5EOQL

Structure of the murine fab 1g6 bound to the vaccinia virus a27 peptide 31-40
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
218
structure length
218
Chain Sequence
DVVMTQTPLSLSVSLGDQASISCRSSQSLVHSNGNTYLHWYLQKPGQSPKLLIYKVSNRFSGVPDRLSGSGSGTDFTLKISRVEAEDLAVYFCSQSTHVPPTFGGGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein/immune system
molecule keywords Anti vaccinia virus A27 antibody Fab 1G6 heavy chain
publication title Linear Epitopes in Vaccinia Virus A27 Are Targets of Protective Antibodies Induced by Vaccination against Smallpox.
pubmed doi rcsb
total genus 57
structure length 218
sequence length 218
ec nomenclature
pdb deposition date 2015-11-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5eoqL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5eoqL01
1QLFB 5IFHH 4HS8H 4R97C 1X5KA 1HWGB 2BSRB 3JUZA 5I8EA 1E4JA 2EXWC 1IL1B 1HKLH 3MBEA 3C6LC 2AERT 1LDSA 2Q8BH 3I6LD 1DBAL 2HKFH 1BFTA 1FG2A 3U4AA 2E7CA 2PCPA 3QAZC 3D9AL 4TVPL 5AWNL 1CVRA 3OAYK 2WBWB 3SE8H 4K7FA 4JN2A 2IF7A 1EEQA 3BIKB 4XAKD 4OM1L 4Y4KA 1I85C 5DD0L 3JWDC 3SDAC 4ENEC 4P2RE 1ZLSH 1KIUA 4L3CB 1IAKB 2EH8L 1QFPA 3B2VL 4M5ZH 2IANA 3KLHD 5DZOA 4S11A 5FA4B 3RDTA 3I6KB 1FJ1A 4M1DH 5LGJB 1QFUL 5TGBB 1PKOA 2C5DC 1AHWB 2JB5L 5IB2A 5KVFH 2WUBH 1I7UA 1OAYL 4M6NH 5K93A 2XN9E 4Z7WE 3HNTL 3QEQD 4BZ2L 4CAGA 2DL9A 1YEKH 3X17A 4CL7A 4Q7DA 1TVBB 4JQVC 4YHPA 1QLEL 4NBYB 4PJBB 4WUKH 3MYZA 3BZEB 1ZHNA 2VN4A 2CO7B 2Z92A 5A3IC 1AHWC 2DYPA 3WHXA 1EAPB 1PSKL 4UI2A 3DHMA 4N8PA 1CR9L 2VAAB 2EKSA 4LAQL 5KSBF 3KPRA 4GUPB 5IVXE 3CVHH 3CC5A 5GRVK 3RL2A 3P4NB 3IDYB 3MGOB 5HD8C 1JJUA 1RZJH 1U6AH 4YEFA 4NO0A 4GMTH 5F7DB 2VO5A 3AS2A 1HHHA 3BVNA 1NCCH 5D1XB 3NPZB 4UOJA 1XR8B 5A2JH 2G2RB 3HC4H 1K4CB 2ZJSL 3GI8H 4P2OB 2F9BT 1FZMA 3BDXA 5F7KC 3FQNA 4M1GH 4W70A 5E00A 4NFCA 4PJIF 3KYOA 1VHPA 3HZYA 3IDYC 1LQSR 3EAKA 3WIFB 5T1MA 3QDMA 4YHLL 5T3XH 4HIHA 1QFWI 4JHBA 3B8YA 5D5MA 5DQDL 5HJ3B 5LAXA 5D1XC 3OX8B 3HI5H 2E7MA 3UJJL 3BEVB 1K8IB 4G6AC 5C2BL 3MV7A 4P2OC 3LKRA 4AL8L 5TF0A 4J3SA 1LO0H 2V5YA 3GJFK 3HUJF 3BEWB 3H0TB 2YPLD 1KTDB 1BVLA 1FVCA 1P9MC 3N85H 1U8KB 1DTUA 1JF5A 5JORB 3CSBA 1BBJA 4DKAA 2DQGH 2C1OB 3UJTL 5CJOL 5EZOH 1QYGL 2PYEE 3AAZB 5MENE 3OAUH 3D1MC 4PRBB 4NKOA 1FFPA 5J13C 3MRPB 1WIPA 5ID1B 4KRPB 3MLSL 1MI5E 5GRUH 3EDEA 1F4AA 1W0YT 3NIFE 1T04A 4LHUG 3PV6B 1EEZB 1JPFB 1MREL 4OZ4B 5EU7C 4UMGA 2ZUXA 3VGAB 5SV4A 1LK3H 1OQOA 3DX9A 1ACYH 2D7NA 5F7WC 5BOZG 4GG6A 4M93C 4U1KB 2XWJB 2YBRB 2NNAB 4BH8A 2Q7NA 5DUPL 4KRPC 1RU9L 4MQXD 3MCKB 3HZKA 1YMME 1RZKL 4XVTL 3VXMA 4JFHE 3P11L 5CHNA 2E6PA 3VGAC 1LEGA 3G9AB 3N50A 5EU6B 2YD6A 1OGTA 5GJTL 5J06A 5EOQH 1JPSL 2PW1B 2XZZA 3DVNB 4JJ5A 1U95A 5E6IA 3EYVB 1E28A 1ETZA 1HOCA 3IYLW 2BC4B 3F5WB 4ZPTB 3LEYH 1T80A 5JNYB 3D2UA 1MFEH 1ORSA 2MSPA 1T21A 4L1DA 1FDLH 3QJHA 3SE3C 4RBPH 1B9ZA 2AXFB 4XNQB 1QQDA 4G8FA 5EOCJ 2WWKT 4FQLH 3PIQA 3EDJA 3U48A 1XGUB 1HCFX 3LV3A 3OF6A 4AEHL 1UKTA 1N0LA 3EBAA 4NRXA 3C6LA 2OTWB 3PNWB 1ZVSB 1JGEA 1PJ9A 3T0ED 2O5YL 5FYJU 4RGND 1Q9OB 3GRWL 3IFPA 2K3TA 4GKNB 3IS1X 3S36L 1AKJB 2VC2H 1EO5A 4ONHB 4LLQB 4D9LL 3B43A 1QLFA 4U0RC 3ZHDA 2BSRA 1IL1A 1J12A 2X4PB 5LGKA 3VCLB 1EPFA 4DJMA 2AEPH 5AZEL 5HYFA 5IHUL 1I85A 5HYSA 2ARJA 3SDAA 1R3JB 1VEMA 2IANE 1BQSA 4G8GD 1ZK9A 3BKMH 1DQQB 2YPKB 3OKNB 2PXYB 3B9KD 5T3ZD 2OJZL 2ZSWB 5DGRA 4KDWA 3BP6A 3L5JA 2BXYA 3ARGB 3BIKA 1J8HD 3NZHH 5MI0C 3MNWB 4BM7A 1NFDF 2F19L 4EN3B 1C1EH 4N0UE 4L3CA 3VGGA 1IAKA 1N0XL 2DQTL 2PXYC 3WIHH 4MAYD 4DKFH 3T08A 4JLRB 2P4AB 2AXHA 3LH2L 5FA4A 5CJXC 3I6KA 4M4RA 2DLFH 2IFFH 3ARGC 1AHWA 4NZJA 5J89A 4ZG1A 4EN3C 1ND0B 5DT1H 3CCHA 3QIWB 4UINL 3EYOB 1T03H 1QKZH 2VITB 5C6TL 5C0AD 4NRYB 3BO8A 1TVBA 2VDKL 4UILL 3V79C 4PJBA 4PJEF 3SY0B 2X4OA 4FFWC 2HT4C 1U3JA 5I1KH 4MNQA 3O2DH 1EAPA 4OUOA 3QIWC 2VAAA 4NHCH 5JW4Q 3C87A 5KTEH 2XQBL 3T0XA 3O11A 3NN8A 3QDME 4GUPA 1HYRC 1KEGL 4Z0BL 3WLWC 5D5ME 2OS7A 4HUWB 4LOUC 2I5YH 1VDGA 5F7DA 3M1BB 5D1XA 3DVGA 1XR8A 3F7PC 4EOWL 4JFXB 1A7NH 2G2RA 1F4XH 3U7YL 1B3JA 2LV4A 4P4KD 5EORH 4CADB 3C5SB 5TH2B 4TQEL 4K9EH 3E8UH 1BLNB 1EV2E 1P9MA 1X5IA 3MGAA 1MEXL 4LDOB 3SOBL 1BD2B 5A1AA 5DQ9B 3KVQA 4LARH 5HJ3A 3PWJB 7FABL 1FH5H 3OX8A 4Y16B 1K8IA 5JXEA 2EIDA 4POZD 2MWCA 3VWJD 3BEWA 3DBXB 3H0TA 1KTDA 1IKNC 1U8KA 4JM4L 3WKNA 4BH7A 2NY0D 5JORA 4GG6E 4CJ1A 3CMOH 1GYAA 2C1OA 4FTVA 5SWSD 5L2KD 1KC5L 1HZHL 1V7ML 1YJDL 3AAZA 1G7IA 1NCDL 4Y16C 2RBLA 1A0QL 4PRBA 5A16B 1EHNA 4OZHB 3VXME 3MRPA 4KK8C 1D6EB 4OCYH 5ID1A 1T5WB 3ZKND 2F58H 1K2DA 4NHUB 2BDNL 4RWYL 4P57B 1CL7H 1EEZA 2CXKA 3MLZH 4OZ4A 5E2VL 3FAWA 5H94B 5KG9B 3S37L 1ZHBB 1JK8B 3SDYH 4M8QB 2ZCLH 3LKSB 4QTIL 2WINB 4KJQC 4U1KA 4PJHE 1A6ZA 2YBRA 1D5XB 4OAWA 5JXAL 2DQJL 5HDBF 5IGXH 2XI9A 3MCKA 1W0WB 5IFAL 4HJGA 4PRDB 3X12B 3GZKA 3J8F7 5D8JH 1KENH 1TLKA 5D72L 4Z5RB 3CFKB 5SWZB 2K1MA 5EU6A 4TN9A 2C3WA 4P9MH 1RURL 2ICES 2PW1A 4LPVA 2W9EL 4KZEL 3DVNA 3FB7B 1GZPB 1R5WB 1T7WA 1WJ3A 3C6SB 2ZG1A 3F5WA 4L4VD 4MS8C 4XBEL 4ZPTA 1G6VK 5JNYA 2FX9L 1C5CL 2H32H 5L88L 4MVBC 4WHTB 2P7TB 4UQ3B 2DQEL 1L7IH 3A6CL 1INQB 2AXFA 5IBTL 5IIEB 3PL6D 5ESAB 5GHWH 2A9NL 1G0YR 4LVNB 5C09B 4AIOA 1UZ6F 1BIHA 4WFED 5E94B 1SJEB 3B9EA 4K3EH 2OTWA 3MV8B 3NCYP 1NAMB 2VL5B 3DNKA 2XNAB 1HHIB 1QSEE 1J0KA 2UVEA 2YKLH 1LDPL 1Q9OA 4GKNA 4M6OH 5DFWH 1AKJA 3UTSB 2EIEA 5IEHB 4LLQA 2WBKA 4KVCH 3ZSTA 2AGJH 3T2OA 4F57L 4IRSC 2CPCA 5FECB 1ZOXA 2MQ3A 3KDMB 5IK3B 4OM0L 2X4PA 3JWDL 3QFJD 4JQIL 3RWJB 3ZKXB 4RFEB 4JB9L 3F62A 4PLOB 1LEKA 1A7QH 3ZDXF 1U9KA 3EJYD 2OL3B 5ILTL 3O41A 5I2IB 4HZAA 5ACMA 3MXVL 2E9IA 1DQQA 4JFDB 3K3QA 2PXYA 2QQLL 1AE6H 4GXUM 4W4OC 3NOIA 3FFCB 2X1WL 5CJXA 1WBYA 3BISA 3ARGA 4LSTL 4XPFH 3ZKXC 4HFWB 1ED3B 2DIAA 1IAOB 1MY5A 3MNWA 4EN3A 4M7JH 4MDJB 2CKBB 4HQQH 3VA6A 4JO4L 4PJBE 3FO0L 3THMH 1HDMB 3OKOB 3QT2A 4MNQE 4JLRA 5EIVA 4FZ8L 3TBVB 3U9UB 5ISZD 5D2LB 2VXVL 5ICZB 4X8JB 5CKAA 1QUNA 4JM2F 4YLQT 3WN5B 1DBAH 2APWA 2EDRA 1ND0A 1JN6B 3GMRB 1HEZB 4G9DA 5C6PB 3QIWA 4WI6A 1DEDA 2X40A 2YRZA 3D9AH 3EYOA 5AWNH 3MTRA 1JRHI 1FNSL 4DUWA 4NRYA 1EEUA 1A7RL 4NUGL 2QSTA 3FO1B 1NCAL 5FYLE 2ATPA 4HUUB 4OM1H 4ZAKB 5DD0H 3NA9L 4RFNB 4DFIA 1XGTB 2EH8H 1S9VB 3B2VH 5JA8B 1UQSB 1X44A 1BQLL 1QFUH 2K7QA 3M1BA 4XBGB 4FXKB 4ZAKC 1OAQL 2JB5H 3ALWA 4KJWD 5ERWB 1LD9B 4D9RD 4JFXA 4RFNC 3QFDA 4NM4L 3ZTNL 1OAYH 3U30B 3ZE2E 5J0BA 1L0XA 3HNTH 4CADA 4BZ2H 3F6LA 4Z95L 5TH2A 4U1HB 3ZZ1A 4FTVE 3IFNH 3JBG7 5E8DL 1IKNA 1BLNA 1SYSB 4HUXA 1A3RL 5EWIL 4NNPL 1BD2A 1QLEH 2XG5A 4LK4A 3WFDH 3L3OB 5KVEH 3P0VL 5DQ9A 4KTYA 4X7EC 5CJ5A 3EIFA 4PJ5B 4Y7MA 5J57B 4Y16A 3V52L 1PSKH 4ZOEA 3U30C 1CR9H 2Z8RA 5HVFB 4LAQH 2Q3AA 4MXQC 3DBXA 2B7DT 4OZGB 1FHGA 2ATKB 4YBLB 3P9LB 4UBDD 3UEZA 5ID0B 3K4ZA 4NQDD 3GUTB 2X4SA 4FQ1H 3S35L 2ZJSH 4MCYA 3PP4L 1HNFA 5I0ZA 5CILL 4D9QE 4OFYA 4P57A 2LFGA 4YBLC 2V6HA 3JWOC 4YHLH 1S3KL 1ZHBA 2GJ6D 5DQDH 2GSGB 4M8QA 3ALPA 4WFHD 2WINA 4JO2L 3UJJH 5B3JF 3A0OA 5C2BH 3QZWB 1D5XA 1ZVYA 4AL8H 4WJ5A 2VNCA 3HZVB 3EOTL 1IAIM 4PRDA 3PP3H 2VJXA 1I3GL 5E8NB 5AG8A 4FMKA 5CJOH 4Z5RA 3CFKA 1QYGH 5SWZA 1QLRB 2P43B 4E41B 1CBVL 1NMAL 3RWEA 5IOPB 4R96A 3MRMA 1EGJL 12E8L 4I77L 4UDTB 3MLSH 3FB7A 4OGAD 4PJAB 1GZPA 1R5WA 4XC1L 3C6SA 1Z2KA 1MREH 2SEBB 3CFDA 3Q6FB 2J2ZA 1ZLVK 4OF8A 3RVWC 4WHTA 3VRJB 1VB9A 4UQ3A 2ZP0T 1GOFA 1C08B 1WLHA 5IIEA 5DUPH 1R5VA 1RU9H 5ESAA 3W0WD 4Y19A 3N1QC 1RZKH 4XVTH 5E94A 4IRSA 1QHPA 3BYTA 3MUHL 1I1RA 4PRHD 3MV8A 3EOYG 1QRND 1NAMA 2NY1B 1MFNA 1XCTA 2XNAA 5DDHB 2FBJL 1HHIA 5TQ2L 5GJTH 3MRLB 4F2MB 1YMHA 1JPSH 3G6DL 1NBVL 1WZLA 3UTSA 1JGLL 5IEHA 5D1QD 4AEFA 2HFGL 4W4OA 4WFGE 5FECA 2WMPA 3KDMA 3VFSA 2VZTA 4ONFL 4ODBD 1P6FA 2VWEE 5FGRA 2NY1C 1HILB 4RFEA 4MXVE 4QXGL 2OL3A 5I2IA 5FM5O 1RK0B 2BHYA 2UWEF 4JFDA 1CFVL 4MJ6B 4U6XB 2FH6A 3MYJB 4AEHH 3FFCA 3GSQB 2DF3A 4FFVD 5GGVY 2WQRA 1ED3A 4HFWA 3SQOL 1IAOA 1U3HB 3UZVB 4MDJA 2O5YH 5E1HB 2CKBA 3GRWH 3S36H 4U3XA 5D1ZD 5DYOA 1HDMA 3HG1D 3FOLA 3OKOA 4D9LH 3VI3E 1G7JB 5GS2D 4IRZL 2WWMD 5D2LA 4DFHA 3K46A 4X8JA 5ICZA 3GMNB 5LJYH 5FKPA 2C7UB 1U3HC 2ICWJ 5AZEH 5IHUH 5C0GB 2C3VB 1JN6A 4OGZA 1J10A 4G7VL 1QFWL 3TFKC 1KLFA 2OJZH 3C8HA 4F3FA 1I1AB 4ZMAT 4QXWA 2CRZA 3FO1A 2KDGA 2Y36L 4ELKB 4HUUA 1XAUA 4ZAKA 3HC0B 4PS4L 2ED7A 2F19H 3RTQB 5DUML 2BVTA 4L4JA 5TE6L 3QWOA 1XGTA 4R90L 4CUCA 4N1EA 3TT3L 4MLIA 1S9VA 1N0XH 2DQTH 4Y2OA 3J7HA 2IGFH 3GMQA 1F6AB 2HFEB 3LH2H 5EUOF 2W59A 4EDXB 3GMOB 1YY8B 3U1SL 1JZ2A 1LD9A 4NQTA 4C55A 1MY7A 3RTQC 1WBXB 3QQ9D 4UINH 1M1SA 3QIUB 3W11D 1J8KA 1M71B 2VLMD 5C6TH 4JZJB 3UBXI 1SYSA 3EFFB 1I8KB 2VDKH 3FZUC 4PRPB 4UILH 3NFNB 3DARA 1SJXA 3BIBX 2C1PB 4RGMB 4HCRA 1VACA 1L9NA 3ILPA 5F6HI 2EH7L 5KSAB 3BHBB 4PJ5A 2CDGA 4KXZH 1BEYL 3VDCA 2CMRL 2XQBH 4YIQA 3QIUC 5DRNB 3ZE0F 1I3UA 1YEFL 1KEGH 4Z0BH 4YHML 4JZJC 4OZGA 4P2QD 1ODAA 3BRDA 3OMZA 3P9LA 5ID0A 4RGMC 3FB6A 3CFEB 4WI2A 5KSAC 1MRDL 4U6HB 3BN9D 5EBMB 4MA7L 3GUTA 4EOWH 1CQYA 2EDKA 2W65B 3U7YH 1XF5B 2WIIB 3RU8L 5EB9A 1ZLVH 3SOBH 3KPPA 1MEXH 4LKXB 4G6ML 1S7UA 2GY7B 1BFVL 2HN7B 3ARYA 5I16A 2GSGA 7FABH 3NFSL 3C9NB 3PWPD 4OD3L 2IAMD 1KCKA 2IBGA 1J86A 3AS0A 2WBJC 2CRMA 3MJ8B 3QZWA 4X5XB 2VR5A 5DC4B 1Y6KR 2VLKA 4GLRI 1HHJB 3Q5YA 4ZUUB 4JM4H 2R39A 3CPLA 3E0GA 3MGTB 5E8NA 3QUZB 4ZDHB 1KC5H 1HZHH 1QLRA 1V7MH 1YJDH 3VXSD 5DJ6B 1U8PB 2NY4D 1NCDH 4MZ2A 4F58L 5IOPA 1A0QH 4Y19E 1QPXA 3ULUL 5K9KB 3MLWL 1Y0LB 4JJHA 5D7IF 3T0WA 1KCSL 2HG5A 3QNYB 4RZCB 2BDNH 4RWYH 1UM5L 4OF6A 1AFVL 1ZS8B 3IKCB 3VI4F 3GFUA 1M4KA 3QUMB 5J1TC 5E2VH 1FL3B 3Q6FA 2ESVD 3QUZC 3S37H 4GRLD 1GXEA 2JJSC 1MVUB 1T1ZA 5DQJB 4QTIH 1JPST 4P49A 1C08A 3FRUA 4O9HL 4YHKL 3TESA 5E2UH 3BXNA 2DD8L 4MJ2A 5JXAH 2DQJH 2BNRD 2CLRA 1MHHB 5C70A 2CR3A 1H3VA 5D72H 2Y4SA 5AAWA 4Y8AA 5C0DB 3M45A 4JZOA 1OM3L 1OOAA 4P3WA 2P8LB 4I0PB 4JFDE 2LAGB 3MRLA 1NUDA 4F2MA 5FO8B 1LP9F 5I1IL 3L5WB 1RURH 2W9EH 4QKXB 4P2CG 4KZEH 1BREA 1S9YB 3E3QE 2R2CA 1RFDL 1FFOA 2VDNL 4KKCD 4XBEH 2FX9H 1C5CH 3DETC 4PGCA 4ZO7A 3FJTA 5L88H 4I0PC 5BXFA 2DQEH 4ZFGL 3A6CH 3BIAX 3B3IB 4R8WL 5IBTH 4QHNB 1HIML 1RK0A 4G42A 5D2LE 4KJYB 4EVNB 1P7QB 1P4LB 3RVUC 2A9NH 5BS0B 4U6XA 2V17L 1ZV5A 3MYJA 1SEBB 3D39D 3GSQA 3QXAA 1A1MA 1DJSA 3I6GB 5GISH 5CGMA 1AGFB 1U3HA 5IT2L 4HK3N 3TN0B 3G6JA 2A73B 1LDPH 2VIRB 1U8MA 3KPNB 2BFVL 1MJUL 3WL9A 3SKNB 1P7KB 4OLZL 1G7JA 4F57H 1T5XA 3GMMA 4R4FH 4PJ9B 5FV2A 4OM0H 4U49A 3JWDH 4JQIH 3GMNA 2C7UA 3MLRL 4JB9H 4X6CF 2C3VA 1YNLL 4NC0B 4UNVA 3SKJH 5ILTH 2RGSA 3O3AB 4NUJB 1EJOL 5C0CB 5FHBL 5AD0B 3MXVH 5DJ0B 1Z9OA 2Y25A 2QQLH 3ZDZF 4G9FD 5IG7B 4NQSA 4PJ9C 3AS1A 4LSTH 1QSFD 4ELKA 3LRSB 5CBAA 2NPLX 3RZCD 4JKLA 5HHOB 3RTQA 1NL0L 5E8EB 5BVJA 1MHCB 3QR2A 2VL4A 1OF2B 4ODUB 1T89C 3FO0H 5C08B 5CGYC 4PJ5E 1F6AA 2HFEA 1GJIA 1TPXB 4Y2DB 2R0WL 2VXVH 4EDXA 1ZT4A 1T6WA 1CU4L 4F7TB 2FO1A 4QF1A 3BWUC 1KPUB 4OZGE 1WBXA 3MBXL 5FYKE 2GUOB 2R23B 3QIUA 5HYEA 1FNSH 3LKNB 4JZJA 3EFFA 1I8KA 1HI6B 2QBWA 1A7RH 3IKKA 3MZGB 4NUGH 4HCRL 3NFNA 5B4MD 1TPXC 4HBCL 1NCAH 4Y2DC 2ZWLT 4X6DB 5B3NA 3BHBA 1SBSL 5FCSH 3HA0A 3NA9H 2GK0B 4ELMF 3DV6A 5DRNA 5FYKL 4YPJA 1AR1D 2WWKO 2BCKB 1A9EB 3JWOL 4JFED 3P2TA 2FH8A 4NN6B 3OR7B 1BQLH 3HCVB 5C0IA 3CFEA 1CS6A 1EFXB 1OAQH 3F12B 2VLKE 5E5MB 1WZ1L 4BSWB 2W65A 3GSOB 4NM4H 3ZTNH 4YO0B 2WBJA 3MPCA 1XF5A 2WIIA 3BZDA 3G5YB 2IWGA 4Z95H 4APQB 2IH1B 4EJ1C 5ICXA 4XXCC 4KROB 5E8DH 3VH8A 1CG9B 3JWNC 1A3RH 4LKXA 4NNPH 4ZUWA 4NN6C 1S78C 3HLAB 4ZS6D 3P0VH 3O4LB 2CQVA 1ZT7B 3EUUA 5F9OL 3FO9B 4YDVB 4XNUL 3C9NA 3IDMB 4YFEA 1D6VL 7CGTA 3NH7L 3V52H 4ZO9A 4X5XA 3MJ8A 5DR5L 3P4OA 1FGVL 4OLYL 4APQC 5IVZB 1HHJA 2BSTA 2DQHL 3N1FC 4ZUUA 4PD4K 3ILQC 5GZOD 3MGTA 5J11B 2V5RA 3QUZA 4HDIB 4JRWA 4H0HB 2JJSA 1XZ0B 1FNLA 3EO0B 2RCSL 4BSVB 5DJ6A 3NIGF 3CDYA 5DC9B 4KY1L 2Y7QB 3S35H 5K9KA 1Y0LA 3PP4H 1FNEB 5JOEA 4K3JL 3LPFA 1VESA 5CILH 3QNYA 4RZCA 4QGYA 3N1GC 1ZS8A 1ZKAA 4PJDB 1FL3A 5J11C 3WNOA 1S3KH 1EHLL 1Q0YL 4G8EB 1MVUA 4QRQA 5DQJA 5H37G 4JRXD 3S98A 5DI8B 4S2SB 1D9KB 4X9HA 1MAML 1XIWB 4L9LB 4PJGB 2NY5C 1VFAB 3EOTH 4DGVH 1DE4B 1MHHA 4CDGC 3DXAB 3WHE1 3CZJA 1I3GH 3CDCA 5C0DA 1T20B 1L0QA 1CBVH 1NMAH 2R56L 2P8LA 4Z76B 5FO8A 1D9KC 1EGJH 12E8H 3L5WA 4I77H 1XIWC 1FZJB 1Z9MA 4L9LC 2GAZA 2HFFB 4NPYB 3ZYJA 1MLCA 3QZWG 1S9YA 2P48B 4XC1H 1J5OL 5CEXB 3H9HB 5AYQA 3ULVL 4ZUTB 1KIRB 4YK4B 3CDGA 3GSNB 3G6JE 4FMFA 4XNYL 2DIBA 1JRHL 2NXZD 3B3IA 3FRPG 5KZCD 4Z7QE 1A5FL 4EVNA 1FVEB 1P4LA 3BOVA 4P46C 1KB9K 2A9ML 1EBAA 1XT5A 2BHUA 1II4E 3ARDD 4YK4C 4WI3A 4XMLL 1OTTD 4M4PA 5D2NB 4LCWB 1GGIL 1TIUA 2D0HA 4CU8A 3PDGA 3PQYB 2FBJH 5TQ2H 4WGWB 4WUUB 3EJZD 4DOHE 2A73A 1J1XL 4QHLB 3KPNA 3G6DH 3KAAA 5FUOL 1NBVH 1G7LB 1KGCD 1JGLH 1P7KA 2HFGH 1D5IL 5D7LD 4XRCB 4PJ9A 5DJXB 5D2NC 3S34L 4ONFH 1F3JB 2XKNB 4K55A 3IETB 1VFOA 4QXGH 3QUXB 2HRPH 3O3AA 4NRZA 4NUJA 2NY6B 1T89A 4UOW0 3RWHB 1CFVH 1IT9L 3WFBL 6FABL 5IG7A 1FNHA 1CGYA 1S5IL 1UWGH 2FL5B 2FLBT 4HWZB 3SQOH 3LRSA 3QG6A 2COQA 5T1KD 4L8BB 3P0GB 3PABA 5HHOA 3QUXC 3GBNL 3BMVA 5E8EA 1MHCA 4ODUA 1OF2A 1AI1L 1S7QB 1JI2A 5H2BB 5C08A 3QO0B 2EDFA 4XI5D 3IXTB 2Y06L 4NO2B 4IRZH 2IG2L 1FZKA 5JIPA 1FYTD 5IB3A 4NIKB 5IP4A 3B5HA 3QHFL 3TBTB 4DZBB 5CEZD 3L95B 3LY6A 4F7TA 1U58B 1IMHC 4ZUSB 1KPUA 4PBVC 4ZQKB 2QHRL 1S7RB 2CUHA 2R23A 2YD9A 4G7VH 5GS0D 5DJ8B 3KPTA 1QFWH 1HI6A 3IU4L 4HS3B 1KV3A 4WENB 2EKJA 4OZHF 5HGAB 5A40E 4NQED 4I8DA 3F7YB 1JFQL 1RIUL 4PS4H 5GGTL 5E9DB 2OLDA 2GK0A 2X4QB 4ODXB 4MHHI 5DUMH 4N0YL 3L7FB 4R90H 2FNBA 1CZ8L 1GC1C 3TT3H 2BCKA 1A9EA 1DN2A 4XXCA 1I1CA 4ZNEA 2J5LB 3OR7A 1FFQA 4OCRL 4LSSL 3REVB 1I1FB 1RZIB 3HCVA 4LCCA 1DBJL 4J3XA 1EFXA 5C0BE 3UTPE 3ZHKA 4NBZB 5E5MA 3U1SH 3BZFB 1V3KA 4BSWA 4KI5D 1ZMYA 2YUWA 3DHJA 4MNGB 3GSOA 4YO0A 3G5YA 4S10A 1D5MB 2C3XA 4LSVH 5DHVB 3RPKA 3UYRL 3VFOA 2J5LC 4NBXB 3HLAA 3O4LA 1T83C 3OAZK 4IHOB 1ZT7A 3ULUF 4XP6L 2RB8A 3FO9A 3NIDF 2RJMA 4LFHD 2EH7H 3IDMA 4PJXF 3RPIA 1BEYH 4CJ0A 2NXYB 4UT9L 2CMRH 2VE6B 1A1OB 3KR3H 3FOMA 5C07B 1YEFH 1JYXA 5IVZA 4YHMH 2WK2A 1KBGL 5EU3B 4ALAL 2CKNA 3L3JB 1G9MC 4NNYB 5DD3L 5FFLA 4HDIA 2KZ1B 1MRDH 1ONQA 1XZ0A 3EO0A 3BDBA 4BSVA 4MA7H 4GW4B 1JGUL 2NXYC 1FNEA 3H9SD 3RU8H 1RUQL 5M7QA 3QUML 1NUGA 1A14L 1K3ZA 1JE6A 1AO7D 4LVHB 2I07B 3CSPA 4BQBA 1BFVH 3RVTD 2HTLD 3O8XB 1EHXA 4FFZL 3SKMA 4U1GB 1V5JA 3NFSH 4OD3H 5KN5B 4LSUL 3GK8L 4S2SA 2A77L 1D9KA 3IS0X 3VXRD 4OFVA 4LP4A 1T1WB 1XIWA 4JN1L 2FHCA 5KS9B 4PJGA 1VFAA 1DE4A 2UZYB 4LQ1A 5E99L 4KK9C 4LVHC 3GSUA 2FBOJ 4P48A 1IM9D 1IBGL 3O9WD 4O2CA 1MNUL 3MRBA 3O8XC 4PP2B 1T20A 4QHKI 1D5BB 4F8TA 4F58H 3ULUH 5HVHB 4KKNA 3S7GA 3LSOB 3OR6A 2KQMA 3MLWH 3QXTA 4Z76A 5IV2B 1FZJA 1EEYB 1KCSH 1KSRA 4NPYA 4P46A 4XPTL 1WAAF 1UM5H 3H9HA 5CEXA 1AFVH 4ZUTA 2UY6A 1KIRA 4LPWA 4E0RA 1SY6A 5HGDB 4GQ9L 4Z7VB 4XWOC 3DROA 5JIHA 5DURD 3D3VB 5HVHC 4XTRC 4O9HH 4YHKH 3QJFA 5DZLA 4MX7A 2DD8H 2LABA 5F6IB 1JWMB 2XWTB 5KJRL 1FVEA 3QUYC 2L7JA 2R9HD 3MV11 1IZJA 3I2CL 4LBEA 1IRAY 2P5EA 4J8RB 1A6AB 4OCSL 2N7BA 5D2NA 4LCWA 2P1YA 1OM3H 2V7HB 3PQYA 1RQ5A 4WUUA 3WDJA 4ZTOL 5I1IH 1MCJA 5F6IC 2X1OA 2EDYA 5DEZA 4HJ0C 1G7LA 4JG1L 3HE6D 4NQCD 4ODSL 4JFPB 5GS3A 2QSCL 3QSKB 3EW3B 2OM5A 4KKBD 1RFDH 4H26B 4XRCA 5DJXA 5HHOE 4NKQB 4BFGA 2VDNH 5DMIL 1F3JA 2XKNA 1CTOA 5C08E 3IETA 4ZFGH 4M02A 3QUXA 4RMWA 4R8WH 5C9KA 5F1KC 3RJDA 1HIMH 1C7SA 2E7HA 3KWWA 3RWHA 4UIMB 2V17H 2WANA 3MJ9A 2XXCB 4MCZB 5GS1A 2CK0L 2FL5A 4HWZA 5IT2H 4L8BA 1O7SA 3T2PA 4M62L 4U1IB 2J8UA 1N3NB 1ZXQA 2BFVH 5H2BA 1MJUH 3MRKB 5B8CB 4YPGB 5F89B 3QO0A 3IXTA 4G80B 1NKOA 4TRPL 2R69L 1UENA 3QEQB 4OLZH 4NO2A 3MUY1 5INCB 4LRIC 4PGDA 1FFNA 4QEGA 3KLHC 2J12B 2RFXB 2CLZB 1IQWL 3TBTA 3L95A 4PJCB 1U93B 3MLRH 4AH2B 4ZUSA 1YNLH 4ZQKA 4M9OA 2D7TL 2QEJA 1S7RA 1EJOH 4ZNEE 5FHBH 1BVZA 4X4MA 3OAZH 5B8CC 5DJ8A 3VDBA 4QXTA 3OKEA 4J7RA 2HTKC 4KQ4L 1AIFB 3F7YA 1Z3GL 2J88H 2QSQA 5E9DA 4ODXA 1Z5LB 5IQ9B 1NL0H 3EYQD 4Q74A 5L8KB 3JUYA 4Y5XB 1QR4A 3O4LE 2D0FA 3UCRA 5B22A 4XCFL 1FZOA 4X9BA 4QOKD 4R3SA 3VFNB 3UBXG 5DMGD 1T83A 5E1AB 1JZ8A 2R0WH 1RZIA 1I1YA 1WWCA 3L1OL 4Y4HB 1FG9C 1CU4H 1LO3L 3BZFA 1WC7B 4MNGA 3MBXH 3VMNA 1MAKA 5JW4R 1D5MA 4Y5XC 5DEGB 5J12B 2JK5B 5DHVA 4N9OB 2ZSVB 4Z7WF 2YPLB 1YPZA 5KVDL 4HBCH 1UH4A 4HIJA 4IHOA 5FUZL 1GOGA 1KLUB 4PJAF 4Y4HC 4JDTL 1SBSH 1H15B 2VDQL 3KPQB 4NKDB 4HUMB 5HGHA 2VTFA 4XMPL 1A1OA 5J12C 2B5IB 5C07A 5FYKH 2X9YA 4N0FA 4DZ8B 2ICCA 5H37H 3JWOH 1AC6A 5GSRA 3NCFB 2CDFB 5EU3A 1K3IA 4Z77B 2Q20A 1JYVA 3O6ML 2Q3ZA 3L3JA 4JFFD 1Q38A 4NNYA 3KNBB 1Z9LA 4Y1AD 1HKFA 2VOTA 3ZTJH 4KV5E 1JHLH 3VE0B 1WZ1H 4PJGE 3NCMA 2LVEA 1KNOB 3V4PL 4HK0B 3EDDA 2NY5L 2P5WA 2B5IC 3PUCA 1CXKA 4KFZC 1UC6A 4F7MB 3OG4B 1B6UA 5DFVD 3HE7D 4MAUL 3Q2CA 1FVDA 3UYPA 2I07A 2HT3D 5F9OH 2YRLA 4XNUH 4YZFF 4W6YB 5KN5A 1D6VH 3NH7H 4LMQI 1KCUL 5DR5H 3SGDI 1FGVH 4L4TD 3KYMA 2A0LD 4OLYH 3ULVF 5KS9A 4MJ4A 2DQHH 4O02L 4MQXC 2FD6L 1O5DT 5GGQL 5HDOA 1YUHB 2Y07L 2I60H 2DN7A 4PP2A 2RCSH 5IMMB 4KY1H 1CCZA 3LSOA 4NZRL 5IV2A 3P4LA 5SV3A 3UJIL 5SX5K 4K3JH 2P5EE 1EEYA 1JTTA 4CW1B 5D2NE 3NTCL 4LCWE 5ACZB 1SY6L 4E42B 3QUYA 3GSNL 3PQYE 5HGDA 4JVWA 2R1XB 4HC1L 5K33A 1EHLH 4FXLA 1Q0YH 2Z8SA 4WUUE 5JOPD 3C2SA 3LEXB 2VSDA 3Q5TA 3D3VA 3STLB 5JPNB 2W0KA 4KK6D 3TNNB 1R5IB 3DSFL 3DIFB 1X5JA 1G7HA 1MAMH 1JWMA 1CDIA 3LKPA 3T0EB 2N56A 4O00A 4RGNB 3B8SA 4TSAL 3K4AA 1J18A 1KULA 5C92A 1J0ZA 5JZ7D 4J8RA 1A6AA 4WW2B 2UUDH 4P4RB 2R56H 1Z9SA 4P23D 4XP4L 2VXUH 1ACZA 3T0EC 4WI7A 1W2KT 4RGNC 1G9NL 4JFPA 4W6WB 1WBZA 4G8GB 1J5OH 1NGXB 3ULVH 2NX5E 4H26A 3B9KB 2B1HL 3BW9B 4WY7L 2X4NB 4PPTA 1NLDL 4WW2C 2J8UE 4MJIE 3STBA 5HHQA 1J8HB 4XNYH 3VFUA 4JFZL 1JRHH 4PG9A 2O5XL 1NCNA 1IARB 1UWXH 1A5FH 4BQ6A 1NCWL 3MJ9L 2A9MH 3FQUA 4UIMA 5L2JB 4WV1B 1UM6L 3B9KC 4LRIA 4XMLH 3GIVB 4MCZA 4MAYB 1VFMA 1GGIH 4FXGA 4Z6AT 5I17B 4XZUB 5BRZD 3CU7A 1WWWX 4X4ME 2XFXB 1S5HB 5CZVL 4U1IA 1J1XH 5FUOH 3MRKA 5TDNB 3E2HB 4YPGA 5B8CA 2R2EB 2P45B 3KYAA 1X5AA 1A02N 4G80A 3QEQA 3B6SB 4WV1C 1D5IH 5INCA 5C0AB 5E9DE 3VFVB 4O5LL 1FLRL 2RFXA 2CLZA 4U1JA 3L3DB 3S34H 3KXFB 4PJCA 3C8KB 3CVHB 4PP1D 1U93A 5DJYB 4AH2A 3HC3L 5I1GL 3TNMB 3V0VB 1LO5B 1H3PL 5MHSE 3SGJA 2ORBL 3LB6D 4U1MB 5E2WL 1IT9H 3WFBH 6FABH 4H0GA 5HVGB 2RQ8A 1NFIB 2XYCA 2J8OA 5EO0B 1S5IH 2FO4A 4YJZL 1OT1A 3T1FA 2PYFA 1Z5LA 5IQ9A 3GBNH 4F8QA 1AI1H 1OAKH 1YPZE 3AU1B 4Y5XA 1N5YL 4P4KB 4WI5A 4OD2B 4WCYL 4LGPB 2IG2H 1YYML 4IMKC 1I4FB 4QO1A 5E1AA 2H26B 3L3HB 3IDGB 3QHFH 2Q86B 5I76B 3IDNB 4PB0L 4Y4HA 1EZVX 5AEAA 1WITA 1WC7A 2QHRH 5DEGA 4EDWL 1M05B 2JK5A 2Y6SD 1G9ML 4LLWB 3VWJB 1UXSA 1CXFA 1XR9B 2ZSVA 3IU4H 4MDIA 1HXMB 2DI8A 3WSQL 2NY0B 2HKHL 2P5WE 1KLUA 2X4RB 1MQ8A 1JFQH 1RIUH 5GGTH 5SWSB 3TYFB 4NKDA 5L2KB 4LLYB 4N0YH 2V2TB 1M7DB 1CZ8H 3RGVD 2ICEA 2DJUA 4DZ8A 1AP2B 3QPQC 3K0WA 3VWJC 2CDFA 4Z77A 2EDEA 1A7PL 3KNBA 4OCRH 5DRXB 4LSSH 3B2UD 1QFHA 3RNQA 3SJVE 5IMOA 5J1AB 1DBJH 2BNUB 5J4MA 3ARSA 4ZXBD 4PV8B 3U0WL 1KG0A 4PJIB 2QV2A 3TYGL 4QT5B 5I66B 1QBML 2FEEI 2HLAA 1VFBB 2VZSA 4F7MA 3ZE1E 4OJFL 4F7PB 4P59L 3N0PB 5H8DA 1I7TB 5J6HB 4CVXA 4XP6H 5ITFB 1TZIB 4ZUVB 3OB0K 1BZ7A 3Q3GB 1LVEA 3RJQB 2ZG2A 4UT9H 4LHQB 4KWUA 2XN9D 4K3GA 4IOIA 1TXKA 1MF2L 4HH9B 2CSPA 3C60C 1KBGH 2V9TA 4ALAH 2HMID 1Q9KB 3BE1L 3H6JA 1K4DB 3IVKB 1F3RB 1YUHA 4MXWL 5DD3H 3TZVD 1GZQB 1PEWA 5DD6B 2YD1A 1LNUB 4L3EA 3BGMB 4L4VB 1JGUH 2P46B 5EO9B 5CZXC 4X80L 1RUQH 4CW1A 3QUMH 3K4DA 5ACZA 3PL6B 1A14H 3RNKB 3HAEB 5IEKB 5FYJL 2R1XA 3ZL4L 1PVHA 4FFZH 3LEXA 2AEIT 1YNTB 3STLA 5JPNA 2P42B 4LSUH 1R5IA 4M1CD 3TNNA 2PO6D 2A77H 5F70A 3T0EA 4JN1H 1JF1B 3PL6C 2EYTB 2DMCA 2PR4L 1T7ZA 4C56B 2R2BB 2G5RA 1RI8A 5E99H 3MRDB 1IBGH 3LS5L 4XAKE 4NZDA 1MNUH 1ZGLB 1OLZA 3FONB 4YDJB 5LCVL 3KPOB 4WW2A 1F5WA 3GKZA 3LEVL 3QFJB 2EEDA 4NQVB 4P4RA 5CFHA 4CVUA 1NBYB 1SQ2N 1H0DB 4HAGA 5DHXB 4ZOAA 4ZO6A 5K9QI 4XPTH 4G8GA 1NGXA 3L5IA 1EXUB 1G1CA 3B9KA 5CBEB 3BW9A 4GQ9H 4MA1B 2X4NA 3V0WL 3IAPA 4GS7B 5CP3H 3VMPA 2PYED 1TFHA 5MEND 3BGAA 5K9JL 4NJ9L 1J8HA 2Y72A 3QEQE 5KJRH 3EJYC 4OD1L 4NSKA 3MRIB 3T3PF 3MLTB 5L2JA 3I2CH 4WV1A 3GGWB 4IRJD 4NT6B 4MA1C 4OCSH 4GS7C 3KLDA 5I17A 5ISZB 1RUKL 2IMNA 2XFXA 1ZHLA 3PWVA 1S5HA 3BKYH 1YN7B 4YHZL 3DGGB 4ZTOH 3DX8B 1YY9D 4X6DF 2ZOKA 4ODSH 5TDNA 3U2SB 2R2EA 1YMMD 1PKQB 3GJFB 3B6SA 1TCRB 4JFHD 4J1UA 5BMFL 1NGQL 3VFVA 1EZVY 2OSLA 5FHAL 3VRLE 5E4IA 4DCQA 3L3DA 5DTFB 5DMIH 3KXFA 3C8KA 3CVHA 3BPOB 1O0VA 3NBNA 4YXHL 5DJYA 1V8HA 2X9XA 3TNMA 3V0VA 2X89A 2V2WB 2XPGA 4OI9A 3CK0L 2YSSA 1SBBA 2DM3A 3BGFB 3C5JA 2V9RA 3N9GL 2UYLB 4IMKA 2JJTC 1NFIA 4NM8L 5EO0A 2CK0H 2D7OA 3BPOC 3ES6A 1JHTA 1FPTL 3VD3A 4M62H 3ZKSD 4X7CC 1CFTB 3MBED 3P40A 1I7ZB 5LQBL 2CUIA 4TRPH 2R69H 4OD2A 3OJDB 5D71L 1KOAA 4LLAA 1AGCB 2BK8A 1I4FA 2H26A 3IDGA 1IQWH 4ZYKA 2UV3A 4K9EC 5I76A 4RNRB 1FL5B 4KJWC 1U8IB 2D7TH 1M05A 4LLWA 2X1PA 2ZCKL 5CD5D 4WFFE 4BKLB 3PHOB 4KQ4H 1I9JL 2DLGA 5E8PB 1PG7L 1Z3GH 2YWYA 3TYFA 5L2KA 2PKDA 3RWIB 5KSBA 4LLYA 1CI5A 2IAND 4GLRH 4PJDF 4PGEA 4NQDB 5GGUA 2NR6C 1JZ4A 2M2DA 2XOTA 1AP2A 4NZTL 3VFRB 5E08L 3QXWA 2VXQL 4XCFH 3WDIA 1YA5A 1QVOB 3MRHB 1CLZL 5FUCE 5EPMB 2W0PA 5J1AA 4UBDC 3TIDB 4DEPB 3L1OH 2BNUA 1DLHB 1LO3H 3P73B 3WD5L 3WFZA 4FQHA 4PJIA 1NMCB 4QT5A 5I66A 1VFBA 2DLTA 1AXSB 2IH3B 3C60A 1KFAL 4ZODA 2NTFA 4F7PA 1FV1A 1I7TA 4L3EE 4AEEA 5BOPA 3QQNA 1J7VR 5KVDH 1PZUB 5A2FA 3VGFA 5J6HA 3ESUF 2EZ0D 5ITFA 4R6UA 5FUZH 4DEPC 5EZJB 4ZUVA 4JDTH 2VDQH 4U2ZA 1I9EA 3Q3GA 2WQ8A 3HUJA 4LCUB 4XMPH 1S7XB 4U2YA 5GJSL 1NMCC 4FQPA 4X4YB 5I1LB 4NO0D 1F6FB 1GGCL 1ZEAL 3NCJL 2ENSA 2H32B 1Q9KA 3NA4A 3MROB 4AQOA 1K4DA 3HNSL 1JYWA 3IVKA 3RX5A 1GZQA 4NQXB 4S1QL 4DTGL 5DD6A 2NW3B 1KXVC 1LNUA 2A38A 4GO6B 1TNMA 3T0EE 2XKSA 3ZDYE 5M94B 2IADB 3V4PH 3DX7A 1UGNA 3WNLA 2NY5H 5EBLA 4I48B 1FN4B 1RVFL 3QDMD 2MTPA 3PL6A 1F90L 4OGAC 3W0WB 3RNKA 5IEKA 3CXHJ 2CIIB 4QLRA 1CLYL 1YNTA 2YS4A 4PRHB 4QRPA 3DUUB 1KCUH 1AD9B 4U6YB 3ARPA 4QRRA 1VENA 1NGWB 5ACLA 3H9YA 4U05A 4R7NB 5C0FB 1JF1A 2J8HA 4O02H 4X6BA 4L8CB 4C56A 1XGPB 2FD6H 5GGQH 3MRDA 1N26A 5D1QB 5JQHC 2Y07H 1ZGLA 1BOGB 2APBA 3FONA 5GRJL 1PFCA 3IJHB 3KPOA 4YDJA 5IJVB 4JHWL 3QFJA 4NQVA 1DVFD 1LE5B 4XX1E 4NZRH 2C4XA 1NBYA 1EUUA 1H0DA 2V7NB 3UJIH 2D31B 5AUMA 1J05B 2GFBB 3NTCH 5T3ZL 1KYOJ 1SY6H 5F9JB 1J1OL 3GSNH 1EXUA 5D1QC 3JV0A 4HC1H 5I8OL 1X5FA 4ETYA 4OFDA 1X5XA 3WIHA 5HHXL 1DSFL 4ZNCD 4GW1B 3F7QA 3SKOA 4TSAH 3S5LG 2QR0A 3KXFE 5D1ZB 5I15L 3GGWA 3HG1B 4F33B 1CFNB 1HH6B 3MV01 2Y9RT 1OTUD 1K6QL 2VZ3A 1YN7A 3DGGA 4XP4H 3DX8A 5JR1L 3OV6A 2AJZB 2VSCA 2NCMA 4WHDA 3HB3D 1AGEA 3WUWA 1KPRB 5F21B 1G9NH 1T7XA 2BOCB 1PKQA 5D1ZC 3D2UD 4OZFB 2DRUA 4RMVA 2AV7B 3SBWC 3QHTC 3L9RB 2B1HH 4WY7H 3B9AA 1NLDH 4C59B 5T3XE 2AKRB 1JWSB 2WWMC 1I9RL 4R4BB 4M00A 2N4IA 1AGBB 5F93C 4JFZH 3AXLA 5DS8B 1NCCL 2O5XH 3T04D 2LQRA 4X9FA 5F7YC 3RAJL 1NCWH 5FEBA 3C6LD 1BBDL 3NPSB 3I9GL 3QCVL 1ZA3B 3O3DB 1UM6H 2MCPL 3MUGB 1IGIL 2KL6A 1NFDA 2AJXH 2AQ3A 3QEUB 2W0FA 4O51B 3IJYB 2B39A 5CZVH 1CFTA 4JRYA 5EH1A 1KCVL 1I7ZA 3NPSC 4O58L 4LHUB 3OJDA 1PD6A 3CH1B 5L2KE 3SDAD 1WVZA 5KSBE 3N85L 1W72B 4O5LH 1FLRH 4ENED 4DW2L 1F2XK 4RNRA 1FL5A 3MLPA 2A6DB 5I1GH 1KN2L 1QSED 1U8IA 1UACL 2VXTL 3VXUE 2OXHA 1ZTXL 3OAUL 1H3PH 2VQ1B 2ORBH 4JKPL 5F7UA 3EYUH 5E2WH 2W92A 4PJEA 3JTTB 5KANI 3PHOA 3W11C 4FZEL 3CLEL 4LIQH 3K1DA 4P2QB 1JZ5A 3WLBB 1CXHA 3WO4B 4PJFF 1RJCA 4WWKD 1DANT 3V95A 3RWIA 2D4DA 4QRTB 1NGPL 4NQDA 2HFTA 1N5YH 3DI3B 3VFRA 4GAGH 3QHZL 2GT9B 5E4EB 4EKXA 5D6CB 3FN9A 4WCYH 4L1HA 1YYMH 2WP3T 4JGJA 1EIBA 5EPMA 3WO4C 5I1HL 3HUJE 3GI9L 5KS9F 15C8L 5HI4D 1IGJB 4PB0H 1DLHA 5FB8B 3IJSB 4RIRA 3PWPB 2IAMB 1LE9B 5DHVH 2AXJA 2Q8AL 2KBGA 4V1DA 3VRIB 4EDWH 1AXSA 2IH3A 1Z0MA 1G9MH 3DWTA 5E4EC 4I3RL 1LHZA 4MNQD 4URTB 4XCYB 4ZOBA 3MOQA 4TTDD 3WSQH 4WTZA 4HKJB 1MVFA 2HKHH 5EZJA 1MIEL 1ITBB 2I9LA 4RRPA 4XGZA 3CAFA 2IAMC 4GKOA 3VXSB 2YD2A 4LCUA 2NY4B 3LS4L 4Z7VF 4X4YA 5I1LA 5L6YL 5F1OB 2NY3D 3PWUB 4J12A 2H32A 5I8CB 3AGVA 2Z91B 3MROA 1A7PH 4PR5B 4QRPE 5FYLD 2GI7A 4OT1L 4QRRE 4G6AD 2QADD 1RJLA 1I8MB 3I3DA 4RAUB 2NW3A 1OP3H 4TSCL 2DMKA 2BNQD 2ESVB 3TIEA 4MYWB 4X5LA 3U0WH 5EN2B 4ZTPL 2NY4C 4C56E 3PXHA 4LEOB 1FN4A 4TSBL 2IPKB 3TYGH 1QBMH 2FX7L 2ZG3A 3EDFA 1N59A 4OJFH 1IGMH 4P59H 2BNRB 2J4WH 3W0WA 5CIPB 5MERA 1FFRA 5JXED 5DRWA 2CIIA 2VDOL 3BP7B 4G7YL 4DKEL 1MJJB 5CJBA 2VDLL 3DUUA 3MACL 2FB4L 3RUGB 1HHGB 4W68A 5KVGH 1MF2H 3FQTB 5DVKA 4U4BA 4R7NA 4FTVD 5C0FA 3DVFA 1A2YB 3SCMC 3BD4A 2VMFA 4PTUB 1XGPA 3TCLB 3BE1H 4EXPX 5D1QA 4MXWH 1BOGA 4HUVB 3IJHA 5GZND 3GBML 4B0MM 5IJVA 1KF9B 3MRQB 2ZUYA 2R29L 1SYVA 5J8OA 2V7NA 5L7XL 3JVGC 1U3ZA 5I1DA 5I6XB 2D31A 5GRVL 1J05A 3HS0B 1SHMA 2GFBA 5F9JA 4XB8A 4YXKL 3SGEI 3C08L 5KOVC 2DKMA 4XAWL 5FYJH 1BX2A 3O0RL 3FAXA 1N64L 5DXWA 1N6VA 4YX2L 3D39B 3ZL4H 1YN6B 1GGYA 4HWNA 3X11B 3CXHK 4KKCC 1G9EA 1PG7W 3D85D 4GW1A 3X14B 4BFEA 2WZPD 5I6XC 4E5XB 4X7TB 4D9QD 2PR4H 1P69B 5D1ZA 5D9SA 3HG1A 3QA3B 4F33A 5IHZB 3SBWA 1CFNA 1HH6A 3LS5H 4EI6B 2FYYA 2EECA 3HAEG 5ALCL 5EC1B 3LEVH 3BUYB 2Z4QA 1MCWM 3TBSA 3L3KB 2AJZA 1G0DA 3OKYA 4RSVA 1AC0A 1KPRA 1MIML 1TDQA 1NFDE 5IB4B 4OZFA 1HINL 2XG4A 3SDXE 1DBBL 4U7KA 4OCXL 1KYOK 3V0WH 3R8QA 3MOAL 2AKRA 1JWSA 4FQQA 4JRYE 4NJ9H 1T1YA 5DS8A 3SPVB 2KPNA 4FQXD 4ZO8A 4OCNC 4OD1H 3WXWL 1SVCP 1ZA3A 3O3DA 2DS4A 1KN4L 3MUGA 2F5BL 4D8PB 1RUKH 4O51A 1S7SA 3IJYA 4XNXL 4YHZH 4PJEE 2EXYD 1CD9B 5KAQG 1T2QL 4LHUA 1J0JA 1NQBA 5BMFH 1NGQH 3CH1A 5FHAH 4QRUB 2EO1A 1W72A 5EULV 4HXAL 4NQDE 2B2XL 4LL9A 3RP1A 4YXHH 2A6DA 2PXYD 5HXMA 1TENA 4KUZL 3QNXB 1H8NA 3MCLL 3CK0H 2VQ1A 4GFTB 2AK4E 3ARGD 3MCG1 3H8NA 3JTTA 4I4WB 1DQTA 4OB5L 4WFGD 5F9DC 4EN3D 4JFEB 3WLBA 1FLTX 4NM8H 3SDCC 4V1DE 1UM4L 2W9LA 1FPTH 4QRTA 1ZLWK 1WQVT 3IF1B 5E70A 5DHYB 3KPLA 4JHZA 3ARVA 4J23A 3S3SA 3V2AR 4ODTL 1OGAA 5LQBH 4OZIB 2GT9A 1AR1C 1RZ7L 2HT4D 4X6FB 5D71H 5D6CA 3T65B 4C4KO 4K07A 3QNZB 43C9B 3AMKA 2UY7A 4OFIA 5DD1L 1JNHA 3CFBA 1IGJA 1PYWB 4D2NA 4CN6A 5FB8A 3WLWD 2OK0L 3PWPA 1MAJA 2IAMA 3P0YL 4K3HA 1RIVL 2VQTA 3VRIA 1F13A 4LOUD 5E6ZA 2ZCKH 2CGRL 4P9ML 1XGRB 4XCYA 3SDDD 1IGCH 4LDEB 1AY1L 2FR4A 2DLEA 3WXVL 1I9JH 4HKJA 1KIQB 1PG7H 3LVEA 1I8IA 1I9IL 3VXSA 2BY3A 3W0WE 3UX9B 4FQCL 4NZTH 3PWUA 4YAQB 5DWUL 5E08H 2VXQH 3S8WA 5I8CA 4BQ8A 1K85A 4PR5A 3KLAB 1CLZH 2H8PB 5HDBE 1R3HB 1U8OB 1I8MA 4RAUA 4LF3B 2ESVA 5D7JB 3HI1B 1NSNL 4K3EL 4JRXB 2NW2B 4AYFA 4GG8B 4LEOA 5DVNA 4QCIB 2RHEA 3R1GL 3MQIA 1KFAH 2YKLL 4U3HA 3SCMA 4Y16D 3CIQA 1IAII 3L6FB 1MWAB 3FT4A 3T8XB 1MJJA 1RPQA 5D7JC 4YUEL 3QDHA 5HTSA 3ARWA 1NAKH 2F54A 1HHGA 5GJSH 3JVGA 1UADC 1A7QL 2DQIL 1GGCH 1A2YA 3NCJH 4PTUA 4KKAD 4XCCL 3TCLA 1UT9A 3R06B 3HNSH 1HQRB 4KJQD 4IOFD 4DTGH 1FAKT 1HN1A 4BQ9A 1VGKB 2OR9L 3P9MB 3MRQA 4NN5C 3LKQA 1UZ6E 1CD8A 5D7IB 1IM3A 4OFYD 4EUPB 3V8OA 2B0SL 1RVFH 4EIGB 4RRPG 4PJ8D 1IKFL 3HS0A 4HPOL 5KZCB 5L9DL 1LO2L 1F90H 3UC0L 2Z9TA 4NO5B 3ARDB 2LE9A 3PWNA 3D39A 1YN6A 4LLMB 3PV7A 3X11A 1CLYH 1A4KA 3MRJB 2VISB 3D0LB 3X14A 1AXTL 4NDMB 2AJVL 4E5XA 4X7TA 4MS8D 5IM7B 1FIGL 4DQOL 3QA3A 4X0KB 2X09A 4JVUA 3ARDC 1EUTA 5D7LB 3JSSA 5GRJH 5HHME 3DPBA 5EC1A 1QEWB 4JHWH 3AREA 1LP9B 3BUYA 4PRNA 1HXYB 2K9UA 3L3KA 3T0AA 2APTA 1OP5K 3EJZC 3PF2A 1SJHB 2MFNA 2BOBB 5T3ZH 1J1OH 3RWFB 5IB4A 2VLLB 4JQXC 5BZWB 4MZ3A 2HLFC 5I8OH 2AJ3B 3BP5A 5HHXH 5MEQB 1DSFH 4Y19D 3OKKB 2UWEA 5T1KB 3T4YA 4IRSD 4HK3J 2ICWI 2D7QA 3MLUL 3TPUB 5ABDE 3MXWL 2NY7L 5KW9L 5I15H 4K7PX 2NY2D 3IFNL 1ZLWH 1K6QH 4OQ1A 3A67L 4D8PA 1A21A 1FYTB 3WFDL 5KVEL 4QNPE 1Y18A 1F3DH 1S7WB 5JR1H 3K74B 2LU7A 5LBSL 2ZUTA 2CO6B 5F3BB 2D7PA 5T1LD 3DVIA 1W72L 3S96B 3STZB 4XI5C 5F9AC 4HKXB 2CD0A 3FMGL 4X6CB 3SDCA 1FIEA 4NQEB 1I9RH 3AUVA 8FABB 2WM0A 3WNPA 3T0VA 1OGAE 1V7NL 2OZ4A 5C0ND 3NMEA 1XEDA 5DEFB 4OUUB 4FQ1L 3LRGA 3RAJH 4PLJD 1BBDH 3GSWB 4I4WA 3I9GH 3QCVH 1QBAA 4KUCD 1N6QL 2MCPH 4HGKC 4XPAL 1KPVB 1T2JA 4OZFG 1IGIH 3BYYA 4JFQB 2CLVB 1BJ1H 4LHJB 5FGCB 2IALB 4JPKL 4OKVB 2DWEB 4FFYL 4K71B 1T66D 2W60B 3LCYA 3VXTB 5DHYA 4JFYB 4X99B 5I0DA 1CYGA 1KCVH 4FG6C 2HP4A 5EUOA 4QTHB 2GHWB 3OKLB 4X6FA 4O58H 3QNZA 1OTSD 43C9A 2UZXB 1SVZA 3VXSE 4DW2H 3G9VA 1PYWA 2YRPA 4P9HC 4UT6L 3WS6C 4OLVL 1KN2H 4HX1B 4Z0XB 2VXTH 1UACH 4YGAB 1QSVA 4KI5C 4D3CL 1ZTXH 4HF5L 4JKPH 4N90E 3EFDL 1B88A 2HYMA 4FZEH 4AEIL 2ESVE 1K5NA 3CLEH 2NTSP 1XF2A 3QXUA 1KIQA 2F74A 4ELMB 4JPWL 3FB8B 4N5EC 3SGDH 2BSED 4UB0L 3FHQA 1NGPH 3NGBB 4GJTB 1YQVL 1QZ1A 1UH2A 1FAIL 5BW7C 1MRFL 4YAQA 4XCEB 3H9SB 3QHZH 5EOCL 3IFOB 5HBBA 4OI8A 1KELL 1QG3A 2H8PA 2Y5TA 1R3HA 5I1HH 1U8OA 4HKZB 1AO7B 2F54E 3GI9H 2GJJA 15C8H 5LVEA 5D7JA 3HI1A 4MJ5B 2A6JB 9CGTA 5EOTB 3NGBC 2NW2A 3L3IA 4GG8A 4QCIA 2Q8AH 3OBAA 3IFLL 1X5YA 5LG1A 1BECA 4GAJL 4I3RH 4W4NA 2VDRL 1BZ9B 4YFDB 3HMWL 3L6FA 1MWAA 3NFPA 3IU3B 1IM9B 1GGBL 2YD5A 3O9WB 1MIEH 3RVTC 3T8XA 3F65A 2HTLC 1TTUA 5IW6B 4YHYB 5E2TL 2DQFB 3BQUB 1F97A 1WCBA 3LS4H 3OAYH 5IESL 3BP4B 5CUSL 1BGXL 5L6YH 3G08B 4LPXA 5IBLD 1JNLL 3GKWH 3D39E 5FM5M 5KAQF 5IKCB 2XICA 3R06A 5B38G 1HQRA 4OT1H 1NKRA 3ULSA 3O9WC 4TSCH 1OP5H 1VGKA 3P9MA 4Y4FD 4YHYC 5D7IA 3BQUC 1R6VA 2JCCF 4XVUD 4ZTPH 4EUPA 5IHBA 5DURB 2GTZB 4TSBH 1MCPL 4FNLL 2FX7H 3HAEH 3RFZC 1JZ7A 4NO5A 3ARDA 5EZIH 2VDOH 4G7YH 4DKEH 1MCIA 2VLKD 3R8BB 5FGBC 3MRJA 2VDLH 3MACH 2FB4H 2BY2A 3FO2B 2YA1A 3D0LA 1A7BA 4IMLB 4NDMA 2F53D 2IBZX 2ICWB 2Q76B 1U92B 1XF4B 4IEFB 4MWFB 5DLML 4KI1A 5IM7A 1HH9B 3HE6B 4NQCB 4ZFFB 2HJKB 2R9HC 4X0KA 3RVWD 4MGXA 3NCEB 3OXRB 2UWEE 5D7LA 1RAMA 3OKDB 3GBMH 3CUPB 2FJGB 1LP9A 2ZKHL 3NABL 2R29H 3BH9B 4GRWF 2IQAB 2YUZA 5L7XH 32C2B 1MCRA 1SJHA 4R0LB 2BOBA 2DQUL 4YXKH 3HE6C 1IC7L 2VLLA 2X1QA 3C08H 3D69B 4XAWH 5BZWA 2IQ9L 3WYRA 4XHJC 3O0RH 1N64H 2IGFL 2AJ3A 4YX2H 4JQVA 2JLLA 3LQMA 5LGJA 5TGBA 1NDGB 3OKKA 4JZNB 4PJ7F 4X7FC 5T1KA 3QULB 3KPRE 2OQJB 4R0LC 3TPUA 5IFJB 4WW1B 3ESVF 1IE5A 1TJGL 5JMOC 1MFAL 5LXGL 1WFTA 3HZMB 4U7SA 5ALCH 1ZWIB 5MEPB 4YR6B 3BZ4B 3RWGB 1CIDA 3BZEA 5HYQB 1S7WA 4BZ1L 1XF1A 3GJFH 4ESKA 3CD4A 4AIZB 2HAZA 2OTUB 1MIMH 5F3BA 4ZFOL 5B21A 3S96A 3STZA 1HINH 1DBBH 1PAMA 4HKXA 3KPSD 4OCXH 4QRSB 2YHGA 3P4NA 3MGOA 3MOAH 4X6CA 1DEEB 4NQEA 2OZ4L 1NFKA 3UDWC 3MV7E 5EUOE 3UTZB 5DEFA 5GIRB 4OUUA 4TULL 5GGRB 3WXWH 1C16B 1K4CA 5DA4A 4GRWH 4P2OA 3GSWA 1G6RH 3OSKA 5ENWB 2QQKL 5AYUL 4OLEA 1VADB 1KN4H 1KPVA 4QOKB 2VLRD 4LKCB 4JFQA 1JGDB 3OQ3B 2F5BH 2CLVA 2R15A 4QHMB 4KPHL 3WIFA 2EYRB 1JF6A 1RUML 2IALA 3WS6A 4OKVA 4XNXH 3TFKD 3VXTA 4KKLD 2DTSA 2AVGA 4JFYA 2DM7A 2LU4A 3EYQC 4X99A 4YBHA 3BEVA 3RY5A 1T2QH 4QTHA 3TBWB 4D0DB 3OKLA 3QCTL 3TWCL 3EKCA 3EGSB 1WFUA 3ZE0E 5KANG 4HXAH 5J3HD 2DQDL 2B2XH 3Q5OA 2YC1B 3LN9A 4HX1A 2Q87A 4KUZH 1ORQB 4HFUL 5BW7A 3MCLH 4PGZA 1ADQL 4JCLA 3BRGC 4B50A 4LASL 1MCDA 4OB5H 3CFCL 5HY9B 4JFFB 3T3MF 3PV6A 5DJZB 1JPFA 2C3HA 4ELMA 2YN3A 3FB8A 4Y1AB 2NQCA 1UM4H 2P8PB 5L8LB 3IGAB 4M03A 3Q6GL 5IQ7L 4ODTH 4XCEA 2XWJA 3H9SA 5E2UL 2NNAA 5HHPB 1RZ7H 4X9GA 2R2HB 3HE7B 4HKZA 5DD1H 1AO7A 1NGZB 2E9WA 4MJ5A 2A6JA 3KG5A 5EOTA 5J9PB 2OK0H 2C3GA 2V2XB 5GXBB 5EA0L 3P0YH 4LLUB 1RIVH 1DUZB 1Q94B 5CD3B 2CGRH 4L4TB 3SE3A 4DK6A 1MWAL 4ZS7L 1AY1H 5DFVC 3VFPB 1Y6MR 5DJAB 1BZ9A 1EGJA 3WXVH 2Q1EA 3HE7C 3EYVA 4PJXB 3IU3A 1IM9A 3O9WA 2HT3C 2ZOLB 2BC4A 3MLVL 1U8NB 5IW6A 3VI4E 4YHIB 3WFCL 3B5TA 1I9IH 3BQUA 2Z35B 4QWWD 3BP4A 3HTLX 4ZSOB 4FQCH 3HMXL 3G08A 5DWUH 5IHLB 1MCSA 4M7LL 2YUXA 4XNQA 3ULUC 5IKCA 4HXBL 1NBQA 1P53A 4HG4J 1XGUA 2WBJD 5C0RL 5FGBA 1NSNH 2EDQA 3PNWA 1ZVSA 1S9XB 4RA3A 3VXNB 5GISL 1W0VB 2GTZA 5C0EB 3T2QA 3JXAA 3R1GH 5HI5D 1DP0A 4KK5C 4X98B 5DO2D 3UMTA 1MJ7L 4ONHA 5T33L 4LVNC 5C0BD 1RZFL 3UTPD 3CFJB 4R4FL 2FHBA 4YUEH 3FO2A 1NMBL 3VCLA 4KK6C 3V7AG 3AS3A 1MH5B 2ICWA 3EYSL 1U92A 1MUJB 1R3JA 1XF4A 2E7BA 2DQIH 4P23B 4HIEB 2JB6B 4W81A 1HH9A 3SKJL 4A2LA 4XCCH 3HE6A 4ZFFA 3BWAB 2HJKA 2YPKA 1BHGA 3OKNA 3OXRA 2ZSWA 4LRNL 3CUPA 2OR9H 4ACPA 5JTWA 1BQUA 4OSUL 1NPUA 4K23L 2IMMA 2IQAA 3EOAB 2B0SH 4XVJL 32C2A 3C5ZD 2PTUA 4P23C 1IKFH 4R0LA 4HPOH 2A83B 2L7UA 2YD7A 5L9DH 3WE6B 1IC4L 4TOYL 1LO2H 2G9HB 4RAHA 3RBGA 5TFSL 3UC0H 5DGQA 5FXCH 3MRNB 3CSGA 4F37K 2WP3O 3FB5B 4XCNB 5JA9A 5GGSY 1N4XL 2F8VA 1NDGA 1NBZB 5BRZB 1AXTH 3H9ZA 2AXGB 2OQJA 4EUPG 2AJVH 5IFJA 2AV1B 1B6DA 4WW1A 4X6CE 5DC0A 5GS2H 1FIGH 2XZQH 4DQOH 4HS6B 3DETD 2E3VA 2VITA 1E4WL 3HZMA 1CFSB 4U0QB 5CEZL 1ZWIA 3IDUA 4YR6A 3BZ4A 4N0CC 3SY0A 3ZDZE 1BWWA 3UDWA 1N5AB 4YHNB 4PGBB 3RVUD 3WN5C 5I9QB 3O81A 5GS0L 4AIZA 4OZFH 2DIJA 2OTUA 1JNJA 3S97C 5F7FA 4P2YA 5GPRA 4P3CL 4GKZB 3QB7C 2JELL 2FEDC 1TQBB 4QRSA 1ERNA 5HHVL 2H2PD 3O6FD 5FCUH 5JDJA 1FP5A 1BPVA 1DEEA 1TITA 4HUWA 2C9AA 5C0JB 1FC2D 1QO3B 2G75B 4PP1C 1IFHL 3UTZA 4WVRA 5GIRA 5I9QC 5GGRA 4AMKL 3LKOB 4XH2B 3MLUH 1C16A 2JJVA 3QXDB 3VXOB 3MXWH 4HV8B 2NY7H 3BT2L 4NYLB 5KW9H 2DI9A 5ENWA 3C5SA 1TQBC 5EU7E 1A22B 2M1KA 4QOKA 4P9HL 5JW4N 4LKCA 1PY9A 3RIAK 4QHMA 3A67H 4HT1L 2C4FT 2XTJD 2NLJB 3AROA 5K9OB 4ERSL 3O3EB 1A8JH 1HQ4B 3TM6A 3PWJA 4WDIB 4MSWB 5LBSH 3VFGL 5JW5B 3TBWA 4D0DA 4DN4L 3K2MC 1W72H 5GRWA 4ELME 2MKWA 3EGSA 5ESVB 5HSFA 5JDSB 4DUVA 3FMGH 4AZ8A 2OP4L 2YOCA 1KJMB 1LEIB 3VD5A 4BZYA 4NZUL 2YC1A 3FQRB 3H9SE 1V7NH 4NKIL 3RY6C 5CGYD 3HR5B 1ORQA 3ZKMD 5E95B 5A16A 4OZHA 1AO7E 1D6EA 4TUJB 3RGVB 1IAIL 4D94A 1T5WA 3LIZL 3G5XB 3MREB 4POYA 1N6QH 2GIYA 3K7UA 4NHUA 4XPAH 5HY9A 4HLZG 4JFFA 1C5DB 5EU6E 2A6KB 4Y1AA 4JPKH 5H94A 4FFYH 5KG9A 2P8PA 1JK8A 5DFTA 3VGBA 1EH9A 3LKSA 1WZKA 3BPCB 3MA9L 1N6UA 1NCTA 4M8VA 2DDQL 2X70B 3RGVC 5HHPA 3RUGF 2A1WL 1W0WA 4NOBA 4DGVL 2R2HA 3HE7A 3ET9F 3X12A 1NGZA 4PLKD 3B2UC 3ARFD 1ZLUK 3ORJA 1I7RB 4UT6H 5J9PA 4OLVH 1OSZB 2J6EA 1KB5B 5GRXG 3U4EB 4D3CH 1DUZA 5IB1B 4HF5H 1Q94A 2HT2D 3ZT5A 2XN9B 4Z7WB 3NIGE 5CD3A 3EFDH 5EUKB 4AEIH 1FE8L 4JHAL 2Q6WB 2ADIB 3VFPA 5DJAA 2GITB 2VLJD 3LQZB 4PJXA 1H5BB 2ZOLA 1T3FB 5IMLB 3U4BL 5J1SC 4JPWH 3TZVB 1OARL 3H3PL 4UB0H 2Z35A 1YQVH 1FAIH 4GXVL 4LFHG 2P7TA 4ZSOA 1MRFH 2CK2A 5EOCH 3KS0H 1INQA 1TJIL 1EFXD 3UTTD 1BJ1J 1KELH 5DK0B 3K81A 1PQZB 2HMIC 2J7LA 5C09A 2AJUL 1NEUA 4KDVA 1A7OL 3TZVC 1SJEA 1IILE 3SKUD 1S9XA 3RIAF 3VXNA 1CXIA 2VL5A 1W0VA 4NC2B 5C0EA 2PO6B 3BSZL 1CGWA 5CIPH 3DMMB 3IFLH 4X98A 3ZYIA 4GAJH 3RVXD 1JCKA 4Q2ZB 5TE4L 2VDRH 2ITCB 3HMWH 4HWBA 2E5EA 3VDAA 1GGBH 2P47B 3CFJA 3LOWA 1HK6A 5IK3A 3UAJC 1T0MB 5E2TH 3RWJA 3I02B 2O61B 4M1CC 5IESH 2PO6C 5CUSH 1MH5A 1MUJA 1BGXH 3DMMC 4NJAL 4P23A 2GTWB 4HIEA 2JB6A 1JNLH 4N1HB 2HRPL 4I9WE 4MD4B 4LQFL 1JVKA 1EO7A 4DUXA 3BWAA 3V6BR 3FN3A 5AAMA 4D0CB 5MEOB 5JO5B 1OB1B 3CDFA 2PYEB 3ULVC 1UWGL 5MENB 5CP7B 3DI2B 2NZ9D 3EOAA 1MCPH 4FNLH 1WAAA 2A83A 4UQ2B 1K8DB 3WE6A 3DYOA 2G9HA 1MHPL 3FB5A 4XCNA 1D9KD 3QXVA 4IRJB 1L7TL 3TBVA 1TNNA 3U9UA 1UJ3B 1T1XB 5BRZA 1NBZA 3VJ6B 1SM3L 3WN5A 5FKAB 1DDHB 2AXGA 3QWRA 5DLMH 3RIFK 2IJ0C 2HH0L 3GMRA 2AV1A 1P7HL 1HEZA 1P2CB 4OCLC 3F8UB 3I75B 1YMMB 2XQYK 4ZFZB 1YEIL 5FM8A 2G60H 4IRJC 1UCBL 1WF5A 1UJ3C 1GRWA 3LPWA 3ZT7A 2ZKHH 3NABH 4E9LA 4P46D 4PGBA 1U42A 1OD7A 4J3WA 4WHYG 1YY9C 3G5ZB 4QOKE 3VG0L 4TUOB 2DQUH 2WLYA 4GKZA 1BD2E 1IC7H 2IQ9H 4EEEA 3MR9B 3RBSA 25C8L 4M9PA 1I1AC 4OZIF 1AGDB 3V8CA 5C0JA 1UQSA 2G75A 1QO3A 2XRAL 3H42L 4WNQB 4XBGA 5DF0A 4FXKA 5ERWA 3WCYA 2P5ED 4XH2A 3VXOA 3QXDA 4HV8A 4NYLA 5I8EB 5CGTA 3MBEB 4LSVL 1TJGH 4OIAA 4U1HA 1MFAH 5D6DC 5LXGH 1TJHL 5EBWB 5C7XL 3I3EA 4JPIB 1FG2B 1MQKL 2LU3A 3L3OA 2NLJA 4GSDL 5K9OA 2MQ0A 2PCPB 3MNVB 1HQ4A 3O3EA 4OZHE 4C54A 1OPGL 3RY6A 4BZ1H 3FT3B 4MSWA 1A6WL 3OJ2C 5ITBL 2H6PB 4BK4A 4K7FB 3MBEC 3KR3L 5EFIB 4JN2B 5ESVA 2ATKA 2XZCL 5JDSA 2C4FU 1KJMA 2OZ4H 3TH3T 1LEIA 4Q9QL 3MZTA 4XPGL 1KJ3L 3HR5A 1PZ5B 4TULH 4EBQL 2IANB 4NFDA 3U6RB 5CS7A 3MV9D 3OGOE 3RGVA 4TUJA 3CZFB 1FJ1B 2NX5D 5CD5C 2QQKH 3G5XA 3MREA 5AYUH 2KUTA 3A6OA 3I3BA 1H3UA 4Q9BA 5SWZE 2QTEA 1C5DA 2VUOA 4MMXC 4KPHH 3BRFA 4MJID 1RUMH 4LLVB 4DGYL 4P5TB 3TP4A 1A6UL 1IJ9A 3ULUE 3SO3B 3BPCA 2D0GA 4N0UB 2OTPA 3R4DA 2ZUUA 2EDOA 2X70A 4PJXE 3QCTH 3TWCH 5JHDD 1Q72L 3OZ9L 1QBLL 3RIFF 3HZVA 4PY8J 3MA7B 5C9JB 2BZDA 2DQDH 3WHXB 2J6EL 3ARBD 1I7RA 4ZSOE 2AS5M 1OSZA 2EKSB 4P5TC 1KB5A 1UYWL 4E41A 3SO3C 3U4EA 3FRPA 4HFUH 3D87B 4LEXH 1ADQH 1EERB 2XN9A 4Z7WA 4WI9A 5C09E 1RZ8B 5EUKA 4LASH 4UDTA 1BAFL 3DJ9A 3HNVH 5JOPE 2Q6WA 1HHHB 2ADIA 3BVNB 3CFCH 4PJAA 3MV8E 4LVEA 4KTDL 2JE8A 5I75B 1T3FA 5IMLA 1CDBA 2EZ0C 2PN5A 2SEBA 3SE9L 3TZVA 2ADFL 3GMPB 1NEZB 4TUKL 3Q6GH 5IQ7H 3DGCR 3HZYB 3UTSE 3VRJA 4JGMA 3QDMB 3I84A 1UB5B 3M17B 4NKMB 4WO4D 4WI8A 4Z8FL 1IGFL 5I75C 3LKRB 1AQKL 5EA0H 3TO4D 4PRID 2Q7YB 3TBYB 5DDHA 1FVCB 2PO6A 3DMMA 3EO9L 4LNRB 1RMFL 1KCRL 2GQHA 4Q2ZA 4HWBL 2A6IB 1MWAH 4ZS7H 3FFCE 2ITCA 4OF5A 5JIKA 1TQCB 3MLVH 1WAAE 4MMZC 3WFCH 3M07A 1B2WH 1T0MA 3P77B 1VA9A 3I02A 4NO3B 3FKUS 1DVFB 1E27B 1HILA 1BQHB 2YK1L 5E6YA 5GGSB 1KUMA 3HMXH 1RULL 5F44A 4M7LH 3GM8A 1PG7X 4MD4A 2B1AL 4HXBH 4P5MB 1G1YA 2P49B 4Z7OF 3VG9B 2DLIA 3FFDB 2VKWA 5BRZE 1A3QA 3DX9B 4F9LC 1UG9A 4MJ6A 2NYYD 2P5WD 1TQCC 4D0CA 4EUPH 4YE4L 5JO5A 5TJWK 5FK9B 5C0RH 1OB1A 3MJ7B 2PYEA 4P5KB 4BH8B 5MENA 2DTML 1DVFC 3MC0A 2FZ3B 2HVKB 4UQ2A 5E03A 1K8DA 4MB3A 2GCYB 1MJ8L 2E6JA 3M8OL 4K94C 3VG9C 5EU4B 1MJ7H 5T33H 4R2GD 1HYSD 3SJVD 4IRJA 3RHWK 1RZFH 1FL6B 4O2FB 2LVCA 1CDUA 1UJ3A 3L7EB 1NMBH 3MSPA 3QDGD 1EA9C 3VJ6A 4XBPB 1U95B 4YWGL 5C0GA 1DDHA 3EYSH 4PJHB 5HI3C 1ETZB 3TN0C 1P2CA 4XWOD 3I75A 3PGCB 1CXEA 4XXDB 2Y1VA 3UBXB 2L0DA 4LRNH 1I1AA 3DX6B 3QEGL 3VW3L 4OSUH 1LMKA 4K23H 2YUVA 4G8FB 3QUYD 2R4RL 1OWRM 3HC0A 4XVJH 1W8OA 2J88L 3G5ZA 1FO0B 1CD0A 1IC1A 3HB3C 4TUOA 1IC4H 4NRXB 4TOYH 2BVOB 3C6LB 3QQ3B 1CICD 5GSVB 5TFSH 3MR9A 4KI5F 5D6DA 2V5MA 2PW2B 3CJJA 4ORZC 1AGDA 5LKNA 4J6RL 1N4XH 3WNNA 4WNQA 1MCOL 2JIXB 4Q9CA 5HDQL 1NC4D 3GMOA 1YY8A 2QLVB 1R0AL 3HPJB 4G3YL 1I3VA 4Z7NF 1XGQB 1E4XI 3R0MA 1M71A 1E4WH 2E9JA 4PRPA 5EBWA 5CEZH 5HYSB 3RI5K 2ARJB 4JPIA 1NANI 3SDAB 3UROR 4K8RD 3MNVA 2C1PA 1GH7A 4JDVB 5KSAA 4H0IA 1EHAA 1PW3A 3FT3A 4HLZH 1PDKA 1QSEB 5GS0H 1U0QA 4A2MA 2H6PA 4RBPK 3S6CA 3BP6B 5GGTA 4P3CH 1RZGB 3GHBL 5EFIA 2JELH 3D18B 3K8KA 3CMGA 5HHVH 1PX3A 2DBLL 2I27N 3A6BL 1YDPB 4WWKB 1W8NA 1T0NB 1IFHH 3D0VB 4U6HA 5EBMA 1PZ5A 1JHLL 4AMKH 4JVPA 3U6RA 3BT2H 3CZFA 4BYHA 3LN4B 2IBBA 3RVVD 2GSIB 1CIUA 4P9HH 4L29B 4RGOL 4E41E 2OR8A 4HT1H 2I9TB 4LLVA 4WWKC 3CCHB 4ERSH 1DBKL 2HN7A 4P5TA 2C26A 2IFGA 3RHWF 1DQML 4Y0GA 5ADPL 3WEXB 4IOSD 2HTKD 3BO8B 4N0UA 2FX8L 1UWEH 4PJAE 1OP9A 3VFGH 4DN4H 2X4OB 1AJ7L 2JKXA 5L0QB 3MA7A 1KJVB 4J4PC 4KROC 4MNQB 4YBQD 5C9JA 5J56B 4FP8L 2OP4H 1KB5L 1WT5C 2WLZA 4NZUH 2I60L 5HI4C 3JV6B 2R0KL 1X9QA 3O11B 3NN8B 4NKIH 4R4NC 5F8RC 4ZDHA 5TF1L 3U0PB 1U8PA 1Q1JL 1RZ8A 1CWVA 1IAIH 3LIZH 2NY3B 5L0QC 4HSQA 2ZCHL 3DVGB 5HYJD 4FQ2L 3IKCA 4TTDC 3QUMA 3S4SG 2QADB 2NZIA 3GMPA 1NEZA 2BNQB 5K59F 3GHEL 2L4OA 3MA9H 1VEPA 4K7PL 4YZFE 3W9DB 4MA8L 3TJEL 2DDQH 3P9WB 1UB5A 2NY3C 4Y4HD 1TTGA 3M17A 4NKMA 2A1WH 3ULVE 1TTFA 1B4JL 5IBUG 2QADC 5J13B 4YFLI 4GMSL 3RI5F 5CCKL 1KIPB 2Q7YA 3TBYA 3QDJD 1F8TL 2HVJB 4IS6B 4M7LT 4I0PA 4RX4D 4BH7B 5F7LB 2VXUL 4LNRA 5BQ7B 1NLBL 2A6IA 1FE8H 4FTVB 4JHAH 2O93L 1Z0NA 1V3LA 1CE1L 1G7IB 4F9LA 1L0YA 1WTLA 4J3VA 1SEQL 4M93B 5JXEC 3U4BH 3P3YA 1OARH 3H3PH 3P77A 4HH8A 3CLFL 4NO3A 1K2DB 4PB9L 1DVFA 1E27A 3FT2B 1BQHA 4GXVH 5CP3A 5GGSA 4NWUH 3QRGL 5LWYL 1INDL 5D4QA 1QOKA 1TJIH 4WFFD 3V7MA 4QHNA 4P5MA 1HSBB 3FFDA 4KJYA 1P7QA 2EC9U 3C8DA 5BJTB 4FQJL 3U9PL 5BS0A 2AJUH 4AY0A 1SEBA 1A7OH 1A6ZB 5FK9A 3MJ7A 5GZNC 3I6GA 4P5KA 4OAWB 2DB8A 1AGFA 3KJ4B 3D85B 2FZ3A 4HJGB 3BSZH 3BI9X 1INEH 2HVKA 3TN0A 3W82A 2GCYA 2VIRA 4LPCA 1BFOB 4RDQG 5EU4A 5TE4H 4EI5D 3SKNA 1I8LC 5DVMA 5FV1L 3GNML 1FL6A 4WHYH 4Y5VB 4O2FA 3L7EA 4HUNB 4XBPA 1YECL 3KJ4C 1M6OB 2YXMA 4PJHA 1FQ9C 1U2HA 4NJAH 2D7MA 3TEUA 5C0CA 4L3ED 4LQFH 5AD0A 5DJ0A 3PGCA 2QQNL 4XXDA 4CDHA 3UBXA 2R8SL 4KJPC 1OY3B 1ZE3C 3KYKH 1G9NC 4Y5VC 3NACL 3DX6A 4H88L 3NVQA 3KS0J 2DI7A 4XT1C 1NC2B 3TVMB 1FO0A 4FQXB 4U0RB 4PRPE 2NY6C 2BVOA 1OAKL 3QIBD 1V05A 3QQ3A 3QO1B 4LSRH 5GSVA 1MHPH 3I85A 4AJ0A 3NZ8B 3VD9A 3WO3B 2PW2A 3ME0A 1L7TH 3L5XL 5HPMB 1NGYB 4Y2DA 2JIXA 1SM3H 3QWQB 3TVMC 5DUBB 1WEJL 4FQXC 2HH0H 3HPJA 2GUOA 2MPAL 3KHOA 3O45B 1XGQA 3LKNA 1YEGL 1YEIH 3DV4B 5MI0B 1ZANL 3MRFB 1LEKB 1UCBH 3ZT6A 3V0AC 3O41B 1RHHB 3CU1A 4RA0C 4X6DA 4JDVA 4PUBL 4OLWL 1QSEA 3VG0H 2EXYC 4RQQB 1RZGA 1WBYB 2PF6A 2AJSL 3D18A 3W2DL 25C8H 3TJHD 1MCKA 3SDXF 2XRAH 1YDPA 3FN0L 3H42H 4QGTA 4LNVA 2ID5A 1T0NA 3QDAA 4WWKA 3D0VA 4GRMB 1FGNL 3F12A 2X4TB 1RUAL 2Z31D 5KSVB 3T0DA 1CDCA 1RD6A 3LN4A 4APQA 2IH1A 2D9CA 1U3YA 2FRGP 2GSIA 4J4PA 1CG9A 1TJHH 4L29A 5C7XH 1MQKH 4GSDH 2VWEC 1WT5A 2I9TA 4G9DB 2YEZB 4YDVA 5DA0B 1OPGH 5GRYA 3WEXA 3PWLB 1A6WH 8CGTA 5ITBH 1DUYB 4S0TD 1JIBA 3KXFD 3JV5A 4X7DC 1FRGL 5DSCB 2ATPB 1KJVA 4M3KB 2XZCH 3SDDB 2X89D 5JOFB 3KGRA 2HA1A 4Q9QH 3JV6A 4OGXL 3U0PA 4XPGH 1KJ3H 4FA8A 3H3BC 4EBQH 4U31A 5I1EH 2Y7QA 2YA0A 2XXMB 4K3DL 4PJFB 2PUQT 3SDDC 2AABL 5D7KD 4M48L 5T3XD 1TZHB 3QFDB 4PJDA 4DGYH 4LPUA 4G8EA 2BNQA 5E24E 4X4XB 1A6UH 5DI8A 4HUXB 3W9DA 2K7PA 2F15A 3KLSA 5FOJA 2X2YA 3OKMB 1Q72H 3OZ9H 4L9LA 1QBLH 4AG4L 4S1DD 1E6OL 1SJVA 3DXAA 2J6EH 5JHLL 3QPQD 4BSJA 4U1GC 4AM0B 4CN1A 1UYWH 1KIPA 1G84A 4V2BA 2HVJA 4IS6A 1H8SA 4I2XB 5BS0E 5ECJE 5BQ7A 2BY0A 1BAFH 3CXDL 2HFFA 5F72S 1DL7H 1F58L 5H35B 4KTDH 2DMBA 2X4SB 2BRQA 3SE9H 4MCYB 2ADFH 3GSNA 4BFBD 5F96L 4TUKH 3SE4C 3VXUD 3FT2A 4HC1A 2BVEA 4K94L 2QQQA 1EK3A 4K2UL 4IDJL 4PJ8B 1HSBA 5F71A 2QJDA 4KKAC 5BJTA 1E6JH 4LGRB 5D70L 4Z8FH 1IGFH 3EDKA 1I8LA 3JTSB 4UOW1 1DBML 4IOFC 1AQKH 3C60D 3OG6B 3OTTA 4DGIL 5C0CE 2G5BB 4WJ5B 3G6AB 4AIXA 4HBQA 3D85A 2YD3A 1NEZG 3BKYL 43CAB 2ZUVA 4X9IA 3EO9H 4OBSA 2X5PA 1CGUA 1KCRH 1RMFH 3L5HA 4PJ8C 4QHLA 4HWBH 1BFOA 1MCEA