 1H3VA 2B1HH 3CXDH 4LLVA 2E7HA 5HDBE 2H26B 3NFNA 2YK1L 2A6KB 4UT6L 1HKLL 1JNNL 3G5VB 4YZFE 1UG9A 2EIDA 1DUZA 1T0MA 3CUPA 1ZTXH 5ITBH 3OG6B 3DNKA 3CSYA 5T33L 3BGAA 1G9NH 4UIMB 4E41B 3BSZL 3PDOB 1A64A 1TVHA 2MQ3A 3GMRB 1G7QA 1TNMA 5E6ZA 6FABL 5F44A 3VWKD 4R6UA 2AJXL 1SEBB 5EORH 3UMTA 1DQLL 4J4PD 1NGPL 5GGRB 4YDKH 1FVEB 2RQ8A 3HI1A 4PRHB 2AXHA 4MMZC 4PJXB 5IR1A 1FL3B 1WBYA 2X4RA 5D7SH 4ENEC 4HFUH 5I1LB 4HEPG 2YD5A 3RIAK 3LS5L 2SEBA 3RIFF 1K8IA 2IQAB 4HFWB 4YDVB 1NDGA 4XMLH 3LVEA 4OGZA 1U8LA 1W0YT 3X17A 5E94B 1Z9LA 4HEME 1CXLA 35C8H 4ORZC 5BZWB 4CBPA 4RWYL 1RK0B 1OP3H 3BKJL 4WTWA 4X4YB 4FQCH 3ZZ1A 3B43A 3AS3A 1IQWL 1JNJA 2DMBA 1JGDB 4KZEL 3OXSB 4JVWA 2VTFA 1EMTL 4XH2B 5IB1A 5MENE 2W0FB 2O5YH 4FMKA 4L8SC 2YEZB 4QRTA 1CFVH 1IZKA 3LDBB 3V6OA 5EZLA 1S9XB 3ZKQD 2X1QA 3WHE0 4GG8B 1IAKB 4WFFD 3QCVL 4HIXH 2C7UA 1BQUA 5IMKA 4LMQI 4N5ED 1J87A 1SMAA 4L8SB 1AQKH 2HKFH 2FSEA 5EU7C 5ESQA 2DBLH 1WVZA 3GSUA 2F19L 4KHTL 5E95B 1FGNH 1VESA 4AJ0A 1OM3H 1RUML 1FIGH 1FAIL 3FOMA 3QSKB 4H8WL 1NC4A 5F3HB 3D85A 2VC2L 2B2XL 3UPAA 4J8RB 1N0LA 5KVDL 2AK4B 5I66A 5IEHB 3EO1B 1LMKA 5J12C 5IK3A 4E0RB 4AT6B 3ES6A 5IHBA 3D85D 4K9EH 1OGAA 1JFQL 3H9SA 1JPGA 2QR0B 3OMZA 1M7IA 4HGWA 3WIFA 4I4WA 4NZRH 5F7LB 3MRPA 1YNLH 4YIQA 3TT3L 4N0CC 5FHAH 2PYFB 4OLWH 3SDAA 5C9JB 3EO9L 5L2KE 5DLMH 5D6DA 3AGVA 2DLIA 5EZIH 1WV7T 3LRHA 1PZUB 2C3HA 5D2NE 5JW3H 1FE8H 2VIRA 3LH2L 3UTSA 3ZL4H 4UT7L 4LGPB 3EYOA 1CIUA 3FO2B 5BW7C 4ZMAT 4RFNB 3GI8H 4XCEB 5CP7A 5L6YL 3HMWL 1I9JL 4NYLB 1PYWA 1RK1B 1P7KA 4G9FB 1I7RA 5E00A 5T3XD 4ZS6D 5MEOB 1GGBL 5GGUA 1ZANH 1KJMB 4U0QB 3CMOL 5C08A 4M9PA 3MV8D 3HZVB 3TH3T 4AM0A 3LY6A 2X4NB 4TVPH 3LQAH 5DFTA 3QUYA 3WDJA 4P2QA 3HPLB 4RIRA 3TYGL 1N0XL 3T1FB 3FO9B 4RDQG 3ZE0F 1SYSB 5ICYA 3TJEH 1IARB 2VYRE 4LPUA 1NCBL 2NY3B 4M6OL 2UUDH 4JFYA 3ZO0A 5DVOA 5IKCA 1QBML 3FQXA 4JFDE 4P2QD 1CIDA 1CG9A 5DMYA 4KQ3L 3OAUH 3WIIH 1YEDA 3HAEA 1KB5L 3RWEA 1UJTA 5BQ7A 4YHNB 4Q6IC 1CCZA 3OZ9L 5GZOC 3TEUA 3DROA 3R8BB 1U93B 3EW3B 5AYUH 5E8NB 3BEWB 3O2DL 1WFOA 4PJFE 3HR6A 1CU4L 1YEJH 3I2CL 3ULVL 4WTXA 3TBVB 3KXFD 1UXWB 5HHOB 3RNQA 4E5XB 1MY5A 1KJVB 4N90E 3GUTA 4G6MH 5J06A 4FTVA 1A7PH 3C6LC 4R0LC 4HX1A 4UV7H 3KYKL 2A9NH 3QUZC 1DFBL 4MX7A 4OT1L 1UCBL 4WENB 4NQCA 1IGYA 1N8ZA 4M02A 3ARED 1MH5B 1MHHA 4EI5A 4BH8A 4PJDE 4LEXH 3ARTA 4EVNA 3GMPB 4CADA 4HKJA 1F90L 4YX2H 4TRPH 2DL2A 3NIGF 2R29L 2QL1A 4FTVD 4O00A 1HEZA 2EH8H 3TBWB 3VMPA 5DD5H 1L7TL 3WJLA 4R0LB 1KV3A 3OWEA 3H42H 2N7AA 4ZUWA 5F96L 4EI5D 2C3VA 4G8IB 1KPVA 1I1FB 4UQ3A 4Y1AE 4OFDA 4GG6B 5GS2D 5KSAC 1WWBX 2YD6A 4LQFL 4R4FL 4DN4L 4B0MM 3O3UN 3OXRB 1Z0NA 5E5MA 4R3SA 3DXAA 3LAFA 3O2WH 4OGYH 3G5XA 3IVKA 1FQ9C 1NLDL 2AXFA 5DHVA 5I0ZA 4ZQKA 2BVUA 4M8QA 1SYVB 1IEHA 3GJEA 3FONB 4JKWA 3PGDA 3LKQB 3TN0A 2F58L 4QHNB 5BOZG 3BZFB 3UTQA 2RFXA 4C55A 2VLKB 1JZ4A 3I6KB 4XBEL 4UU9A 3NFPA 3EGSB 4Z0XA 2MFNA 1NFIA 4UILL 4UDUB 1FG2A 1XR8A 4PRNB 4BSJA 1B90A 1QRNE 1G7PA 5D5ME 1S7XB 3NH7H 3FHAA 4KMLB 4MXVF 3HNVL 4OIIL 4XVJH 3QHFH 1I1AC 2DDQL 1TNNA 1RZFL 4M3JA 4L1DA 2Z91B 1T5XA 2YD1A 3T3MF 2VSCA 1ZGLA 1LEKA 3SY0B 12E8H 1UZ8B 2XQYK 3HNTL 4PGDA 3KNBB 4PJBE 1Z9MA 3C5JA 5LCVH 1JGVL 1FZKA 4BFBD 2X9XA 5DURB 1E28B 1P4LB 2FWOA 1I1AB 2IBZY 3BDYL 5EA0H 2R0LL 5CJ5A 1PLGL 2YRZA 3P9MB 2E7LC 5EU3A 1IAIM 5GGVL 4OGAC 5J6GA 4ODBD 1OL0A 1GYAA 5IVOA 2NTFB 4WV1A 5DJ8A 1LO0L 4XCFL 3DBXA 1MFEL 2H2PD 4FXGA 4WNQB 2X89D 5FDWA 4JFFD 1Z9OA 2VJXA 2AEPL 1MCPL 4AEEA 3O3EA 3CFCL 5C07D 1S3KH 3U7YL 5DD1H 3T4AA 4ETQA 4D3CH 4JFOA 3QCTH 5C0CD 5C71A 5FYJL 5BO1H 4LVNB 1EHLL 1KTDA 5LXGL 3AB0C 4X6CF 1INEL 5HYEA 1L9MA 1NAMB 2EXWD 2CPCA 5ILTL 1FZJA 5SX5H 2J8UB 1LP9B 3Q5OA 3RZWA 1T6WA 2NXZD 4HKZA 3BO8A 5HGAB 2Y72A 3CDYA 4H26A 1OGTA 4HS3B 5TFSL 4ELME 4XWGH 4O51A 3CCHB 4K2UH 2WBJA 3RZCD 3M8OH 5DJ2B 4ODWA 4N8VA 3I85A 3TFKC 5EFIB 3PIQB 1XF2B 5BRZE 1KXQE 5IMLA 4XP9H 1RIVH 1G6RA 1J86A 2I5YL 4TUKH 3VG0L 4MMXC 4OF3A 4NQXB 3FTGA 4ISVB 2NPLX 4KK9C 2IANB 1AH1A 5HXMA 2AV1B 1G7LA 4KAQH 4RMTA 4M7KL 4X6DF 1C08B 1BECA 4PGCB 1ADQL 4RCAA 1UFUA 5A2KH 4KZDH 3BKYL 3QIUA 1GAFH 2ERJC 4D0CA 1L6ZA 3D39D 4X4XA 4R4BB 5CUSH 3P4MB 1G7MA 4Q9BA 4LOUC 3V5KA 2E6JA 4UZGA 3NBNA 2WV3A 3NPSB 1HQ4A 3TVMC 4ODVL 5CGYD 2DLEA 3GMMA 4U1MB 1L9NA 2JJTC 1M71B 4U6TA 2OL3A 1R0AH 2VZTA 1O7VA 2ERJB 3EHBC 5CJ8A 2R8SH 1HCFX 3T0DA 2BNQB 2JTDA 1GJIA 3TVMB 5I1IL 2VSDA 1CXEA 4APQB 1VPOH 3WNOA 5F9WB 1J0IA 4EUPA 4NWTH 4Y4KC 3D0VB 1M7XA 5IG7A 2VAAA 4GRMB 3VFPB 1B6DA 3FFCB 3MZGB 4EN3C 3MJ7B 3G5ZA 1XR9B 4Y4HC 1OOAA 4XCNA 2A6DA 1AKJD 2APFA 2DLTA 5E6IC 4R97C 3IF1B 4TSAH 3BISA 4J3OC 4Z8FH 5H2BB 2VLJE 5C0DA 4LCIL 1QO3B 3E6FA 5EC1A 3ZYOA 4HUWB 2C3GA 3DX6B 4FRWA 5JOFA 4Y4HB 4NUGL 2WIIA 2D0FA 4EZMA 1UZ6E 3BQUA 1ZLSH 4R97B 4F9PC 3STLA 5B3NA 2OR9H 1KGCD 1WBZB 1TCRA 3TA3B 5C0FA 2NW3B 1RFDH 4M5ZH 4YUEH 5F7EL 5FUOL 1OSPH 3TV3H 1UKTA 1T4KA 2VLRB 2OQJB 1YEHL 3O3AB 1GZPB 1U8KA 2YC1A 1QLRB 1TZGL 1IT9L 2G2RA 1CT8A 1H3TA 1AGBB 5BW7A 2FJFB 4MVBD 1FNEB 3BE1H 4RA3A 1FC1A 1N3NB 1G7JA 1J0HA 2NW2A 4FQXA 4YJZL 3D0LA 3NAAH 2G9HB 3NN8A 2BFVH 1LVEA 4X7DC 4POZC 2EECA 4LSTL 5ADOL 1S78D 4NO3A 3RWHA 4UV4L 3B2VL 2NCMA 4O2EB 1XGPA 3L9RA 4WFFE 4U4BA 2IMMA 4YHML 3KPRD 1T5WA 3RJQB 4M1GH 2FZ3B 3M17B 3IDYC 3WNPA 1HQRB 5D1ZB 4GAGL 4I3RH 2X10A 1AY1L 1W0WB 5F3BA 1R5VB 3ECBA 4KC3B 1PEWA 4OAWA 3NCBB 1KFAL 1KPRB 3V6OE 4ZFFA 4RFOH 3OKDB 1I1YA 3Q6FA 3ZHKA 3VDCA 1MHPL 4L29A 3NCEB 2HG5A 3G08B 4NJAH 4ZOEA 3PWUB 4QRRD 5LBSL 5TF1L 1U8IA 4LLAA 2VISB 3QNXA 3RTQD 2XN9B 1KIUA 4J3VA 1DQQB 1SJHA 3F62A 3ARDC 1DN2A 4QRUA 5JW5A 2VMFA 3MRFB 4G42A 2HFGL 2BC4A 4MLSA 4RAVA 4AIZB 3IXTB 5FDYA 3VGGA 5KZCB 4JY6B 2C1PA 5I1DB 1S9YB 3D2UD 1F4WH 1N7MH 5FOJA 2NY7L 4KXZH 4X6DA 3S4SA 4IOIB 3CC5B 4D9QE 4PB9L 3ARDB 2YD8A 3SKNA 3WFBH 2PO6C 3CMGA 1ZLWK 43CAB 1EXUB 1YQVH 2VDRH 1J8HB 4QYOA 2G5RA 1TZIA 5C0GA 4PB0H 3D25A 3LKNB 1OQOA 1A6WH 2F8VA 4OZIA 3MYJB 3JWOC 4KTYA 5CBAB 3B2UD 5HY9A 3GMLA 4PLJD 2A74A 3M45A 2CLVA 4KI5C 1OGAE 2PO6B 3PNWA 3FT4B 3H9SE 3RWFA 1Q9KB 4CVWA 4HGMA 5ELIA 3ULUL 2X5PA 1ZA3B 3CFEB 3MRQB 4OKVA 1DP0A 4LAQL 4HUMB 3FOLB 2DQIL 2LVCA 4ZXBB 1BFSA 5DGQA 1R5IA 1U3YA 2XZQH 5FYKE 2YD4A 1FZMA 3BW9B 4DQOL 3VI4F 3LEVH 1RURH 1LK2B 1X7QB 3UTSE 4MAYC 1NGXA 4QOKD 4OFYD 1QFWL 3PQYA 2V7NB 2EDHA 4U1GC 5D7IF 1LEIB 2APXA 5B39A 1JVKA 1FVDA 1H0DA 3MRHB 1OTSD 2C5DC 1FV1B 4H0IA 2KH2B 5JW4M 2AEIT 3IJSA 4HC1A 4P57A 4MAYB 1KACB 3GSNA 3V4PL 5C08E 3ZHLA 2K7QA 3Q6GH 3C08L 4LBEA 4HHAB 4F9LC 3OSKA 4PLKD 2ZNXA 5D7JD 5FB8B 4P2QE 5TPWH 4XC3H 2VITB 3DMMD 5F93C 4G8GB 4DGVL 3IJHA 1E4JA 3UPCA 1NBZA 4NOBA 3L7EA 4HH9B 1EEUA 3EYFA 4M5YH 2A9MH 2EC8A 4JGMA 5KVEH 4TVPD 3FRUB 2FBOJ 2JCCB 1FLRH 2CJUL 1X6NA 3VWJC 1JUFB 3EJZD 1CR9H 3EDJA 4HK0B 1FFNB 2XWTB 1WWWX 4G3YL 3BP4B 1T7VA 2FEEI 3DWTA 5FKPB 1DJSA 4AL8H 4BFGA 4TTDC 2APWA 2L7JA 3DIFB 3WV0A 4LHJB 2Z35B 4FFZL 1I8KB 5LGHH 1YYML 3PHOA 4PYGA 1T04B 1NLBL 3VWJB 5JO5A 3ISWA 1QOKA 3MUGA 5DUBB 1FSKB 1NMBH 3T8XA 1WZLA 1PGRB 2RCSH 3C5SA 2CIKB 4FTVE 2NY2C 3KS0H 1AD9A 2F74B 2VDKH 4EBQL 1QSEA 4NQCE 2DS4A 3JV5A 3CH1B 5F7WC 5DDHA 2DJSA 3C60D 1FNFA 1MCSA 1X44A 4MQSB 3RAJH 4E42B 5IEKB 2HVJB 2AI0L 1A7RH 3RDTA 4B5EA 2V2XB 4X5XA 2E9JA 1QHPA 4G7VL 5HYFA 3Q3GA 1V05A 1U2CA 2AJ3B 4NRZB 5GJSH 3BDBA 3FN0L 4LHQB 5I76B 5TGBB 3EOBA 2NQCA 4X6BA 2X70A 2LVEA 4Q0XL 5J1SC 5IMOA 2XFXB 1IM3A 4ORGB 1IC5H 5JZ7C 2CH8A 3DXAE 2A0LC 1T1XB 1BAFL 3SPVB 3BDXA 3Q5TA 3U1SL 3LMJH 15C8H 1YY8B 2E7MA 2VLLB 1Q94A 4DVRL 4LMQE 4TPRL 1DVFD 1JTTA 2NY5H 5DEFA 1YMHA 2FGWL 1NGYB 1I9IL 3ZDXF 4ZG1A 5DHYB 4WDIB 3SGEI 5DJDB 1T1YB 4UDTA 1ORQA 3VXTB 5LWYH 1NMAL 4R7DA 2Q7YA 2A6JA 3BYYA 1XZ0A 3LCYA 4HCRL 4NRXA 4HKXB 5GIRB 4XZUA 5IGXL 3QZWA 4RZCA 4IRSD 1XH3A 2ADGA 2JJSA 2IPKA 5ISZA 1LO5A 2CDFA 2P8MB 4HIJA 3SGJC 3MRBA 1S7TB 4YK4C 4DW2L 5E0QA 5AD0A 1I7ZA 3I3BA 4YFLI 3PWJA 2OMBA 5JXAH 1QHOA 3OHXA 3MX0A 3IYLW 3NIDF 4O4YL 4CGTA 2Q8AH 4W70A 4UINL 3BD3A 4M7JH 5ISZD 2Z93B 5CINL 3LS4H 5D7IA 2VR9A 3L6FB 3QQ4A 4KKAD 5JLZB 1BEYH 1BX2B 4PG9B 1DEDA 4YK4B 4PY8J 2GK0B 3O4OB 3QP3A 4QHLB 2UZIH 3VCLB 3OKOB 3T0WA 1AI1H 4PJ7B 2NY0C 1EUTA 5D1QC 5HHNA 1QSFB 4K3EH 4F3FA 3IFPB 4XAKE 5DD0L 2RB8A 3QIWA 3WSQL 2WZPD 4XNYH 5EBLB 1T03L 1U3HC 2XA8H 1T6VN 5I1AA 4JG1H 5CSGA 1HHGB 4EN3A 4AY0A 3HMXL 5IBLC 4KUZH 1QLEH 2ICWB 3MUJA 4P46D 1VFAA 5JNYA 2O5ZH 4NQEA 5E8OB 1JHTB 3ZE0E 2GIYA 2NY0B 3GSQB 5D1QB 3TNNB 3NA4A 4Y16B 4FZEL 4LSVL 3CVHL 3AAZB 3QCUH 3R0NA 2HT2C 4ODUB 3T77A 2VDPL 2FBJL 4NNPH 4YQXL 4IS6A 3UC0L 3QWRD 1P53A 4CU7A 3VFGL 1PQZB 2I9LB 3EDDA 4LPTA 4KHXL 2YBRB 3MGAA 1JNHA 1I9RH 2QQKL 2PCPA 3D9AH 3QEUB 3O8XD 3LD8C 3KPQA 4LEOB 2D7TL 4UT9L 2FX9H 3BKMH 3OB0H 3VFVA 4ZO8A 1M05B 1GCFA 4JRYA 1SHMA 5IF0B 5KW9H 4PRDB 1AJ7H 1MLBA 2FL5B 2ZSVA 1BP3B 3SJVB 4NGHH 2VN7A 2NY6D 1H8SA 3WFZA 4ZUTA 3G6JB 4OLYH 5EBWA 5IVXF 3UXFA 5DZOA 4ODXB 5CS7A 2ORBL 5C7XH 1TCMA 3QDJB 2HT3C 2QQLH 1LEGA 3S36X 4D0DB 2FYYA 5D6CA 3RPIB 3F7YB 3MBEA 5GGTA 2QQNH 4WW2C 4JM2B 5C3LD 1I3UA 2R0WH 1A3RL 1ND0A 3S35L 4HWZA 1G6VK 1QVOB 4JY4A 4P3CL 3HE6A 2DQFA 3CJJA 4PRBB 4M1CC 3NIGE 5MERB 3QQ9D 1F6AB 2IPTH 1BIIA 2FIKB 3MCKA 3W9EA 3TIEB 4PJ8A 5IVZB 5DSCB 2ITCA 4HDIB 4KMTL 1F00I 3IETB 3GM8A 4YHLL 4WW2B 3SOBH 4OJFH 5FYLL 4GLRH 1ONQB 4GT7A 3P0GB 3JXAA 2QHRL 3VGAB 2EDDA 4U6HA 1I9EA 5IFJA 4YDJA 3RX8A 4LHUA 4NFBA 3T08A 1BLNB 3JV6A 3ROLA 4WI8A 2BNRB 1GVIA 1FYHB 4LCWB 5F7NC 4PJ9D 1BJ8A 1HOCA 4S1RL 3WFCL 3EDEA 1DDHA 4P5MA 3OKNA 1J1XH 3HZYB 2EE2A 1I8LA 1XF1A 1YEIH 5T1KA 4PJGB 1LO4L 3L3DB 4JFQB 4QWWD 4OCSL 4NJ9H 2VH5L 4DTGL 2DQCL 2O5XL 4HWNA 2I26N 4Y4FD 1A5FL 5CJOL 4G6KH 3UROR 4FXLA 4XPFL 2ID5A 1JF5A 5KG9A 3HFML 1UWEL 2D9CA 3CU1A 4RGMC 4L8DB 4JPWH 5CWSB 4MXVE 5ESVB 2OTUA 2OLDA 5KTEH 1I8MB 4J1UA 5H35A 4OF0A 1JNLH 1N2RB 1CF8L 1VACB 2DQEL 1JPTH 4FABH 5T3XL 3QI9A 4PG2C 1CD0A 3RBSA 4RGMB 1HSBB 5C0RL 2IPUK 5FM8A 3FQWB 1KTLB 2I25N 5DT1L 1S7QA 3HUJB 2CMRL 1JP5A 1U8OB 4JRXB 2ZSWB 4DKAA 3CVIH 5IM7B 4YXHH 4YHIB 3MACH 2HMID 4GMTH 3WXWH 1N4XH 3MXWL 5I8OH 3KPTA 4WFHD 4ERSH 3LPWA 3VFOA 3MPCA 4I77L 4HLJA 5I1GL 4KQ4L 3S9DB 3KPNA 4OLUH 5E8DH 1TETH 1M1SA 3LQMA 4BQ6A 4BZ2H 2BCKB 1NGQH 1LO2H 4FZ8L 3KHQA 5HGBB 1OTUD 1FFPB 2EEDA 4QHMB 1CVRA 4OFIA 2XQYG 4O9HH 3PDDA 1YA5A 5CLWA 1K4DB 5C0BB 4JHAL 3CLEL 3QDGD 3TZVC 5EO0B 3CFDA 5FO9B 2X42A 5I9QB 3O45A 1URLA 5EUOF 2Z4QA 1NEZG 5JHDB 4NPYA 4L5FH 4QTIH 4MCYA 2IAMD 4JPIA 5HI3C 4F9LA 2D3VA 3L3HB 4K94L 4ODSL 2CLZA 3TZVB 1KCKA 4EI6B 4MLIA 1MCEA 3ROOB 5IVXA 4P3DB 1VADA 2VXQH 3HZKB 1LHZA 3MLZH 3BHBB 4KTEH 4CVXB 3S3PA 1OSZB 3STZB 4EQ2A 1NEZB 2VXSL 2Z31C 3OG4B 3QA3B 4NO0D 3X11A 5F8QC 3LPFA 1JL8A 9CGTA 2OTWB 3FKUS 5IOPB 4YXKH 3O4LB 3RGHA 1U41A 1JBJA 4HLZG 2X1PA 4NT6A 2ZKHL 1CN4A 3CAFA 4U1HA 5A43C 1IAOA 3IS0X 5HHPA 3NCMA 4OI7A 1AO7A 3VXSA 1IGML 3SCMD 4MNHB 3ZKXB 2Z31B 4UBDC 4J3UA 1P4IL 1RD6A 4X6DE 3TO4A 4YWGL 1NCAL 3T0EB 1Q72H 1XF4A 1EUUA 4J2XA 4QHUA 4O5LL 2WWMD 3MLTB 4JQVA 1NUDA 1S7VA 3FQUB 3OR6A 1AO7D 4FQ1L 1Q0XH 4F37F 1A2YB 4DZBA 1IGCH 3BP5B 3TO4D 1JF1B 4Q9RL 5F6HI 2VZ1A 3V2AR 4OSUH 1AQDA 1ZT1A 1MWAA 1TJGL 5GZNC 4BFEA 4OZIE 3GRWA 1RZKL 2BVPA 2MTPA 1XIWA 4MWFA 4D8PB 3A6CH 1ZLVK 1VB9A 1EV2E 2V9RA 3U82B 3WUWA 2GCYB 1DBML 4HKBB 3JVGA 4HIIA 1QSVA 2MCG1 1E6JL 4MNQD 4Y5XC 1V3KA 5EOCJ 1NUGA 4PJHB 4QOKE 3P4OB 4P5TA 2RAMA 3S88L 1MIEL 3DX9A 2A73B 3B9KA 4DCQA 4M1DH 1PZ5A 2HT4D 4LSUH 1YJDC 5FHBL 3MNZB 1JI1A 1BZ9A 3SDYL 1U8HB 5D70H 3UJJL 4P5TD 3V6FA 5DD6B 1PG7H 3PQYE 2P5WB 1DLFL 1EEYA 3EBAA 3D69B 5T1LA 1ZHNB 5L9DH 3VA2C 1WIOA 4AZ8A 2YUZA 3CLFH 5BOPA 2IC2A 3BJ91 4QY8A 3S35X 4GKZB 5F9OL 3ALXA 5T1LD 3VXOB 3BFOA 1F11B 3GSOA 4MA7H 1IAII 1ERNA 3RNKB 3C5ZD 1GC1C 3EYQD 4P0DA 4LRIA 4JN2B 1EZVY 4JZJC 4HWBA 4YPGB 1TJIL 4K8RC 1ACYL 4YR6A 2YPVH 3F7PC 5KS9F 1T20B 3WE6B 4ZD3L 5ADPH 4ZO9A 2P8LA 3VXMD 2FD6L 4L4VB 3IDNA 5C0AB 3ARZA 4JZJB 1IKFH 4BZ1H 1NSNL 1AFVH 4GKSB 3MV11 3TWCH 3AM8A 1RAMA 3QXAB 1AGCA 4PJEF 4LP4A 4KMQA 4LFHG 1FZOB 3LB6C 1AXTH 1N26A 3VFNA 4I2XA 2J6EL 1BD2D 4NM4H 1SJXA 5EZOH 1GGUA 5F6IC 3VMNA 1U8JB 3QRGH 5EN2B 1UXSA 3N1PC 3Q2CA 4GUPB 3THML 5AWNH 3MRNA 1T0PB 4YO0B 2XKNB 3U0TA 1QSEE 3GMQB 2GEEA 5TQ0H 2OXHA 3BN9C 3MLUL 5D8JL 2FJHA 1VCAA 1YN6A 3KPSD 5ERWB 2AGJH 5F6IB 3R1GL 4OB5L 2Z9TA 2H6PB 4WCYL 4RGND 1RJLB 4WUKL 4JE4B 1SY6L 3MLVL 2WSKA 1NAMH 5HHXH 4HS8H 2EDKA 4QRPD 4CN6A 2ZUYA 3D48R 3V0WH 1MRFH 2YSSB 4WW1B 4HUVB 5I8KL 1JV5B 4UNVA 1HKLH 1JNNH 2VQ1A 3VRJB 2W9LA 4LPWA 5T33H 1P4BL 3AU1B 1WZKA 1KOAA 5T3ZD 2X4PB 3NPZB 5I30L 4PTUB 5ALCH 1WJ3A 5B38A 5EG6C 4ZUVB 2BDNL 4OLXL 3EOAB 3QUKB 3QH3A 1TVBA 4LCCC 3L3JA 2IH1A 2R23A 5EU6B 4XVTH 1DQLH 2LQRA 1N5YH 1EHXA 3K8LA 1MF2L 4YE4H 2YXMA 3WFHB 5DD3L 3O6FC 5EB9A 3GGWA 2N4IA 3HRPA 4MHHI 1OPGL 4ODHL 5DTFB 2R2BA 3ARBA 4BSVB 1MI5D 1RU9L 4E9LA 1KCVL 5C92A 5ISZE 3BH8A 4LLYB 4LCCB 3MLWH 1HILA 2AEWA 1VA9A 4JAMB 4MXQC 4JLRA 4LU5L 4S1SL 4L3CB 1QR1B 1DBJH 3VI4E 4QXGL 1MUJB 4S1DD 2KKQA 1CE6A 2W38A 4M43L 4NFDA 5L8KB 3P9LB 5D7IE 3RI5K 2OP4L 1JGUL 4P4RB 3S96A 1N59A 3P77B 5JA9A 4JDVB 1CXKA 3MUZ1 1NCDL 2VXUL 3OX8A 2CKNA 3GMNA 5D7LA 2QSCH 4UTAL 2B1HL 3CXDL 3VXUD 2R9HC 3QIBC 2YHGA 2JB6A 1FJ1A 3F5WB 4P4KC 4ELKB 3QCVH 5K93A 5AAMA 1ZTXL 5ITBL 2RHEA 5K9JH 1G9NL 3GB7B 4XGZB 4Z76A 3IDJB 4MDJB 4ZAKD 3P4NA 2V5SA 3QIBB 3S34H 4NQEE 1ZSDA 2D31A 2Y7QA 1V5JA 4JCLA 4GBXD 3B83A 4U6XB 3O2VL 5EORL 1CGUA 2ZOKA 3L95A 1IKNC 4NN7C 4YDKL 3SDCC 4KK8D 4NKDA 5JOEA 2QSVA 2R1YA 3TCXA 4P5KA 1C5DA 4P49A 1C8PA 3SKOB 5D7SL 2HH0H 2XV6B 4Y19B 4EIZC 2MQ0A 3MRIA 1U2HA 2HJKB 2VC2H 4HFUL 1AGDB 3OKEA 4LL9A 4JM4L 1HK6A 3EDKA 3U6RA 1QBBA 5EBMB 1CVSC 1KIRA 3AY4C 3L3GB 4G43A 4JGUA 4XI5D 5C09B 4XMLL 3REWA 4NN7B 4PJEA 3UDWC 3SDCB 3SE9H 1BWWA 5KOMC 1BBJB 4JRYE 3CNKA 5EU4A 35C8L 2MNUA 3N1FC 5A16B 1PKQA 3UCRA 1CFQB 4K71B 4FQCL 3GHBL 1EDQA 3PDOA 1XCQB 5KVMC 3PWNA 1FIEA 1YMMB 4XPGH 3L7FA 3RY6A 5HPMA 4KJQC 4M6ML 5D7KD 5K9KB 4EXPX 5GGRA 3CFBB 2O5YL 3QUMB 4PRHA 4E41D 2OS7A 4RGOH 5DMIH 4D9RE 1CFVL 3EO0B 5IWLC 4U1KA 4F7PB 1S5HA 4FN0A 1R3HB 4X6FB 5E8EA 1T66D 4L3EB 2H45A 3V6ZA 4HIXL 4S1QH 2OZ4H 1CFNB 1HXYA 5D2LA 3UO1H 3WDIA 4UT7H 4PRHD 3W0WB 4TYUA 4KKLD 3KYMA 1H3PH 4PGBB 3IDIB 1AQKL 2HKFL 5CP3A 1XGTA 2GJZB 1FNGA 4U7KA 3NIFE 4RDQF 5L6YH 3HMWH 3QO1B 4J3TA 1G7IB 4M4RA 3RA7H 2DBLL 2GFBA 4LVOB 4NNYB 5CMAA 1FGNL 1OM3L 4C4KO 4Z7WB 2W65B 1FIGL 2YPKA 3W39A 1X5KA 2QADC 3OXSA 4YHPA 3IJYA 2W0FA 2EDQA 4GW5A 3ZDXE 1UACH 4O58H 1OARL 1E4XI 1Z0MA 2YEZA 4PJIB 4ENED 2KZ1B 4X7TA 4D0BA 3U7AA 4TUOB 5TE4H 1A6VH 1N0XH 2BSSB 2F8XC 2P7TB 3IDMA 5C70A 2AS5M 4K9EL 1F97A 4FS0A 1QNZH 1A1OB 2NTSP 1VGKB 3MRJB 5ICZA 5FA4A 2H8PA 5KAQF 3SDXB 4JFEB 4NZRL 1G9ML 3ZDZF 1YNLL 1WICA 2F54A 2FLBT 5TH2B 5FHAL 4OLWL 1R3LB 3G5YA 3ALWA 5DLML 4GG6F 3NIDE 5EZIL 4DOHB 3OZ9H 3LPGA 4ZPTB 3HPJB 5JW3L 3PGCA 4XNMA 3BI9X 1G7HB 1CYGA 3I2CH 3ZL4L 3I6GB 2XA3A 3DVGA 2H1PH 4R2GC 3O9WC 3VH8G 4ZFOA 5IEHA 3L3OB 5DJCA 2DYPA 1A6TA 3GI8L 4WFHE 3OAZH 2PTUA 2EDWA 2VAJA 2YS4A 4P99A 5DMGD 1RZIB 1AHWA 2CO6B 5IBTH 3L5WB 4OT1H 1UCBH 5HYJA 2CLRA 4H5SB 5IW6B 1ZANL 1MQKH 3JWDC 2DYPD 1F90H 4R2GB 4EOWL 3O9WB 5MHSE 3WYRA 3QEQB 3DVIA 3QFJA 5IB2B 2EXYC 5J6HA 3JWOH 4N0UA 4WWKB 4TVPL 3AXLA 3F7VB 4XPAH 3KVQA 3VH8B 5HYJD 3HE7C 1E4KA 1GOGA 1X5GA 4KPHH 5F96H 3OKLB 2EDNA 1NUNB 3HI5H 2P8PB 4OKDA 4N9GA 3TJEL 4CVZA 4GKNB 5ACZB 4MD4B 4BK5A 5DJ6A 4DN4H 2XY2A 1ROWA 3RWGA 4HH8A 5M7QA 4ESKA 2UZYB 3EIFA 1EO8H 3MRRA 4NBYB 5JW4N 3OAUL 3WIIL 3AC0A 1FO0A 3DGGA 4BKLB 1NLDH 1OF2A 2IEPA 1HHHA 2X44D 4KI1A 2YRLA 4XCYB 4G9FA 4LLDA 4N0CD 4N8CH 2LV4A 1MFDL 4L8CB 1D5BB 3VGEA 2N56A 4DFHA 2FGZA 1KLUB 5KSUA 5IVXE 4QT5B 1KJ3H 1UM6H 2GTWB 2Z92A 4HAFA 5TJWK 1H8NA 2VZ3A 2HJLA 1DN0B 4G9FD 1KJ2L 4UILH 2VE6B 1AIFA 4U1SB 1N64H 1MCFA 3U46A 3T1FA 2G5BA 2YUWA 3IKCA 2HVKB 4LF3B 4G6ML 1UB6A 1A7PL 4UV7L 4LDLB 2A9NL 5JPNA 3V7AE 1C16B 1GOHA 3TJHC 1NBYB 1RZFH 2IGFH 1D7FA 4LEXL 1KLFA 3G9AB 2EDTA 4YX2L 2PW1A 1AO7E 3RPKA 2IBGA 3VXSE 1A9BB 1UGNA 1NGWB 5SV3A 4P2OC 1HHKA 2NY3D 3HNTH 5DD5L 4MNGB 3H42L 4U6VH 3IGAB 5HGDB 1R6VA 3T3PE 5C2BH 1BBDH 2Z8WC 3BEWA 1BVLB 1OQXA 3OPZH 3PJSB 2WBKA 5F1IA 4P2OB 1DE4A 1KJVA 2QLVB 3O2WL 5FUCE 4OGYL 1A4JB 3RGVC 5B3JF 1NCNA 3U7YH 2DKMA 3I75B 1HZHH 5FGCE 5HHOD 3WNNA 3GMPA 1GOFA 1MCCA 5FYJH 5EO1B 1K4CA 3BXNB 4M6AA 5DK2A 4JJHA 4PJAA 3E1F1 4UAOC 1YDPB 2CKBA 4NC0B 3REVB 3KYNB 5GZOD 3KGRA 4NHUB 2EDLA 3RGVB 1MCWW 3BMWA 3PF2A 2EDJA 4MSWA 3KPOB 1ORSB 2JKXA 2AJZB 3MGOA 1I85A 5IMMA 2P24A 5IJKA 4MDIA 3QHFL 3BX7C 1SEQL 4P9HL 3GBLA 3HG1A 5TFSH 3WS3B 1H9VA 4LSSH 2CUIA 3U0WL 2WWKT 3QPQD 1P2CA 3MOBL 5TDOA 4KY1L 2H3NA 3ZKNC 1ETZB 3O6FA 4QHNA 3MSPA 3IDUA 5F8RC 1U92B 5HHQB 1MCQA 3HG1D 3WN5A 3GJFA 4PJ5A 1JPFA 4ONHA 4V1DB 2I07A 1DEEB 5E9DA 2P5EB 3OQ3B 5D1XA 1I7UB 2LE9A 4KDTC 2E8YA 3ARFA 1KSRA 1HN1A 1B0RA 3MRDA 1DR9A 2A83B 1S7WA 2XTLA 1HH6B 4KK6C 4GRLB 2VLKD 4A6YB 5E9DD 1D6VH 3MJ8A 1S3KL 3I84A 5DD1L 5FGBA 4FMFA 3BKYH 3QG7H 4QRSB 2VL5B 2DF3A 2PW2B 4JKMA 4JANB 3UBXI 3P30H 4D3CL 3QCTL 4NKIH 4WO4A 5BO1L 3UYOD 4FA8A 3SN6N 3PXJA 4N9OB 2IPUG 1UZ8A 1TQBC 2BNUB 4IDJH 1OAYH 3RP1A 3U83A 1J0YA 3NCYS 3M1BA 5CIPA 5AUMB 4I2XE 1EHNA 2JLLA 1KCSH 3VW3H 5I15L 1B2WH 4K3JH 4UOW1 4WO4D 4KROB 3RIFK 1KG0A 4PJCA 4PRPB 4JFZH 2DMCA 5I8CA 3L3KA 5DURD 3MR9A 2RBLA 2HFEA 3X3GH 4C83B 1I1AD 3NFSL 4XWGL 2GJ6B 5FECA 4K2UL 5DQ9A 5EU5B 3M8OL 5FIEA 2UVEA 5EO9A 2YPLA 1A47A 3U9UA 2WBWB 5E4EC 3DSNA 4XP9L 1RIVL 3E2HC 2FHBA 4TUKL 3UPRB 4HD9A 2FX7L 3GSRA 5CD5C 3N1MC 3E6HB 1D9KB 3K4AA 2OJEA 3JZ7A 5T3ZE 3VGHA 3TBYB 3RJDA 5TE7H 1PEZA 4LLQA 2VNCA 4KAQL 5IT2L <