5EOQL

Structure of the murine fab 1g6 bound to the vaccinia virus a27 peptide 31-40
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
218
structure length
218
Chain Sequence
DVVMTQTPLSLSVSLGDQASISCRSSQSLVHSNGNTYLHWYLQKPGQSPKLLIYKVSNRFSGVPDRLSGSGSGTDFTLKISRVEAEDLAVYFCSQSTHVPPTFGGGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Anti vaccinia virus A27 antibody Fab 1G6 heavy chain
publication title Linear Epitopes in Vaccinia Virus A27 Are Targets of Protective Antibodies Induced by Vaccination against Smallpox.
pubmed doi rcsb
molecule tags Viral protein/immune system
total genus 57
structure length 218
sequence length 218
ec nomenclature
pdb deposition date 2015-11-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5eoqL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5eoqL01
1JFQL 1CXHA 2Z35B 1F6AA 2ERJB 1I8IB 3W0WD 5I19H 4FQXC 3TZVD 1KENL 3MNZB 5EBGA 1PQZB 2G9HB 5JHDB 4KKAD 3PHQA 2VLJD 5BOZG 2VC2H 3HMWH 3FCTB 2VE6A 2XICA 4P59L 4KK5D 4JM4L 5KN5A 4M6ML 2WWKO 1Z5LA 3MREB 2RIKA 3STBA 2JJTA 2R0KH 4PJXF 4XBPB 3HZYB 3CNKA 3UC0L 5JHLL 4UOW1 5D7IE 1KELL 4HKBB 5C09A 1R5IA 3O9WB 3MXVL 4ZFZB 4A2LA 1IC4L 1DQQB 1OTTC 2R4RL 3A6CH 1C08B 5CIPH 3BD5A 1FO0B 3UBXB 4HGWA 3SKNA 1AFVH 2GEEA 5E4IA 1U3ZA 3T4YA 1NC4A 4HS3A 1D5ZA 2XZZA 3TA3D 1I3GL 3QFDB 4HUUA 2X4SB 4KMLB 3QUYC 4TSBL 3CFCL 4N1EA 3K3QA 4NRYB 5DSCB 3FRUA 1MRCL 1FNGA 4G3YH 5CJQH 5H37H 3RNKB 4F3FB 2XQYK 4FG6D 5I0ZA 4JRYD 1BGXH 1P7QB 1S7TA 2PTTA 4P2RA 1FORH 2E6QA 2XNAB 4TYUA 5L9DH 3PWNB 3CFJA 4I3RL 1T1ZB 4HBCL 3RI5F 4M5YH 4U3CA 3RL1A 4D9RD 1MIEL 2YD3A 4LFHG 1DVFB 4OCRL 1PBYA 1R6VA 3MLZH 5C2BL 3WMSA 4BSWB 2WIMA 5KG9B 3B9KC 1TJHL 4WUUD 1T21B 5JQ6H 2JF1A 5TE6H 1OD7A 5E08H 1FL3B 5KANG 1YMHB 5ICYB 3MRQB 1YC7A 1KCVL 4UV4H 2D4DA 1TQBB 3EZJB 5LWYH 3LD8B 5D1QB 1VGKB 4MA8H 4HWBA 5E8OB 5J3HD 4H5SB 1FE8H 4RISL 2DRUA 4P3CH 3BXNB 3S3JA 1UM6L 3QIBB 2VDOL 2HMID 2CKBH 3WDJA 4FFVC 2MWCA 4ERSL 3W11C 3KYMB 5GJSH 3ZDYF 1SQ2N 4CRPA 1JGUH 1MHCB 4F9LA 1T2QH 4PBXA 1JWSA 2ADFL 4YHIB 1WBYA 3FO2B 3CMOL 2EYSB 4ZAKC 5TFSL 3B2VH 1K8IB 2IGFL 2X2YA 5J1AB 4NC2B 4NN7B 3TYFA 1OF2B 3WEXB 1KB5B 3BH8A 2EDBA 3LKSB 3IFLH 4P2OC 4H8WL 5DMIL 3U1SH 4L29B 3L3HA 4L4VE 3KLDA 4RMTA 1A4JA 1G6RB 2JE8A 5E03A 3SDYL 2E27L 5F3BB 3FO1A 1PGRB 5E5RB 2FECI 1T0NB 3CUPA 1VESA 4GUPA 4JKKA 1S8DA 1JNLL 2BXZA 4PGEA 3ELAT 2GUOA 3H3PL 5EZLA 3T4AA 5K59E 5EU7E 3LN4B 4GLRH 4I0PC 5KSBA 3LRSA 1FFNB 5C09D 3RL2A 1P84J 1S9XA 4X7EC 2F8XC 4HX1B 1RI8A 2V9QA 5LCVL 3SDDC 1OTUC 2IMMA 3O3DB 4KQ3H 1A3LL 1BLNA 4C58B 3MLWL 3PWVA 1CXFA 4NZDA 1NC4D 1UXSB 4KI5F 5TGBA 4I4WA 5SWQB 3T0AA 1X5FA 3SE3A 4JPWH 4MD4B 4MSWA 2DQTH 3ARUA 4XBEH 2WQ8A 4R2GC 35C8L 2OTUA 1UQSA 3IRZA 3MBEA 1YJDL 1JMXA 5FM4A 1LO0H 1UG9A 3QFJB 2I27N 1GRWA 5DRZB 4P2RD 4QT5A 5BVJA 4JLRA 1NCAH 3DECA 1DQML 5D5MB 3LHPH 4WWKB 3O2VH 4ZMAT 4IM8A 1P4LA 3MLYH 4FFYH 3BO8B 2CXGA 1B2WH 3QIWC 5E95B 3KNBA 5DURD 2B0SL 1UT9A 4P46D 3NPSC 3SJVB 1N59B 1OQXA 1KN4L 1HINL 4F58H 4XCYA 2AEPH 3HS0B 1QEWA 3QG6B 5DJAB 3V7AG 4TSCH 3EYVB 1AXIB 4M1DL 4OCXH 5I1GL 3C5ZA 3AGVA 4R4ND 5T3XD 3L6FA 4LKCA 4YC2B 1NGZB 2YD6A 1T3FB 4QRUA 3MGOA 1BJ8A 3P40A 2CK0L 3ARVA 4OD3H 5FO8A 2IC2A 4QCIB 4KUZH 3QCUL 3FT3A 1ZGLB 1MQ8A 3QI9A 3BIBX 3SE9L 3DX9A 4R4BB 3DYMA 4YFLF 1IL1A 2V5TA 1S7VA 5GGRY 3PHSA 2QR0A 2PR4L 5DRNB 4HIHA 5JPMA 4CU7A 1S3KL 1RZKL 2UYLA 2DDQL 2AXJA 3OBAA 3L7EB 3S6CA 1XGPA 5K93A 1INEL 5IROC 3ZDZF 5EIQA 3QRGL 5ECJE 3GFUA 4K3HA 4YGAB 1IT9L 2EZ0D 1DUZA 4HFWA 1QSEB 5A3ID 1F4WL 4NDMA 5L8KB 3MV8A 5FYJL 5A43C 5CKGA 1V7ML 5I1JL 1CD1B 5ERWB 4OZFG 1FIEA 5IJVA 5KSBE 4IOIB 2XTJC 3KDMB 3UO1L 3HI1A 4X6DB 1ZHBA 4LDOB 4ELMB 2IAMA 4D9LH 5HDQL 3LEYH 5EU4A 1P6AB 1RUML 1XCTA 2P49B 3JUZA 5E2WH 2X9WA 3ROOA 4XAKD 2QQNH 2X10A 1QVOB 1WFNA 2EKSA 2RJMA 2C5DC 4PJCB 3O6MH 3F8UB 5CZXD 4XAKE 3MBED 4PGDA 3O6FB 4Y5VB 2C9AA 1FGNL 4TUOA 5IOPB 2DM3A 2EDFA 4XPGL 3KYOB 3LEXA 5CD3A 5KJRH 1AKJA 3C09B 1Z0NA 1NAML 3DIFB 2EEAA 2XY2A 4ODXA 2VJXA 5C0JB 1A7BA 2Q3ZA 4DZ8B 4K7FB 2L7UA 1IAOB 5C2UB 5FF6B 3VXSA 5DJDB 4BH8B 1XR8B 1GOGA 4ETYA 5DDHB 2SEBB 4LLDA 5GSVB 1KBGL 3C5ZD 5J1TC 2VL5B 4BJLA 3W2DH 4KZEH 4JZNA 2VLJB 4UU9B 3QDJD 4NC1C 3BRFA 4NZUH 4OM0L 3QPXL 4YHZL 5C6TL 1GIGH 2W1NA 4M5ZL 3WKML 5KS9A 3V6OE 2ZCLL 4TULH 2FJGB 5D7IB 1BZ9A 5DGRA 3WLBA 1DJSA 2AKRB 4KKBD 4GRWB 4JAMA 4BZ1L 3EOAA 4PJ8A 2VABA 2XZAL 3NACL 4NNPH 4S2SA 5IR1A 2D7MA 3VG9C 2FHCA 5DWUH 2BP3A 1I9RL 4NUGH 3MLRL 4Y19A 5A2JH 1WZMA 3MACH 3U46B 1SY6H 2J7LA 1WWCA 5F6HJ 5TE7H 1PX3A 4GMSH 3TA3B 4IJ3B 3WXVH 3ZE1F 3DVNB 1WSST 3GRWH 5DT1H 4YDVB 4UQ3B 5K9QI 5K9KB 4NO2B 1AXSB 5M95B 2I5YL 4KTYA 4CVWA 1DTUA 1UZ8A 5K33A 4JRYB 3FO9B 1BFVL 4Z7UF 1KPVB 2NR6C 3MV8E 1CGTA 2J12B 3IDIA 5MEPB 3WNKA 4PG9A 4QRTA 1MFBL 4ZS6C 1ONQA 2X40A 3VXPA 2IAMD 3CCHA 2VERN 1QO3B 1UENA 2BCKB 4NIKB 3KPPA 3H0TB 1ZWIA 3IETB 2Y06L 4S11A 1CU4L 2ILLA 2AGJL 4TVPD 3MROA 4WUUB 5E2TL 3L3OB 3IJSA 3V52L 4H1LG 2FBJH 5F89A 5FHBL 1JYWA 5INCB 3UTOA 5IGXH 1AKJD 3F7YB 5J57B 1JFQH 4LHUA 2WIIB 4PLJD 5C0ND 4KDVA 2ZUWA 2GJJA 1KENH 1HXMB 1ZV5A 3U4EA 1S9KC 1P7KB 5ID1A 3T0WA 3SY0A 1ERNA 5ILTL 2A73A 3QUZC 3UYRL 4ALAL 1DUYA 4P59H 1ES0A 1ZHLA 3VXSE 3I50L 3P9LB 3HE7A 1F6AB 1X5IA 3GSNL 4GW4A 3UC0H 4YHNB 4YPGA 2VXQH 1D3CA 4Z7NF 1UM4L 3PHQB 5EC1A 1B3JA 3MXVH 4O5LH 1IC4H 4B7LA 2R4RH 2DMKA 3QAZB 4OUUB 3DXAA 5EBLA 1A21A 2VE6B 3LOWA 3MRRA 5KN5B 3CZFA 3GJFA 1Z5LB 1UA6L 2H3NA 1ND0A 4MJIE 1B0GA 4HG4K 1SJVA 3VU2A 4KKLD 4NOBA 1S5HA 4MDJA 2FB4L 1Y18A 4OFYD 3CFCH 1I1CA 2MQ0A 4W4NA 5DQDL 1LNUA 1MRCH 4JFHD 3E3QE 5C09B 1KYOJ 1R5IB 1OT1A 4OV6F 1NGQH 2NY0C 3SEPA 4KXZH 2DS4A 2N56A 4LAJH 4Y19D 4NZRL 4HGWB 5E7BA 5FYLL 4U1HB 4I3RH 1NMCB 1NC4B 4HS3B 4Y4KA 1C7SA 1D5ZB 4Y19E 4XP5L 3TO2A 4HUUB 3UCRA 1VACB 4GBXC 2W60A 1JGVL 5C2BH 3FRUB 1FNGB 2RCSL 4IRSC 2F5AL 4I2XA 5EU3A 1TJHH 3QUMH 4KJPD 5DJ6A 5F7NC 3CSYA 2PTTB 1EGJA 4F7EB 4P2RB 2W91A 3CVIL 3CFJB 1KNOA 1ULVA 2B8OT 3RL1B 1EERB 4QHLA 4RISH 2DMCA 3C6LC 4ONHB 1U8PB 5DURB 4ERSH 5EOQH 2CPCA 3ARBC 3V2AR 1CGUA 3X13B 4XNYL 3HZMB 1N5YL 5TFSH 1X5JA 2IGFH 1OLZA 4CN6A 2P45B 1D7FA 1DQJA 1JN6A 2AJYH 2NY2C 4H8WH 2IQ9H 2MFNA 1P1ZA 4GRLA 4RQQA 3SDYH 2E27H 4N9GA 1O0VA 1JWSB 2CIIB 1WBYB 1KCUH 4J3SA 3ZL4L 3HCVA 1MCOL 1JNLH 5KW9L 3TYFB 3VFWA 4PGJA 4W6WB 4JJ5A 4U2ZA 1M7XA 4K3JH 1JNHA 3BH8B 4Z18A 4PP1C 4LKXA 1HKFA 3DX7A 3L3HB 4GQPH 5I9QC 1A4JB 3OKKB 3CX5K 3FO1B 4P4RA 2X4OA 5LCVH 3H7LA 4PGZA 1S78D 2BERA 4Y8DC 3CUPB 4JQXC 4GUPB 1S8DB 5A16A 3MLWH 3OGOE 4PGEB 4JFZL 4JHAL 2XACC 2MQ3A 2GUOB 3DXAE 5I17A 5EZLB 2GAZA 3S34H 3T4AB 3V5DB 4YDLC 3TBVA 35C8H 2G75A 3ALPA 5KSBB 3LRSB 1YJDH 3RL2B 4V1DD 4HMCA 2HT4C 3IDJA 1OOAA 1N3NB 1CIUA 3HAEG 4MD5A 2OQJA 3G9AB 4Q6IA 1KJVB 4LEXH 1DQMH 4LVNC 4WI5A 4L4TA 5D71H 4Y4KD 5TGBB 4I4WB 4P9HC 5DVKA 4HC1A 4MSWB 3THML 3HUJF 4MNQA 4HIJA 3QJFB 2EIEA 4HWEL 2OTUB 1UQSB 3GMRB 1AQKL 2B0SH 3MBEB 3SQOL 5D4QA 1KN4H 1HINH 1EZVY 3AMLA 2O61B 1G9MC 4M1DH 1JGLL 4I2XE 4QT5B 5BVJB 4JLRB 1I9JL 3BGMA 3RVUD 4PY7A 1P4LB 4P2QA 3LIZL 5DZOA 3KNBB 3BD4A 2QLVB 3PV6A 4C55A 2CK0H 4PJFA 4XCYB 2CUMA 1HWHB 1QEWB 3VI3E 5ACZA 2H32H 4MB4A 3C5ZB 5FB8B 3C5SA 4FXGA 5F9WC 3QO0A 3L6FB 1RAMA 2NY4C 4LKCB 3DYPA 1EPFA 4QRUB 2VYRE 1LE9B 1QYGL 1HHJA 1RZKH 1S3KH 3ARYA 1N8ZA 4GRLD 4HIXL 1PLGL 2YRPA 5FO8B 2DDQH 4KXZI 4LAQL 5E94A 4JG1H 3QI9B 4RA0C 1INEH 3MJ7A 3DX9B 2AXGA 1ADQA 1A6VL 1ZT1A 1IL1B 4X80L 1S7VB 1OGTA 3FHAA 1UZ6E 2NTSP 12E8L 2IBZY 5I30H 1F4WH 4XNQB 2NLJB 4HIHB 5JPMB 1A6UH 4NKMA 3GI8L 1LP9F 3QZWG 5DRWB 2UYLB 2BSED 1JPTH 1GZQA 1SHMA 1LMKA 5I66A 1OD9A 1T5WA 2VRAA 1XGPB 4WTXA 4TUJB 5CJXA 3UO1H 2V6HA 3WNMA 3GBNH 4IDLA 4MJ6A 4F15B 5HDQH 3GB7B 4WCYL 1C5CL 1BF8A 3QEQA 1K3IA 1DUZB 4HFWB 4NDMB 1KB5L 3PQYD 1F4YH 1A6TA 3MV8B 3P0YL 3AS1A 5BMFL 1WICA 2AJSH 2R1WA 3SOBH 1T2XA 1Q9LA 1OAXL 3QG7L 3BT2L 1G6RL 2OZ4A 5IJVB 1J0IA 3EOYG 1KXVC 2RHEA 5L2KA 5F44A 1G7QA 1PZ5B 3HI1B 1N4XL 2IAMB 4NQVB 2NZ9C 1J7VR 1C5BL 1NAMH 4M7KL 5F96L 2EKSB 1DN2A 1Q94A 4YHYC 3HMXA 4L4TE 3DVFA 4UDUA 3QNYA 3CFDA 4PGDB 4ZDHA 4MNQE 4TUOB 4CMHB 3LEXB 2KQMA 4PY8J 5CD3B 1QFOA 2EYTA 2YD2A 1KBGH 4PLKD 1AKJB 2XG5A 3DHMA 4JM2F 3D3VA 2H6PA 4JO1L 1HE7A 4OCYL 4LFHD 4XAWH 3MBXH 4R8WL 4P2QD 1H5BA 4JN1L 2W9DL 3HZKA 3S36L 2D7TL 4OLYL 3QPXH 4OT1L 3VXSB 4P2QE 1F3JA 3JWOL 4RBPH 1A7QL 3WKMH 5IBTL 4ZSOB 2ZCLH 4LLDB 1WAAF 3MFFA 4PJFE 3W81A 4YHML 1OP9A 2OMBA 3MOQA 3CZJA 2BOCB 2BXYA 4JZNB 2VDKH 4PJHA 2XZAH 1ROWA 5FUCC 1SM3L 4NO5A 4WUKL 1I9RH 1GGYA 2V7HB 3MLRH 3TLRA 2R0LL 1CL7L 4ODTH 1PAMA 4RFOH 3TVMC 3WCYA 4JKMA 3N1PC 5KS9B 1CE6A 3ZDXE 1IGCH 1ZGLM 4M7ZC 3OHXA 3T08A 3WLBB 1BZ9B 4MAYA 2XXCB 4KK8C 2F19L 2X4RA 4JAMB 1VENA 3EOAB 2VABB 2XY1A 4S2SB 5IR1B 3PXHA 4X6CA 1TTUA 1HCVA 2I5YH 2F15A 4IOFC 3EYQC 3FB8A 4L8SA 4HEME 4Y19B 2FWOB 4MA7L 1FFRA 4K3EH 2C26A 4K2UL 4QXUL 1MFBH 5CUSH 1MEXL 4CL7A 4Q0XL 5T5NF 5KSUB 3N1GC 5GS0D 5JZ7D 4OQTH 2DTML 4DW2L 1TDQA 3QEQD 2DJSA 1CU4H 2AGJH 1OCWL 3EDEA 4JFEA 1UZ8B 5D1ZC 3QEQE 3V52H 1BF2A 1FVEA 1IQWL 5FHBH 4OZFA 3IDIB 1VFBA 5L2KD 5AAWA 1B88A 4QRTB 1ONQB 3VXPB 5DK0A 3X17A 3PJSA 4X7TA 5L2KE 4JANB 4P23A 4PJBA 2YPLD 4P5TC 4L9LA 1TZHB 3BP7A 2Z4QB 2F54A 3MROB 3IJSB 3ZZ1A 1RZ8A 1OY3B 4KV5F 5DHYB 4ALAH 2H26A 3WIFA 4XVTH 1G9NL 4UT7L 4YK4C 1JHKL 1FYHB 4XVSH 3D3VD 2C3HA 4F7CA 3GSNH 2YR3A 3EBAA 4TN9A 5BV7C 5CZKA 1ZLUK 4IS6A 1EA9C 1A3RL 4POZD 3U4EB 1SEBA 5ID1B 5JR1L 4U0RB 5AZ2L 3SY0B 3QHFH 2FX9L 2A73B 4NQXA 1DUYB 1ES0B 5CP3A 1J05A 1ZHLB 4HPOL 3SGDH 1RSFA 4UV7L 1UA6H 1BMGA 4CNIA 3HE7B 2VXSL 5E70A 3V7AE 1CCZA 3DI2B 4GW4B 4LRNL 5FYKD 4JFYA 2NY5L 5DQDH 5AYUL 4YPGB 2C1PA 1RUKL 5EC1B 1HH9B 5FYKE 4PJHE 4G6JL 4MNGA 3DXAB 4LVOB 4NZRH 5EBLB 1CIDA 2FIRT 1CZ8L 3MRRB 3CZFB 3GJFB 3HPLA 4XX1G 5FYLH 1PZUB 5D6DC 2H3NB 5FUOH 1ND0B 3W9EA 1B0GB 2CLZA 5FXCH 2DBJA 5C8JA 3QP3A 1S5HB 3GEWB 1OSPL 4MDJB 1JGVH 1Y18B 5I75C 2XOTA 3PDOA 1LNUB 4ZUVA 1MCQA 1WZ1H 2RCSH 4V1DB 1F45A 5I74B 3JTSA 4X6CE 5HYEA 1A7RL 2IQAA 1KFAL 3VW3H 5JW3L 3CIQA 3D85A 3VI4F 2VXTL 1CI5A 2JELL 3QUYA 5FO7A 4Y4KB 2FNBA 4XC1H 3TO2B 3NZ8A 2CR6A 5I8KL 1MCDA 2IFFH 4PV9A 5IVXF 2W60B 4HJ0C 4XVJL 1H3TA 5K9OA 5C0AA 4GG6F 4EXPX 5D2LA 3RDTA 4I2XB 4Z7OE 1IAIM 5DXWA 4JFED 4F7TA 2WUBL 3CSYB 1N5YH 1K8DA 4K7PX 4LSRL 1L9NA 4JFEE 4UBDD 1KNOB 4U6TA 5GGVL 4Z7QE 5IQ9B 4M7LT 4QHLB 1UJ3B 4U49A 1UH2A 4WI7A 1C8PA 3B9KA 2A6KA 5H94B 1KTDA 5T1MA 5C3TA 2AEQL 4JHZA 3NIDE 2F54D 1GC1C 2NW3A 4H1LA 1IAIL 4XC3H 2MNUA 5GS1A 4HK3J 4OLXH 5KW9H 4Y5YA 4O02L 4HKJA 1MCJA 1BIIA 1DQJB 1JN6B 4DFIA 4GAYA 3WFCL 3OAUH 2WBWB 3QEHA 4GRLB 4RQQB 3RWEB 2BVEA 3T3PF 4ZAKA 4N9GB 3SKUD 1KJMA 4DEPC 3HCVB 1OWWA 2FHFA 3KPTA 4P2OA 3VFWB 4JHAH 5FV2A 4JJ5B 4OGYL 1JNHB 4LKXB 3DX7B 1OTSD 4HZAA 1IVLA 1DFBL 5C0EA 3IDYB 5T33L 4C4KO 5JUEH 3UPRA 2COQA 1YA5A 2IBGA 3O4OC 4K9EH 4P4RB 4MZ3A 1W0VA 2X4OB 4PIRF 2D03L 1GVIA 3D0LA 3O6LH 4LMQE 4MNGE 5I17B 2GAZB 3G9VA 3MNWB 3ULUC 4D9QD 2NXYC 3PQYB 4M4PA 1OM3H 3TBVB 5JPNA 1RV6X 3TC9A 1ED3B 3GBLA 1RMFL 1YY8B 4P4KA 4D9QE 3IDJB 5TPWL 4LSSL 5B38G 1AIFA 1VFMA 3HG1A 4LQFL 3P9WB 1JGLH 4Y1AA 1EHAA 1FO0H 1OARL 2V2WA 4HXBH 4Q6IB 2ZNWA 2O5YL 3ZLQC 1A1MA 1I9JH 4O4YL 3I75B 4YH6A 5HGGS 1OWRM 5F1OB 4GSDH 1AGFB 3F7PC 3LIZH 4MNQB 4HIJB 5HHXL 1X7QA 1YEGL 5JIKA 4YBLB 1QFPA 3RDTD 1EV2E 2DICA 5DR5H 4HF5L 4X98A 4XNMA 4XH2A 5C0AE 3VD9A 5D2LE 1N0LA 4RMQA 2H1PH 5F71A 1U8KA 5SWZA 3SGDI 1XR9A 3RWDA 1LO4L 3BGMB 5HI3C 1E4XH 4PY7B 1NCBL 1REIA 3GJFK 4P2QB 3B5TA 3SO5A 2YUZA 4WEMB 1J0HA 1QYGH 3PV6B 5CD5D 1PLGH 4PJFB 3WS6C 5CSBA 4FP8H 1TETL 5ACZB 3T2QA 2PN5A 5HYFA 4JFXA 4U1KA 3V4PL 4DTGL 1QBBA 5CZVL 1F90L 3RWFA 3C5SB 4FXGB 5I1CL 3QO0B 1OL0A 2CRZA 12E8H 2DQGH 1BD2A 4WHYH 3OV6A 1HHJB 1V3MA 1QFHA 1N8ZB 5IJKC 2APWA 4U7MA 2ARJB 1CFTB 1BBDH 2KZ1B 4ODWA 1LWRA 2W92A 5E94B 4MMXC 3JV0A 3MJ7B 4ZS7L 4OSUL 5LGKA 4LSDA 1JF6A 4O9HH 1EK3A 1ZT1B 1C12A 1TNMA 4A2MA 4I1NB 4WCYH 4Z7VF 1C5CH 1OGTB 5ANMA 4HWBL 1KB5H 5GRVK 1R3LA 1WZKA 4NKMB 3U83A 3S35X 1NL0L 2NTFA 1OAXH 3MUJA 5GS3A 3QG7H 5CFHA 3BT2H 3ZKNC 1G6RH 5I66B 2OLDA 5I73C 1G7IB 4HHAA 2DM7A 1T5WB 3L5JA 2NXZC 3LAFA 4OD1H 1N4XH 4JO2L 2E6JA 2G60L 4MJ6B 4ODSH 1KLUA 1C5BH 4M7KH 3QEQB 2UVEA 5HVGB 1UEYA 4Z76B 1EHLL 1A6TB 4JM2C 4LK4A 5EU6A 1UWEL 2R1WB 1BVZA 3QXDA 4P4KD 3E6HA 3WN5C 2Y7QA 2BVOA 4I18C 5L2KB 3HAEA 3HG1D 1RIVL 4Y1AD 4RCAA 2NY6C 3OPZH 3HG1E 4TNWF 2YPLB 4JO1H 4ZOAA 3NBNA 4Y1AE 5MHSD 4R8WH 5DLMH 3AS2A 5HGBA 3D39A 1Q94B 4OZHB 4LGPB 4DCQA 4HZLA 4UDUB 3QNYB 3S36H 3CFDB 2D7TH 4OLYH 5MHSE 3MRLA 3KPSE 3BP4B 3JWOH 1MCRA 4R97B 1A7QH 3O2DH 1V7NL 4D2NA 5IBTH 5IMMB 1L0QA 4PRHA 2EYTB 3S37X 4YHMH 3R0MA 5SWZD 2CGRL 3D3VB 3DX8A 2H6PB 1N7MH 5HI4D 2HLFC 4QGYA 4RZCA 2IPKA 1H5BB 5SWZE 1SM3H 3HZKB 3ALWA 1FSKB 2BVTA 2V5RA 3ZYIA 3ULVH 1CLYH 5IW1B 1CL7H 3VXRD 3D0VA 4M00A 4JKWA 4KKNA 3T04D 3MFFB 1D5IH 3LKPA 1BJMA 4KH2A 1JVKA 4ETQA 3MLXL 2FD6H 2HA1A 5B3JE 4RWHA 4NO5B 5ICZA 1OGAA 4I5BA 2BNQE 2OX5A 5E00A 1RULL 2ICES 3UTQA 4Z0BL 1MCKA 3S97C 3CFEA 1BD2E 5LXGL 4MA7H 4LSQL 1CE6B 2RFXA 4K2UH 3OHXB 4LPUA 1S7UA 2R39A 1MEXH 1UACH 4WI4A 5LG1A 3OJDA 1I3UA 4HWNA 3MJ8A 1HILA 3GMMA 2AK1H 2DTMH 4DW2H 2EDRA 4LLAA 5LBSH 3V5HA 1B4JL 3E6FA 1OCWH 2NYYD 3FB8B 3QZWA 4L8SB 5ANME 4BZYA 1IQWH 3I3EA 2E9WA 1QHOA 3PL6C 3TBTB 3SCMA 2B5IB 1ITBB 2QQLL 5DJXA 4HMDA 5EOCJ 4R3SB 1E4XI 4BZ2L 3MV9A 4Q9QL 4MLIA 4KDWA 4CJ0A 4JFEB 4W6YB 2NY1D 1P84K 3B6SB 3TO4A 4OZFB 3ZE2E 5EU6E 4WO4D 1VFBB 1PEWA 1TLKA 3AB0C 4G8IB 1YQVH 1S7RA 4UT7H 1JHKH 2XTJE 2D4FA 4YE4L 5DJ8A 5DK0B 1QQDA 2R2EA 4FA8A 4RA3A 4X7TB 3INUL 1AHWC 4P23B 4PJBB 3D39D 1P4IL 4L9LB 3BP7B 2F54B 3X14A 4ZXBA 2FR4A 2FX9H 3HB3C 1G84A 5DA4A 1QRKA 2H26B 3WIFB 4PRHD 4HPOH 4F9PA 1RIHL 3MR9A 5L2JA 5F7EL 2EXWD 4PRHE 1FLRL 3Q1SL 1CN4A 4LRNH 2NY5H 4PJXA 4GS7B 4IS6B 4KGLA 1JHLL 2ZUUA 1RUKH 3RX7A 1SEBB 3QUZA 1WFOA 4LOUC 1IGYA 5CJOL 4NQXB 1FBIH 1CZ8H 2APTA 1J05B 3I84A 4PBVC 5E8PA 2E9IA 3Q6GH 4XMLL 3TPUB 4CNIB 1MCSA 1FZKB 2DM2A 4JFYB 1XH3A 5LJYH 4LP4A 3G5ZA 2P42B 3BUYA 1OGAD 3U82B 1K4CA 2P5ED 3WIHA 4OKVB 4IMKC 4N9OB 3W82A 5CS7A 4NC1E 1JPSH 3O11B 4MNGB 1KFAH 4UQ2A 5JW3H 3QSKB 4XNUH 1OGAE 5E99H 1KXTB 3HPLB 1JE6A 2EYRA 2JELH 2J8UF 4EI5A 3OKOA 4N1HB 4WI2A 2GCYA 4YQXH 2CLZB 2ID5A 5FM5O 4J6RL 5C8JB 1G7LA 3E8UL 4XVJH 4GRWH 3PDOB 4ZUVB 3GGWA 2Q20A 3Q48A 4YEFA 2NQCA 1EO8L 2P44B 2MMXA 2VDLH 4LLWB 1NAKL 1A1OA 2PKDA 1IGTA 5EO0B 2IQAB 3I02A 3D85B 1F8TL 5BRZD 4K3GA 4I0CC 1NGXB 3CC5A 5FO7B 3SCMD 5HVHB 2D0HA 1GYAA 1RIUL 1KTKE 3DETD 3HHRB 4ZUWB 4IRJC 5J0BA 5GGSB 2FO4A 4PV9B 3QCVL 32C2B 4YXLL 4QNPF 5K9OB 4PPTA 2BSRA 2B39A 5D2LB 4NWTL 3RDTB 1G7HA 4M1CC 4F7TB 3MV9E 1E27A 1VEOA 3ZMRA 2ZUXA 1IAIH 1CWVA 3TO4D 3DO7B 1WJ3A 1K8DB 1KCLA 1KJ3H 2WUCL 4HH9A 1VFOA 4WFHE 3C6LA 4X5XA 1MCWM 2P8PA 4ODUB 4O02H 4QHKI 4RFNB 2Y36H 4XHJC 1EXUB 4IMLA 3RVTC 3ARBA 2A6KB 3PF2A 3WFCH 1KTDB 5IT2L 5HI5D 3KYAA 5DD3L 3QNZB 5FA4A 4ZXBD 2WLZA 1QBMH 2P46B 2NW3B 4KK6C 4H1LB 4G5ZL 2NZIA 5C0DB 1T22A 5GS1B 1AJ7H 4OAWB 5I1KL 3BPCA 4Y5YB 2X4UA 1AGEA 3ABZA 4HKJB 2FATL 3MLVL 1XIWC 4PS4L 4JRWA 4OGYH 1A5FL 5AG9A 4GAYB 2Z8SA 4FNLH 2HT3D 2ZSVA 5IWLC 1KJMB 4PJXE 2Y6SD 5JA9A 2D03H 1NGPL 5FK9A 4MWFA 3KYNA 2J88L 3FONA 4NNXA 4GRMB 4LASH 4P2OB 3BP5B 4RAVA 3MRJA 4PRDA 3A67L 4ZFFA 5ALBH 5C0EB 3WHE1 1MRDL 1RMFH 4MMZC 1MLCA 2OBGA 4JQXA 3BGFB 3UPRB 5IKCB 2CO7B 1W0VB 4LSSH 2ZUTA 1XT5A 1ZVYA 5ITBL 5B4MC 1OARH 5IB4A 4P48A 2DKSA 5IESH 2O5YH 4EI5D 3QDMA 1AXTL 2W9LA 4PLNC 4ZUSA 2VLRA 4E0RA 4GQ9L 5DUPH 5HHXH 4UUJA 3D87B 5JPNB 1YEGH 1KOAA 2CSPA 4P4KB 4HF5H 1T0MA 4W4OA 3LQAL 3IJYA 4UINH 3HG1B 1CFQA 4Y1AB 3GSOA 3VGBA 2PYEA 1A1MB 1LO4H 2GSIA 1ITCA 5FFLA 1BAFH 1TZGH 3HA0A 3IAPA 1X7QB 3B43A 3FB7B 1C5DA 4K8RD 4XP1L 2XKNA 2DI8A 2AS5M 4X98B 4HEPG 4XNMB 4XH2B 5H35A 1TETH 3IAQA 5A2KH 1SYVA 1CLCA 4OLWL 4KRLB 4UTAL 3EUUA 2EDYA 5AUMA 1CG9B 3V4PH 4DTGH 1U8KB 5SWZB 4LEOA 1QR4A 5CZVH 1F90H 1U93A 1XR9B 1I8LC 3RWDB 3NCCB 5I1CH 3ZDYE 1D9KA 1U6AH 4EQ2A 1Z9MA 4YBQD 5J11B 2DLHA 1EUTA 4C83A 5DEFA 5DD5L 3MZTA 3HI6L 5CEZE 4L8DA 4OFKA 2H2SD 1CICA 1R3KA 3AM8A 4F8TA 4WTWA 3VXRB 1WITA 3D69A 4DFHA 3O41A 3P0GB 3D2UD 3CLEL 4JFXB 2IANE 4U1KB 2XV6B 4WW2F 4JGMA 1EGJL 2AK4E 4L8BA 4OSUH 3T0VA 3RWFB 2KKQA 5BZWA 5T3XH 5T5NG 3P3YA 5GRVL 1A22B 2VITB 5EC2A 4HWBH 5IB2A 1LGVA 1BD2B 3NIFF 4XCNA 2ICCA 2ZCKH 5DEGA 2OL3A 3BRGC 5D7JC 1XGTA 5F7FA 4I77H 4WNQA 1UCBH 3WD5L 4ODWB 5I76A 1FC1A 3BJLA 2ORBL 1YNTA 3BISA 1CGWA 1YC8A 2X4NA 4PTUB 4M93B 2BHUA 5IK3A 2OJZL 5GISL 4JO2H 5T1KA 3U30B 1SVZA 1C12B 3WYRA 4Z7WF 5ANMB 3UAJD 4KI5D 1EHLH 1KSRA 3LMJL 3MNVA 1IZKA 1UWEH 2DYPD 1MF2L 2P8LA 2LFGA 2EIDA 1U3HA 1ZE3C 5ESAB 1AO7D 4ZNCD 1ZHNA 3VXOB 2VLKA 3AMKA 5GGRA 2QV2A 3EFDH 4HJJH 3KHQA 1RIVH 3GMNA 3WFBH 4UAOB 4PFEA 1KLUB 3HPJA 3QDMD 4Z77A 1XEDA 1CGSL 4XX1E 1LILA 2UWEF 5EU6B 3QDME 1WCBA 4ENEC 2BHYA 2VLRE 1MFNA 1KYOK 2XTJB 2APXA 3E6HB 2ITCB 5E6ID 2IALA 5DF0A 5C07A 2W0PA 2BVOB 2VH5L 1X9QA 3MLTA 5B38A 2EDQA 3HAEB 3WKNA 4FFZL 3KLHC 4TPRL 3SPVB 3N50A 2PYED 2CGRH 1GGIH 2B4CL 1ZMYA 4KJWC 5EUOF 3QQ4A 3LEVL 1XCQA 2QQKL 3D39B 4DCQB 4NC0B 1YUHB 4HZLB 5DRXA 3NCJH 5FM8A 3RZWA 1MIML 4X0KB 3H3BC 3MRLB 1OSZA 3PDGA 4PRHB 2OYPA 2R29H 1XF2A 3DX8B 3KPLA 1IAMA 5GJTL 1D9KD 3MLXH 1YNKH 4RZCB 2IPKB 5FGBC 2VDQH 1UKTA 4HC1L 1JGEA 1HNFA 2X1WL 4XZUA 5JIHA 3WSQL 2GTWA 2D9QB 3M45A 3V4VL 1CICD 4Z0BH 3BZEB 3VD5A 1DL7H 5LXGH 1UH4A 2HTKD 2F53A 3G5VB 1T03L 1GAFH 3D0VB 4NCDA 2LE9A 4WHTA 3LKPB 5CLTA 3VE0A 2YD5A 3RVWD 4K94H 4ETQB 1OVZA 4F37F 3HKFA 3ZT6A 5IBLC 1FAIL 1U92A 4M43H 3ZDZE 1OGAB 4I5BB 2P5EB 4OF6A 5E00B 1YEEL 4CN4A 4LCUA 1FNSH 3UTQB 3JV4B 2VXUH 4PUBL 4QXGH 1D6VL 3VXNB 4U33A 3CFEB 5FKPA 3MRDA 4BH7A 2RFXB 3K81A 4Z7UA 5J13C 3ZO0A 5T1KD 3OJDB 5HY9A 1JUFA 1NKRA 1IQDA 3MJ8B 1HILB 3VG9B 2LU3A 1EAJA 4JR9H 2HAZA 1LDSA 3V5HB 4EJ1C 3IXTA 4Q9QH 2X44D 3E6FB 2R23A 3AXLA 2ICWA 3QZWB 3MCLL 1Q0XH 4Y2DD 1RZ7L 1WBXB 4PR5A 1U3HD 4GO6B 2VLKD 1T6WA 2XQBL 3SCMB 3QO1B 2R69H 4YE4H 3RHWK 5DJXB 1AY1H 2DQFA 1ZLUH 3R1GH 2VLKE 1ADQL 2IPTL 3INUH 4MGXA 3PGDA 1NFKA 1GGCL 3AAZA 3RZCA 1H9VA 4AIZB 4DOHE 3WXWL 3QPQC 4LLVA 4C56A 2BVPA 1BEYL 3TO4B 5HYSG 2RAMA 5F7MC 1JRHL 2YZ1A 3OKDA 5C07D 5BCAA 5M7QA 1XGRA 1S7RB 3STZB 3T8XB 1WC7A 5DJ8B 1QQDB 5C07E 2R2EB 4X5WA 3ZTNH 1EVTC 3Q1SH 5GS0L 1BOYA 4L1HA 1JHLH 3BSZL 4NT6B 3FQUB 4LBEA 4G7YH 4Y0GA 3X14B 4ZXBB 4TVPH 2FR4B 1NH6A 3VH8A 1EEYA 5ISZA 4Q6YA 1QPPA 2EDEA 3RAJL 1N5AA 2W0FA 1Q9WA 1R5VA 4LPVA 1Z0MA 1LHZA 3K4DA 2IH3A 1TCRA 4XMLH 5L2JB 1BP3B 2DQHL 2DQIL 4OIIL 5JO5A 2QSCL 1SJEA 4PJXB 3FMGL 5FECA 3BI9X 4JFFE 3QUZB 1HKLH 1AR1D 4KRPD 3HMXL 2X9XA 3GSUA 3A6OA 4ZODA 1IGYB 2F53D 4TNVK 4Q97A 1R3JB 3N1FC 5E8PB 1MPAL 4J6RH 4QF1A 2CIKA 2F53E 3E8UH 1XH3B 5B21A 3G5ZB 4YZFF 4OCWH 5FUCE 4HCRA 1K4CB 1EO8H 4CVZA 1NAKH 3ZE1E 3CXDH 4NGHL 4QRRA 5J12B 5TF1L 1F8TH 1EO5A 3QUXD 1UWGH 3S88H 2EYRB 5ID0B 4EI5B 1DQLL 3OKOB 1RIUH 2F58H 2GCYB 2FEDD 1BZQK 2DLTA 1G7LB 4Z7UE 3QCVH 4Y4HC 4YXHH 2BRRL 1KF9B 4JHWH 5FYKL 1AD0A 1A6ZA 3L3IA 2VB5A 3F7VB 4NWTH 1SYSA 4TTDC 1A1OB 1NLDL 2WUCH 2HWZH 3CC5B 5JDSA 3CU7A 4YHPB 3P9MA 1MFAH 4NQDA 5BW7C 1BOGA 4Y4FC 3VFUA 5DK2A 1URLA 4X7CC 3MRGA 4J8RA 2YUWA 4K23H 2BSRB 3RZCD 5IT2H 3GHBL 2IPUG 5DD3H 3S7GA 4PRIA 5C0BE 4C56D 1E27B 2J4WH 3BYYA 2X70A 2VAAA 3C6LB 1EO7A 4X5XB 5I1KH 5F1SA 2P8PB 3RNQA 2QQQA 2FATH 4PS4H 3LPWA 2A0LD 3QT2A 3EDFA 3BWUC 1LK3L 3VXUD 4PB9L 5FA4B 2X7LA 2UZIL 5C92A 4H8WC 1CLZL 5IIEA 1NGPH 3D2UB 1T22B 1QTYT 3VXQA 2J88H 2ED8A 3PWPA 1IC5L 1TPXC 4Z7NE 1U2HA 3N9GL 1AGEB 1YDPB 4DGYL 2Y07H 4RRPG 3BMWA 4U3HA 5ISZE 1KIRB 3A67H 3GM0A 1YNLL 2QSQA 1D5XA 1FAKT 3RTQC 2ZSVB 3MTRA 2XG4A 2XI9A 5FK9B 1TENA 4MWFB 3KYNB 5E8EA 5ITBH 3FONB 4NNXB 1AI1H 2DQUH 1U8OA 3NA9H 3DGCR 3RKDD 5KAQF 4Y5XC 1AXTH 3U6RB 3UDWC 2Q8BH 5FUZL 1L9MA 4N5EC 4GQ9H 4ORGA 4PRDB 2GTZA 4ZFFB 1IGMH 2C4FU 5BZDB 2VO5A 2ZJSL 3SDXF 5IHZA 4U7KA 3HUJA 3MRIB 4PRAA 1MLCB 4W68A 3AREC 2EXYC 4LRIC 5B8CC 1B9ZA 1AO7B 2Q76A 2ZOKB 4PGBA 3LQAH 4PJIF 4ZD3H 4TQEL 3NAAL 1YJDC 2M8XA 1DEEA 1U8JB 4QRRD 1EH9A 4NPYB 5IB4B 1QNZL 5DC4B 3S96A 1GHFL 2XYCA 2L7JA 3NCEB 5I71C 3GJFH 3QDMB 1QR1A 4QRRE 2FH6A 2VLRB 4E0RB 3QQ9D 1A9BA 4MNHA 1G7MB 1DQDH 4UUJB 1IM3A 1EZVX 2GK0A 5BO1L 3VWKC 3OX8B 3IGAB 4ZPVA 1T0MB 4OCNC 5E6IB 3RUGE 5IB1A 3IJYB 3TT3H 1CFQB 3ARDD 1RZIA 1A14H 3GSOB 2PYEB 4LLQB 4KROC 4DKFH 2KUTA 5EIVA 4UI2A 2GSIB 2YA1A 3HNVL 4NQDD 1ZK9A 3WBDA 4EN3D 1K5NA 5DD5H 5IBUG 3HI6H 2ESVA 3LN5A 1C5DB 3OMZA 4NQDE 4PRID 4M6AA 1QLFA 1HOCA 5F9DC 5H35B 2AAVA 3ZT7A 1SYVB 4DAGL 3H9SA 3U0TA 2GJ6A 5AUMB 4PRIE 2WZPD 1QBAA 1U93B 1KEMH 3LDBC 4I9WD 1D9KB 1KJ2A 3CU1A 5GZNC 5IM7A 2AJVL 5HYIA 1J11A 1NQBA 4NFCA 5DEFB 5FYJD 3WS6A 4C83B 5LVEA 4L8DB 3EJZC 4CADB 3RI5K 3RWGA 3QNXA 3VFOA 1CICB 1R3KB 2QKIB 3S98A 1LP9A 1BECA 1PFCA 5L6YL 3D69B 1MCBA 1RZKC 2VR4A 2ORBH 3O41B 5F9WB 3D6GA 4RDQF 3C9NA 4XWOD 1I1YA 3DNKA 3O3EB 4L8BB 5GISH 4O58L 5BZWB 3SGEH 3GKWL 3HC3L 4PJ9A 4KTDL 4HIIA 5IB2B 3PWPE 1OQOA 2WINA 5DS8A 5IJKA 3ZDXF 2GW5A 2QADD 1HDMA 3H42L 1XGTB 1MF2H 4R4FL 2FEEL 3DMMD 2XRAH 3CK0L 5I76B 2WNGA 1YNTB 1WIOA 2UY7A 5IK3B 2A9NL 4J3OC 2LU4A 1MFDH 4XNZC 5T1KB 1MNUH 2Q8AL 2NX5A 3KJ6H 1NCCL 4B0MM 3VXTA 4YUEL 4G9FD 4D8PA 3MNVB 1NBVL 2A6IB 4Y2DB 2PW2A 2YXMA 2P8LB 3DRQA 1U3HB 2YD7A 4Y7MA 1ZHNB 3HUJE 1A9EA 2VLKB 4FFZH 2VUYA 3GMNB 3EDKA 4N0UA 4TPRH 4ZYKA 4EBQL 2EDOA 4DOHB 5T3ZD 2B4CH 5DO2C 4J4PC 2R56L 4GKZA 3HPJB 4Z77B 3LEVH 4JM2A 4M7JL 4JQVC 1I9IL 3BX7C 4ODHL 2QQKH 5T3ZE 5TDNA 3WN5A 2BVUA 1WCBB 4KJQD 1T7ZA 2FJFA 4I18A 3CPLA 3VA6A 1GOHA 4E41A 1T04A 3TBWA 2IALB 1O5DT 5C07B 2JK5A 3MLTB 5B38B 3M07A 3VG0H 1N6UA 2APVA 5I6XB 1WAAA 4HLJA 3FL7A 5GJTH 3ILQD 1I7ZA 3BDYH 1T20A 4HC1H 3C08H 3DRTA 4K55A 3VGGA 5DRXB 2ESVD 3I3DA 7FABL 1AC0A 3SGJC 1QSFE 3G6DH 1TFHA 4JFPA 2D7NA 4JO4H 1L7IL 2ESVE 3L3KA 2V9TA 1T03H 1XF2B 2GJ6D 1ZA6A 1FP5A 5LGJA 2YS4A 1RZFH 2EDXA 3RA7L 4U0QB 2XIDA 3SE8H 2VQUA 2BDNH 4HDIA 3H9SE 2GJ6E 1FAIH 1MJUL 3LZFH 3IDNA 4XZUB 4KRPB 1E4KA 4YFEA 3BOVA 2GTWB 4PUBH 1D6VH 1HWGB 3QBTB 1CFSA 4NQEA 2DQCL 1QLEH 2F53B 2E8YA 4M8QA 1LO2L 2ENSA 1LP9E 1WCQA 3OKEA 4WHTB 1E0OB 3VE0B 4OLZL 3IU3B 4PJ9D 4WFED 4CW1A 4KVCL 2Y72A 5ALCL 2BNRE 1U92B 4XI5D 1R5WA 3ECBA 4LL9A 3ULVF 1JL8A 4LCUB 4YNYA 1BJ1J 3MCLH 4M7ZB 2E9BA 4NKIL 4QWWD 3QUXB 5CINL 3FQTA 1VEPA 3W9DB 2GFBA 4LCWE 5SV4A 4QO1A 3WNNA 5HY9B 2FJHA 1JUFB 3N1MC 3QB7C 5DI8B 5HDLA 2OP4L 3T65B 2NX5D 1ADQH 3IS1X 1E6JL 3NIGE 3M8OH 3IXTB 4LSVL 3WXWH 3AXLB 2NX5E 3PL6A 1VKXA 1BEYH 1J1XL 1JPFA 3CXHJ 5ETUA 1JRHH 5D2NC 5D96C 2AQ3A 4IEFB 4MA3A 1GH7A 3U9PH 3VFSA 5IEHA 2DQFB 1M6OA 4CDGC 3PGDB 5GS0H 4N0UE 1RD6A 3AAZB 4MQXC 5HHVL 2OCFD 3CMGA 3RZCB 3OAZK 2WLYA 1YY9D 1J0YA 1TVBA 3HLAA 2XT1B 4YAQA 5MERA 1OAZL 4LLVB 4C56B 2BVPB 4ZPTB 3P11L 1Q9KA 4E41D 3GMLA 2PYFB 3OKDB 2OZ4H 1XGRB 1AHWA 4E41E 1WC7B 3SGEI 3NIDF 4X5WB 3K2UH 2DQHH 4P99A 2DQIH 5SWSA 4OIIH 1HQ4A 1X5AA 5F6IC 1OW0C 2QSCH 3VRLF 3FMGH 3VXUB 4KAQH 1WAAE 2IWGA 3BKJH 4LBEB 3JWNC 3PWLA 1CYGA 3HMXH 1DN0A 1NBYB 4BYHA 1EEYB 4RWYL 3CDGA 3L5WA 4I3SL 1T66C 5HGDA 5ISZB 1RU9H 1N5AB 2W0FB 5C6WH 1Q9WB 1R5VB 2MCG1 4X6DF 2IH3B 4FQPA 3MUZ1 1MPAH 5I1IL 1MH5A 5F7YC 5JO5B 5FIEA 3SO3B 1SJEB 5JA8B 5FECB 3S35L 1BVLA 5JQHC 4Y88A 1HXYA 3CFBA 3GSUB 1K85A 4NGHH 3QIUA 3MODL 4LLYA 5TF1H 4NQED 4OLVH 1F11A 4M48L 2B2XL 2DWDA 5HGAB 1YECL 2Z8VC 3FT2A 2O26U 1MJ8L 2Y23A 3BZDA 4QF1B 2CIKB 4NQEE 3P4MA 2BRRH 1HYSD 4IMKA 5FYKH 5IVXA 1JZ5A 3FHQA 1N0XL 3HE6A 4MA1C 3DV4A 4CVZB 4GG6A 3O6KL 3LSOA 5CIPA 1RJYB 4HWUA 4QRRB 5F7WC 2HH0L 3VMOA 4PP2A 1YYML 4KUCF 5JOPD 5KTEL 5EIIA 3BPNC 2DWEA 2X1QA 1VFUA 5ACMA 3IDGA 1AGBA 1TJIL 4ZNEA 4GXVL 3EW3B 5JOPE 3VFMB 3BJ91 3ILPA 1AD0B 1A6ZB 1Z9LA 2GQHA 2F8OA 3L3IB 3TIDB 1SYSB 1KIQA 4MLSA 4JO3H 5FYKU 3K0WA 5E1HB 4OF0A 1NSNL 2AXFB 3MV7D 2OR7A 2YSSB 5T1DL 3UJIL 4XPAH 3LCYA 3MO1A 5JDSB 4JKPL 3IYLW 3P9MB 4NQDB 1BOGB 3KPQA 4KV5E 3MRGB 1MJJA 1C1EL 4J8RB 4UT9L 1LK3H 5CCKL 4PB9H 3O8XC 1ZSDA 3KLSA 4QKXB 2UZIH 4PRIB 3RX8A 3T77A 5DJ0B 3X3GL 1CVSC 4LCCC 3BFOA 3CSGA 5HYSA 5BOPA 5D1XC 2AABL 4OZFH 2XFXA 1LO5A 2X70B 1HHGA 3N9GH 5KANI 3NH7L 1WZLA 3RNQB 5FOBA 4DGYH 1J8KA 3MGTA 5KSAC 1G0XA 5EPMA 5SWSD 3I6GB 1YN6B 1Y6KR 4MXQC 1YNLH 4EOWH 1E28A 3N85L 2X7LB 2ZUYA 2DQDL 4XCCL 5AD0A 3TJHD 4W81A 3S36X 5IIEB 1T7WA 5I1HH 3VXQB 1XIWA 2VLLA 2I26N 4YX2L 4DJMA 3VGAC 2X89A 4LPWA 5FUZH 2X1XR 1D5XB 5IWLA 1RUAL 2QADB 3TCLB 4RGNC 3V95A 5KSVA 3VMPA 1WVZA 2VLMD 5IVOA 3DMMB 1DBML 2ERJC 4KFZC 5DQJA 3QIUD 1I1AC 1JRHI 3NAAH 1QNZH 4PRNA 4K9EC 1U8OB 1K4DA 5CP3H 5DVNA 4ZTOH 1F97A 3RY5A 4XXCC 4Q9BA 2YWZA 1R24A 2GTZB 2DBLL 2R2BA 3VI4E 2AJXH 5MENA 1NBQA 4PRAB 5BO1H 3HE6D 5DMKB 1MRFL 4XNXL 2Q76B 4PGBB 3KPMA 3EYSL 3TV3H 5IVXE 4U1MA 2JCCF 1DEEB 3NZHH 3QWOA 2VL4A 3S96B 4DUXA 4GG6E 3O9WC 3L5IA 1UJTA 5ICXA 4AH2B 1A9BB 4MNHB 3LN9A 3ZHLA 1IM3B 1A7OH 3FOLA 1QFWI 4YGVA 3RJDA 2GK0B 4S1QL 2WWMC 2UV3A 3CDYA 3C2AH 4D0BA 4KY1L 1C16B 1U95A 3WIHL 4ZNEE 2EE9A 3OZ9H 5IB1B 4MS8D 4DAGH 1EX0A 3SE4A 1RZIB 4NJ9H 2E7LC 1PKQA 1BFTA 1JI1A 3NN8B 3WFEH 4K71B 1T89C 1K5NB 2YUVA 3WLWC 2W0KA 2ESVB 3LN5B 2ZNXA 3BN9D 5EDXA 1QLFB 1DVFC 4FHBD 1KC5H 2HKFL 3F65A 1FZJA 3T2OA 3U0TB 3HRZA 2GJ6B 2OXHA 1QA9A 3T1WA 5E8NA 3GKWH 5EBMA 3ZSSA 3T3PE 3CX2A 1JYVA 4FQCH 5IM7B 1J1PL 4Z7VA 1X4XA 2V5YA 1TQBC 3RVVD 3LD8C 5D1QC 3RWGB 3QNXB 3VFOB 4R4FH 3U48A 1LP9B 4EDWL 1CE1H 1RHFA 3QIBC 4IDJH 2MQCA 3CK0H 5CP7A 3KPOA 4OI7A 5IV2A 4H1LH 1I1YB 5B3JF 2A9NH 3X3FH 4PJ9B 5TE4L 4APQD 5AZEL 5CEZL 4HIIB 4YUEH 2WINB 1LQSR 5DS8B 2G5BA 3FQRA 4MCZA 4PREA 3L5XH 4NN7C 1NBVH 1HDMB 1TVHA 2J5LB 2HT2D 3F7RA 1PKOA 2EC8A 1WIUA 4K7PH 1L7TL 3DBXA 3GSVA 3TNMA 3OB0K 4EBQH 1KTRL 2R56H 5DUML 2NX5B 4XP6L 1I9IH 3VXTB 2H45A 4ODHH 1IM9A 4YR6B 5CJBA 4D8PB 2CQVA 5HJ3A 4R26L 5I73B 2D7OA 4WI6A 5MEND 1KN2H 3JZ7A 2PW2B 4MB3A 1ORQB 1CD9B 4NRZA 2BNUA 1QOKA 3CLFL 3E2HB 1U41A 5MENE 3KJ4B 4ZYKB 4H20L 4GKZB 1FZMA 2A1WL 1ZA3B 4LHUG 4NKQB 4JM2B 4L8CA 1FYTA 4UIMB 4HAFA 4KKCC 4F7MA 1W0YT 3EHBC 3HC4L 1B6DA 5HD8C 2DLGA 1CBVL 5TDNB 3WN5B 4WGVB 2HKHL 3ETBF 3CPLB 4E41B 3VJ6A 4EXKA 1T04B 3TBWB 1K2DA 2JK5B 1L7IH 1I85C 1QLRA 1V3LA 3EO1A 3JWOC 3QEGL 3D9AL 3TT1L 2F74B 2APFA 4QRPE 1FPTL 4P2YA 3NOIA 4FQQA 3RY4A 2OTWA 3L3GA 1I7ZB 2ARJQ 3AU1A 4FQJL 4BQCA 5D72H 2DLFL 1T20B 4M6NL 5FCUH 3EJYD 5DFVD 3DSFL 3DRTB 1XF4A 5E2UL 1LO3L 4R7DA 1T0PB 4WWKC 1CFNA 1NPUA 1LE5A 4JFPB 1FG9C 2DQCH 5CILL 4BQ8A 3ULVC 2X6MA 1QPXA 1LO2H 1ZA6B 3K1KC 5LGJB 4PJGF 5FGBA 2VDNH 2HJLA 3RGHA 3MYJA 4HDIB 3FO0H 2O5ZL 1YEIL 1QUNA 2CJUL 4JDTL 3IFPA 2N1KA 5TQ2H 3O3AA 4YC2C 4Z7VE 4FFWD 4NKIH 3JBG7 1CFSB 4NQEB 3P30L 2AP2A 2WBKA 4LMQI 1QKZL 4M8QB 2MKWA 3OKEB 1M7IA 3MOBH 1U58A 3KS0J 5GRUH 2OP4H 1R5WB 3D25A 3ECBB 4LSVH 1QSED 3UTTD 4HD9A 4YNYB 1J1XH 4M8VA 4S0SD 2Y25A 4N8CL 3OKLA 2FIKA 2R0WH 3FQTB 4QY8A 2WANA 3ZKXB 4AMKL 2CDFA 3BN3B 2YN5A 1T1XA 3JXAA 1IM9D 2HJKA 3IF1B 3X11A 4DGIL 1OAZH 4U3XA 2OL3L 3I2CL 3P11H 1DBKL 1PY9A 3LKRA 1VKXB 1G0YR 5J89A 3K4ZA 5ETUB 1OAYL 5EZOL 3MV7B 2WBJA 3NCFB 4MA3B 2V5MA 4PD4J 43C9A 5IEHB 1A64A 3LS5L 1M6OB 3MRCA 3EYFA 4S1DD 1OT2A 3MJ9A 1TVBB 3HLAB 4YAQB 4FMKA 4G8EA 2VZVA 5JDJA 1FYTE 1Q9KB 2FEEI 3WO4B 5MI0B 4LARL 3GMLB 2OI9B 2Y5TA 4GXUM 4RWYH 3FN0L 5JMRA 3LB6C 4LIQH 4U1JA 1X5GA 3DURA 3NTCL 4L4VA 3O6FC 4Y5VC 5KAQG 5I1IH 4L5FL 4UNUA 5SWSB 1HQ4B 3S35H 1KLGA 5F7DB 3QWRA 2I9TA 4KDTC 3PWLB 4OJFL 3C09C 2NY5C 2R4SL 3BKYL 1DN0B 3MODH 3WUZA 3CDGB 5C0FB 3L5WB 1G0DA 5HGDB 4Y16A 4M48H 2IG2L 4UNVA 5CSGA 4M3JA 2J8UA 3BKCL 1MH5B 1MJ8H 2DQJH 4UOJA 3PV7A 4LSPH 3V4UL 1BM3H 1BVLB 3DVIA 1HXYB 3CFBB 3VCLA 2ADJA 3EDDA 3O6KH 4R90L 3QA3A 3KPNA 4N0FA 4Z5RA 3TZVC 3QIUB 3WFHA 4MX7A 3IKCA 2HH0H 4LLYB 2EO1A 5ITFA 4KKAC 1F11B 1KG0A 2DWDB 4FXKA 5EORL 5HYJA 1P9MA 1ODAA 3FT2B 4WU7A 3IVKB 3P4MB 1IAKA 4KK5C 2M26A 3EOTL 1IILE 1WFTA 4X9BA 5IVXB 1MHHA 4L3CA 2HRPL 1U42A 3HE6B 1TQCB 2HVKB 3DV4B 5B22A 3S9DB 1A02N 3R06A 4GG6B 3F62A 3B9AA 3LSOB 4DZBA 3OF6A 4UILL 3S37H 4PP2B 5ENWA 5T1DH 4LCIL 3UJIH 1PX4A 2YRLA 4EEEA 2B1HL 4JKPH 5EIIB 2BC4A 4HUKB 2DWEB 3KYKL 1NUFA 4XPBH 5DC0A 1WWAX 3UTPE 1AGBB 4IIQA 1C1EH 4JHBA 2HLAA 3RVXD 2EECA 3ILPB 3TA3C 1DQTA 1KIQB 4IJ3C 1TCMA 1C7TA 4XRCA 1QSVA 5IFHL 5EN2A 4MAUL 3QHZL 2WBJD 2AABH 5BW7A 4RDQG 1A7PL 4Y4FA 4FG6C 3NH7H 3ZKMD 3O0RH 4E5XA 2I9LB 4DN3L 3DROA 4PJ5A 2PF6A 5F3HB 7CGTA 3KPQB 1MJJB 1WISA 1FL5A 1ZSDB 3DI3B 3N85H 4JPVL 1JPGB 2DQDH 3SBWC 2Z91A 3T77B 4XP9L 1CLOL 4PB0L 2DN7A 3LKQA 5HYSB 3L3DA 3FT4B 3T0EA 1LO5B 1BVKA 5F8QC 5FOBB 2VMFA 3MGTB 4L4VD 5HHMD 3VWJA 3IKKA 4N90D 4OFIA 1ZLWK 2JJUA 1NMBL 5HHME 1E28B 3OR6A 5J3HC 4N90E 2A74A 5AD0B 2VZTA 1ZEAL 3TH2T 5CEXA 3ET9F 2HMIC 5E2VL 3LH2L 4TSAL 5IHUL 2VLLB 4Y16D 3DTXA 2YHGA 4APQB 5GQBA 1V8HA 2DBLH 2VISA 5DTFA 1D6EA 2DM4A 2DAVA 2J8UE 5KSVB 5F88B 3BVNA 1MRFH 3GO1L 5C6PB 1YN7B 1SEQL 3SDAA 5DQJB 4TRPL 3EYSH 1UB5A 4W70A 3UDWA 3K46A 4PRNB 1K4DB 3FAWA 3TP4A 4G6FB 4NUJA 5CWSA 1W72H 4KJYA 1R24B 5F7HA 5BJTA 4HQQL 4EUPG 5EU7C 3JTTA 3BRDA 2R2BB 3OKMB 4XGZA 5HYJE 2E5EA 5MENB 3P4LA 4S1QH 4ZFGH 3WDIA 4UT6L 4KY1H 4BFIA 3WIHH 2WAHA 3KPMB 4YXKL 4U1MB 4QNPE 3QWOB 3GSRA 1BIHA 3C6SA 3JWDL 5EOCL 2CKNA 5ICXB 1X5KA 2DIBA 4FQIL 3VWKA 3FOLB 1NMCC 5FKAB 4FQ1H 4HPYH 5F1NB 3H6JA 1E4JA 1U95B 4JDVA 4HCRL 2HKFH 4MXWL 4GAJL 2KBGA 4PJ7F 3K80A 5KZCD 1PKQB 1VEMA 1HI6A 4N0CD 4WW2A 2B20A 3U7YL 4Z95L 3MRHA 4FZEH 5IB5A 4DKEL 1J1PH 1KCSH 3V5KA 3PIQB 4FS0A 3V6OA 2ZP0T 4PJ5E 4K8RH 4EDWH 4R0LA 4HAGA 4RGOL 1NUNB 4JY6B 5GGQL 4LSUL 4M9PA 4EDXA 3HRZB 4P46C 2KQNA 1VA9A 1QA9B 3T0ED 1A6PA 4OQ1A 5E8NB 3WFDH 5EBMB 4BK4A 4BQ9A 5TE4H 3VWJD 3GBML 5AZEH 3Q2CA 3T0EE 4Z7VB 2YOCA 4R4NC 4Z7WA 3AC0A 1AR2A 3UJJL 2ZSWA 1JP5A 5I1EH 1BFOA 3VMNA 5INDA 2OR8A 4NM4H 5CP7B 3KPOB 1L7TH 1S5IH 3REVA 3EFFA 5IV2B 3IRPX 2LVCA 1B90A 4PBWD 1J0JA 1M7DB 4F9LC 1FJ1A 5DUMH 4XP6H 5FHAL 1S7SA 1F3DJ 4LPXA 2G5BB 4CBPA 3FQRB 4MCZB 4PREB 3UTTB 5DMYA 4F2MA 5HYQB 4R26H 2UWEA 1GC1L 1U36A 2X4PA 4YDIL 1TVHB 1K3ZA 5EWIL 3SDAD 2VZ3A 3CLFH 1CR9L 4PY8I 3DBXB 2GI7A 4EZMA 3GSVB 3TNMB 1GGBL 5MEOA 4PJDF 3MUGA 4H0GA 4U1LA 4Z0XA 2A1WH 5GRJH 5EUOA 1IM9B 5C9KA 4MD0A 5ESVA 2DOCA 3HC4H 4L3AA 1CBVH 5CMAA 2CUHA 5HJ3B 5FO9A 1QG3A 2HKHH 2L0DA 5F7LB 2EZ0C 5L88L 5A3IC 2BNUB 3OXSA 4OZIF 4OI8A 4J4PA 1JZ4A 2I07A 5BQ7A 3B2UD 1YEDA 1MJ7L 4JQVA 1NDGB 3QEGH 4CVUA 3CDFA 1T83A 3D9AH 3TT1H 1JHTA 1I8KA 2GIYA 5DQ9A 3MA9L 1FZMB 4L8CB 1FYTB 2MCPL 5TQ0L 2DLFH 4PRBA 3EO0B 4CUCA 2EO9A 4OTXH 4F7MB 1JGDB 2VDML 4JREB 3DSFH 2ZCHH 5E2UH 1LO3H 3O2WL 2A6JA 4Q9RH 1UVQA 3VJ6B 1RUPH 1K2DB 1GPOH 3C8KB 1QLRB 2XN9A 3BEWA 5CZXC 3MBEC 3EO1B 1MUJA 2BY2A 1A2YA 5T3ZL 3ULUL 4FQQB 2OTWB 3L3GB 3AU1B 2O5ZH 2CJUH 3SGJA 3UZEA 4TUKL 4GAGH 3EYOA 3C5JA 1ZS8A 1KCRH 4GAFB 4GLRI 4JDTH 4HXAL 4P57A 4PGCA 1MCPL 4R7DB 3X12A 1CFNB 1LE5B 2YPVL 2CMRL 2F8VA 5I8CB 5I1LA 1WTLA 3H3KA 1BFSA 1QSZA 2YBRA 4MJIA 4BELD 1SJHA 3NIFE 1GCFA 3QI9D 3NPZB 4IRZH 3MRBA 1FV1A 3MYJB 1PY4A 3NABL 1SVCP 4IHOB 4QXTA 5I16A 3C5ZC 1FNLA 3VXMA 4P2CG 3GUTA 4K94C 3IFPB 2EH8H 3FTGB 1MVUA 3O3AB 4LVEA 1AE6L 4Z7WE 1TVDA 1IBGL 4WTZA 3C60A 4QYOA 1M7IB 5CGYD 1RZJH 4G7VH 4AMKH 1U58B 4ZFOA 3BQUA 3OAZH 1KJ2L 3DVGA 5DYOB 3D25B 3NCYP 4MHHG 4YWGH 4KKBC 3MV8D 3I2CH 3HNSL 4DVBA 4G80A 1OAYH 1RQ5A 3OKLB 2FIKB 5I2IA 2J2ZA 2UWEE 2IPUK 4QY8B 4ZQKA 3U7WL 1HH6A 1JF1A 2CH8A 3LS5H 4XPHH 2CDFB 1UYWL 4OQTA 3G6AA 1T1XB 5CBAA 5JLZB 1BQLH 4X9HA 3QDGA 3QCTL 3X11B 2R15A 5DC9B 2H9GA 4F15C 4WDIA 4ODVH 1EIBA 5EUOE 3WJLA 4LARH 4YJZL 3GDBA 3FN0H 1D5MA 2WBJB 4A6YL 3RY6A 5F72S 4J4PD 4KK9D 4UNTA 3NTCH 4X8JA 2HRLA 1FRGH 4L5FH 3LQZA 5D93B 5C0RL 3BEVA 4FTVA 1JI2A 1J8HA 4ZG1A 5E24E 2IAMC 5HSFA 4G8EB 4OJFH 3NGBC 4HT1L 3WDHA 1DR9A 2Y5TB 3VXSD 1GZPA 3ZHKA 4XPFL 4G6AD 2XN9D 4U1JB 1F00I 1FDLL 4JM4H 4M6MH 1HZHL 1OW0A 4L4VB 5HHMB 1K6QL 4CMHC 2XN9E 3DHJA 3V4UH 5JHLH 1KELH 2RQ8A 3JVGC 1K9TA 4WFFD 3A6BL 4PLJC 2H2PD 5C0NC 1I7RA 4TNWK 2ED7A 3FFCA 3V8CA 4MJID 4Y16B 4X9FA 4WFFE 2H41A 4U1GB 4JDZA 2DD8L 5TF0A 1FVCA 3QXTA 1I3GH 3B3IA 1TZIA 4TSBH 1JPST 4PJ8D 1JZ3A 4HLZG 3RGVA 1MWAA 4OZHF 3GHEL 5E8DL 2ADJB 3VCLB 2APBA 3RPIA 2HP4A 3KPNB 3CX5J 5GRZA 1WT5C 4Z5RB 1ZTXL 5A40E 3VXME 4X83A 3IKCB 3ZE0F 3EO9L 4P3DA 2ZG2A 5ITFB 3ARFA 3SKNB 4LCIH 1KG0B 2Y9RT 4FXKB 3C60D 5GZOD 2B1HH 3T4YB 4HBCH 4LF3A 1MIEH 3RP1A 2C3VA 1IAKB 3BQUD 4OV5A 4OCRH 4L3CB 3E3QC 3R06B 4JFQA 3ESUF 4KKLC 3BMVA 5IFHH 4DZBB 5ENWB 1S7TB 4JCMA 1KCVH 2E7HA 4LSTL 5KVFL 1NCWL 1Y6MR 2AERT 2YMXL 2BC4B 3OGCA 1OB1A 2ATKA 1CGVA 5JXEA 4IIQB 2HTLD 1EBAA 5DMGD 3RUGF 2ZOLA 1UM6H 2HLAB 3EYUL 4CU6A 2VDOH 4L3EA 4AY0A 3PDDA 3P73A 4RMWA 4JPVH 3PP4L 4XRCB 2XZQL 5EN2B 3QDGE 5JOEA 2ADFH 3AY4A 5KZCB 3CMOH 2YD4A 4XPTL 4KJPC 4E5XB 3DROB 4PJ5B 2BHZA 3FJTA 4FTVD 4Q9CA 4LHUD 3I6LE 3M1BA 1FL5B 5DMIH 4HW6A 1NMBH 1J8HD 2JIXA 3D5OF 4LCCA 2YEZA 4PJEF 5JOFA 4FTVE 2Z91B 3FZUD 4QHMA 5E2VH 3LH2H 1J8HE 3LKQB 4TSAH 5CJ8A 1ZVSA 5CGTA 1X44A 2FECL 3L3DB 3T0EB 4QLRA 1CD0A 1CDIA 4NQCA 4WW1A 3V79C 2R8SL 3RWIA 2Z31A 1BVKB 3VWJB 2OSLA 1F5WA 3H3PH 3HE7D 3TBYA 3KG5A 3OR6B 3SDXA 4NM8L 3GO1H 2A74B 2HYMA 2JB6A 3GZKA 1CXLA 1SEQH 5CEXB 1A1NA 4TRPH 3Q5OA 2DI7A 4UMGA 1INDL 4PJIA 3DXAD 4YZFE 1A3LH 1MCHA 2NY3D 1M05A 4M6OL 5L0QB 4U0RC 4QOKA 4DN4L 4CJ1A 3DTXB 4YPJA 1CXEA 2AI0L 1YEFL 3FFCE 4HQQH 4ZOEA 2BSSA 2VISB 5DTFB 1D6EB 3MLUL 4KHXL 1TIUA 3RGVD 1I1AA 4AEEA 2BJML 1S9XB 1V3JA 3SDAB 2QSTA 1UB5B 4HWZA 5EBWA 1YPZF 3ARFD 1BLNB 4U1NA 3JWDH 3TNNA 3R0NA 1X5HA 4XXDA 3PWVB 3FOMA 1NFDF 5EOTA 3VA2C 1S78C 4LVOC 5BJTB 4FQIH 1A47A 1GL4B 3JTTB 4XGZB 4ONFL 1PG7W 4XBPA 3KGRA 3HZYA 4B50A 3SHSA 4BFIB 5E56A 3OQ3B 4HCRH 3ARGA 4ZO6A 4ZFZA 2QJDA 4LNVA 5GGSY 2YK1L 1C08A 3GSRB 3C6SB 1FO0A 5I1GH 3ULUF 1H8OA 5I74C 4NBZB 5ESQA 3CGTA 3VWKB 5JXED 4M02A 1CDCA 3FFDA 4Z6AT 2W9EL 4OGAD 4Y4KC 5TDPA 4L3EE 1Z9SA 5C9JA 4LSUH 3CXHK 3H9HA 3A6CL 3QCUH 3TN0A 4O2FA 3KXFA 1P7QA 1OLLA 1HI6B 4WW2B 3SE9H 3QXAA 5FA3A 4J3XA 1MREL 2NW2A 3MRHB 3DUSA 3CFKA 3K8MA 5TH2A 3K8KA 2PR4H 1DVFA 1RURL 3MGOB 3RVUC 4P5MA 1P5UA 2IADA 2NPLX 5HDBF 2JIXD 2DQEL 3UJJH 4F57L 1UJ3C 4OI9A 4R0LB 1PSKL 5H2BA 3OB0H 4EDXB 3C8DA 2DJ4A 3FT3B 2QHLA 5A2IH 1FL3A 1YMHA 1BGXL 3L3JA 4XWGL 3MRQA 3MLPA 3IT8D 5D8JL 2Z31D 5L9DL 3QRGH 4EVNA 5IVZA 4K7PY 1IT9H 4LHJB 4NQCE 2LQRA 4Z7WB 4U1IA 2QR0B 3P77A 5DHXB 1NKOA 4U7SA 2ZSWB 5FYJH 1BFOB 4YDIH 4HUNB 1MCFA 1V7MH 5INDB 5I1JH 5EWIH 3ZYOA 2C3WA 2K7QA 3REVB 4S1RL 1MHCA 3EFFB 5JQ6L 3SDXE 2FHBA 5E08L 4GRLC 2P4AB 1FNEA 3J8F7 4RGMB 2J1KA 1FJ1B 4J3WA 1N6QL 1K8IA 1WLHA 3IFOA 1DZBA 3PP3K 1S7SB 1RUMH 5DZLA 5CAYB 4J2XA 2VKXA 4PJIE 4MA8L 1OF2A 5GRYA 3BYTA 2Y1VA 1H8NA 4QOKE 4F2MB 1B6UA 2UWEB 2CKBL 2NNAA 1I1FA 1PW3A 5L88H 4HSQA 5KOMC 5FYJU 2AXHA 1FGNH 3TFKD 4XPGH 4XTRD 4LLMA 1T2QL 3IDYC 2E6PA 3NIGF 1MJ7H 1ZHBB 3MGAA 3MUGB 1XF5A 4Z0XB 4U1LB 4PJAF 5EU4B 1NEZG 4L4TD 2MCPH 1XCTB 5E0QA 5TQ0H 1NCNA 5EUOB 3ROOB 5GRWA 4EUPA 2B4CC 4MD0B 5ESVB 4MNQD 4X8XA 1DBBL 5CMAB 5FO9B 5F1IA 3WNLA 3K4AA 1FFNA 3OXSB 4I13B 3ARGD 3BIKA 2I07B 5BQ7B 1PVHA 5L8JB 3KWWA 3Q5TA 5D6CA 3O3DA 1I8KB 5DQ9B 5T3ZH 5C0CA 4PRBB 2EEBA 3FKUS 4PG2A 4ODXB 3BZFA 4Q6IC 5SWQA 2JTDA 4HXAH 1MCPH 1JZ2A 3EZ8A 1UVQB 4OM0H 5C6TH 4YHZH 3BIAX 2CMRH 2QSVA 4OCSL 2P5WA 2CXKA 4M5ZH 1CFVL 2XN9B 3BEWB 2DIAA 5EB9A 3TN0D 3QFJA 1OP5K 1A2YB 2PO6A 4WHDA 3NABH 4BZ1H 1NC2A 4PLKC 3NACH 3KXFE 1DLHA 3EYOB 2MSPA 1ZS8B 4HBQA 2DQTL 1I7TA 4PGCB 4XBEL 3X12B 4HUVA 1AE6H 4CMMA 4HK0A 3SDCA 4MJIB 1N59A 2YBRB 1LO0L 1SJHB 3HS0A 5DJAA 4JY5L 2VZSA 2JJVA 2VIRA 2QTEA 4FQLL 1DDHA 1FV1B 2EDNA 4QXTB 4JEGB 4PJ8B 5I16B 3VXMB 4BQ6A 4MJ5A 3TGXA 4FFYL 1MVUB 3SGKC 2V7NA 5I1DA 2LU7A 2XZCL 3PUCA 4JPKL 1BFVH 4F58L 5AG8A 1T80A 3C60B 1OAKL 4QYOB 2VKWA 4TSCL 3U7WH 3BQUB 1UYWH 1U8LA 2E7BA 3DVGB 3QCTH 5LQBL 2Y06H 3U36A 2WWKT 4M03A 5E2TH 4DVBB 1GGTA 4G80B 1WQVT 3VFNA 1MY5A 4JVPA 4OD3L 2CR3A 2EE3A 4KUZL 3STLA 4ZQKB 3L7EA 4PG9B 2J3SA 4JN2A 1JF1B 1HH6B 1N26A 1WTGT 2AQ1A 3CSBA 5C0RH 1J9CT 3CCHB 4XB7A 3G6AB 5CJXC 5CBAB 1QP1A 3KPPB 1T4KA 1ZWIB 3QDGB 3RPKA 2PXYA 4WDIB 4AIXA 5GS0C 5JZ7C 4HT1H 4EI6A 5E2JA 1IC1A 5ILTH 5F89B 1D5MB 4MVBD 3UYRH 4XPFH 1M71A 1J18A 1O7SA 1GGUA 3V6BR 3UYPA 4X8JB 4IOIA 2XTLA 3LQZB 3I50H 3BEVB 4X6DA 4XVUD 4FTVB 4LHUB 5C0CD 1J8HB 1WV7T 1KPUA 1UM4H 5KVGL 5C0CE 1H3XA 1HHIA 1UKSA 5ELIA 1GZPB 1ETZA 3H7BA 2P5WD 4NN5B 3LPFA 4FQXA 2R9HD 2P5WE 2PO6D 5SV3A 4D9LL 1XZ0A 1A7NL 4DVRL 2FB4H 3QFJE 5E2WL 3DIFA 3GHEH 5E8DH 3TESA 3O6ML 1ZTXH 3F6LA 3RWCA 3FFCB 1H5BC 4B53A 3SDCD 5FF6A 4POZC 3EO9H 2Q87A 1FSKC 2NY3B 2BFVL 1LDPL 4JDZB 3ULVE 5DVMA 5KJRL 4MAYD 4XP5H 3B3IB 1TZIB 2Q3AA 4POYA 3W0WA 4DWHA 4BSVA 3TZVA 3RGVB 1MWAB 4R9HA 2F5AH 3RPIB 1Y0LA 4N1CA 1U8NA 1Q1JL 4P3DB 3ARFB 4X7DC 4LSTH 4AK1A 3DV6A 4UTBL 3CVIH 4NNYA 2YMXH 1D5BA 1P5VA 2C3VB 4HKZA 4OV5B 1EEQA 1XF1A 4CKVX 2V17L 4JFQB 3PP4H 5EU3B 2XZQH 3UJTL 4NZUL 4XNYH 5DJ6B 4R7NA 2FH8A 5JIIA 1ZLWH 4TULL 5CBEA 1JTPA 1OB1B 2ZPKL 3TA3A 3H9ZA 2ZOLB 4P23D 2B5IC 5FDYA 4MQSB 5K9KA 3PGCA 2M1KA 4NO2A 4HV8A 5KVDL 2PXYD 2J6EA 1HHHA 3HZVA 5DJCA 3WV0A 5FV1L 1B4RA 4GKSA 1EAPA 4EQ3A 3VRLE 4NUGL 4JRYA 5HTSA 3ZL4H 1MCOH 5HVWA 3MACL 1SY6L 5EH1A 5AAMA 2VQ1A 1T7XA 2VTFA 3M1BB 4UBDC 1JZ6A 2JIXB 1FCGA 2HFTA 4LCCB 2YEZB 4OBRA 4NM8H 4X6DE 1P1ZB 4ELME 3LQMA 4QHMB 1MY7A 2D2OA 1KEGL 2C4FT 4L9LC 4RFEA 4WW1B 4NQCB 4NZTL 4M6OH 2FO1A 1MCEA 3RWIB 1W8OA 2Z31B 4DN4H 4AM0A 4UOW0 4JFZH 4FQXD 2OSLB 5ACLA 3HNTL 3TBYB 4KHXH 3SDXB 5GS2D 3MJ9L 2BJMH 2JB6B 5CHNA 4C54A 1A1NB 1P53A 2PNDA 4GS7C 3MA7A 4PJIB 4FN0A 3ZTJG 1F4XL 1M05B 2JCCA 5A16B 3DYOA 4QOKB 5CKAA 1RHHA 4ZOBA 5E6YA 5IGXL 4I0PA 2Q7YA 1BWWA 4H25A 5D9SA 3LPGA 2BSSB 3THMH 4HWEH 1I3RA 2G75B 1AQKH 1FQ9C 2KPNA 1OTTD 4YHNA 1I1AB 3BPLB 3SDDA 3SQOH 1H3VA 2P8MA 3Q0HA 3QDAA 1OTSC 3W0WE 2UVFA 4HWZB 5EBWB 1DSFL 2YK1H 4MD5B 4OUUA 2OQJB 3D85D 2EICA 4U1NB 3TNNB 2BX5A 3UX9B 2VLJE 4XXDB 3FOMB 3QUYD 5EOTB 1MCIA 3VFPA 4L4TB 1H15A 3JV6A 3KPSA 2W9EH 2JLLA 4WVRA 4QEGA 5C0AD 2VXQL 2ENYA 4GRWE 3ARGB 5IW6A 4O5LL 1TXKA 1IGJA 2X1OA 3PHOA 3V0WL 3GMPA 4U1HA 1MREH 3QIWA 5ESQB 2ICEA 3OSKA 3FFDB 4LVHB 4MYWB 1RURH 1VACA 3B9KD 5KOVC 3VRIA 5HVHC 4F57H 2DQEH 1U8IA 2LTQC 4NN6B 4HIXH 3AUVA 5TDPB 1PSKH 1WEJL 5C9JB 1NGQL 4LAQH 3H9HB 1W0WA 4YIQA 1TTFA 3TN0B 3RDTC 4O2FB 4XWGH 3KXFB 4G43A 4F7EA 3QXAB 4PD4K 5D8JH 5FA3B 1A6VH 2BNQA 1WWWX 2NW2B 3DUSB 4FFVD 2R0ZL 4JRYE 3CFKB 4X80H 4BKLA 3W11D 5TH2B 2EC9U 4ONHA 4P5MB 2IADB 3GI8H 1U8PA 4RFNC 4D9RE 2GK2A 1GOFA 2VQTA 1EDQA 3AS3A 4P46A 3OJ2C 4IBLT 1J0ZA 4ZAKD 5H2BB 1JCKA 4S1RH 5CD5C 3QUML 3X13A 3BHBA 3HZMA 3L3JB 2IBBA 4GKNA 2AQ2A 1N6QH 2AXGB 4EVNB 4WUUE 4P2OD 5IVZB 5B39G 5GS1C 4NHCL 4U1IB 3P77B 4ONGL 4Y5YC 3P0YH 4U1SA 1NMAL 2DKUA 5BMFH 5EOQL 5JIPA 1GZQB 4NKOA 5IROA 3WE6A 1IGIL 1ZT4A 5EFIA 1FNEB 2CIIA 2DTSA 2F9BT 5C7XL 5HDOA 3IFOB 3TPKA 4I0PD 4WEUD 2JCCE 5F96H 4ELKA 2AJYL 5GIRA 1DBBH 4AQOA 2IQ9L 2NNAB 3NCMA 1I1FB 1ZANL 3SDDD 1OTUD 1Q9LB 3OKKA 3K8LA 1X4ZA 4LLMB 3TM6A 3V6FA 2G2RA 1G7QB 3ROLA 1FFQA 2L4OA 3BGFC 4NP4L 1KCUL 4X6EA 1XF5B 1NJ9A 2ATPA 4YLQT 4R2GD 5I18L 4OCYH 4EUPB 4K3JL 1NUDA 3KPSD 1HYRC 4JN1H 2W9DH 4ODBD 3V5DA 4BFBD 1R3IL 5I8EA 5IQ7L 5F1IB 4OT1H 3VH8G 4ZDHB 4OCSH 2X41A 2GJZA 2CUIA 2ICWJ 1CFVH 3BIKB 1OPGL 3V7MA 1BQSA 4LNRA 2GHWB 3KWWB 2CRIA 5D6CB 1N3NA 4P4KC 4KWUA 5C09E 1KJVA 4PJGA 3QIWD 4QTIL 1JJUA 5C0CB 5IMKA 3BPOB 1MI5A 1SBSL 3BZFB 3S34L 3RKPA 1SJXA 4WUKH 2YA2A 3QJFA 3S5LG 1FH5L 4OF7A 3GMRA 1F3JB 2R0LH 4KI1A 2P5WB 2O61A 1VGEL 3RBSA 4L4JA 4JY5H 5F9AC 2AEIT 3LKNA 2FX7L 2PO6B 4FQLH 4BFGA 4LEXL 2F19H 2BNQD 2PTUA 4F7PA 5D71L 1NC2B 4ACPA 4PJHB 1DLHB 4P2RE 1BD2D 1I7TB 5HI4C 1CDYA 4G6KL 4HUVB 4CMMB 1JWMA 2XZCH 4HK0B 3SDCB 5J11C 4JPKH 1P7HL 3B4NA 3RBGA 1OAKH 1Q72L 4QXUH 4KC3B 2VIRB 4MAYB 3UBXI 4Q0XH 1DDHB 5FB8A 1FFPA 2VXVL 1NUGA 2X4RB 3QJHA 2C3GA 4LPCA 3UTSA 4MJ5B 4X6CB 2Q7NA 5LQBH 4GMTL 5T3XE 4IOSD 1Q38A 2C4XA 2V7NB 1LE9A 3QDJA 5I1DB 3IXAA 4ZUUA 1F42A 1SBBA 1EBPA 5GGUA 1U8LB 2A2QT 4M93C 2YXFA 3U30C 3U36B 5EU6D 4XNQA 2NLJA 3VFNB 1FVEB 2XTJD 5DRWA 4NO0A 1HNGA 2A77L 2NYYC 3STLB 1G9NH 4JN2B 4JG1L 3T3MF 4TUJA 3F12A 3MRKA 5AWNL 3PJSB 1NEZA 2D9CA 3DARA 3GB7A 1T4KB 4JRXA 4UAOC 5I30L 1A3RH 2PXYB 5KVGH 4PYHA 4EI6B 4WWID 3D18A 1PJ9A 1A6UL 5JR1H 5AZ2H 1AH1A 1RZ8B 2B7DT 3EJJX 1JPTL 1IGFL 1M71B 4AENA 2CLRA 3ZYJA 2NY1C 4UV7H 4CGTA 2OTPA 2N7AA 5E9DA 1PZ5A 2P7TA 3GBNL 3KAAA 4F7CB 4NQVA 4WO4C 2FSEA 2VXSH 2NCMA 1KIPA 1A7NH 4DVRH 5AYUH 1MI5D 1YQ2A 4H26A 5DVLA 1JYNA 1KPUB 2P24A 4PJGE 4NRXA 4NFBA 4X6BA 1F4YL 1HHIB 1MI5E 3OWEA 4G6JH 2AJSL 3SOBL 1ETZB 3H7BB 3AFLA 3MLSL 5FGSA 3P0VL 4U31A 2BFVH 1LDPH 1Z3GL 3H2WA 1X5XA 4FQXB 3ZKQD 5IUSA 1XZ0B 3JVGA 1OSPH 4I8DA 1MOEA 3IDUA 2C1PB 1FN4A 2EXWC 1X5LA 3RWCB 5IFJA 1Q1JH 1A7RH 4OZGF 2X9YA 2VXTH 4UTBH 3T0XA 4ZSOA 3G5XA 3W9EB 3LV3A 5I8KH 5F7UA 2FGZA 1JIBA 3W0WB 1WT5A 3UTSD 4BSVB 2P47B 3TZVB 2BOCA 2V17H 3ORJA 3MBXL 4XAWL 4NKDA 1ZLSL 1LEKA 2YRZA 1Y0LB 3GM8A 1UKQA 3HC0A 1U8NB 4JB9L 4WEBL 3UJTH 3UTSE 3JTSB 3I9GL 2WUBH 2V7HA 3IFNL 5CEYA 3H9YA 3DV6B 4LSRH 4NNYB 5GGVH 3QULA 3QDJE 3QUYB 4GBXA 1D5BB 4HS8L 2ZPKH 1J10A 2EDDA 3NZ8B 4MCYA 4NYLA 2DLIA 4HKZB 4IRSA 2LAGB 2I25N 3MV9D 5C1MB 4OFYA 2BZDA 4YDKL 5C0AB 2VDKL 4DK3A 5KVDH 1RK0A 2AEQH 5MEQA 2NR6D 4O51A 4WFHD 3UZQA 1BQHG 2IFGA 4NO0D 1CL7I 4ZS6D 4R7NB 2FWOA 1N64L 4ODTL 4RFOL 5IEKA 1IGCL 4JZJC 5CBEB 2VN7A 1HSAA 2WW8A 3JUYA 3A0OA 3CVHA 3RX5A 3ISWA 1G7PA 5KSUA 4ZFOL 3B9KB 3SCMC 4JRXD 3DETC 3PGCB 5T1MB 4HV8B 1U9KA 2IANA 1HHHB 3HZVB 1F02I 5DJCB 4GKSB 1EAPB 2AK4A 1CDBA 4JRXE 1KEGH 1F4AA 4NZTH 1V5JA 4K3EL 3TO4C 5E9DD 1INQA 1BIIB 2VQ1B 5CUSL 1F13A 2YA0A 2Z8WC 2XWBA 5GPRA 3HNTH 4OQTL