1UB5A

Crystal structure of antibody 19g2 with hapten at 100k
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
209
structure length
209
Chain Sequence
EVKLLESGGGLVKPGGSLKLSCTASGITFSRYIMSWVRQIPEKRLEWVASISSGGITYYPDSVAGRFTISRDNVRNILYLQMSSLRSEDTALYYCARGQGRPYWGQGTLVTVSSAKTTPPSVYPAAPGCGDTTGSSVTLGCLVKGYFPEPVTVTWNSGGSSVHTFPALLQSGLYTMSSSVTVPSSTWPSTVTCSVAHPASSTTVDKKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords antibody 19G2, alpha chain
publication title Structure and Dynamics of Blue Fluorescent Antibody 19G2 at Blue and Violet Fluorescent Temperatures
rcsb
source organism Mus musculus
molecule tags Immune system
total genus 34
structure length 209
sequence length 209
chains with identical sequence H
ec nomenclature
pdb deposition date 2003-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ub5A02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ub5A01
1G7IA 5K9QG 5DTFB 5C0GA 4J12A 1A14L 4HIJA 2YRPA 3A67H 3CX5J 4JO3H 2PO6D 3BJLA 4OB5L 1A4JA 4HLZG 3KPTA 2P44B 1U8JB 1RZKH 4HGWB 2X4NA 4FTVD 3ZL4H 2AS5M 4ELMB 4XXDB 5HI3C 3SPVB 4X80H 1INDL 2QEJA 4MA8H 3FQXB 2R2HA 4HLZH 3DVFA 1MJUH 4F3FA 5IOPA 1D5IH 4G7VL 4D0CB 5KSAA 1RZIA 2WM0A 4KI1A 5IVXB 2CIKA 1SJHB 1NBYA 3N9GL 3T4AB 5FF6B 4DKAA 3DX8A 1FN4B 3VWJB 3P77B 1FPTH 1A3RL 2DD8H 1ODAA 3QFJB 3MBEB 2UV3A 1YEKL 1AY1L 3RIFF 2IFFH 3V8OA 1YN7B 3X12B 1UQSA 5KW9H 5CEZE 1L6XA 2KQNA 4MYWB 2GSGA 2NXZB 4RX4A 4RFOH 2A2QT 5I19L 4AEHL 5DD6A 2B1AL 3N1FC 1IE5A 4FQXB 4ZUWB 5EIIA 3OKNA 2UUDH 1OT1A 5HHNB 3MMEA 5BV7H 4I77L 3B9EA 3SDYL 3DBXB 4KDTA 2Z91B 2A6IA 2P8MB 5F21B 4PGEA 2A77L 1A64A 3GRWL 4G7YL 4KJPC 1IAIL 4QHUA 1LP9B 4POYA 5EBWB 2VR9A 2ZCKH 1IKNC 5L0QC 3SKJH 4ZOAA 2QADB 3DO7A 1DJSA 2CXKA 3MNZA 3NBNA 4IDJL 4PJ8C 5TDOB 4X6EB 5EC2A 4I8DA 4HAGA 1AGBB 2B7DT 5EC1B 3U83A 3OV6A 4JDZB 4J1UA 3FB5A 5F3HB 4FXGA 2DLGA 1IGJB 1WSST 5CJ8A 5C0BB 4MD5B 2HFFB 1R3HA 3V4UH 4PJFA 4J3VA 3P4LA 2RJMA 4LLWA 1KIUA 3NPSC 5DHVB 5E8DH 1MFBL 4PGCA 5HI3D 4H8WC 4X7FC 2VXUL 3FO2A 3PDDA 4BQCA 4P3DA 2VRAA 3KXFE 1C5BH 1AR1C 5E4IA 1KTDA 1KTKE 3EO1A 4Z7WF 1A6ZA 1XZ0A 3MRIB 1RUMH 4BH7B 1T3FB 2FB4H 4PJHE 1MCPL 3SO3B 1TQCC 4Y5VB 4EI5A 2AXFA 1JGLH 1JNLH 2AJZA 4LCYB 4W4OC 4NZTH 1NEUA 4PTUB 4X6BA 1FP5A 4Z77B 3QUMH 4PRNB 1QSEB 1U92A 3KXFD 4O2CA 5EO0B 3GMLA 1HSBB 3TNNB 3REWB 1X5HA 2OQJA 3DI3B 4NQEB 1MHCA 1PG7H 4EN3A 3QB7C 3QUZB 3GK8L 5INDA 4X6DA 4YDVA 1MH5B 3I6LD 5E5RB 3HC4L 5FA4B 1UENA 2D03L 3U7YH 3ARXA 4KJPD 2FCBA 4PJAF 5KVGH 3L3JA 4LEOB 3L5IA 1ADQL 3EJJX 3G5ZA 1MQ8A 1TPXB 3WFBL 1L7TH 1T1XB 3SY0B 4Z7VF 3RNKA 4I18B 1WF5A 3IFNL 1ZTXH 3KPRD 2MQ3A 4FZEL 5I8KL 5BRZA 2YD3A 3D69B 1X4YA 4YXHL 3G5XA 4YDJB 3LV3B 3AB0B 3FQNA 4CGTA 1WT5C 3MLYL 5DJ2A 1EGJA 3TN0A 4BK5A 2JJUA 2GJ6B 4QRRA 1IMHC 2IPKA 1MVUA 1ZLWH 2R0LH 3QEQE 2NY6C 4F7PB 3V7AG 2NY3C 3VGBA 1J1OH 3KYOB 5BV7B 1WGOA 3JTTB 1JI1A 1K3ZA 2FGZA 3BE1H 4NP4L 4P59H 2ZNWA 5FIEA 3MRKA 2I60H 4MQXC 3DV4B 1INQB 3S4SG 2NY7L 1AR1D 3GMRA 5TH2B 4N8CH 1KEGL 4PJXB 2X1XR 4UV4L 4IRJB 5INCB 5HYQB 43CAA 2YPLA 4MJ5A 3ZE2F 1UJ3A 5AZ2H 3QEQD 4HC1A 3OSKA 3VFTB 1CGVA 4NWUH 3RWFA 1TZGH 2DIJA 3TEUA 3EYOB 2VWEC 1VSCA 2VERN 3C8HA 5CMAA 2CKBA 3D2UA 4XCCH 5K9JL 1MHHA 2AV1A 5IFHH 1P4IL 4HZLA 4RGNB 1W72L 1OGAB 1AXIB 3QNZA 5I73C 1HHIA 2FBJL 4PJIF 3V5KB 3MYJA 4ODHH 5FOBB 4NSKA 3FO1B 4WU7A 5ESVB 1XF2B 1FZOB 4OFVA 4Y1AD 1AH1A 3OKLA 1C16A 4WW2B 1I3RB 5MP6H 4K3JL 3AXLB 4TUOB 4Y4HA 3SCMA 3EOAA 3U0WH 1JGUL 5E5MB 5H2BB 3SKNB 5GZOC 5HHVH 2ZUSA 2IH1B 5EPMB 5IT2L 1J8KA 3MGTA 4PG9B 1GGCH 1AJ7L 1OT2A 4XAWH 2LTQB 2WBJA 3QDJA 3IGAA 4HFUH 1A7NH 1NGQH 1Q1JL 3LB6D 5D2NB 3VG0L 3GKWL 3UYOD 3JVGA 4D2NA 5HVHB 5CKGA 1LHZA 2H8PA 2F74A 3BGFB 1JWMA 3QUMB 4OLXL 3WIIH 5EH1A 4GKOA 5JOFA 4KMQA 3V52H 5I1LA 3SQOL 5DEGA 3GMPB 4LSUH 3OR7A 1UH2A 3NOIA 2NY3D 4S10A 2YA2A 3ULUC 2YD4A 5L2JB 1FNGA 2VWEE 3F7YB 4NQUA 5KS9E 4XAKE 2I9LA 4JZNB 4FQHB 3VGGA 1XGYH 4MQXD 4PY7B 1QRNA 3PG2A 4OT1H 32C2A 3DUSB 4N90E 1G6RL 1NLBH 5EOCH 3NCBB 1E4KA 3WIFA 1H3GA 1AGEA 4YLQT 4D9QE 1ZGLB 2ADIB 1NMAL 1DDHA 3OPZH 5KOMC 5H35B 4Q97A 4JFOB 1P7QA 1NLDH 1XGTB 1ZLUK 3NA9L 4QRTA 4Z76B 3MSPA 3QYCA 1MCKA 3QUXC 4ZXBC 1A7OH 2CQVA 4XAKD 3TCLA 4APQA 5AD0B 1WWBX 1GC1C 1J11A 3NFPB 2VLKA 1S78C 1ZLVK 2DYPD 4N90D 4C57C 3RWJB 5C2BL 3U30C 5DD0H 5MEPA 4O5LL 4M7JH 2X4SA 4U1KB 1BQHA 3FN0L 3ZKQD 5C92A 4D9QD 4HUVA 2VUOA 1BM3L 2H32H 1PSKH 4I2XA 2PXYA 3BIAX 1NMBL 1IGMH 3OB0H 1MUJA 2QJDA 2NLJB 4PJCE 2BMKA 3WHXA 3LQAH 5GZOD 2ZCHL 1J1PH 3PWLB 1T80A 4OZFA 3MROA 4X7DC 1H3PL 3H7BB 1OW0C 5HDBE 5JPMA 2CLZB 3BDYH 5IKCA 3ULUE 4Q9RH 3BI9X 3CFEA 1OB1B 4NNYA 2QQNH 4RFEB 3EUUA 5DHYB 2XQBH 3BD4A 2O5YL 4PTTB 5I8EB 2EDDA 4MZ3A 1IJ9A 1LE9B 1AXSB 1SEBA 4GG6B 5B22A 1BJMA 4P4KA 4KTEH 4KRPB 4Y2OA 4DVRH 1BECA 4ZFGL 3PQYE 4PP2A 5B3NA 4OLEA 3AGVA 2WLZA 1RIUL 1OSPL 4XNXH 5IMKA 4HMCA 3OAUH 5EOCJ 4GKZA 4L4VA 2BSTA 4QGTA 1MCOH 2NY4B 3QQNA 4OGZA 2V9QA 4O02H 4OKVB 2E27L 1HOCA 2OL3H 4I13B 4F8QA 1TQBB 5FGCE 4U1NA 3QEGH 4J3UA 1KIQB 3CZFA 1MJJB 3RWHA 2FO4B 4JKPL 1S5IH 4HFWB 3ZYJA 4F37F 2RFXB 5D4QA 3T0DA 2YHGA 5E6YA 1NBZB 4QRPB 1XGRA 4HKBA 4HSQA 4JRYB 1UB6A 2R2CA 3QUXD 4RRPA 2BRRL 4AIZA 5KZCD 1KN4H 4ZXBD 2EDLA 4G8FA 1FO0L 5D5MF 2PO6B 1NCWL 2R39A 2GY7B 4TNWK 3HNVH 2QLVB 3IFLH 3VDAA 3IDIA 1RZJL 2FL5B 5E24E 4CRPA 2OMNA 4WVRA 2GITA 1MI5E 2PTTA 3X17A 3W11C 3P9MA 3PNWA 4WGWB 1UADC 1WBXB 5MEND 1EEYB 1K9TA 1JGEB 5D7IA 4DEPB 2GTWA 1AE6H 1MIEL 3SQBA 1I8KA 5BQ7A 4HS3B 2VE6B 4WEMB 2ITDA 3MRFB 4K7PX 5IMMB 2Q8AL 3G5YA 2CO6B 1EEZB 3B43A 5J11B 3RWIB 2D7OA 4XP9H 3E2HB 3MJ7A 1WAAF 1GH7A 1W2KT 3VGAB 4PB0L 4C58B 1MI5D 2C4XA 3AS3A 3QWOA 4I3GA 3WNMA 1B0GB 2CSPA 4PJ7B 4Z7QF 5IBTH 5JW4Q 1AY1H 3G04B 1R3IL 4D9RE 1YEFL 3M8OH 2YPKA 5FB8A 5IWLC 3HI1B 1J5OL 1N6VA 1D5XA 2OR9H 1N0XH 3TV3L 2HFGL 2H32B 2HVJB 3VFOA 2KZ1B 4I0KA 3H9YA 4MNHA 2B1AH 1N4XH 4QTHB 3DURB 1SJEA 2MHAB 2AQ1A 1QOKA 1UEMA 2HJFB 3QPQC 4MDIA 3SDCC 3D3VE 5DJCA 4HIHA 1FVCB 4D9RD 3LOWA 3GSRA 2VLRA 1FFNB 5FDWA 1RIHL 2A77H 2VDQL 2YN5A 1DBBL 4XC3L 3GRWH 2HH0L 2Y7QA 3MNVA 1IAIH 2J8HA 2Q3ZA 3BP7B 2EKSA 1KACB 3S37X 1CD1B 2JF1A 3BH9B 2VDML 5K93A 4HK0A 3T8XA 2A9NL 4GQ9L 3LCYA 3DV6A 2V7NA 3CUPB 4R6UA 4QXUL 4DOHE 4UT6H 1RPQA 4JPKL 1KLUA 2LQRA 3R06B 5A1AA 3HNTL 4NDMA 4H5SB 4U1JA 2NW3B 2NY2B 5DMIH 1KTRL 1NAKH 3W11D 4ZPVA 3LKPB 1I8MB 2OL3B 1KIPA 2IEPA 2ADGA 3BEVA 3KPNB 2Y36L 5FK9A 3MLUH 4X98B 1OP9A 3SDXE 2BVPA 5GJTL 1FH5L 2UVEA 2UWEE 4NOFA 3CCHB 3PV6B 4WDIA 3V6ZA 4M1DL 4OM1H 1WICA 4KK6C 3LSOB 3TH3T 4DGVL 5FO7A 4KHTL 4WU5B 2DBJA 4NQTA 3CX2A 4U7SA 4Z5RB 4KKBC 1F11B 4X9GA 5HXMA 3B2UC 2B1HL 1ED3A 4MMZC 4OCWH 4PV8B 3V5DA 1MCPH 3GMMA 3CH1B 4Q9QL 4R26L 3KXFB 4KZDL 4OFYD 4MD0B 2VZTA 5GJSH 2FH6A 5J89A 4HPYH 5T3ZE 1XCQB 4UT7L 3HUJF 5TF0A 2QKIA 4ODUA 4NO2A 3LZFH 5T1KD 1BFOA 4RAUB 3TNMB 4KMTL 2NY5H 2HJKA 1NJ9A 1MFCL 2XTJC 3MODL 4DFIA 1EUUA 2HJLB 3ET9F 2W0FB 4C56A 2PETA 3GK8H 4NN5B 2R23B 3QPQD 3SDCD 3VXNA 1T1YB 5I1CL 1OF2A 4Z7UA 3UROR 1I9EA 3TO4B 1GCFA 3FHQA 2VABB 1FLTX 4FA8A 5L0QB 3KPRB 3SKOB 3WMSA 3HR6A 2X4QB 1DBAL 4NRXB 1G9ML 2H1PL 3C2SA 1ADQH 3KLAA 3KYKH 4PRBB 5JMOC 3CXHK 4I0PB 3IFNH 4OLWH 5D9SA 1OHQA 4YXHH 3TLRA 5B21A 4S11A 3QG6B 5I1IH 3IDYC 5GRJL 3ARPA 3IETA 2AEIT 3HTLX 3VXUD 5GGVL 3H3PH 1HN1A 2I25N 3FFCE 1IM9D 1CFSA 1N64L 4BJLA 1KB5L 1H8NA 5I75B 1QBMH 2AEPL 4OCYL 1CDIA 3VXSA 4HJGA 3MNWB 2X89A 2GT9B 3RDTC 1R5IA 5IHBA 3IAGC 2JCCA 3HC3L 3EO0B 3MV8E 4XT1C 4MJIA 4ZUVB 1KG0A 3PL6B 4HWUA 2VXTL 1F8TL 1VFUA 2I24N 4MS8C 4J3TA 3UXFA 5ALCL 3S37L 3QEQB 1QFPA 1X5LA 5K9QI 5CINH 2XWBB 4RWYL 4KJYA 4HT1H 4TSAL 2NY7H 3D18B 3FFCD 1HHJA 2XTJE 4KKBD 1CDHA 1KEGH 3B2UD 4RGOL 2C1PA 2FNBA 4N0RA 5CP3H 3UO1L 1X44A 4X4ZA 4HWNA 3F58L 5AZEL 1E4JA 2YMXH 2ZUXA 4Y88A 4GBXC 3MV8D 1P1ZB 1U8JA 5E95B 2NYYC 5EG6C 4Y1AB 2FJHA 5LQBL 5HYFA 1J7VR 4ELMA 2Z0BA 5GRVK 1DBKL 5BXFA 3DETC 3G9AB 5E70A 1VFBB 1D6EA 2DRUA 2FBJH 2VITA 1T04B 5IVXA 4XP4L 2XTJD 5FYJU 1FN4A 2BNQA 3QFJA 3MBEA 4Z0XA 5C71A 2YUWA 3AMKA 2Z31A 1JGUH 4RZCA 1B2WL 1U9KA 2DDQH 3L3DA 4L1DA 4NO3B 5J6HB 1D6VH 2X4PB 3PIQA 3W0WA 4OD2B 1Y6NR 4P46A 1AJ7H 4YWGL 3P40A 3VFMA 5EULV 4GRLC 3RHWK 2ZSVA 2P5WA 4CADB 1Q1JH 3VRJA 1FNSL 3GKWH 5HHXL 3BKCH 4G6KL 1A6VL 3SDAB 2XZCH 3ZTNL 2NY3B 3Q2CA 1JYWA 4OLXH 4QKXB 3V6OE 4ZUSB 4R96A 1CLYL 4MA7H 1FFRA 2HLFC 5T1LD 5EBLB 3SQOH 5I1AA 4N0YL 1IEAB 3P30L 3CC5B 3DYOA 4H88H 1PEZA 2Z93A 4H0IA 4CKVX 4OV5A 3HAEA 3IDGA 3BO8B 3OGOE 2P4AB 3RDTD 2R4SL 1ZLUH 1G0DA 4MS8D 3F7QA 4FQ1L 1S7VB 3BPOB 1TTGA 4NKIL 4K7FB 1G6RH 3SE4A 4X6EA 2A9MH 2UYLB 3AREC 4NO5B 3ARUA 2EO9A 1HCVA 4ZO7A 2J8UB 1I8LA 4NQDE 2A6KB 2F5AH 5KS9B 1YEGL 1T7WA 3FO0H 3NN8B 2VZSA 4P2CG 1NMAH 2P47B 3L5XL 3IRZA 4PJBE 1KC5H 4ODXB 3QDGE 4YHPA 5E08H 1V3KA 4R4FL 5D70L 3NA9H 4GBXD 5HGDA 1ORQB 4MD5A 4Z78B 2HFFA 3UTQB 4PUBH 2NYYD 4E0RA 4GKSB 3KHQA 5H94A 4OIBA 3MLRH 1QSFB 3ZT7A 1FNEA 1JK8B 4NRYB 4DGIL 3OF6A 3B2VL 4OCSH 3DETD 4HK3N 5E6IA 3W81A 1IAOB 3B9AA 1PQZB 4NQDD 3FN0H 3MRHB 2D0FA 2ZZUT 3MV11 1F4YL 1BM3H 3V4PL 5CKAA 5D1XA 3U4AA 2VDNL 3QDGD 1F90H 5DZNA 2A1WH 3MCG1 3T2OA 4BH8B 1MQKH 4KV5F 1EK3A 3O6LL 4Y5VA 2ZCHH 4KHXL 4OTXH 1VHPA 2AK4A 2R9HC 4BSJA 1T2XA 4Y89A 3A0OA 2F53A 2DM4A 2N7BA 4Z77A 4GRLD 4X9HA 2EE9A 5DUBB 4EUPA 4FQCH 1HSBA 4MQTB 3NTCH 1HKLL 3KS0H 4KZEL 4Y4FC 5CS7A 4FFZL 1ZSDA 2DI7A 4F15B 4MJ4A 4WHTB 3W5NA 3JWDC 3DUUB 4YPGA 3VXTB 2A6JB 2AGJL 1X5FA 4YXLL 2HLFD 4GW1B 2R56L 5FA4A 3L3OB 4ZFGH 1KENL 4MVBD 1T21B 3CDGB 3MCLL 3QUKB 1IZKA 4LIQL 1S7XB 4LEOA 1OSPH 3E6FA 4M1GH 5DF0A 3LS4L 4OZIF 3BP6B 3CFJA 4POZC 4XBEH 1FFPA 1PFCA 3F7VB 2Q7YB 3SY0A 2HWZH 2VZVA 3CNKA 3S34L 2E27H 3D69A 1RHHB 3T3MF 2FEEL 4LQFH 3LV3A 5I1HL 3ARED 3QUXB 4KQ4H 5FCUL 3JWOL 4JKPH 3EDDA 5KZCB 1U8HB 3QXWA 1CWVA 2E7LA 2Q1EA 4HS6A 3U30B 1PG7W 4NZDA 1QG3A 3KYOA 5C0CB 2BRRH 1YMMA 2D0GA 1GHFL 2BSSB 2VLLB 3ZDYE 5MENB 4JFDA 1TZHA 8FABA 3V7MA 4NRZA 3IVKB 1T03H 4NHUB 4NPYA 2DIBA 5E2VL 2BVUA 3SDDB 3WLWC 4OZHF 2X7LB 1A1NA 2Q3AA 5CJOL 1CT8B 3AMLA 3M17A 4PJXA 2BP3A 4N9OB 4XNYL 2XWJB 2YOCA 1G6RB 3K8MA 2FX8L 4RISH 3IJSA 3GMNB 2Q8AH 4G9DA 1NFDF 3ARVA 4E41E 2R9HD 3KS0J 2IC2A 2RGSA 4IMLB 1YEHH 5FYLE 4OJFH 1T66C 3QULB 1ZT1B 2XZZA 3WFCH 4UV7L 3GMQB 4PB0H 3KYNB 2KDGA 5I16B 4HW6A 3U46A 1YDPB 3FO1A 4Y4FD 3FT2A 1XF2A 4U0QB 3MUGB 1R3IH 5CGMA 3G6JF 1Q9WA 1YEFH 4TUOA 4X4ME 2G60H 4XNUL 3WL9B 4ELKA 3F5WB 1D5BA 1D9KA 4C55A 4E41D 2ORBH 3SKNA 1KTLB 2XXCB 5MEQB 4RMUA 5TFSL 3TV3H 3O6FC 4LSPH 4JLRA 1DANU 5F7KC 1B0RB 1DQLL 1MAML 2DJUA 3FL7A 1DUZA 4POZD 5IW6B 2XNAB 4LGRB 4ORZC 4OQTL 3I75A 4JN2A 1C5CL 4TVPD 1IEHA 35C8L 1OAKL 4DCQB 3CIQA 1XF5A 1LO4L 1NKRA 1NUDA 2AJXH 3BH8A 3T3PF 2X9XA 3D85D 1VGEH 1RIHH 3IJHB 1C12B 5TQ2L 4XC3H 1WFTA 2PUQT 1RQ5A 3I85A 2XY2A 2B4CL 4K8RL 1MRDL 3HZVB 1VADB 4ORGB 4Y7MA 2R1WB 2VDMH 5KOVC 5DMKA 3VXRE 3P0GB 1MF2H 2IQ9L 1NGYB 2EYRB 3QI9B 4GQ9H 2YD8A 2C1PB 2NZ9C 4Y16A 3IDMB 5D2LE 5K9OB 1BGXL 1NKOA 4PY7A 1CBVL 4WJ5B 4UMGA 4B50A 4OLVL 3WLWD 1Q72L 4DQOH 3VWKA 1QO3A 4XMPL 4JFHE 3DMMA 1CXFA 2ZUQC 3IXAB 1YYML 3FHAA 1E6OL 2DLFH 5IFJA 4ODBD 1X6NA 5DUPL 2Y36H 3LN5B 1S9XA 1F6AA 1YJDL 2C4FT 2I07B 2AQ2A 4I5BA 4J4PC 5GSVB 1FH5H 4LPYA 3EYFA 5JXEC 3DROB 3UBXG 4M1DH 4LAQH 3LHPH 4X5LA 3LAFA 3RWJA 2V5YA 1T0MA 3NGBB 4OFIA 3UPRA 3SDXB 4JFHD 4IRZL 4N68A 4XP6H 4F9LA 3Q3GB 4LU5L 1MPAL 3LDBC 1FIGL 3A6OA 5JUEL 5KSBA 4Q9QH 5F7DB 4KZDH 2K3TA 5HGHA 3ARTA 4XC1H 1Q9OA 4YE4L 3QISA 2EYTA 5CSZA 5EA0L 2BNUB 1FSKB 4PJGE 1H5BB 3S8WA 4RA3A 3FB7A 2H45A 3O6FD 5LBSL 4NN7B 3TBWB 1S7RB 3VMPA 1MCNA 1ONQB 4K7PH 1CQYA 4KMTH 5DD5H 1MFCH 1XMWA 5CJXC 4ISVA 3AM8C 2YD5A 3PXJA 2ESVE 4H20L 5I1CH 1BOGA 1CL7H 3JV6B 3PJSA 1RZFH 1SVZA 1T2JA 1A6PA 1NAML 1YMHA 5ADOH 3SKUD 1AXSA 3MJ8B 3ILQC 3Q1SL 2R29L 1DBAH 3BW9B 5CZVL 1G9MH 1HILB 2H1PH 4MJ6A 3VXUB 3MACH 4KXZH 3RL1B 1OL0A 3O4OB 1N5YH 1IM9B 1LK2A 3JUZA 4DJMA 3DRTA 4MNGA 1UGNA 1S9VA 4LMQI 5KN5A 3DX7B 3RY6C 5GRJH 2ESVD 5GGVH 5GRXG 3IT8D 4C4KO 4Q6IA 1KIQA 4XH2A 2EDHA 1N64H 1B9ZA 2IAMA 4HFWA 2FHFA 4YPJA 2X5PA 1CXIA 3FFCB 3KPPB 3QNXB 1E27B 1I1RA 1NBZA 4QRPA 4WUUD 1IC4L 1AP2B 3SOBH 1F8TH 3U6RB 4J4PD 1IRAY 5I6XB 5ALCH 3BYYA 3S37H 5FYJE 4O2EA 5JXED 1NCDL 3K2UL 4RWYH 4KROC 2H9GB 2YXMA 1FV1A 1JWUB 3AY4A 4KFZC 1N7MH 4FTVA 4PS4H 5CILL 4RGOH 2OM5A 5DVNA 5T1MB 2H26B 3OJMB 3UO1H 1I7ZB 1S7UA 3STBA 5SWQB 1WBXA 3F58H 5AZEH 1EEYA 4F57H 1FC1A 3MO1A 3QO1B 2WAHA 2VE6A 2AXGA 2D2OA 3CXHJ 2J2ZA 1HI6A 2H6PA 3PWJB 5DVKA 4LSQL 3RWIA 1CGYA 5FYJD 3UTSE 3C5JB 3MJ9H 1UYWH 1B90A 1FLRH 4MQ7B 2ZOLB 4XVJL 4NO0D 2FD6H 2FR4B 2ZWLT 1E28A 5EOTB 2CR3A 4FHBD 4TTGA 1B0GA 1EDQA 1DN0A 3WFHA 2HFTA 5IEKB 2ARJB 4JB9L 3CSPA 1MY5A 1B6UA 2HKHH 2FZ3B 2C9AA 3P0VL 4LAJH 5C6TL 1B2WH 3U9UA 4BSWB 2EIBA 3VG9C 2LU7A 1OTUC 4ERSL 4LF3A 4M43H 3UBXB 3TC9A 3UTSD 1P7HL 2EDJA 2H32A 2P46B 4QO1A 5T1LB 3U9PH 1FNSH 1IAII 3U0TA 3MOAH 3MLXL 3RZCC 1A6VH 2MHAA 2AABH 5EZIH 3WV0A 1I1AC 3QIUB 4YBQC 1QKZL 3ZTNH 3PGDB 4ZD3H 4MSWB 3GSOA 3DXAE 3LEXB 3KPSD 1CLYH 3OR6B 4Z7WE 4PD4K 1EVUA 3MREA 3NZHL 3P30H 4HBCL 4WEBL 5HPMA 1RFDH 2YD1A 3HNSL 4LSRL 3I02B 5LXGL 5TGBB 4CU7A 1KJMA 2OZ4A 3AS0A 3P4NB 3BH9A 3TIEB 3NABH 5C0IB 4WEUD 4WWKC 1SYVA 5D1QB 5DEFB 3RVVC 4LKCA 3MA7A 2Q76B 1IBGH 1YZZA 3H3BC 5IB3B 4NKIH 4JR9L 1VFAB 4KROD 4WNQA 3DXAD 5I8CB 4OCLC 1YEGH 1OAYL 3SGDH 1MCJA 2ATPB 5HYIA 1K6QL 4NJAL 1S7TA 2EH7L 3ILPB 6CGTA 3DRQB 4LVHB 1I8MA 4KDWA 3RVWC 3KPMA 1SM3L 5DQJB 3ZE0F 3UPAA 4NQDB 2YA1A 3MRQB 3KPNA 4WFEE 1LEIA 5IK3B 2EDEA 4JQXC 4PJAE 4KI5F 3MRNB 1FG9C 3O41B 5GRUH 3QDGB 2JIXA 3CVHB 4LASH 2GI7A 4DGIH 1YEDB 3B2VH 1I1YB 3JUYA 3PV6A 3VCLA 4Z7VE 1UG9A 5ITFB 3LSOA 4TVPH 5SV4A 2JK5B 4Y5YC 2CGRH 5JW3L 4Q6YA 3W39A 3NFNB 3J7HA 2AEQL 3WD5L 3TZVC 2ID5A 3E8UL 4GRLB 4IRSC 4LCUB 4MJ2A 3CDFA 1VPOL 3VW3L 5IB1B 3KXFA 4XMLL 3L7EB 4BZYA 1OTUD 3T2PA 2IQAA 1OVZA 1OOAA 4WUKL 3STLA 1WIPA 3NIFF 3PWUB 1F58H 4PJHA 2C3VB 4MXWL 4PRPE 1H8OA 2DQIL 2M1KA 5DK3A 4L8DB 1PY9A 5ERWB 4KZEH 1F6LL 3RZCD 3X11B 4FFZH 2HJLA 4HZAA 4HWBL 3QZWA 4YBQD 2ADFL 2R4RH 5T5FL 1IKNA 3QWRD 4YXLH 2W59A 1KN2H 2R56H 3I50L 5KVEH 1C8PA 2XZAL 4P2RE 5ITBH 1HCFX 1MIML 2DQEL 1KENH 1HYRC 3QCUH 3MCLH 3ZE2E 2FIRT 4ZPTA 4OAWB 2X4QA 2P8LB 4PJ8A 2QSVA 2JJTA 2O61B 4PRPD 3AREB 1DQQA 3W5MA 3DYMA 4WWKD 3BGMA 1OM3H 5FUZH 3RVVD 4EDWL 2P24A 4J23A 2HN7B 1R0AL 4O2FA 4NNXB 4L8CA 1HH9B 2H3NB 1A9BB 1XGQB 3JWOH 2AEWA 3FQTA 1HXMB 4ZNEE 3L1OL 3UTTD 3RU8L 4D0DB 3IFOA 1Z3GH 4YDKL 4U3CA 3WFDH 3MV7E 1S7WA 3RVWD 1CI5A 1NANH 3EO0A 4ZUVA 1MREL 1QZ1A 2F5BH 1FG2A 3BPCA 3TVMB 1EJOL 1BJ8A 4F80A 5AYQA 3GBML 3QEQA 3CDYA 5E2VH 1EFQA 3QP3A 1URLA 1FNHA 3TT1L 4G8GD 5CJOH 2FX7L 2RBLA 5E7BA 1CXLA 1E6JL 2EIEA 2LABA 4UTBH 1BZ9A 3HE6C 5I74C 1LDSA 2F54B 3RX7A 3WXVH 3MV7D 3TZVD 4KPHH 2Z8SA 4IRSD 4S1SL 2ZOKB 3CK0H 4LSSL 4XPBL 1O7VA 3VFGL 2DQDL 4Y4FB 3BOVA 1MWAL 5C0NC 2EECA 3NCMA 4DN4H 5D6CA 2R1XB 5LGHH 5I66A 4UV7H 4X6CB 3T2QA 1JVKA 1EERB 3R1GH 3VXOA 3O2WL 5DVMA 1U8MA 4G8EB 4E41B 5CBAB 2BVQA 3S3JA 1Z5LB 2BSRA 1JRHL 4D3CH 2F58L 1S7QB 3U2SB 2V2WA 4JFYA 4B41A 1KXTB 1U3YA 3SJVB 1NCUA 1RMFL 1CLZH 1EV2E 5I1GL 5J6HA 2X4PA 3TBTB 1RURL 3G6AA 2A38A 3C9NA 1MCEA 3LKSA 3TBYB 2CDGB 1ZVHA 3MFGB 1WT5A 2Z92B 1H0DB 3D85B 5EORH 1WBZB 5J13C 1CLOL 2C26A 4OQTH 4M8QB 1OD7A 35C8H 4PJDB 1QSVA 3EFFA 1MCFA 1KBGL 1RV6X 4MAYC 3O8XB 4DKEL 3RAJH 1LO4H 5B8CC 1X7QA 4HK3J 3HG1E 4ZDHA 3NACL 5E6ZA 3MPCA 5EBLA 4QEGA 5C0RH 1IEAA 5C09D 2B4CH 4K8RH 2MPAL 5BVPL 5M95B 1EO8H 3OJ2C 5FGSA 4NQCD 4DAGL 5JHLH 2DLEA 1KPUB 5KJRH 2APFA 2XY1A 5FYJH 3ULSA 3MRDB 3LN4A 1BGXH 3BUYB 4KU1A 5JXAL 1X5JA 1NBQA 3FFDB 5JW4N 1T22B 1UH4A 1Q72H 2CR6A 5D93C 3HG1D 2UYLA 2D4FA 4P57A 5HPOA 2KBGA 2CDEB 5KS9A 2FLRT 3FO9A 4FXLA 3QDMB 3NN8A 2PR4L 3NZ8B 1WZ1H 1YYMH 3D25A 3HE6D 4U1IA 5IB5B 1E6OH 3MV9E 3MRBA 3B83A 3KLHC 2DYPA 2ED7A 1A7BA 1LVEA 1ND0B 1DSFL 5IW1B 4OM0L 3O3EB 1QLFA 4PJ9C 3H9ZA 2EIZB 1YC7A 1JZ5A 4Y4KB 4QCIB 4DN3L 1ROWA 5J1TC 1IQWH 2EC9U 1YNTB 2YSSB 3GSNH 1IAOA 3LEYL 4IRZH 1BFTA 2BCKB 2EH8H 2V5SA 3ZYIA 1M7IB 4F7TB 1WTLA 1NDGA 4OLUH 5F9JA 1IM3B 1FIGH 2V7HA 3GSUB 1ZVYA 4NJ9H 4UU9B 5DFVD 3MV9D 5TE7H 5JUEH 5L88H 4RFNB 5ADPL 2WK2A 1LK3H 5MI0B 4C54A 4YE4H 4BH8A 3L6FB 5EB9A 2G5RA 5EA0H 4NCC1 5GSRB 4KK5C 2QHRH 4UNTA 1TENA 5IESL 2BZDA 3D5OF 1D3CA 2GJZB 4XP1L 4PJCA 4JO4H 5DUBA 1JHLL 1FE8L 5D5ME 1LEKB 2J7LA 4DTGL 2D31B 2FGWH 3QG7L 4MAYD 3VXTA 4TSCL 1NAMH 3WHE1 1S5HB 3ZKXC 4FZ8L 4HUUB 3Q1SH 3FB8B 2FBOJ 4HWZB 3L3OA 5CZVH 5AEAA 3X14A 4NKMB 4WHDA 3QUKA 2B5IB 4P4RB 1Q0XL 1S7XA 4QOKB 1T20B 4GRWF 4NQXB 2Q7YA 3JBG7 2ZUQB 2IADB 4IJ3C 3HZKA 3VD3A 1I7TB 3PQYA 1RHHA 3BQUC 1NGXB 4KY1H 1WAAE 2LFGA 5C0EB 1H3TA 5KAQG 3QIWC 3UYRL 3EGSA 5ILTH 1JPFB 4WUUB 4XBPA 5E9DE 1RZJC 2AJ3B 3QUXA 3K74B 5EZLA 1DQJB 1G6VK 2FO1A 5C07B 4Z7QE 4ZXBA 4F58H 4PRAB 2IPUG 3JXAA 3MZTA 1RZGB 3KLHD 3OHXB 4PRDA 4KRLB 5JTWA 3ULVL 1F4AA 1Q9LA 4TUJA 1EO5A 1IC4H 5I9QC 4PJ9D 4BKLA 4NQVA 2BSSA 2YBRA 1SBSL 5MENA 3LDBB 4NM4L 1SHMA 1EGJL 5IJVA 1KPRB 4PGBB 5DJ0B 5L6YL 4NHUA 4WFHE 3S88L 1AGDA 3N1GC 4Z0BH 5E9DD 2WUCH 5I76B 1UXWA 2EXYC 5I1EL 1F42A 3PDOB 1ZEAL 5CEXB 1OW0A 5DC9B 3TF7C 2Y07L 3BPNC 15C8L 1VA9A 4YHIA 5DK0B 3ARQA 3QRFM 3S5LG 1MI5A 4RMRA 1X5KA 1YY8A 3C5ZC 2VQ1B 3PHOA 4Q9CA 4KK5D 2DS4A 2J5LB 4LSVL 4PREB 4N9GA 1ZT1A 5CUSH 3T65B 1PZ5A 1TNMA 4K94H 4WFHD 3GMQA 1T1ZB 3QAZB 3KYNA 4HC1L 3UCRA 5DQ9B 4GW4A 5B38A 1G7MA 2VOTA 3RFZC 3OG6B 3U4EB 5JORB 3H2WA 3MRCB 3MUGA 4JE4B 3P73A 4L9LC 5CEYA 1YQVL 3ZTJH 4ERSH 3GSNB 5C8JB 5C3LD 1BOYA 3MFFA 4M5ZL 4Q2ZB 2NX5D 3KPSB 5BMFH 4AMKL 4JHAL 2DJSA 5IHUH 5HD8C 3WIHL 4ZFOB 3TJEL 3VRIA 1XGPA 4CAGA 2XNAA 1I7UA 3B9KC 1CR9L 4UAOB 4YNYB 5IMLB 2DQHL 1AO7E 3NH7H 3BQUD 1WCBB 5IF0B 3QIWD 5FYKL 1YN6A 4IOIA 2IF7A 3C08L 4LVOB 2O5ZH 3GJEA 4GXUN 3QXAB 4WEBH 1RJLA 5F9WC 1AKJD 4K07A 3HNSH 3BAEL 3MXVL 4BELD 4LSRH 1MNUL 5LXGH 4F7EB 3VDCA 3K7UA 5JW5B 4XMKH 1GZQB 5SX4I 3HUJE 3S36L 3E6HB 1U95B 1XCTB 4N0FA 4ZUTB 4EEEA 5K9OA 1QLEH 5F7WC 1RUQL 5BZWB 4ZFFA 3WLBA 4I4WB 3H9SE 4JFXA 4P2OC 4NJAH 2EH7H 4A6YA 1P4LB 3EHBC 4LCWB 3QPXH 1J12A 4QHNA 2WV3A 1KB9K 2AERT 4GKNB 1PYWB 3VFRA 2D7MA 3C5ZD 3FQWB 5DQDL 4M02A 4ZYKB 4XXCC 1JV5A 3C6LA 3SCMC 3BDBA 5H8DA 3DROA 4WHYG 4OFYA 5IWLA 5GRZA 3G5VA 1CG9A 3H9SD 4UBDC 4PD4J 3SDXA 4YZFF 4WHYH 3ZHDA 4JDVB 2UWEA 3WD5H 3E8UH 4GS7C 3BZ4B 2R8SL 5EU4B 3TBSB 4AH2B 4K3DH 4GMSL 5T1KA 4XMLH 1I85C 4H25B 1RK1B 1P5VA 5DFTA 4OD3L 4WUKH 1CL7I 3CU1A 1LO2H 1FFQA 3M45A 3SDCA 4EBQL 1CE1L 4NT6B 5CIPH 3EW3B 1U8PB 2DQCL 2DQIH 2ICWJ 2VYRE 1ZLSL 5HD8D 3TBWA 2AJVL 5K9KB 1UACH 5HYSG 3B9KD 5JHDE 5I2IA 4KXZI 2EE6A 5ICZB 1T0NB 3M1BB 5DRNA 3LRSB 5E00A 3PWNA 1JCKA 1TJIL 5E1HB 4KAQL 2ADFH 3RUGF 5T5FH 4M1CD 4OSUL 3S5LB 2XZAH 5F1IB 3X3FL 3INUL 4S1DC 1MIMH 1A22B 2DQEH 2NTFB 1VERA 4HUWA 3TYGL 4CMMB 1UM6H 5LAXA 4YC2B 4DUXA 2KKQA 1E4KC 1AC6A 2VLJB 3NCYP 1MRCH 1NGPH 4HIIA 3UTTB 1FYTE 3L95A 5JHDD 3L5HA 4KJWC 5BJTA 1CICC 1NC2D 4XCNB 5J9PB 2EDXA 3F65A 4JY6A 4C59B 2YD9A 1MJ7L 5GHWL 3CXDL 1LMKA 3EJZD 3L1OH 3OKOB 3DARA 4UQ3A 1FBIL 1HQRA 4JANA 4P2OD 2WINB 3D2UD 2VDKH 3RU8H 5C0DB 4MD4A 1CZ8L 3DGGA 3B5GA 3EHBD 5GS0C 5ICYB 2ICWB 3VH8G 4G8GB 4XNMA 1FL5A 4XPHH 3FFCA 2Q6WB 3MOBL 4Y5YB 3TGXA 2FJFA 2XZQL 1EJ6A 4HS8L 3MRLB 3SCMD 5KG9B 3MV7B 5E94A 4ZNCD 4JAMA 1NPUA 1F13A 5B39G 5C0FB 1JWSA 3MV8A 4DWHA 3U4BH 4UBDD 1UM5L 1MJ8H 3JWNC 2WBJD 5A2FA 1TETL 1I7ZA 4HX1B 2HT3D 1X9QA 2NPLX 3MJGX 4E5XB 3L9RA 3IU3A 2ATKB 1DLHB 2K7QA 1KJ2B 3IJYA 25C8H 1UKSA 4TULH 1AGFA 1BIIB 2E3VA 4U31A 2APXA 3UC0L 3OKDA 4XX1E 4P4KC 3RTQC 2DWDA 3ZZ1A 1TDQA 1JRHH 1BEYL 1DEEB 4BQ6A 4JZOA 2QQKL 1S3KL 3MR9A 1CFBA 1DQTA 4JFEB 4S1DD 1ZVSA 3EDFA 4KQ3H 1CXHA 5I1GH 2XWTA 2CLRA 4YIQB 1RURH 3K4AA 1NQBA 1DBML 2BK8A 2UZXB 4PJ5B 5EZOH 1INEL 1WISA 2YKLL 1GGBL 5AYUL 3DHJA 3GFUA 5C09B 3HRPA 1I1CA 4KJWD 4YEEA 1CICD 4JM2F 2DQGL 4JCMA 4DKEH 5CIPB 4NQCB 3RDTA 3EOBB 4G5ZL 4APQD 3FKUS 1FNLA 3OR6A 4U6VH 3FTGB 3WUZA 3TBVB 5IIEA 3LKRA 2MPAH 4O00A 4EOWL 5GS0D 1LWRA 5F7FA 3I02A 5DXWA 5HYSB 3V6OA 1AXTL 1A47A 1C1EH 3BZFB 4KV5E 5CFHA 1BD2E 5IG7B 2X4UB 5F6HJ 4JRXE 3FT3A 3HE6B 5I74B 4CNIA 2ZJSL 3BIKA 3HPJB 4FQJH 4P9HC 1BAFL 1ZWIB 1XGUA 2DJ4A 4GBXA 1ETZB 4OZGF 3X3GL 3BHBB 2R0WL 1BVLA 2ATPA 3LIZL 4G9FE 3KNBB 3ILPA 2NZIA 2WLYA 3WHE0 5ID1B 5CBEA 1JHTA 2G9HB 1DSFH 1BD2D 2CRMA 4NQDA 3UP1A 1J88A 4PJBA 3O41A 2OR7A 3QDGA 1JTPA 3CVHA 5CGTA 4OZIE 3QHTC 4WI9A 2NMSA 5IQ7H 4P4KD 3SN6N 1NCTA 4NOBA 3T3ME 2JK5A 3OGCB 4G9FD 5J4MA 3VH8B 1S9WB 3U7WL 3NFNA 4KTDH 2F19H 2BOBB 2DQFB 2KZWA 5ADPH 4GRLA 4LCUA 2OLDA 4OGXL 1ZHKA 2VSDA 1FZMB 1DQDL 5MEOB 5IESH 5F72S 4JZJC 3WFEL 5B39B 1C08B 4MAYB 2I9TA 4MGXA 5F1NA 4HIEB 3TP4A 2OJEB 4XP1H 4TPRH 1IC7L 3UX9B 2HFEB 2BY1A 5LKNA 1A6UH 3D39E 4DTGH 3ARDC 3CZJA 1A1OA 5DK2B 2WIIB 4WFGE 4ZTOL 4OZHE 3ARFB 4TSCH 4L8BB 4U1SA 1G7IB 4FZ8H 2RB8A 3OZ9L 2VDRL 5C0GB 1ZT4B 4M7LL 2FEEI 4HIJB 1A4JB 2DQUH 2X4NB 4E42A 1LO5B 1K5NA 1T2QH 5C1MB 1U3HC 3AREA 3KGRA 1NFDE 5T33L 4GAYA 5EU7C 5DJDA 4YX2L 4F3FB 1O0VA 5IOPB 5KSAB 3D39D 3G6DH 3DUHA 4MA1B 1CTOA 2HN7A 3VFPA 2CIKB 1NBYB 4WFGD 3DX8B 4XPGL 3LKNA 4NNXA 5FDYA 1A9BA 2BJML 2EDQA 4NKDA 5I1KH 4X8JA 3J8F7 4CJ0A 1T5WA 3G6JE 1GIGL 3ULVH 1UCTA 1UQSB 4P5TC 1A4KA 2ZPKL 1JPTH 3EYSL 1SBSH 5DD6B 1EGJH 3ARBC 4LIQE 3RWDA 5EIIB 3OKNB 4HWEH 5ICXB 1SY6A 1U2CA 3EFDL 5FO8B 2HVKA 3VFWA 5E0QA 4HIXH 4KKLC 4PGEB 1YPZE 4ZTPH 5FAAA 3GHEL 1IKFH 4PFEA 4MX7A 4QHUB 4XRCA 3SKMA 3ESVF 4P3CH 4LSVH 4XPAL 2W9DL 3REVA 3V6BR 3DO7B 1SJVA 2VLRD 1EXUA 3LEVL 5EU7E 1JYVA 1U3JA 4G8EA 5SWSE 3HMXA 4E41A 1Z5LA 1YNLH 4LSTH 4AG4H 2NX5B 3ARDD 4IIQC 5E8PB 2MSPA 2WQRA 3WSQH 3U2SA 1YQVH 4J1UB 4HUXB 3FB5B 1HNGA 2CKBH 1K8IA 4P48A 4KUZH 4GSDH 5GGQL 3RL2B 4M5ZH 2BY2A 1R3HB 4PJFB 1A7PH 3TBTA 4LLWB 4JHAH 1U3HD 4X4MA 4PGCB 1PY4A 1UWEL 3FO2B 4M5YL 3D85A 4R2GC 1CR9H 3E1F1 3MZGB 5SWSD 4P3DB 3QXDA 5ID0A 3S4SA 4IS6A 1KTDB 1IVLA 4O4YL 4XB8A 1A6ZB 3W9DA 5KVFL 1E4XL 4CVWA 4DKFL 5HHOE 1I9IH 1MNUH 2UZYB 3BDXA 1ZANL 4QLRA 3OTTA 5I15L 3GB7A 2XYCA 2AXFB 3O0RL 1JGDA 2JB6B 4R90L 4P5TD 4X6BB 1MCSA 1KPUA 1U92B 1I3GL 4O2CB 2AJYH 3GMLB 2QSQA 3BPNB 3FFDA 2VXQL 4ZFZA 3VXRA 2HT4C 4WV1C 4LLUA 4NHCL 1P4BL 2VXVH 4FQQB 4X6DB 4YDVB 2Q20A 5D2LA 3O11A 1CQKA 3MLTB 3A6BL 4R7NA 4KKLD 4IOSD 3RIAF 1ZA6A 1NGWB 3WN5C 1KCRL 5ANME 4ZO9A 1ND0A 4C56D 5IW1A 3N1MC 5HGAA 1T7VA 4OGYH 3RKPA 5DD3L 1QHPA 5I1JH 1WITA 4M4RA 4L9LB 5I8OL 5DT1L 4JO1L 2YSSA 3BGAA 3BPLC 1MCWM 3G5XB 1DTUA 4RMSA 2WUBL 3FQNB 2BCKA 1A3QA 5E8EA 2YPVL 3O6FA 5DJ2B 4TRPH 1CGWA 4OF3A 3IYLW 4QRRB 2XPGA 1CF8L 5GGTH 4GW5B 1MVUB 1BQHG 1KYOK 1L7IL 5FV1L 5GS0H 5GSRA 3P11H 2X1QA 2MCPH 2ZCLL 2NXYC 2WQ8A 1WIUA 2AJVH 1EUTA 3MRKB 2YWYA 3K81A 4M7KL 4R2GD 4BQ8A 4PJGA 1ES0A 2D7TL 5HDQH 1TJIH 1VFOA 2X89D 1LEKA 4KAQH 3GMRB 2D31A 2XOTA 4J3OC 4OSUH 1CGTA 3OAZK 4OZFH 3X3FH 1J0IA 4NFCA 43CAB 2YPLB 4JGUA 2P42B 2WWKT 4HUUA 1UJ3B 4MJ5B 3U48A 3RI5K 1KB9J 3A67L 3RWFB 4JO3L 2ESVA 3BMVA 1RZKL 2PF6A 4K3GA 1ZHNA 2P7TA 5DS8A 4ONOA 3ZL4L 3T04D 5CMAB 2CKBB 1ZMYA 3D2UB 4X80L 1MHHB 1T20A 4HZLB 4NQXA 2UZIH 2FIKB 1D5IL 1FAIH 1I7TA 4PYHA 3RVTC 3DGCR 3MYJB 4NSKB 4AY0A 5JW4M 1G7PB 4WU7B 3CXDH 3BESR 2HT4D 1FPTL 2DD8L 1C16B 3I2CH 3CFBA 2JB5H 4J4PA 4Y4HB 3SCMB 3EOAB 5F9AC 4J6RH 1UZ8A 1HEZA 2X9YA 3ZSTA 5E6IC 1LP9F 1JUFA 2IFFL 2AV7A 1YECL 2CLVA 2DICA 3HE7C 3MGTB 1KGCE 2BNQD 5HYJE 3C8KA 5KW9L 1NMCC 2VDLH 2WBJB 4PRHE 3IGAB 4GS7B 5IQ9B 2Z31D 4RFOL 3QIBC 1KPRA 2AW2A 5DJ0A 4HKZA 2VO5A 4RRPG 2H8PB 1CE6A 2F74B 3W0WD 4J3WA 1UM5H 2PW1B 5AUMA 2IWGA 2VH5L 5EUKA 5BV7L 1U91A 5JOFB 2P5WD 4KKNA 4U1LB 2XT1B 5A2IH 4POUB 5DEGB 5ACLA 3QXUA 2MTPA 4NO0A 4FFYH 4X9BA 4XI5C 2J4WH 4RAVA 1KGCD 5CJXA 3OR7B 1G7JB 4D94A 4NN6B 4PRHD 2ZCKL 3C60A 1FNGB 2NXYD 5CHNA 5HHMD 1IGFH 3JSSA 1G84A 2I9LB 3SKJL 4ODVL 1T83C 4TTDC 5DJZA 1QRNB 32C2B 1A1MB 3VDBA 3WYRA 3UTSA 5T1DL 4LHUD 3WIFB 3D0VA 1AGEB 3I9GH 3U4EA 3SE8L 5JORA 1YC8A 3N85H 4HJ0C 4WI3A 1DDHB 3T0BA 4HH9A 1CICB 2ICWI 1P7QB 4XZUB 4QRTB 1JF5A 4L8SC 4Q2ZA 2EDWA 3ZE0E 3V4UL 3KPSA 1INEH 4X6FA 4APQB 2YKLH 4ZFOA 4JCLA 2K9UA 1D7FA 1QPXA 4KI5E 2VLKB 5DJXA 2J12B 3ECBA 4YNYA 4GG8B 4HPOH 3RVTD 4RDQG 2DQGH 4PY8I 1C5BL 1IGCH 5IF0A 5HGBB 4HUVB 1MHEB 4MXQD 4RIRB 3JV5A 3FB6A 4WTZG 2OSLA 7CGTA 2PXYB 3KJ4B 3QXAA 1RUML 3HMWH 2FB4L 3OF6D 4EOWH 5E6ID 4L3AA 3GNMH 3WHXB 2BMKB 1AXTH 1T0PB 3DXAA 4GT7A 2W0KA 1JGLL 4Z7WA 4OZFB 4HKJA 3MROB 4NZTL 3NIFE 4BZ1L 5JPMB 4LLAA 2ZJSH 1XCTA 2ZSWA 3QIBD 1BAFH 3CFEB 3QH3A 3Q6FB 1PG7L 4TVSa 2F53D 5HJ3A 3V0VB 1SEBB 3HS0A 4LNVA 4NGHH 2D0HA 4P4KB 4XI5D 3U7YL 3RPIA 4DZ8A 5J1SC 5KVGL 4U33A 4XGZA 4ALAL 4YK4C 2P45B 5L2KE 1L7TL 4GKZB 4L4VB 4ZAKA 1QRKA 3P0YH 1ZTXL 4JPWL 1D9KC 3EDEA 1HOCB 5T3XH 4TTDD 4PJXF 4LARL 4U1NB 4OLZH 4PJAA 1MLCA 3RJQB 3ZT6A 1JZ8A 1G7HA 3CZFB 4JDVA 3RWHB 1VENA 3BZ4A 3WS3B 4Z7VA 4V2CB 4HJ0D 3TBSA 1HK6A 4AH2A 4FFWC 1J05A 4FOMA 4OGXH 3QEUA 3RZCA 3ZT5A 1F45A 4HMDA 1DQDH 3BP4A 1I1AA 1XGRB 3NCJL 1GGTA 1J1OL 1UB6B 2GAZA 4HKBB 1JYNA 4AIZB 3EAKA 4YDLC 4DZBA 3QWRA 4G8FB 3DX9A 4P59L 5K9KA 2AP2A 2I60L 1NGZA 2WNGA 3CFCH 4LLMB 3IDIB 4WW2F 5ICZA 3GBNH 1W0VA 4ZTOH 2GITB 2I27N 2WP3T 4PRPA 2PTTB 5F7MC 4LPXA 3P9MB 4N8CL 1NCBH 2DBLL 3PNWB 4FQLH 4WWKA 2H2PC 4M7LT 4M7LH 4UIMA 4XP5H 3PWPE 1IAKB 5F8QC 4GXUM 5D7IB 4K7PY 2NTFA 1A6TA 3GO1L 1I8KB 4LP5A 2RAMA 1Y0LA 2ITDB 4LVNC 4OZHB 3VWKC 1P6AB 1TZGL 1X5ZA 2JE8A 4DVBA 1C5DA 1X5IA 4NCC2 1KXQE 4P2RA 1PLGL 5FM5M 4YO0A 5IFHL 4R0LC 4M62H 4XPGH 3QWOB 5J9PA 4ODHL 5C6WH 2KPNA 5J56B 5C0DA 4JQXA 4CVXA 5MP6L 3BSZL 4LPTA 5FB8B 1GIGH 1QNZH 4LLDB 5A16A 5ICYA 4LEXL 5F6HI 5I71B 1D5XB 2P43B 4ZNEA 2B2XH 5HHVL 2ZPKH 3VFOB 1GGCL 1QFWM 4XWGH 1QSZA 4MNHB 3RWEB 4M93B 3UZVB 4D0BA 5DUML 3MV7A 3TZVA 1TMCB 1UWGL 4IRSA 1NGQL 5JOPE 1OWWA 1D9KD 4MDJA 1G9NL 5C0FA 4MDIB 4GUPB 2LU4A 3MA9L 4HIHB 5DJCB 4MB4A 4OFKA 1OWRM 1IC5L 2FATH 3O3AA 4RMVA 3GSRB 2VLRB 3MCKA 3V52L 4XWOC 4YFDB 1MFAL 2Y7QB 1CGSH 4FFWD 1JRHI 3ZDXF 3LH2H 5MHSE 4LSUL 5ISZE 1GXEA 2Z9TA 1KJ2A 4HK0B 5IVZB 3T8XB 4XPAH 4LPWA 1QVOA 3ROLB 1BIIA 5JOPD 1YPZB 4L4JA 2V7NB 1KLUB 1XGYL 1T1WA 4NDMB 4U1JB 1NLBL 4HDIA 1U3HB 5EOCL 5I17B 1B6DA 4ZPVB 1ITCA 2H2PD 3HRZA 5MHSD 5SWSB 1RJYA 3PHQB 5ISZD 3FCTB 1OLZA 2ADGB 3BEVB 4YIQA 3MRJA 3MUJA 3VWKD 3HLAA 2NY1B 5FK9B 1ACZA 1U8IA 1GOHA 1IQDB 2BVPB 1A7OL 1UWEH 4M5YH 4MWFA 4PG2C 4FRWA 4YFLI 2Z4QA 4WDIB 2EDTA 4OUUA 2Y6SD 5FO7B 1UWXK 1F4WL 4UDTA 2FLBT 1ED3B 4P5TB 4GG6F 4YEFA 1E4XH 3V5DB 3KG5A 1A21A 1H3WM 2X4RA 4AYFA 5JA8B 1PSKL 5EO9B 3TBVA 1IGML 5E8NA 3O0RH 2X1OA 1W72A 1KEMH 3LQAL 3HG1A 4JHWH 1HDMB 2X4UA 3O2DA 4G6AC 2QKIB 4U4BA 1I3GH 1BFOB 3HE6A 3HAEG 3BDYL 2HJKB 1NJ9B 1BJ1J 5GRWA 3HA0A 4N8PA 1NCCL 4C56B 2DQTH 3TWCL 3HAEH 3VXNB 3WXWL 4Z7UB 1EVTC 2XQBL 1JYXA 3A6BH 4B0MM 3KNBA 4LP4A 2BC4A 1G1CA 1XFPA 3D0LA 1KCRH 5F1KC 3THMH 4XWOD 1V3LA 4GXVH 5IBLC 2K7PA 2A74B 4TOYL 3KLAB 5DD3H 1CIUA 1Z0NA 4V1DE 5DC0A 4MB3A 4XNXL 4U1MA 3MV9A 3OAUL 4GRWE 5ANMB 4O51A 3PP3K 4O02L 1VDGA 3IETB 4YHKH 4R4NC 4CMHC 1J10A 2IG2L 2X70A 3BIBX 2YPVH 3QEGL 1UVQA 1CFSB 1M1SA 5EOQL 4YXKH 4UB0L 4CVUA 5IEHB 3GHBH 5C0AE 3TA3C 3CFDA 3VXSB 3C09C 4HJGB 3OAZH 3V0WH 1FZMA 4V1DD 2JCCB 4DGYL 5EIQA 1KG0B 1IT9H 1C08A 5E2WH 4PBWD 1A6WH 2VC2H 5B8CA 4HIEA 4M7KH 1RK0B 4X4YA 1MCLA 4PJ7F 4ODWA 2ED8A 1B3JA 4KJYB 5KVDH 3HN3A 3HNVL 1MCWW 1A3LH 1HHJB 1N59A 2WIIA 1TVBA 4ZODA 2CUMA 4P9ML 5F1OB 2A6DA 4Z7OF 4G80A 4EUPG 4L8BA 1X5AA 5C0AD 5BO1L 2APWA 1ZT4A 3UJTH 5KVMC 1VB9A 2OXGA 1NUFA 3K80A 5D5MA 1AE6L 4EUPH 4GLRH 4J7RA 1LO5A 2FJHB 2A83A 2HA1A 4G6AD 4N0UE 3WJLC 5BXFB 2NW2A 4XP9L 1MAJA 2YR3A 3WNLA 1D6EB 2VITB 2AJSL 3WN5B 1U58B 1WEJL 2OI9B 2BNQB 4Z0XB 5CP7B 2GIYA 3P4OB 5IBTL 4PJ9A 2EDKA 4KJQD 2IGFL 1AQDA 5E2JA 2Z31B 4TYUA 2XQYK 1KYOJ 4Z95H 4RZCB 1WAAA 3M8OL 3L3DB 2VKXA 1YECH 3PIQB 5E99L 3W0WB 5E9DA 4P46B 2OR9L 4ONFL 1I9JH 4JFQA 1N0XL 3VFMB 4TUKL 3VU2A 2ZSVB 2P5WB 1N0LA 2Y5TA 3VRJB 5IB4A 1N4XL 4H8WL 5JLZA 3CSYB 2Y9RT 4ONGH 1VEPA 5ICXA 2X09A 3C2AL 3VD9A 4NUJA 3M07A 4OFDA 4R4ND 1RZ7H 4PRHB 5FO8A 2VH5H 4R96B 2NXYB 4NYLB 5DSCA 5HHMB 4S2SA 5I1AB 5K59E 2Z93B 3VXPA 1BZ7A 2PYEE 5FHAH 4OV5B 3HAEB 3IDGB 5CEZD 2YRLA 3HI5L 4NWTH 1RIVL 4JDTL 4ODVH 1V3JA 1FZJA 2YEZA 4G6ML 4UT6L 2VB5A 1K8DA 4M7ZB 2JJTC 1CXKA 2VMFA 3NAAH 5T1DH 1U41A 2NX5A 5E8PA 3KR3H 5AAWA 4JJHA 1HZHH 3SE8H 5DMIL 1CN4A 1EBAA 1NAKL 4QT5A 4HUXA 3T4YA 1LD9A 3O4LE 2PYED 4YHPB 5I0ZA 3RL2A 4JFPB 3EYUH 3NMEA 4LPCA 5HGDB 3BQUA 1FO0A 4PRIE 4E0RB 3QIWA 5H94B 4Y2DC 5DVOA 3MLUL 5DRWA 1EIBA 3CLFL 1FNEB 1AKJA 4D9LL 1MFNA 1NCAH 4QYOB 5E6IB 5F97E 2E8YA 4YJZL 4PPTA 4OM1L 2AVGA 1KV3A 2L0DA 1XT5A 5EO1A 1OSZA 5D1XB 2G75A 2A73A 3O4LD 2AK1H 4OCWL 4LCCC 2JIXD 4FNLH 4UILL 3WDJA 1AO7A 4M6OL 3GDBA 2AK4B 4M48L 5GJSL 2JB6A 5F8RC 4H0GA 4KUCD 1J87A 4HPYL 2F53B 4BZ1H 4OI8A 2XFXB 3LZFL 4EUPB 2LAAA 2NY5L 3UPCA 1ZSDB 5JQ6H 4FQQA 3C5ZA 5F7HA 4YPGB 3HUJA 3RUGE 3QJFA 4P99A 3MLTA 1NGWA 1JPSH 4RMQA 3H9SA 3H7LA 2M8XA 3ES6A 3E6FB 3KYKL 4XVTL 4ALAH 3CFJB 1FFPB 2CO7B 4L9LA 4OLWL 4JPWH 5JNYA 4LPVA 4P23C 1P5UA 1WWAX 4LARH 5I1IL 5DDHA 4PJ8D 4OCNC 4L8SB 5GGRA 2ICEB 4R97C 3H3PL 3GKZA 4BZ2L 4PLNC 2HAZA 3QRGH 2L7JA 3GMOA 4BFBD 1Z0MA 4GW5A 1QBML 1Y18A 1G0YR 3B9KA 4XBGA 4HS6B 2BFVL 5J6GA 1QBBA 3NCJH 1SQ2N 1YMMB 4Y2DD 2P5EE 1AI1H 3EZJB 4Q9BA 4JFDB 1TZHB 1NEZB 8FABB 5IM7A 4NRZB 1G7LA 3I3BA 5GGSA 4NPYB 2XG5A 4JM2C 5CINL 3UZEA 5F9OH 4HT1L 1A1NB 1A9EB 2CPCA 2R2BA 4XNQB 2DBLH 3M17B 3IAQA 2WBKA 3C6SA 3GUTA 2Z8VC 3UAJC 1BWWA 5JHDA 3GO1H 3FOLA 2YMXL 3UTZB 3IJSB 3KAAA 1YEIL 1NC2A 3MXWH 1QFOA 1N26A 4G9DB 2R0ZH 4RBPK 3UJJL 2XKUA 4NC2B 3CFIC 4P2OA 1PLGH 5FEBA 4W70A 2FIKA 5HHQA 1JPGA 3U46B 4GRMA 3FT2B 1G7PA 3U36A 2ERJC 1FYTA 1ZHLA 2Y1VA 3S35X 1Q9WB 3BSZH 4XXCA 4NKOA 4R4BA 1R5VA 2IALA 4LEXH 3L3KA 3G08A 4ELKB 2DQJH 1D5BB 1D9KB 2DDQL 1WVZA 5FM5O 1V7MH 4JG0H 3QDAA 1FHGA 1D6VL 4JLRB 3GZKA 4X7CC 3TH2T 3MLWH 3HR5B 3DX6A 5DUMH 1DUZB 5IQ9A 1UWGH 5IR1B 2PCPA 4QXGH 5HBBA 3I75B 2J8UF 2VL4A 3PABA 4JN2B 3BKCL 1I85A 4P23D 1G9NH 1GC1L 3DJ9A 4QRQA 3MA9H 1U42A 3VGHA 2XZCL 3T1WA 2GK2A 4P5MA 1BX2A 2PW1A 3O3DA 4NQSA 1XF5B 4U05A 1IC5H 3BH8B 1OTTC 3R0MA 4MA7L 4U1LA 1MFAH 4H88L 1Z9MA 43C9A 1SBBA 1G7JA 5DMKB 2NY6D 3MRGA 5I1DB 5L7XH 4F9PC 3O6MH 1P69B 2X2YA 2BNRE 3MLVH 1J9CT 1RI8A 4Y16B 1DLFH 4U1HB 2MFNA 1KB5A 4RA0C 4JM2D 1A1MA 1HHKA 3VWKB 1QO3B 2A9ML 1BFVL 4OZGE 3DMMB 1UWXH 2F5AL 5FKPB 1PJ9A 1WK0A 9CGTA 3FO0L 5ELIA 4M6NH 5EUOF 1KC5L 5E4EB 3ETBF 2OMBA 3UAJD 4JM4L 5E08L 5IFJB 1CICA 4XZUA 1S9XB 2BNRD 1F6AB 4LBEA 4I5BB 1FC2D 4PUBL 4AL8H 2E9JA 3EYFB 3LS5H 1HXYA 5GGTA 1A7QH 3BWAA 3MLRL 4R9HA 4OCSL 1T0MB 1F4WH 3VXQA 4GG8A 8CGTA 3UPRB 5DLML 3DECA 2VDOL 5HGBA 1MHEA 2JLLA 4RIRA 1HINH 3GBLA 4GMTH 2ZUUA 4QF1A 4ZQKA 3LMJH 1EHAA 5D7KE 4NZUL 5KSBB 4WFFE 5J7CC 3KYMB 3BRGC 2W92A 1F90L 2A1WL 3HZYB 5HGHB 1Q9OB 4YHML 2EYTB 1MQKL 5CSZB 5EDXA 1E4WL 4OTXL 3KPLA 2XI9A 2GTZA 1JTTA 5CEZH 3FB7B 3X13B 4ZSOE 4FABH 3R8QA 1UA6H 4ISVB 1NCCH 2WZPD 4FQCL 1KCKA 1CFTB 1M4KA 1BD2A 3TWCH 5D7SL 3NTCL 3H6JA 1IEBA 1GVIA 3Q6FA 1VEOA 2OZ4H 3KHOA 3WXWH 2W60B 1BOGB 3PP3H 1K2DB 4JRXA 3QQ4A 3PJSB 4WFFD 4ZS7H 3V0VA 4K9EC 1YMHB 1OTTD 4HLJA 4ONHA 4ZO8A 4YHZH 1A8JH 1KNOA 2OK0H 2FYYB 3RTQA 1L0YA 1TJGH 3MRMA 4MJ6B 4TOYH 3L5JA 4G9FA 2DTSA 5DMYA 2ARWA 4M1GL 3ULUD 1LK2B 4PYGA 4XBEL 1GOGA 1OGTA 3DRTB 4MNGB 4PLOB 2HWZL 1S9VB 4QHKJ 5KN5B 3DVNA 4UNUA 5DRXA 5DRZA 2IG2H 5HVWA 4LQFL 4N8VA 4Q6IB 4C83A 5IFAH 3PXHA 2MWCA 1Z9OA 4XH2B 4KQ4L 4OZIA 5EOQH 2IAMB 3LKQA 4UB0H 3WS3A 2V17L 5FFLA 4Q0XL 3FQRA 2CKNA 2PN5A 3CPLA 3PQYD 4X7TA 4NC1E 4XTRC 1K85A 4LLQA 4OZ4B 3IKCA 1OARH 4GO6B 4DGYH 2G2RA 3K1DA 1I1FA 1NFIA 4O2EB 2APVA 3EOTL 3B8SA 5IMOA 2QBWA 1Y6KR 3L7FA 3MYZA 4YHLH 1T03L 1QP1A 1S78D 4LLMA 1FV1B 5TE6L 3ISWA 1DE4A 4FTVB 2EEAA 4P9MH 2EXWC 5E1AA 3ESUF 1S7UB 5BO1H 4FMFA 1IAKA 2PTUA 1XF1A 3CMOH 3MO1B 3QZWG 3D39A 3BKJH 4RISL 2AXGB 3P9WB 4OZHA 1HI6B 2H6PB 4FG6C 2OJZH 1YEHL 1DQML 4OJFL 3WFCL 3SGKC 4WTWA 2AJSH 1UZ6F 4HBQA 3L3GA 2D7PA 4OLYL 1WEJH 1X4ZA 1E28B 2QHLA 1DN0B 3WFHB 5EU6E 3C6LC 1REIA 2IGFH 4G8IA 4WY7H 3DSFH 5ENWA 1KF9B 2X41A 5D7JC 3U9UB 3B6SA 2G60L 5LWYL 4JG1L 4LF3B 4FQ2H 4LLDA 4OI7A 5E99H 2JJWA 1WZMA 5F7EH 4ONFH 2ORBL 2DI9A 3MOQA 4TUKH 4LSPL 1CS6A 3RWEA 5TDNA 3G6JA 3U0TB 2J88H 1Q9KA 4H8WH 2R15A 3AAZA 2GFBA 3K1KC 3RGVC 4OGAC 5H37G 3C09B 5D6DC 3C2AH 1MY7A 5EU6D 2E9WA 5E2UL 3FRPA 1BBJA 3GSOB 4GUPA 5H37H 5IJKC 4JZJA 4G6FD 3MREB 4G6JL 1JZ2A 4U7MA 2AJXL 3OQ3B 5HPMB 1VGEL 4MNQE 1PKQE 4TNWF 4HCRA 1KJMB 4XTRD 1X4XA 4KKCC 3HI5H 5EZJA 4MA3A 3ARDA 1RIVH 4JDTH 4QNPE 2IBZY 1FCCA 1SYVB 2BERA 1MF2L 3D9AH 5IVZA 5JZ7C 2W07A 1QYGH 1K4CB 1KXVC 3ROLA 3VWJC 5DJ8B 2VDPH 1YPZA 3MA7B 4LKCB 3RA7H 3SDXF 4G6MH 1TITA 5BZDA 3B5HA 1CTNA 5FGBC 1GL4B 1MSPA 3D3VD 4WNQB 3BKYH 3BWUC 4DQOL 4EJ1C 4MCZB 1U3HA 2EXWD 5SV3A 5I17A 4YR6A 1S7TB 3VA2C 3VXME 1BFSA 4MNQD 5EBGA 5I18L 2DKMA 5SWSA 3KPMB 3PHQA 1LILA 2DLFL 3FCTA 5JO5B 1UCBL 4LFHD 2FWOA 1LEIB 1KJ3H 1E4XI 5D71L 3IDJA 2ARJQ 4GOSA 3OXSA 2IANE 1FFOA 1L0XA 3PP4L 5GISH 1IQDA 3BZDA 3O4LB 4FG6D 3DI2B 3CLFH 2JIXB 3BMWA 4D9LH 1AQKH 1RJCA 3VCLB 1BVKA 1GGIH 4LAQL 3LHPL 1KULA 4HKXA 4JGMA 3DVIA 5A40E 2YZ8A 3HKFA 4XP6L 1HNFA 5SWZE 3I3DA 1I4FA 4P5TA 3W39B 3C6LD 3B3IA 4X9IA 4UILH 2ZUTA 5EO9A 5D7JD 2FX9H 5TE4H 4M6OH 2I26N 3ARBA 2EKJA 2IQAB 4M48H 4KK8C 4XC1L 2QADC 2IAND 3STLB 4G42B 3VGFA 1HDMA 3QT2A 4PJHB 2QL1A 1X5XA 5HHOA 4JY5H 3QNYA 3BXNB 4K23L 4K7PL 4WI7A 5DD5L 2J1KA 4OGAD 4WTXA 3QFJE 5SWZD 3QZWB 2XKNA 1IL1A 3QHZH 1CL7L 1RZFL 4BFIB 4RWHA 5ADOL 3O81A 3IU4L 4ZPTB 5T3ZD 4PJ8B 2H41A 4LNRB 2A74A 4KKCD 3AU1A 3BFOA 4XVTH 1DQQB 3MACL 4IIQA 3BGMB 1YNKH 5JZ7D 1N5YL 5KBNC 3VWJD 2P24B 5ANMA 3ARZA 4O2FB 3O9WC 1CGXA 4L8CB 3MLSL 4B7LA 3FQTB 4Y2DB 4BZ2H 3NPSB 3IFOB 5FECB 5DD1H 5IEHA 1XEDA 1F3RB 1S7WB 3IAPA 2BFVH 5D72H 3CVHL 4JY4A 1LP9E 2BHZA 5F7NC 5EU5A 3QJHA 3HZMA 1FG2B 1R6VA 1I3UA 3BPCB 3SOBL 4L4TE 4UOW1 4RBPH 3WKNA 1RK0A 1BQSA 3QUZC 4OF7A 4GLRI 4UDUA 3PGCA 4IHOB 3DOSA 3V6OC 1C7TA 5GRVL 1TQCB 4KK6D 4CVZA 4MB5A 4IDLA 1N7ML 4PS4L 2XICA 1BZ9B 4WW1A 1QEWA 4EIZC 3CSGA 1QR1A 5C0BE 4F57L 1TPXC 1YEIH 3KLDA 1HQ4A 4ZOCA 4I18C 4KK8D 3UJJH 2QADD 4WV1A 4L4TD 4XPTL 5D6CB 3IF1A 5I66B 1DBJL 1UYWL 3MJ9L 1A5FL 1FLRL 3KVQA 3ULUH 1UM4L 3VXOB 1U8MB 2OP4L 1ZHBB 2VJXA 3WN5A 1U58A 2FD6L 3NCYS 2BVQB 2BSRB 1CFQB 3AROA 1EEQA 4ODSL 2ZUWA 2X6MA 5CP7A 3P4OA 2V2WB 4BYHA 3OXRB 5C0BD 4JFYB 2HKHL 1YQ2A 3CGTA 5CZKA 2KUTA 5JR1H 1WCQA 4M43L 5C9KA 1RD6A 3G6AB 3C9NB 1UKTA 3LKSB 4G3YL 4AEEA 1QSEE 4JQVC 3U9PL 2X4TA 3MOAL 4NQEE 1GC1H 3CSYA 5HYJA 2AABL 3Q48A 5EZIL 4IRJC 3O9WD 2NY6B 3EFFB 4GJTB 3O3BA 4ZD3L 4CJ1A 1PW3A 4PRHA 1X7QB 4ZDHB 3LD8C 3MBXL 5GGRY 4NYLA 4PBXA 4WIQA 2OTWB 1HWGB 3F8UB 1RFDL 3FONB 2CDFA 5M94B 2VAJA 4RGNC 1QSED 1RZ8B 1SY6L 4LHUA 2E7HA 3NABL 3U82B 2C5DC 4PR5A 3P9LA 2B0SL 2W0PA 4BM7A 3ULSB 3LN4B 1TCRA 3QUZD 1IBGL 2YS4A 4OIIL 4WW2C 5IHZA 1MLBA 2HTLC 1BFVH 2BNRB 1MCQA 4P57B 1ZLVH 3GJFA 1KSRA 3FT4A 1VACA 3FO9B 1M6OA 3BD3A 2GJ6E 1EAJA 5F1SA 3D25B 1M7DA 4U1IB 1CCZA 3MRBB 5IB2B 4JM4H 5B38G 2DYPB 2LTQC 5I73B 4JFPA 4L3CA 4F2MA 1JHKH 1TIUA 1QLFB 1BQUA 4LK4A 1BQLH 5D2NC 4WENB 5HVHC 2ZUVA 5GRUL 1DN2A 4LASL 3VRLF 1LO0H 5IP4A 4QYOA 4ZUUA 5DLMH 3U1SH 2VDOH 1V5JA 3CLEL 4TVPL 4W4NA 2GJ6D 3HE7A 3RHWF 1NDGB 2CGRL 5F9JB 2V7HB 4NZUH 2DM7A 3NVQA 5L9DH 5I0DA 4JKMA 4YHMH 4P5KB 3QIBA 1E4WH 3MUZ1 1G1YA 1ZLWK 3UJIH 4JVUA 5HGGS 2WBWB 5KSUA 2Y06L 1H3VA 4FN0A 1PD6A 1MCHA 5GXBB 5F89B 4RGNE 1F58L 5DHXB 1OGAE 3WE6A 2XFXA 3MJ6A 3VI4F 3FMGL 4PJCB 5F88A 1B4JL 2R1YB 5D7SH 4XVSH 4IRJD 5SX5K 4ZSOB 1PZUB 2AXJA 2R4RL 5AAMA 5FKAA 3DSNA 1KN2L 5KVEL 5C2UB 3N1QC 5ITBL 1T83A 3X14B 2DTML 4UIKH 3QCUL 1BMGA 1YY9C 3S35H 4EIGB 3HFMH 5DFWH 3L3HA 1AR2A 3ALPA 5EFIA 5D2NE 3SGEH 1OM3L 4A6YH 5FO9A 5FUZL 3HZKB 1K4DA 2ADJA 3PQYB 3T0XA 2BDNH 2CK0H 3EGSB 2HTLD 3LPFA 3L5WA 4XBPB 4YFEA 3EYVA 4L8SA 2DWEA 5DR5H 2ICEA 5EZLB 1Z6JT 4ZXBB 4AEIH 2V17H 4Q0XH 4TQEL 1G7QB 4F8TA 1Q0YH 1Z3GL 3WFDL 5FGCB 2DI8A 3O6KL 4JKWA 4PRDB 3PDGA 2QV2A 3RVXC 3PF2A 1NCNA 1Q9LB 4YGVA 4TUJB 2IH3A 4X6CF 4AM0B 3TFKC 3CMGA 4BKLB 4NQVB 2YBRB 1YUHB 2F5BL 3EOTH 1N2RB 1RY7B 5IJVB 1NEZA 2HKFL 1R24A 4X4XA 1AGDB 3H9HA 5TE6H 5C0JA 4U6XA 1UXWB 2XA8H 1A9EA 4EKXA 3FOMA 1P7KA 4XNQA 4UTBL 4KRPC 2P8PA 4M3JA 4AENA 2VZ1A 1MHPL 4HXBL 3WXVL 4KPHL 5IGXL 4YHIB 2BVOA 4XPFH 3UTZA 3CK0L 1MI5B 2Z8WC 1YY8B 3PHOB 3ZDXE 5T3ZH 2DM3A 1UXSA 1DQMH 3PWPA 4N9GB 4DN4L 1TQBC 1OP3K 5LGHL 1PZ5B 4PJDF 2BXYA 4OLYH 3R1GL 2ICCA 3BZEA 4FP8L 2DB8A 4GW4B 5B38B 1G7MB 3V7AE 4CW1A 4KGJA 4G43A 4M00A 4D3CL 5CEYB 3FRUA 3P73B 4OQ1A 2W91A 5LWYH 4JG1H 1XIWA 4Y19E 3T1FA 5LGJA 1WJ3A 3MFFB 3U79A 2Y4SA 2EDBA 1CLZL 1Z9SA 2ED9A 1YY9D 2GEEA 5FYLD 1R5WB 1KOAA 4G6FB 2KL6A 2HRPH 3VRIB 3HR5A 4IMKC 1MCIA 1XGPB 5EORL 5IR1A 1I7UB 5F96L 2X05A 3T77A 4P2QE 5E2UH 4A2LA 3AS2A 4DEPC 2AJUH 1KCVL 1RVFH 1YN6B 4G6JH 4IOIB 1ZXQA 3RAJL 2COQA 1PX4A 3GJEB 1RJLB 4Y19D 4GG6E 2EDNA 3BKML 3TPUA 5C0RL 1OQOA 2QSTA 3QXTA 3D3VB 3OB0K 3SBWC 4QHMA 5I1DA 2C3HA 1EO8L 3VGAC 5JHLL 3QQ3A 1QLRA 5KJRL 5FYJL 4N0FB 4P2QD 2BY0A 5ISZA 4RMWA 4U1HA 4ZFFB 3WLBB 4QHLB 1AC0A 4Z6AT 4JFXB 3WEXA 4A6YB 3A6CH 5FKPA 4QRUA 5I18H 4KRPD 3RIFK 4DOHB 2R69L 1XF3B 2W65A 1WZ1L 5F3BA 4QHNB 2LVEA 5J06A 1UCBH 4R0LA 3VXRD 4QRPE 4JRYE 3F6IA 3D48R 5D71H 2IMNA 5BVJA 1CK0L 3VFRB 1RUPH 3PP4H 1CFVH 2DOCA 3IDXH 2SEBA 1JV5B 3C6LB 1J0HA 1WLHA 1T66D 1IQWL 5D8JH 3QFDA 5D7JB 1QACA 3P2TA 3GSNL 4MXVF 3G5VB 1CG9B 1IGIH 5DURD 1J0YA 2EH8L 2UWEB 4KVNH 3W2DL 4M03A 4OLUL 5TE7L 5DO2C 2JTDA 4NJ9L 5FA3A 5L88L 1H3XA 5T1KB 1MWAA 4ZFOL 3KYMA 5KTEH 1LK3L 4JRYD 2FH8A 3HZYA 1J1XH 7FABH 3VFVA 5SWZB 4H1LA 3SDCB 3P3YA 1DVFC 2QHRL 2VR4A 5JQHC 3X13A 2HG5A 5C08E 4I1NB 2ENYA 4K23H 4JPIA 3QXVA 4UOW0 2NY2C 4JO4L 5I2IB 1CFTA 1XR8A 5DRNB 4PJ7E 5E00B 3PWNB 3OJDA 2O5XH 3LKOA 1WC7A 2XKSA 1GJIA 2FGWL 2W60A 4OF5A 4JQIH 3C60C 1K2DA 5HVFB 1G9EA 1ZKAA 4Z7OE 3PGFH 1WFUA 1EPFA 2V2XB 4HUWB 4ZS6C 3IU4H 2ZG3A 1DP0A 4Z8FL 5AG9A 1A2YA 2BOCA 5LAXB 2FYYA 3AUVA 3OL2A 3FAWA 3EIFA 2DAVA 5C08D 1RULL 4HIIB 3TYFA 3L95B 3HI6H 1TTUA 4URTB 4K71C 3ZE1F 2NZ9D 5BJTB 5HTSA 3LPWA 4UUJA 3HCVA 4JEGB 2VAAA 2J6EA 4KY1L 3MLSH 4JY6B 1T7XA 1T89C 4V1DA 4UQ3B 5ETUA 5ILTL 4JANB 1HQRB 2CUIA 4MD4B 5KANG 5K33A 4PG2A 3DGGB 4ZOEA 5JIHA 3BT2L 1FVEB 4F58L 3CVHH 1EX0A 1DFBH 4OZ4A 4XNMB 1FL5B 1GZPA 4HULB 5EWIH 1ZT7A 2FJFB 1JGVH 5T5NG 4X9FA 1I7RB 5C0AA 4NN5C 5LCVH 2EEDA 1FJ1A 1I9RL 5E94B 2X44D 1ZE3C 1NSNH 4JAMB 3STZB 3TO4C 1JWSB 3MV8B 1QQDA 4Z0BL 2E6JA 4BSVA 2WUCL 1EZVX 4BQ9A 2W9EL 4L4TB 1MCDA 3H42L 4OIAA 2GCYB 4XHJC 1WBYA 4U6YA 5BOPA 4RNRA 2PW2A 5DO2D 3L9RB 3IU3B 4UQ2B 3K0WA 3BN9C 1F2QA 4I0PC 2XTJB 1G0XA 1KT2A 4NBXB 3S97C 3IJYB 1UJTA 5TPWH 3F12A 4XPTH 3MUY1 1DVFD 3GGWA 1AGFB 1DBJH 1A5FH 4KVCL 5DMJB 1UM4H 4LMQE 3QHFL 4L3EE 5CUSL 4NFDA 5F44A 2W9LA 3OKDB 4K94L 3B5TA 2OP4H 2YUVA 4PB9H 2NY2D 4R3SA 2DWDB 5BW7C 3LRHA 2D9QB 4X5XA 4ODSH 5I75C 5CLWA 3C87A 4N0UA 2IBGA 3QCTL 4JZOB 3C60D 4ZAKC 3MR9B 1ZVSB 2MOVA 3OKKB 1CVRA 3PL6C 4ZS6D 3ILQD 2XWTB 5ESAB 1MFDL 2CLRB 3O9WB 3IDYB 1UEYA 4G3YH 3S7GA 2BXZA 5BMFL 1JNHA 3I6LE 1E0OB 4L3ED 5IHUL 3TESA 4DW2H 4X99A 5FOJA 1B88A 4P2YA 1VCAA 3GSWA 2DL2A 3VGEA 3OAYK 3TA3A 1JBJA 2AI0H 3NH7L 4HQQL 3RDTB 2OTUA 5CJ5A 1EFXD 4U7KA 3MBXH 3KPRE 4WCYL 2O5ZL 1KCSL 5IIEB 1J18A 3LKRB 3RKDC 2LU3A 3FQUA 5FM8A 5KAQF 1WV7T 1OAZL 1SY6H 2B0SH 4HG4K 4XMKL 3FT3B 1K4CA 2HRLA 2IBZX 5DJ8A 4CNIB 4TSBH 3BIKB 2PYEA 4OIIH 1S9YB 1XGUB 1QLEL 2BVYA 2E9IA 4GBXB 3TO4D 2ILLA 3LB6C 4MCZA 4P49A 1BVLB 1KJ2L 4XHJD 5TQ0H 3JWDH 3WJLA 5CBEB 1IFHH 1JHTB 3QPXL 3H3KA 5JO5A 4M9PA 1AIFA 3BN9D 4F7CB 2GSIA 4I0PD 1MVFA 5ACZB 3HMXH 1TXKA 5F7UA 4H26B 4PJBB 1SJXA 5FYLH 4NZJA 3O4LA 1ORSA 3SDAC 4PGJA 1UT9A 4HJJH 1KPVA 2VZOA 1MFEH 4PRIA 4O58L 2NY5C 3CLEH 3ORJA 1VGKA 2FRGP 2VQTA 4NCDA 4ZAKD 5SX5H 1HHHB 5D7LE 1YYLL 3HHRB 4K3DL 5DJAA 5C86A 2V2TA 1LO3L 1ZHKB 1U8KA 3BVNB 2BVEA 3PL6D 4LOUC 4WFED 4Y1AE 1A0QL 4V2BA 2Y06H 4RQQA 4G42A 1LO2L 2EICA 2I9TB 3BPOC 5F1NB 3LD8B 3P4MA 3FMGH 1Q94B 3BXNA 1A02N 1B4JH 1UACL 1N3NA 3F7PC 1A1OB 1I1AD 5TF1L 1EAPA 2X1WL 3UZQA 1U8LA 2XA3A 4U1SB 1L9NA 4YHNB 2AAVA 3O2DL 5D7LD 4MAUH 4BFIA 3WIHA 1BREA 2DTMH 5DYOA 3RKDD 2V5MA 2GK0A 4LLVA 4E42B 1UM6L 1K5NB 4LNRA 4LLYA 3RUGA 3B8YA 3GI8H 1MRCL 4GAYB 1NGPL 5F6IC 1KIRB 1R3KA 2WWKO 5DJDB 4QRSA 3OJVC 3VFPB 1R3LA 3NIDF 3V79C 1N5AB 3LKNB 4EI6A 1MRFH 3ARGC 4PJIE 4NKDB 3KYAA 4Q74A 2C4FU 1KELH 4Y2DA 4P2RD 1IARB 1RUKH 2VDKL 4TQEH 4X8JB 3ABZA 3WNNA 1T5WB 3DVGA 5FECA 3FJTA 3O6KH 2GUOA 4Q7DA 1LNUA 4XPHL 1A4KB 2Y5EA 2MQ0A 2W1NA 3E0GA 1H3UA 2IJ0C 3IFPA 3Q5OA 4HV8A 2HKFH 3SDAD 4LDOB 4LCCA 4F15C 3GSQA 3RWDB 4IHOA 4F7MA 1NBVL 1OP3H 1LE5A 2J8UE 1CU4H 2YC1A 1M05A 2P5EA 3U4BL 1U93A 1UB5B 2HVKB 3VFWB 1A7RH 1MJ8L 2FSEA 1MHPH 4HXBH 5IGXH 3I84A 4I9WE 3S9DB 3WCYA 3ZO0A 4MX7B 4XRCB 3ZLQC 3SKMB 4LOUD 3DLQR 3RWCA 4GH7B 1QSFE 25C8L 4WI5A 3REVB 5JA9A 4TULL 1EXUB 4HXAH 4OI9A 4FP8H 4ZOBA 5TDPA 1ZHBA 5HY9A 4LQ1A 2Q86B 3I6KB 2AXHA 1WFNA 1CFQA 3ROOB 5KSVA 4HEME 2EDRA 1Y6MR 4F37K 1QFUL 3MRRA 4I9WD 1K8IB 1F3JA 3OXRA 3CFKA 1AGCA 1P2CA 1OPGH 4PJEF 1TJHH 4KQ3L 4P23A 5EUOE 3GSXB 4U3XA 3WO4C 1QSFD 4K3EL 3WUWA 5EZOL 2WW8A 3SDDC 1WUNT 4Y19B 4X7SH 4CL7A 3QUYA 5F96H 1BHGA 3ARYA 1SYSB 3TIDA 3QA3A 3QXDB 4CN1A 3GIZL 5ID0B 3S4SB 4IS6B 1T7YA 3SGJC 1KCVH 2DMBA 3W9DB 4EVNB 3ARGD 4JO2L 4U6VL 4UOJA 3BKMH 1PAMA 4P2QB 5IROC 2OTWA 1IGYB 3GB7B 3FONA 1XH3A 4JM2A 1JGDB 1C1EL 2P48B 2OCFD 1RZ8A 3I6GB 3ELAT 3OG4B 1QBLL 3GSVA 4AIXA 1S7SA 5EBMA 3GEWB 4ZFZB 3VXRB 4FQJL 4M61A 4UTAH 1S8DA 4LLUB 2BNRA 4GAGL 5D96C 5D2LB 2R69H 3O11B 1FVDA 4R7NB 2Q87A 1ZA6B