2IALB

Structural basis for recognition of mutant self by a tumor-specific, mhc class ii-restricted tcr
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
239
structure length
239
Chain Sequence
b'AGVTQTPKFRILKIGQSMTLQCTQDMNHNYMYWYRQDPGMGLKLIYYSVGAGITDKGEVPNGYNVSRSTTEDFPLRLELAAPSQTSVYFCASTYHGTGYFGEGSWLTVVEDLNKVFPPEVAVFEPSEAEISHTQKATLVCLATGFFPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRAD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CD4+ T cell receptor E8 alpha chain
publication title Structural basis for the recognition of mutant self by a tumor-specific, MHC class II-restricted T cell receptor
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 57
structure length 239
sequence length 239
chains with identical sequence D
ec nomenclature
pdb deposition date 2006-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ialB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ialB02
4XPGH 5GZOC 4UDUA 2BMKA 1ZT4A 4ZFGL 4PLKC 1V7MH 2YR3A 4WTXA 2F53A 4O2EA 2IBBA 4G8FA 3HZMA 5H94B 4KHXL 1I9EA 3I02A 5C08A 4Q6IC 3G5ZB 4QT5B 3EO1A 1A1OA 3BEVB 1YN6A 1T20B 1KJ2B 2D3VA 1UFUA 4F33B 1JI1A 3MRQB 4EEEA 2C1OA 3NIFE 1AR2A 3SDAC 3HTLX 4P57B 4JM2A 5EU6A 4WFEE 5I1GH 3L3HB 5D7KD 1HDMA 4JFHD 3UTZA 4HWZB 1AGBA 5CIPB 3RNKB 4S1SL 4BSVB 4D9LH 4YHZL 1M7IA 3A6BH 2C7UB 5D93C 2FZ3B 4JFFA 4LAJH 4YE4L 3MUGB 3ARGC 3BGMA 3GJEB 4U6TA 4YNYA 3P30H 3RWFB 3GIVA 5KOVC 3RGVB 4AM0B 5I8EA 3CC5A 1F5WA 2DJ4A 5E99H 1OGAD 4XPFH 4PGBB 1ZLSH 1ND0B 4MDIA 3MOBH 2D9CA 3W39A 2A6DB 4YC2B 4JVPA 1VSCA 2EDEA 4IRJA 1YPZE 3ZHKA 3QRGL 3QXVA 3HRZA 4HKBB 4JO2L 3BZDA 3DHMA 5H37G 3MV7A 1JZ3A 1ZS8A 4KJPC 1P9MA 1T03L 5C2UB 3LSOB 5JQHC 3ZKQD 5JPNB 1U0QA 2Z31B 5FM5O 2HN7A 3E6HB 2XZCH 4PJ7F 2PYFB 3RTQB 5FYJE 3VWJA 5L88H 4N8VA 5C0AA 3O9WC 3WHXB 1ZAGA 1MH5A 4AG4H 3NA9H 2NYYC 4KVCH 2VIRA 4XNQB 5IM7B 1EERB 4YHIA 2XKNA 5IJKC 2QADB 3MRCA 4FQIL 2NNAB 3KNBB 3EDFA 4NKMB 4CN6A 3HG1B 2YD4A 5JOFA 1P6FA 1JNLH 2AK4B 3VFPA 3C60B 1CVRA 4ODTL 3TJEL 4OI7A 1MCLA 4S0TD 3J8F7 4CVXB 2EIZB 1MPAH 1URLA 2FX7L 2KUTA 4QHMB 2X4TB 3S36L 3LB6D 2C9AA 2WBJC 2AJVL 4HAFA 1UT9A 2JIXB 1PAMA 4K3HA 3ZTNL 4PJBF 5DT1H 1X3DA 4XXCA 1KC5L 2Y72A 4XP5H 4LNRA 1ZLUH 4B53A 1OWRM 2XZQH 4GAYB 4NN7B 4PJDB 1T66D 2LU4A 1FIEA 4HK3J 1R3HB 3D9AL 3QQ9D 5AYQA 3TF7C 4K7PL 3BW9B 5KJRL 2W60A 4NQCA 5SWZB 3B9EA 2IEPA 3H6JA 2ZCHL 2RJMA 5C0RL 3BKJL 1D6EA 4HK0A 5FOBA 1FG2A 2ED7A 3DROA 2VXUH 1R24A 4M1GH 4TUKL 4P48A 4R7NB 1MI5E 1DBKH 4OAWA 5I1DB 5DEZA 4Q2ZB 2BVEA 1C1EH 5JPMB 1KCVH 5E8OA 4MD5A 1LO5A 2W0FA 2CRYA 1FQ9C 2BC4A 5D7IF 3FB8B 3ES6B 1LEIB 5J4MA 1AJ7H 3ARFD 3ULUE 1OVZA 5T1KD 3MV8A 4NQVA 1I3RB 3KHOA 4JANA 1XFPA 4NHUA 2OTUA 4LHQB 3EFFB 1YECL 3NABH 2JK5A 5CBAA 3ZL4H 1UZ6F 1PD6A 5FOJA 2I60L 1D5MB 3S5LB 3QNYB 4RWYL 5C0CE 4WEBL 3C87A 4C57C 4L1DA 3MRMB 1JPSH 3VXPA 5DRNA 4UNVA 4PRAB 3PABA 5E2UL 3N1QC 5MHSD 4QRSB 4D9QE 3N1PC 5I71B 5GRYA 3ORJA 5E00B 2XPGB 4D94A 4FG6C 3OAZH 5IMMA 1TJIH 4OD3L 4G7VH 3O3BA 5E5MA 3RJDA 2DB8A 5GJSH 4TQEL 5HDQL 1A1MA 1BD2A 4JFPB 4GG6A 3LVEA 5FYLD 1WITA 1ZSDB 1AKJA 2X4PA 1DE4B 3IVKB 3NPZB 4Y2OA 3VXOB 5I1LA 4WU5B 1SYVA 4ZD3L 3L3JA 5I76B 2YRZA 1J0ZA 1NDGA 2NY2B 1ZLWH 2MPAH 2VQ1B 5DTFB 1CDGA 1D5MA 5KAQF 1RI8A 5F7DA 4KMTL 4HIIA 3U0TA 1RUKH 4N5ED 3PQYD 3SKJH 1NCBH 4Z78B 3O3AA 3KPLB 2OX5A 4OM0H 4EN3D 2PR4L 4GG8B 1XF2A 1JNJA 2WBKA 4Q9QL 3BPOB 3REWB 5IB5B 2PYEB 1S5IL 4L9LB 5HVHC 5DFTA 4EUPG 1FVDB 1VACB 3IKCA 3PGFL 5ESVB 3F8UB 1XF3A 5F1NB 1LE5A 1KCLA 3H9SE 3LEYL 3RJQB 5J12B 3QFJA 2VDLH 3LRHA 1WFTA 2VABA 1RZJC 4EDWH 5LXGL 4M7KH 1UM6L 1MREH 4FN0A 3HR6A 5EFIA 4OCLC 3ARSA 4OF0A 1NANH 1GL4B 1QRNE 1MCEA 2DRUA 5D7JB 4HS6B 1BFVL 3WFCL 1D6VH 1JHLL 5KSBE 2DYPD 2GEEA 4H88L 1GYAA 1FCGA 1T0NB 1QLEH 3PL6C 4LVNC 4PJ9D 4X9GA 4UTBL 4R8WH 5CLTA 5J11B 2AJXH 2F19H 3KPRE 4OFPA 4B7IA 1UVQA 2V17H 1U8OB 3B8SA 3LD8B 3U82B 1P5VA 3ULVE 3PP3K 2W9DH 5AAWA 1QKZL 3BZEA 3F58L 2GJ6E 3BPLC 5IW3A 5DD3L 3IGAA 1OD7A 4R97C 1YZZA 4LLVA 1CD8A 3CFJB 3MRJA 1UWXK 4PGDA 4X4ME 3RL2B 1F90H 3WIIH 1VFAB 3O3EB 3DRTB 1FNGB 2O61B 2A9NL 5E5RB 5E70A 4K8RL 2VXVH 4PJGB 5IMOB 3VGHA 2PTTB 1B0RB 3O6FB 5J9PA 2VDRL 1NMBL 1EA9C 2XG4A 3OKYA 2CGRH 3EKCA 4JFED 2VE6A 4M02A 5DD6B 3VDBA 2DMBA 4ZSOA 3T4YB 2HRPH 4YBLC 3VWKC 2VLJE 2NY7L 1T5XB 5DQJA 4RAUA 3DXAE 1YDPB 2UWEF 5KN5B 4HH9A 2NW2B 5DURD 4CU7A 5SX4I 1WAAF 4PIRF 3UPAA 2DQUH 5D1XD 1A4JA 1LQSR 1II4E 1NGPH 3KLDA 3MLRL 5A43C 1U58B 1NCAH 1BGXH 2VC2L 3KPMA 4RMRA 1S7WA 5DUML 2FLBT 3F62A 1A6TB 3MLPA 1S8DA 1CGSH 3GSWB 4YHMH 5IIEA 1QR1A 2VLKB 4MSWA 4MJ2A 1CE6B 3BGAA 1BQHG 1I7RA 3TNNB 4IHOA 3EYSL 3T4AB 1RK0B 4IIQC 2NY6D 1P53A 4GUPA 3VXMB 5CGYD 4DKDC 5FF6A 4DN3L 3T2PA 1QSFD 4OFYA 1BP3B 3BI9X 4R7DA 3TBSA 4KFZC 1ZK9A 4YPGA 3ARED 4JZNB 3C6SA 4Y0GA 4X6EB 4JN2A 5CINL 4WUKH 2QSCH 2XWBA 1ONQA 3DMMD 3WD5H 5KVGH 4LLAA 5FV2A 3I3EA 1TZIB 2HT2D 1LO0L 5EZOH 4F7EA 2J4WH 2YUZA 4YO0A 1JYWA 3VH8G 3ULUC 3SJVB 4EOWH 5C8JB 1MCHA 1MY7A 4X6CA 4S1DC 5DJDB 4QRQA 5GSVA 3V4PH 1H3PH 3MJ9A 3QHZH 3ZYOA 2XWTA 2EZ0D 4NGHL 1KTRL 2AJZB 3MRKA 3DUSA 2HFEB 5DJ6A 4NN5B 3UC0L 4LEXL 2EDDA 2VDQL 3G5XB 4ONGH 4GKZB 1UQSB 3DYPA 2YUVA 5DRWB 3MCLL 4HT1H 3TNMB 3EOBA 1IL1B 5E1AA 4TTDD 4N90D 2X1WL 1EV2E 4HGMA 1BHGA 4HHAB 5C9JA 3MXWH 5TDPA 4N9GA 2GHWB 1JRHL 2Q7YA 5C09A 2EYRA 1T3FA 2NXZD 2UVFA 4HULB 5MENE 4XZUB 5I17A 3BKCH 4OGAD 1XZ0B 3DPBA 1AD9B 5DD5H 5ILTL 1FH5L 4WGVB 5LBSL 5IB3A 1RMFH 2BVOB 3ZMRA 3ARBA 3MV9B 4Y5XA 3TVMC 1FGNH 1NUFA 1UJ3B 3K46A 4WTZG 1JK8A 5C6TH 4TRPL 4IM8A 3IXTA 1TZGL 4QCIA 4MX7B 1RJZB 3HCVA 4G6FB 1IM9D 5JR1L 4R4BB 1KBGH 4ZNEA 2Q86A 1W8NA 3KXFB 4P2OC 3OKDB 4TSCL 3RZCC 1V7ML 1HOCB 1DEEA 4Z76B 1MWAA 2J8UB 1RY7B 4PRPB 3U2SA 2GJZB 4OM1L 3WEXB 1SMOA 3MNVB 5CBEA 4Y2DD 3FB5B 1TPXB 1UH4A 3T0EB 3MJ8A 5B22A 1A64A 1T1WA 1P4BH 5F6IB 2R15A 4M5ZH 1N6QL 2LAGB 3BWAA 4LEOA 5E8PA 5C0BA 1WWCA 1CT8B 1GGCH 2G75A 2YPVH 1KCRH 1RULH 2BNRD 5FK9B 4NCC2 1NC4B 2BVYA 1IAII 2A83A 1WZMA 3A6BL 1EO5A 1A2YB 1UG9A 4YHPA 5HHQA 4JRXB 4X9HA 1FE8H 1QLFA 2IFGA 2Y25A 3OAYK 1CCZA 1IGYA 4YDKL 4Y5VB 1VFBB 5ANMA 4QF1A 1GC1H 4Z7UB 4CVZB 4MNGA 1MCCA 5C0EA 1MLBA 4X7SL 5A16A 3KLAA 4XPFL 4JFOB 1S7XB 1ZLSL 3WLWD 1TLKA 1QBML 3MOBL 1SEQH 5I16B 3QH3B 1B4JL 5BW7A 4S0SD 4A2MA 4AENA 1HSAA 1X5XA 4U7MA 1HSBB 4WHTB 4DUWA 1TVBA 4I3RH 1WBYB 5EORH 4G43A 1K4DA 3DX6A 2BP3A 2XZCL 1MCJA 4JDVA 3SKMA 1NCCH 4LLQB 4PJEB 2I5YH 3PHOB 3SDYH 5FECA 4P2QD 1A7NL 1WT5C 2XN9A 3VXSD 1E4XI 3KPNB 4KVCL 1BBJB 1P84J 3SDDD 1EO8L 3BIKA 3W5MA 4YHNA 1JGUH 2B20A 4W6YB 3GSNA 1KYOJ 3QUZB 3I2CL 2XICA 4Z95H 1I9IL 3IDYC 3LKOB 3AM8C 3P0GB 5TH2A 5HYJD 3RWIA 3QPQC 3D39B 3TH2T 5JO5A 4Z0XA 1MPAL 1I7ZB 4H0GA 5CP7A 1KB5B 1PKQE 2NXYC 1UWGH 2EO1A 3FO9B 5H37H 4GMTH 5ICXA 2R29H 1I75A 4FQ1L 5ABDE 2CIIB 3QISA 5DT1L 5AWNH 1Q1JH 5HVGB 4XP5L 4F3FB 1U3HA 4F37F 4F7PA 1H8OA 2OZ4A 4Z7VB 5M95B 4P2CG 3MJ9L 4I18A 1KB9J 1RD6A 1YUHB 2X4UA 5J6HB 4DCQA 3CFCL 5ADPH 5CKAA 5C7XL 3VD3A 5EIIA 1I8MB 2W07A 3STLA 3RBGA 4UBDD 3NIGE 3BZ4B 1T89A 1XCQB 3PGDB 1KACB 4QRTA 2ZCLL 3IETB 3MBEA 3FFCD 4U3HA 1C1EL 5EUOB 2DL9A 2CXGA 3LKPA 2EDHA 4JHAH 5JIIA 4F9LC 4JM4H 3Q1SH 3TZVC 3BGFB 1XGUB 3D0VB 1AJ7L 4RISH 4WWKA 2NY0D 3EFDH 4YDLB 1R3IL 4PTUB 4PGCB 1BLNB 3QHTC 4OCXL 3WO4B 3JWOH 1DUYA 3OF6A 5KS9E 5IUSA 5GQBA 3ZHDA 2JELH 3NABL 5C3TA 3ZL4L 5HJ3B 3BDBA 1HINH 4KK8C 1Q9WA 3KJ4C 4F2MB 1LP9F 1JNHA 2IGFH 3WDJA 3CFEB 3H42H 4I4WA 4DK3A 4U1IA 4BH8B 3C6LA 3RWEB 1DN2A 3T1FA 1L7TH 2GJJA 4G7YL 4NQDD 5IHLB 5DMIL 1A6UH 4WI5A 5HVWA 3MLVH 3MREA 2L4OA 4HJ0D 4UT7H 3OHXA 2EYTA 1MWAL 3U46A 1ZANL 3MRHB 4RSVA 1YEJH 4Y4FB 2ZOKB 2NY3D 5F96H 4DVBB 1KXTB 4UINL 4TSAL 4N0UA 2VL5B 3TP4A 1FNSL 1DVFC 1KCUH 1J05B 1RIUL 4XAKE 4I2XA 4GMSH 4MAYD 5GISL 3ARGB 4P4KB 4ELMA 1QNZL 4R0LB 3BEWA 2MPAL 4H8WC 4WW2F 5K33A 5EPMB 5DO2D 5L0QC 4PJ5A 3MLTB 5DHYB 5IGXH 3FZUD 5SWSE 1BM3H 4LRNH 4Q6IA 4WNQA 3SKJL 4PG9A 4OZIE 4HS3A 3LN4A 2JJUA 4RRPG 3VFOB 2VZOA 4O00A 4AT6B 4Z7QE 1JV5A 1BVKA 1IAIM 5JXED 1LK2A 3L95A 3SDAA 3CVHB 3PDOB 43C9B 1HYSD 3U48A 3EDJA 5IB4B 2OQJA 3WLBA 5D6CB 3PP3H 1C12B 1KPRB 3H3PH 1CBVH 3ZDZF 2EH8H 3FCTB 1J0HA 2WK2A 2HAZA 3U4BH 4EDWL 3T65A 4QNPE 3NPSC 2IH1B 4M7KL 3U7WH 4RCAA 3S4SA 4KK9D 4X7CC 1UWXH 1N4XH 5EN2B 4LCYB 1I85C 1P69B 5BRZB 1YNLL 2X4SA 3P0VH 2XA3A 1OAKL 1SJHB 3U9UB 1SEBB 3RVUC 8FABA 3WUWA 5CWSB 2Y6SC 1QLEL 4RFOL 5AZEL 2EICA 1QG3A 4LPXA 1S7RA 3GSQA 2AJXL 1NFDE 2CIKA 4JGUA 3IJYA 4NO5A 4ONFL 3GSNL 1ZEAL 1F3DJ 5CJQL 3S9DB 4JDZB 3L3GB 1OTUD 1XF4B 1EFXB 2W9DL 4EUPH 4PJHA 3QEQB 1IJ9A 2ADIA 5DK2B 4Q0XH 4XP6H 3JV4B 2B0SL 3O9WA 1TQBC 2JJTC 2AS5M 4LMQI 1HH9A 3IU4L 3D25A 2JJWA 4HQQH 3S35H 5CFHA 4XP1L 5E2TL 4DKFH 3MRBA 3LEVH 2ORBL 4HV8B 3FQTA 5HHOD 3RPIA 2OZ4L 7FABH 3SKNA 2VXVL 4WFGE 4M4PA 4BM7A 3TO4B 4PRHA 4AMKH 3BMVA 1UH3A 4HIJA 4QRPE 3CUPA 5BV7H 1MFDH 5D2NC 4Y4KD 3O3DB 1NAMH 2IQAA 3MLUL 5CS7A 2WBJA 1KPUA 4J8RB 5AZ2H 1HQRB 3OXRA 1QLRB 1IZJA 3UPRA 1ORQA 4BFIA 5FKAA 2X4OA 1FFOB 4U0RB 3OKNB 5GHWH 3B2UC 3S7GA 3A6OA 4K7FA 5ISZE 1R3JB 3UJTH 4LCCC 4PJXB 3VGAB 2FX9L 4L3EE 3MGOA 4BK5A 3LQZA 2NX5B 4NBZB 2AEPH 4HDIA 3GNMH 3QJFB 3QIBC 5C07B 1DQQB 3RWCB 2IANB 1CGSL 1IE5A 2HTKC 1UKSA 5E6IC 3NOIA 5E9DA 1AXSA 1CLCA 4K9EH 3CFBA 5CJBA 1EVTC 3VD4A 3SDCD 2UYLA 1R5VB 2ERJC 5C0IA 1UADC 1QO3A 3L1OL 4NJ9L 5TE6H 3SGJC 4L4VD 3WD5L 2QSCL 3SCMD 2H1PL 4V1DA 2BSTA 3BQUC 1S9WA 1BFOB 3ZE0F 3I85A 1DLFH 1JI2A 3IU3A 2J4WL 1XGTA 4G42B 2J88H 1U8KB 4KRLB 3MROB 4YQXH 4U6XB 4Z7WA 3QQ4B 4M6OL 3F12A 1H3PL 3GKZA 1WCQA 2Y07H 1CL7I 3LKNA 4XC1L 5IVXA 1A0QH 2YPLD 1BFTA 4LMQE 1OARL 4GRLC 1NBZA 2APFA 5TQ0L 3OR7B 4G8GE 1G6VK 4F37K 4TVSa 4IRSC 4NOBA 3HRPA 2KL6A 3S3SA 1CFTA 3K1KC 4WV1B 3HHRB 1YA5A 5L8KB 5JOPD 4OGYH 3T77B 3MLXL 5HVHB 5L2KA 1JTTA 4KV5E 4WFHD 2HG5A 1AO7D 3GIZL 5GZND 3SO5A 2EYSA 1OP9A 3CU1A 4JFYA 3MXWL 2P43B 1Z5LA 3FONB 5L6YH 2A73A 1J7VR 3OGOE 4OZFB 1KTLA 4KTYA 1I1YB 4NFBA 1BF2A 3VFTA 4LSUL 3OTTA 1RZFH 2VZTA 1AI1H 1HXYA 4JPWL 2N1KA 1CF8H 1GH7A 4LLUB 2XQBL 3HE6C 3STBA 4M9OA 3MODH 5D8JL 3S36X 1NC2A 2I9LB 5C6TL 1CD1A 3I75B 1DQML 3ZE2F 3BUTA 1U8IA 5EU5A 4ERSH 2RQ8A 4LVNB 5I30H 4Y16D 2V5SA 1YPZB 4XC3L 2I9TA 4NQSA 3OAYH 4WEMB 1KFAL 1YEKH 4HUVA 5DJ0B 3FQNA 1L7IH 1XR9A 4PV9B 2XZAL 4M7LL 4J6RL 2ED9A 1RUAL 1A3RH 4KKBC 5F9WC 1KEMH 3QDME 2ZSWA 3WS3B 4I0PC 3MACH 4N68A 1FNAA 1RJLA 3TBWA 3PJSA 4M5ZL 5IVNA 3K0WA 3U7AA 3N85H 4FXGB 2HLAA 2P7TB 1OAQH 2ATPA 1KCRL 3QQ3A 1RULL 4YIQB 2V2TB 1KG0B 1TXKA 5IVOA 4YFEA 5BVJB 2YD7A 2DWDA 4PJFE 4DZBA 3FOMA 2WWKT 1OM3H 4KUCD 4ZUWA 2ITCB 5HHVH 3QXAA 4MXVF 3PL6A 1SM3H 1FE8L 3D2UA 4V2BA 5JUEL 4MNQA 1EEQA 1YC7A 4YGVA 4KI5D 1MHHA 4YBLB 1GC1L 2RHEA 2BJML 4L4TD 1EMTL 3KPTA 4P59H 3OKOA 4ZOEA 3DVGA 3W0WA 4R9HA 2CDFB 4UV4L 1G7MA 2D4FA 1SEQL 3EOTH 2OL3H 3ZSSA 3SE4C 4NYLA 4P2RD 3DBXB 5GXBB 5MEQA 3FRUA 4W4OC 3TA3B 5DJ2B 3KPQA 2AXGA 5FO9B 5I18H 1ZT7B 3JTSB 2J12B 2R1YB 1VEMA 3V79C 1CDHA 1HHGA 3O2VH 5EORL 1NGZA 2A6IA 1OPGL 2BDNH 1IT9H 4J3XA 1NCCL 5EC2B 3FRPA 2A6JA 4ODUB 4K94H 2I5YL 5GRVL 5D2LB 3SDYL 4EZMA 1CICD 4OZHE 4WI3A 1A9BA 2N7BA 2F5BH 2X7LB 1U8MA 1LNUB 3UBXI 1L6XA 3QIWB 4LVHB 1Q9LB 4M61B 2PW1B 5E7FA 4JQVC 3VWKA 3J7HA 3QO1A 5KG9A 1MI5B 3KLHC 1JGUL 2LU7A 4JG0H 1OLZA 3LH2H 4LRIA 4OLYL 1ACYH 1UM5H 2CO6B 1UZ8B 3F7YB 5T1LD 2W9EL 3G9VA 2C4FT 3L9RA 3N9GL 4EUPA 4FQXA 1YEDB 1SJEB 4E41D 3QIUD 5JLZB 1I1AC 2OTWB 2RIKA 1BF8A 1UB5B 1HHHB 3R1GH 4GMTL 2DICA 4LPWA 4XRCB 3NFPA 3VXRE 2YMXH 3VGFA 1I8KB 3V7MA 5ADOH 1Q1JL 2IMNA 4NNXA 4OGXH 5EBWB 2ZNXA 1U42A 3V6FA 3C5SB 2QHRH 5C0CB 5DVMA 5AD0B 4IIQA 3FOLB 5EZJA 4NNYA 5H2BA 4CL7A 1NAMA 4DUVA 5BMFH 4KKLC 3TH4T 2QR0A 1WIUA 4HGWA 2FYYB 5DGQA 1CG9A 1MEXH 5L2JA 4IDJH 4BQ6A 5IQ9B 4LOUC 4LPUA 4PYGA 2R0ZH 4HUWA 1T7ZA 4GO6B 2COQA 3PV6A 1FFPA 4LBEB 2AQ1A 3EDEA 4R3SA 1ZWIA 3ARWA 3QYCA 1PZUB 4R96A 3QCTH 1NUDA 4GSDL 4HD9A 5DHVH 1HN1A 4IMLA 2AXJA 4JHAL 4YWGH 2VKWA 3EHBD 1U41A 1FFQA 4KQ4L 5D1ZC 4LPCA 4AK1A 1R0AL 5D7LE 4QWWD 1K5NB 4G6AC 1HHIB 4LHUA 1S9XA 4IRZH 1EX0A 1XIWD 4JLRA 3JWOL 2OI9B 5FYKH 4JZOA 1HHKA 4P3DA 3HI1A 2Z8SA 1LO3H 4X5LA 4NDMA 3ROOA 1KJ3H 4JY4B 4P2OB 3RZCB 4U1MA 2IGFL 5GS0C 2ICEA 1NAKH 3HPJA 4ESKA 4LCWB 4OCSH 3CSBA 5C1MB 4NZUH 2XRAL 4AZ8A 1U95B 1JZ6A 43CAB 3UP1A 5I1JH 4UI2A 4X9BA 3H9SB 1A6UL 3PWUA 3TBTB 4U6YA 4MHHI 4ZUVB 1Z3GH 2DDQH 1XR8B 4PREA 1AHWC 2YD8A 5F96L 3TVMA 1MIMH 2CRZA 5DC0A 1KCUL 3BO8A 4PY8I 1AFVL 3B6SB 5KSBB 1DN0B 3O45A 4LARL 3MLYH 2F53D 2OJZH 4L8SB 1BQLH 1F3JA 3ZT7A 1BQHA 4BSWB 2MJWA 5F9JA 1HKFA 5C08D 3O8XB 5B38A 3KPRB 3G08A 4OIIL 4YDJA 2W59A 1H15A 4H5SB 3BP5B 1BM3L 3BDXA 5MEPB 4GW4B 1L9NA 2G5RA 2GJ6B 3BAEL 1NL0L 4MCZB 3MQIA 5HPOA 1G9EA 2K1MA 1UYWH 4JAMB 5EU6D 1CGXA 1T7YA 5IEKB 3B3IA 3DYMA 3PXJA 5JZ7D 1MFCH 4UB0H 2FDBP 5E2VH 4OUOA 1JPST 5SWQB 4PJ7E 2FIKB 5IVZA 2DBLL 2DD8L 4WW1A 3M8OH 2JCCF 1X6NA 5BVPH 2ATKB 4HIXH 2RAMA 4GKNB 3QI9C 2R2CA 1QRNA 3QO0A 2VXQH 1S5HB 5TGBA 1E6OL 2EH8L 4ZAKC 5JNYB 4K3GA 3RL1A 3TN0C 1AQDB 1F97A 2FSEB 3U4BL 3V0WH 4OTXL 4NKDA 4NUJA 1Z9MA 1EGJH 2HJKA 2BY0A 1N4XL 2D0GA 1MJ8H 4WFFE 3MUZ1 4N1HB 3N1MC 3QSKB 2VLJB 3MX0A 4IRJD 1TTUA 1MFAH 2IAMC 3O6LH 5D9SA 4MQXC 4JGMA 3DXAB 3V52L 3IDYB 3PHQB 3MV7D 3IJSB 1KENH 2E7MA 3P77B 3QXUA 4QRUA 5DMKB 3HAEG 2Q76B 1U8JA 2RB8A 5ESAA 3QJHA 2NXYB 4LLYA 4GAJL 3MXVH 1A02N 4PJBE 1JZ5A 5F7KC 4X4MA 1DDHA 1QBAA 5F1SA 1RJYA 3DGGA 3VWJD 3ESUF 2ZG1A 4HLZG 5C0AD 4JQXC 1UWEH 3RIFK 4R4ND 3Q5YA 4Q0XL 4MJ5A 2OJEB 1VPOH 2G2RB 1HK6A 5E08H 2F74A 3RGVD 1WT5A 3GBMH 1BZ9B 4KU1A 1ZA3A 2GITA 4HQQL 3S35L 5CMAA 4P5TC 1NUGA 4WCYH 2R1WB 3I9GL 4S11A 7FABL 3DX9A 3X13B 4DFIA 4DW2H 3GMRB 3QUXB 4F7CA 3AM8A 4AMKL 3DJ9A 1DQJB 4NQXB 1V3LA 4C83A 1NAML 4R6UA 4P23A 1NFIA 4XH2B 5HYSB 1CLOH 4G9FE 5AZ2L 4YR6A 4JFQA 1HHJA 5D7IE 4JRYE 4UUJA 4MDJB 1YNTA 4K8RD 4JREC 4OLZH 3GMOA 5IBTL 4QHNA 3FT4A 3O4OC 2CUHA 4LAQL 2DQGL 3LZFL 4YXHL 3MNWA 3OAUH 3KPSA 1UZ6E 3VCLA 3HG1D 2IALA 2AK4D 2Z9TA 2EDKA 2VDPH 4NQCD 5T3ZE 3F5WB 2C1PA 3V6BR 2ZUXA 3P4NA 1CGYA 5EBLA 5DI8B 1GJIA 1DBJH 4NQEE 4NKIH 4NO0B 4NBXB 5B4MC 4D3CL 3ZKND 1SVCP 5ITFA 4K9EL 3IFLH 4OGZA 2X9YA 4WGWB 3HS0B 2XTJD 5EOCJ 4WUUA 1MLCB 5MENB 2GI7A 1INEL 4BUHA 5F3HB 1Q9OA 4F7TA 1Y18A 4BFBD 3PWPA 5I8OH 4OCRH 3TT3H 4F9LA 5C92A 3VRLE 1EEZA 3MYZA 3TZVA 3H3KA 2CRIA 1N7MH 3PWVB 1TJHH 1ZT1A 1U8LA 3MV8D 1EXUB 2Z8WC 5J13C 1RZGB 3O81A 4ODXA 4YFLI 4G5ZH 4TNWF 5HGHA 1J18A 4RMTA 1YJDC 2H32A 5K9QI 4U1JA 4RFNC 3CIQA 3GKWH 5EO1A 3ZKMC 3RDTC 2Y07L 1ED3B 2VLLA 3CU7A 5L0QB 3E8UH 3RX8A 5ACZA 3M1BA 4PR5B 5D1QC 5J8OA 1AXIB 2VLRA 1MHEA 1YEEH 3BISA 4MA8H 2FO1A 4PUBH 5FM5M 4JY5L 2ZUYA 4QRRE 1BD2D 5HPMB 5D5MF 2V2WA 3FO2A 5DHVA 3MNZA 1AKJD 2IBZX 3OL2A 4IOFC 4PRBA 4MVBD 4NT6A 1JHTB 4M6ML 4MHHG 5L6YL 3U9PL 1M6OB 1ES0A 1DVFA 3T8XA 3PWNA 1INDH 3ECBB 3O41B 3IFPA 1DLHA 1R3KB 3VXUB 5I9QC 1U8NA 5A40E 3Q3GB 4HWEH 1JF1B 1CF8L 4G9DA 1YEGL 3IDXL 3QT2A 5F88B 3CMOH 1LD9B 3L5XH 3THML 1RFDL 2EE2A 3TPKA 2YD9A 4M00A 4M8VA 4CDGC 3RNQA 1G7LA 1MJUH 3WE6B 5AUMB 5I30L 1MCOH 2CH8A 3LPFA 5KVFL 1NCWL 2ZUUA 3B43A 2OP4L 4UNTA 4FFZH 1BOGB 4G6MH 5EUKA 2X4NA 3RVXD 3QFJD 1F13A 1Z0MA 1QD0A 3WJJC 2FR4A 3MCKA 3V2AR 2YBRA 4TN9A 3C8KA 1N64H 5DJYA 3N50A 5FYLH 1KEML 1G9NC 5HI4C 5K9JH 5D4QA 1G7HB 1PGRB 1VGKA 3WSQL 1INQA 1QSEA 1I85A 3WFZA 4JFDE 4DVRH 4YXLL 2H3NA 4JZJB 2BNQA 4MD0B 2P8LA 2ED8A 1ZA6A 1OM3L 3UYRL 4YDVA 2R2EA 4OIBA 1FBIL 4DEPB 5A2LH 4P46A 3IDIA 5IHUL 3U36A 2UWEE 3O0RH 2B5IC 1PKQB 4R4FL 4XHJC 4MD4B 1WAAE 4KZDH 3V8CA 4KUCF 1JPTH 3ARDC 1X5LA 4CADA 3DX8B 4E5XA 4LCCB 3O4LE 1T4KA 5I18L 4M7JL 4M7LT 2YXFA 1EGJA 1IGFH 1WEJL 1TETH 4RWHA 3CZJA 3W9EB 1IC1A 4ZS6D 1IT9L 2XA8H 5IF0A 2R23B 4ZFZB 3OR6A 3QZWA 4JHZA 5D2NA 3C5ZB 1NGYA 2F5BL 4LSSH 2Z93B 3UPCA 4O02L 5EZIL 1X44A 1KV3A 5A2FA 1PX3A 4JG0L 4U31A 5FYKE 2EDXA 4OJFH 3IFOA 4LLDA 1VHPA 3MRPA 1PQZA 2GUOB 2EE6A 1W72H 3HE7C 1C8PA 2F8VA 3JVGC 3GSVB 1A1NB 2NZIA 4HLJA 4JPVH 4ZO9A 5DC9B 2QQQA 2DKUA 4FQQB 1G7JA 5IEHB 3QIBA 3MJ7A 2YMXL 3DVFA 3OJVC 3MOAL 3HNSL 5E6IA 4DTGL 3QPXH 2NZ9C 4BZ1H 3C09C 2AXFB 2QHRL 1QP1A 4I13B 4OFYD 1IZKA 3AUVA 4XMLH 1GCFA 4IRSB 5GGVY 5HD8C 4A6YH 5IHZB 3EGSB 4LDLB 3T1WA 3NBNA 1U92A 3SGJA 2UZIH 4X9FA 1QFOA 1T1ZA 3OJDB 3V0VB 3RWJA 3BQUA 1FSKC 4M6NH 1E28A 2O5XH 2O93L 1P7QB 1JBJA 2J7LA 2GTZA 2B2XH 4J4PD 3L5WA 4OZGF 3UDWA 4WO4B 4OLVH 3S6CA 2FJHA 1A6AA 4YHLH 3G5VB 1GZPA 5KS9A 3T0BA 4PRDB 3P73B 1M7XA 3HE6B 1I7TA 1TDQA 3L6FB 4GRLA 4XMPH 4XBPB 4K3EL 5SWSB 1EBAA 4CNIA 4IRZL 2K9UA 4H8WL 4LSQL 4ZUSB 3VE0A 1LO3L 1OAZL 2EDRA 4N0RA 5IJVB 1XGYH 5EIVA 5C09D 1MFEL 4J2XA 3CPLB 2G9HA 1CWVA 1J87A 1LO2L 2YKLL 3BOVA 5JHDE 5F9WB 5FEBA 3GHEL 3AXLB 3EW3B 4JO3H 4KTDL 2RFXB 4NM8H 1WC7A 3ARBD 3HZKB 3NFNA 1S7UB 3GSOB 1Q0YH 2YN3A 1KELL 3CSGA 5DJCA 4CW1A 3LN5B 1TQCB 4FQJH 1AGCA 2NY4D 2Z92A 5HY9A 1F45A 4EI5C 3VFGH 1I8LC 1QA9B 1A5FL 1Z6JT 3GZKA 3EYQD 5I15H 3F6IA 4OZIA 3TCXA 3GI8H 3O2WH 4JFHE 4OQTA 5TDOA 4QXUH 1AP2B 4HKJA 4PJ8A 1AR1D 4TNWK 1BQLL 1N3NA 1YN7A 3D0LB 4M7ZB 4OKDA 4POZD 5EBMB 4AEEA 2G5BB 5IROC 4K94C 5CUSH 3VXNA 2MTPA 1WICA 5FA3A 1G6RB 3SE9L 4K23L 4FQHA 4HBCH 2Q6WB 3GHBH 4K3JL 3P9LB 2VDNH 4I0PA 5C0BD 5FUOL 3CNKA 2C5DC 3MV9D 4HAGA 4IOIA 5E2VL 5JHLL 1J8HE 2BVUA 2R9HD 1F42A 2YEZA 2Q8BH 5C0NC 3ABZA 4W6WB 2EO9A 5BVPL 4HIXL 5ID1A 5EWIH 5FGBC 2V5TA 4JM2F 5D2LF 4FFVC 2DI9A 2WANA 1ZMYA 4S10A 1HEZB 1OGTB 1N5AB 4RMSA 1E4KC 4QRPB 4FHBD 4Y89A 1EGJL 4V2CB 2APBA 2H2PD 1MJ8L 1NFDA 1EBPA 2HTLC 1JTOA 3QXTA 4UIKH 1T5WB 1X4ZA 3T0ED 3OBAA 3O6LL 3BT2H 2YA1A 4D0BA 3DURA 3VW3H 2CJUH 4YH6A 4HFWA 3QHFH 4LVOC 2OK0L 2EEBA 3HC0A 5ISZB 4PJCA 4W4OA 3KYMB 1LILA 3MYJB 4HUUB 4MWFA 1I1AB 1GGYA 3VFVB 5KW9L 4FTVA 3HMWL 1YY9C 3B83A 1K6QL 2VMFA 4KJWD 4LKCB 4TPRH 1CDJA 2DMKA 1B2WL 1CFVH 5BO1L 2DQTL 2RR3A 5IFAH 4MCYB 3Q6FB 4PJIE 4APQB 2P5WA 1IGCH 1R5IB 3EYOA 3WN5C 3WNLA 1KIRB 3MRGA 5ALBH 1P1ZA 1OTTD 1W0VB 2EXYC 2XY1A 1NDMA 2ZOLA 1IAIL 1RIHH 3L7EA 5INDA 4ZOBA 1OB1A 3WFHB 4Z0BH 1IAKA 2Y5TB 3Q5OA 3WKML 4KKAD 3L3DA 3WIFB 1DSFH 3ZT5A 5GGQL 3QCUH 4XCYA 4Y19E 1E4JA 3GDBA 1AE6H 1CLOL 4L3EA 1QUNA 4GAGL 3HAEH 5JW3H 5DRXB 3ESVF 1RHHB 2YSSB 2SEBA 3MBXH 1A7OH 1YNKL 3NCYP 4Z8FL 2X09A 2F5AH 4M93C 4OLZL 4DN4H 5D1ZB 5IESL 1D9KC 1CFQA 4HLZH 3SHSA 1ZGLB 5E24E 3BH8B 1LO4H 4KROB 4ZDHA 2ZZUT 4MS8D 3MA7A 3VFRA 3KYOB 4OF6A 1Z9OA 4XBGA 3WS6C 3I6GB 4G8GB 1RZ7L 1LP9E 5DF0A 3PNWB 2VDPL 4PJ9A 1I8IB 2DF3A 2V9QA 4KY1H 1P4IL 2GSIB 3GMQA 1HILA 4ODSL 1AGFB 2IADA 5DDHB 1I1FB 3LKSA 3C2AH 3M17B 1ETZB 3GB7A 4NKIL 4OSUL 1RZIA 2R2HB 4XMKL 4XNYH 1T2QL 2FL5B 1BAFH 2FEEL 2P8MA 3P40A 3DTXA 4LL9A 3DX7B 1OAXH 3WIHH 5JW5B 3P11H 1JWSA 2B8OT 4RFEA 3TT3L 1AHWB 5IK3B 4D9RD 3LQAC 3EJZC 3HB3C 4Y8DC 1KIPA 3CK0L 1RUML 1TJHL 5H35B 2BY3A 4NRZB 4YFDB 3BN9C 5IBLD 3OF6D 1XGPA 2B4CH 4G5ZL 1EHLL 5BQ7A 2DQFB 2XWJA 1M71B 3NACL 4A6YA 3GKWL 3UTQB 2YZ8A 3C6LD 3EYFA 2H8PB 3F7QA 3DNKA 2Q8AL 1J86A 5KSAB 4EDXA 1KLUA 5MEOB 5JIPA 2KPNA 2F8XC 4GXVH 5DUPL 5F1IB 1MJJA 2PXYC 3GMPB 3E0GA 4OQTL 2NW3B 1YEEL 2HVJB 4GH7B 4MA8L 2EE3A 3QULA 1TTGA 3H7BB 4HUXA 4OBSA 4L5FL 2VERN 3PQYE 4S2SB 1Q9KA 3S34L 1LE9A 3TFKD 3HPLB 2KBGA 1BVZA 2ITDB 1L9MA 3ULSB 3QCVH 1QYGH 4B50A 2P42B 2ZSVA 3CAFA 4Y4HC 2P24A 2ZWLT 5CHNA 3ZDZE 3O2DH 3QI9B 2ZJSL 1WBZA 3FQXA 4YHOL 4LQFL 3BUYA 3ZTJG 1MAMH 5GZOD 4PJFB 3IF1A 4ZAKB 1MHPH 4B5EA 3EDKA 3TN0B 3TBYB 2Z91A 1ZHLA 4GQ9H 3LV3A 4NSKA 4GG6F 4PJ5D 1KGCE 1A6ZA 2VLME 3QG7L 3SKOA 4L3CB 1CFNA 5IB2B 4XPAH 3DO7B 3C08H 4XGZB 4OV5B 3L5XL 2MWCA 4PRIB 1NCNA 3IDMB 4YK4C 3SDAD 4JVUA 1IGTB 3V6OC 2HJLB 2BERA 3KAAA 1J0JA 3H9YA 4J3TA 3QDMA 2X05A 1KJVA 4P9HL 3QUMA 1BZQK 4I9WD 5DSCA 4FZEH 1Z0NA 5HYQB 1H5BC 4FFZL 1W0WB 3BH9A 4XBEH 4P99A 5HGBA 2R4RH 1TITA 2R2BB 2OM5A 3TM6A 5C9KA 5FYLL 1N64L 2A74A 3ARGD 3QXDA 3AS3A 1EJOH 3M45A 3TT1L 4H26B 4QYOA 2GSGA 5GGVH 5F7NC 1YEHL 2ILLA 4X7TB 3KPPA 4LLMB 5CJ8A 1WCBA 4NN6C 4OZHB 3CFKB 3JBG7 4MQ7B 5TF0A 4QHUB 3IDNB 1UXSA 1BMGA 4DVRL 3CH1A 1DBAH 1S9KC 2IAMA 1XF5A 1N0XL 3P4MA 3GBLA 3VG0H 1T04B 3VA2C 1RSFA 2VAJA 4KJPD 2X70B 3BDYH 3SKUD 3D69A 4N8VG 3G5YA 2X44D 3FN0H 3O9WD 4KZDL 4JQXA 3Q0HA 4JFEE 2EECA 1JIBA 1JPTL 2NYYD 3PIQA 4MQSB 1MCFA 2B1AH 4L8BA 1NBYA 3KPOA 4NZRH 1P2CB 3MV11 1PEWA 1CLZH 3U6RB 3V4UL 4MQ7A 1N59B 1S9VB 4N0YL 1ZTXH 4P5TA 2NLJA 1TETL 3MLSL 4PRHD 4K7PY 4I3GA 5I6XC 2APVA 1CD9B 3BHBB 1T66C 2ADFH 2DTSA 3GO1H 1UCTA 1IEAB 1LDPL 4UQ3B 4F15C 4HIEB 2WBJD 5JORA 2HVKA 1JUFB 1YQ2A 2HFGL 3IB4A 4KKCC 4ZFOB 3PUCA 4JB9L 1FZMB 1AIFA 5BZWB 1W0YT 3RUGB 2ZUTA 3U4EB 4AH2A 4HXBH 4TUOA 1OL0A 3VJ6B 1U93B 5ENWA 4ZXBC 3ZE0E 4DAGL 5BS0E 3VXRA 1QSFE 2VXTH 5E6ZA 3QDHA 1MHCB 5D7LB 2VJXA 3WO3B 2AV7A 3UTTA 2FIRT 1TCRB 1NGXA 4LCIH 5F9OH 1MRCH 2WAHA 3GMNA 1BJ8A 1F3DH 1FVEA 3DV6B 4EQ3A 1A7QL 3NN8A 1PJ9A 3RDTB 5E9DD 1X7QB 3HC4L 2E7LC 5I66A 4FXLA 4C58B 1B90A 3UTSB 3FO1A 3QPXL 1TENA 1YYLH 5D1QB 2PKDA 2E27H 3IYLW 2YWYA 4NRXA 3RRQA 3K7UA 3UBXB 4A6YL 5GS0L 3T09A 4TNVF 4V1DD 1IMHC 3DOSA 3MGTB 3QWRD 4CUCA 4CN1A 3HAEA 4HPYH 5CZVL 2EIBA 3KGRA 3LRGA 4W70A 4EI6A 3UJJL 1CLYH 5IKCB 4LPTA 3JSSA 4G6KL 2O5XL 5I1AA 1RPQA 5FB8B 5CD3A 4N90E 5DD1L 1FFNB 4KI1A 4DGVL 1DCLA 2IAND 4KZEH 2IPKA 1CFBA 1U2CA 1S9YB 5C6WH 4YHLL 1KTKE 3VXSA 4ISVB 4X4ZA 1DFBH 4WW2C 5FM4A 1FN4B 1S7QB 3V5KA 2WINB 3CFIC 4X6CF 3VFSB 3ZE2E 2X4QB 5EZLB 5EO9A 3VRJB 4XMPL 3S37H 3VDCA 4FG6D 3HMXH 1UA6H 5IOPA 2FATH 4HCRA 5HYJA 3HI6H 4QTHB 5L2KD 4NNPH 3EO0A 2Z31C 4C56A 3V8OA 4N5EC 5ICYB 1ZV5A 3JTTB 3RTQC 3R0MA 2YN5A 4PJ7B 4PJAA 5IFHL 5GSRA 5CEXA 5BV7B 4PGEB 3LHPH 3S35X 4JRWA 1JYVA 2Y7QB 1CE1H 4NKOB 1IC7L 3V7AG 1IAOA 3QUML 4J1UB 1UH2A 4HFUH 4JO3L 4KK6C 4NM8L 1LEKA 5B3NA 4N0FA 5BXFB 2WIIA 4X8JA 2QADC 1BZ7B 3GUTA 2JB5L 2VZVA 1A7RL 1S7VB 4OCYH 4BQ9A 1NC2D 2XV6B 1S7TB 4QTIH 2EDWA 3C60C 3MTRA 4RNRA 2BY1A 1DBML 3TCLA 1UB6A 1NGWB 3TIDB 1T1XA 3O6KH 3VFGL 4MXVE 1O7VA 3QFDA 4QOKE 3PHSA 4F80A 2B1HH 1DQDL 2BNRE 2O5YH 3RWHA 1TZHB 3GI8L 4XNXH 1XH3A 3LPWA 1CL7L 2HKFH 3L7FA 4O51A 4CU8A 1VADA 3IXAA 1LEGB 4WVRA 5EOTA 1TVHA 4FABH 5I1CH 5F1OB 4PJBB 3VDAA 3VFWB 5CUSL 4DGIH 5FUZL 9CGTA 4E0RB 2DLFH 4RGND 3WJJA 3ARDB 2BSSB 5DFVC 3IJHB 1JGLL 1SHMA 2BOBA 5CJXA 3NTCL 3ILPB 1NEZB 2ADGB 5D71H 3TO2B 5A2JH 2HH0L 4KGLA 5FO8A 5E4IA 4BSJA 5DUBB 4JEGB 2NY1C 3D48R 1FZKB 1JPFA 1UC6A 4CN4A 3QNZA 3ARYA 2WWMC 1I1CA 1F11B 2FRGP 3MJ6A 5CILL 5EWIL 4GBXB 3EOAB 2EKSA 3MZGB 3PL6D 4MNQD 3VXME 2LE9A 1DANU 3T2NH 4NQDA 1N6VA 2GFBB 3W0WD 4F7MB 4MA7L 2PO6B 3D18A 4XCCL 4P2QE 1NBVH 4BJLA 1JYXA 3S88L 5D7IB 1JGDB 4OT1H 5DVOA 4JRYB 3SJVE 1Y0LB 1Q8MA 3VW3L 1IC4H 1GPOH 1WUNT 4RBPK 4NJAH 3B9KC 4LKXB 5LAXB 5DJXA 4X5XA 1VFMA 3K80A 4E42B 4WDIB 5BZDA 4MAYA 1AH1A 5F8QC 4KHXH 3RKPA 1CIUA 5CEYB 2YD1A 4MA1B 5EU7E 1RAMA 1OLLA 3CLEL 4HJJL 4YEEA 3VH8B 1G7PA 5F7MC 5I71C 3VWKD 1XCTA 4LSTH 1CI5A 4ZO8A 3JXAA 4M9PA 5EU4B 5TDNB 4G9FA 5JXEA 4Y5YC 5GGRA 1HXMB 1JHKL 4JKKA 5E8EA 1J1PH 4S1SH 4YHZH 1CDCA 1FSKB 3KJ6H 2CRMA 3EJYC 4FQ2L 1NLBH 3HE7A 1EHAA 3LKRB 3JVGA 4PLOB 4U3XA 4YE4H 1K2DA 1KLFA 3K3QA 3GSXB 3DMMC 3BXNB 2NY2C 3FL7A 1MRFL 5E4EB 1UACL 2WQRA 3NH7H 2EH7L 5I75B 1FZOB 5E7BA 4DN4L 2F5AL 4IS6B 4HJGB 3FFCE 2H9GB 1LO4L 2BSRA 4NQEA 3QRGH 1MI5D 1MIEH 4JO2H 1BWWA 4ZTOH 3G6JA 1CVSC 2F58L 1JWUB 4Z77A 4DQOL 1VB9A 1B4RA 1IBGL 3QNXA 1OT1A 4LP5A 4QLRA 1PZ5A 5FGCE 4GAFB 1MCBA 3WNOA 3ULUD 2C3VB 1I4FA 4YHYB 5J12C 1FP5A 4D0DA 4HCRL 4LDEB 4M62L 3SGKC 4S1DD 1H3WM 1IVLA 1BREA 4X6DB 3T0DA 4N8CH 4ENEC 5J1AB 5FKPA 2OL3B 5D7JC 2BNUB 3MUY1 4L29A 5C0CD 2VR4A 1MRDL 1QBBA 2C3GA 1DANT 4LHUD 5DJZA 4ODTH 4X98A 3TJEH 4OGAC 4RAHA 3U0PB 3IAGC 2CMRH 3SO3B 1OP3K 1OSZB 2DQCL 3QG6B 3QRFM 3RQ3A 5J11C 3L3KA 1KT2B 1VDGA 1ZVHA 5JTWA 3ZTNH 1HH6A 5IMKA 1PYWB 4QRRA 4JCMA 1MCPH 3TYFB 3MO1A 1VGEL 2HRLA 3S96A 2PW2A 3GRWH 2P5EA 2VISB 4FRWA 2QQNL 1Q94A 4D8PA 1PBYA 4LLWB 4ZMAT 4NC0B 3OGCA 4AQ1B 4ZQKA 1P7KB 1Z2KA 3TVMD 3D9AH 2BVPA 3AU1B 3QA3A 4P2YA 2DM3A 4TNVK 4K7PH 4PJEE 2CK0H 4Y2DC 1QYGL 4WY7L 2MNUA 3REVB 1KTDA 4JFDB 2ZCHH 4EI5A 5C0RH 1G9NL 3O6FC 2F54A 4NZDA 5J06A 1U8PB 4X4XB 3LKQB 1MHPL 3HMXA 1JNNH 4GQ9L 1I9JL 4UDTA 2VL4A 3HR5A 3O11B 4MNHA 4AIZB 5DEGA 1XEDA 5IROA 5E0QA 1EEYA 2UWEB 3C08L 4L8DB 4LF3B 1P4LA 3H9SD 4NWUL 3QUYB 3HUJA 4ELMF 1K8DB 5CSZB 2FECI 4PG2A 5HHNA 3RFZC 1F4WH 1C08A 4PB0H 1VFOA 3O4LB 5KVMC 5GS1C 4FZEL 4U6VL 1QEWB 1QRND 2I60H 4HKXB 3F7VA 4WEBH 3JWNC 3FT3A 2ICWB 5J6GB 4MA3A 5JDSB 5KZCB 2JB6B 3ZTJH 2IBZY 1FJ1B 2I26N 1E4KA 3WN5B 3KPRD 4FP8L 4XB7A 1D5XA 1M05B 5FA4A 3IRZA 2FWOB 5ESQA 2OBGA 4UQ2B 5HDQH 1DBAL 1UXWA 2GJ6D 2ARJA 5F21B 1FVCB 5INCA 4WU7A 4RZCA 5D96C 2DLGA 1WAAA 1AO7A 1XAUA 2GAZA 4X99A 3RWGA 1A8JH 3SDDC 2AJSH 3AAZB 2V5YA 1ZHBB 3PF2A 3QAZC 5EUOE 4YEFA 4XWGL 3BDYL 4ZD3H 2GK2A 2HMIC 1OW0C 4YAQA 3CDGA 1A22B 3FN0L 3JV6A 3QEHA 2NQCA 2L0DA 4KMTH 4LCUA 3VMNA 4HZLB 3MA9H 1FNEB 4U05A 3KDMB 4M1DH 5EU7C 4R90L 3GMLA 2AJYL 2PR4H 3D85B 4PJHF 3R06A 5T3ZL 4PP2A 3DXAD 4Y16A 3CGTA 3ARXA 3DUUA 4G80B 4JO4L 2Z8VC 3PGFH 3CVIH 4NRYA 3QPQD 2ZG3A 2B4CC 3GO1L 2ADFL 3BZFB 3LEYH 3WNMA 3FTGB 1X4YA 2DLEA 2AV1B 4DZ8A 2HJFA 5I8KH 1G7QA 1UM6H 5IR1B 1CXIA 4ORGA 2NTFB 5GGUB 5CIPH 4HXBL 1OF2A 1E27B 3IDJA 1GGBL 2X4RB 5B8CB 5LGJB 3W5NA 1UJ3C 1BFVH 4EVNB 1D9KA 1QQDB 3GSUA 1MOEA 1TIUA 3WFCH 1PY4A 1JHLH 3P0YL 3QEUA 5C0GB 4X5WA 4L4VE 2CO7B 4Y1AA 4H88H 2VSDA 5I19H 3WS6A 2WSKA 2Y06L 5HYFA 5F9OL 4LCIL 3BP4A 2M2DA 4PRNB 1AC0A 2PCPA 5LKNA 4FQCH 4WJ5B 4QHLB 3CCHA 4ELKA 3F58H 4WUUD 5DD3H 1TPXC 3WL9A 5EO0B 5H8DA 2Y23A 5F6IC 2YPLE 1RURH 2EIEA 4C59B 5D5ME 4JKWA 4I3SH 5J89A 3TZVD 4O58H 1B0WA 3SE3C 4PPTA 3D3VE 4HPYL 2A9NH 3CSYB 3SDXA 4K8RH 1B6UA 1K4CB 3SGEI 4R2GC 4OCMC 3W2DL 5JOPE 4UT9H 3DETC 4ZUUB 2YC1B 4RAVA 1BJ1J 4ODWA 4WFHE 3ME0A 4KK8D 2K7PA 3GJFA 1CICA 4Y5VC 4ZYKB 4MJIA 2FJFA 2CQVA 1DFBL 4H1LA 1R3LA 2NY7H 4NO0D 1RZ8A 2XNAB 2NY5C 4RMQA 5C86A 4Z7WF 1DTUA 2PXYA 3S37L 4CMHB 4I0CC 3HMXL 3BJLA 4QHKJ 1UA6L 1QFWI 2NR6C 3HC3H 1N2RB 3BPCB 2FATL 4GKSA 5JHDA 3MLRH 4NNPL 1DUZA 1Q72L 4JFXA 3QIUA 3VGGA 1OGAB 4XXDA 1H5BB 1OTSC 5KSVA 4YDIH 3ARQA 1C5DB 1J8HB 1DVFD 2EXWC 3CFDA 3FQWA 4Y4HA 5ACMA 1J8KA 5C71A 1YMMA 5EU3B 1MNUL 5EOCH 4H20L 3EYSH 1VA9A 4XNMA 2R0LH 5GGTH 3QWOB 5CINH 4OCYL 1MCQA 3T3PF 3QUZC 4GXUN 4QXWA 4ETQB 3ROLA 1CU4L 1LO0H 5TE4H 3GMMA 2X9WA 1EIBA 2CDEB 2O5YL 3V6OA 3GRWA 2E9JA 1BPVA 2ESVE 4NM4L 2R0WL 5MI0B 1A14H 4R26L 1WFOA 4NGHH 4NZJA 1FO0A 4P5KB 5M7QA 1JE6A 2KQNA 1RZKH 2CDGA 4N0CC 3S4SG 4GXUM 1GVIA 1M7DB 4LIQE 1KNOB 4X0KB 4U1HA 1CXHA 1QSED 3MRLB 5EOQL 4RBPH 5D71L 5DJ8B 2BNQD 1XGQA 4P2RE 5J1SC 4ZPVB 1T1YA 3WUWG 5I1KL 3IDGA 1EVUA 4S1RH 3H9HA 3OKMA 2E5EA 2Y6SD 2FGWL 4F15B 3BP6A 3BVNA 3T2NL 5ILTH 1FH5H 3P4OB 1U91A 3X3FL 5DS8B 1PLGL 1NUNB 3L3IB 3BGFC 2GT9A 4OT1L 1O7SA 1EAPB 2XT1B 4TUJA 2OXGA 3WUZA 1CFSA 1FDLH 5DJAB 3I50L 4TRPH 5F7HA 5IW6B 3QDJE 1U8QA 3VD9A 5LWYL 4PJIA 4OIAA 2DWEB 4ZS7L 5JR1H 1FFRA 2ZCKH 4G8IA 2UZXB 3MRFA 1SYSB 4KXZI 4TSCH 5FIEA 3PWLB 1LP9B 3ARFB 4G6JL 1Y6NR 5T1KB 4OM1H 3V5HA 4MQTB 1AGEA 1FNFA 5K9KA 5IV2B 3TPUB 4LSTL 1BIIA 1FL5A 1N6QH 4PV8A 4Y19A 15C8L 3B2UD 1IEBB 4Y4FC 2DLIA 5HGDA 1OCWL 4Q9RH 5DMGC 5EB9A 2CLRB 2V7HA 4ZXBA 3LY6A 1QFHA 3QDGE 4O4YH 1J1PL 5HGAB 1FAKT 4K2UL 3KJ6L 2A1WL 1A6WL 1NLBL 2EDFA 4OZGE 1JN6B 3OKEB 1KIQA 5HHPB 3CXDL 3QIBD 2H6PB 3WV0A 4P4KC 1A4KB 1RU9H 4YDKH 3VFNB 4R0LC 5LCVH 3GSRB 1XF1A 3CX5J 2UUDK 1BQUA 2HTKD 1A3QA 4WW2B 1GSMA 5E6ID 1F4XL 3NH7L 4X7SH 5F97E 5H94A 2E7LA 1M1SA 1QBMH 3G5ZA 1KUMA 4QT5A 4I8DA 5GRUH 3BEVA 4G3YL 1T20A 1KJ2A 4J23A 1B4JH 1A7PL 1KN4H 1MIEL 4F33A 1OP3H 5D72L 3MRQA 2DM4A 1FYTE 5IQ7L 4ZTOL 2AXHA 4P57A 4NO3B 3L3HA 1JYNA 3BQUD 3EYVB 3PQYB 4HWZA 5CIPA 3LOWA 3RNKA 1CGUA 4BSVA 4FNLL 5CAYB 2FO4B 2C7UA 4HWNA 2FZ3A 4EN3B 2LVCA 3FQUB 1A7NH 3MUGA 3GJEA 1EO8H 4RGMB 3RWFA 3RGVA 4AM0A 1QFWM 4N8CL 1KIUA 2DTML 4PGBA 1ND0A 3I2CH 4GRLD 5CD5C 2Z4QB 3BESR 3UO1H 3B5TA 2EC9T 2A6DA 4M3KB 1I9IH 4HKZB 2CMRL 4HKBA 2KH2B 1CYGA 2I07B 2UVEA 4PTTB 3S3JA 4EXPX 3DVNB 3LSOA 5JPNA 3B2VH 1T6WA 2WNGA 2Z31A 4UTAL 1G9ML 4FQ1H 2P47B 3E6HA 1P7QD 1NCDL 1MCPL 4GW1B 5BJTB 2PYFA 3RTQA 5F3BB 1DEDA 1KLGB 5IB1B 2DYPB 5GRVK 3T2QA 3WHXA 3GRWL 5T3XE 3C8DA 4XAKD 5C08E 1FC1A 4I48B 3FQRB 2BOCB 3MJ9H 3L5IA 4XNQA 5IM7A 2QJDA 2DIJA 2BVQB 3VFUB 1FORL 1I1RA 3KS0J 1F6AB 3HE6D 1FO0L 5KTEH 2NNAA 3KNBA 3RVWC 2NY1B 3CFCH 4NKMA 2OSLB 3HG1A 2A38A 5ERWB 2CK0L 2AK4A 2Z35B 2XFXB 3C60A 5C7XH 1ADQH 4F58L 5D2LE 4G8EB 1W72B 3LRSB 3SBWC 1FL3B 3ZZ1A 3PDGA 3TO4C 3I6LE 4CVXA 2VITB 4MMXC 2EIZA 4PJ8D 3RVTC 4QHMA 5HI5D 2X4TA 4HC1A 2ZCLH 1BIHA 1JNNL 4OB5L 4JR9H 2JIXA 4TTGA 5KANI 2HFTA 4JFFE 5FV1L 4U0RC 2FH6A 2Y4SA 2VDMH 4OFDA 3MC0A 4I0PD 5CEZL 5DEFB 2IH3B 4GAYA 2DKSA 3VGAC 4H0HB 4PJDA 1F4WL 1OAYH 3BKYL 4JFEB 2CKBB 1R3IH 4PB0L 4ONHB 4OCXH 1ITBB 3B9KB 3MRNB 5JA9A 1C16B 1DR9A 2VR9A 1R3HA 5GGSB 4J3WA 5GGTA 5DURB 3MV7E 3BW9A 4UAOC 2BRRH 5SWZA 1JGEB 5D1XB 4G7YH 4OKVB 3B9AA 4R7NA 1QR4A 2DQHL 2DL2A 5DMIH 5C0JB 5I1DA 2EE9A 4Q2ZA 2P4AB 5GJTH 3U4AA 4ZPTB 5JPMA 4L4JA 4NPYB 1MWAH 1NMCB 3WMSA 4X4YB 1ZANH 4X80L 5JW4Q 2BXYA 2GW5A 4UINH 3FB8A 4Y5YB 3ES6A 1LEIA 4W81A 3DSFL 4TSAH 4Z5RB 3MRIB 1FNSH 2NY6B 2X10A 4QXGH 3RY4A 2AJSL 5BS0B 1I3RA 2DQIL 1RIUH 4FTVD 4RGOL 4A2LA 1QSFB 4ZTPH 3X14B 3EFFA 3AREB 4GLRH 5GISH 1FGVH 5JDJA 1ZVSB 3A67L 3U1SH 1QNZH 3DMMB 2VB5A 3FRPG 3ZKXC 5F7EL 4L1HA 3S5LA 3QNYA 2VR5A 2P5WD 2XQYG 3MRMA 3MA9L 4PRAA 3QXWA 4U3CA 5F89B 4QRSA 5K9OB 4M1DL 5E00A 3LEXB 2XPGA 4HX1B 3KLHD 4WV1C 4UU9B 2XZZA 3KYNB 1D5ZB 2DM7A 1QTYT 5LGHH 4LCWE 2XXCB 4TSBL 3CVIL 1JRHI 2R69H 2D7NA 3MV01 4JFPA 1E0OB 1KJ2L 3HNTL 3HFML 1ZSDA 5I1HL 1DE4A 4NQCE 1I1AD 3JV5A 4L3ED 4LU5H 3IVKA 4H25B 4X6DF 2Y9RT 2CKNA 3VXOA 4KDTA 4WU5A 5I76A 5I8KL 3MR9B 1UCBL 3W82A 3G9AB 2VQ1A 5DTFA 3PWJB 2A6KB 1ZHKB 5E8NB 1YNLH 4KWUA 3U79A 1OAKH 1DJSA 3NCMA 5DK0B 3MZTA 3MMEB 4Z78A 4ODHL 3RI5F 1VKXB 3KPLA 32C2B 5I19L 3CZFB 4KKLD 4GG8A 4RFOH 2DOCA 1H8NA 3PE9A 5AZEH 3L3OB 3REWA 5IB5A 2PYEA 3KYNA 4L9LA 4ONFH 3GSNH 1FZJB 1ZEAH 1FVDA 1VACA 3HZVB 4LOUD 4H0IA 4FQCL 2BHYA 5CJQH 2VQUA 5ESVA 5F1NA 5D6DC 1IM9B 2B0SH 3SGKA 4HWBH 1MAJA 1RURL 6FABH 3IU4H 3RA7L 4AJ0A 4XP1H 5E2TH 4I3SL 2AJUL 3FHAA 4O58L 1ZGLP 3HI5L 2ORBH 3V5DB 1BEYL 3ZDYF 5D7JA 3RHWF 4LHUG 4HS6A 2OZ4H 4P3CL 4Y2DB 3BD3A 2QKIB 4UT9L 1AD0B 1VEOA 1T0NA 1T80A 2DIAA 4GG6E 3QUKB 4QOKB 3MLUH 3UZVB 5GS0D 1U8OA 2BNRB 3BPNB 5EC1B 4HG4J 5F7LB 2E9BA 4FXKB 1SY6A 2DIBA 1MELA 2A2QT 1V3KA 4K07A 1FV1B 3RU8L 3RWDB 1HZHL 4HW6A 2FX9H 4HF5H 3HC3L 3CFJA 4MJ4A 3TA3C 3RL2A 2V5MA 4JE4B 1VFAA 3O3EA 3DRTA 4QHKI 1QZ1A 1F4YL 2WP3O 4GRMB 1FNGA 2O61A 3QB7C 5GS1B 2WUBL 4Z7NF 3T0WA 4YDIL 4PJGA 5IMOA 4D0CB 4IEFB 2PTTA 3FT2B 4XPHL 1B0RA 3O6FA 5I0DA 4JM2C 3SQOL 3HLAB 4FQPA 5EOCL 5JZ7C 1NQBA 1JWMB 5DD6A 3QIWC 5B38G 4LVHC 2R0LL 3TJHC 5GGTL 3T4YA 1AGDB 2AKRB 1AXTL 3L1OH 4NJ9H 1T5XA 4RIRB 4JKMA 2E9IA 1YDPA 5FDWB 5KN5A 1Y6KR 2H1PH 2NW2A 1W8OA 3K4DA 1LK3H 5TE4L 3T0XA 3KG5A 4P2QB 5D96B 3FN3A 2D0FA 3QDMD 3SDDB 3NMEA 1HI6B 3QAZB 3G04B 1U58A 4M6OH 1A14L 25C8H 4IRJC 4J4PA 1ZXQA 4XVTH 1A6TA 3QI9D 5ID0B 4XC1H 4OV6F 1H8SA 2VO5A 1X4XA 3GSWA 2VLKA 4ZAKD 1CE6A 1RZKL 2L7UA 3TN0D 3VMPA 1OARH 1ADQA 5TQ0H 3TNNA 5DFWH 2E8ZA 3T4AA 1RK0A 5IG7B 2PN5A 5GS2D 2JJSA 3VXMA 4XVSL 1IQDB 2YD2A 1DBBL 5C0DB 3C5JB 5T5NG 2NMSA 4JZNA 3MLXH 3SGDH 4X6EA 2IAMD 4CMMB 4UZGA 4MQXD 3U30B 3TLRA 3GIZH 1TZIA 4GW5B 4S1RL 4QGTA 3CXHK 3I6KB 4WTWA 5GRZA 3SY0B 3BFOA 3SJVA 5C8JA 3OKKB 1S7SB 2EDYA 4BKLB 5DA0B 5DJDA 3K4ZA 4LSUH 1OW0A 2MQ3A 4JPWH 5B39B 2AJZA 4ZSOE 2HFEA 2XQBH 2O5ZL 3G5XA 5D8JH 3G6DL 3RAJL 1H0DB 4GKZA 1OHQA 1FDLL 2X5PA 4HPOH 1DQMH 1UQSA 5DRWA 3FFCB 2OI9C 3TNMA 4P5TD 4BH7B 4P5MB 1IL1A 2ZCKL 4XCNB 1IQWH 4PP1C 2WLYA 2QQLH 4XC3H 4QY8B 4AEHH 1F4AA 1WBXB 3X11B 3B4NA 1KFAH 4NO2B 2V7NB 2UUDH 1U3ZA 4ZFFB 4HHAA 1H3VA 1X5AA 2NY0B 5FFLA 4PLJC 5AAMA 2QHLA 2XZAH 3OJ2C 1YEFH 4M7LH 3WNNA 3OJMB 4J6RH 4XZUA 1RUAH 2J3SA 4KGJA 2GTWB 5FGCB 1XZ0A 1AD9A 1KF9B 4NC1E 4ALAL 4HBQA 2VSCA 2BVOA 3BP7B 4XI5C 2H26B 3MV9A 2VDKL 3S98A 3VXRD 4Q9RL 4LDOB 3MLWL 3ZKSD 1UJ3A 5DMYA 5F9AC 4O4YL 4R2GB 4N5UA 3UTTD 5F7UA 1NJ9B 4KQ3H 4MX7A 3VXUE 1RJZA 2VN7A 2R1XB 5DQDH 1FPTH 4R4BA 5JUEH 1ROWA 1B88A 4L8SC 4Z6AT 1RU9L 4Q58C 2D7QA 3KXFA 2DQEL 3QEGL 5LCVL 3OKDA 4L3AA 3O8XC 3VA6A 3X3GL 1HOCA 2BJMH 4X6CE 1EMTH 5B4MD 4Z76A 1IGJB 2IWGA 2A9ML 2J8UA 4PRPA 2B7DT 2GJZA 4UV4H 3WEXA 1MFBL 3MNVA 3FB5A 3ULVC 5GRUL 3T0EA 4YHKH 1KN4L 4LSDA 1PDKA 2W92A 4KAQH 4CVWA 3K2UH 4IJ3C 1SY6L 1CT8A 5ETUB 1UKTA 3NIGF 5HSFA 3SE3A 1T7WA 5FK9A 3FB6B 2JCCB 4J3SA 1NC4A 2RCSL 1OPGH 5D7LD 3GM8A 4ETYA 1A2YA 3H0TB 1HKLL 4JRXA 2ADJB 5CJ5A 3JWDC 4XP9H 3ZKMD 3FB7B 3RDTD 2E6QA 3O6ML 1VFBA 4Y5VA 1NANI 4CVZA 4Z7UA 1MQKL 3OKLB 5ICZB 1ZHNB 4U6HB 4M43H 4OLYH 2VDOL 4JFOA 1S7XA 3C9NB 5D1QD 3UO1L 3X12B 1WZLA 2ZKHL 1ZVYA 5I16A 1WJ3A 2W9EH 3N9GH 3W9DB 3QH3A 5I0ZA 3RI5K 1XGRB 4TVPL 3TWCL 4C56D 4HWBA 1RVFL 5DZNA 1HSBA 4WHTA 1TJGH 1J0KA 3B2VL 1WBYA 4IOFD 4JPIB 2HP4A 3SPVB 4ZNEE 4XCEB 1YC8A 2BCKB 4LLQA 4PJEA 3UYPA 3PHOA 3MRDB 5HDBF 5I2IB 5HHXL 4KDVA 3KPNA 5JQ6H 1BBJA 3K8KA 2HFFB 3NCJL 2CSPA 2X89D 2GIYA 4OCWH 5GRJH 5KTEL 3QUZA 3P9MB 5C0BE 1ADQL 1RUQL 3RHWK 3QUXC 3LKOA 1KPVB 2VZUA 3D39A 1GIGL 1I7ZA 4JY6B 5CJOL 1KB5A 3ARZA 5CCKL 4LSPL 4JR9L 3TIEB 3FO9A 2F8OA 5HHOB 4GSDH 2CIIA 3VMOA 2DAVA 1PKOA 1PG7H 4OZIF 4KQ4H 5ANME 3B9VA 4F3FA 4MNGE 2VDML 1R0AH 4Z7VA 4Y4KB 3VFMB 3B9DA 1OAYL 2XTLA 1YUHA 1IM3B 4XP4H 5J6HA 1U8HB 4JJ5B 4X6BB 3CD4A 3DRQB 4WFFD 5FO7B 4UILL 2D31B 3OZ9L 1W2KT 2BRRL 4HIHB 1I8MA 5IBUG 4KH2A 1UEMA 3BZ4A 3QBTB 3K74B 2XRAH 1XCQA 3GGWB 1FL6B 3PGDA 3IETA 5JA8B 1CXKA 4NC2B 5GJTL 5DRZB 4XHJD 4QEGA 5EUOA 4HEME 4MZ2A 2XN9E 5DK3A 5GIRB 3LMJL 1EAJA 4RQQB 3VXTB 4NP4H 1J1OL 1BVLB 1XGUA 3V4VL 3D0VA 4O2FB 4PY8J 2W65B 4BFEA 1G7IB 1T0MB 2WIMA 2J5LB 3SDCB 3E6FB 2YOCA 4QXGL 4WI6A 4F9PA 4PTUA 4PGCA 1BLNA 1AFVH 4XAWH 4ZTPL 1HCVA 5FCUL 1YMHB 4OD2B 4LARH 5J0BA 4L4VB 4F57L 1FGVL 5I73B 1NGQH 3U1SL 5HJ3A 5EBGA 3ZDXF 3SCMB 2N4IA 3LN9A 4NBYB 3PGCB 3S37X 4F2MA 2AAVA 3CFEA 4PJCF 4OIIH 3QZWG 4BH8A 5T1MB 3RWEA 2AJ3B 2ARWA 2DLTA 4Q7DA 4PB9L 3R0NA 2CLVB 1NL0H 2GKIA 3BAEH 4G9FD 2LAAA 1KEGL 2YPLB 3MRHA 5LGHL 5IFJB 1I7UB 4Y4FA 2ZOKA 2DBLH 2DD8H 4DVBA 1J10A 5D5MB 2R69L 3NCYS 3HE7D 2VL5A 4N1CA 3D3VB 4J3UA 1J05A 1NFKA 1IKFH 1E6OH 4LU5L 3KWWB 4W6XB 2XOTA 3MFFB 4OTXH 3ARGA 4KRNA 4P4KA 3STZB 5T3ZD 4R0LA 4U1KB 5KVEH 5F44A 2OR8A 2D7MA 4M8QB 5LG1A 5EPMA 5DYOB 2MHAB 3MLTA 5DHYA 2NZ9D 1JPGB 4NQED 1H9VA 2VAAB 4WENB 2DLHA 5HD8D 3V52H 2R56L 3VFOA 4AT6A 4UIMB 1RUPL 4OFIA 4D9RE 1ACZA 4B41A 3WFBH 3CVHA 2IFFL 3PDOA 43C9A 4GAJH 2NY5L 5IB4A 5KSUB 3V0AC 5D6CA 5MERB 1EZVY 1C12A 1KPRA 4K3DL 3LS4H 1JF5A 3FCTA 4HWBL 4JFZH 5J3HC 4BUGA 4L8CB 2IH1A 5F70A 6FABL 5I8CB 5EN2A 4LCYA 5TFSL 5BRZA 4JPKL 5IJKA 1D5BB 4JDTH 4ONOA 2P48B 3I9GH 1SJHA 4JZJC 5IW1B 3U9UA 4KPHL 1SEBA 5IMLB 3BRFA 1F58L 3DIFB 3WDIA 5CWSA 4DEPC 4N0UE 1KN2L 2FJGB 4Q6YA 2P8PB 4QRRD 1X5JA 4PY7B 4I2XE 2FD6L 2Q7NA 4DGYL 2E9WA 2ESVB 4JDZA 3L3GA 1XF4A 1EFXA 5M94B 4ELME 4TULH 2P5ED 3H3BC 3QEQA 4ZNCD 5DK2A 3SN6N 2EDOA 5IBTH 1SQ2N 3JV4A 4FS0A 1N8ZB 4U1LB 1PG7W 3ULUH 1KB5L 4PJ5E 3P4LA 4LAQH 2DQGH 3LZFH 4YXHH 4HF5L 3MRRB 5C0FB 4XT1C 1QFPA 4L4TB 3VRIB 4HV8A 2MFNA 3CH8A 3V6ZB 4EI5D 5E94B 1HYRC 4QXTB 4UAOB 2F54D 4P2RB 3SBWA 3TO4A 4D3CH 3TYGL 4I9WE 3C5ZC 4FOMA 3O3DA 1SVZA 5J56B 4J8RA 1INEH 4WHYG 1NSNL 1HQRA 2PTUA 1K85A 1QLRA 1ORSB 3CMGA 1FFOA 1X6LA 3OKNA 5E5UB 2MKWA 3OX8B 4U0QB 4UNUA 4DFHA 3QWRA 1LK3L 3EYUH 1R3JA 4PJXA 1KJMB 2BRQA 2NX5A 1BJMA 1NH6A 5C0ND 5HYEA 3QDJB 4JN1L 2YPKB 1A21A 4XNUL 3QJFA 25C8L 4JFDD 5C07A 1DQQA 3RWCA 4XVTL 2IANA 4OZ4B 1HQ4B 5BW7C 2HT3C 3NZ8B 3ZKXB 3UCRA 2C3HA 1HWHB 5T1LB 4FFVD 4O2CB 4U1NB 3RPKA 4E41B 1WZ1H 4PJHE 1MUJB 1QVOB 1R5VA 4U1SB 1ITCA 3KYKH 3JUZA 4NWTH 4D2NA 4JHWH 5ITBL 2HTLD 4JY5H 2IQ9L 3LDBC 1T83C 2ICWJ 4MMZC 2RGSA 1DQLL 1CXLA 5JMRA 1BFOA 3E2HC 4M6MH 2EDNA 3U9PH 5DQ9B 4G42A 1MVUB 3QDGB 1U8KA 3MROA 3QP3A 3RKDC 4U6XA 3QQ4A 1YY9D 4WO4C 3G6AB 4OZGB 4BELD 1TTFA 4OUUB 4YBQC 1JZ2A 3VXQB 1YEGH 4MJ6B 3LAFA 2FECL 3IDXH 4XVJL 1CDBA 1K8IB 2WQ8A 3DV4B 3FFDB 4P3WA 3OR7A 3THMH 1RFDH 4HPOL 5F7YC 1YY8B 5F7WC 4P4RB 1P6AB 2EXYD 3A6CL 4WV1A 4LSRH 1TNNA 1IQWL 2GCYB 2QQLL 3T77A 1U3HC 3TBVB 4AEHL 5KVFH 1R5WB 1NCWH 4KJYB 1EPFA 3BIAX 1A9EB 3DLQR 1FYTB 2OP4H 1B0GB 3RIFF 1O5DT 5C2BL 3H2WA 1WV7T 3FONA 1YEFL 3D6GA 4OZFA 1XIWB 3CX2A 1GZQB 3CVHL 4MLSA 1I1YA 4EIGB 2VRAA 5E9DE 3BSZH 4K7PX 1N5YL 3DARA 3WSQH 1RK1B 3RBSA 1J12A 2Q3ZA 1TQCC 1WLHA 3F7RA 3H7LA 1D9KD 1QSZA 4LLUA 4ZUTB 3WNKA 5A3IC 3HZYB 4YXLH 3MBEC 4Y1AD 1T21B 1UGNA 2I9LA 3OXSB 5L7XH 3I75A 3F7PC 4KQ3L 3FO0L 4LP4A 4V1DE 3UYRH 1EFQA 1FBIH 2GK0B 5DQDL 1J9CT 3BYYA 1FPTL 2IG2L 1YPZA 1BX2B 2CLZB 4LGPB 4X6FB 5IHUH 4M7ZC 4WWKC 4R4FH 4Z7WE 5DJ0A 4PRIE 5TE7H 4PV9A 1T22B 5CSBA 5D6DA 1DZBA 4UDUB 2BMKB 5T5FL 4YHKL 1ZT4B 3WS3A 2F53B 4O2EB 4KAQL 3K2UL 5EULV 4G8FB 3I02B 4LSVL 4FXGA 5C08B 2XIDA 2P7TA 4M7JH 3EJZD 3HB3D 3IAQA 3EO1B 4YIQA 1A1OB 1WEJH 1KG0A 2V2TA 1YN6B 3BN9D 5BVJA 5BOZG 2Z0BA 4KJQC 2C1OB 1H3TA 4JM2B 5EU6B 2ITCA 1ZLVK 4MJID 4JG1H 1HDMB 1HIML 4XP9L 3UTZB 2IPTL 3VI3F 1AGBB 4O02H 5EZIH 3T3PE 1M7IB 1PFCA 4XX1G 4MB3A 4M43L 2CDFA 2PXYD 4JFFB 3T0AA 4YNYB 3BGMB 1EUUA 2MQCA 3NVQA 3DBXA 5JHDD 2ZUWA 2X42A 3GIVB 3UJIH 5I8EB 3CC5B 3TA3A 4FMFA 5DJ2A 1JMZA 5FO9A 1ZT7A 4MDIB 3JTSA 2WM0A 2R1YA 3W39B 1TJGL 4Y4HD 4IRJB 2QSTA 3HRZB 3MGAA 1YMMD 5HBBA 5E2WH 3MOAH 2A0LD 3UZEA 3MV7B 3HNSH 1U3YA 4DTGH 5EC2A 1H3XA 1ZS8B 4ODUA 2J8OA 5D2LA 4LIQL 4APQC 3MLZL 2X7LA 2H32H 1LNUA 2HN7B 5JQ6L 3QIWA 1Q9LA 2QQKH 1A6VL 2PW1A 4M61A 4PJAF 5AYUH 3T2OA 4OCWL 4RGNE 3UTOA 1MI5A 4N8VB 3VWJB 5K59F 5GRJL 5C0AB 1MH5B 3BRGC 4KVNH 5CKGA 1UZ8A 3F7YA 1GGIH 2VIRB 5C3LD 2OR9L 1YEDA 4YHIB 2XKNB 1SJEA 1BJ1H 3MRCB 5JLZA 3RUGE 2OTWA 2PUQT 5JOFB 3VFPB 2DJSA 5LGKA 2NPLX 1J8HD 4EIZC 1UB5A 1HHHA 4MNQE 4XRCA 1KCSL 5SX4H 3VG9B 1FNLA 1PG7L 1I8KA 5EBWA 1QFWL 4XPTH 4KROC 3W0WE 4BQ8A 3C5SA 3ARVA 5C0CA 1RIVL 5HHMD 4K3EH 1NBQA 5AD0A 4YX2L 3FOLA 2J2ZA 4OI8A 4XP4L 5TPWL 4H8WH 4LSQH 4NZTH 3TH3T 4LNRB 2R4SH 4GRWF 2AABL 1OAZH 1X5KA 2FYYA 3BE1H 5DR5L 3UTSE 1MFEH 5IQ9A 5CEZD 2YKLH 1LO2H 4MZ3A 4LBEA 1T2JA 3GHEH 1GC1C 2W60B 4KTDH 4NQCB 3RP1A 3RVVC 4HG4K 4K71B 3UTPE 1KELH 1D6EB 4KMQA 4HK0B 5FOBB 1FG2B 4XCFH 3DROB 1TVDA 1R24B 4NP4L 3OWEA 2FX8H 3UMTA 4OAWB 1K5NA 3JZ7A 3WXVL 2XTJB 1A5FH 2QBWA 1HHIA 1RZJL 5E8OB 4MD5B 1LO5B 2W0FB 2X1PA 4JVWA 4XAWL 2O26U 3VGBA 3K8LA 1N0LA 5HXMA 4XWOC 1JGVH 2BC4B 1NGQL 2BFVL 4JY4A 4P2OA 2H2SC 3RZCA 3I3DA 5KSAC 3MV8B 4NQVB 4JANB 4LCWA 4NHUB 4U1GB 1CDYA 4PS4L 2LABA 2OTUB 3CDCA 3SE9H 4K23H 1U95A 4WHDA 2R8SL 2JK5B 43CAA 5CBAB 4JQIH 4KKCD 4K3JH 3H9SA 1ERNA 2D7TL 3TBTA 4Y19D 5FUOH 1PVHA 4IJ3B 4ZUVA 3Q6GL 3VXPB 1Y6MR 4ZO6A 1XR8A 2ZPKL 5DRNB 4ZXBD 5JHLH 3PABB 2AP2A 1WTLA 5GGSY 5JXAH 1RQ5A 5FYJL 5IMMB 1VFUA 4RMWA 1IKFL 3B6SA 3O3BB 5E5MB 2X40A 5KSBA 1DN0A 4L8SA 3BRDA 1A1MB 4Z7OF 1BD2B 1CDUA 4BSWA 5KVEL 4GG6B 3O8XA 1AKJB 2X4PB 5DVLA 3KPRA 1CS6A 3KR3L 2Y36L 4H5SA 3BP5A 3F6LA 2XKUA 5I1LB 5MEPA 3LCYA 1SYVB 4WI4A 3UAJC 2C26A 3L3JB 4GW4A 4NUGL 1NDGB 1RJCA 2GJ6A 4MCZA 2OK0H 4JAMA 4O9HH 5IEKA 5F7DB 4OBRA 3WFBL 4HIIB 3U0TB 5KW9H 5SWQA 2FIKA 3HMWH 1K6QH 3ILQD 1A3LH 3O3AB 2ATKA 1B2WH 3ARUA 4GKNA 5BO1H 2DQTH 3G6JF 3V9FA 1XF2B 1SJVA 1S5HA 2AW2A 4ODVL 1FLRH 3LS4L 5JNYA 5T3XL 3ARTA 5LJYH 4JFZL 1AQDA 2FSEA 3IKCB 3NIDF 4ZOCA 2JJVA 4WRLA 3VRLF 4KMLB 1LE5B 1XF3B 4JDTL 3EO9L 3QFJB 1IAIH 3AY4C 2VLJA 2VABB 3UBXG 1L6ZA 3DGCR 3DXAA 1GHFL 3JWOC 3WKMH 3PHQA 3IJSA 3P77A 4QO1A 1N26A 5EFIB 2FEDD 5DMKA 2Q76A 3HKFA 4BZYA 5GGQH 2Z31D 2DS4A 2A77L 1FIGL 3JUYA 4GAGH 3MCG1 3RTQD 1WQVT 1YNKH 1H3GA 4TULL 1AQKH 4Z8FH 5IESH 2OJEA 3ULUL 2AK1L 1UVQB 2G2RA 1QHPA 1EO7A 4KK6D 2OR7A 1BZ9A 2QADD 1RZ7H 3BZEB 1KGCD 1S78C 2VLMD 3C60D 2PF6A 4EBQL 2R1WA 3IGAB 1P4IH 4RGNC 3PP4L 4ODSH 4LLVB 3X13A 3MRJB 3GMRA 5CGMA 4PGDB 3QUXA 1O0VA 2BZDA 4OSUH 1I3UA 4XMKH 1E4XH 1T2QH 5KVDL 1DQJA 1MAKA 4NQXA 2KZ1B 2JIXD 4MXWL 5CZKA 3INUH 4XH2A 5HYSA 3ZT6A 4W4NA 3HNVL 5J9PB 4MDJA 3CLFL 4EXKA 3CK0H 1RUMH 2VE6B 5DFVD 1C5BL 4ZSOB 3EYUL 1JZ7A 5LQBH 5EIQA 1NMAL 5DQJB 1SMAA 4RAUB 3N0PB 3IS1X 2G60H 2NY1D 4HH9B 5E8DL 3UYOD 1EHLH 3HUJF 2WWMD 3F5WA 5SWZD 3NACH 4ZOAA 1LGVA 3AS0A 1A4JB 2Q8AH 5DI8A 3VU2A 4NO0A 1U36A 3ALWA 2J8HA 5DUPH 3KPMB 1WZ1L 3HS0A 4OQTH 1P84K 4UOJA 1MLCA 1S7WB 5MENA 3KYKL 4NWTL 1S8DB 1I3VA 2Z8RA 3KS0H 5F3HA 4JHWL 5IIEB 1QR1B 4L5FH 4MSWB 4WHYH 1KYOK 3S34H 4YFLF 1I7RB 4IHOB 1WISA 3PWVA 4GUPB 1NEZG 2IBGA 1EXUA 5FF6B 4X6DE 3B9KD 1RZGA 2ICWI 4KK5D 4R7DB 2ZJSH 3TBSB 4YPGB 4YHOH 4LQFH 1D7FA 5C6PB 3C6SB 4LRIC 3RIAF 4JN2B 2XWBB 1ONQB 1X9QA 5F71A 2R0KL 2P44B 4FFWC 4XPBL 5DZOA 4HXAL 3QG7H 3TV3H 4FQXC 3P9WB 4F7EB 1ED3A 4YO0B 3SE8L 3GI9H 4X6CB 1CGTA 4PR5A 1V3MA 4QRQB 5GSVB 3U0WH 4KHTL 2XWTB 1KB9K 4O5LL 4OLUL 5E6YA 5E56A 3FJTA 3MRKB 3DUSB 5DJ6B 4LSRL 1X5YA 4P9HH 3KPSE 5HPMA 5I74B 3ALXA 1G6RH 3ULVL 3EJYD 5BS0D 5BV7C 3EOBB 1JHTA 2DMCA 1M6OA 4YUEH 5E1AB 2HWZH 3ECBA 3O41A 2H41A 5GRWA 3TT1H 2NY2D 1R3KA 3VXUA 1YEHH 3BSZL 5IP4A 3A0OA 2OMBA 5C9JB 3Q3GA 5TDPB 3ZDYE 4N9GB 1JF1A 1K3ZA 4WUUE 5D7SL 2Q7YB 3EIFA 5C09B 2EYRB 1T3FB 1CQKA 5I17B 5F88A 4WHCA 1AY1H 1Q38A 1LD9A 3PWPE 3WFEL 1N0XH 4LFHD 5L7XL 3SEPA 3JWDL 4TOYH 5IB3B 2PYED 3ARBB 4Y5XB 3WE6A 5AUMA 4LK4A 2D0HA 1ZLVH 1OD9A 2NY4B 3GK8L 1JK8B 1BOGA 2XI9A 1I9RL 3IXTB 4QCIB 5TE7L 1X5IA 3HCVB 4K9EC 4KRPC 1EDQA 5JIKA 4NHCL 2Q86B 5EA0H 4LPVA 2JJTA 3R8BB 4HS8L 4FZ8L 4KI5F 3AGVA 3FHQA 1DEEB 5KAQG 1MWAB 1G7HA 4FQLL 4ENED 3U2SB 5D7JD 2VLRE 4Z7NE 1L4IA 3V4UH 2VXSL 4N0YH 5CBEB 5CZXC 4AQOA 3MJ8B 3MLSH 3N1GC 4U33A