2IALB

Structural basis for recognition of mutant self by a tumor-specific, mhc class ii-restricted tcr
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
239
structure length
239
Chain Sequence
AGVTQTPKFRILKIGQSMTLQCTQDMNHNYMYWYRQDPGMGLKLIYYSVGAGITDKGEVPNGYNVSRSTTEDFPLRLELAAPSQTSVYFCASTYHGTGYFGEGSWLTVVEDLNKVFPPEVAVFEPSEAEISHTQKATLVCLATGFFPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CD4+ T cell receptor E8 alpha chain
publication title Structural basis for the recognition of mutant self by a tumor-specific, MHC class II-restricted T cell receptor
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 57
structure length 239
sequence length 239
chains with identical sequence D
ec nomenclature
pdb deposition date 2006-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ialB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ialB02
2Q20A 3QFDB 4RAUB 3VG9B 1B2WH 4LCCB 5EWIH 1C5DA 4UV4H 3SCMD 5C0AA 2Z31D 1I9IL 4HMDA 3G6AA 3UJTL 5I16A 4XNXH 2AGJL 4YDKH 1P7QD 4ONHB 1IQWH 3TA3D 3A6CH 4ZTPH 4E41D 3WJJC 1YUHA 4S11A 4HKXB 4NO2B 4LVEA 3D0LA 4R7NB 3IRPX 3CSPA 3S3PA 1M05A 4POZD 4NNXB 1WC7B 2DLGA 5D1ZC 4MWFA 5KVDH 3C09C 4NGHL 5B39B 4UB0L 3AM8C 4M5YH 3BGFC 3C8KB 4KK6C 1CFTA 4MAUH 4Y4HC 4ZO9A 4OCXH 1XCTA 1E28B 4OZIE 1R3JA 1KELL 3OKNB 1B0RB 5F1KC 4Y4FC 1F4YH 2EDWA 5DVNA 4MCZB 2NTFA 4R0LA 4HIEA 5DHXB 2UVEA 5L2JA 3GRWL 2AEQL 3QIBB 3TBVA 5DS8A 4FTVE 1A6TA 4GLRI 4EZMA 1MLBA 1NGYB 2X4RB 1HXMA 5EO0A 1EBAA 1UVQA 3EYQD 4CDHA 4H8WH 4B41A 4PJ7F 3MCKB 3P9WB 2VXQH 3HAEH 1QBBA 4PR5A 2ESVE 1E4XH 2L4OA 1A9EA 5IFHL 4I3RL 4MXVF 4WVRA 3SKNB 5F9OH 3WHXB 5EFIA 3L1OH 5IR1B 4QRPD 4JO2H 3N06B 2N7AA 5F88B 3MROA 4X6DB 4TUKL 4P5TD 4XBGA 1WWBX 3V6OE 1I8LA 4GAYB 4XHJD 1AQKH 2FO4A 1ZAGA 4KZDL 1N2RA 2IGFL 3LOWA 4WI4A 1CIUA 4XBPB 3F6LA 4Y19D 2IFFL 4MGXA 3CSYB 1FDLH 2PO6C 2QADC 1QR1B 4PLOB 1GGYA 3REWB 4KRMB 4LP5A 2HJLA 4Z7WA 1KLUA 2CSPA 5DUML 3NFPB 5ELIA 4JJ5B 1P53A 3P2TA 4PTUA 1I9IH 3CXHK 3UJTH 2A1WL 2EYRA 3W39B 2AGJH 1VFAB 4EXPX 4UQ3B 2HFFA 3BN9C 4ZFFB 3T4AB 1DSFH 1TVHA 2NXZD 3MNWA 4ORZC 3MRLA 2Y5TB 3EJYC 4XI5D 5F1OB 3OKKA 3CFEA 4KXZI 3VGBA 4XVJH 4NGHH 4GW5B 1CTNA 2MWCA 4KHTL 3SBWC 2AV7B 4UB0H 5BS0D 3MRGB 3UYOD 3ARBD 5C0FB 4G80B 4HDIB 1KELH 5TDPB 3D2UB 3GBNL 2DJSA 3BDXA 4WWID 2OZ4H 2Y06L 5IJVA 4UZGA 4GXUN 2WZPD 2BZDA 1H0DA 5SX4H 3BHBA 2H2SD 3GRWH 2AEQH 3U9UA 2XZQL 3LQZA 4I4WA 1IGML 5DJCA 1M7IA 5F89A 2B2XL 5E00A 1ZT1A 2MQ0A 3QP3A 4OIAA 1NC4D 2ZCHL 3FRPG 1RI8A 3RDTB 1KTLA 4HC1A 1HSBB 3O4LE 5IFHH 4I3RH 5IFJB 3LS4L 4FQPA 1HN1A 1SMAA 3QIUC 5CGMA 1ZHBB 2R0LL 5KSBB 2G5RA 1A1OA 3F58L 3RY6C 2BVYA 4DFHA 2QBWA 4FQXD 4KPHL 1H3PL 4TUKH 4RAHA 1VEOA 5D7LD 2HVJB 5HHXL 1WF5A 4KZDH 2IGFH 2VN4A 2OTWA 4LOUC 3RX5A 4BFIA 1XGRA 2B39A 5I18L 4ZPTA 1OSPL 1RK0B 3HZKA 4WU7A 3SDDC 2Z91A 4QF1A 1NLDL 3GSNB 3V2AR 3DIFB 2YD4A 5FDWA 2ED9A 3DX7A 1DEEA 5DHYB 5F9WC 1IEAB 4HIHB 1ZV5A 4KUCD 5T5NF 1U3ZA 4YHPA 1Q9LA 3DVGB 5DUMH 2BC4B 1LO4L 1WITA 1G0DA 1A9BB 2X4UA 3JUYA 3FO1A 2A1WH 1JPGB 3KS0J 3MACL 4NO0A 1P7HL 3QB7C 1ZT7B 3B6SB 1KUMA 3RY4A 3KLSA 1JMZA 1S8DA 1X7QB 5F9JA 5FUCC 5DD1H 3BRGC 1ONQA 3KYOB 3WS6A 5IB2B 1GZPB 3QDMB 3FQUA 4JY6A 1BD2B 3HMWH 3X13A 4KHTH 2PKDA 5LVEA 3MZTA 4CW1A 5HD8C 1RZIA 4GW4B 3T0EE 2K9UA 4YHZH 4PJ8C 3GBNH 1DDHA 2Y06H 3NIDF 4Z7QF 4Z7WF 2XV6B 2V7HA 4HQQL 2DN7A 4TTGA 1CD9B 3IFPB 3NACL 1K85A 3ZT5A 4J7RA 4OUUB 1XF4A 3MRHB 5IFAL 4EN3C 5FA4B 4PGCB 2DTML 5I0DA 1MFEH 2XZQH 1OAQL 1TETL 1IGMH 1HEZA 5JW5A 5DTFB 2W0FB 1EFQA 1G0XA 1L9MA 2Q1EA 2B2XH 4L8SB 5KSBE 4YHML 4G9DB 4QXUL 3S34L 4K3HA 4EDXA 3E6HB 3PHOB 4JM2C 3JXAA 4Y5XC 1RUQH 2Y72A 4U05A 3IYLW 3HE7A 1QVOA 3RKDD 3LS4H 3TYGL 5BXFA 1JGLL 1UCBH 1P4IL 4OFKA 1EO5A 2R0LH 4GRWH 5T3ZL 2HJKA 1LDPL 5JUEL 3F58H 3FQNA 4GRLC 3BP7A 2CRYA 4KPHH 1H3PH 5I1CL 5FYJU 3DVNA 3O8XC 5HHXH 2HVKA 1HHGB 2CKBL 3DVFA 2FJHA 3T77B 3TBSB 4JDVA 5I18H 4Z7VA 1OSPH 3PGCB 4GFTB 3MJ7B 5C09D 4N9GB 1NLDH 5FA3B 3MRBA 1XGPB 1A4JA 3UPRB 4TOYL 1S9KC 5F3BB 1JZ4A 5DUBB 1QO3A 3K81A 5JXAL 2D3VA 2VJXA 3SQBA 1LO4H 3CDGB 5ID0A 1KT2A 2G9HA 1OGAE 4EI6A 5A2FA 1ND0A 1S9WB 1BD2E 3PP3H 3WNMA 3A6OA 3MACH 1L4IA 2NYYD 4HUVB 3G9VA 4GAGL 2VOTA 3JV6A 2EDDA 3PUCA 3VGAC 1UKQA 4G43A 1Z2KA 4DN4H 4C56E 4LL9A 1R5VB 5AAMA 4FABL 3I3EA 3QH3A 5C0BB 1JI2A 1PX3A 1T1ZB 1MAKA 1ZLSH 2VLKB 4QKXB 4YHIB 4QGTA 3NH7L 4XTRD 2HJFB 3FONB 1XIWB 3MSPA 4LDEB 2L0DA 3N1PC 4JGMA 2X4OA 4X0KB 4FQCH 2EDNA 1G1YA 4JPKL 3H9SE 5JMOC 3DTXA 2VKXA 1I7RA 4HQQH 1WBZB 4D0CB 3NACH 4J2XA 1Q1JL 1BHGA 5E2UL 3SE3C 5IFAH 4PJ5A 2BSSB 2DTMH 1F97A 3JWDL 1OAQH 3L3HB 1TETH 5JIHA 4AEEA 3HZVB 1BLNA 3ARSA 1VHPA 5D96B 2VZSA 4YHMH 4QXUH 3QDGA 3S34H 1FQ9C 4UIMA 4PB9L 1ZTXL 5IHBA 3GSUB 3ULUD 3TYGH 4GKSA 1OD9A 1EX0A 1JGLH 3D87B 4OQTA 1P4IH 1UEMA 5T3ZH 2DIJA 5KVFL 1LDPH 4JKKA 3CK0H 5JUEH 4LNRB 5I8CA 4JFPB 3QQ9C 4FFZL 1N6QL 3QUYB 5I1CH 4J8RB 4WDIB 2C4FT 4FZ8L 1BBDH 3ZE1E 2ZUVA 2ESVD 4R8WH 4IBLT 3T1FA 2CKBH 2PCPA 2Y36L 4A6YB 4BSVB 5KSVA 4MMZC 5DYOB 3QXDA 4NQDA 1B6DA 3TBYA 3FN9A 5C0CB 2IBBA 2Y25A 5CJOL 1PY4A 1R24B 3MGTB 4XP1L 5DO2D 3C6LB 3VFVB 1A6VL 1X5IA 2VDRL 3S4SB 2JIXA 5C08B 4YXHL 4MJIA 3VFRB 4Z7UE 3EDDA 4YO0A 5JXAH 1D9KD 5ADOL 1YEHL 5H94A 1CLOL 5C0BE 1DQJA 1U2CA 3F7PC 4GMTL 1KBGL 2CUIA 2DKUA 1XF2B 1RHHA 2XWBB 3IDJA 4MXWL 1CFNA 2VLRB 4LIQE 1ZHKB 2VLKE 4E9LA 3SCMC 4GAGH 1P1ZA 1FP5A 3TA3C 5H2BA 4FABH 5T3XD 3T4YB 3WFZA 1DQML 4DCQB 3QXAA 2WW8A 4Z7VF 3I6GA 2YD1A 3R0NA 2KQNA 3WFBL 3NH7H 4WUUA 3O4OC 5T5FL 2P8LB 4NFDA 2XT1B 7FABH 3V0AC 3UAJD 4QXTA 1NBYA 4JPKH 1DUZB 1FFQA 1J1OL 4JDZB 3BPNB 3O3DA 5TF1L 4U7SA 2WANA 4D9LL 1Q1JH 1SHMA 2AJZA 2HRPL 4HS6B 4X98A 3U36B 5E2UH 1V5JA 5D1XD 2LV4A 3JWDH 4FFWD 3K74B 1HOCB 1CGTA 1I7ZB 1NGZA 2VQUA 1W2KT 1X5ZA 3QIBD 2VLME 1G0YR 1JL8A 5EDXA 5FGBC 3BVNA 5FM5O 3EYQC 4JG0L 3O3AA 5IIEA 1ZTXH 2CRZA 2OL3A 4GG6B 5F8QC 5KVFH 1YQ2A 2IJ0C 4OF5A 2Q7NA 3UTSE 1T6WA 5C0CE 4M7ZB 4P5MA 1AGDA 4FFZH 1FNLA 1N6QH 1UWGH 3ECBA 4D8PB 3FO2A 1I75A 1B0GA 4U6HB 1I1RA 3UPCA 5JW4Q 2JJSC 4FZ8H 1JWMB 3L3KA 5DSCA 4ZO7A 4P5TC 2Y36H 4XHJC 2E8YA 3S9DB 3SE4A 2ZSWB 5CJOH 5AD0A 4XP1H 3BH9A 4P9HC 3ZSTA 3H6JA 1ZS8B 2VWEC 3Q0HA 1NAML 2B4CC 1A6VH 3KPSE 2VDRH 5DD5L 3H3BC 2VE6A 1NFDB 5F6HJ 2VLRE 3T0BA 4PGBB 4YXHH 3RVWD 1QRNA 3EO0A 3OX8B 3QIWB 3VFMA 3WD5L 5ADOH 1W8NA 1YEHH 3PDDA 2DM2A 2FZ3B 5J7CC 4P2CG 3BGMB 1KBGH 4GMTH 2X4PA 4MXWH 1KEGL 4ZYKA 2O93L 3OKMA 1IM9A 1SJEB 4DVBA 2X1XR 1I8IB 2ICEA 2BMKA 4LSPL 1S7QB 2LAAA 2YRZA 5IB4B 4H1LH 2CD0A 4JKMA 5FFLA 5JA9A 3KHOA 2X4TB 1DQMH 4WCYL 1R6VA 2NXZC 1WJ3A 3TNNB 2M2DA 4XI5C 3SY0B 4NN6C 3WFBH 4OZHE 1RHFA 5F7HA 5T5FH 5C0DB 3UTQA 1INDL 3ARBC 4ZD3L 1CFVL 1ZOXA 5HYJB 4P4KA 1J1OH 3DV6B 1DL7L 1FBIL 1T83C 3D2UD 1U95B 2IAMA 1RJYA 2VLLB 2HRPH 1CDHA 4I0PA 3NTCL 4NSKA 4M9OA 1SJVA 3KPOB 2FSEA 1YDPA 2H2SC 5E9DA 1WEJL 5AWNL 5I1LA 2W60B 4PJHE 5B38B 4GG6E 1OT2A 2VTFA 4F7CB 3V5DB 4IMLA 1MRCL 1JN6A 2V9RA 5HHPB 1AIFB 1CLYL 3MRQB 5I74C 4HWUA 4MA3B 4JM4L 4NKMA 5CBEB 1BQLL 3QXWA 1MAJA 3RDTD 2MPAL 1MH5B 5FO8B 3WN5C 1INQB 2UZIH 1AD0B 5HHQA 5KW9L 2DTSA 2ERJC 1W72A 3CGTA 1MAMH 3DV4B 4CVZA 4OZHF 2IH3B 4O2CA 3CZFB 4Y5VA 3MLYL 2KKQA 4TNWF 4BFEA 3ME0A 4FQXC 4ZNEE 1NFDE 3PWLB 3B8YA 1HH9A 5C0ND 4RAVB 5I6XC 1U8QA 1A7RL 1HQRA 1BVLA 2J1KA 3KPRE 3QRGL 4TUOA 3UDWC 3L7EB 4D0BB 5DJ0A 5MHSE 5T1KA 3K8LA 1G7IA 1QRNE 5FM5M 1GVIA 3NN8A 5I0ZA 1K4CA 1NAMH 2GJJA 5DD5H 3T3ME 4QRUB 3IKCA 2P46B 4CU6A 1YY8A 1SY6L 4LGSB 1QEWB 2R8SH 3WD5H 3FOMB 2APTA 4CMHC 5TE6L 4NN5B 3LPGA 2BVQA 2GAZB 3V0VA 3SKMB 3SKUD 3C5SA 3ULVE 1V05A 4Q7DA 3WLWC 4LSPH 1IAOA 1NPUA 3DX9B 4POYA 1MLCB 3NFSH 1YMMA 4ZOEA 3VRLE 4NWTH 5HYJE 3PL6A 5E8EB 4YDIH 3RWJA 1LE9B 1JZ3A 5EU3B 4QHMB 2QL1A 1N64L 1U8OA 1OGAD 4KQ3L 3QDMD 1BD2D 2B8OT 5FM4A 4JAMA 3HI6L 3MO1A 1INDH 2YUXA 2BOBB 4ZD3H 1CFVH 2FEEL 1DL7H 1FBIH 4M8QB 2VIRB 4L8DA 1OAZL 4UINL 2EXWD 4H0HB 1OAYL 2UUDK 4FFYL 3NTCH 5DMKB 2A9NL 2YD2A 1C16A 1WEJH 4XX1E 5AWNH 1NAKL 3RWEA 4WW1B 1TTFA 2D31B 2J5LB 3VFPB 4AY0A 1MRCH 2IQAA 4YHYB 5B3JF 4URTB 3QG6B 1CLYH 2PYEA 4IRJB 1T80A 1AHWC 4JQVA 1NC2B 5I17B 4JM4H 1UENA 1DZBA 2D0GA 2F53B 1BQLH 3AS2A 3V4PL 1CBVL 3LZFH 4PJGB 3RKDC 4R4ND 4ZTOL 4HJGA 5IEKA 4JHBA 4OT1L 5JW3L 2BSTA 3GJEA 4WO4B 3FRUB 3GMMA 4OF8A 4L4VB 4Q9RH 1VGEL 3MLYH 4Y2OA 1ORQA 3MLWL 5DQJA 3E8UL 3D39E 2ZUQC 4P48A 2VSCA 3ARVA 5T1MB 2V5MA 3GJFB 3QRGH 5JORA 2P5WB 1IM3A 4XB7A 2ADJA 1FC1A 5HJ3A 5C7XL 2P42B 1KIQA 2FL5B 1FJ1B 2NQCA 1KXTB 4P2OB 3VI3E 3L6FA 4YZFF 1SY6H 4KRNA 4PRAA 3PQYB 4X6CA 3JVGA 5DLML 2E7HA 4ZQKB 1JNHA 1A7QL 1LNUA 3ALPA 3ARGD 5ECJE 3T65A 4S0SD 4LLDA 3MYJB 2HLFD 2LAGB 1VSCA 3TCLA 1FIGL 3QEHA 5JNYA 3SGDI 4CJ0A 1EUTA 1I8MA 4LLYB 3IJSB 5IEHB 4AT6A 4Q6IA 2NYYC 2AJ3A 1U3HD 5KSUB 3T04D 5JXED 4ZFOB 1K5NB 1OT1A 1LD9B 1Z9LA 2BY0A 3CFKB 1N64H 4JZOA 5C0BD 3RKPA 4KQ3H 2EDOA 3BISA 1PYWB 5EZIL 5CBAA 1YY9D 3PWPB 2VLKD 5DT1L 3HI6H 4XTRC 2EEDA 1AR2A 1GPOH 3DRQB 2AXHA 1XIWD 5TGBA 2DMBA 3B3IB 1OAZH 3AVEA 4PJEB 1LEKB 2V5RA 2WK2A 4M02A 4UINH 4JPVL 1MI5A 4PD4J 4R3SA 1OAYH 4FFYH 5EZLA 4FP8H 2Q3AA 5ICYB 4R4BA 2EC9U 2A9NH 2CLZB 2F53E 5I73B 1NAKH 2R1XA 4YBLC 5E4EB 3LKSB 2D7PA 3NCFB 2E9BA 1CF8L 4OLEA 1T0NB 4PJXE 4F9LA 1HK6A 1NGPL 2VLJE 4QNPE 4KGJA 3V4PH 1T1WB 4RA0C 1MWAA 1IGJB 4X83A 1AQDA 4ZTOH 2DWDA 4X5WA 4OT1H 5JW3H 2PNDA 1DQDL 2P5WE 1WCQA 2VLMD 3MGAA 3VFOA 3RGHA 1RZGB 1NGXB 4MDIB 5D70L 1VGEH 3QUYD 5LGJA 3KDMB 1KCSL 5I1GL 2WBJA 1K3ZA 4GLRH 3U6RA 4C4KO 1C08B 3PQYE 4PV9B 1MVUA 4XPGH 5K9JL 1AD9B 4K7PY 2G5BA 4RDQF 3UTSD 5C0CD 4XMPL 2Q7YA 5C7XH 2P8MB 2GK2A 4HH8A 3PWVA 3NGBB 5I1AA 5IW6A 3QDAA 3ZYIA 1F4HA 4HHAB 4LKCB 1FHGA 2JJTA 4XC1L 5DO2C 1KIRB 3C6LD 1MIEH 3ARQA 3RWIB 1I8KB 3VDCA 4O5LL 2IH1A 5C08D 2YD5A 5DLMH 2V5YA 1A7QH 1KB9J 3RIAF 1D9KC 3VXSB 1MY5A 1SBSL 4L4TA 4W6XB 4QY8B 1TZHB 3VFTA 3QZWG 4PG2C 3RWFA 2YD8A 4NQCA 4J4PA 4PRIA 1RZFL 2R2BB 4OUOA 5HHOA 3VG9C 4LCCC 2VLRD 3AREB 3OKEB 2FX9L 4ZO6A 4KDTC 5EOQL 4P2RE 5EN2A 4H88L 4PGDA 1RURL 4UDTA 1C8PA 4PJEE 5F7LB 4CL7A 1REIA 5J6HB 1ZT4B 5EZIH 5D4QA 3MJ6A 4OIBA 1Y0LA 1A3LH 1BX2A 5DT1H 3S96B 2FH6A 1S7WB 1CGSL 2I60L 1U41A 3U4EA 2GFBB 3HMXL 3UAJC 4QOKA 2WLYA 1G6RA 5KBNC 3EYVB 2RCSL 2XN9B 3FQRB 4JPVH 4X6CF 1ZE3C 3TVMA 5KTEL 2NCMA 5BVJA 4HWBL 2OQJA 5D1XC 4EQ3A 5IG7A 3B5TA 4G42A 1FCCA 4FFWC 1LO5B 3GIVA 3QIBC 1CF8H 5SWQB 1MCFA 1J7VR 1NGPH 4C58B 3EO1B 2K7PA 3B5GA 2AABH 4MDJB 4WU5A 4P9HL 5JO5A 5J1AB 3QEUB 3TEUA 2B4CL 3ZHKA 3WJLC 1DQDH 2ZPKL 3GIZL 4PY8J 4N8VG 4ODXA 1BFSA 3DSFH 4MAYA 2C3VB 3QXTA 5BZDA 5K9OA 3U1SL 5D70H 5CGTA 5TDOB 5ILTL 1KCSH 4LLUA 2YC1B 5I1GH 4ZFGH 1NGWB 2EYTA 3V4VL 5JW4R 5K9JH 3I3BA 1U8KA 4XMPH 5IM7B 1NCBL 1SEBB 3VXSE 3L3DB 5JDSA 3MV8A 5DHVA 5JZ7C 4XC1H 3D18B 1C7SA 3PGDA 4O5LH 1GOHA 1Q94A 2DWEB 5CS7A 1T20A 3RVWC 2DQIH 3QUXA 5IUSA 4G6AD 3QIWD 3L5WA 4P2QA 5J9PA 1SBSH 3RNKB 3HS0B 3EHBD 5IB5B 3SJVB 5C70A 5D2NB 1RZFH 4JN1L 1ED3B 3O6ML 4HUNB 2F5BL 4KMLB 4P46B 2FX9H 5FYLE 4Y88A 4O2EB 5EOQH 4FNLH 3WL9A 1HSAA 1VGKA 4H88H 4PJDA 1FFNB 2Y4SA 3BX7C 3I85A 1RURH 1JTPA 5DMGC 2PTTA 3NIGF 2HLAA 2XKSA 3CPLB 2GUOA 1S7TB 3WNLA 1FGNH 3H9HA 4WNQA 5GSRA 2IPKA 3WLBB 3TN0A 3ULVD 3EZJB 2C5DC 1M4KA 3ZKND 4OI9A 4ODUA 3QFJB 3HMXH 2JB6A 4F15C 2PYFA 5F3HB 5T1LA 2P24B 1ZANL 1OP5K 5HYJD 1D3CA 2RCSH 3P73B 3RTQD 1C5DB 4OLZL 3BESR 2DIBA 3JUZA 1J0ZA 4G7YL 4ODTL 3PHQB 1BFOA 3T0EC 2N56A 1DE4B 2XQYK 1M05B 1I9JL 5C07B 4L29A 1FFPB 3GB7A 4WI8A 2BK8A 4XPHL 3VE0A 1OQXA 1WZMA 3X12A 5ESVA 4P9HH 1WFTA 1CFTB 2DQCL 4LBEB 3RDTC 3GIZH 2ZPKH 4P99A 1JGUL 1RJLA 4JRXA 4CVWA 4JPWL 1O7VA 2YK1H 3U1SH 4LPWA 1TNMA 5ILTH 2NR6C 4CU7A 1Q9KB 5L2JB 2EE3A 3RGVA 1HILA 5F1IA 2H32H 3V4VH 3U7WL 1HXMB 5EO0B 1HDMA 5C0NC 1NCBH 1BBJA 3RI5K 2DYPA 3SJVE 5D2NE 4IMKA 4PR5B 5CZXD 5I1IL 3FB7B 4MLSA 1J12A 1HI6A 2ZUUA 1U8HA 2GITA 5EC1A 1A9EB 4U4BA 4WEUD 2SEBA 4W68A 3D39D 3QAZB 5HDBE 1N6VA 3L3GA 1GGCL 3HNSL 4HXAL 4QRRE 3EO9L 4JN1H 4LHUG 3O6MH 4WI5A 1SYSB 2F5BH 2OR7A 4G5ZL 2NLJA 2FO4B 4O4YL 5DK0A 4OCRL 5H37H 5LBSL 1MCWM 4OCYL 4LCUA 3QFJE 1X6NA 4ORGA 1IJ9A 5J3HD 3V52H 1GGTA 1SYVA 2E7LA 1MFCL 3WUWA 4FXLA 2HJLB 3KPPB 4Z7WB 2QSQA 2IANE 2VL5B 1X3DA 5E2TL 1ZANH 1FZMA 3LKOA 1MELA 2W1NA 5C07E 1FNEA 2GSGA 2ORBL 4PTUB 2EXWC 2EYRB 1KPRA 1BF8A 4G8IB 4G7YH 5FYJL 5C6PB 3BUTA 3QZWA 4ODTH 8FABA 1RZJC 2HFFB 1WBYA 1TVHB 1A7PL 1N5AB 4XCYA 2GTZA 3MRLB 1I9JH 1EA9C 3DX8A 1RU9L 3CFEB 4IRJD 1HIML 1T04A 4PB0L 4XPHH 4PJDF 1OGTB 3OTTA 5GGSY 3TWCL 5EULV 1DBAL 1NC2D 4TVSa 4Y16C 2DQCH 2F53D 5MEPA 1ZHLB 1OP5H 5MERA 4V1DE 4R4NC 4KROB 4EOWL 1G7JA 5ESQA 5IJVB 3SN6N 1VFBA 4WO4D 1H0DB 4ZUVA 4DGIL 4N0FB 3BHBB 1UADC 4L4VD 2YPKA 2VLJD 1CXKA 3U9UB 4GT7A 3GSVA 3LQZB 1UWEL 4I4WB 3L5IA 5DJCB 4POUB 5E00B 1ZT1B 1CXEA 2P5WD 4J3TA 3N1FC 4OZGE 3LV3A 4PS4L 5I1IH 3RU8L 4ODWA 4P2OD 3VH8G 1JPST 2E8ZA 3MUZ1 1FO0L 1PKQA 4DEPC 1JGEA 3PQYD 4QHKJ 1YEDB 4U31A 2VDQL 3TGXA 4CVUA 4I18A 1QBML 1GGCH 4Z78A 3ARGC 4HXAH 4MHHG 1JNNL 2GY5A 3EO9H 6FABL 2HLFC 2E3VA 5L0QB 4G5ZH 4N8VA 4I2XA 5J06A 4P3DA 4AENB 1KN2L 1BVKB 9CGTA 3HE6B 3GMNA 4OCRH 5LBSH 2OTWB 4OFYD 5T33L 5EO9B 4BFIB 3S36X 2J4WL 2PR4L 2A0LD 4JZNB 1U3HC 3HAEA 3HZKB 4WU7B 4UAOB 3O2DA 5TH2A 2PW2B 4MJ4A 3GM0A 5FDWB 4NRZA 4R26H 1MCWW 1DBJL 1MFCH 3DX7B 4BH7B 1DEEB 1YY9C 3FL7A 4XPFL 3PWPD 3DBXB 4YHPB 5E2TH 2DRUA 1BIHA 4PJIA 4K23L 5KN5A 1VFOA 4KI5E 1CTOA 3W11D 2ORBH 4MSWA 4OSUL 4XPBL 2VAJA 5FYJH 3DRTB 3DO7A 2Q87A 3FJTA 3MV9E 4NO0B 2C4XA 1OF2A 2NXYD 2VXSL 4LGRB 4NHUB 5K59F 5FK9B 2EIZA 5DRWA 1A7PH 3QI9B 4HSQA 4DUWA 5FO7A 3HG1B 4ZXBC 5AAWA 1S8DB 2X4QB 1Q8MA 2XTJE 3PIQB 2F8OA 1HIMH 4JY6B 4PB0H 3TWCH 1J8HE 3MYZA 4CW1B 3ZTJG 1IEBB 3OF6D 3QCVL 5IV2A 2P5EE 3B9EA 2QHLA 3V7AG 4IIQB 4EOWH 3OGCA 3FQWA 3SQOL 4JHZA 4NQXA 2C3HA 3QO1B 4FQQA 1L0QA 3V7MA 4DGIH 1ZXQA 4X4YA 1P6AB 3QUYC 1U58A 3QHTC 4MQXD 3VXUA 4NKOB 1UWEH 4PIRF 5JW5B 1S9VA 2Y5EA 1J1XH 5IHZA 1NJ9A 2EO9A 1IAII 1II4E 1J05A 4PS4H 1WZKA 3RU8H 3FB6B 1QVOB 5INDA 4Z7NF 3C6LC 4X7TA 4LPTA 1D6VL 1FO0H 4UTBL 2HJKB 2VDQH 3QISA 5GS2D 1QBMH 3IVKA 4DUXA 2ICWA 2WQRA 1JNNH 5TF0A 3GRWA 2AK4A 4JFDA 3VXSD 6FABH 1D5BA 3DVNB 2XZCL 5HVWA 1KN2H 2DQEL 2HVKB 4KRPD 1FL5A 5T33H 3ARED 2BXYA 2PR4H 4WTZG 4AQ1B 4I5BA 4R4FL 3SGKA 1UKSA 4NYLB 3MRBB 1A4JB 4KJQD 4KRLB 1TCMA 1B4RA 2BVEA 4XPFH 2YPLB 3VJ6B 4OCWL 5FYLD 5IMOA 2DJ4A 4UU9B 1SVCP 4Y5YC 4K23H 5ID0B 3HG1E 4ZS6D 2P8PA 1KT2B 3UTPE 4J3VA 2G9HB 4NIKB 1ADQH 4UBDD 1ND0B 3FFCA 2XN9D 4OSUH 4YXKL 4XVSL 4ZSOE 2VXSH 3LEXB 1KYOJ 4LHUA 4LKXB 4G43B 3BPOB 5JOFA 1R5IB 3QH3B 1R0AL 1TQCB 1C1EH 4OGAD 4NKDB 3V8OA 2I9TB 2OCFD 1A6ZA 3QCVH 1EEQA 4MD0A 3PV6A 2X1PA 1BZ9A 2D7QA 3OPZL 3DTXB 3SQOH 4M8VA 1I7RB 2BSRB 2A74A 2FWOA 2ZCKL 1ZWIA 3OR7A 4G8EB 3VGFA 4PJIF 4YR6A 1YJDC 3QDJE 2Q76A 3L5HA 3S35X 4PJBB 1QFUH 1YC8A 3ILPA 1Z9OA 4PBWD 1A6AB 3QDGB 1FVCB 3Q5YA 1BZQK 5CSZA 4UIMB 1NANI 1UACL 2ARJA 1UCTA 5AG9A 2UV3A 3EFFB 4GKSB 3TV3L 5EU4A 3ZE2E 4UTBH 2AK4E 1CD1A 1CIDA 4RBPK 4OBRA 4GBXB 3ARFA 2CK2A 5KVEH 4G6AC 1UJ3B 5CJXC 1I85C 3EHBC 3OKLB 5C6WH 2WM0A 3C5ZA 2XZCH 5DGQA 4IHOA 4KI1A 3SJVD 1O0VA 3T1FB 5KSVB 4P46D 3TBYB 3CD4A 1KV3A 2JTDA 3C9NA 2YPLE 4NQDB 3LEYL 3VXRE 4NPYA 3ARDA 4Z6AT 4R4FH 1E27A 3DMMA 3VFNA 3OR6B 3ULSA 1FNGA 2YZ8A 1ES0A 2HRLA 3LD8B 1RZ7L 3U9PL 2V2XB 4OCWH 3ULVC 4NZDA 3LHPL 3ZKNC 3VH8A 3QFJD 4GG8A 2I25N 1F00I 5HGDB 3HN3A 3N1QC 4LCWA 4Q9QH 3RTQC 4H26A 3IDJB 1IKNC 1CFNB 4YXKH 3LSOA 5IMMA 4XVSH 1RK1A 2X2YA 4XNMB 5IB3A 1Z5LA 2BVPA 2OP4L 3ZE2F 3L5XL 1YEEL 3OGOE 3MMEB 3QO0B 4KMTL 1PBYA 5BVPL 3BPCB 4X5XA 2IAND 3MRMA 1PG7L 4F7PA 5ICZB 2R1YB 1R0AH 3GMQA 5GJSL 4M48L 1SQ2N 3QXAB 1URLA 5C0RL 2YA0A 3VWKA 1QSZA 4OCNC 5C07D 3WCYA 3I6GB 3CFJA 3BMVA 3ZYOA 1U91B 3LKQB 2BNQA 3U46A 3C8DA 5HI4D 4ONGL 4PJBE 2Z92A 3ZKSD 1ZSDB 1NBYB 5BMFL 1KIPA 3IU3B 4JFEA 1EO8L 1KB5L 2CQVA 3O3DB 4K7PH 1VACA 2W65A 2ZCKH 2AJZB 2R2HA 4WHDA 1K8DA 4X98B 3HPJA 1LP9A 2AJUL 3SKOA 2DAVA 3K46A 1F4WL 5FO9B 1ZLVK 1X5HA 3JZ7A 3WBDA 3DXAB 4A2MA 3UYPA 4YUEL 2FECL 1WTLA 3P4OA 5IIEB 1UACH 4U1NB 2ZWLT 2YBRA 5C2BL 4KJWC 4KFZC 1INEL 4U1KA 1EZVY 3TV3H 2X44D 2Z9TA 1MCQA 3JV5A 1IAKA 2VN7A 3MLRL 5C0IB 4CMMA 2J88H 1EGJL 1I4FB 4OZFB 2PTVA 3ECBB 3FO2B 1NMCB 1B0GB 3MNVA 1PKOA 4NN5C 2QQNL 3LKNB 2AW2A 3L3KB 3MRFA 2QQLL 5KAQG 5IROA 2DICA 5ETUA 1E4KA 5JOPE 2ZUTA 3LEYH 5D7JA 4DK6A 2FH8A 5JMRA 5AD0B 2AS5M 2CR3A 3B43A 2XICA 4NBYB 3D3VE 5DJZB 3KLDA 3BE1L 3ZKMD 3QPQD 5J3HC 3ZYZA 2DI8A 1KYOK 2VE6B 4NQSB 4TUJB 1LMKA 1RZ7H 1YNTA 1U2HA 4MJ5B 3NCEB 3EO0B 1QFOA 4RBPH 4LVHC 3U9PH 2GHWB 3FTGA 3VFMB 5BJTA 3LHPH 3BQUC 3N85L 4JFOA 2EDKA 5AZEL 3QULA 3X3FL 2QSCL 5MENA 5ITBL 5I8EA 2C1OA 1JTOA 3WFDL 3GBLA 5DMIL 3O11B 5F7DA 4M7LL 5DA0B 3EKCA 4GKOA 3RHWK 1IM9B 2OP4H 3MZGB 3L5XH 1YEEH 2BMKB 4KMTH 4GRMB 5BVPH 1I1YB 1PG7H 3MQIA 4M48H 5GJSH 5C0RH 1WV7T 2H3NB 3BEWA 5EZJA 4JRYA 4WHYH 4YHYC 1NEZG 5E6IA 2PW1B 2X89A 3PE9A 3N1GC 1BJ1J 1J18A 3UTQB 4R2GD 4NM4L 5BMFH 2JCCA 1DBML 4P4KB 1CGVA 3DXAE 3QHZL 1EO8H 1KB5H 4QXGL 2X42A 2XTJD 2DM3A 4KROD 2KL6A 1LE5A 1NLBL 3LN9A 1KJ3L 4NNPL 2AJUH 2NY7L 1F4WH 4ISVB 4NSKB 5E9DB 1KCRH 3ZDXF 4HUWB 1JN6B 2VH5L 4YUEH 1IFHL 1U8JA 4LAJH 3VXMA 4Q9RL 5C2BH 1INEH 1FL6A 2V5TA 2JKXA 4OIIL 2OX5A 2GJ6E 3D0VA 3G5YA 3IDYB 4O51B 4P2OC 5DRZA 3B2UC 3LQAC 3GO1L 3MLRH 3V7AE 2AXGA 3PWNA 3SDCA 4LIQL 4KTEL 4Y4KA 1S7VA 2QQNH 2WP3O 3EDFA 1T3FA 2QQLH 3SE9L 1QFHA 2AXJA 3I2CL 3AAZA 3OXSB 2YKLL 1U9KA 3RZCA 3HE6D 1U8QB 3F12A 3PDGA 1LP9F 2J8UB 4TUOB 5T1KB 3RRQA 4H25B 1G7IB 5IW3A 4OQ1A 2HG5A 3BE1H 5GS1A 4OI8A 1RFDH 2X9WA 2E6PA 5E6YA 4QTIL 3DETD 1YY8B 3OKOA 4HPOL 3PJSA 4LVOB 2UZXB 1MCCA 3N85H 5AZEH 3STZA 3X3FH 2QSCH 4TNVK 5ITBH 4FG6C 2BVQB 3WFDH 5DMIH 4M7LT 2HH0L 3V0VB 4M7LH 2ZUYA 3CVHB 3W11C 3C5SB 2YWZA 5LQBL 2FB4L 2BOCA 2OXGA 3KPQB 1KPUA 2NXYC 3BFOA 1YMMB 4NO0D 3CH8A 2J6EL 5I73C 3RWJB 3W9EA 1H3GA 3QI9D 5EU6A 3HG1D 4X8JA 1C12A 4PJAE 3UTPD 1U8OB 5D1ZA 5E4EC 1S9YA 2KZ1B 2VB5A 3TNMB 1RPQA 2OBGA 2R0ZL 3ARXA 5AZ2L 1FSKB 4JAMB 4YDLB 4KAQL 2B0SL 4DAGL 1JJUA 2JELL 4L3EA 4NM4H 4Y4HA 1WWCA 1DBMH 3H9YA 3QHZH 1QFPA 1EPFA 4QXGH 4JLRA 4L8DB 2APVA 2FEDD 4GH7B 5TJWK 1NLBH 4RQQA 1KJ3H 4JHAL 4NQEB 4NNPH 1QSEE 1UB6B 1T03L 1K9TA 1MJJA 1CU4H 2NY7H 4H1LA 5I2IA 1EEZB 1C16B 2XWTA 4MQXC 3RWEB 3HRPA 3MRPB 4X6EA 2OYPA 2VH5H 3HLAA 1Y18A 1IFHH 2XA3A 5JHDE 2C3GA 4Y1AA 4XMLL 4MVBD 2RJMA 4KK9D 3RWDA 3MLVL 5HXMA 3QUZA 1T21A 1EERB 1E0OB 4OIIH 4Z7OF 4L3CA 5DVLA 2W9LA 3M17B 2VAAA 5CINL 2GI7A 4HJGB 5IEKB 2J8UE 1AGEB 3FFDA 4LIQH 4JZJB 3T0DA 3GMMB 2JCCF 3FOLB 3CX5J 4KC3B 3SE9H 3TLRA 3MGOA 1ORQB 2EC9T 5DQJB 3I2CH 2YKLH 1JHTB 4AIZA 3VI4F 3GHBL 4KRPC 5JORB 3AREC 1IM3B 2ADJB 1OB1A 1LQSR 5HJ3B 1KIQB 1D6EA 4ERSL 3LS5L 4QTIH 4U33A 2PO6A 2APBA 3L6FB 4HPOH 3D6GA 4KJQC 4PRAB 4RFOL 2VZUA 3CIQA 5D7IA 5KANI 4MNQB 2A6IB 1M71B 2YPLD 1CI5A 1LNUB 1T6VN 3HC0A 2HH0H 4ZS6C 3KPTA 2WINA 2P7TB 3QEHB 1B90A 2AJYL 3BP5A 1P5UA 5LQBH 2YRLA 2FB4H 2OJZL 4JKPH 1U8LA 2AJ3B 3FKUS 2J6EH 2BSED 1NAMA 1X4YA 1YJDL 3CDCA 4OQTH 1QD0A 3UO1L 1MY7A 5ADPH 5E7FA 3BDYL 4Y8DC 5FYKD 4LLAA 4NQEE 5CBAB 3DVIA 5KS9A 2R0ZH 3SBWA 4UDUB 5AZ2H 5C0EB 4KAQH 2B0SH 1G9NC 1MUJA 1SM3H 3HI5L 2JELH 2RFXA 4OFIA 5GZND 5TGBB 4Q9CA 3O0RL 2ID5A 4M3JA 5HYSG 1H3WM 2RBLA 2GSIB 2Z93A 4NT6B 1MI5B 4R3SB 4HIIB 1T03H 4J3SA 4M61A 1DQLH 1RQ5A 1DANU 5EBGA 3LVEA 5CZVL 5LGKA 2R1XB 3S35L 1QHOA 2E27L 2IALA 4XMLH 5J56B 1ETZA 2EH7L 1EAJA 3QDGD 3MLVH 43C9A 5IF0A 1PG7W 5E2JA 2DQJH 1MWAB 1MNUL 2D9CA 1F4AA 3KYNA 5CINH 3G9AB 3ZKXC 1NEZA 3FCTB 3QIUA 4X5WB 4K3GA 5ALCH 3T0WA 4GBXD 3H7BA 3RY6A 1F02I 1KG0A 1YPZE 3ULVL 3BZFA 1R3IL 3KPLB 2N7BA 1NUFA 4HV8B 2XWJA 4M7JL 5LGJB 4XAKD 3FO9B 2ZNXA 5D2NC 1ITBB 2WBJB 3S37X 3U6RB 3GHBH 2C9AA 2R4RL 2QQKL 1MVUB 4P46C 4MNQE 1VENA 4NQDD 5CKAA 1N6UA 3SDDA 3BIAX 2AAVA 4ERSH 3LS5H 1A1NA 1GZQA 3IXTB 4YPJA 3EOYG 4Z9KB 1MCEA 3ZZ1A 3V4UL 1L0YA 4P49A 4WJ5B 1WIPA 4RFOH 1JYXA 5CSGA 4Z77A 1IL1B 2Q8BL 2FIKA 5C1MB 1NDGB 4BZYA 2KDGA 5JOPD 1JPTL 2V9QA 5GS0D 2VSDA 5JHLL 4XB8A 4L4TB 3VFTB 4BSWB 3RWFB 2LVEA 4NQCB 4U7KA 4H20L 4PRIB 5CP3A 3O2WL 5HHOB 2OJZH 2CLVA 2R9HD 3QNYA 2XPGA 1ZKAA 5ID1A 5EN2B 1YJDH 1XGTA 4PGDB 4UDTB 2OL3H 3UO1H 5E8DH 2LABA 3WIFA 3BDYH 1EJOL 2FRGP 3PABB 2VKWA 5BZWA 1Y0LB 3BSZL 5D72H 2AVGA 4U1SB 1DP0A 3P4MA 5F6IC 5EUOE 4MX7B 2BNRE 3HI5H 1ZGLB 1FG2A 3LB6D 1ZA6B 3UBXA 5C8JA 2ATKA 4S1SL 3U4EB 3BD3A 4PJ8A 4NO3A 1QLEL 2ADFL 4QOKB 1G6RB 5C3TA 4EKXA 3I6KA 4U1JA 3TVMB 5D7IF 1IC5L 3G5VA 3WXVL 4MA1B 3AY4A 5IG7B 5CZVH 4EN3A 1P7KA 4G42B 4TVPE 4D0DA 3G5XA 1EO7A 1WICA 3LPFA 3S35H 5BO1L 3GIVB 4AEFA 3DXAD 3H42H 5GGRA 2E27H 4UV7L 5E4IA 2EH7H 5SWSA 1IEHA 4NFCA 3SE8L 4JM2A 4Y5XA 3VMPA 1FZKA 3ABZA 3UTTB 5JDJA 5JO5B 3ROOA 2IADA 2OTPA 5F7YC 4PREB 1VESA 2X70B 5KS9F 5KOMC 3QUKA 1F90L 1TENA 4ODXB 3VMNA 4G3YH 5BZDB 3JWNC 1KJVB 4GRLA 1R3IH 3BP4A 3QAZC 5D7SH 5K9OB 3ULVH 1SBBA 2WSKA 2P47B 4M7JH 4BKLA 2X7LA 3O8XA 1H5BB 3GSXA 4LLUB 1CE6A 1JI1A 4HUXA 3AROA 3G6JA 3RBGA 5IMKA 2R4RH 2QQKH 3MRCB 1MCLA 2X4SB 2XZZA 1IAIL 5JDSB 4G6ML 3MV8B 3FT3A 5DHVB 3V4UH 1XEDA 3QPQC 4FQ2L 3ZKMC 3PGDB 1QYGL 1IZJA 1Q94B 2Q8BH 3T09A 3ZT6A 4M9PA 3P77A 1JPTH 3L5WB 5EPMA 5JHLH 4P2QB 3BAEL 3MUGB 4EUPB 3H8NA 4XWOD 3RBSA 3MBEA 3M07A 1TZIA 5DFTA 3O2WH 1CG9A 2O5XL 4H5SA 1IM9D 2EYSA 2HKHL 3WL9B 3N0PB 2A83A 4F33A 4J1UA 3GGWA 2D0FA 3JTTA 2BVOA 1EJOH 2Y6SD 1PFCA 2C4FU 4KI5C 1AXIB 1W72H 3BSZH 4WNQB 2MKLC 4ZUTA 1BZ7A 5F7WC 3G5ZB 3G04A 4ODUB 5JIIA 4GS7C 1FZOA 5BCAA 3VD5A 2JB6B 4JANA 1QLEH 4R2GC 2ADFH 4P4KD 2V5SA 2WWMD 1IC5H 2XTJC 1Q72L 3WXVH 3BZDA 1B9ZA 4KROC 3SE3A 4P3WA 2R39A 4OLXH 1S5HA 3UTTE 3DURB 3HUJA 4QTHA 5BO1H 3IETA 3BI9X 5E9DD 3BZEA 4JO1L 2Z8SA 4AL8L 1F2QA 4UV7H 5SWZE 3TO2A 4L29B 3QEQE 3SE8H 1TZGL 5D93B 1QSED 5D6CA 3NZHL 4XP5L 1L7TL 5CWSB 1AFVL 4MD4B 2VR4A 4PJFA 3KVQA 4ELMB 3VFUA 1IGYA 1T7XA 2O61A 1QLRB 4MHHI 1RJLB 4JRXB 5ISZE 1JPFA 3E6FB 4NFBA 2V2WA 3MUY1 2AXFA 2VABB 5L0QC 1HILB 5F1IB 5HYIA 4U1LB 1HDMB 2X10A 1A6PA 1WTGT 3HE6C 5C0GA 5CLTA 5KG9A 2NNAB 2HFEA 4WEMB 1IAIH 2RIKA 3QA3B 5K9QI 4TYUA 1PEWA 5T1KD 5J11B 4G6MH 2DYPB 1TVDA 4FQ2H 5CHNA 1AI1L 3E3QE 1HI6B 1UXWB 5EC1B 3DETC 1QYGH 1JZ6A 1MHEA 4OD3L 2F74A 2SEBB 4JCLA 1WAAE 4JM2F 1PSKL 1I7TB 1MCKA 4HUUA 3BAEH 4YEEA 4M6NL 3BXNA 1LK3L 4YFLI 2O5XH 3SCMA 5CILH 1R5WA 5DK0B 2HKHH 2IBZY 3KJ4C 3TA3A 4E42B 1YMMD 3UZEA 2D7NA 1CFSA 3VG0L 3G6JF 1LEGA 3O2VL 3IDMB 3QI9C 2F58L 1SYVB 5DQDL 1NMAL 5E5MA 1NEUA 2R29H 2VXUH 3WS6C 3MLTA 3WUWB 1KJMB 1UA6L 4BH8B 1VPOL 3OAYK 1JV5A 4QHLB 1QQDB 2FO1A 3WKNA 3ZO0A 3LCYA 2YR3A 4HIJA 4IIQC 1Q72H 1FRGL 2FEDC 3FO0L 1FNEB 2GSGB 1A0QL 3LRSA 4HKZA 4NQED 4LQFL 2UZYB 5A43C 3AXLB 2NW2A 3AUVA 1WAAF 3S88L 1WBYB 2X41A 5E2WL 1MEXL 4ELME 5E8OA 4AL8H 4XCYB 2GTZB 4FZEL 5HGAA 1E6JL 1HH6B 2D03L 2I26N 5FGBA 3DX8B 1T04B 3IXAA 1TZGH 1I1CA 3F5WB 3M45A 3W0WA 3HMXA 3NZHH 4MVBC 4RMWA 1KTDB 4KK9C 3MRRA 3ARWA 4RX4A 4XP5H 1S7RB 4M43L 2AI0H 1L7TH 4YPGA 1AFVH 5F1SA 1B0WA 2PTUA 5MEPB 5MERB 1G7JB 1HHIB 1TJIL 4HBQA 4HWBA 3GKWL 4U6VH 3VDAA 3C5JA 2EEBA 5BOZG 5FYLL 4QT5A 2JJSA 1B6UA 3VD3A 1QFWL 4HWEL 4P5TA 5GGQH 3KLHC 3VXNB 3RY5A 1T1YA 1F11A 4NBZB 1TDQA 1OY3B 4OV5A 5C9JA 1A3QA 2NZ9C 4PY7A 4Y19A 3HUJF 2KPNA 4S0TD 4XP4H 1AI1H 4ODWB 2J12B 5HGHA 1OARH 4OD3H 1S7UB 4ZUUA 3WO4B 1PSKH 5GGUB 3AFLA 4I18B 2NW3A 4XCCL 4MNQD 4BQ6A 1G9NL 4M6NH 5FOBA 3RL1A 4AZ8A 4Z78B 3SGJC 4NNYA 4PJFF 3VXTA 3SPVB 3FMGL 2H1PH 3BJLA 1LK3H 2DQTL 1NBVL 2H32A 4I2XB 4P3DB 4FQJL 5E56A 4E41E 3GMNB 3TT3L 4N0YL 3HCVA 4NUGL 1ZK9A 5TPWL 2NY4B 5L8LB 3HAEB 2EE2A 3VG0H 1HKLL 1TMCB 2F58H 3BPOC 5J12B 4GSDL 1NMAH 5DQDH 4MQSB 4N0RA 5GRVK 1W0YT 5DEGA 1A1MB 1HCFX 5DJAA 5BS0A 4DKDC 3MFGB 3UX9B 1KNOB 3IDXL 3ARBA 3EUUA 1DQQA 5GZNC 4PJIB 4CAGA 1T83A 4LRIC 2X09A 4LSQL 1FRGH 3FO0H 1A0QH 1AJ7H 2DLHA 2LTQB 3BH8B 1MIML 1MI5D 4ZUWB 4LQFH 3DO7B 1UZ8A 2MQCA 5DA4A 1OF2B 3S88H 2EIZB 5DRWB 5E2WH 4M5ZL 5FO7B 4FZEH 2PUQT 1D5IL 1E6JH 2WIIB 2D03H 1HWGB 5GRVL 3ARPA 4YC2B 1RIUL 1FNHA 1NC4A 1NSNL 4NZRL 3U0PB 3ZE0F 4IRZL 1U8NB 4M43H 1LEIB 3OAYH 4QRPE 1F6AA 1T7ZA 3WN5A 1TJIH 3GSOA 3PWUA 1JIBA 3GKWH 1AGFA 1FNAA 1NGQH 2R23B 2HT3D 1FFOA 4FQQB 4G8GA 4GBXC 5BV7C 3OHXA 3HZMA 1PQZA 5DC0A 4WV1B 5FYLH 5D2LE 1UJ3C 1QFWH 4FQXA 4HWEH 4M03A 5D7LA 5ENWB 3VD7A 2WBJD 1XR8A 3UDWA 3EAKA 3RQ3A 1H15A 5IVXA 3GEWB 3LAFA 4TRPL 2BFVL 3V0WL 3HRZA 5B39G 1K6QL 1F5WA 2UWEE 2YD7A 4Q2ZB 5INDB 3LD8C 4X7TB 4WW2C 1X5XA 3GSRA 1TVBB 4XCCH 3IVKB 1Q9WA 1XF3A 1ZHNB 1H3TA 4O00A 4PTTA 4RIRA 5GS0C 4ZODA 4JFDB 4XPTL 3FMGH 4LARL 1EDQA 4PRHA 3OXRB 2DQTH 1NBVH 4R7DB 3RWCA 3WEXA 4FQJH 4NQCD 1NQBA 4HLZG 5C9KA 3TT3H 5IP4A 4N0YH 4L8CA 4NUGH 2VYRE 5TPWH 1J0IA 2R9HC 1HXYA 2W59A 1KSRA 1JF5A 4I5BB 1LK2A 3S5LA 4GSDH 1IGTA 1G7QB 2AEPH 3T0AA 3WFHB 2ADIB 4YHNA 5H35A 1YEGL 2ZG1A 3AMKA 2ARWA 1F4XL 4JFHE 3IDXH 2AP2A 2ZOLA 5IMOB 3LB6C 4OKDA 3TZVA 1G7LA 4PJCA 4DGVL 3EJJX 5FCUL 3FFCB 1MIMH 3TVMD 2UWEF 3IKKA 2E6JA 2C1PB 1NBZB 5LXGL 4K7FA 4M5ZH 5JOFB 1D5IH 1P4BH 4UI2A 1L6ZA 2GCYB 1UFUA 3FB5A 2F54A 3HC4L 4JY4A 1RIUH 3GFUA 1NSNH 4NZRH 4FS0A 4IRZH 1J9CT 1A6ZB 4Y8AA 1U8IA 1S3KL 1JWSA 4FFVD 1MFBL 3UTTD 1JF6A 3PV6B 4KDVA 2I27N 1BZ9B 1CDUA 5CGYD 1MVFA 2ED8A 3BIKA 3RIFK 1M7DA 2O5YL 5DQ9A 3NZ8A 5DVMA 4G6KL 2FWOB 2VZTA 3OR7B 3QEQD 1Q0YL 1I9RL 1L9NA 3JV4A 4UUJA 1NMCC 1R3HB 3ILPB 3B9VA 2PXYD 1X5GA 3L9RB 5BRZE 4TRPH 2BFVH 1GH7A 3W5NA 3V0WH 43CAA 2OTUA 4JPIA 2OI9B 35C8L 1K6QH 1UB5A 5EU4B 1UC6A 1CD1B 1T4KB 1N3NA 4YHKL 5ANME 3LKPA 3FN3A 32C2A 1OSZB 4CJ1A 4P2QD 4K55A 4ODVL 1JFQL 1U92B 2NY1B 4XPTH 4LARH 4HEME 4XWOC 1RZ8B 3ARUA 4IHOB 4OAWB 2G60L 3V6BR 3PDOA 2VRAA 3C9NB 3DWTA 3S3SA 1XZ0A 4XXDA 3ARDB 2ADGB 2W07A 4V2BA 4YIQB 1E27B 3DMMB 3VFNB 3C87A 1NCTA 3ULSB 1FNGB 1ES0B 4RZCA 4MD5A 2Y6SC 1FO0A 1YEGH 5IVXF 4GRWB 2VDLL 1F4XH 3KPMB 2OMNA 3VU2A 1N8ZA 3QBTB 1PGRB 5IKCA 3OV6A 4DZ8B 1Q9OA 4D94A 4GG8B 1DN0A 2NY0B 4DGVH 5FCUH 5I1DA 4HF5H 4LCWB 5IW1A 4H26B 3K80A 4KUCF 2WWMC 5IMMB 3BO8A 4M1GL 4Q6YA 5IB3B 4OJFL 1Z5LB 2BVPB 1KXVC 1K8IA 4ONFL 1MCPL 5LXGH 4CN6A 4K8RD 1VADA 3MRMB 3NVQA 5ITFA 2VNCA 3GMQB 1DLHB 3BD5A 4OZIA 3HC4H 4ZS7L 2YUWA 2DL2A 3M1BB 3VXQB 4YNYA 5B8CB 1P4LA 4HFWA 1JGDA 2GT9A 3O6FB 3U79A 1S3KH 3QDHA 2BNQB 1MFBH 3P9MB 3ELAT 2Z92B 3BZ4A 4MJ6A 4OD1H 1UH2A 1U0QA 4JFEB 5L2KB 2IFGA 4FTVA 3IDYC 2O5YH 4G6KH 2W65B 2R2HB 1K8DB 5B3NA 1Q0YH 1I9RH 1LP9B 4QRSA 4HWZA 5CIPA 2R0KL 4PJCF 3Q6FA 2ESVA 4XCEA 4N0UE 4MYWB 4UIKL 4K94C 5C09E 1OHQA 2BDNL 3R8BB 3RI5F 5E24E 3UBXI 4U6TA 4PRBB 4CRPA 5BW7C 2PN5A 3T1WA 4DZBB 1XT5A 2CK0H 4QYOA 1D5MB 35C8H 2VQ1B 2YBRB 5EB9A 2DYPD 3QQ3A 1BPVA 1CZ8L 4U1KB 3D25B 3I84A 3H9ZA 1BQUA 5EUKB 1AXTL 4YHKH 1FORL 1IAKB 3K4ZA 3V6OA 2I9LB 4CMMB 1D9KA 5DZLA 4ODVH 1ZVSB 1JFQH 4PG2A 3MNVB 5D7KD 3TPUB 2G60H 4HKJB 3MRFB 3MJ8B 1CXIA 4GRWE 3TESA 5DC4B 3C2AL 4KDTA 2XFXB 2FEEI 3LDBC 5D7JB 3BPLB 3F7YA 5HBBA 2B7DT 4JGJA 2XXMB 4HKXA 4NO2A 1ZLWK 2OXHA 3X3GL 4R7NA 1YNTB 1WC7A 4JFXA 4CGTA 4GKZA 1QBLL 5CLWA 4JFOB 3GI9H 3QULB 3OJ2C 5MENB 1CQYA 5I8EB 2C1OB 3C8KA 5F7DB 4LPVA 4S2SA 1EFXA 2CKBB 3OKNA 2L7JA 4M1GH 4X4ME 1B0RA 3F6IA 4OJFH 4PPTA 5I76A 1QUNA 3I50H 4MCZA 1P2CA 4ONFH 3QQ4A 1MCPH 5D1XA 4NN7C 4PP1D 3VXOA 5L2KE 3QIBA 4ZS7H 3OAZH 2J3SA 2LQRA 2X4RA 3P9LB 1QSFB 4GMSH 3ULUE 1UGNA 2GK0B 3TIDB 2DLIA 2JCCB 5I9QB 3WJLA 3KWWA 5DJ2A 4YLQT 4AM0A 5CAYB 4PP2A 4KKAC 5CFHA 3SKNA 1LE5B 3WHXA 2VXTL 5LCVL 4LHQB 1YNKL 3O2DH 4JZJC 2R0KH 4OB5H 2YSSB 4JFFB 5F6HI 3GMRA 4PRPB 4UIKH 2BDNH 3NPZB 3K1KC 4GAYA 3O4LA 1EHLH 3ISWA 5SX5K 4ZAKC 1NFIA 1P69B 4Z95H 3NOIA 5FECB 1CZ8H 1FL6B 4OZIF 4CNIA 3BEVB 1E6OL 3FQXA 3CCHA 3CSYA 3G5YB 1AXTH 5DRZB 3VWJA 1FORH 3WDJA 3WNNA 2ARJQ 4CUCA 3REWA 4HEPG 2CIIA 2B5IB 3SDCB 1IQDB 1QRKA 5EBWB 2Z4QA 2APFA 1S7VB 4XNYL 1MSPA 4JJ5A 2YS4A 2YUVA 5GGVY 5T3ZE 3A0OA 2HMID 5F71A 2CJUL 3AAZB 3C2AH 5T3XE 1H3VA 3F12B 2YRPA 2VUOA 1Z6JT 4P4RB 1EK3A 4UQ3A 3T0XA 1CVSC 2NY4D 5EO1B 5D9SB 3T4AA 3X3GH 2HG5B 5KZCB 1YYLL 3TBWB 3PJSB 1QBLH 1EH9A 4GW5A 4RSVA 3D85B 3P0YL 1DUYA 2JLLA 4MA8L 4PGJA 1T5WA 4HDIA 1ERNA 4DQOL 3HR5B 1QSFE 3IU4L 5AUMA 4XAWL 2BOCB 3THML 5BV7L 5CEZL 4HGKC 3WMSA 1KPUB 4UNUA 4JFHD 3T0EA 5E94B 3X11A 1ZLWH 3W9EB 1OTUC 3B9KB 5EU6B 3SGEH 5GGRY 4UT6L 3SO3C 3TH3T 2G75B 1C12B 5D1ZB 4XVUD 3DSNA 4GQPH 3S4SG 3C09B 2Q8AL 2HP4A 4XH2A 3REVA 4F9LC 4I48A 3TFKD 4Y4HB 4L3EB 4Z5RB 3TO4B 4JFFE 1IGIL 4PRPE 3RDTA 3MV7B 4JLRB 1AGBA 1HSBA 3M8OL 4RQQB 1T2JA 5F7FA 5LCVH 1ZHBA 5KSBA 1YNKH 2HT3C 4X6DE 1MJJB 3O9WB 4H1LB 4HKBA 4M7KL 5I2IB 2NY6D 1LO2L 3RX7A 1RUAL 3PXJA 4X6EB 3B9AA 4X9HA 3BWAA 2WAHA 1UEYA 5I15L 3I02A 4Y1AB 3IJYB 2AQ1A 3RWDB 3DNKA 2EH8L 3EYSL 1T21B 3QUZB 3STLB 2X9YA 1KB5A 2I5YL 3GSNA 4L3CB 4HMEA 1A2YA 2VAAB 1NCDL 3QR2A 2IFFH 4HIHA 3WNKA 5BRZD 4XNYH 4OF6A 4OFVA 4LPYA 3MGOB 2D2OA 1F2XK 1BREA 1DANT 2CJUH 2QR0A 2WWKT 4P23B 5SX5H 2DQUL 1EXUB 1BQHA 4JVUA 1OB1B 3SDAB 4LSUL 1D6EB 1YYLH 2OJEA 2OLDA 1BM3L 1X7QA 4FMKA 2PO6B 2QADB 1OGAA 5E1AA 5IT2L 1EHNA 4UILL 5IJKC 1EGJA 1GZPA 2EDFA 1IGFL 1BD2A 5C2UB 4RWHA 2NY2B 4APQC 3P0YH 3ZDYE 5D7IB 2BJML 4GW4A 4U1IA 5HTSA 4DQOH 2O26U 3QT2A 4XRCB 2WINB 4C56A 1SJHB 3T2OA 1YN7B 3FFCD 4XAWH 3THMH 5BV7H 4FA8A 5CEZH 3IFPA 2H26B 1U8LB 1CLZL 4MA1C 4U0QB 4X6BA 3MRHA 4RGMB 1NAMB 1AO7B 5EU7E 1CDJA 3MV7E 4IRSA 4UT6H 4XZUA 1EHAA 2AQ3A 5HGBA 1PX4A 3OQ3B 3VFGL 1RAMA 2W0FA 1HHHA 1I1FA 3H9SA 4F7MB 2Q8AH 4UQ2B 1MHCB 2YOCA 2BRQA 2V7NB 1KC5L 1EAPA 3CUPA 1CGWA 1MUJB 4Y16A 4X9IA 1FLRL 3E6HA 3PHOA 4LSVL 1CDIA 1IGIH 4N5ED 5F7EL 3RVXD 4KZEL 4FFVC 2X05A 3PWJB 4PG9A 4N8CL 4CKVX 2ZCHH 2W0KA 2Z93B 3M8OH 3ZKQD 3QRFM 5GXBB 3BKYL 4M7KH 4M61B 1GGBL 1LO2H 4KY1L 1RUAH 4B7IA 4LMQE 4B53A 2Z8RA 1ITCA 1H5BC 3CSBA 4JRWA 2PXYC 5I15H 3TYFA 2MSPA 4GAFB 1W0VB 4BELD 1G7HB 1F3DH 2EH8H 3EYSH 3KXFB 5IF0B 1PVHA 3Q48A 3X17A 2PF6A 1WWWX 2I5YH 2E7CA 5FA3A 4HJJL 3N50A 1NCDH 3UPRA 4LSSL 3VRIA 1FE8L 5DUBA 3H7BB 3MRJA 3H0TB 4NCDA 3ARGA 3CDGA 2NY1D 3BDBA 4C55A 3UMTA 4K71C 3MLZL 1XH3A 1S9WA 2DQUH 3E3QC 5B38G 5KSBF 2N1KA 3K2UL 4HUVA 1U3HA 4Z7UA 1OL0A 2XQBL 1B4JL 4WENB 3ARDD 1CDGA 3QDME 2JB5L 3OSKA 4NRYA 3DMMD 5C0BA 4YK4B 4IEFB 5IT2H 2OK0L 4UILH 1T1ZA 1AR1D 1IGFH 4XX1G 3GSWB 1QKZL 4Z77B 1MJ7L 2VLKA 3KNBA 3P40A 4YHLL 1JMXA 4YHIA 2BJMH 4U3HA 2HJFA 3RPIA 3FONA 1NH6A 1AO7E 1N4XL 5TQ2L 5LJYH 2APXA 4EI5B 1QTYT 2NY0D 3LN4A 1WWAX 3MRIA 3IGAA 4N68A 2CDFB 4D0CA 4U6YB 1AY1L 1QZ1A 2Y07L 4OI7A 1CLZH 2XPGB 3CXDL 5HDOA 5FKAA 5ID1B 2VL4A 3FN0L 1BMGA 4ZXBA 4K8RC 1OOAA 2J7LA 3HZVA 4JN2A 1A4KA 5DJYB 3SDXB 3ZTJH 5BZWB 1KC5H 1BIIB 4KTDL 3AS1A 1FG2B 3UBXB 5C8JB 3WS3B 3O6FD 4KZEH 2X4NB 4LSVH 5F7EH 2ATKB 2BNQD 5T1DL 4KKBD 2FYYA 4D9QD 4NO3B 3JBG7 1OAKL 4N8CH 3GSUA 2K3TA 1MHHA 4U1JB 4JFED 1CL7L 5L2KD 4XXCC 1C5BL 1S7XA 4X4XA 3BKYH 3G5VB 5GGSA 1GGBH 3KXFE 2J6EA 1P7KB 1VEMA 3QUYA 3V5KB 2HTLD 4GJTB 2C3WA 5ABDE 2A6KA 2ZKHL 4OF0A 4BSVA 2BERA 3MR9A 5SWSB 3ROLB 3UTSA 4FQLL 5C0CA 5JQHC 3RX8A 4Y5XB 5EIVA 1FZKB 1JF1A 5J11C 1PAMA 1OW0C 3ROOB 2IADB 1MJ8L 3OJDB 4LSSH 2IF7A 3FZUC 1FE8H 1MRFL 2CIKB 3RA7L 1VCAA 1BQSA 3VFRA 2JK5A 3QEGL 5E8NA 1I1AB 3DUUB 4KV5E 4TOYH 2W9DL 2X7LB 3DUSB 3GMLA 2FLRT 5EIIB 4G8FA 1QSVA 2H9GB 4HUXB 1U42A 3MLZH 3KPSA 3FRPA 2VLRA 3K2UH 5TFSL 2EXYD 2XQBH 1B4JH 4PRNB 5D7JD 4QXWA 3B83A 2JB5H 4UNTA 2VDML 5HDLA 4GUPA 3T4YA 5H37G 2QQQA 3NFNA 2Z31C 2OK0H 1GC1C 4DCQA 3ES6A 3ET9F 3CH1A 2EKSB 3W82A 5T3ZD 3CVIL 1MJ7H 4YHLH 3P77B 4QO1A 1CT8A 4HGMA 1N4XH 5EPMB 5MI0B 4Y5YA 2R2CA 5TQ2H 3EJZD 4POZC 3RHWF 3MBEB 3ZE1F 3IDNB 4Q9BA 2D7TL 1DUZA 3SDXE 1CG9B 4JDZA 3HTLX 3MNZB 4W4NA 2QHRL 4KK8D 2Y07H 3U36A 3CXDH 4OZHA 3VD4A 4F33B 2A83B 3FN0H 4MB4A 2R56L 3A6BL 3JTTB 2EDJA 2BVOB 2MCG1 5E70A 4AYFA 1IC4L 5K9KA 4KTDH 5EC2A 4MNGB 4Z7UF 1BWWA 4OLVL 1QSFD 1GHFL 1BZ7B 5HSFA 2FLBT 3G04B 4WWKB 5T1DH 4EVNA 2DBJA 3EDJA 1BOGB 2X5PA 1CL7H 4PJHA 4U1GB 4GG6A 4PB9H 4CU8A 1Z0NA 2X9XA 5LWYL 3T3PE 5A2IH 4NQUA 1S5HB 4BQ9A 3IDGA 3HUJB 4QTHB 3FB8A 3WFEL 1JWMA 3O3EB 4JFFD 4PRPD 2ZKHH 2ZSVA 3TO2B 3QWRD 3GM8A 4QLRA 1CGYA 3HZYA 3Q1SL 4FQLH 4MNHA 2ZSWA 2GYSA 3WIHA 4XNZB 5C08E 1MOEA 5HPMA 4NKIL 1ZS8A 3ZDZE 4R96B 1MJ8H 4PJFB 2DS4A 3RZWA 4ZNEA 1IGYB 1NFDA 2O61B 1JRHL 3RA7H 3QEGH 3WO4C 1I85A 4AIXA 3KPRA 2XKNA 4NUJA 4ZFZA 3BGMA 3DARA 1RIHL 1RMFL 2HMIC 5CP7A 3DGGA 1CLOH 4LF3B 5TFSH 5DD3L 4RNRA 5C0GB 1I8IA 1XR9B 1FGVL 3C60B 2B1AL 3LMJL 2VDMH 5IB4A 2NY4C 3RP1A 2X4TA 5CHNB 5DURB 3RFZC 3TNNA 3CVIH 1MHEB 1DVFA 2GJZA 4TNVF 1CICB 4MXQD 3KS0H 3O45A 4YEFA 1NCNA 3E2HC 3D85D 1BP3B 2FNBA 5C0DA 1T89C 3BXNB 3WIIL 5HYJA 2D7TH 3G08A 3RTQA 4TVPL 4F7TB 2QHRH 4MNGE 1NDMA 1R5WB 4W4OC 1OAUL 2R56H 5CZKA 1H8SA 3A6BH 5TF1H 1UG9A 5FIEA 4D9LH 5L8JB 1CFSB 5JTWA 1IC4H 5B38A 3B9KD 5EU6D 3V5DA 5E5MB 3IS0X 1MFDL 4OLVH 1GHFH 5HHPA 4XVUC 3MRQA 2EKJA 1UM4L 2I07B 4YC2C 2R1WA 2ITCA 4MA3A 4M6OL 4KK6D 4Q74A 4Y4HD 4JR9L 3TO4D 4WEBL 2A73A 4ALAL 4JG0H 3QJHB 1BVZA 3MV7D 1MH5A 6CGTA 5DEFA 2JJUA 5ESAA 5F9DC 3EYFA 3P4NA 5LWYH 3LRSB 4HKZB 3UZQA 4F7EA 4RRPG 2NW2B 3O9WD 2NY6C 4WV1C 4BQ8A 2IH3A 3WFEH 1KLFA 1MRDL 3CZFA 5E8PA 4OV6F 2YMXL 2R4SL 1K2DA 3MOQA 5HGAB 3PWLA 5IBUB 4DKEL 3L7FB 3MRDB 2CLRA 2GW5A 4Y1AD 3CFBA 3W0WB 4NKIH 4F58L 3MRRB 4YPGB 2X1OA 3QUZD 5D5MB 5GGVL 4V2CB 1Y6NR 3WUZA 3D39A 5I1JL 4L3AA 4IOSD 4OLWL 1QEWA 3NCCB 2AK1L 4OZ4A 2Y1VA 5EOTA 2Q6WA 4XHQA 2H41A 5IBTL 4FXKA 4NDMB 4PJHF 1RIHH 1RMFH 4GG6F 3HI1A 5C92A 1T1YB 1F11B 3QUML 4P23D 3EOBA 3ZTNL 1FGVH 1U93A 2B1AH 4LGPB 4PRDA 3C08L 3LMJH 3J7HA 1KEGH 4HUKB 4PY7B 5IOPA 3SDAD 1MF2L 5E8EA 2F5AL 1LE9A 5I75C 5EU3A 5IHUL 4QHMA 5ACMA 2PO6D 4M6ML 2WLZA 3BQUA 4WCYH 1AXSA 2NY2D 2NW3B 2IEPA 1UH4A 5FOBB 2BOBA 4NNYB 3HR6A 3WIIH 1NFDF 5MEOA 1R3LB 4TVPH 4M8QA 2H32B 1NCAL 3U0TB 2Y23A 3BN9D 4B7LA 3MV11 1AO7D 5EBLA 3T3MF 2D31A 4XCFL 1XCQA 3VFPA 4ZUSA 3QNZB 3QG6A 1KTKE 4MS8D 5IK3B 5DJAB 1NC2A 2NX5B 4M6OH 1DQQB 5DJ6A 3RPKA 2F53A 4JR9H 4N5EC 1GCFA 1FPTL 3VGEA 5FF6B 4P57B 4DW2L 3ULVF 3R0MA 5FGSA 4AEIL 3RUGB 1T7WA 4I9WD 1G7PA 4PJXA 2MPAH 1UZ8B 4LEXL 3VRLF 1MRDH 2VLJA 5KW9H 4KJYA 1T0PB 2YMXH 2R4SH 5IQ9B 1A8JH 2CPCA 4DKEH 4QRTA 3CMGA 3ETBF 1GSMA 2P5WA 4F58H 3KXFD 4PLJD 5CP3H 4L9LB 1FJ1A 1FAIL 1A7RH 2OI9C 4P2OA 5GGVH 3WN5B 4IOIB 2V6HA 2R15A 2ERJB 3GSOB 3ORJA 5I1JH 4ODHL 4OLWH 1AGFB 3PQYA 1T22B 2AK1H 4G9FB 1FFOB 4G8GB 4Z18A 3HZMB 1PQZB 1OM3L 1I3RB 3RAJL 4AQOA 4KKCD 4HJ0D 5I19L 3MYJA 2ENSA 1T7VA 2NY1C 1CCZA 5D7LB 1JGVL 3QUMH 5TE6H 1UXSA 4OFYA 4RMRA 3ZTNH 3P3YA 3C08H 3IJSA 5IEHA 1ACYL 4OCMC 1GRWA 1A21A 1KACB 1MF2H 4JFZL 5DVKA 3ARDC 2F5AH 3HRZB 3L3OA 5IHUH 3PV7A 1EEYA 4M6MH 5B21A 1PYWA 3NIFE 1VFUA 3GUTA 1A7OL 1AR1C 2GEEA 5KSAB 3EDEA 3MCLL 2VR9A 5D1QB 2MFNA 1XF3B 3DRQA 4PTTB 2FR4A 4P2RA 5EU5A 1T0MB 4PRHB 1BFVL 3RWCB 4PGEB 3WE6B 4EI5D 2NY0C 4PJEA 4OFDA 1LEKA 3SDYL 1NCAH 4LVNC 4L8CB 3BIBX 4RMSA 3V5HA 4KVCL 1HQ4B 1IC7L 2NX5E 1HXYB 2FJFB 12E8L 5C0JB 4ZDHA 5FUOL 4YX2L 3R06B 3S5LB 4XCFH 4IS6A 3VI3F 5F21B 4LFHG 2D0HA 5HYQA 3RUGE 2EE9A 1UYWL 4LPUA 4PJGE 5B8CC 2ZOLB 3O6FC 1BWMA 1FPTH 2FECI 1T1WA 3TZVB 1UM5L 3CJJA 5J6GA 4DW2H 4PJCB 4MB5A 1PY9A 5DD6A 3FQTB 4L4VE 4AEIH 1OP3K 1WGOA 4R97B 5FCSH 1CBVH 2AV1A 4MDIA 2DMCA 3ULUC 4K7FB 4N8PA 2HTLC 2UUDH 3VXPB 3K8KA 3T2QA 2OR9L 3FB5B 1C08A 2AKRB 2F54B 1HHKA 1S9XA 4JY4B 4G9FE 3MLWH 4NM8L 4D9RD 5SWSD 1GYAA 3E8UH 3CFDA 1U8IB 1FAIH 4HGWB 2IPUK 1KIRA 3C6SA 1I8KA 4YDJB 5DQ9B 1CN4A 1OM3H 2H45A 3RAJH 5I19H 1G84A 1I1AD 3K0WA 3VXSA 2YXMA 4QY8A 4UUJB 5FGCB 4WI7A 4G7VL 1YN6A 5JQ6L 3AREA 4PJXF 1JP5A 1SJXA 4RRPA 1WT5C 1ACYH 4RMVA 2EXYC 1FIGH 2FBJL 2C7UB 4JFZH 4QNPF 1KPVB 3BPLC 1QNZL 3BW9A 3PWPE 3JSSA 2HKFL 3D48R 1A7OH 3LKPB 3AB0B 4F2MA 3MCLH 1RSFA 2DBLL 3S96A 2GFBA 1BFVH 3EJZC 1ZGLM 5E2VL 3WFCL 3MBED 3SDYH 1T1XA 2Y9RT 1GGUA 3FQRA 5EWIL 5DK3A 4UV4L 3L95A 4KK8C 1IC7H 4DTGL 2V2TA 12E8H 2BCKB 4XXDB 5FUOH 4YX2H 4U6XA 5J8OA 3CFIC 4ZTPL 4WFGD 4LPCA 4RZCB 4GQ9L 2KBGA 1LO5A 2ATPB 5IB1A 1FO0B 1UYWH 3OL2A 1N0XL 1Q38A 2VDOL 4PJ7B 3SOBL 3EO1A 2I24N 3TH2T 3FT4A 5EZOL 4WWKD 5IKCB 4KHXL 1Q9OB 4WHYG 1UM5H 1AKJA 4PYGA 1DN0B 4JFQB 1P5VA 1HKFA 3BN3B 5DR5L 1F42A 3BGAA 4YGVB 4DJMA 2NY5C 4TTDD 2C3VA 1F4YL 1K8IB 5TDOA 3R4DA 4XVTL 5C3LD 4YBLB 4PJEF 4NRXB 2YPVL 2YC1A 5ITFB 4U1MB 1XGQB 2OR9H 5J4MA 1NGWA 4UNVA 4F9PC 4JY5L 4HCRA 4NM8H 1JTTA 1P4LB 1FYTB 4HFWB 2GT9B 3RNQB 3RVUD 4BUGA 1NCWL 5DWUL 5FV2A 3BZ4B 4MJ6B 3D18A 4Z0XA 1MCSA 1E4XL 4MB3A 4YAQB 1OP3H 4FTVB 4HH9B 5E95B 3LRGA 3UC0L 5F9OL 2VUYA 4HWZB 3JWDC 5IB5A 3SJVA 3BYYA 5D2NA 3Q6FB 4G7VH 4LDOB 2ESVB 4XCEB 1ZA3A 5JQ6H 4P46A 3AS3A 2XNAA 2GTWA 2FBJH 1HCVA 2AEIT 3NMEA 3C60D 3I75A 3QPXL 5JLZB 1QNZH 2QJDA 4RFEA 3QNXA 3QQ3B 2HKFH 4QRRA 4E0RB 5DURD 5C71A 4PD4K 5TDNB 4L9DA 4I77L 4MXQC 1CICD 2DBLH 4L8BB 1D9KB 4GKNB 4F80A 2F15A 2XN9E 4CADB 3QFJA 1FL3A 5E2VH 5F3HA 3WFCH 5MP6L 2P24A 3P73A 1CGSH 2I60H 2DQFB 4PJ7E 2HWZL 4DTGH 2C26A 3F7YB 1HE7A 1UM6L 3CNKA 2IANA 3OG4B 3PHQA 3O3BA 1WFOA 4GQ9H 5KTEH 4MXVE 4I0CC 3QXVA 1DSFL 1DE4A 3G6AB 4Y89A 5C0AB 5I16B 5EG6C 4HWBH 3IRZA 3B9KC 2CUHA 2XA8L 1N0XH 4JFXB 5C07A 7CGTA 2VDOH 4XBEL 1FFPA 1YZZA 4GKZB 3EGSA 3SOBH 1YUHB 4XVJL 2FJGA 3HPLA 5EZOH 3D0LB 5ERWA 4KHXH 1T5XA 1ULVA 4LBEA 3TO4C 5DR5H 4MWFB 4M6AA 4S2SB 5EU7C 1EFXB 4HFUL 5GGTL 1TQBB 5I76B 1P84J 1FYTE 2OZ4L 1P2CB 1CFQA 3QQ4B 5D1XB 1XCTB 2B4CH 1R3JB 4XVTH 1JHKL 3VXOB 3O9WC 2YPVH 3V9FA 1Q9KA 4AG4L 2CO6B 2NTFB 4HIEB 4R0LB 1WZ1L 2YD9A 3IS1X 1EMTL 4JY5H 4V1DA 4DOHB 1KB9K 2EIDA 1C5CL 5F70A 1NCWH 5DWUH 3TBVB 5DS8B 5HHNA 1A6TB 3AGVA 3W0WD 1MLBB 4PGZA 3KPNA 1LWRA 3QUZC 4RX4D 5I1KL 1UVQB 1FYHB 3FB7A 3KWWB 5DJ2B 4AM0B 3ARYA 2CDGA 3U0WL 4PP2B 4X7CC 5DD0L 4EEEA 4HBCL 3RJQB 3UC0H 3UYRL 2VZOA 1G7MA 4OZGA 1JPSL 3MX0A 3GMRB 1TXKA 5EFIB 1SYSA 3O4LB 4GXVL 4BYHA 4P23C 1NFIB 4WHTA 1I7UA 3MROB 4PLNC 3QPXH 4XBGB 4XNUL 4LAQL 3SDAC 5IHLB 1N2RB 4M4RA 4CNIB 3FQXB 5CD3A 4I1NB 3CCHB 2HFGL 3VWJB 4I77H 3D69A 4MQTB 1CDBA 2CIIB 4J3WA 5BOPA 3KPPA 2NY2C 3T8XA 1NMBL 2VL5A 5JA8B 2Z4QB 5MP6H 5C0AE 3DYOA 2UYLA 1KLUB 2HWZH 4TQEL 1EVTC 4G8IA 1UM6H 3VGHA 3QYCA 3WNPA 4WHCA 4OLZH 5KVGL 1ZGLP 4RGMC 1N5AA 3EZ8A 4KGLA 2XA8H 5DD1L 4QGYA 4XBEH 2A6DA 4MS8C 4IM8A 2IWGA 3HMWL 1OGTA 1P9MA 3MNWB 5HDBF 3GI8L 1DUYB 4F8QA 4F15B 2NX5D 3MV9A 2XTLA 3K8MA 5HI5D 3OKKB 3IAGC 1ZHLA 1T5WB 4YHZL 1RIVL 4L8SC 3RL2A 5IVNA 4HFUH 4ZOBA 1YMHA 5GGTH 1IILE 2CMRL 4DOHE 2X1WL 5AUMB 4A2LA 1H3UA 3B8SA 3QCTL 4AH2A 3TIEA 1JHKH 2DI9A 1J8HA 1JGUH 4N0FA 2JE8A 1NKRA 3T0EB 3UPAA 3V79C 1JZ5A 4JPWH 3X11B 2V9TA 2P5EA 4AG4H 3MLPA 3EOAA 1MFEL 1WZ1H 1EMTH 4ZNCD 1RJCA 4GXUM 1C5CH 4XH2B 4Y2DA 4WI3A 3REVB 4I48B 3U7WH 4PLJC 5I1KH 1FC2D 4HD9A 1M7IB 5F89B 1RUQL 4LASL 1AGBB 5DD0H 5F7NC 3U0WH 4HBCH 4U2ZA 2XZAL 1VB9A 4WI6A 1UCBL 3ALXA 3KYMA 1N5YL 4HPYL 4L1DA 1YEDA 5DZNA 1HYRC 3MJ9L 4G9FD 4G8GD 4HKBB 3UYRH 1KTLB 4KKCC 4HJ0C 4WTWA 3U2SA 1JPSH 3RWGA 1T2QL 5JOEA 2DF3A 3S3JA 1TJHL 3QJFA 3BWAB 4GXVH 4AENA 1A1OB 1BVKA 2LFGA 3L3JA 3HE6A 3PP3K 1A47A 3HNSH 3I02B 1E4JA 5EO9A 4CN1A 5F7MC 3KLAA 4XNUH 4JZNA 1E4WL 4LAQH 4FXGA 4O4YH 4S1RL 3NIDE 1KB5B 2HFGH 2YUZA 4Z7QE 4Z7WE 2PW2A 4OCYH 1A2YB 1OTTD 1XGRB 4YK4C 4ZPTB 4BH7A 5JXEC 2Z91B 1FCGA 5KSAD 2FATL 1NMBH 4QF1B 2XI9A 3DBXA 5D1QD 1I3GL 1CGUA 1FVEA 3GSQA 4JB9L 4PRHD 1D5ZA 1WUNT 1UQSA 2ZJSL 3KJ6L 4O02L 4EI5C 2QR0B 1KJ2L 4TQEH 1Q9LB 3WLWD 1XIWC 4EIZC 3DRTA 5DJXA 1BQHB 4OZGF 2X4UB 4NHUA 1P84K 4OFPA 5FK9A 3FO1B 5KVGH 2JF1A 3ULUL 2DLEA 5EA0L 3QI9A 2OJEB 4DN4L 3HG1A 1XGUA 2X4QA 4Z0BL 1ACZA 1OGAB 5E1AB 3PIQA 5JIPA 5DZOA 5HHMB 5ICXA 3LH2L 1ZLSL 4ZSOA 3GI8H 3R8QA 4KWUA 5F9JB 1ONQB 1IEBA 4OZFG 4U1IB 4XT1C 1RU9H 1RIVH 3FQUB 3TZVD 4BZ1L 5D96C 4C56B 4FQCL 3X13B 4IIQA 1DBAH 5M7QA 2CMRH 1RZIB 3QCTH 2DM4A 1A3RL 3QO1A 5F96L 2IMMA 4X6BB 1DDHB 3AY4C 4IRSB 4OGYL 4XZUB 2V7HB 4NKOA 5HGBB 4LEOA 4S1QL 1HHHB 1FG9C 1I1FB 1XF4B 3H9SB 2F54D 2DQHL 3RJDA 5CJQL 1EAPB 2APWA 3CUPB 1MCHA 5KVMC 4Y16B 1MCIA 15C8L 1HEZB 4QEGA 4E5XA 3QDJA 2VITA 2OR8A 4KI5F 5I71B 3RIFF 3FB6A 4LASH 4PG9B 1Y6KR 4B0MM 2XZAH 3ILQD 4EDXB 1N5YH 1CS6A 4PBVC 4RGNB 4HPYH 1JZ8A 5FYJD 3MJ9H 1KTRL 3CU7A 1QOKA 3HFML 2AERT 3CK0L 5T3XL 3V6ZA 3HE7B 4DUVA 1I1AC 2ZUXA 1YEJL 4MQ7A 1T2QH 4TSCL 5BXFB 4WI2A 1TJHH 3K2MC 4FQHA 1BBDL 3FQNB 1TTGA 4R8WL 3TYFB 1AP2A 3BP7B 3IFNL 4PJ9A 4LSTL 4N90E 1E4WH 1F13A 4X80L 4CDGC 3SEPA 4S1RH 2BHUA 1IC1A 3IFLL 5D71L 2FJHB 2A6JA 4JDVB 2J4WH 3IAPA 4JREB 4NYLA 4Z7VB 2M8XA 2X40A 4DEPB 2LU4A 4IJ3B 3VRIB 2FATH 3MRJB 2YPLA 3SKJL 3VJ6A 1I3GH 3ARGB 3SGJA 3VXRA 4Y0GA 1DBJH 5F8RC 4UU9A 5MI0C 4JB9H 4U1HA 5CJ8A 2ZJSH 3KJ6H 4O02H 3MBEC 1QO3B 1CWVA 5J0BA 1IVLA 1KJ2H 1XH3B 2UVFA 5HHME 1NFKA 1LDSA 2NY5L 1U3HB 4Z7UB 4EI6B 3LEXA 1WZLA 2AJVL 2IQ9L 4LKXA 3ULUH 5EA0H 2P48B 4XPBH 4NRYB 1R5IA 3BPNC 3EFDL 4Z0BH 1MCNA 1MCOL 2YA2A 3JV6B 4NKDA 3LH2H 3SO5A 3KNBB 5AG8A 2I9TA 3FHAA 5CIPH 3RPIB 1F8TL 5IWLA 4WWKC 4BZ1H 2DQGL 1EUUA 4LRIA 4M3KB 2BY3A 4M62L 7FABL 3AU1A 3LN5A 3LN4B 4N1CA 3MRIB 3IGAB 2BSRA 4U1GC 2X4OB 5L8KB 1A3RH 5F96H 2F8VA 1R3KA 4TTDC 4G8EA 5FKAB 4RFNB 4ELKA 5DEZA 4EQ2A 4ZXBB 4OGYH 1JK8A 4HXBL 4PJBA 3DHJA 3MFFA 4JN2B 8CGTA 2YN3A 2EDQA 4M7ZC 4S1QH 3VA2C 1A4KB 2DQHH 4PJ5B 4RGNE 5CJQH 1A6AA 1LHZA 2VR5A 3UROR 2D4DA 1JZ7A 4KKNA 1FVCA 1FYTD 2AJSL 15C8H 2BRRL 1RY7B 1BLNB 3RVUC 2FYYB 4XNZC 1OTSD 3EFFA 1MHHB 3DOSA 1G9MC 2ED7A 4OCLC 4FTVD 1S7XB 2RR3A 4GBXA 4X4XB 5GGSB 3WV0A 3HFMH 5T3XH 1UZ6E 1UJTA 2J2ZA 1UJ3A 1YEJH 2ENYA 1UWGL 4TSCH 4AIOA 1YNLL 1D6VH 3OKLA 5DRXA 2BY2A 4Z7VE 5DF0A 5I8CB 1X5YA 2A6KB 3KGRA 3QIWC 3IFNH 4N1HB 4LSTH 3MR9B 2LE9A 3UTSB 3MLXL 4X80H 2DQEH 3C60C 5D71H 3IFLH 1JF1B 5DC9B 2PCPB 3OR6A 3VGGA 1OCWL 3QXDB 1RV6X 4WW2A 4LLVA 5M94B 2JK5B 2ZUWA 3SKJH 4KH2A 1CICC 2V2XA 5E8NB