2IALB

Structural basis for recognition of mutant self by a tumor-specific, mhc class ii-restricted tcr
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
239
structure length
239
Chain Sequence
AGVTQTPKFRILKIGQSMTLQCTQDMNHNYMYWYRQDPGMGLKLIYYSVGAGITDKGEVPNGYNVSRSTTEDFPLRLELAAPSQTSVYFCASTYHGTGYFGEGSWLTVVEDLNKVFPPEVAVFEPSEAEISHTQKATLVCLATGFFPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the recognition of mutant self by a tumor-specific, MHC class II-restricted T cell receptor
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords CD4+ T cell receptor E8 alpha chain
total genus 57
structure length 239
sequence length 239
chains with identical sequence D
ec nomenclature
pdb deposition date 2006-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ialB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ialB02
3C9NA 1TVHB 1P6AB 3UYPA 2DL2A 1HSAB 3FL7A 5DRXA 3OQ3B 1CCZA 2OTUA 1MIEL 3RA7L 1FZJA 4OF8A 3QRGL 5FO7B 4TNWK 5E6IB 4W4NA 3PWNA 5ILTL 3WSQH 2CR6A 4QRRD 1T2QH 1U6AL 5GJTH 1KENL 4PJBE 3C5ZA 2BC4B 3D18A 4XH2B 3UZVB 3U7YL 4PJEE 1NMBH 3FRUA 4HFUH 4I13B 4X6CB 4BUGA 4N0FA 1OB1B 5HXMA 4JHWH 4LDLB 4XWOD 5LKNA 1WT5A 1KUMA 3TIEA 3HC4H 4UV7L 1CE6B 4OD3H 5DFTA 5C08E 1CLOH 2WINA 3TZVA 4OCXH 3HPLB 3PGCB 3MNVB 4ZNCD 4M7LH 3N85H 4IBLT 5C0RL 4RQQA 3UBXG 4CN1A 2YWZA 3SE4C 1FNFA 3L3OA 1OD7A 4G5ZL 3RI5K 4Y5YC 1XF3B 4MJIA 1OQXA 1GIGL 5SWQB 3FN9A 3P4MA 4GAJL 3O41B 4I3SL 3L3HA 2A83A 3JV4A 2EDWA 3ARZA 1U92B 3E8UH 3S37H 3RA7H 3TIDB 4I0PD 4QXUL 4XPTH 2AJZB 3U4BH 4JPKH 3VXNB 1NAMH 2OBGA 5HDBE 1DE4B 3QEUA 2YKLH 5IEHB 1QKZL 1NBQA 2VITB 3K8LA 4D9QD 4DFHA 3F7YB 1QSFD 4LF3A 1V5JA 4XB8A 5LBSL 5IHBA 1KELL 3QXDA 5DRZB 4HFUL 3G6DL 4OGAD 4TUJA 3RNKB 1E4KA 3G5XA 2DLTA 3GIVB 2EDEA 3EYVA 3QCVL 3QPXH 5ESQB 4W81A 4Y4FA 3EOYG 4HD9A 5DD5H 5IQ7L 3VFPB 2BP3A 3KR3H 4XI5C 3K4DA 3DX7B 4NCC1 4OCXL 3STLB 4JFEB 4GRLC 1GGBL 4WNQB 2YPKA 2XN9E 3CMGA 5CKAA 3NFNB 1H15B 4IRJB 1FV1B 4EI5A 1UJTA 4R8WL 3SO3B 4JR9L 1ZEAL 4KHXL 4PGDA 1DUZB 3OKOA 4ZMAT 3QO0B 3RWDA 4PTUB 2EYTA 4G8EA 1FZMB 2Z8RA 4Y16A 4P57B 1CFQB 4RNRA 4JPIB 1YEJL 2BSSB 3ARGA 3CCHB 4OV5A 4LLMA 1SBBA 3HE6D 2W92A 3A6CH 3N1PC 4IM8A 3FCTA 5DMJB 2VAJA 3P9MA 1BJMA 1ZHKB 4L8CB 2P45B 3O4LD 3NIFE 3ARFC 4WCYH 4F2MA 5GSRB 2QR0B 2R1YA 3MX0A 5IJVA 5TDOA 5J6HA 4HIEB 3NIDE 5BO1L 3H0TA 4AM0B 5CJXA 4WHYG 1MHCA 4YDJA 3NMEA 1N64H 4K07A 1IE5A 3PP3K 4JKPH 2ZNWA 3BIBX 2IALB 1ACYL 5LGHH 3HI6L 1A6PA 5L2KA 4RNRB 2OXHA 4EIGB 3OKLA 1FJ1B 3G9VA 5BRZD 5GS0L 4N0CD 2GQHA 3OKMA 4MD4B 2VYRE 4A6YA 2RJMA 4WRLA 3VGDA 1TZGL 5J9PA 3QDJB 2NY6B 3U83A 2A6JB 1URLA 4YNYA 1QSEB 2ZCLH 2AXGB 5T1DL 4X6CA 4EN3C 3MRGB 4S0TD 4RISH 1A7RL 3GI9H 4QHUB 1OM3H 5IP4A 2VDRH 4GW1B 5A40E 1C12A 5KANG 4AZ8A 1EUUA 3ULVE 4JKKA 3B9VA 3ULVH 3O6MH 4N0RA 3U1SL 5DJZA 3H42H 2PYEE 5MHSD 4JLRA 3KJ6L 4RDQG 3ZKND 5J0BA 5IOPA 4LLUB 4PY7A 5F96L 2DB8A 1A6ZA 5H35B 3L3IB 4G6ML 4JGUA 1NL0L 5FV2A 1KIRA 5IMOB 1U8MB 2YRLA 1AHWA 5TGBA 4GBXD 4PJAA 2BVQA 3I84A 2EIZB 3MFGB 4AENB 2OL3H 4X7SL 4ZAKD 1DANU 2R2HA 4NQUA 2ZUVA 1KPRA 1J7VR 3O9WB 1TZGH 1JPGB 3HR5B 2YEZB 1EO8H 3IU4L 3LV3A 5T33H 2VLLA 1VPOL 2OZ4A 3ARTA 5CEZD 3DNKA 2ZG2A 4NUGH 1IC5H 3HUJB 4HZLA 5HJ3A 2YSSA 1DQMH 2H8PA 4Q6IC 2JIXD 5F88B 5F72S 1OLLA 3S4SB 4H8WC 4I0PA 1D5BB 4XNYH 1IC7H 1Q94A 3BGMA 4KC3B 4LIQE 2XG4A 5L8LB 3WNLA 1XF1A 4HUNB 1SEQH 3GGWB 1T5XB 5E95B 4WNQA 5B4MD 4APQB 4FQQA 1I7ZB 4MA8L 4HFWB 4GXVL 3HE6A 1JWUB 2Z8WC 4JFPB 1E28A 1WCQA 4WHTA 1L7IL 3MRBA 4N0UA 1BJ1H 2JIXB 3FO9A 2WBJB 3UPRB 5GGUA 1XR8A 4PTTA 3EDJA 4HF5H 4LMQI 5SV4A 4N5UA 3IETB 3G9AB 4L4VE 4HAFA 1SM3L 4P5TD 1WAAA 4L29B 4UNTA 5JW3L 3SKOA 3T2OA 1HILB 4GMTL 5IVXF 3LEXB 1HHKB 4JGMA 5I74B 3GZKA 1ZANH 3HLAA 5T5FH 4MHHI 3OPZL 3FQWA 1NH6A 4M7ZB 2UZXB 1L6ZA 4LVNC 5TFSH 1RUAL 3MRDB 2RFXA 1X7QB 3BP5A 5T3XL 3D39E 4PRIB 2XRAH 3EGSB 1JGUL 3MNVA 2NY1B 3PXHA 2EDJA 1CLZL 1CXEA 5SWSA 1OGTB 1FBIL 4YGVB 4KPHL 3HNSH 3M1BB 4YUEL 2VO5A 5DJ2A 2XTJC 4OD3L 1EHNA 3LSOB 1QBLL 3THML 2C9AA 1CF8L 3AGVA 3WFZA 4PJ7F 4O58H 3VRIB 3V0VB 2FEDD 2WWKO 1I1AC 5C0FB 4M7ZC 4P5MA 3BE1L 4BJLA 1JHTB 5TJWK 4IRJD 1XIWA 2Y25A 3LEYH 1LWRA 3B5GA 1A6WH 4UUJB 3G5YA 4UT9L 5C09A 1JWSA 2ZG1A 2KPNA 2GAZA 2IPTL 5LGJA 2PO6D 3HRZB 1MSPA 4I5BB 4NO5B 4Z7QE 5FOBB 1U8PA 5ITBL 3GSQB 3RZCB 3QISA 4OZ4B 5HVHB 3MGAA 4ZOCA 1T21B 3HA0A 4KRPD 4KKAC 1U41A 4BH8A 3GBMH 1TJGL 1G9NL 1MFEH 4JLRB 4PJIB 4FG6D 2V17L 1LILA 4W4OC 2OJEA 1LP9E 3E6FB 3WHXB 5IFHH 4NC2B 2W9EH 1S7TA 3OJVC 1NAMA 3AREC 1KJ2H 3AXLB 1I7ZA 3VGBA 1QBLH 1WAAE 4Z7NE 2NXYC 2QQLL 1EVUA 2DTMH 4LNRB 1B0GA 5I1IL 2A77L 4JDVA 5FM5M 1QG3A 1JZ8A 5L88H 2QQQA 1EGJH 3ZT7A 2VLKD 4R8WH 3RY6C 4XAWL 2CUMA 4XCEA 1MJUH 1LE5B 3GSNH 4LVNB 1A6WL 4TUOA 5GPRA 1N6QL 3E8UL 1MIML 4I3GA 1LK3H 4P23D 1MCEA 3C5JB 3LN9A 3FZUC 5DEGA 4NBZB 1GZPA 2YPKB 3WNMA 4UDUA 1UKTA 3MA7A 3RPKA 3MLXH 4HUXA 2GT9B 4Y16D 2NY3B 3BMWA 1ZK9A 1RUPH 3QUMA 1IM9A 3HPJB 4ODWB 3V5KB 1VERA 3VRLE 4DKAA 5BO1H 4LKCB 3BQUA 2F5AH 1WF5A 3D48R 4A6YL 1TTGA 3MRQB 1E4JA 4KGLA 1CLCA 3OXRA 1OAYL 3UZQA 1G6VK 5L2KD 2Z4QA 3SJVA 3QFJD 4HH9B 1ACYH 4PLOB 5EC2B 5JORB 1JZ5A 1N59B 1D5IL 3MO1A 4LAQL 3QDMD 1MH5B 3TIDA 2JCCA 4XNQA 4XPBH 4CADB 5D7JD 1BMGA 4MS8C 5CSZA 5E24E 1N6QH 4LCWA 1P7QB 2FBJH 3FRUB 2NQCA 3G5VB 4DCQB 1IM9B 3G6JF 1M1SA 1KTDA 2BJML 3HUJE 4P46C 2C7UA 1INDH 1WQVT 2HMID 4ZO8A 2ZKHL 4I4WB 3QDMB 1WV7T 2YD7A 3NPSC 4GG6E 1XFPA 3OXRB 2NXYB 3U1SH 4CVUA 2XACC 3C2SA 3V4UL 2GHWB 1ZHLB 1XIWC 3LKSB 4U6VL 4FFZH 4GRLA 3E1F1 2AAVA 1BJ8A 5CJQL 4A2LA 2AQ1A 1KPVA 3U0TB 3UP1A 5IWLA 1OQOA 1S7XB 4L9LB 4MQXC 4GH7B 4NN7B 4NQCE 4EI5C 4ELMF 2QQNL 2R23B 5J1AA 4E41B 1AH1A 2VNCA 2WV3A 4MXWL 3UCRA 5L2KE 5EOQL 3SDYL 5ENWA 1FGNH 5LWYH 1QPPA 3RWEA 3BO8A 2E7LC 2JTDA 4F15B 3SGDI 1DQJB 4R4ND 1UJ3A 1OAZH 2PYFA 2DLEA 3OAYK 4Z0BH 3GSXB 3RL2B 4F33B 4HPYL 1NCCL 5HPMB 3BZ4B 2VH5H 3ZE0E 1NBYB 3SGEH 2QSVA 5FKPA 1P6FA 4AEFA 5D70H 4MNHA 4MQ7B 1DBBL 5FYKD 3W2DL 4LCCB 1RJLA 4X7FC 2FECL 4OUOA 1PKQE 1FPTL 5DHYA 5HYFA 4LLQB 3TVMC 3HPJA 4DUWA 5IB3A 3VA2C 2QKIB 5DD0L 4Y4HD 5ICXA 1WCBB 4NP4L 2NXZD 4F15C 1GOHA 2YXFA 4JFHD 1XGTB 3MA9L 3MLYH 5E5UB 4YBLB 4ZDHB 3IAQA 3KPTA 5TF1H 3BUYB 4K3JH 2H3NB 3C8DA 1LDSA 3S34H 5D7JA 4L3CB 4M1CC 5B8CB 3GHBH 4Z7OE 1U93A 1MJJB 5GGSB 1DL7L 5IWLC 3JTTB 4HPYH 2NY0D 5DHYB 3CFJB 1XIWB 4M4RA 4DEPB 1AGBB 3ZKSD 2XOTA 1KJVA 4JRXE 3F7RA 1GYAA 1QSFE 4PJHB 1HKLL 3T0AA 1IC5L 1TETL 3AB0B 5SX4I 1U6AH 4IEFB 2F54B 2BNQB 1Q9LA 1MFAH 4FQJL 3QNXA 3BDYH 1R5IA 3S37X 2XA3A 3NCJH 2W65B 4F37K 4ZPVB 5TE4L 1QFPA 1T66C 5DURB 4FQXC 2WMPA 4JN2B 3DV4B 1KCLA 3LS4H 4KKBD 2B1HH 1H8NA 2FEDC 5IBUB 2PCPA 2QQKH 4AMKL 4CBPA 3RKPA 5MENA 1BPVA 4OLVH 2H26A 3GI8L 4OCWL 4NPYB 3GKWH 3CFJA 3WKML 4OCSL 4RZCA 3D3VD 1LMKA 1YECH 3CFIC 2HJKB 32C2B 4HFWA 4Y5VC 1FAIL 1K4DB 1VFOA 1V7NH 3MRPA 4JQVA 4G80A 3AVEA 2AJXL 4I3SH 4KJYB 4OFKA 1FO0B 2C5DC 2EO1A 1CXKA 3HKFA 1I1AB 4M62L 1EFQA 2YPLB 1NAML 3N50A 4PRNA 4J2XA 4P2QD 5DQDH 2XTJB 4L8DB 4Z78B 1WIUA 1TQCB 5E8EA 5F7DB 4RZCB 5E8DL 4NZDA 4JREC 5JUEH 3WDJA 2YMXH 1FZKB 3SDCA 3SDDA 2VDOH 3H9YA 4FNLH 3FRPA 1JYWA 1M05B 2QQKL 3TO2A 1CICA 4OCMC 5IUSA 1A4JB 4EDXA 3GNMH 3O6LL 1ONQA 4PGCB 1JYNA 3DRQA 3T1WA 4DQOH 3KYKL 5L2KB 1SVCP 2FATH 4Q74A 2BHUA 3MSPA 5CEZL 5EPMA 1S9WB 2I5YL 4I2XA 2P5WB 2XA8L 4FQXA 4CU7A 1AO7E 4TSCL 4Q9CA 4ZPTB 3W9EB 3BD4A 3ARRA 1U8HB 4KJQD 4V1DA 4WUUA 4X7CC 3WNNA 3G04B 1OLZA 3BPCB 1QLEH 1TCMA 3SKMB 4QHUA 3MRHA 5F7EH 4YDKH 2VC2H 3D0LB 2YXMA 1CXFA 1PY9A 2MWCA 3HS0A 1AKJA 4QOKB 2E9IA 5A2IH 5DQ9B 3B2UD 2K7PA 4B0MM 1EERB 1JRHL 2H1PL 1X9QA 4JFFD 3H9ZA 4PJGE 3CZFA 4ZPVA 1IAIM 1F3RB 2EDBA 2ED8A 1E4XL 1PQZB 3GRWL 2DYPA 5ADOH 5DT1L 2YUVA 4YLQT 3HE6B 4L8SC 5FYKU 5C3TA 1BLNB 2J6EH 5KG9B 5B39G 4NM8L 1MWAH 5ACMA 5BV7C 1A14L 1YEHH 4WV1B 5I19H 3UYRH 1UB5A 4HLJA 3CFDA 3FB8A 1CVSC 2RBLA 1IGYA 3R8QA 4HK3J 3VWKD 3ULVD 2XFXA 5EOCJ 1KEMH 4PJIA 1I3VA 2XWBB 3LHPL 4XC3L 2GJ6D 1FLRH 4RX4D 2X42A 2ICES 1ZVHA 4GG8B 4K23L 4M48L 5K9QG 3HHRB 5FB8B 3LRSA 3GMNA 2BSSA 1NLBL 3V4UH 3RL1B 3EYSH 3MLSH 4KMLB 1BD2A 3MYJB 1A3RL 5D1XB 2FDBP 2XQBL 2UWEF 5DD5L 2VABA 1T2XA 5DSCA 4TRPH 1M7DB 1JHTA 1F8TL 5FECA 4MA3A 5HVWA 2Z91A 3QQ9C 1J0KA 3WIIH 3HZYA 3LB6C 2VUOA 3V7MA 1F11B 1J1XL 1KJMA 1HZHH 2CH8A 3NZ8A 3CVHA 3W39A 5HYSG 5I1JH 3QIBC 1ZEAH 4KHXH 4RQQB 5ICZA 1I8MB 4OFYD 4Q7DA 3MUGB 3ZLQC 4X7SH 3F7VB 3K74B 1QSFA 1YJDH 4R96A 4ZOAA 4NQEA 2G75B 1NFDB 2DDQL 4XPAL 3ZDXE 3GM0A 4LSUH 2VQUA 5LAXB 4BFEA 2ESVA 3Q2CA 3AY4A 4OZHB 1JNNL 4PG2A 5I1CH 5GGVL 4JG1L 2APVA 4H5SB 1CZ8H 3LRHA 1T1ZB 5CMAA 5D7LE 4BSVA 4LHUA 3J8F7 5CSZB 2A6JA 2MKLC 4V2CB 2XKNB 3PHOA 3EJJX 5DHVA 1EJ6A 1U58A 1XCQA 1RHHA 2A9NH 3V5DA 4HV8A 2PYFB 1A7OH 4ZOBA 3BSZL 5IBTL 4I18A 3GO1L 1CBVL 2XZCH 2MCG1 5GZNC 1N64L 2X4TB 1GPOH 1DFBH 3PJSA 4IRZH 9CGTA 3WUWG 4JKPL 5IOPB 3DXAB 2BRRH 3DIFA 1QRNA 1P69B 1X5GA 4MX7B 3KPRB 3G6JA 4LDEB 4APQA 4HWEH 2VLJB 4RFOH 1KTDB 2D9QB 1II4E 1G9MH 3BAEL 3RY5A 4XCFL 5FYJH 4OKVA 3MZGB 4GMTH 1JF1A 1WWAX 4NWTL 3ARGB 1T20B 3ROOA 5B39B 2VH5L 4NBXB 5B8CC 4LPXA 1S9VA 3CZFB 1OSPL 3WD5H 2YSSB 3LCYA 4P2QB 1FRGH 2DQGL 1D9KB 1TDQA 1BQLH 1S7UA 3HC0A 4QHLB 1WWBX 2HFTA 2JK5B 3LS5L 3PWUB 1A0QH 2OLDA 2B1HL 3ZKNC 5EZOL 1C08B 5I8KH 3REVB 3AU1A 5ENWB 3ILQC 3ARGD 1IVLA 2EYRA 5F1OB 4NFBA 3PL6A 1Q8MA 5C0GA 4OI9A 3V6OC 1N5YH 1NGQL 1I1FA 2NLJA 3TA3A 4MXVE 3KLHD 5FKAA 2X89D 2Z4QB 5AEAA 4WUKL 2DKSA 3O2DA 2HTKD 3F5WB 1RJYB 2DJUA 1ZHLA 3W9DA 3RWIA 1BEYL 2X4OB 2BNRD 3HI5L 3MRGA 1QFOA 2ICWJ 3CX5K 2QKIA 1IC7L 2XKNA 3PHOB 4OB5H 1G9NH 1MFEL 4OZFG 2HWZH 2MOVA 1BZ9B 2AV1A 3BW9A 5JUEL 1ZA6B 1G7HB 3HZYB 4JO1L 3T77A 4BQ8A 2FJGB 3QG6B 5HYSA 3TO4B 1EHLH 5IK3A 1IGJA 1CDGA 1TCRB 3L95A 1GC1L 1W0YT 3TPUB 2D7PA 5JXED 2JCCF 5CSBA 3PWPD 3VFPA 5EC2A 5GJSL 3KLDA 3NAAH 4FXGB 3VFUB 5EA0H 4JFED 3JWDC 3I6KB 4WEMB 1DQLH 1BIHA 2ZOLB 1I9IL 1KCRH 4GAJH 4MJID 3ULUL 4LCCC 3UXFA 5C0EB 1AY1L 4HMCA 4ZUVB 4KRLB 4EUPH 2WQ8A 2JB5L 5T3XD 5T5FL 3FO2A 3QP3A 2P43B 4L4VD 3REWA 3FB8B 3HI5H 3TPKA 4M6ML 1P5UA 2EO9A 4XAKE 1YPZB 1S7QB 3QUXB 4XT1C 3ZT6A 1WIPA 2P5EE 1D5ZA 1F2XK 3GRWA 4JPIA 4XP5H 2WP3O 2QTEA 5GXBB 1KJ2B 4CJ1A 1FCCA 2B8OT 1YEDA 4QXGH 2LVCA 1NMCC 2M26A 3OKYA 5D96C 4KPHH 4K94H 2PO6B 1KG0B 3JTSA 2APBA 5HGAA 2Q1EA 5J57B 4RGOH 2B5IC 2WIIA 1A6TB 4ENEC 4RRPG 4PJXA 4HUWA 3F8UB 3FT4A 5ADPL 2R2HB 3GNML 5I71B 3X13B 3HUJF 1C5BH 3O3DA 1CLYL 1FSKB 5JW4M 1UT9A 2X4UB 4QHKI 3FB7B 4N1EA 4Q2ZA 5EUOB 1U3HC 4ETQB 3D6GA 1Q0YL 1ROWA 3O6FB 4OZHE 4XPTL 1JF6A 2NY1C 2OR9H 2V5SA 4G9FE 4U1JB 5FV1L 2IANE 3F62A 2UWEB 4X5XA 3DGGA 4HGMA 1QSED 1LGVA 2DQTH 1EFXB 3T4YB 5IR1B 3IT8D 1HKFA 1T6VN 3QULA 3TT3H 1AQDA 3SDCC 1BZQK 1ZOXA 3SDDC 4YIQA 5JXAH 4PJCE 5IB3B 1N6VA 3Q1SH 4MYWB 3EYFB 1TLKA 3WIHA 2YD8A 3IJSA 5I1DA 3FHAA 5IQ7H 2APXA 3EDFA 4HKJA 3U0PB 1Y18B 4MCZA 5J1SC 3GRWH 5F9OH 4RAVB 1OW0C 1CFTB 4HEPG 1KJ3H 2R69H 3D39A 3QWRA 4PGBA 1J8HD 1IEBA 2CDEB 2VXVH 5T1LD 5INCB 2BXYA 3ZO0A 2E27L 1BFOA 5C0BA 1GRWA 4YQXH 4IRSA 5ISZD 4UTAL 4KDWA 3KPRD 3KWWB 1UXSB 1ED3A 1H0DB 1LE9A 5B4MC 1M4KA 1FFNA 2H2SD 4G7VH 4B7IA 2EE9A 2R0LH 5D1XC 2YC1B 5B21A 4B50A 8FABA 1MCFA 5D9SB 1WTGT 2G9HB 4OKVB 3BIKA 1R5VB 5FFLA 1QBMH 1YYLL 2VDLL 4M43L 4PBXA 4ZXBD 1IAIH 2IG2L 2VDQH 3TBTA 3HUJA 1TNNA 4HZLB 4M00A 5IHZB 3OL2A 3DXAA 2F53E 3SCMA 5JIIA 3D39B 4PRIE 4XNZB 3ULUF 4OCLC 1KIQA 1I8IB 3MV9D 3L5HA 4X5WA 5EIVA 4YHNB 4EJ1C 3CXDL 4Z7OF 4MCYB 1FL5B 5KS9E 5B38A 1WTLA 1SYSA 1MF2L 2AJZA 1OTUC 2MHAB 1PJ9A 4WHTB 1ZLVK 1Z9OA 4IRJC 5D1ZC 3K3QA 2D0GA 1NGZB 1I3GH 2DL9A 4LRIC 1JTPA 3IU4H 4QF1A 1Q9OB 2OL3B 3DSFH 5JR1L 4R7NA 4P2QA 1S8DA 2VUYA 3D9AH 4PJ9C 1RZ7L 2BVOA 2EE3A 3C6LC 4S11A 4DFIA 4KGJA 2GYSA 3MMEB 4I3RH 5L7XH 1NBZA 4JFDD 5EIIB 4HDIB 4N0FB 4LLYB 1V3LA 4HH8A 1X5HA 1B2WH 3CC5A 3TA3B 4M9PA 4K8RL 3FT3B 3TT1H 3L3DB 4LLVB 4MQXD 1CGTA 4WEBL 3WE6A 2IBBA 1MF2H 1UACL 3H3BC 1XGUA 1BOGB 4NFCA 1E4WL 4KI5C 4KVCL 4AEHL 4WI9A 1MREH 1YNKH 1VFBB 4KQ3H 5CBAA 4FG6C 3IDIB 4WO4D 5HDOA 5I30L 4H0HB 4XC1L 2A0LC 3MBXH 3DV4A 4Y88A 3CSYB 4ZO6A 1X5AA 1T1YA 2H9GA 2CKBB 3WN5A 4GXUN 1OD9A 2NY4B 2R1XA 3MPCA 2Z92A 1ZANL 3IJYA 5DURD 1VKXA 3WFEL 4WY7H 1MRDL 1QRNE 4LSVH 5L0QC 4OD1L 1ZWIB 1D5XB 2BHYA 1RZKH 4POZC 5HGBB 3VJ6B 2BSRA 5EO0B 1MCDA 3H7LA 4P46D 3GSNB 2CDFA 5IB1A 2HWZL 5I8EA 4NCDA 1G6RA 1MFDL 5KSAB 4Y19A 1G7IA 3VGAC 4PGEB 5C7XL 5C9JA 1A7PH 2SEBA 4BM7A 3VXMB 1T04A 1HXMA 1W72L 4S2SA 1IC4L 4ZFOB 3I6LE 4XCYB 2DS4A 3UJIH 4GXVH 4QRTB 1UM6H 1YEDB 5INCA 3IXAB 3HC4L 3RWFA 3T0EB 5T3ZD 5E8NA 1BP3B 2X1WL 4O5LL 1KPUA 1QD0A 4YEFA 5J13C 1I9IH 2HVKA 3GMMA 1WISA 1AFVL 2PR4L 4NO0B 2X2YA 1DBAH 2J8OA 1IM3B 4GUPA 1RSFA 2C3GA 3SDXF 2R2BB 1CR9L 1RIUL 4PRPE 2IPUK 4HGKC 3VXRB 2EECA 3KLAA 3LN5B 3VRJB 5DTFA 3OB0H 4NQCD 3FHQA 2FD6H 1R3JA 1TJGH 1IGCH 2GUOA 2J12B 3F5WA 2P5WA 4U6XA 4F9LC 5B38G 2GITA 4U1JA 1ES0B 1QACA 2XZAH 1NGXB 1I85C 2F53D 5IW6A 4CDHA 1EFXD 5BW7C 2EDLA 1W72H 1S7SB 4HUKB 4OZFA 3N06B 3LQAC 4OZGE 4DAGL 3ZTNL 4M9OA 3PWJB 1CD0A 5EIQA 4NQCB 4KY1L 4WI2A 3VD3A 2XQYG 3WNPA 4WW2A 1YEFL 5GJSH 3K1DA 4NN6C 4MA1B 1KFAL 2KBGA 2NTFB 4X4ME 1T7YA 4V2BA 3SGJC 3F12A 1CFNA 3NACL 3HPLA 3PGCA 4NQXA 4K9EL 3MV7E 3TC9A 4HUVB 1JTOA 2GITB 3CX5J 1KLGA 3O2VL 3V8OA 4LHUD 3QUML 4OQ1A 1ZTXL 3ZL4H 4ZYKA 4HCRL 1MCPH 2IAMD 5ITBH 4KJWD 3CFKB 2EEDA 1N5AA 4G9DA 1UH3A 3RNQB 4JFPA 4LDOB 3JV0A 3TNNB 3LD8B 5DHVB 3TVMD 2E7BA 3AROA 4O4YL 3IVKB 5M94B 4Y8AA 2BY1A 1G7IB 4XWGH 4Z7UB 4CU8A 1NCAH 4OUUA 4P4RB 2ZOKA 3PWLA 4ZAKA 3ZHLA 4OZIE 3QCUL 3QXAA 4NQDA 5C08A 3ZTJH 2HA1A 3BDBA 4YZFE 3HMXA 1KBGL 4N8CL 5DJCB 3D0VA 4NNXA 5HYQB 5L9DH 4DQOL 1X5JA 2FEEI 2Z31B 3KDMA 4DKFL 1HEZB 4Z7VF 4PYHA 4XAWH 3P4OA 1EAPB 3MBED 4LKXB 3OF6D 1K5NA 4YQXL 1ZA3A 1Q0XL 1AQKH 1FG2B 1WFNA 4WWKB 3ZHDA 1CXHA 1KJVB 3S37L 5JO5A 1Y0LB 2WWMC 2A6IA 2ZG3A 3LQAH 1U2HA 3QUMH 4H20H 4HCRH 2NXZC 2AABH 3BW9B 4JPKL 3VXRE 2VERN 3RWHA 1AO7A 1GXEA 1RI8A 1MVUA 1CWVA 3TO4C 2FZ3A 3B3IA 3F7VA 1OGAE 4OT1L 4M6NH 5IGXL 2X4OA 5C71A 2R8SH 2CK2A 4CL7A 4U6VH 3EFFA 5K9QI 1J12A 3TT3L 3WBDA 2GW5A 3LZFL 4U1LB 3VWJD 5AG8A 5I16A 1SMAA 3WXVL 3DUUB 1KBGH 25C8H 3M17A 2P42B 5EO9B 1LEKB 3PNWB 3Q6FB 5ADOL 4OF6A 3INUH 4LP4A 4NBYB 4Q6YA 1P1ZA 1YY9D 5DDHB 2G9HA 3PGDB 1ZVYA 1FE8H 3QSKB 2WLYA 1CK0L 2X44D 3SQOL 1GVIA 1YEHL 5IV2B 3IDYC 3UTZB 4IMKC 2E27H 4D0CA 4P9MH 2EDNA 2DAVA 5EPMB 2V2WA 2ICCA 4ZG1A 1T89C 3BJLA 5CINH 5EB9A 5KJRL 2ZPKL 2A74B 4QRSB 3IDUA 4U1SA 4K7PH 4EXKA 3LHPH 1OP3K 4KKBC 4FMFA 3KYOB 4HKXB 1T5WB 4JM2B 3KJ4B 1RZ8A 5D70L 2VDKL 2BCKA 4RMQA 4ZTPH 1FQ9C 1NC2B 1HHIA 3EFDL 3EUUA 3FQXA 3P11L 5DD0H 4YFEA 4N0YH 3O9WD 1CL7L 1FFPA 1BQLL 3QZWG 5DEFA 5INDA 4OZGB 4YO0B 1TTUA 4JB9L 5EZOH 1A9EA 4GXUM 3I2CH 5I1JL 1FZJB 1DBKH 4RBPK 4JN2A 2Y9RT 2CSPA 3I6KA 5DUPH 4PJDE 2GSIA 4FTVB 1UXSA 4JFOB 5HYIA 4HF5L 3RI5F 1S9XA 2ZP0T 4ZFGL 3O11B 2P8PA 2AXJA 3WHE1 1I1YB 3SN6N 4LSUL 4ZS6C 4KAQH 3HAEG 5E6YA 1NGYB 4J1UA 2FECI 1HOCA 1W72A 1J0ZA 1HH6A 4NT6A 2VDRL 3MYZA 2Z9TA 3VGFA 5E6ID 2I60H 5DC4B 5H37G 5CJBA 4YX2H 4HH9A 2J8HA 4JKLA 2V9TA 1LD9B 1XH3B 4X98B 4G6FB 1F2QA 4U6XB 1NSNL 5IW6B 1IAKB 5CD3B 3ECBA 2OR8A 4XBPB 1C1EH 4XCNA 4L9LC 4OQTA 4R90H 3I2CL 4XCCL 3ZZ1A 5A16A 4XAKD 5C0IB 5IKCA 1FHGA 1KJMB 5EZIH 3VXNA 2PXYD 2W9LA 1EAJA 4G6KH 4JRYB 3RUGA 1UZ8B 1AP2A 5DEZA 2J3SA 5DD6A 1WUNT 3QUYB 1C7TA 4C56E 3VXUD 2HLFC 1AO7B 3V0AC 3EJZC 2GFBB 3ULUH 3BXNA 3O2DH 4YR6A 3VWKC 1I8KB 3U7AA 4LLMB 1JGLH 5E08L 3K80A 3MR9B 4QRTA 2IC2A 1HQ4B 3WFEH 4C83A 4JO4L 1IGCL 3C6SA 3UO1L 3B9KD 3CLEH 4WFGE 3OJMB 1QUNA 4KUZL 4PV9A 2PUQT 3IDJB 2YK1L 2I9TA 1Y6MR 4WW2B 3QQ3B 5ITFA 3T0DA 1H3UA 2YEZA 3RWEB 2AV1B 3LY6A 4MCZB 1HIMH 1NEZG 2DWDB 4OLWL 3DXAE 3M07A 4NRZA 3V95A 4DZ8A 3OKMB 4QXTB 1ODAA 4X6FB 4DTGL 4KRPB 3AMLA 2EIBA 4DN3H 4PJFB 3DLQR 3IF1A 4LL9A 5CGMA 1J8KA 1H8SA 3ROLA 1DBAL 2GY5A 2V5MA 4WU5B 1JHLL 3FAXA 1MJ7L 3HR5A 3DX9B 1NEZA 5A3ID 2VZ1A 3BT2L 4QHNA 3R1GL 4X4XB 2L0DA 2FHFA 5GIRB 1P4IH 2EYTB 3DARA 1JZ7A 3CSPA 1KT2B 4RGMB 2HKHH 3P9LB 1KCSL 3O8XB 2GJ6B 3LDBB 1JGUH 4OFDA 4I9WD 5D71H 5I17B 5J1TC 1RUQL 2ORBL 3PF2A 4I77L 4KROB 4JO1H 3GMRA 3P40A 3GGWA 3VFRB 4MXQC 4M8VA 5HYEA 3IXAA 4JHWL 3KR3L 1A6AA 1DVFA 2UVFA 3QUYC 3ALPA 2WSKA 4XZUB 4D0DA 1U91B 5DJ0A 1VFAB 4NM4H 3VFSA 3O0RL 4DTGH 2YN5A 3O8XD 4Z7WB 5E8PB 3O6LH 1WWCA 4JR9H 2IBZX 1MHCB 1OT2A 4YDJB 3S35H 1KC5H 3HNVL 4DZBB 4YDVB 3PWJA 3AM8A 3SQBA 3T1FA 2X4PB 2VN7A 4TSCH 5DQJB 4GKZB 1ZTXH 2X7LB 4PJ8C 3HE7C 2RCSL 3ZL4L 3EZJB 2R0LL 4BSJA 4JHZA 2E6QA 3P4MB 4LIQL 1SJHB 1EEZA 4IHOB 4FXKA 1S7UB 5LBSH 1F13A 4X5XB 3G6DH 5SX4H 4PJ9B 4N8VA 1DLHB 1RAMA 1E28B 1AGDA 2ZUSA 5K9OA 2R29L 4G8EB 4MMXC 2FYYB 3BIKB 4AIOA 3ZKXB 1WJ3A 1E4XH 3HG1D 3T3ME 3RU8L 2IPKA 3GMOA 4CU6A 2R0WH 4M7KH 2DQCH 5DUBB 3U4AA 2HN7A 4UDTB 3BEWA 5KW9L 4AYFA 2ZSWB 4JFDE 3VI4E 1L0QA 4XRCB 4O9HH 3E6FA 5DFVD 1JMXA 2CDEA 2CKNA 3BD5A 3SCMD 1FORH 1I3GL 3QUZB 2X1OA 3CXHJ 5HSFA 5BRZE 3WUZA 3QIWC 4YC2B 5GGVH 4RIRB 2RFXB 1IMHC 4FFVC 1S5HA 4LNRA 5J56B 4LIQH 1F4XH 4WHYH 5I1DB 5FUCC 1ZA6A 2BSRB 3NFPB 5EO0A 5AD0B 3KLAB 5C1MB 3DMMC 2Z93B 3T4AA 2FGZA 1NAKL 4GO6B 3EFDH 3Q1SL 1VEPA 1B2WL 3MJ7B 4JB9H 3P30H 4JM4H 4GSDH 3O41A 4S0SD 1L4IA 2UY7A 3GMNB 1U0QA 1I8IA 2DQCL 2HJLA 1VENA 5IBLC 3T0BA 1GGYA 4ZNEA 1MHEB 5F97E 2GJJA 1FE8L 1MREL 3SY0A 5K9JH 4UTAH 1OARL 3MOQA 3KPLA 3T8XA 4Y4FC 4MMZC 2NTFA 4JFYB 5CINL 3NZ8B 2JJTC 2F74B 2ZPKH 1ZAGA 5C0CE 4TNWF 1YN6A 2EEAA 2H8PB 3EYQC 2BFVH 4JY5H 2XTJE 3U7WL 2V2XA 2VE6B 3NGBB 5HI4D 1KG0A 5CEXA 3L9RB 2YD3A 4ZUTA 4UT6H 1GC1C 5F7UA 4D0BB 4WI6A 5EU7C 4C59B 1JPGA 4BH7B 1B0GB 1OVZA 1IARB 4XX1G 1Z0NA 2VR9A 5GGRA 3UBXB 5I1KL 4GKSB 3L3GA 1SYVA 4XX1E 1ZGLP 1Z9MA 5BXFA 4J4PD 1EHAA 5HHPB 4JFDB 4UIMA 1UH4A 4ZSOE 4OM1H 3A6OA 3K4ZA 3BD3A 4I2XB 3C5JA 4WGVB 2AERT 1R5WA 4BQ6A 4QHLA 5FYJL 5CEXB 3MLPA 3QIUD 4LVOC 1NPUA 5I0DA 3MRBB 2EDOA 3V4VL 1NCDH 2VZUA 3T0ED 2DQIL 2ZJSL 1R5VA 2GK0A 5L2JA 5T3XH 2AKRA 3BFOA 2Q86B 2E6JA 4BK4A 2YS4A 2HT2D 1Q1JL 3G6AB 4KK5C 3PHQB 3KPMA 3ARBD 3OZ9H 1GGIH 1YUHA 4MD4A 4A6YB 3JBG7 2C3VA 2GSGB 2DYPB 1BVLA 2XN9B 5DYOA 2APFA 1MI5E 2F5BL 1QSVA 5EA0L 4UOW1 4JY4A 2ZUQC 4I9WE 4X4XA 4ZXBC 4CMMA 1F58L 2VIRA 1Z6JT 5ALCH 3QI9A 2DWEB 5DJ8B 3BP5B 4ODTH 1OTUD 2HH0L 5E7BA 3UTSD 2X9YA 1NGPL 1C5CL 5EDXA 1FNGA 2XA8H 1NC4A 4URTB 32C2A 1LEGB 4KDTC 3DECA 1G1YA 3FRPG 2YPVH 3NOIA 4XMLL 4X9GA 4JFFA 4PRHD 4JO4H 1Z2KA 3ETBF 3DUSB 5E4IA 1MCHA 2JF1A 5C0FA 2Z8SA 3QUKA 5IFHL 2R4RL 3QDGD 1Q1JH 1EPFA 1JV5A 5F88A 2RR3A 1IAOA 3BESR 3O6KL 4YDIH 1UWEH 1G9EA 3CFBA 3KXFA 4X8JB 4QXWA 1A5FL 3WIFA 2B0SL 4OLVL 4OCWH 2X4RA 4OLWH 4PRIA 2F19L 1MFNA 5DMYA 3FO1A 5DT1H 3DMMD 4Z7QF 4M1GL 3DBXA 2F53B 1DQLL 4GG6A 3BN9C 1MHPL 1TMCB 5DHXB 4TTGA 3MRMA 3FB6B 3CK0H 4H25B 3ZE1F 4HPOL 1FNEA 3UTSE 1CDUA 4LVHC 1NFDE 4UT9H 5IB4B 2NCMA 3V6OA 3RFZC 3LKPA 5IROC 4Z5RA 3L5WB 2ZOLA 4C57C 5HHXH 4KI5D 4KH2A 3WIHL 5F89B 5DQDL 4AY0A 3OGCA 4LPCA 3U7YH 2IBZY 4MD5B 1TENA 1A64A 4CVXB 4R7DB 5D71L 1F5WA 2Y1VA 3JWDH 4LRIA 2P5WD 1OAQH 1J0IA 1ZKAA 2QEJA 3FKUS 2APWA 4QXGL 4BZ1H 3DYMA 4G8IB 4EDWH 5DJDA 4G6JH 2ITDA 3E6HA 3T0EE 3ET9F 2F19H 1QRND 2UWEA 3EYQD 1G7JB 4JO2H 2G5BB 3KPRE 4M03A 5DVLA 2EC9U 1FVEA 4N0CC 2FATL 4XPBL 3WLWC 3DUUA 3EO0B 2OTWB 5FF6A 3GSNL 4PR5B 3ARVA 1UH2A 4M7JL 5ACLA 4WVRA 2Q76B 2BOCB 1PZUB 3LV3B 1KNOB 2PKDA 4NFDA 5B22A 3X13A 1LO0H 1YN7A 4OUUB 5EU7E 1NGZA 2CR3A 2AKRB 3MJ8B 5EN2A 1RUML 4JG1H 3FB5B 2NW3A 3IDYB 1TNMA 3MLTA 4JVWA 3BWAB 1HINH 2FSEA 4XWGL 1T0MB 4WWKD 4MA7H 1RZFH 4MQ7A 5F8RC 3P11H 3P30L 3PV7A 1AJ7L 1SJHA 1GGUA 2VXUH 1ZSDB 1RZ8B 1AC0A 5CBEA 3VDBA 4P3CL 4XCNB 5CIPA 1GGBH 4E9LA 1GAFL 4GRMB 4CMMB 3TZVC 5D8JH 5M7QA 3DETD 3HTLX 4LCWE 3RGVC 4AT6A 1DE4A 3QEUB 4G6AC 5L9DL 3OMZA 4HMDA 2CJUL 2ATKA 3OKDB 3V6FA 2NMSA 1JNJA 4G8GD 2HKFL 1KTLA 5KW9H 3HC3H 3CDGB 5JMOC 1EA9C 4EOWL 4NRZB 5FYLL 4DZ8B 2AK4D 2N7AA 5I73B 1K8IB 4KK5D 4H20L 2ITCB 5AAWA 1G9ML 3BAEH 3U79A 3GMLB 1R3HB 4XCFH 1J05B 1LO0L 2BC4A 5C0AB 4R3SB 3WN5B 4YXHH 4U49A 2AJSH 4U1SB 2K7QA 5CSGA 3VG9B 4M5YL 4WFHD 1W2KT 5J7CC 2A73A 1FPTH 5E1AA 4U1MB 1XZ0A 4UTBL 3VXSD 2DM3A 2NNAB 3L5XL 3K2UH 5DJXA 5FYKH 4FXLA 5F7LB 5I6XC 1V7MH 5DD3H 4J3WA 2J1KA 2D4DA 2UZIH 5DK0B 1XCQB 1A0QL 1HXYA 3FONB 4J4PC 5SWSE 3QEHB 5I1LA 1LNUB 2OJZL 3HG1A 3IXTB 4Y2OA 4MXWH 3L3HB 3L3IA 3S34L 3NIGF 4EOWH 2EE2A 3GJFB 1IAKA 4ZYKB 4ONFH 1RIVH 3OAZK 3ROLB 4KKLD 2EIDA 2VIRB 4MB4A 2AW2A 4OLXH 3UTSB 5AAMA 5GS1B 2W59A 4FZEL 1YNLL 3B8SA 3V4VH 1A7RH 3MLWL 4R0LC 3CVHB 4ZOEA 4E0RA 5I1HL 4HEME 4I3RL 1A2YB 5DMGC 4OB5L 5ISZE 1BIIB 3MRLB 4HIHB 5GGQH 1BQUA 1MI5A 4KTYA 5CILL 4DUVA 6FABH 3BRDA 3DI3B 3I9GH 1EZVY 3BGAA 3GO1H 5F9WC 4XHJC 1CYGA 4KUCF 1J5OH 4GRMA 3PGFL 3TT1L 2BRRL 1DBML 1OAXL 2XICA 1JNLH 4DVBB 4F80A 1S9YB 5HDLA 2CLRA 4NJ9L 3QQNA 1EX0A 3QDMA 1C5CH 2FWOA 2IEPA 3GHBL 3RUGB 2K3TA 4YHLH 2WAHA 2X4PA 3OR7B 1RZIA 1J05A 4M62H 1BIIA 1FN4B 5F8QC 5BRZA 3C6LA 5B3JF 3MLUL 4O2FA 2R0ZL 3RL1A 3S4SG 1TETH 4IHOA 4OIIL 2ZJSH 1YY8A 1ZE3C 4HUUB 4Z76B 3C6SB 1QNZH 1XCTA 3WUWA 1E0OB 2YBRB 4Y4KB 3MFFA 5LGKA 5CLTA 3OKOB 3MV8A 3CFDB 43C9A 3MRQA 4YAQA 1GGIL 4R90L 4XCCH 1BAFH 1GCFA 3QEGH 4ORZC 4WU7B 3R06B 2HT3C 3OKNB 4JJHA 1JNLL 4M7LL 1UKSA 3MNWB 2CIIB 3KYKH 1FCGA 3C6LB 4Y8DC 1TFHA 4WFFD 4ZFZA 4H0IA 2G75A 1C5BL 1YEIL 4PJXF 4PJIF 2CLVA 3DUHA 4ORGB 4OLUH 4AIZB 4P5MB 3IDNA 3EJZD 1X5YA 4X4YB 1MCPL 4HDIA 3RWGA 5C8JA 2DF3A 3UTTE 1B0RB 2OR9L 1FNLA 3RIAK 3SBWC 3GMPB 5HGHA 5LXGH 1K4DA 1T2QL 1DBJL 4KKCC 4OIIH 2L7JA 1RHHB 1B3JA 4KUZH 2R2BA 5IVOA 1KT2A 1Z5LA 3CLFL 1QNZL 3FB5A 1A3LL 3V5HB 5EFIB 3VXUA 2B4CC 4NO2B 1U92A 1YQ2A 2WUBH 3MV11 2WQRA 5IVNA 4LPYA 3ECBB 3JWOH 2VWEE 4ELKB 2JLLA 2AK4E 3QUXD 2R0WL 4BK5A 1U91A 5DJ0B 1JN6A 1ORQB 1E4XI 4ODSH 3QHFL 3MRKA 4AT6B 1QO3A 4DW2L 2MKWA 4M7JH 5BZWB 4HC1H 2AV7B 2CPCA 3F6LA 3O3BA 2Y36L 1DQJA 1L9NA 2G60H 1A1MA 4TPRL 3U82B 2P47B 1RZIB 3T3PE 3TGXA 4MJ6A 3KPPA 2D31A 4YBQC 3MUHL 1HHGB 4XC3H 1RUMH 1KCSH 4MNQB 1I4FA 5E6IC 4NQSB 4OLEA 4KV5F 4ODVL 3FCTB 2QSQA 3SO5A 1MEXH 4PRNB 2W0LA 5T1LB 4ZPTA 1GZPB 3W9EA 4R2GC 5ISZB 5BW7A 5EBLA 1BOYA 5EBWA 2PW1A 5DO2D 5TQ0L 1XZ0B 1FZMA 1QPXA 1RZJC 3GB7A 4GSDL 5IK3B 2XZQH 2YRPA 4N8CH 1JUFA 5HVGB 1S5IH 2VLLB 4ETYA 1G7LB 3GSRB 1OCWL 5F93C 1GOFA 3QWQB 1NGWB 3CUPA 4NM8H 4F8TA 1INQB 1A14H 2NY0C 4X0KB 1AQKL 1U42A 1RUKL 3B9DA 5IROA 4IOFC 4IRSB 5TQ2H 1YY8B 1UA6L 1ZLWK 3MLXL 2PETA 5EU6D 2E3VA 4K3EH 4K23H 2B5IB 5FA4B 4JY6A 4QHMB 3OJDB 4C56B 4N8PA 4YFLI 1PKQA 1UVQA 3KJ6H 2Q3AA 4Y4HC 2R29H 1UC6A 1CL7H 1HDMB 5KTEL 5A3IC 3OAUH 1A7OL 1WK0A 5D5MF 3VFMB 1YUHB 2CIIA 5GS0D 4XPFL 3JSSA 2FX7H 3P9MB 1NL0H 3QWRD 1TJHL 4K7FA 4PP1D 1HILA 1U36A 4ZFOL 1DR9A 1T7ZA 4NZUH 4YC2C 4U31A 3SJVD 3FT4B 1J1XH 4GFTB 1SEBA 4WFFE 4PB9L 1PZ5A 4D9RD 5LGHL 4GRWH 2NY5C 4OAWA 2BOCA 1FIGL 1J87A 1F4HA 1BBJB 4NKMB 1PEZA 2XKSA 2NX5E 5F9JB 3QUYD 2DN7A 5T33L 3EAKA 3TA3D 4AH2B 3DVNB 2NYYD 4H8WH 2CO7B 4S10A 4F7CB 1ZHBA 2YN3A 4L4TE 2HLAA 4PJFE 3VFGL 2I26N 4MJ5A 2ITDB 3GI9L 1SJEB 1S7TB 2VQTA 1V3JA 3C09B 3S4SA 2Z31C 4J3OC 3JTSB 3M8OH 2PNDA 1MUJA 2P8PB 3B2UC 4JM4L 1YQVL 1VB9A 1YMME 2LV4A 3SGDH 1QFHA 5FA3A 4U1HA 4X7TB 4NKMA 2UZIL 1TJHH 3S5LA 1U8JB 1CBVH 1DBMH 4KTEH 2GJ6E 4KKCD 5KSVB 3MREA 3WJJC 3DX8A 2F5BH 1FGNL 5D93C 5LWYL 4PTTB 3RZCA 3QH3A 2Y7QA 5K9JL 3G5ZB 4Q2ZB 4DUXA 5DQJA 3I50H 4WUKH 4LPVA 5JW3H 4ODTL 1JZ3A 4L3AA 4MXQD 5FM5O 3RVVC 5DFWH 3HNTH 3PWUA 3KYAA 3QG7L 2A1WH 3EHBD 3H9SE 2DWEA 4YJZL 4K9EC 1IFHH 3MFFB 3PWVB 2BVTA 12E8H 1Q9KB 5ERWA 2LTQB 2QADD 4QRPB 3P9WB 2MSPA 1RJCA 3LH2L 4JFFE 4GW1A 2VLRA 4M6AA 4ODBD 1I9JH 5I8EB 3T77B 5GGQL 4MXVF 3C5SA 4RAVA 4G8IA 4DAGH 1KOAA 4QGYA 2B2XL 3LAFA 4U0RC 4KK9D 1GSMA 4FQ2L 4EXPX 4O58L 2JB6B 1NBYA 3FTGA 1I3RA 4JEGB 4KY1H 4QRRB 4PYGA 2Z92B 3AS1A 1BBDH 4X6CE 5HGAB 2EKSA 4DOHE 4RMUA 2Z31A 4PV8A 2QADB 2WBWB 4BQ9A 1KFAH 3B8YA 4N1HB 4Z76A 3AREA 1ERNA 1UGNA 2VR4A 2BNUB 3GK8L 5K59E 5I1AB 3H8NA 1EFXA 3T4YA 3QDGA 1MVFA 4U6YA 5JDSA 3W11D 4UU9A 2A73B 5E1AB 1F3DJ 4CNIB 2CRIA 3QIWD 3BT2H 4CVWA 2MCPL 4D9QE 2DI7A 3QXUA 3U30B 4P57A 4J12A 1JGLL 5E08H 2XQYK 2XFXB 4OCRL 5H37H 5JHLL 2VOTA 3MJGX 4XXCA 3ARFD 4PRAB 3MV8E 2XPGB 4XP5L 1FNEB 4A2MA 4GBXC 3BHBB 2J8UF 5D2NA 5KBNC 2AEQH 2FX9L 2NY3D 4HS8L 4JZJA 4ODXB 5JHDE 2H32H 1BX2B 3AXLA 3H9SA 1RV6X 2FIRT 1XF5A 4KFZC 4RGOL 1H5BA 3C60A 4RWHA 4KJPD 1VKXB 4F9PA 1PYWA 3I75B 3VGEA 3QIBD 5J4MA 1AGDB 3RHWK 2AJ3B 4OBSA 3EGSA 1MOEA 4BH8B 5HHMD 5ALCL 3S35L 3IDIA 2Y6SC 5I17A 5DJDB 3P2TA 1J8HB 5C6TH 4P3WA 5HHME 4FQHB 1IQWL 5TPWL 1HI6A 3JUZA 3H6JA 3QQ9D 5I18L 4Q0XL 2VL5B 2Q7NA 1B90A 5EOTA 3IJYB 5F44A 4PP1C 5FGRA 5JOPD 4HIJA 4QTIL 4X9FA 3F58L 3NABL 5DJYB 2D3VA 5C0EA 2O26U 3L5WA 1RUPL 1S5HB 2Q76A 4U1MA 3U6RB 3CLFH 5C0CA 3V5KA 3EYUH 4LBEA 2V7NA 2D2OA 1T7WA 1N2RA 4A6YH 5JW5A 2IAMB 3TIEB 1CGSL 4KRMB 1VESA 3VWKB 4I0KA 5F1NB 3MRLA 1PDKA 4GMSH 4ZFZB 2WK2A 4QF1B 2DTML 4IDJH 1VFMA 4YEEA 3I3DA 3TJEH 3HI1A 4FQ1H 1LHZA 2HT2C 5C07D 3QDJA 1XF4A 5D2LF 3RVTC 4PJBF 4RMSA 2VLJA 1T0NB 2QSCL 3DX6A 3QIUC 5JW4N 4P0DA 5HHOA 5C0CB 2A9ML 5J89A 5CP3H 3TNMB 1MHHA 2VKXA 3CVIL 4P5KB 1XR8B 1U8PB 4LF3B 4TOYH 1JNHA 2UVEA 2O5YH 2VMFA 2XWBA 4LCIL 3SDAD 2MQ3A 2IGFL 5CZKA 4QXTA 4KI5E 2D31B 3BWAA 5KTEH 1YEGH 5CFHA 1QSEE 2OJEB 3ARQA 1IGTA 2H26B 2Q7YA 3WL9A 1R3LA 4N90E 1G7MB 1LO2L 1NUFA 4D0BA 2Y06H 4OJFL 1NFKA 3B9KA 4WTWA 2NY7L 3EYOA 4QEGA 4X7TA 3WXWL 4M3JA 1IJ9A 5GGUB 4U6HB 2D7MA 5C08D 1KCVH 1NLDH 1JWMA 5I19L 4Q9RL 3MRMB 2XT1B 4ONFL 1J0JA 2LABA 4B5EA 4WO4B 4OBRA 1RUKH 4J3TA 4P2RD 3DSFL 5JR1H 4MNGB 5IG7A 1T7XA 3QWOB 1GGTA 3KVQA 3WS3B 3DUSA 4UDTA 5HVFB 3ILPA 3FT2B 2UYLA 3ULUE 1D3CA 3O6FC 3T08A 3HE7A 4PUBL 3CDYA 5JA8B 5FGSA 4M6NL 4FA8A 3EYSL 3ESUF 3H3PL 3GMPA 2ENSA 1KTRL 2XXMB 1JBJA 1NAKH 2JE8A 2D4FA 4FFZL 3W11C 4HKBA 1JHKH 5D1QB 1FYTD 4LSQH 4QRPD 4PRDA 5KSBB 5ESVA 2VXUL 1IL1A 1T3FB 3VCLB 5C0AD 2HJFB 4RAUA 1RIHL 1C1EL 1AGEB 3CXDH 2FX7L 5KVGL 2FZ3B 2AVGA 4XP6H 2OCFD 3VFTB 1NLDL 4FQHA 1HHGA 1M7IA 5JW4Q 1J86A 5BS0D 1NC2D 4XC1H 2JB6A 4Y2DC 4UDUB 1FYTB 3QFDB 1VACB 2BCKB 2PW2B 1WSST 4HXAL 3QG7H 1CIUA 4EUPB 2AXFA 3SE9L 1WVZA 3SBWA 3K8MA 4U3XA 3ES6B 2DBLH 3HAEB 3QIWB 3HRPA 1YPZE 5FGBA 12E8L 3VMOA 1O7SA 4CMHB 1TZHA 1MFAL 1X44A 4FQJH 4UT7L 5CEZE 3ULVL 4LOUC 4V1DD 3LOWA 2NPLX 5C7XH 4NQDB 1MRCL 3BZFB 1P5VA 1UQSB 4HIIB 1ZXQA 3LN4B 2AJYL 1KCUH 4UT6L 5TE4H 1Q9WB 1XAUA 3OB8A 3BSZH 2DLFH 1C16A 4PJIE 3GFUA 4MVBD 5KVGH 4C4KT 3MA9H 2ICWB 1KPVB 3GKWL 1UACH 4QCIB 4YHMH 3FQUA 3QNZB 3TZVD 1CICD 4U1GC 4GOSA 5GS2D 4YK4C 5JIHA 1L6XA 2VLRD 3SO3C 5BZWA 2NY1D 3ULVF 2C1OA 5IHZA 4YO0A 4NWTH 2CGRL 5I71C 4RCAA 1JL8A 3KYMB 2VZOA 5EUKA 3QZWB 1HKLH 3W0WB 1IFHL 1CFBA 4UT7H 3K4AA 1A3QA 1HHHA 3NCFB 1ZT1A 4N68A 3DRTB 1RQ5A 3MCKB 4GRWF 2JCCB 1A8JH 2CRZA 4LHJB 5I1EL 2FX9H 3QXTA 3OHXB 1A7PL 5CILH 1J10A 3TVMB 6FABL 1I1YA 4NN5C 3ZTNH 5AYUH 5FM8A 3L7EA 2PTUA 1U95B 1CFVL 4HKZB 4PJ5E 3ALXA 5SWSB 1Q9LB 1A4JA 4EDXB 5EZIL 4D0CB 5E6ZA 3LPFA 4QY8B 4JQIH 1HSBA 1WITA 1EH9A 4HWNA 3IFNL 3IDMB 4ODSL 5IG7B 3ULSB 3BX7C 5AZ2H 4UQ3A 4MLIA 2LU7A 2ZCHH 5CS7A 4J7RA 5B8CA 2GTWA 2AK1H 3AUVA 1A21A 2W9DH 4G3YL 3DETC 2YPVL 3AM8C 4Q6IB 4E5XA 2P44B 4YDKL 3C6LD 3QDHA 2X70A 5AWNH 3H0TB 2XWTB 4NKIH 4F7MB 4ZFFA 4LVHB 1NCWL 1FO0A 5D2NE 2APTA 3RTQD 5JIKA 3JWDL 5IFJA 1DEDA 1W8NA 4NYLB 1J1PH 1NJ9B 1LD9A 3VGAB 5GRXG 1SJEA 1UJ3B 3E2HB 5HDQH 2MTPA 3WDIA 5D1XD 1SVZA 4PY8I 1HIML 4YHZH 1C16B 2P8LA 3O6FD 3E0GA 1AE6L 3C2AH 1A5FH 3ARXA 3O2WL 3VWJB 2GCYA 3BPNB 4BUHA 1FC1A 4IJ3C 5F6IC 1S5IL 4R2GB 3ULUC 1VFAA 4XNZC 4WUUD 1BBJA 4PJHF 1OSZA 1PYWB 5GRUH 3QO0A 3RWDB 1FYTE 2Z35A 1KB9K 5KS9B 3VFOA 4RWYH 4OD2B 3OTTA 2IH3A 4G3YH 5KZCD 3SGKA 3MR9A 4QTHA 1JFQH 5F6HI 3MXVL 4M3KB 1JPFB 4YZFF 4GKZA 2EDRA 1HINL 1WEJL 4JFZL 5ANME 4MQTB 1I4FB 1G0DA 4OF7A 4GQ9H 2FCBA 4WGWB 2P5EA 1C08A 4PLJC 3ZT5A 1D9KC 2A6IB 4X6EB 3VXTA 3K2MC 1KB5H 1YEEH 2VN4A 3QCUH 4M93B 1MFBL 5I1AA 3X11B 1KYOK 3WIIL 5JQ6H 4JKWA 5DGQA 3EW3B 1AXTH 3FFDA 3S36H 4PJ8B 3MCG1 4AEIL 1E6OH 4N9GA 3JZ7A 1MCKA 2EXWC 4KMTH 1CXLA 4Y0GA 1ITCA 2HFEB 4ZUSA 1L7TL 4HS6B 1MIMH 2DQUH 4PB0H 4XPAH 1INQA 1LP9F 4DGYL 3K7UA 2PTTA 2V6HA 1IBGH 3BPLB 1EAPA 4LKXA 3VFSB 1CGUA 3U9UA 1I8LA 2VDKH 3P0VL 4ZTPL 4LBEB 4F7MA 2JJTA 2A0LD 3DV6A 3I6GA 3L5XH 2CD0A 4L4TA 5T5NF 5CGTA 4L1HA 4KJYA 3QT2A 3HS0B 4IRSD 4HV8B 3RVXD 1FAKT 5INDB 4Z7UA 1AJ7H 4X6FA 3X3GL 1GPOL 25C8L 2BDNL 1HDMA 1MI5B 2GEEA 4KTEL 3ZDZF 4YFDB 4Q9QH 4P2OD 2ZCKH 3CFKA 4I0CC 2GK2A 5J8OA 2WBJD 3HC3L 2NNAA 5DJXB 5FIEA 1IAII 3RUGE 4CN4A 1TXKA 4DVBA 4NNYB 4LAJH 5JPNB 1Z3GH 1YJDL 4LCUB 4G7VL 1J0YA 3V5DB 4NIKB 4Y4HB 2BJMH 2HVJA 4PJ7B 3HMWH 3QEQD 4YHIA 2X7LA 5GGVY 4F37F 2BNQA 4UZGA 3WJJA 4K94C 1CFTA 2OL3A 5C09E 1OP5H 1OTTC 1NCDL 1R3JB 2GUOB 4OI7A 3VFRA 4XVTH 1FNSH 3E6HB 4NUJA 2X10A 2IWGA 4DKDC 3L3KA 1SHMA 1NSNH 4XVJL 4CVZB 4F57H 1X4YA 1V7ML 3CFEB 1BQHA 4JAMB 5EU6A 1JZ4A 3V6ZA 4XPFH 2P46B 4ISVA 2NY0B 1AI1L 2J5LC 1UCBL 2P7TB 3FQRA 2C4FU 4X8XA 4PY8J 3CC5B 5GS0C 1K85A 4U2ZA 4NZUL 3ZMRA 3TBWB 5BOPA 1N0LA 4G6KL 3S5LB 1B4JH 2BSTB 5JZ7D 2Z35B 1AKJB 5KS9A 1F11A 2C4XA 5EUOA 1ZHNA 4ETQA 3MBEC 3NCMA 5FYJD 4HWEL 2IMNA 4KJQC 4YHOH 1NGPH 3MROB 1PG7X 1MLCA 4Z0BL 3MRCB 3SHSA 2J8UE 4NGHL 2MCPH 3MGOA 4KXZH 4U1GB 5DJAA 4YK4B 1OWRM 3HCVB 3LKRB 3CH8A 2A6KA 3PQYB 1NDGA 2BFVL 2XN9D 4JY5L 1J88A 5F7DA 1BLNA 4XPGH 4L4VA 1KEGL 1P9MA 3RBGA 2DRUA 3OKKB 4R7DA 4RGNE 3ZDYF 3GB7B 4XVJH 4HX1A 1JYVA 3ES6A 3HAEA 4HWBH 3SPVA 4YDIL 1MCNA 4K8RH 1CDJA 4HMEA 1GJIA 1JE6A 3MUGA 1AI1H 4KROD 4R7NB 1CFVH 1CDHA 4MNQE 3RDTB 1WBXA 1I1AD 3VFWA 1I1RA 2Q87A 4JPVH 1Z9LA 2AQ3A 4HBCH 1CQYA 1NGQH 1R3KA 1AHWB 4NQED 3KPSA 3IJHB 1R0AL 3C08L 1XGPB 3QFJB 5KVFL 2VXTL 1I75A 4DK3A 1SMOA 4X6DB 3DX9A 1U8LB 2MFNA 4PJ9A 1FG9C 1JP5A 1REIA 5BQ7B 3FJTA 4OD1H 4QOKA 4IIQA 3EIFA 5ANMB 2D7TH 3IFLH 5ID0B 2CIKA 4JN1L 2C3VB 3BDYL 1U8KB 3CLEL 1OHQA 5E56A 4P2YA 3NCJL 2QADC 4Z95H 4KZEL 2WWMD 2LVEA 3FQTA 3OZ9L 3DTXA 3GJEA 1A1OA 4GS7C 2WUBL 1OAQL 5BVPL 2C26A 4P59H 1D5MB 5HHVL 3JWOL 1XGRA 1UM6L 5AYUL 2CK0H 4LCWB 1MCIA 5GS1C 1ZS8A 4U7KA 3SY0B 2VRAA 4Z7WA 1WBYB 3SGKC 5AG9A 1CLYH 2HTLD 3QNXB 4DN3L 2HH0H 1KJ2A 4QRQB 3FAWA 1S8DB 3BYYA 1A47A 4TPRH 3QBTB 2NY6C 1NGWA 2ADFL 1A4KA 2Y72A 5DRNB 2ESVE 3O6FA 4DEPC 2RCSH 1EO5A 4OCRH 5A2LH 4XTRC 4PJ5A 3OAYH 1ZMYA 3PDOA 3V8CA 3NIDF 3T04D 2HKHL 5E2TL 3REVA 3V52L 4K3DL 5IJKC 2X9WA 4J8RB 4TOYL 2O5YL 1JTTA 1U8QB 4Z95L 4OFYA 4JY6B 4QHMA 2BK8A 3RWJB 4BSWB 3ARDD 3TV3L 1AXSB 3TA3C 2IBGA 2IFFH 4ODHL 1CLOL 1P7KA 2GSGA 2D7QA 1JYXA 5B39A 3D1MC 4PGCA 1KJ3L 3O3EA 3TCXA 4LGRB 4DOHB 3D2UA 4FFWC 4MDJA 2ERJB 1R5WB 4GAFB 3KPSD 4N90D 1I1CA 1R3LB 3QFJE 1MY7A 1HHHB 4ALAL 2J2ZA 2ADIB 3WEXA 3P4OB 4UV4H 5KVMC 5GS1A 3O45A 1IBGL 5HHOE 2JJWA 3NABH 4L1DA 2HFFB 3DVFA 4WI8A 2ADJB 5IFJB 5F3BA 2WWKT 3RPIA 3TBSA 3TCLA 4PG9A 4I1NB 1XT5A 4OFPA 4RGMC 2X4NA 4KKNA 4M5YH 2ATPB 2W60B 3RIFF 2N1KA 4IRSC 1YPZA 3MUJA 3NN8A 3K2UL 5FYKL 2Q8BL 1BVLB 2XN9A 3FTGB 5DYOB 4G6JL 1JIBA 2IFFL 3V9FA 4ONHB 4CMHC 2DLGA 3KPOB 4XP9H 4GMSL 1MJJA 5GGSA 2AJVH 3HMXL 3AU1B 1UM4H 2O61A 1N3NB 2WBJC 5F9OL 5HHQA 5C0BE 1KN2H 3DHMA 2ZCKL 2EDFA 1K6QL 4UBDD 5IT2H 1A6TA 4PRDB 4UIKH 1R24B 4N0UE 5CKGA 1MFCH 3WFHA 5C86A 1CG9B 4H26B 4XWOC 2FO1A 3AAZA 3FFDB 3CH1B 4WI3A 4UINL 1VDGA 1P7HL 3D9AL 5C9JB 4NRXB 1CFSA 1VADB 3GMRB 3SE8H 5T3XE 4L8BA 2DBLL 5KOMC 5T3ZH 3PP3H 3QZWA 4S1RL 4X0KA 1KN4H 3X3FH 1G7MA 4CADA 4JO3H 1QBML 1FZKA 4M43H 3JUYA 2WIIB 2IGFH 4J3UA 2D03H 3O3UN 1X5KA 1XF2A 3OKDA 2Q8BH 1ZLVH 5EO1A 4LU5L 5FDWB 2IANA 2AJYH 3BKYL 4OLZH 3MCLH 2MNUA 4LLDB 1LO2H 1P53A 1ZHNB 2UUDK 1GAFH 4POUB 3RVUC 4JANA 3GSVB 3B4NA 1V05A 1GGCL 4NZTH 2DMBA 5JZ7C 5DRZA 3MJ6A 3PGFH 2Y5EA 3RDTD 2A38A 5JHDA 3VFUA 2DYPD 1QOKA 1IGML 5EULV 5IB4A 3OG6B 1YC8A 4NQDD 3BP4A 4F2MB 5JHDD 3K46A 1P9MC 1K3IA 1J8HE 4NO0D 2X40A 2DDQH 4XI5D 2NY5H 3T2QA 4PRHE 3RAJH 1OB1A 4NSKB 1V3KA 5KSUA 4APQD 1QSEA 1IEAB 4J3XA 1JPST 3CVHH 2ESVB 4OZHA 1QA9B 1GZQA 1DDHB 4WY7L 2AJSL 3EZ8A 4PJXB 1FFNB 1I7TA 4JZNB 1X5LA 3UTOA 2XZZA 3DVGA 4JHBA 3TZVB 1SJXA 4XCEB 4Y4HA 5JHDB 1JHKL 4N9OB 3TO4A 3GKZA 2C3HA 1IEBB 1H3XA 5IEKA 1SJVA 2VLKA 4M8QB 1H15A 2BNQE 5GZOD 3W5NA 2P5EB 2L4OA 4K8RC 2EDKA 1B0WA 3D85D 3O4OB 4P2RA 5ESAA 3C5ZB 4O5LH 4V1DB 5E2JA 2R23A 1YNKL 5GSVB 3KPRA 3PL6B 5A16B 4G9DB 4ZFGH 5HHMB 2NR6C 5E0QA 4DZBA 4PJAF 5AZEH 1TVHA 2AJUH 4OD2A 5CGYC 5M95B 3VFOB 3MJ9H 3QB7C 3TYGH 1X6LA 2AK1L 2FSEB 2W9DL 2CKBL 1I9RH 2FD6L 3MV01 4LSTL 4QRRA 4P3DB 1T2JA 1CDBA 4RRPA 2XZAL 3BRGC 3TYFB 3I02A 5EUOE 3ZE2F 3MJ9A 5TF0A 2ADGA 1WZ1L 3ARUA 4NO0A 4HIXL 4UB0H 3NGBC 1FV1A 1O7VA 4IRJA 4GRLD 2YPLE 4QOKD 3HC0B 1I9JL 4YHKL 1D6VL 3VFNA 1IC4H 5DD1L 5F7WC 1NUDA 2Q6WA 5DC0A 1OGTA 5J06A 1N2RB 1N5YL 4PJ8A 1FJ1A 1J18A 2ZNXA 2QHRH 1EBAA 5J6GA 2EDHA 1HSAA 3GIVA 1UJ3C 2QL1A 1BF2A 3O2DL 4PJFA 5IF0A 2BY0A 3NH7L 4B7LA 3VG0H 2BVPB 2JJUA 3KPNA 2FX8L 4L3ED 5CZXD 2VABB 4QTIH 4E41A 4EVNB 5CUSL 2C4FT 4JVUA 3BYTA 3JWOC 2IQ9L 3OGCB 4PJEA 4JM2C 4U1IB 5EWIL 5AD0A 2D7TL 5FA4A 4C56A 2HRPL 1CI5A 2YK1H 2G5RA 5DFVC 4ONOA 3RPIB 3TBSB 4MNGE 4B53A 4KZEH 1RK1A 2GTZB 1R5IB 2ILLA 5DWUL 5J11B 1EHLL 3MGTB 3U9PL 1F6FB 1QLRA 1T04B 4D9RE 1HQ4A 4LPTA 3NFNA 3R0MA 1NMBL 1FYTA 3QFDA 4DKEL 2BRQA 4ZO9A 3G6JE 1CD1A 3OX8A 5CAYB 4NWUL 1WC7A 3OG4B 1BZ9A 1MHPH 3ME0A 5JA9A 2I9TB 3DMMA 2NX5B 4OLUL 5GISL 4PR5A 5C6TL 1QTYT 3RIFK 4HPOH 4GG6F 2F9BT 4S1QL 3U4EA 4Y5YA 5DMIL 2C1OB 2PTVA 2EH8L 4ZD3L 3L7FA 2NTSP 3EJYC 2HFGH 5DRXB 2ZUUA 1DBJH 2J6EA 1PLGL 3EYVB 4OT1H 1K2DA 4TSBH 5IGXH 2R8SL 4K3EL 4H1LH 2OSLB 3P4LA 2R56H 3BOVA 4O4YH 5TGBB 3N9GL 1JWUA 4K94L 4NNPH 3WEXB 2BY2A 4FQIH 4X80L 1A7QL 3PIQB 1JK8A 5IIEB 5EU5B 5I1IH 3VW3L 5L88L 1F45A 3EOAB 5DK2A 2IH3B 4MZ3A 4LFHG 5F7YC 1FFRA 3PDDA 4PG9B 1CK0H 1CE6A 1NFIB 4NRXA 5CZVH 1KXTB 1DUYB 2WP3T 5GRUL 3JVGA 1HYSD 4XPHL 5CP7B 2YR3A 1IILE 2R39A 4PGBB 5F7NC 3RGVA 1MRFL 1D6EA 1ZLUK 1G7JA 4XRCA 5I0ZA 1RPQA 1T5XA 4JZJB 5DJAB 3TYFA 2ED7A 3B9EA 3E2HC 5ALBL 4YXLH 4EVNA 4ZUUA 5JXEA 1YMMA 5KSBF 1D5XA 3VJ6A 5I73C 2ZZUT 5GSRA 3QQ3A 1F3DH 4LEOA 1RMFH 4UTBH 1U9KA 4EUPG 3QULB 1PSKL 4IIQB 1YMHA 5MEOB 1YMMD 1EGJA 2E8YA 3OXSB 3FO0L 5TQ0H 5E9DE 3TNMA 2PO6C 1MFBH 2J88L 1F00I 4AJ0A 4HUVA 3VW3H 5FB8A 3A6CL 5HI5C 1H8OA 2IAMC 3W0WE 2BSED 3C8KB 3INUL 3IF1B 1UM4L 4H1LA 4OSUL 4XP6L 1I3RB 1D5IH 5HY9A 3GHEH 4LHUG 1DVFD 3VXME 4CVZA 1WIOA 4ZAKC 1A22B 4UUJA 4WDIB 3F65A 1M7XA 5CHNB 4Y5VB 2KDGA 2FJFA 3BN9D 1NC2A 2R0KH 3ARBC 3RX5A 3UBXI 3D87B 4YNYB 3WDHA 3SE3A 3MRJA 1CE1H 3LIZL 4WW1B 3PGDA 3KPLB 4FZEH 1V3MA 3UTPE 3AMKA 3SJVB 3MLWH 5IVZA 4PUBH 3RJQB 4WTXA 5DJ2B 5FHBH 3UJTH 3B6SB 4ZQKB 2BVOB 1ZT7A 5EU6E 4NDMA 1KEGH 1CQKA 1A6AB 5D2NB 2UV3A 3RWCA 3UEZA 4NZRL 2UYLB 4HUMB 4JCMA 2OK0L 1VHPA 1U2CA 3VGHA 3JV6A 4LSQL 1I8LC 1TIUA 2X4QA 2FJFB 4WTZG 1NGYA 4PLJD 1MCOL 4Y4KD 3GJFH 4LRNH 5DMKB 1OAXH 1RY7B 4MAUL 4MA3B 1N5AB 3TO4D 3X14B 2MHAA 2OJZH 4LK4A 5EG6C 4X7EC 3KGRA 3QEQE 3C9NB 4WU7A 3RNKA 1OARH 4LSDA 4U33A 5KSVA 5F3BB 1P4BL 2V7HB 5LQBL 4F7PB 4XP1H 3B83A 2J4WL 1A02N 1WICA 3MJ9L 3OV6A 2FO4A 3KPQB 3RAJL 1T1XB 6CGTA 4L4JA 4XNXL 3BVNA 2DQHH 3GMLA 3L6FB 5IB2B 4U1NB 5BZDB 5DJ6A 2VISA 3QDME 2VWEC 3TN0D 5KS9F 2EC9T 1MQ8A 5E8PA 1BD2D 2DQDH 4Z8FL 2AEQL 2YBRA 1QO3B 1A9BB 3EDKA 4Y16B 2YRZA 1JUFB 1TQBC 3C87A 1TZIB 1BAFL 2OS7A 1H3PH 5ID0A 1RK1B 1SY6H 5HHOD 3RVXC 3CMOH 4I18B 4OTXH 3IS1X 2WLZA 4YHML 4JKMA 5IHLB 3I50L 3QDJD 4OM1L 2ADGB 4QGTA 4P23C 5CD5D 1JHLH 1RK0A 3N1FC 3S3SA 1INEL 1X6NA 4WUUB 4HUXB 5AZEL 1FO0L 1QEWB 3NH7H 4MQSB 4U2YA 2YUZA 3SKMA 4JDZB 5C0IA 5IKCB 4QHNB 1TJIH 5GS3A 3M17B 1G7PA 1YN7B 3OJDA 5GGRB 1U8JA 1CT8B 1ETZB 4CNIA 1UVQB 2IQ9H 2IQAA 3TCLB 3F58H 3LKSA 4NKIL 4U0RB 1UWXH 1FVDB 3X12A 4YGVA 1VGKB 4UAOB 1A3LH 5JORA 2Y4SA 3IKCA 2FLBT 4YGAB 2LAGB 1EDQA 3OBAA 5D93B 2P48B 4OF0A 2YZ1A 3RZCC 3UTTA 4AEEA 5JOEA 1MCBA 3EYUL 1HYRC 1Y6KR 1YY9C 4S1DC 3E3QC 3MRDA 3O2WH 3GJEB 3UX9B 2KUTA 4NKDB 4LCCA 2JK5A 2W0PA 4JPVL 2HMIC 4DKEH 4FZ8L 4AQ1B 3IDJA 3D69B 2R2CA 4EBQH 5F9JA 2B7DT 5TH2A 3VXSA 1YEIH 3GSXA 4F33A 5E00A 2G60L 5AZ2L 1IQDA 1FO0H 2CIKB 1OGAA 1BZ7B 4PD4K 1MJ7H 4W6YB 4BFBD 3ARDB 5IHUH 3R1GH 2P1YA 1KLGB 4LNVA 5DF0A 4OLYL 1AGFB 1DQQB 2IH1A 5E1HB 5ICYB 3Q5TA 2CLVB 1LK2B 3QIUA 5GHWL 4U0QB 1NCWH 2X4QB 5ESAB 5E8DH 2MMXA 3KPNB 3O6KH 5K9KB 1W0WA 4R97C 4G9FB 3O3BB 4Z7VB 1G0XA 1TPXC 5CJ8A 2CLRB 2BX5A 3ARFA 4PIRF 1RZKC 4O2CA 2CK0L 4QRQA 3B5HA 3UAJC 3QDAA 1OGAB 1AGCA 4W6XB 5HJ3B 3CSGA 4NYLA 5EZLB 3V7AE 1HYSC 4NHUB 5HPMA 3WXWH 3CSYA 3F12B 4NQXB 4M6OH 4NNXB 1K6QH 5IT2L 3MLRH 4WENB 5DXWA 2XNAA 4KWUA 4XXCC 1VACA 4FQLH 3T2PA 1VEMA 3TBVA 1FDLH 4Q97A 5KG9A 1N3NA 4H5SA 1CD8A 1ZWIA 4DVRL 2XY1A 1W0WB 1EGJL 5IMMA 5C09B 3ORJA 5TDPB 2F8OA 4QRPA 4JQVC 4K3DH 3ARBA 4ONGH 1X5FA 4TSBL 4ELMB 1N6UA 4XBGB 1WEJH 5I8CA 3UDWA 3DYPA 2YZ8A 1R6VA 3BUYA 2EEBA 4HLZH 4RAHA 5DQ9A 1JZ2A 2X4NB 1VSCA 2H3NA 1ZT7B 5CJOH 1HQRA 4YR6B 3WFDL 1DLFH 1RULL 4IMLB 1CGSH 1S7VB 3MCLL 2YWYA 5IJKA 4UNUA 1A7QH 4DJMA 2E6PA 4LPUA 2Y5TB 3GSWB 4PV8B 4J3VA 4OSUH 1RIHH 4M1CD 4ZUUB 2HT3D 2ID5A 3D69A 4RFNB 3SDAB 4RGNB 2D9CA 5AUMB 2F58H 1OCWH 5I76A 5ID1A 1QLFB 4UNVA 4NN7C 2WUCL 4P48A 5JO5B 5BS0A 3MRKB 1ZVSA 4PP2B 3F7QA 1KTLB 1NDMA 3C5ZC 1EBPA 3S5LG 2VDNL 1T66D 3T0WA 3DOSA 3DRQB 4X6DE 1N59A 3MO1B 5D6DA 4JRYE 4K2UH 1VGKA 1NGXA 1E6JH 3U7WH 1KGCD 5LG1A 2HTLC 4EIZC 2NW2A 4MJIE 3DRTA 2DQEH 1A3RH 4KVNL 2GCYB 4UQ2A 1A6VL 3IKKA 3S96B 3F7PC 1YEGL 1P2CB 4Z7VE 1EXUA 2BOBA 4G9FA 3FQNA 1JWSB 3FO0H 4I0PC 5FECB 3M45A 1MAKA 1MAJA 5GIRA 5HYJA 3HE7D 5K9OB 1LVEA 2NY7H 3B2VH 2PW1B 2CJUH 4M5ZH 1PKQB 3NTCL 3TLRA 3VCLA 3FFCE 1MCLA 1H3TA 3LRSB 1KIQB 2X4TA 5FYLH 1P4BH 3QO1B 5I15H 2DLIA 1FIGH 4IOIA 1MWAB 1HH9B 1MUJB 5KJRH 3PDOB 2CDGA 3BPCA 5C6PB 1UXWA 4XHQA 4POZD 4YE4H 3LEVH 1JNNH 4AG4L 3HMWL 1RJZB 3TN0C 4GLRH 5CWSA 2X09A 4YXKL 4YDLC 4FFWD 4DCQA 3WYRA 4XPGL 2OYPA 3NCYP 1ZLWH 3T8XB 5C0ND 2BMKB 1AR2A 3VGGA 2OZ4H 2EIEA 4Z8FH 5I1EH 4N0YL 4N9GB 1FVDA 1PQZA 1QSFB 5DJCA 3D3VE 2X5PA 3QO1A 4Y5XB 5EORH 2G5BA 3SDXA 5DRWA 5EBMB 3MODH 3U46B 1TQCC 2PW2A 5FUOL 3H9HA 4PRBA 3VMPA 5I1KH 1JZ6A 4JY4B 3QIBB 1F58H 4TYUA 2GT9A 3GIZL 3Q5OA 3QA3B 2DBJA 1T1WA 2VQ1B 2ICWA 3CFEA 3JTTA 1CGXA 4N0UB 5J11C 4RFOL 3GK8H 3DMMB 2E7HA 3IFNH 5D1ZB 1KYOJ 5C07A 1NUGA 1HHIB 1EMTL 4KQ4H 3PHQA 2VDML 1SY6A 3L3JA 4ZS7H 4YE4L 3A67H 3DX8B 3SOBL 3HNTL 3LN4A 1WZMA 1CDIA 2XYCA 5D1QC 4Z6AT 3EOBA 4HGWB 1QBAA 1A9EB 4KHTH 1IKFH 4TULL 1W0VB 4LFHD 1JGDB 4Z9KB 3Q5YA 4LGPB 1JV5B 4JRWA 3R8BB 2DLFL 4L3EA 4J4PA 5T1KB 4PJHA 4XBEL 1MY5A 4U1NA 4ZNEE 4JDVB 3MACL 1J5OL 3B9AA 3ZHKA 3LD8C 4XVSL 3PWPA 1LO3H 2I24N 2HT4D 5JW5B 2WW8A 3GUTB 2OQJA 4EBQL 3UBXA 1P7KB 4MWFB 1I7RB 2WANA 3CSBA 1YC7A 1RVFL 4MDIA 3Q0HA 4BKLA 4GRLB 4KQ4L 3CPLB 1IQWH 5CBAB 3C08H 2AJUL 4DGIH 3MZTA 3CD4A 4X99A 5FGBC 3L9RA 3VH8B 5FYLD 3MLZL 3LKPB 2AK4B 4PJCF 1CU4L 4HHAB 4U7SA 3U2SA 5MENE 5GRVK 4XMLH 2HJKA 2GAZB 3OSKA 2BVPA 3MRHB 5C0CD 5LGJB 4ELME 2NX5A 3PNWA 3Q6FA 5L0QB 2BOBB 3SEPA 2XKUA 5KN5B 2OMBA 4M1DH 4R2GD 1A1NB 5E9DA 1ADQL 4P5KA 4YPGA 3TFKD 2VZSA 1JPSL 1Z0MA 1HSBB 2NX5D 2VXQL 4AQOA 3MACH 3U36A 1IGIL 4APQC 3TF7C 5BVPH 2IAMA 5GGTL 4Y5XA 1KB5L 1YEEL 4FQIL 4X80H 5GQBA 5FEBA 3LSOA 3TPUA 2Q3ZA 1T80A 1BFOB 5C0BB 3VFVB 4KK8C 2QHRL 4WFHE 5DS8B 5F70A 1ZT1B 3VWJA 4PJGB 4FQ1L 3MLRL 2O61B 3QPQC 1XGRB 5GGRY 3CU1A 1G7PB 2W07A 2ZCHL 3PIQA 4WWKA 5K9KA 3MRJB 5TDOB 4FTVD 1M7DA 4UV7H 4P4KC 1DJSA 4PB0L 5I18H 2ZUTA 1KIUA 5MI0C 1KLUB 2Z93A 3V6BR 3EHBC 4GKSA 1NCTA 2GTZA 4FQCL 1WFOA 2OTUB 2V5YA 1P4LB 4RAUB 5D7SL 4M1DL 4LCIH 3SKOB 4L3EE 4JM2D 1AD0A 1XGQA 2P4AB 1T0MA 4IMKA 1JPSH 3NFSL 4Y19D 2G2RB 4WJ5A 5I2IB 1EJOL 1X5ZA 4O02L 3G08A 1FL6A 1DSFL 1LDPL 4BZ1L 2EKJA 5C0GB 5IW3A 1RZJH 1QLEL 1RK0B 5D8JL 2Y06L 3TV3H 4LSSL 3VXQB 2ARWA 4N1CA 2VAAB 3PABA 2V2TB 5ADPH 3STZA 3CFCL 2FR4B 3KHOA 2E7MA 4JO2L 5E9DD 4U1KB 1F3JB 3RP1A 3R4DA 1MFCL 1OP5K 4C56D 3NA9L 4Q9RH 4HC1L 4AK1A 3M1BA 1CFQA 2YPLD 3CXHK 3NIFF 2DD8L 1T03L 1ZGLM 1Z3GL 5I66A 1ZSDA 1JFQL 5GZOC 3MXVH 5I74C 4OGYH 1QVOA 4P4KA 2YD9A 4M93C 4YH6A 4ZSOB 5D5MB 4P9HL 1QFUL 3A0OA 4NSKA 3UPAA 4PJEB 4PJAB 3UYRL 4AENA 4HIJB 5MHSE 4GQ9L 4HIEA 4LGSB 3BPNC 2OR7A 1LP9B 3FT3A 1IM3A 2HTKC 2EDTA 1KEML 1KIPA 2X1QA 3X12B 1LEGA 1T3FA 2FB4L 3DSNA 1JNHB 2YA0A 1RHFA 5IMKB 2H6PA 3PJSB 3RKDD 2A6DA 5I66B 2M1KA 2ICEA 1ZT4A 2J8UA 3CDFA 3D85B 3QNYA 1FVCB 3BH9B 4JHAL 4PLKC 3UDWC 1RIVL 2KL6A 4O9HL 4Y7MA 4ZS6D 3U9UB 4YHYC 1YMMB 2Y6SD 5MEPB 3RVVD 2AXGA 4HXAH 1CIDA 4ESKA 4OLXL 1X7QA 3U48A 4WV1A 4H0GA 5HYJD 3ARWA 4J1UB 1F4XL 1ZLUH 3WFCL 2GJ6A 2IPKB 3GMOB 4OGXH 4D2NA 3P0VH 3MV8B 4YXHL 1NJ9A 4RMRA 3VWKA 2NY3C 4KRNA 4R96B 3GBNH 5C2BH 1S9VB 3C8KA 5EZLA 4MSWB 4NJAH 4POYA 1BREA 1B4RA 3VXOA 1KXVC 4CUCA 1BX2A 3H9SB 3VI4F 5I1CL 3HZVA 5DD3L 3IFOB 4P49A 1QR1B 5KSUB 2VISB 1JJUA 1NKRA 2ZUYA 2VJXA 5T1KD 5HD8C 1PG7L 2VAAA 3SDXE 4WFED 4YWGL 3J7HA 2Q7YB 3WL9B 1U58B 1P2CA 2OP4L 5JIPA 3FO2B 4JZJC 3PWPB 3CX2A 3TN0B 5KANI 5HPOA 3T1FB 5BVJA 3MJ8A 1A1MB 1MHHB 3BPOC 1TQBB 2XWTA 4G8FA 3VXMD 1H3VA 5D2NC 2VTFA 1DFBL 5D6DC 5I1GH 4K71B 3ARDA 3BDXA 4Z7WF 2BVEA 1EEZB 3D25B 3B9KC 4PJGF 3VFGH 3MRFA 4G6AD 1K4CA 2CQVA 4G7YL 5A2FA 3UYOD 5IM7B 2HRLA 2VE6A 2W0FA 4HAGA 2FH6A 2DM2A 3PQYA 4UB0L 4RFNC 1F4YL 3SDAC 2E7CA 1DZBA 2OZ4L 4BQBA 1Y18A 2HP4A 1VPOH 2VSDA 4N8VG 2X4RB 3FFCA 3STZB 2BZDA 3S35X 3UJJH 1CS6A 1UCBH 5H94B 4M02A 3I9GL 1U95A 4HKZA 1DUYA 3MLVL 5HGGS 4E41E 3QQ4A 1DP0A 4IMLA 4NQVA 1MCWM 5I9QC 1OSPH 2HJFA 3WD5L 4L29A 4TNVF 5FO7A 3QR2A 1RJYA 2H2PD 5IW1A 3IB4A 3T65A 4JE4B 4NO3A 4NJ9H 1KB5B 4G43B 4MA8H 2MJWA 3BKMH 4WW2F 2VZVA 1HK6A