2IALB

Structural basis for recognition of mutant self by a tumor-specific, mhc class ii-restricted tcr
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
239
structure length
239
Chain Sequence
AGVTQTPKFRILKIGQSMTLQCTQDMNHNYMYWYRQDPGMGLKLIYYSVGAGITDKGEVPNGYNVSRSTTEDFPLRLELAAPSQTSVYFCASTYHGTGYFGEGSWLTVVEDLNKVFPPEVAVFEPSEAEISHTQKATLVCLATGFFPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the recognition of mutant self by a tumor-specific, MHC class II-restricted T cell receptor
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords CD4+ T cell receptor E8 alpha chain
total genus 57
structure length 239
sequence length 239
chains with identical sequence D
ec nomenclature
pdb deposition date 2006-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ialB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ialB02
4WW1B 3RVWC 5H2BA 1S7UA 4OZIA 2ZSWA 4P2OB 3LDBB 3QEHB 4Z0XB 2MWCA 5CIPB 2A83A 4LU5H 5F7KC 5TDOB 4EDWH 2ED8A 4YHMH 4X7TB 1UH4A 2BNQE 5C0GA 1A6UH 1IARB 2XFXB 3WUWA 1I3GL 3OAYH 4M7KL 3CMOH 1TMCB 4PLOB 3NCMA 1YC7A 4F7PB 4XT1C 5DRZB 2JIXD 2A0LC 1WWAX 1U8JB 4W6YB 4P46D 1RJLA 5E0QA 3VDCA 1KCVH 1MHEA 1MFDH 1IGJA 1MCOH 3REWA 4XCNB 3SDCD 1T03H 3JV5A 4KI1A 2FIKA 2P8PA 5TH2A 4R0LC 3E8UH 5HY9A 1BWMA 1S8DA 1JCKA 4L3AA 4AG4L 3KYAA 4X0KA 2DD8L 4F2MA 3QZWG 2H3NA 3UC0L 2EDEA 2F5AL 5IHBA 1U8QB 1VFMA 1WF5A 2OZ4L 4O2FA 1I85A 4NZRL 3QDGE 5DLML 2WINB 2NW2A 2AV7B 5IUSA 2K9UA 1FGNL 3MNVA 5EOQL 1MREH 3IAGC 2FD6H 2FLRT 2VLKA 2NNAA 3KS0H 1CICB 1S78D 4JRYD 3VCLB 1CK0H 4MSWA 4XMKL 2OTWB 4YHIA 3UTQB 4X6DF 2W0LA 1U93B 4LGPB 3KVQA 1OW0A 4KMTH 4N0RA 3MV9D 1FJ1B 3TA3D 5DO2C 4NNPH 3DROB 2I9LB 5J1SC 4Y5YA 3LKSA 5JORA 5J4MA 1FGVL 2E8YA 1YN6A 2MPAL 1T4KB 4U7MA 3DURA 1KB9K 2YA0A 3MRHB 4E0RA 4MD4A 4JM4H 2LVCA 4K7PH 3MROB 3MLVH 4OLXH 2VL4A 3O6KH 4QRTB 2AJSL 2PW2B 5HJ3B 1FFNB 1HKLL 4GG6B 1U8PB 3ZKND 5INDB 3SQBA 5DMIL 3RGHA 4R8WH 1BFSA 1KN4H 1OTTD 2HH0L 1H0DA 2DWEB 2PYFA 1U58B 5GS0L 5EOCL 5HGDB 4XPFH 1RIHH 1JPGA 1T2QL 2Y23A 3MRQB 5A3ID 2VXTL 2P5WB 3HZYB 2DIJA 2AI0L 3FQTB 3OJDB 4NQCB 1KJ3L 5L88L 4H8WL 1V3JA 1HNGA 2GAZA 4FQXD 1YA5A 2VABB 4OCSH 1FL6A 4G3YL 1CGUA 3DO7A 4KKLC 4LCWD 3BOVA 3BRFA 4LRNL 4O5LL 5C3LD 2VC2H 1I7UA 3R06A 1TPXB 3Q1SL 4U0RB 3T8XA 3OAUH 2JJWA 4RGMC 4U6YB 4MD0A 4OB5H 4V1DD 1KBGL 1SBSH 3QUZC 5GGVY 3FQNB 4UT7L 3T3MF 1N59A 5ESVB 4LDOB 1ZWIB 1KELH 2Z92B 4WUUB 3TN0B 3ZTNH 3MO1A 5FO9B 4RCAA 1T4KA 1OF2A 2CQVA 1OP3K 1FZJA 1Z3GH 1KB5A 4KI5D 4ONHA 2D7MA 3SEPA 5FHBL 1TFHA 3SCMB 2DWDB 3SOBL 4DN3H 2OR7A 2JJTA 1NCAH 3V6FA 1BMGA 3O6FD 2ADGA 3OR7A 4JKLA 3RL1B 3TIDA 3FN0H 1SVCP 1WCQA 3NGBB 3MRIA 4F3FB 4QWWD 4QCIB 2ID5A 3B2VH 4XAKE 5JIKA 1KJ2L 5EU6D 3P40A 2X6MA 4R0LA 5M95B 4QRSA 2MNUA 4X9IA 4HDIA 3QXDB 3V7AG 4EUPH 2Q1EA 1OTSC 2DJSA 3MOBH 1QSFB 2X4OB 3QG7L 3FQRB 3V5DB 5GSVB 2ICCA 3O9WB 4NJ9L 1NGQH 3HNTH 5E5MA 4JFHD 4LHUA 5TDPA 2M1KA 5I1LB 4OI9A 1DQJA 4KI5F 2EE3A 1NBVL 3MTRA 4FP8L 3BZEB 5C9JB 1Z0NA 2FO4A 2VLJA 2VZOA 3BWAB 4X9HA 4XNUL 4JZJC 3RZWA 1F11B 1YJDH 1JHLL 4BZ1L 1RHHA 2FIRT 2VITA 2N7BA 3OL2A 4B7IA 2WBKA 2IANB 2DWEA 3SE3C 5T1DH 3QI9D 4AQOA 1EO8H 4KTDH 5HGDA 2A83B 3IDMA 1R5WA 3BVNA 5CJOL 5CJXA 5KAQF 5IB1A 2BNRD 4DCQA 5DK3A 1YMHB 5J12C 5ISZD 3MV7E 1G7IB 4O02H 1W0WA 4DUVA 1MJJA 3JWDH 1DTUA 3PGDB 4K3EL 4GW4A 2ZUTA 2YEZA 3GHBL 3GRWL 1ZEAH 1JYVA 3A67L 4EN3B 1QFWM 3K4DA 1T3FB 1IC7L 3T2QA 1PEZA 2ZCLL 2X1XR 3A6OA 2R56H 4HFUL 4MDJA 3PWUB 6FABL 3UTTD 4C58B 4HJGA 5I73B 3T0EE 1XGTA 3VFTA 4M8QA 4UV7H 2X1WL 4GS7B 4WWKB 1I9RL 2E7CA 2E27H 2Z8VC 4BZYA 3JWDL 4UOW1 1E4KA 5IEHA 2HJFA 4OZGF 2X4TA 4JQVC 2BVOB 3T1WA 5F9DC 3MCG1 4TRPL 5CD3B 3WLWD 4PGCA 3QQ9C 1JRHL 3QUZA 3K7UA 2NW2B 3K4ZA 2VLRE 4JFHE 4YXLL 4KHXH 1QD0A 3EHBC 1XGRB 3CH1B 4ENEC 1EIBA 1P7QB 3IB4A 4GAGH 4K9EC 1TZIB 3CVIH 2FEEI 4HIEB 5DURD 1JZ5A 5E00B 4XNYH 2CLRA 4QGYA 2EIEA 4N1CA 1S8DB 5DD5H 1UVQA 1ZLWK 3C5ZC 2YRPA 4DW2H 1OP9A 1UWXH 1NAKL 5L2JB 2A38A 3FB8B 4O9HH 1IT9H 3O41B 1BD2E 1QLRA 2Y25A 4XP6L 2AABL 3F58L 4B0MM 4HUNB 4ODWB 3WJJC 4S1DC 4FQHA 5EPMB 1NMCB 3ILPA 4M1GH 3MRBB 2YSSB 4AMKL 3VG0H 5JZ7D 2VLKE 1KENH 5HDBF 4O58L 3GIVB 3AMLA 3OGCA 1URLA 1A5FH 3FHQA 4H26B 1T22B 4PRHE 1GZQB 3X14A 3EYVA 3GSNB 3BGAA 4P23B 5E5UB 4DK6A 4K8RD 3WD5L 5D2NE 4JPKH 2KZWA 5E8PB 1NCWH 3TNMB 1FZOA 1INEH 4AIZB 1AH1A 2ATPA 3TJEL 1ZGLM 5M94B 3OZ9H 3NTCH 1PG7L 4EI5B 1OT1A 4QKXB 3HI5L 2ZJSH 3RKPA 2OR8A 1R3KB 1TJIL 3QUYA 5B21A 1SMOA 3CSBA 3LV3B 3WFDH 4C54A 1INDH 1QRKA 3DVGA 1K4DA 5EA0H 2QQKH 1KPRA 3VGBA 4HQQL 1ZA6B 5TQ2L 2DLFH 4AEEA 1ADQH 2Z92A 4WUUA 1UG9A 3KR3H 5ENWB 3HI6L 1N59B 1XZ0B 2J88L 1G7PA 1E4JA 3DETC 1IRAY 5E08L 5JW4Q 3HI5H 1UA6H 3LKPB 2A6JB 1VADA 5IVXB 3SE9H 4BFBD 1TZHB 4Y1AE 4UINH 4Y19A 3G6JA 4G7VL 3IRPX 1A4JA 4PJ8C 4F9LC 1ES0B 2DICA 1BEYH 3D3VD 4KRMB 2OQJB 4Z78A 2GITA 1JZ2A 2VABA 4LSDA 4NBXB 2Q20A 5CP3H 4CN1A 1DL7L 4G8EA 4GRMA 5CZKA 3E1F1 4R9HA 4HKBB 1QSZA 1BD2D 5IG7A 5ISZE 4PGEA 2PYEB 3AS1A 3SE9L 4NO0D 4R90L 1GC1H 5DD1H 3QIWB 2V5MA 4G8GB 4GOSA 2PO6C 5D1QD 2UUDK 4GAJL 4LLWA 1DVFD 5E03A 4J12A 3EZJB 4RWHA 4JPVL 3LN9A 5CEXA 1TVBB 2RIKA 1UWEH 3Q5TA 1IJ9A 1A14L 2NTFA 1BM3H 4X6EA 5SWSD 4XVTH 3OKEB 4KK9D 3UJTL 2B20A 4JVWA 4WU7A 2R1XB 3ZL4H 5DD1L 5CEZD 3PE9A 1PZ5A 4LAJH 4LGSB 1LO0H 4X7DC 4OGZA 1BECA 2V5SA 1FL5B 4N8VA 1TVHA 3FKUS 1NCUA 1YY8B 5MEQB 5K9OA 3WS6A 4BSJA 5I1EH 1UCBL 4ORGA 3MRIB 4F3FA 3QRFM 1D5XB 1L9MA 3CCHA 2EIZA 1QVOA 3C5JB 4JZOB 3OBAA 5DUML 5FCUL 4WDIB 4BFEA 2EDQA 2GTWA 3OKMB 4NC1E 2AQ3A 5E2UL 4NCC2 1C5BH 3MUGA 2BXYA 2F5BH 2F53D 2RGSA 3D25A 4DN4L 1TJHL 2I24N 1AGBB 3ZL4L 4P46A 1OAUH 4XNXL 1KYOK 1M71A 3S96A 3FT4B 4PV8A 3SDAA 2OP4H 2Q86B 8FABB 1JTPA 4FQIL 4L8BB 4PUBH 3QIUC 1HEZA 4PJ5D 2Z8WC 1DN0B 1JZ7A 4P2RB 2YRZA 4YXKL 2IQAA 4Z8FH 2YK1L 1DQML 4FQHB 1VERA 1F8TL 5AZEH 2N56A 3BD3A 3P4OB 5D2NC 3NGBC 3DETD 3PHOA 4XRCA 2ZSVA 4PJCF 1CDHA 4XBEL 5IMKB 4ZAKA 5IK3B 2CIIB 1F4YH 3AXLA 1WTLA 3CPLB 3DX9B 3ZT5A 5LXGH 3FO9A 4OD1H 4ZFOA 1EPFA 4OIIH 5E1HB 5EBWB 1WZMA 1XF2B 1U92B 5FCSH 1F4WL 4RAVB 1ZT1A 2LU4A 4M1CD 4RGOH 5B4MD 4Y5YC 1D5MB 1IEAA 5I30L 5TDNB 3MLXL 3T65B 5F9JB 4Z8FL 3CVHH 1HXYB 1C5DB 5IHZA 2XKSA 2E7LC 1HHGA 2IPTL 3ULUE 3FRPA 3A6BL 5DK2A 5F7HA 1FH5H 2W0FA 4D3CL 3I2CH 3F7YA 5CHNA 4CU8A 3C2AL 1OQXA 2P5WD 3WO4B 1N6QH 3WLBA 1WC7A 3CSYB 5BV7L 3ULVH 4WVRA 5DMKB 1K4CA 3QAZC 3UTPD 4NQVB 4LQFH 3U0PA 3EFDH 2EYTB 4TSBH 5CJQH 3V8CA 1CFQB 1JWUB 2OZ4A 2G5BA 1U8MB 1DBMH 3FQWB 5TQ0H 1QBAA 1P4IH 3W0WA 3PWNA 2ZG3A 3L5JA 4MAYD 4HKXB 2AEPL 3CAFA 1I7TA 1AKJD 1FNLA 3PP4L 1UB6B 3UZVB 3RL2B 3VFWB 1EO8L 3MGTA 3GGWB 3ZDZE 1LILA 1EGJH 1JPSL 4WHTB 3SO3C 3TWCH 3BAEH 2APWA 2H32B 1D3CA 3UTTE 3NCCB 4O02L 4OGYL 1FNGB 2P7TB 3BKJL 2MCG1 1B6DA 5IHUH 2IPKB 3RJQB 3HUJA 4ETQB 3PQYA 3G5VB 1IGTA 1SJEB 3P9LB 1QHOA 3ALWA 5D1ZC 2JJTC 1XT5A 4FG6C 2W59A 4QXUL 4Z95L 1CGWA 4UU9A 3RI5F 4NFDA 5JXAH 3BAEL 1AO7D 2HA1A 4KV5F 4Q6IA 3ZKMD 3K46A 4HC1H 4OLWH 1HHHB 1DLHB 3DRTB 5EU6A 1CK0L 1NFIB 1X5HA 3T77A 1CLYL 1GGUA 1NGYA 4WHYG 4HIEA 2EH8L 1P7QA 1MAMH 1OARH 4JKMA 2X4QA 1L0XA 1Q72L 4OZIF 4YDVA 2O5XH 3L7EB 2B0SL 2XWTA 2Z31C 1CLOL 1F6AA 2BVPB 1MCOL 3CFKB 5A2FA 4NRXB 5FKAB 2PYEE 5HBBA 1X5GA 1P1ZA 5E6YA 5F97E 3SKJH 2ITDA 4UQ2B 4WDIA 4QLRA 1J8HE 4YUEH 1TNMA 4U1HB 1RK0B 3AB0B 1UH2A 3MLVL 4C59B 5DD5L 1XGPA 4ZAKC 1IE5A 3MNWA 3BN3B 4GQ9L 3W9EB 3RNKA 4N5EC 4G8IB 3KPRE 4FNLH 3N50A 4LOUD 5L8JB 4QRRD 3OX8A 3VRIB 3WFEH 5JOPD 1X44A 5J6GA 4TPRH 3FFCE 1ZA3B 3U4EB 4DEPC 1YNKL 1RI8A 3QXWA 1ZOXA 3G5YA 5F9OL 4XX1G 1F2QA 2V7NB 4IIQB 4YHPA 5JOPE 3DYOA 4F7CA 3RU8H 2ZUXA 2X10A 3O6FB 4M43H 2NXZB 2VH5H 4JFDB 4G3YH 3MRNA 5HPMA 1K8IB 4WW2F 3KYKH 4IRSC 2Z91A 4Y4HA 3OJVC 2A6KA 5JXED 4OFPA 1J87A 1OHQA 4Y8AA 4PGEB 2GAZB 2BHZA 4HAFA 4Z18A 3S7GA 2A9NL 4HJJL 5FK9A 2ZG2A 2NY6C 5DEGA 4UILL 5DD3H 5GXBB 5EO1A 4UZGA 3V5HA 5F7EL 2YMXH 5L0QB 4G8FA 4WU5B 4DFHA 3BT2L 2Q8BH 1HKLH 2ARJQ 4JPWL 3VXMA 4OLEA 5FGSA 4RFEB 2EH7H 4FOMA 4I13B 3WSQL 1MHPL 3DUHA 3HB3C 3UTPE 1FFNA 2H6PB 2IQ9H 4QHMA 2IQAB 1NBQA 4U2YA 2ZOLB 2XN9A 2R2EA 2VUOA 3W11D 4G80A 3OHXA 4ONFL 3VG9B 3J8F7 4TOYL 1NSNL 2YMXL 3DRQA 3QCVH 4PYGA 4Q9QH 2DL9A 4OUUB 5FA4A 1RFDL 4MJ6B 4JFZL 5KS9A 4UTBH 4P2RE 4MNQB 2BDNL 4TVPL 1PX3A 2XRAL 3KPSE 5HGBA 4POZC 3FO2A 4JY4A 1FCCA 1R3KA 3QG7H 4YHZH 2H2SC 5KTEH 3AVEA 4S2SB 3NPSB 4ELMA 5I17A 4PTTB 4PGDA 3S4SG 1JI2A 2GK0A 4Q6IC 1UZ8B 4IDJL 3AS3A 3H3PH 1XF4A 1IBGL 3TPUA 1FFOA 3D5OF 2HT4D 1A21A 3QDJA 2E9BA 1RZJH 3QNYA 2H3NB 3G6JF 4I5BA 2VDPH 3O2DH 3J7HA 1MNUH 3DECA 4OLYL 1EX0A 4PJ7A 3KHOA 1QSEB 3EOYG 3WFHB 3UYPA 5SV3A 3VDBA 2YPLE 3QUXC 4ZPTB 2APFA 3PHQA 1AC0A 3BIAX 3G6DH 1CF8L 2ZP0T 4NRZA 1IL1B 4JREB 3UTZA 1RJLB 2ZUQC 3RHWF 4P4RA 2YPLD 5F9AC 1CIDA 1FN4A 3PV6B 4NZJA 2YXFA 3RDTC 1S9VB 3L3DB 3S97C 1BQLL 5C07D 4ETQA 3SY0B 3CSPA 1WBYB 1NANH 4ALAL 3V5KB 3Q0HA 1NBVH 4GKOA 4ZTPL 3P0GB 4GJTB 3RWCA 1RK1B 5SWZA 2NY5C 1P4LA 4RMWA 2H1PH 1S78C 2HWZL 3RUGB 4PP2A 5BXFB 5HYQA 3ULUF 1AO7A 5I16B 3QPQD 3QG6B 4HPYH 1KN2H 1JHTA 4PUBL 3BP7A 5FHAL 3UPRB 5IT2L 15C8H 4KK5D 3QXAB 4Y4FA 4X4YA 5KVGL 1QKZL 1RZIA 4ONGL 2MCPH 3VXNA 4RA0C 1IQWH 5CJOH 1MFAH 3IU4L 1YNLH 5IEKA 5EO0B 43CAB 1UFUA 5BMFL 1PW3A 4ZNEA 2NY0B 3T0AA 4PRID 2LU7A 1ZHNA 3DX8A 1MCSA 5HGHA 3QDAA 1QEWA 4XNYL 5FOBB 5DQJA 4CVWA 2LE9A 1AGDA 1I1YA 3GBNL 3UO1H 3V4UL 5FFLA 5E2JA 3MYJA 2PO6A 3MLXH 4PLKC 3I6GA 1GGTA 3MRRB 2J8UB 4DVBB 2JCCF 2ICES 4DGYH 1KCKA 1UKTA 4XPGL 4G42A 5EU5B 1INQB 3CX2A 4Y16D 4FQXC 1MCQA 2J6EA 3TA3A 1LNUA 5BMFH 4D3CH 5FO8B 4TUJA 3QSKB 1I1AD 5HHVH 5AYUH 2BJMH 4J3SA 3TBYA 1RK1A 4HPOL 2YBRB 3IAPA 2Q87A 4ZSOA 4NPYB 1AJ7L 1V8HA 3WO3B 2XY2A 4BK5A 3BRGC 3GBLA 1T5XB 3BN9C 5GGSA 4ZFOB 1A5FL 5LGHL 3ARDD 4KQ3H 3VFMB 1QFWL 5SWSA 4Y16B 5I74C 1RZKL 1OT2A 4MA8H 4CADA 1WZLA 1HH9A 3OKYA 3PHQB 1ZVSB 4OF0A 4B7LA 1Z5LB 4GAGL 3S6CA 2D7QA 5JZ7C 5AYUL 3ESUF 2FX9H 3MRCA 2W60B 4Z77A 2HJLB 2R15A 1OGTA 1NC2D 1JNJA 3KPQB 3FQRA 3V5DA 3ARGC 4IEFB 3SDAC 3GDBA 2ESVA 1INDL 1U8IA 1I1RA 5C0JA 1RUKH 3QXDA 3HNSH 3HE7C 3ARXA 3N1GC 2X4RA 3MJ9A 5D1QB 1AD0A 3GZKA 4OGAC 1EAPB 2BERA 3ZDZF 3M17A 4DGIL 4IM8A 3F7PC 2EC9U 1ETZA 5D2NA 4F37F 5H37H 3QZWA 2R2HA 4U1JB 2HKFL 4WRLA 5C0CE 4AENB 5IMMA 4K7FB 1JNNL 4O58H 3ARDC 3W0WB 5F1NA 1T2JA 2NY4D 2W07A 2A73A 4PB0L 5D7LE 3V8OA 3VWKD 1BQHB 1MRFH 1ONQA 3HAEH 2R1WB 2YD4A 5JW3H 4Y5VC 3MR9B 4KUCF 4K9EL 3MFGB 5DVMA 4Z5RB 3Q3GA 3TYFB 2FATL 2K1MA 3DHJA 3TT1H 5HHMB 5T1KD 3SGJA 1XGQB 2CDFB 4WFFE 2HLFD 1RURL 5D7IF 3VXTB 5IR1B 3U7YH 4M7JL 4MD0B 4BSVA 3CMGA 4OD3L 4HEPG 1N5YH 1T80A 4DCQB 2VAAB 1NAML 3MV8B 1IVLA 3WXVH 3RPIA 4ORZC 2X70B 5CEYB 3ZZ1A 3ZE0F 3BSZH 1JFQL 4DZBA 5CKAA 5CCKH 1U3ZA 4S11A 3UXFA 3QFDB 3RX5A 2J88H 3BEVB 1PZUB 1UWXK 1KEML 2IH1A 5L2KE 3U7YL 1I3VA 3QO0B 4U2ZA 5CP7B 3PG2A 1ZMYA 3ARBB 4LLQA 4F7TB 4M93B 4XP9L 1HXMA 4APQD 4ZPVB 4NQDA 1MIEH 1RVFH 2R23B 3LD8C 1BVLA 5CMAA 3C08L 4F33B 1K8IA 3U0WL 5J9PB 2WZPD 1HZHH 5A43C 5D7SH 5IVZA 4I3RL 2ZZUT 1JGUL 3WFHA 4E42B 4RWYL 2NX5E 3DUUA 4FQPA 4XCYB 5B3NA 5CCKL 5JNYA 5GRVK 1JMXA 4K7PL 1ED3A 3WFCH 3REVB 5HVWA 4M4RA 4GKZA 5IBUG 3RU8L 3UCRA 4RGNB 2VISB 4HK0A 3QJFB 4YE4H 4LP5A 5BJTB 3LRGA 4LF3B 1JL8A 1A7OH 4FQLH 4NOBA 5KBNC 1E6JH 4X8JB 1QYGL 2HYMA 4L29A 3C08H 1RIHL 4KRPD 1M05B 1A7QL 2DBLH 3MNWB 3T3ME 1JE6A 1AGFA 4JREC 1KJ3H 3THMH 4ZOCA 1T0MB 5IQ9B 3B43A 2CMRH 2YK1H 4FQJL 1IAKA 2KKQA 4XHQA 2XQBL 5GRJL 5AWNL 2I26N 5E6IA 2BY0A 1TQBC 4H26A 3ARGA 5FA4B 5KOMC 1BIIB 4OCLC 3HE6A 1JWSA 5I1EL 4DUXA 3B6SB 5IW6A 2X4SB 3HE7A 3HR5A 4PJHE 1MOEA 4BKLB 3PQYD 5C0AD 3UZEA 3DVNB 4OZGB 4MJ5B 4YZFE 5J89A 3MRCB 4I4WB 4TVPH 1CFTB 4N9GA 4MJIB 3ARYA 3D0VA 3QUYD 4BFIA 1IAIL 3H9SA 5JA9A 5LJYH 3LRHA 5I15L 5DWUH 4HK3N 4J4PD 3SDDA 4LCIL 3UTTB 3F8UB 3EO9H 4NJAH 4YXKH 2G75A 5GISL 3QDMB 4YWGH 1OLZA 3HLAB 4WWKD 5ICYA 2UVEA 4Y0GA 5FF6B 4GW1B 1LO4H 2N7AA 1DBML 4MNHA 4JZNB 5H8DA 1N5AA 2A6IB 4HS6A 4OCNC 3SBWC 5HHOA 1OD9A 2K7QA 3BMVA 1D6VH 4FFWD 5C0CA 1A3LH 2IFFL 4KDWA 1ZHNB 3TJHD 5LVEA 4KDTA 5CAYB 3TYFA 1A7RH 1KLUB 5FOBA 5GGTL 1KFAL 1CLCA 3MR9A 5SX5K 3ARBC 2NY6B 1LE5B 3DVGB 4EDWL 4MDJB 3GI9H 3QO1B 4YDJA 4OFDA 5IJVA 1BOGA 1S7RA 1Z2KA 4I77L 4X7SH 3VFGL 4ALAH 4L4JA 1KCRL 3O4LE 1NCDH 5CUSH 2IGFL 5E8DL 4BH8B 2GIYA 4ZTPH 1WC7B 1VACB 3RWHA 2CIKB 3HZMA 1A6AB 1ZVYA 3F7YB 2APBA 1U6AL 1AY1H 5I66B 2WANA 3G08A 2WWKT 1T22A 3QDMA 5HHME 1A2YA 3MCKA 4WW2B 1QHPA 2BY3A 3RX7A 1LP9F 1RV6X 2P45B 3VXRB 1I9IH 3QFJB 5GS2H 1YUHA 2XN9D 3VFGH 3CH8A 2DMCA 3B5GA 3BDYH 4Y5VB 2VDNL 4XTRD 5DHYA 3IETA 3U2SA 2VERN 4AEIH 2X70A 4YNYB 5CEYA 3MJ6A 4MD5A 4YDKL 5I1KH 4OBSA 1OAYH 1AKJB 4D8PB 1GZPA 4MJ2A 2Z31B 1A7BA 1EEQA 3O0RL 12E8H 3BEWB 1P53A 1A6PA 2I5YH 3QWOA 3BE1H 5DMJB 4KTEH 4DK3A 2W9DH 5FO8A 3K2MC 1HCVA 3G9AB 5EC2B 3LCYA 8FABA 3N85H 4X8XA 4Z7VE 5JXAL 1H3GA 3V2AR 3FT4A 3GKZA 4M6NH 3SDAB 1MFCL 5A2JH 5F3BB 3C9NB 3OKLB 4Z9KB 3L3OA 1NUDA 4XAKD 4OZIB 1FPTL 4RX4A 5C2BL 1UACL 4OF3A 5H2BB 2FX8L 4ZDHB 4YPJA 1FVCB 4O00A 4JFXA 1KTLB 3WHE1 1OWWA 4XWGL 4JO3L 1NFDE 3BISA 3MRLB 3TIEA 1HHJB 2EH8H 4FG6D 4JZOA 5D1ZB 1D5XA 1EBAA 4X99B 4HWZA 4M62L 3KXFA 2NXYD 4XXDA 4D0BA 3ZSSA 4U1GC 4QNPF 1VEPA 1R0AL 5C0BB 4X8JA 1ROWA 1AIFB 3QWQB 4AH2B 2DQIH 1NH6A 2R0KL 2AI0H 4GAYB 3WJLC 2F74A 2PYED 5HI3C 5BJTA 4ODHL 3CSYA 3GBMH 3IJYA 4E5XA 3LKOA 1QTYT 1LE9B 1YPZF 5ID1B 1VFBA 4KKNA 1EFXB 3RA7L 3TP4A 4I9WD 3GSWA 5IROA 3SJVE 1HOCB 4KK6D 4QHLB 4NUGH 3LKNB 4A2MA 1R24B 1MUJB 1FFPB 1NFDB 3HS0B 2BNQB 2AW2A 3KYMA 2BCKA 5GS1C 1WITA 4XPHL 5IBLC 4OQTL 5IW3A 4MA1C 1UM4L 2HT2D 5DJZA 2DQFB 1IQDB 5D7LB 2NY0C 5MENB 3F62A 3UYRL 3D85B 4YXHH 5JPNB 2IG2L 5ADPL 1G7MB 5T1KB 1UYWH 3FO9B 5B38B 4Q0XH 1E0OB 3ALXA 3BIBX 3P11H 2FGZA 2V9QA 3JV6A 1XF5A 4MJ5A 1NCAL 1XCTB 5TQ2H 2P48B 4JFDA 5L6YL 5FA3A 4DOHB 1I1AB 1LP9E 4PJCB 3S88H 2XIDA 4F7MA 3ZDXE 5C6TL 4U7SA 2WLYA 5HDQL 2BSSB 1FO0B 1GHFH 4HD9A 3MRHA 4XCEA 4ZS6C 3TA3C 5IM7A 3I3BA 4QT5A 4KRNA 4WENB 2WAHA 2DRUA 3WNNA 2X4OA 1YN6B 5TF0A 3H3KA 3ES6B 2Q8BL 3RP1A 4Y5YB 4GAYA 4LPYA 2AKRB 4PJAE 1CFNA 2EXWC 1I8LC 1SYSB 2XZQH 2AXFA 2UZIH 1R3HA 1MJUH 3MOBL 1EERB 5KSBE 1IAKB 4U6VL 1K6QL 2Y06L 1OY3B 5DJ0B 1I8MA 5D5MF 2NQCA 4BQ8A 3RNKB 3NIFE 1CICA 4XWOC 5TE6L 2ADGB 1PVHA 1YMMD 2QKIB 5DFTA 4N8VB 3STZB 3B2UD 1B2WL 2ERJC 4JKPH 3HC4L 1KTLA 1YEJL 1F3DH 1NEZB 3LHPL 3IXTB 1HNFA 2JLLA 4LF3A 5LGJA 5GGQH 1M7DA 1MI5A 2EZ0D 3I75B 4NRXA 3BESR 3FTGA 3P2TA 4DVRL 1KLFA 5GS3A 5A16B 2JIXB 1K85A 3T77B 1M7IA 3MLUL 4PGZA 2FJHB 3QISA 2ILLA 4MVBC 3TH2T 1TXKA 1KUMA 2FIKB 4YE4L 2E3VA 3P0VL 4MD5B 5FGBC 4KJWD 1F5WA 3PUCA 3LVEA 5DUBA 4CJ0A 3KJ6H 3ET9F 4FXKA 1II4E 5EZJA 1R5VA 1JRHI 1NBZA 3LHPH 4UU9B 4QNPE 1FAIH 1OAQH 3K81A 5BRZB 5ACZA 3OV6A 3SDXB 3NPSC 1CLZL 4M48H 3MA9L 3CC5B 5I8CB 4YDLC 2IMMA 2BNQD 4B50A 5FYJL 3KYMB 1MHCA 1YQVL 1WV7T 5MP6H 2MCPL 5T1LD 2XPGA 1Y18A 3T3PE 2XQBH 3TNNA 1QQDB 2OI9B 1JWSB 1MRDH 3P77A 3WXWH 5JIHA 4ZFGL 1HDMB 1A6TA 1NAMA 3NACH 4J3XA 3QDJE 1H3PH 2C3HA 3UTSA 2B4CL 3MBXH 1ZAGA 2AERT 5I19L 5DHVH 3AC0A 1IKFL 3VFWA 3RWJA 1KLGA 3WS3B 1KIPA 3I6LE 3T4AB 4XBGB 3GMNB 1GPOL 4Z7WB 2P5EE 4P4KB 4X4XA 5DJCB 4MWFB 1GAFH 1YEIH 3IJHA 3IDNA 1BQSA 2C4FT 4KQ4H 3DV4A 2VDMH 4D0BB 3F5WA 2I07A 4OCWL 3TLRA 4UIMA 2XNAB 5F96H 2UWEB 4J3VA 2EDJA 5CWSA 3INUH 1JGVH 4HWUA 1SYSA 4HJGB 2NY2B 4RAUA 5GRVL 2AJYH 1T3FA 2DYPA 2FSEA 1AJ7H 4GMTL 3RTQA 1T0NA 2YD2A 3RWGB 4N9OB 4N1EA 3VWJC 4DW2L 2PF6A 1AFVH 4MMXC 4JZNA 5FYKU 2V9RA 1EUTA 1AO7B 4WUKL 5C0DB 3E2HC 1AGEB 4WHDA 4GXUN 1QO3A 3CFCH 3X12A 3LSOB 2XN9E 4M5ZL 3D39E 4S10A 5GGUA 2NXZC 1LO4L 3U0TA 4LLYA 3RFZC 4UOJA 1Q0YL 5EZLB 4IIQC 1EZVX 4M1GL 5I18H 2ZOKA 2NY1D 2OSLA 1QR4A 2FNBA 3OF6A 2JB5H 3GBNH 4IRZH 4JEGB 4NM4H 3S35H 5F3HA 2FWOB 1JGEA 3CLEL 3I3DA 5C2UB 1FN4B 3PV6A 4IOFD 5MI0C 1NGWB 2J4WH 4ZS6D 5H94A 3RZCD 3O41A 3ROLB 5DC0A 5EOTA 1X7QA 1HCFX 4I0PC 1KPVB 1FFPA 1ZGLB 1BJ1H 1G9MH 5BW7A 3Q48A 4AEFA 3AB0C 2R2BA 4P5MA 1JMZA 1GGCL 2MFNA 1CQYA 2OMBA 3RGVD 3BWAA 4LARL 3OZ9L 4J3UA 5DUBB 4LKXA 3WIIL 2EYRB 1BBJA 3JUZA 1KEGH 1VFBB 3HZKA 1S7XB 5DJXA 1HSAB 4P5KB 4PG9A 3CGTA 2BOBA 3G5YB 3X17A 1H8SA 3O6ML 5D7IA 2GKIA 3G04B 3SO5A 4K94H 2F19H 3EZ8A 4D2NA 4XXDB 1RIUL 1ZHLA 4HDIB 5EB9A 5J3HD 2HTKC 3WIIH 1RUML 4HBCH 1K8DB 1F42A 3GSXB 5JHLL 3MXVL 3LN4B 3ZKSD 2XTJB 3C5ZB 1NAMH 5SX5H 5E8NA 1MFDL 4S2SA 43C9B 5D5MB 2FJFA 1IGFH 5E6ID 4OZFG 4X4XB 5DJCA 3FB5A 1FO0A 3B9DA 2CDEB 2DQEL 4R2GB 2YD6A 4LMQI 4QHMB 3DVFA 5C7XL 4JM2D 3U9PH 3RY6A 5I1CH 5HHXH 3OHXB 1EEZA 4ELKB 1UJ3A 1FNSL 1DP0A 5IWLA 2P8LB 1BFVL 5HYFA 3D3VB 2CGRL 5ICXB 4GO6B 2NY2C 2PW1A 4UB0L 4BQ6A 3E6FB 4A2LA 4ZD3H 4PV9A 3JV6B 5CP7A 3NCYS 4JPVH 4YUEL 2GI7A 1HXMB 4GQPH 4HKBA 3DMMD 1FE8H 1PJ9A 2QTEA 1HQRA 1MWAH 2OJZH 3KPRB 1WLHA 4KAQH 5C7XH 2WIIA 1RJZB 3CFDB 3U9PL 2GITB 4WNQB 3RWFB 1Q0XL 2ZOKB 4KKCC 5C0AB 3AM8A 3RTQC 3IVKB 4PD4J 3TBVA 4QXTB 4QRQB 1MCHA 1U8OB 1FGVH 1KB9J 1T6WA 1WIPA 2MPAH 4JGMA 1YNKH 1PG7W 1JZ3A 5DD6B 1AXTH 4OUOA 2J8UA 1IZKA 4DVBA 4KJPC 3H9SD 3AU1B 2CJUL 1FLRL 4LAQL 3GB7B 1XZ0A 3FB5B 3WIHH 3VGHA 1TJHH 3LS4L 3S98A 3CVHB 3GK8H 3IS0X 2H26A 4HH9B 4EIGB 3BJ91 5JW4R 1ORQB 4OD2B 4HWZB 5T5NG 4JZJB 2WBJD 3PL6A 4EQ3A 2O5YH 1YY8A 4JHZA 2NNAB 4PS4L 5MEQA 3QDGB 1F45A 2CK0L 3LRSA 5DYOA 2VC2L 4XP1L 3NN8B 5D6CA 1A7PH 1ZHLB 3RWJB 5L2KD 4ZUSA 1NDMA 2IBGA 3ZE0E 1RUQL 3QRGH 1YPZA 2R4RH 5ALBH 4NO0B 4IMLB 5L7XH 1FV1A 5IB4A 1OTSD 3MREB 3Q6GH 4KVCH 2R2CA 1PKQA 2OMNA 1OGAA 3TFKD 1MEXH 3PJSA 4MXQD 2OR9L 3FOLB 1P6FA 3MMEA 4JFZH 4ODSH 4P2QD 4FFWC 5HYJA 4IRSD 1R6VA 4NFBA 2YPKB 3X13B 5FUOH 1MF2L 2YKLH 4U6HA 1KJMA 3A6CL 2WBWB 2X40A 5T1KA 5LAXB 3L5IA 3OB8A 1YC8A 3C2AH 3PHOB 3SCMC 3FN0L 3IFLH 3MODL 2IFFH 4YLQT 1MVFA 1RZ7L 3TT3H 2FO1A 3ZHKA 1KB5L 2VDQH 4JR9H 3V0VB 5IW6B 5J0BA 3IDGA 2GUOB 3QIBB 1UXSB 4Z7QE 1T5WA 1R5IB 4RMVA 4LCYA 4LDLB 2CDGB 5MEOB 3I6GB 5IB5B 1X9QA 4JPIA 4ZTOH 1UZ6F 4P9HC 1UJ3C 5F8QC 3H6JA 1GL4B 4DOHE 4I77H 4CN4A 1T7ZA 3EO9L 1TETL 5F9WB 3QIWC 1QSFE 4U1NB 2DI9A 5C0EB 2DYPB 1I8MB 4X9GA 1OCWH 4GMSL 4JQIH 3GMLA 4GRWH 5DSCB 3IRZA 1U8MA 3ARZA 4OQTA 1OSPH 5GS0C 1IGMH 1A6UL 3CK0L 3ORJA 3GJFA 2X2YA 3NVQA 1FVEB 2O5ZH 4MSWB 3JV0A 3NABH 5TGBB 3HFMH 4CAGA 4AIZA 2X9XA 4WIQA 1T0PB 2NY2D 2VDRH 3REVA 3L3IB 3BD5A 3WXWL 4OLUH 4PRNA 4Z7VA 5BOPA 3D18B 2YA1A 4X9FA 5L8KB 5I75C 5IHZB 5TPWH 5GS2D 2YZ8A 4UTAL 32C2A 1J10A 3KPQA 4PJAA 4PJGF 3RWFA 1MQKL 3ZLQC 3DOSA 4NHUA 4NZTH 4FHBD 5HY9B 3WEXB 5KVGH 4KJQC 2EDYA 3ILQD 1U3YA 3UZQA 5EO9A 3WHE0 2AK4B 3D0VB 5LCVL 5JDJA 3NIDF 3FN3A 4AT6A 4S1SL 1CICC 5EZIH 4OI8A 2W91A 4FFYL 2C7UB 3QFJD 1H3WM 5IMKA 1YEEH 2YPKA 3X13A 4YPGB 3T0XA 4H25A 1OWRM 2GFBA 3BFOA 4Z76B 4QY8B 3VFVA 4H8WC 3VXQA 1T1XB 4HLZG 2VZSA 3MCKB 4WW2A 4CMHC 5JW4N 1C12B 1CXEA 1G6RB 3FCTA 2X4SA 4XPGH 4HUMB 4A6YL 2AQ2A 5CP3A 1ZA3A 3I50H 4PR5A 4PGCB 3Q5OA 3GGWA 2VDKL 2QSCL 4XMPH 4TQEH 3W81A 5IBUB 5D2LF 4P3DA 1NMCC 3BP6B 1UB5B 3EAKA 2GT9A 5ISZB 2BNRB 4FMKA 4ELMB 5I17B 2HLFC 2DQHL 3KYKL 3MV7A 1JTTA 5KN5B 4UMGA 4NC2B 1LO3L 4P59L 4XPAL 2JK5A 2V5RA 4XMLL 5EU4A 1VA9A 1J1OH 1G9NH 3ESVF 2PCPA 1T21B 4TQEL 1ZWIA 1LDPL 1S9XA 4N0UA 1RZFH 1D5ZB 4RQQA 5DVKA 1VPOL 3QBTB 1IAOB 2WBJB 4O2CB 1VB9A 1Q94B 1XGYL 3TN0A 3MFFA 4NKMB 2IG2H 4R7DA 5ADPH 4NQCD 1UYWL 1L4IA 1NGZB 2XKNB 4YPGA 2R2EB 3DRTA 3QIUD 4G8GE 4WHYH 2RB8A 1PSKL 4GH7B 4YJZL 2WV3A 3PIQA 4D9QE 4ZYKA 1MCLA 2HN7B 2PXYA 4W4NA 5KZCD 3CFDA 5BRZE 4YGVB 5C92A 4QXTA 1R0AH 1RUPL 4Y4FD 3TJEH 4K94C 4U1KA 1RZFL 4ESKA 3QHZL 1UXWB 3OAZK 1RJZA 1JNNH 1T66C 3VH8A 3QCVL 1S9VA 3KPNA 4UNUA 4Y4KB 3HMWH 4TTDD 1Z3GL 2ESVD 5JDSA 3X3FL 4Z7OE 5I73C 4XVUD 1S5IH 5CSZA 5KSAB 1AQKL 1OPGH 2D0FA 4JFPA 4G5ZH 3ZDYE 1X4ZA 4TUOB 4ZXBD 1U8PA 4JB9L 1LEGA 4P4KC 2IPUK 2FATH 3TT1L 3SKMB 1NC4D 3KR3L 2EDXA 1BBDL 2NTSP 5ID1A 5DJDA 5EUKA 3RWHB 2VLRA 3RWDA 3H7BA 5EZOH 2CO6B 3RVUD 4WTZG 2AK4D 1FG2A 2X89A 1UA6L 4ZFZA 4PRAA 3U4EA 1L7IH 4LSPH 1VENA 3NPZB 3P4NB 1N5YL 3BKCH 3H3PL 1FVEA 4G7VH 4HKXA 4YBLB 5JOEA 1RMFH 3SQOL 3LB6C 2A9MH 3MRPA 5IFJB 4MAYB 3MLZL 3OF6D 3LN4A 1RZJL 5GGRB 2RHEA 1O7SA 1WAAA 5IEKB 1IC4L 5HDLA 3VXNB 4ZS7H 1TTFA 4C57C 2DM7A 4X4ME 4UQ2A 4MQTB 1SVZA 5BW7C 4LDEB 4CDGC 2XTJE 2Q7NA 2NY3B 4RIRA 2Z4QB 1RMFL 1IMHC 5FB8B 1Y6NR 4FXGB 2QBWA 4H20H 3RNQA 3MGAA 2HP4A 1FZJB 4ODVH 2UVFA 4ZMAT 1NJ9A 1MJ8H 5C0JB 4P3CL 4PJXB 3O45B 3DGGA 1LO2H 1JPTL 2GFBB 4PJGB 1A7OL 3GRWA 3QDGD 3GMQB 1ITBB 4NWTL 4GBXB 3G6AA 3BO8A 5HD8C 5FDYA 4P5TD 4P2OD 1T5XA 1U3HC 3RUGF 3CFJB 2CLVB 2ENYA 1GPOH 5F70A 3VFMA 5IT2H 3VRJA 1TZIA 5AAWA 3BHBB 2Q6WA 1LVEA 1EEUA 3G5VA 3PQYB 4ODUB 2JIXA 4OLZL 1EJOH 3M1BA 1PEWA 3MLRL 3UMTA 3CLFL 3TN0C 1BWWA 3QNXA 1QBLH 4Q6YA 4ZFFB 4JO4L 3QUML 3SPVA 1AGBA 3Q6GL 4HXBL 4L4VB 3DX6B 2Q76A 3LD8B 3TCLA 1I7RA 4KK8C 2QJDA 3QEGH 4NC0B 4OV5A 4OF8A 2ARWA 4OIAA 5EU3A 1TPXC 2X4TB 4LFHD 4U0RC 4GXVL 4PJDE 4DGYL 2B39A 5ECJE 1EUUA 1MF2H 4M5ZH 5DQ9A 2XI9A 3CZFB 4KXZI 1BREA 3ULSB 4L3CA 4B41A 5HGAB 4MNGE 3QHFH 5GJTH 3WNPA 2VE6B 4S1DD 3V4VH 3HE6D 4RX4D 5E4EB 1F4WH 1R3JA 3T1FB 3BZFA 5F1KC 1RZIB 3MV11 2ITDB 5GISH 4MJ4A 2VLKB 3VI4E 2P44B 1S9WB 1J1PL 1CDYA 3VXPB 1GGBL 4MDIA 4U3XA 2G60L 5IVXF 3LPGA 2B1HL 4L9DA 4OCWH 5SWZB 1D9KB 2OTUB 5KJRH 4P3WA 2IBZX 1G9ML 2LABA 2GHWB 2JELH 3PDOA 2AXGB 5DZLA 5F9JA 1J0JA 4R97C 4KROD 1IC7H 3LEVH 1EO7A 3CU1A 3M1BB 1MIMH 2K7PA 1D6VL 2BSED 3BQUA 3QQ9D 4GUPA 3LQZA 1TETH 4U1GB 4ZUTA 5INCB 5CKGA 1WAAE 1Q9OA 4Y5XA 4JFEE 2C3XA 4JDTH 1KFAH 4LLMB 1G7HA 1MCWW 4NZDA 2F58H 1I9RH 3CFCL 2YD7A 3BP5A 3VJ6B 1A1NA 3VXOB 5ACZB 5GJSH 4M7LH 1OB1B 4HZLB 1K9TA 3EYOA 3HG1D 3PNWA 1IL1A 3HB3D 3P9WB 5GGSB 1Z9SA 5B39B 3FRUA 3MXWH 4NPYA 1NGZA 4JJ5A 4YH6A 3FFCD 3N1QC 5E56A 3PWLB 4X7TA 3IDXL 1LK2B 4HJ0D 1M7IB 2MSPA 4LSVL 3BYYA 1OAXL 1N3NB 1AIFA 4N0FA 3CUPB 3O4LD 1AY1L 5L9DL 5J06A 2GK2A 2HTLD 4OGYH 1ZE3C 1G0DA 2VLME 3JSSA 3HI6H 2J12B 4M02A 2OL3B 4HS3A 2Z93A 1CGSL 4ZUWA 1UJTA 2ARJA 3GHEH 4MLSA 1MCNA 4Z7UF 4DZ8B 1XF1A 3BDYL 3EFFA 5IF0A 1KCSH 5IHLB 4JN2B 3C60C 1U3HA 4UIKH 3F12B 5DJ0A 5ESAA 1JZ4A 2QQLH 1KIRA 5E99L 3UPCA 4YDKH 4J4PA 2OYPA 3SDDD 3BSZL 1PKOA 4Q9CA 1KENL 3MRPB 4M4PA 5IFJA 1K4CB 4MNQE 4CU7A 4JGJA 2ZUUA 1P9MA 4FQXB 3L1OH 1D7FA 4KTYA 1CE6B 3QFJE 1JF1A 3I02A 5F1IA 5KSBB 1OGTB 1DJSA 4NKOB 1S7TB 2BSSA 2IH3B 4UIKL 4OBRA 2J8OA 4FQCH 1RVFL 4JANA 4QF1A 2DQGH 4GFTB 3A0OA 1FL6B 1S3KL 3UDWA 5C2BH 2DIAA 3QIWA 1PG7H 1QLRB 3T65A 4YGAB 1JGUH 2C1OB 4G6FD 3TH4T 1ND0A 3IDJA 2IFGA 3BEVA 4HS8H 4JAMA 1EEYA 1BM3L 3WV0A 1JHKH 2DYPD 4PRHD 4GG6F 2BMKA 1X5AA 5CSBA 3TPKA 1HH6B 4XRCB 1F3JA 5GGRY 2AEQL 1NKRA 2D4FA 4NDMA 7FABH 4HFWB 4LLVA 4PD4K 4BA8A 1ES0A 5DGQA 2R9HC 4ERSH 5ICZB 3GSUB 1C1EH 4ODHH 8CGTA 1XGQA 2AJUH 2FJGB 5C08D 1VDGA 4FTVA 4QRPB 3N9GH 4PS4H 2KQMA 2J5LB 3Q3GB 5J6GB 4NQEA 3TM6A 2F5BL 3PXJA 2HH0H 4LCCB 5IESH 1IC1A 2AJ3A 5AWNH 5I1IL 3BQUC 3GSVA 3SE8H 3LKSB 1MJ7H 3MACL 1QPPA 5L7XL 4O4YL 3ZDXF 2HT3C 2VQ1B 2PTUA 5A2IH 3PABB 3DV4B 3QUZD 2E5EA 5H35B 4YHYB 3UBXG 3MRKB 4KROC 2C1PB 3LQAL 5C0BE 4EKXA 5DMKA 1GC1L 1SYVB 3V0AC 3VFUB 2CJUH 4DFIA 1B4JL 2JB6B 2FH8A 4JPWH 2VR4A 3SDCA 4U1HA 4K07A 1LEKA 1F97A 3U48A 5CJBA 1VGEL 4L4VA 3R1GH 2EH7L 5DMGD 4ONHB 1B88A 5IMOB 5D70L 1BF8A 4JVPA 5TE4H 3S88L 2WINA 3IFLL 3MODH 3QCTL 5ANME 1GHFL 1WEJL 5T3ZH 2ZWLT 1R3IH 1ZXQA 2G5RA 1DLHA 1TQBB 1YDPA 5IIEB 1Z5LA 5L2KB 1ZTXH 3DYMA 1FORL 4Q6IB 1RU9L 2EEBA 3NIDE 1XF2A 3KYOB 5E8OB 3FRUB 2CLVA 2A9ML 4XP1H 1I7UB 2Z0BA 2QQNL 4YHNB 25C8H 3A6BH 5FM5O 2W0KA 3RVUC 2XKUA 1ZANL 5E5RB 1IGJB 4N9GB 4Y89A 5E7FA 3S34H 4OT1H 4FRWA 5E2UH 2AAVA 3IETB 5FUCE 1KJVA 3B2VL 1B0WA 4MB4A 3WKML 1Q1JH 3KXFD 2ICWJ 1A7RL 3TBSB 3KJ4C 1A8JH 2IPKA 2VN7A 3VG9C 1ZLUK 1PY9A 2P43B 3MREA 4YDIH 3KPTA 4LHQB 1DBJH 1IGIL 2Z35A 1Q9WB 3RZCA 4PTUB 3PDOB 4RGNC 1HSBA 3C09B 4N68A 5TQ0L 4IMKC 3S34L 3GMOB 5CEZH 5E1AA 1DBBH 1I3RB 4JDVB 4BFGA 4YAQB 4BH8A 3QH3B 2VLLA 5EULV 1RZ7H 2AJZB 1QVOB 3C5JA 1NLDL 4N1HB 5KSAD 1EK3A 1TLKA 4L5FL 4M93C 3OR7B 4OD1L 1OAKL 1Q9KA 2VE6A 2ORBL 2H32H 1KIQB 4BZ1H 4RMRA 3RAJH 1QNZH 2VZTA 4UTAH 4KY1L 3E6HB 4RFNC 1BAFH 4MX7A 5GQBA 3TO4C 4M9PA 1QZ1A 2H9GA 2PTVA 5IBTH 4PJFF 5KS9B 1OTUC 1G6VK 4GW4B 3L3GB 4EVNA 1JK8A 4HC1A 5JIIA 4I2XA 3D9AH 2EDHA 3DXAD 1LGVA 3DXAB 3WNOA 1SJXA 1H3PL 3D1MC 4J23A 5GGSY 3CXHK 4NSKB 5GRZA 4DEPB 2D9CA 4HPYL 3HC3L 4JY5L 1KN2L 4NUJB 5J1AA 2FGWL 3BWUC 2BMKB 3RWCB 4P49A 5LQBH 2BVEA 1JZ6A 4GKSB 2H8PA 5CJQL 5D7IE 1ZT1B 3RVWD 4LVNC 4ODWA 4CW1A 5ERWA 4PJGE 1CN4A 1MFAL 5CINL 2EDLA 1W2KT 5ALCH 1XR9A 4Y2DB 3WBDA 2Q7YB 2HKHH 1EGJA 2AEPH 3QUMB 2A6DB 1UACH 3FO1A 4U6XA 4PIRF 4TN9A 4LMQE 3FJTA 2DQDL 4QOKD 4TULH 3UO1L 3V4UH 2J8UE 1F4AA 3BKML 3RKDC 5D1QC 1I9JL 4G7YH 5T33L 1KGCE 5D1XD 2LTQB 4LHUB 5TDPB 4NM8H 3AUVA 5A16A 5D7JC 3VGFA 4AZ8A 4KGLA 1IAMA 1MFNA 5GSVA 3IJSA 1IAII 4K23L 3TVMC 2EIDA 1N8ZB 4HMCA 4OFYD 4P2QA 4E9LA 4YQXH 1WQVT 3DV6A 4L3EA 3MV7B 4PRIE 4X7CC 3HG1B 2FLBT 1PG7X 4OLXL 4JN2A 1UZ8A 1A6WL 2JF1A 1KCVL 3FB6A 4PB9H 4M43L 3D39A 3G9VA 5JHDB 1KOAA 2BFVH 5DMIH 3W5NA 4HULB 4M8QB 4L8SC 3B2UC 3NH7H 4FXLA 5KSUB 4BQCA 4XWOD 4MJ6A 2DI8A 4JRXE 4BQ9A 1RAMA 1U8LA 3GSVB 2A9NH 4HJJH 4LVOC 3DRQB 3MLPA 4AMKH 5DQDL 4K71B 1CL7I 4OFIA 3AAZA 4B53A 4KVNL 3LH2L 1G6RA 2X9WA 3FCTB 5JMRA 1BLNB 3RZCC 1ZSDA 4QHKI 4NZRH 1J1XH 4U6YA 3VI3E 1A47A 3QWOB 4IMKA 4PJFB 1W0WB 4M03A 1D9KC 4R4FL 1CYGA 2P46B 2FR4B 1N26A 1MREL 2ITCA 1NDGA 3KNBA 3HZVA 1FNAA 1HK6A 5D7KE 3GSQB 3QI9B 3VXMB 1J1OL 3O3BA 3KG5A 1G9NL 4KU1A 5GRWA 5I2IB 2V2TB 3B9KC 1QLFA 5F8RC 2QADC 4WJ5A 1MCCA 3EJJX 4K8RC 3PV7A 2D2OA 5EU6E 1DEEA 3TO4A 1VFOA 4WO4C 5DJYB 3WCYA 3VWJD 4L4TE 4PJIA 5FHBH 5LBSL 3DHMA 3EUUA 3WO4C 1BHGA 1N4XH 1MJUL 3MRNB 5HPMB 1KTDB 1K2DA 2HFGL 2Z8RA 3OXRB 4JVUA 4PRNB 4Z7VB 4ZXBC 2D7TH 5JTWA 1GOFA 5JW4M 3FAWA 2KPNA 2NX5D 4ODBD 4FA8A 4URTB 1TZHA 5E5MB 4PJDF 3SGEI 5I1DB 3QPQC 1DCLA 3MV8E 3PQYE 4JDZB 3G5XA 5DS8B 3FMGL 4Z5RA 1ZHBA 2P42B 1I1YB 3B8SA 5DRNA 4PJBE 1NUNB 1V7MH 3HC4H 1AQKH 1IBGH 4C56A 3WXVL 4ODVL 1FLTX 5EU4B 3VRIA 1XGTB 3VFTB 1A1MB 4NCC1 1A3RH 1ERNA 4TNWF 5ETUB 4GBXD 1U3HB 3S3SA 3B5TA 1MI5E 3RL1A 4OKDA 3TIDB 3BJLA 4CDHA 2VXVH 1BZ7A 4FP8H 4YAQA 3KWWA 3HG1A 3QEUB 4AYFA 3WLBB 2BVQA 3W0WE 3I6KB 3QIUB 4HWEL 4TYUA 4H0HB 3EYVB 1F13A 4BH7A 3QUXB 4R4NC 3WDJA 5IVXE 4HW6A 1HZHL 1X5XA 3KLHD 5IB1B 1CXLA 4UDTA 5CILH 3QIBA 1NSNH 2NTFB 4HH8A 5C0RL 3W0WD 3K0WA 3TVMA 4PY7B 1RUAL 4OGXH 5E9DD 4GRLB 3OR6A 4N90E 1A9EA 2B2XH 5HDBE 3U6RB 4Z77B 1AXSB 4H88H 3SDYH 1EJOL 1GOHA 4H1LG 1IEHA 2NY3C 3GKWH 4KKBD 3BD4A 2Y36L 3K74B 1BFOB 2CPCA 1B0RB 2IBZY 4R96A 1A7NL 1DBKH 5CILL 4E41A 3OKDA 5DJAB 3THML 5L2JA 5FYKL 1BP3B 2HVKA 1S7QA 2NY5H 1ZLVH 3H0TB 4JFDE 4XNZB 5EUOF 4DJMA 4Y8DC 2FHBA 4OKVB 4U6TA 4XXCC 3VA2C 4WI9A 3QFJA 3RVTC 3UTSE 4D9LL 1HYSD 4I5BB 3P4MA 1JGDA 4YBLC 1A4JB 4Y19E 5MERB 1OAUL 5ALBL 5INDA 3TGXA 5CIPA 3E3QC 2SEBA 1QFWI 2OS7A 3EO1B 1GGIH 3VFNB 3NA9H 1CF8H 5C0IA 1PLGL 2DJUA 2MOVA 3CU7A 3PWNB 2XZCH 1F8TH 5AZEL 3MJ9H 1Z9LA 3PABA 5JQHC 1P7QD 1U0QA 2AEIT 1NC2A 1FRGH 1FJ1A 2CUIA 1Q0YH 1L7TL 1RZJC 5HYSG 4S1QH 3WYRA 3QDHA 3TFKC 3KYNA 4JLRB 3B8YA 4LVHC 5DRNB 2EDBA 1N0XL 5B22A 4PRDA 4Y4HD 3WKMH 3RWEA 1D6EA 4PRAB 2EO1A 1FNEA 3MOAH 4KGJA 1JF6A 2J4WL 1TVBA 5A1AA 2NY0D 1JHTB 1XH3B 1FDLL 3O3EB 4U7KA 2C26A 4PRHA 5GJSL 3O6FC 3C6LC 3QULA 1V7NH 4KRPB 1NAMB 3I2CL 4CNIB 1U8QA 4UQ3B 2WBJC 4ZTOL 3KPOB 5HHMD 4JGUA 4LARH 2H2PC 4G8GD 1WBXB 4XBPB 5DMGC 5K59E 1HHIB 5EBWA 1Q8MA 4RAVA 3O8XB 4RZCB 3OJDA 4NQCA 1KCLA 4L4VE 4JQIL 4H5SB 4EI5C 4PLNC 1HQ4A 3KPMB 1CZ8H 4YFLI 5TF1H 3QQ4B 4F9PA 4KJPD 2WQ8A 3LKNA 3FQUA 2OL3H 3NMEA 4NRYA 1P7KA 4PJ7F 3HFML 5FYJE 4LIQL 3R4DA 1GIGH 3D85D 4PV8B 5BCAA 5I1LA 4Z7WE 4FQQB 4X5XA 3S96B 4P2OA 3VFOB 4HQQH 4NN7B 4HPOH 5T1LB 3PWPD 4XP5H 4FTVE 2IANE 3L95A 5DD0H 2C9AA 4ODXA 2HRPL 2HMID 5FYKD 1FC2D 2F54A 4ORGB 1KXVC 2XWBA 1I1CA 4QRPD 3EJZD 5AZ2L 1FL5A 3IDXH 3ULUC 3N1MC 3F58H 3VCLA 3O2WL 1QSFD 2VOTA 4OD2A 3MOQA 4KC3B 3KLAB 2VIRB 3LKRB 5I8EB 4UB0H 2R29L 1YEKL 1FO0L 3VFNA 4DGVL 1MCDA 3GJFK 3DXAE 4ZFOL 1MVUB 2X9YA 2ESVB 3BKMH 1SM3L 3IJSB 3PGDA 4U1IB 3KPRD 4X9BA 4JG0L 5DGRA 3D48R 3T4YB 5KAQG 3U4BL 5DFVD 4OZFH 3H9HA 1S9YB 2FH6A 2EDRA 3MRFB 4LASH 1G7QB 4POUB 3RVXC 3ZT7A 5EWIH 1BVLB 5CMAB 5ITBL 4TNVF 4WU5A 5EUOA 4OTXH 2R4SH 4HEME 5SWSB 2A1WL 3O2DA 4CW1B 3VW3L 1Q9OB 4Y5XB 4C55A 1VKXA 3VJ6A 4RBPH 3MRQA 1FC1A 1FNHA 2DQHH 1DLFL 1TZGL 3OR6B 4OM0L 4MB5A 2C4XA 1XGUB 3SE8L 5F9WC 4G6ML 1RURH 5IJKC 5J12B 3HZVB 3O11B 2FX7L 5B38G 2RAMA 1BQHG 4X4ZA 1EHLH 2OXHA 5F7UA 4W4OC 2W9EL 4X6DB 3VFSB 1NANI 4RFOL 5D5ME 2CMRL 4WGVB 3O3DA 1CXHA 3DO3A 3RVVD 4G6KH 4RDQF 3KHQA 3PF2A 2A0LD 1VFAA 3QRGL 1JV5B 4G9FD 2AEQH 4PJHA 1WTGT 1OM3H 3P3YA 2O61B 4EDXB 1CFQA 3BMWA 4NT6B 4WEUD 4F57L 4Z7NE 1E4XL 1UM4H 2E9IA 4NKIL 5EU7C 4IDLA 4R4BB 4S0SD 5KVMC 3GMPB 4JY6B 4P9ML 1V3MA 3FFCB 5I1AA 5HHOB 1I8KA 2QQNH 1MCRA 1IAIM 4KMLB 5EIIB 5HGGS 4AIXA 4GKNB 3TBWB 5T3ZD 2HFGH 4KV5E 1BBDH 4X80H 1KBGH 3DSNA 1R5WB 3BVNB 3H7LA 4XVJL 1RFDH 1LHZA 1T20B 4UT6H 2W0PA 5IB3A 3BEWA 4UNTA 4JM2F 1LO0L 1PD6A 1AHWC 3L3DA 1RULL 1YMMB 4R96B 5D1XC 4GW5B 2VSDA 4RRPA 1N7ML 2PUQT 3VXOA 1HKFA 3D39D 3FB8A 1F11A 1HE7A 1H5BA 1TCRB 2AJSH 3CXHJ 5CBAB 4S1RL 4L8SA 4QYOB 1OLLA 2AK4A 3PGFL 1G7QA 2XOTA 1PYWB 4ZODA 2RCSH 3IU3B 4HWNA 3VD4A 4MCZA 1NLDH 4LQFL 2XV6B 2IAND 1I9EA 2QHRL 2YBRA 3M8OL 4NQXB 4XPFL 3EYFB 4KK8D 2R0ZL 3HE6B 4YR6B 4GRLA 3KPOA 2BNUA 5DDHB 3ZO0A 3QUZB 1SJHB 4WCYH 4AM0A 5GGQL 5ILTL 1W0VB 5CBEB 4FQIH 5GGTA 5GS0D 4RGMB 1MJ8L 3FT3A 5D6CB 1NKOA 4Q58C 1NCBL 4QRSB 1EAJA 4FQ1L 5ABDE 3VXPA 4YK4C 3NABL 3MLSL 1G7JA 4OM1L 1P7HL 1B9ZA 4F15C 2VAJA 3HAEG 3BH9B 3H9SE 2OCFD 4J3OC 1MLBB 5LXGL 2VDLL 1BOGB 2VWEC 1RZ8B 1UENA 1JPSH 2QHLA 1A1MA 5AD0A 2IBBA 3LPWA 3NA4A 1G6RH 4UT9L 1WWWX 3PWUA 3K1KC 1UCTA 3JV4A 2FGWH 4N0CC 4M48L 5DHXB 5C9KA 1I9IL 1FAKT 1KB5B 3SE3A 3TO4D 5KW9H 2MHAB 1T2XA 4IOSD 3QUKA 4QRPA 4XCCL 4K7PY 4OAWA 2C3WA 3B5HA 5IJKA 5CLWA 4ZXBA 5CJXC 5ICZA 3H7BB 2Y07H 2CXKA 4QXGH 2N4IA 4ZFZB 3L5WA 4IJ3C 5HHQA 2VXUL 3FB7A 1T1WB 4J6RH 3ROOA 4EUPG 4YFEA 3CFBA 3C5SB 2OK0L 1XR8B 1YEEL 3ULVL 1WGOA 5F7YC 4PYHA 3EYFA 4W70A 3O0RH 2DOCA 2ZPKL 3EDDA 4NZUH 1G7MA 2X09A 1X5LA 2J3SA 3V5KA 1C7TA 4HV8A 4RGND 5IV2A 2EDTA 3IDUA 4M5YH 1T6VN 5E2TL 1SY6L 3MJ8A 1QBML 4WTZA 2FCBA 5FM5M 1P4IL 2LAAA 4K23H 4JAMB 2NPLX 3I3EA 1NGQL 3HNTL 3S36X 2APTA 5C9JA 1T7WA 1MCKA 2Y7QB 3NFPA 3HC3H 4JY5H 2P8LA 1YMMA 2RR3A 2DS4A 4ETYA 4LP4A 1XF3A 5EBLB 3X11B 1J0YA 4XNUH 1S9YA 3OPZL 4HUWB 1QSEA 3ZE1E 1M71B 1W8NA 1ORSA 4XTRC 5KVDL 1FCGA 2WUCL 2QLVB 3ARVA 5FYKE 1S5HB 4F7EA 4L1DA 3FT2A 3QUXD 2J8UF 2WLZA 4NQDE 1YEFH 4XC3L 2HJKA 1D5ZA 4IHOA 3LKRA 4ZSOE 4BUHA 1LDPH 1ONQB 3CMOL 5ADOH 4BZ2H 5DT1L 2QQQA 4TULL 5E8EB 3TBTB 5I1AB 3STZA 1F90L 1CCZA 5JPMB 2C3GA 3OPZH 4I0PB 5IB2A 5EFIB 3MRKA 5ACLA 2Z93B 4LCUB 1T03L 5I1KL 1HI6A 1ZV5A 4QOKB 1G7JB 4H1LH 5C07A 1WFTA 4QHNA 3LY6A 1X6LA 4MYWB 4RDQG 4X5XB 3OGOE 4HMDA 1GGCH 2P5EB 4OQTH 1EH9A 2R56L 4G9DA 4N0YH 2ICWB 2LVEA 4QT5B 1ZLSL 2BOCA 1C8PA 5AG8A 4G8GA 3RWDB 1FNFA 4YIQA 2A74B 2JCCE 1L9NA 1T1XA 3T2PA 2AJVL 5DZNA 3R8BB 1Q9LB 3VWJB 1X4YA 2Q7YA 1NCWL 4CADB 1RIUH 4XH2A 4PJIB 1IM9A 2H2PD 4M1DH 3W11C 3S9DB 5DF0A 4H5SA 4KZEH 3U2SB 5EUOE 2CH8A 5HI4D 4N0YL 3CIQA 4JHWL 4WWKC 5E6ZA 1MFBL 4Y2DA 3QEQD 4GS7C 3HRPA 1HQ4B 5IG7B 1A22B 1ZLSH 4BSWB 3EO0B 4JM2C 4YO0B 3BKCL 5F7DA 3IDJB 1MRFL 4HAGA 3GSNH 5FYJD 2GSIA 5E99H 3CSGA 5JUEH 4YGVA 1Z9MA 1N64H 4H1LA 4HUUA 3DXAA 2Y06H 4EN3C 3TYGH 1EMTL 3GSWB 5K9KB 2VH5L 3MPCA 3R8QA 1MFBH 1KN4L 4WY7L 4PJ8A 4F9LA 3V7MA 4X7FC 4RQQB 1CBVH 5EOCH 3UAJC 1BZ9B 1REIA 2OI9C 2H41A 1AD9A 5EIVA 2VR9A 5DR5L 5L88H 4JRYA 5FXCH 2O93L 4U0QB 3AS0A 4JRXB 4X99A 3GSRA 4ZO6A 4L3CB 4NGHL 4YHLH 5F1NB 4KJYA 1FZOB 1DBAH 3NFNB 5HHPB 2FL5A 3H8NA 5JHDE 1JHKL 1KV3A 4JO2H 4Z7WA 4DTGH 1MLBA 3MRGB 4JPKL 3TBTA 4XBGA 1D5IL 3MV8D 5E2WH 1WCBA 3C6LB 4I18C 1FAIL 5DJ2A 5DUPH 5KG9A 1MY7A 1O0VA 2XWTB 5BRZD 1BQLH 2Q8AL 2FHCA 5DTFA 2NXYC 1UWEL 2AJUL 4D9QD 2YSSA 4P57B 5FYJH 5EBMA 5TH2B 2M26A 4NBYB 5T1DL 3MBEC 1A6VH 3NFSH 3S5LB 3LMJH 1CD0A 4X0KB 4F2MB 2VYRE 5T3XH 2Y6SD 4NQCE 4QYOA 5LWYL 5CZVL 2R9HD 1K6QH 3W82A 4ZUVB 4JKKA 3MLTB 4UV4L 3WS6C 4QWWC 1W8OA 3LZFH 2EE6A 3MCLH 2DN7A 3W2DH 3G6AB 2GTZB 2Q8AH 4F80A 5JQ6H 1YQ2A 4J8RB 5CGYC 1WWCA 1JPFA 4FQJH 3C87A 1BJ8A 5C0GB 4LSUH 1YEJH 4NHUB 2F8XC 4I9WE 2FR4A 3X3GH 3B6SA 5KSVA 1T20A 2Y5TB 1AR1C 1YEHH 3CJJA 1BIIA 2VXQL 3PP3K 1J8HD 3U1SL 4UV4H 1LNUB 4P46B 4JHBA 2OP4L 4ZUSB 2DF3A 2VLKD 5DYOB 3D0LB 1YJDC 1R3IL 5JQ6L 2LU3A 3MGTB 1NFKA 2BK8A 5D6DC 4WW1A 1G1YA 1EBPA 5MEPB 5I6XB 2MHAA 1CS6A 3BPCA 3CD4A 4U3CA 4YDJB 3O9WD 3EFFB 5IF0B 4NT6A 6CGTA 1A6ZA 3EDFA 3ZTJG 4JY6A 3KLHC 3B9EA 3JV4B 4O2EA 1M05A 1ZS8B 1ZT4B 5DQ9B 5EO0A 3LEVL 2R1XA 5I15H 2W9LA 4QHUB 5GS1B 4NQVA 1KPUB 3EGSA 4AJ0A 3TESA 3UPAA 1JVKA 2A77L 4NOFA 5JOFB 1UM5H 4HS6B 1HHKB 5E2VL 2FECI 4IBLT 1MCPL 3VI3F 5DK2B 2FBJL 3BW9B 4PJFE 2BX5A 2B5IB 1NMAL 1CE1L 1DQTA 4TUOA 1N0XH 4LVOB 2WIIB 4B5EA 5JLZB 3NIGE 4JFFD 4L1HA 3TN0D 1NBYB 2VKXA 4I48B 4U3HA 2JJSA 4L8SB 1YYLH 2X1OA 3VI4F 1ND0B 2NZ9D 5FK9B 2E27L 4IOFC 1JGVL 4KHTH 4XB7A 5BVPL 3DX9A 4HIHA 1W0YT 1E4KC 1BAFL 1SJVA 1H0DB 4M6AA 4PJGA 1T1WA 3ROOB 3E6FA 5KANI 4BM7A 5B8CC 2EKJA 1KCRH 1IC5H 2A74A 4NBZB 1BPVA 5C0NC 2CUHA 1F4YL 1EEZB 2CDFA 3AY4C 3O2WH 5C6PB 1S9WA 4PY8I 3UBXA 2RJMA 2LTQC 1KPUA 3CVIL 4WI5A 1CDCA 5D8JH 1I1FA 1EXUB 2RFXA 4NHCL 4PJDB 4DGVH 2D9QB 5TF1L 1BVZA 3ZKXB 1UC6A 5DVNA 5GHWL 1BVKA 1Y6KR 2WWMC 5D1ZA 4R0LB 4EZMA 5LQBL 3BH8B 4QTHB 4KKCD 2QADB 1Y0LA 5EFIA 4LSQH 1CGXA 1ULVA 4S0TD 1GIGL 2WM0A 4LCUA 5I1CL 2OLDA 1U95B 3BX7C 5LCVH 1H5BC 1L0YA 3OTTA 1AGFB 5ETUA 1BFVH 1F4HA 3RGVB 4HH9A 1CR9L 1OF2B 5D7IB 1E27B 4QRRB 3C8KB 5F88B 1U8KB 4ZOEA 5FYLD 4OCYH 2KL6A 3RZCB 1PQZB 4GXUM 3BE1L 4NO5A 4NO2B 2ZUWA 3GSOB 3P4MB 1UH3A 1HINL 2P1YA 4K71C 4XC1H 1ED3B 3LDBC 3N85L 5B39A 2XN9B 4OM0H 3F7RA 4KK9C 5D6DA 4M00A 3TVMD 2CD0A 4Z6AT 1FZKA 4WV1B 1GXEA 5M7QA 1CR9H 4RWYH 4JO3H 4NNXB 3KDMA 4I8DA 5DHVA 4M7ZC 4XI5C 4MXVF 2ZUYA 3WNKA 3U36B 1X7QB 5DFVC 4KPHL 4BQBA 4TSAL 4GQ9H 3PWJA 3STLA 4K2UL 1SY6A 5E00A 4UDUB 2C3VA 5I1IH 1BJ1J 1IGFL 1G9NC 3BW9A 3NH7L 4P99A 3K2UH 5J3HC 3S37L 4LGRB 5EBGA 4G6AC 5JR1H 5I66A 5EWIL 3WIFB 3RDTD 1U9KA 3O3EA 3HZMB 4XPTL 4XVSH 1VACA 3LH2H 4RMQA 4ELKA 4HUVB 1QFUH 3M07A 3ARPA 3LQAH 4N5UA 1CT8B 4APQC 1DQLH 1D6EB 1TVDA 3LKPA 1XH3A 2W65B 4IRSA 4K2UH 5HYEA 4YBQC 2PETA 2XZAL 4N0UB 4DN4H 1VGEH 2Q3AA 3ARFB 2D31A 4AEHL 4KJYB 4C4KO 3I9GL 3W9DA 3E8UL 3IFOA 3KPPA 1R3JB 3T1FA 3KLAA 1CFBA 1KEMH 1RQ5A 1Q9KB 5GZOD 4LVNB 5K93A 2DQTL 4XVSL 3DSFH 1DFBL 3IAQA 4H8WH 3BP4A 3L3HB 1FZMB 3L5HA 5CJ8A 4MJID 1MIEL 4OZGE 1OTUD 2ADIA 3HPJA 4TTGA 3X3FH 4Q9BA 3T4AA 2OXGA 4HT1H 2OL3A 4HS3B 2EDKA 4ZUWB 5FO7B 3VD3A 5MEPA 4MA7H 5FEBA 3BPNC 5B8CA 3IDIA 3QR2A 35C8L 3P30L 3OKLA 5DC9B 1QRNA 4X5WB 4JPIB 3TYGL 1JGDB 1J18A 1CIUA 4FQQA 3PGFH 5C0ND 1JZ8A 4NQEE 4KZDL 1Q9WA 4FNLL 4EI5D 3CDYA 3WIHL 1UT9A 4FABH 4M6ML 2GTZA 3GI8L 5EU6B 1TCRA 5I8OH 3MRBA 4OCMC 3RVXD 4TUKH 4L8DB 5EIQA 1L6XA 5DR5H 1NQBA 3FO0H 4U6VH 1WFUA 5F6IB 4X98A 2CRYA 2OM5A 4ZS7L 1DUZA 3UROR 2XY1A 4HGWB 3SJVA 2BSRB 1NFDF 2DKMA 1PBYA 1JF5A 1NEZG 2ZUSA 5GRJH 5J57B 3BQUB 4YC2B 5GS0H 4LCCC 4OJFL 5BV7C 2DM2A 4U1IA 1JIBA 4PJAB 1BLNA 5SWQB 1G6RL 2JKXA 3B4NA 2L4OA 5IMOA 4HGMA 1G7LA 5FB8A 1BJMA 1XFPA 4MGXA 3SKOA 4G42B 5EU5A 1DQMH 4BELD 4CVXB 2YPVH 3U9UA 4OCSL 4I2XB 2JB6A 2RCSL 2LV4A 3LMJL 3WKNA 4P9HH 3OB0K 3BIKA 2FSEB 5CEZE 1UWGL 3O6LL 4MZ2A 3FB6B 4HKZA 3V0WH 4OIIL 3PL6B 4CKVX 2O61A 2JCCA 5IMLB 1IEBB 4U1SA 2WNGA 4JM2A 5HSFA 1CLZH 5C09D 3D2UD 2X7LA 1M4KA 2YD1A 4LLUB 4MA3A 2NY5L 3EW3B 5J11B 4LLDB 3VXRD 2PN5A 4M7KH 4C83A 5HVHB 3RVVC 2D0GA 4RSVA 2VB5A 1HYSC 4F58L 2F53A 5IVOA 3N06B 4OF7A 4JFOB 5LGKA 3X3GL 2EC8A 3O6LH 1RPQA 2HT3D 2GSGA 1AQDA 2HKHL 1TQCC 1EJ6A 4PBVC 5EH1A 3WDHA 2HG5B 1VGKA 4LLWB 4JO4H 4PTUA 5FV1L 3E0GA 3ZE2F 4Y19D 3A67H 1HHGB 1TJGH 1X5YA 2ZCKL 1E6OL 2H2SD 4GXVH 1I3UA 5DJZB 3G5ZA 3Q6FB 3NIGF 4HUXB 4PJEA 1CD1A 1CDIA 3IGAA 5D4QA 4M61B 1YNLL 2Y07L 4PGBA 4QGTA 1IKNC 3I50L 1UQSA 1VKXB 1HHIA 2VDPL 3NCEB 5I8KH 4XC3H 3K4AA 2FX8H 2CIIA 5C0FB 4YHNA 1CICD 1QSEE 1NCDL 1X5JA 2J5LC 3KYOA 3DTXB 5CUSL 5E8OA 1FZKB 4WV1A 2YD5A 4LCWB 4LRIA 2VXSL 4I18A 4X6BB 3C6SB 3LKOB 5E95B 5IR1A 1AP2B 3TWCL 4KJQD 1HILA 3HE7B 1MAJA 4ZUUA 1J8HB 4JE4B 1UM5L 4JFFB 3MBEA 3AAZB 5E24E 5I18L 2HVJA 3DROA 4UNVA 4KH2A 3QDJD 3C5ZA 5C07B 4KTDL 2FJFB 5DI8A 3K1DA 1CXFA 1NC4A 5HVFB 1T0MA 1RZ8A 3PWVB 3MRLA 2R2HB 4U1JA 3TIEB 4AENA 3FONB 1NAKH 4R8WL 3M17B 3AFLA 4PRBA 5J56B 2F54B 4K3EH 5J8OA 4HF5H 5DJ6B 12E8L 5FHAH 4LPTA 5I71B 3ARED 4M1DL 1SEQL 2FX9L 2HT4C 3GSNA 1M7XA 5DK0A 1EXUA 2RFXB 4PJDA 5CBEA 3VRLE 4LKCA 4P5KA 4PG9B 1MAML 3MA7B 5MEND 3K3QA 2B7DT 5D7LD 5DLMH 4YR6A 4QRUB 3WN5B 4M6NL 3P73A 2QADD 2R8SH 3P11L 3FN9A 4BJLA 3OXRA 3UJJH 1LP9B 4PJCE 5C07E 3U7AA 2ATKA 1G0YR 4P5MB 3ROLA 3C60B 3NFPB 2C7UA 5CSZB 1NGWA 3DO7B 1U8JA 1B0RA 1ZGLA 4AT6B 5B3JE 2ZJSL 3QUYC 4WJ5B 1J7VR 1OW0C 5HI4C 4KHXL 4ZSOB 4XAWH 5FYLL 5DEGB 3ZKXC 3C2SA 3KXFE 2BDNH 3SN6N 3SQOH 2H8PB 4FN0A 2GJ6D 4DN3L 1ZT7B 2NY1C 4PJXA 1MY5A 3SGJC 2PYFB 2ZKHL 1NJ9B 3HMXL 5A2LH 3X12B 1XR8A 4MQXD 2NY7H 3HA0A 3RA7H 1WIUA 3S37X 3VWKC 2AK4E 4FFZL 4JG0H 1Z6JT 5HYSA 1KT2A 2WW8A 4F7CB 5C8JA 1QO3B 1KJ2H 1RZKH 4XP4H 3MC0A 3VD7A 4Y4HC 1QEWB 4J7RA 3HAEB 4H20L 2VXTH 4EVNB 3B83A 5JUEL 1SHMA 2XNAA 3BDBA 2I9LA 5F7EH 2R4SL 4K3DH 2ZKHH 3HMXH 4XPBL 2JJSC 4RMTA 5T5NF 2DMBA 4C4KT 5KN5A 1EMTH 1KTRL 2CLZA 3WFZA 1JV5A 5FM4A 3GSXA 2D03H 5D7JD 5AD0B 1NC2B 4EQ2A 1OPGL 4OV5B 1OSZB 2BNRE 2L7JA 3EOTL 2DLIA 3QZWB 3RKDD 4MJIE 4L3EB 2F15A 3GKWL 3LKQB 3VE0B 1INEL 3ARSA 4XI5D 2EEAA 4J1UB 5C6TH 4PJ5B 4NWTH 4DKAA 5K9KA 3BPOC 4CRPA 1JPST 3SKOB 2P24B 2HTKD 3D2UA 5GSRB 1X3DA 1N5AB 2A6IA 1AXTL 5GRXG 4MNHB 4NQUA 1W0VA 5KVEL 1HSAA 4NGHH 1LWRA 4YHLL 4MNGB 5CZXC 5FGCE 1NGYB 4WNQA 3EOTH 2AEWA 3DGCR 4I0KA 3K8MA 4ZAKD 1JNLL 3CFJA 3HN3A 3V7AE 3RHWK 1OM3L 3VRJB 5F7WC 4BFIB 3SGKC 4X83A 3O4LA 1DVFC 1KXQE 3WE6A 2DQTH 3L9RA 4U33A 4NRZB 1H8NA 4Z7VF 5H37G 5I0ZA 4OD3H 1MCWM 3V52H 2ZG1A 2VJXA 4HCRL 4U49A 4HFUH 4FZEH 1DQDL 1FVDA 1NCNA 3NAAH 2X4NA 5EC1A 2EICA 1BEYL 1DE4B 1DZBA 4I1NB 4L8BA 4HT1L 1JYNA 4P46C 1LD9A 4TNWK 5DZOA 3ZKQD 4WUUD 1RUQH 2WWMD 3FOLA 5F96L 4K8RH 5EU7E 2GJZB 2Y1VA 4XNXH 1S7WB 1MNUL 3ZKMC 1MWAB 5B4MC 2ED7A 1F4XH 3QIUA 3QCTH 1LEKB 4FS0A 3HUJF 3P9MB 5T3ZL 3P0VH 2DQJL 2HFFB 1MEXL 1BZ7B 3QUXA 5E6IB 4LPXA 3IF1B 2BVOA 3U30C 5ESAB 1WICA 4Z7WF 4JZJA 3S36L 3GI8H 4PGJA 4QRPE 1BF2A 3T2NL 1JRHH 2G60H 5IB2B 4GBXC 3GJFB 25C8L 3GMMA 2MKWA 2GY7B 4ISVB 4AIOA 2X4UB 3GSRB 4UIMB 3PWPE 2YN5A 3WUWG 5FKPA 2I27N 3HAEA 4N0FB 5I1JH 5IM7B 2QHRH 5FIEA 5GIRB 1S7XA 5DJXB 2YEZB 4N90D 3GNMH 1DBJL 1IGIH 3OG6B 4X6DA 5FOJA 4APQA 4D9RE 5BVPH 4LKXB 3UP1A 3MRDB 4X6FB 3D6GA 1F00I 4WWID 1RZGA 3O4OB 3QXTA 1N6QL 4ZPVA 1QKZH 3PNWB 4CJ1A 4Y4FC 4HIHB 4HFWA 4KDTC 4F33A 1UQSB 1FYTD 3TV3H 1GVIA 5D93B 5IW1B 5D7LA 5ELIA 3PDGA 2IANA 3D69A 2AP2A 2PTTA 1H3UA 1KULA 3EO0A 4MQXC 2BCKB 3U46A 3BPLB 4V1DB 5CGTA 4LHUG 1IGCH 4JJHA 4UI2A 5B39G 3RUGE 1M6OB 4HKJA 1CDBA 3UTZB 2QR0B 3GUTB 5J1TC 4MJIA 4JQVA 1KACB 2J6EL 2X05A 1AGCB 1T66D 1JF1B 3I02B 4WI7A 1CXIA 5E8DH 4YXLH 5I9QC 1QR1B 2GCYA 1OGAB 1EGJL 1T83A 4E0RB 1FNEB 1PKQB 4JHAL 4OLUL 1IAIH 3PGCB 5D7KD 5FKPB 3V79C 1UM6L 1YEDA 4CMHB 2BVUA 4L9LC 2CDEA 4YHML 4NQSB 4MVBD 4XZUA 1LO5A 5KSAC 1MQ8A 4NQDD 3CLEH 5BVJB 4Y4KC 1FSKB 3LV3A 2ZCKH 2NX5A 1MH5A 2J6EH 3ZDYF 5MHSD 1KIRB 1IC5L 4XNMA 5SWSE 2X89D 3SGKA 5GGVH 2AS5M 1DVFA 1OGAD 3MQIA 5HHXL 3T2OA 2DLEA 2DTSA 3U82B 4D0DB 2IADA 2D4DA 4PJ8D 4LEXL 3KLDA 3L95B 1FVCA 3CNKA 3AREC 4JDVA 5HYJD 1MCJA 4JY4B 1WFOA 3V6OE 1PAMA 3H42H 5BZDA 3L7EA 4LCCA 4WU7B 1GZQA 3X14B 1XAUA 2I5YL 1ZLUH 1HDMA 5T33H 1WUNT 2E6PA 2VZUA 4RGNE 3SJVD 5KVDH 4UAOC 4XCEB 5GRYA 3CZJA 2Z31A 1DLFH 1TZGH 4NO3B 5CGMA 1I1AA 2DAVA 4PJCA 4Q97A 1YEFL 3M45A 3U0WH 1J12A 3DPBA 4GSDH 4ZNCD 1BQUA 3NTCL 3UX9B 4DKDC 2IPUG 4JFPB 5KANG 1DDHB 2R0WH 3VMOA 1DN2A 3EYUL 1AE6H 4RISL 4J3WA 5BRZA 3ARDA 3WFDL 2Z8SA 1CL7L 3N9GL 1CVSC 5IFAL 2BY2A 4PGBB 3JUYA 3ZTJH 1CFSB 5E9DE 5DHYB 3SHSA 4XMLH 1YDPB 3MYZA 5IIEA 3LS4H 2YUWA 1LQSR 3BKJH 3DGGB 3TZVB 1AXIB 3F7QA 2IC2A 2BY1A 3PIQB 4ZYKB 3D2UB 3QEHA 4Z0XA 5GSRA 4M7JH 4MS8C 5IB4B 4NKIH 2VDNH 2IH3A 3I75A 2UYLB 3B3IB 3HE7D 5DUMH 5FCUH 3VH8G 5BO1L 4GKNA 4XVUC 4KPHH 4LEOA 4R4FH 2E9JA 4LPVA 3LEYL 2C5DC 3OKKB 5IKCB 2F74B 4O51B 3MRRA 1A7PL 5HGHB 3AMKA 1C5CL 2V7HB 3RWEB 3LIZL 3K2UL 3L3HA 5H35A 5FECA 2V17H 3WNLA 2H9GB 3OX8B 4XPHH 1MWAL 3DBXA 3F5WB 5I1GL 3DARA 1QFHA 3KPSA 4KTEL 1ZT4A 1GYAA 2UWEA 1NPUA 1U3JA 3EJZC 4JHWH 4O2EB 2X4PB 1R3LA 1QLEL 2VLLB 1I8IB 3BKYH 3BGFB 4U1LA 4D0CA 5C09E 5HHOD 4UUJB 4TVPD 5E1AB 2Q76B 1ETZB 5D2NB 4NWUH 3VXUD 4LRIC 4IJ3B 5I75B 3LIZH 1A1OB 2IALA 2XT1B 1N64L 1WSST 4X6CE 2HFFA 4HUVA 1T5WB 4I3SH 3EDEA 1KCUH 2D7TL 3OXSA 1T83C 2GUOA 5FA3B 1UEYA 3GO1L 1QQDA 3VGEA 2GJ6E 4XVTL 3MRMB 4LCYB 1XF5B 1C12A 1XGUA 1L7IL 4L9LA 1QLEH 1D5MA 4FQLL 2HJLA 5KSAA 1I8LA 3EDKA 3EOBB 3U7WL 5EC1B 3TBSA 4Y4KA 1DANU 3U4AA 4HGWA 3SJVB 4IRJB 1HYRC 1NCCL 2G2RB 3CX5K 2FYYA 1NCBH 4WI4A 5LKNA 5CJ5A 2F53E 1RIVH 4ZUVA 5HYIA 1DBAL 1CTOA 1H15B 4YK4B 4FXKB 4WFHE 5EZJB 4P2RA 2XACC 3JWOH 3O45A 3P9LA 1HEZB 3LS5H 4IDJH 5C08E 1XIWD 3EFDL 3GSOA 4Z7OF 4TUKL 3W39A 2XTLA 3HE6C 1NCCH 1E27A 4QRRA 1OD7A 2KH2B 2BVQB 2O5ZL 5KVEH 4PRPB 3L3IA 1RU9H 1A1OA 2IALB 4WO4D 1OTTC 4OGXL 3OKMA 1A3QA 1YY9C 3T0EB 1AO7E 4Q2ZB 4WI2A 3ILQC 4EN3D 2Z4QA 3CCHB 5DEFA 5SWZE 2GK0B 4N5ED 5BS0E 5K9OB 3T0DA 1AI1H 4E41E 3RDTA 3BP4B