5EOQL

Structure of the murine fab 1g6 bound to the vaccinia virus a27 peptide 31-40
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
218
structure length
218
Chain Sequence
DVVMTQTPLSLSVSLGDQASISCRSSQSLVHSNGNTYLHWYLQKPGQSPKLLIYKVSNRFSGVPDRLSGSGSGTDFTLKISRVEAEDLAVYFCSQSTHVPPTFGGGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Anti vaccinia virus A27 antibody Fab 1G6 heavy chain
publication title Linear Epitopes in Vaccinia Virus A27 Are Targets of Protective Antibodies Induced by Vaccination against Smallpox.
pubmed doi rcsb
molecule tags Viral protein/immune system
total genus 57
structure length 218
sequence length 218
ec nomenclature
pdb deposition date 2015-11-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5eoqL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5eoqL01
3DECA 5DZLA 4K3JH 5TDOA 4EN3B 3KPOA 4OKDA 4OKVB 2X44D 1YDPB 5EUOE 5H2BA 1L9MA 2XFXB 5HPMA 3TO4C 1K2DB 1OL0A 2PCPA 3QQ9C 4XHQA 3IDGB 1BQLL 2YN3A 5EU6D 2J1KA 1ZTXH 4R26L 5T3XH 4MJID 4N0FB 5EU3B 4IRJC 2XRAH 3NZ8A 1NCBH 4N9OB 4MXVE 4M48H 5IESL 2WP3T 1RJCA 2HKFH 2NX5B 3RU8L 4RSVA 1I8KB 2P5WB 4Y5YC 4H1LB 5F96L 1KTDB 4P23B 5DJZA 3WKMH 5KN5B 2BVOB 4EUPG 3JUYA 2QQLL 3FQRB 4TPRL 1X5YA 3J8F7 3MCKB 5F9WB 3MA7A 1B2WL 4PJAA 3DVFA 3KLHD 5ERWB 3JWDH 1U3HA 2NLJB 4TSAH 5A2JH 2FEEI 2RHEA 3MV7E 1EXUB 1A1MA 1N8ZB 1I3RB 2YEZB 4LCUB 3DV6A 4JRXD 5HGGS 5T1DH 4IM8A 5CBEB 3HRZA 1A4KA 1DQQA 1ZT4A 1BFVL 3UCRA 5H37G 4P2QE 2EKSB 4Z0XB 1DLHB 1RIVL 3ROLA 5I1LA 1FNSH 4Z0BH 2ZUUA 1ZSDA 3WLWD 4H8WH 4NQEE 4L4TA 1AFVH 4OLZH 3VU2A 2BRRH 4OLVL 5JXEA 3P30H 4N0CD 1GCFA 1F00I 2EH8H 2NXZB 4HEPG 1UWGH 1CBVH 4HIIB 2R0ZH 2OLDA 5GIRA 4ESKA 1U3JA 5K9QG 2DJSA 4C83A 5DK3A 2EXWD 4HZLB 4YHNA 2KPNA 2CPCA 3ILQC 4QRSB 1CD8A 2D03H 5I16B 3T08A 3KYNB 1XR9A 1CN4A 4G5ZH 3RVXD 2IH1A 4DAGH 2AGJL 2D9CA 4G7YH 4TSCH 4LQFH 5D1XD 5E95B 15C8L 5AEAA 3K7UA 3CFJB 5C0ND 1UZ6E 1ZHBA 5GSVB 4NJAL 5DLML 3LDBC 4LASL 4UNTA 3QB7C 1L7IH 3ARXA 2A6JA 4RFEA 4PY8J 3X3FL 2O5XL 4JRYD 4UV4L 4ZS7L 2BY3A 5ACZB 4YDIL 4NO2A 3LIZL 3T0BA 1OOAA 5GGRY 4X6DF 1KJ2H 4ODXB 4QOKA 1YQVL 1K5NB 2VH5L 2ADJA 4OUUB 2H2PD 1KB5B 4WFHE 4P5TC 2Q76A 3PGDB 1S78C 4EN3D 1A64A 4WW2A 2VSDA 4XPAL 4KRPC 3GSWB 1ERNA 1J88A 4XRCA 4YC2C 3RHWF 2K7PA 5HPOA 1NBZB 5GXBB 2ATPB 3IDXH 3OKOA 1SEBA 3RBSA 4QRPB 4QKXB 1VFAB 3BZEA 3QNXA 1YEKL 4UINL 1PEWA 5CUSL 3BMVA 3CVHH 3UPRB 4ZDHA 4M7JH 2XA3A 3PF2A 3I6KA 3C6LC 4TVPE 5ESAB 1CD1B 5DJCA 1YJDL 4X9FA 5HHOA 3U46A 4OV6F 4GKNA 2UWEF 3GMMA 1JRHL 1R24B 3MLVH 2EH7L 3QUMH 4G9FA 4PJ8B 3SDAB 1TVHB 5L8LB 1BBDH 1VGKB 3FKUS 1OAYH 4L1HA 3STZA 2P5WD 4PG9B 4I9WE 3IFOA 4PJ7B 4P23D 2A73A 4JCLA 5FM5O 3SGKA 2XT1B 3O3AB 5C0RL 1JWUB 2ATKB 1VACA 2GTWA 3TO4B 2MKLC 1AE6H 4WUUE 5D1QB 1TPXC 1PKQA 2VC2L 1X7QA 4MAYC 2H8PB 2KH2B 2IQ9L 1IC5L 4R90L 5D7IB 2O5YL 3OBAA 4WO4D 3VGDA 1L6ZA 1QBAA 5HYSB 3NACH 3I2CH 4KJYB 4WNQB 1RMFH 4PTUA 1NGXB 5I8CB 1UKSA 5DYOA 3GBNH 2V7HA 4NKOB 3SKOB 2ICES 1A9BB 4I0PD 1YN7A 1MCEA 5JHLL 4PD4J 3RNQB 4KK6C 3U82B 3RUGE 3SDCA 4YUEL 1BVLB 4AH2B 3E6HA 4NO5A 5KTEH 2I9LB 2RFXA 1TNMA 4HC1L 3MGAA 4S0SD 1DANU 2NXZD 3OR7B 4NQVB 5AAMA 4YDLC 2Z8WC 2JIXD 2R2HA 2X89A 2FEEL 4UU9B 1HILB 1NCCL 4MNHA 2NR6C 4RCAA 1XCTA 3OTTA 1CDHA 1FZOA 1BQLH 5DI8B 5FO8A 1VEPA 5C9JA 2XI9A 4R26H 1I7TB 2GSGB 1G7JB 5F1SA 3HNTH 5CZXC 1IM3A 1JZ2A 5IESH 3RZWA 1KEGL 3S3JA 4D9QD 1I3VA 2XKSA 4P2OA 2H6PA 3RU8H 3VFMA 1H3XA 5F96H 3PWPB 2ZUTA 4UDUA 2UVFA 4XP1L 5F21B 4P9ML 4F33A 4UQ2A 5IK3A 4YHOL 2LV4A 3HZKA 2QQLH 3GSXA 4TPRH 3RVVD 1R5VB 1WEJL 5F7UA 3G9VA 3QIWC 4I18A 3ULSB 1B2WH 1IGML 1U92B 5JOPD 4U1JA 5BW7C 1B6UA 5B4MD 2BVQB 4X6BB 4ZUTA 5C0EA 3W39A 3LDBB 3S35L 1X4ZA 3O4LE 4HLJA 1BFVH 5E8DL 3KYMB 4HDIB 5FB8A 1RIVH 3U4AA 1CL7L 3L3DB 1B4JL 1UXSB 5GHWL 4IOSD 3ZE2E 2Y23A 3OJDB 4PJEA 3QDMA 2R23B 4L9LA 2WSKA 4OV5B 1HH9B 4OLVH 1G9EA 1WFNA 3RVUD 3QJHB 4JQXC 4OZFB 1J05A 4C56E 4HSQA 3O3DA 4YIQA 4P5TB 4BQ8A 1QFPA 5J6HB 3SDAD 4PJ8D 1A6TA 1NQBA 4JG0L 2PTVA 4P59L 1JZ8A 4N8VA 5HGDA 5E24E 1BOGA 4JKWA 5F7FA 5IROC 4Z7UA 3GMPA 3O3UN 5ISZE 2DL9A 4ZO8A 1JPSL 4NNXB 1MNUL 2YD3A 3LQAL 4JQIL 5D1QD 5GRJL 2AGJH 4LEOB 1BFTA 3IRPX 3MRQB 4YFLI 4QGTA 4QYOB 1YN6B 15C8H 1A3RL 1MAJA 4NSKB 1MUJA 3UJTL 5DQ9B 3C6LB 4NJAH 1TVBA 5DLMH 4MDIA 3ARYA 1ND0A 3WL9B 1X4XA 1T2QL 4LASH 3TVMC 4HUXB 3I02A 2WBJD 3P11L 4NHUA 2FYYB 3X3FH 3HAEB 4WFED 4MJ6B 2O5XH 3OKYA 3OJMB 4UV4H 4ZS7H 1MVFA 4YDIH 3D9AH 3LIZH 4FXGA 3BP6B 1MCDA 4Z7QE 1D9KA 1TPXB 5CZVL 5ID1B 4BFEA 5DVLA 3CSYA 5INDA 4LARL 1YQVH 3SN6N 5C0GA 1DSFL 3LPFA 4R4FL 2VISA 2AK1L 5EBLB 3PWUB 2LAAA 4UBDC 1AGDA 3DRTA 2YPVL 4OFYD 3L3GB 4CVZA 4XPAH 5CWSA 3WIFA 5HVHC 2E6JA 3SDXF 1OTSD 2VL4A 2HJFB 3MBEA 1CQYA 4DGVL 2B2XL 2ZNXA 2CR3A 2KZ1B 2OR7A 4OLEA 5DHXB 1YEKH 4UINH 4UTBL 3HZYA 1T5WB 4S1SL 5CUSH 3OKNA 1S9XA 1RURH 1XGYL 4LLMB 5F3HB 2CDFB 3OL2A 3PWNA 3P9MA 4HUVA 1YJDH 1RJYA 3P9LA 2X4PA 2W38A 3C87A 5E99L 2CUHA 1L7TL 1JRHH 4DZ8A 2EH7H 2I24N 2X2YA 1CLCA 3BP7B 3C60D 4NOFA 4WWKD 1E28B 1S7UA 4XX1G 5C07D 1PY9A 4KK5C 1R3HB 3LKSA 1ZGLM 3PWPD 3UO1L 1WBYA 4Y19E 3VWJB 1BOYA 4NHCL 1EFXB 3PABB 5D72L 3RX7A 5C0RH 5L2KA 4YQXL 5F6IC 4YDJA 4K9EL 2VNCA 2VC2H 3IDJB 5KSAB 4JFED 4PJXB 1IAKB 1J86A 1X4YA 4KTDL 2IQ9H 4JFFD 1IC5H 4R90H 2CLVA 3S3PA 5E5MB 2O5YH 1HHJA 4UB0L 4Z7VB 1IQWL 1HDMA 3T4AB 2Y7QA 3KYKL 4WHDA 4MQXC 5D2NC 4J3XA 2DI8A 1UH3A 5FOBA 3KS0J 4EQ2A 5A2FA 3FCTA 2X9YA 5KOMC 3MUZ1 4U1GB 3O3BA 2XWBA 2V5YA 5JHLH 5D1ZD 3A6CL 4OCWL 4RGNC 4PB0L 4P4KA 4ZNCD 2X4UA 1ZA6B 3EDDA 4MD5B 3ZDYE 1MHPH 5EH1A 4YUEH 4MNQE 4Y4KD 4ZOEA 1F4AA 5T1LA 3QFDA 4BFIB 2FBJL 4HC1H 1NCDL 4S10A 3FZUC 4Q6IA 2I27N 4HAFA 1IC4L 4MCYA 5FECB 4UOW1 2W0PA 5DK0B 3IJYA 3RWDB 2DI7A 4WUKL 3X11B 2R69L 3SE3A 5F3BB 4NUJA 1NCCH 4ETQB 4X6CA 5C2BL 5HVWA 2AK4E 1CDUA 1U8KA 4JHZA 3CC5A 5EPMA 1WWWX 4ZFZB 5CJOL 2FJGA 1CIDA 3RRQA 1ZVYA 3HB3C 1KIUA 5GISL 1QUNA 4NJ9L 1KEGH 4G8FA 3OV6A 2HG5B 2NYYC 5C71A 3TP4A 5DUPL 3AS1A 3UX9B 1LO0L 3FO9B 4JZNB 1RZKL 4XP1H 4P9MH 4X5XB 4FQLL 3LS5L 1QRNE 3ARGA 4YHOH 1TNNA 2GK0A 1HHGB 1MIEL 1WEJH 3JBG7 5BVJA 3UBXG 2XA8L 1DVFC 3TBWB 5SX5K 1IGMH 1YPZB 4QRQB 5F1OB 4RX4D 4Z6AT 1T83C 2VLLA 2UZIL 5CP7B 3P73B 5T3XE 2C3VA 2YUWA 4OF5A 1XF5B 2I25N 1U8OA 3FQNB 4KJWD 4PRPB 4G8GB 3S35H 2BSTB 5E8DH 1R3KA 5J9PA 4DUXA 3FFCA 1HH6A 1CL7H 4RZCB 1B4JH 3D5OF 5GHWH 1OF2A 3CXHJ 1V5JA 3MRIB 3C8DA 2ADGB 2DKMA 3VFOB 1PG7X 3KLSA 1AGEB 2ARJA 3DROB 1QD0A 2I07B 4NN5B 3KYAA 2X4SA 1VDGA 1C5BL 4PLOB 4U7SA 4MQ7B 4HIJB 1NL0L 4HFUL 4RMSA 4JFQA 3QH3A 4P59H 4JG0H 1LP9F 5HD8C 1EMTL 1YYML 4S1DD 3IKCA 4XNZC 3FTGA 3HE7A 3VWJD 3SDDB 2XWJB 1EFXD 4MS8C 1FAKT 2C5DC 1JPSH 3B8SA 3LKRB 2FO1A 3KXFA 3DIFB 1ZVSB 3DXAE 1MNUH 4O51B 3LQAH 2P1YA 4JQIH 5GRJH 4KKCC 4PGEA 1Q9WA 5KSAD 4OZGE 4DQOL 1NGYB 4U7MA 3NBNA 1A3RH 2I26N 5IVXF 3IVKA 1FVDB 3UJTH 5KSBB 1T2QH 3CDCA 4Z76B 2DDQL 3UP1A 3VFSA 5BS0A 5E8EA 3P11H 1N7ML 3R0MA 1BM3L 4JFHE 1KIRA 4NN7B 5EZJA 3GSOA 3A67L 3V6OA 2A77L 5JR1L 2BK8A 2WV3A 4GLRI 3MLZL 4JREC 5F6IB 5BV7L 1C12A 3PJSB 4P9HC 4OCLC 4KY1L 4WIQA 5CZVH 3U9UB 1U8LA 4LARH 2F53A 1DSFH 3TA3C 1WV7T 4R4FH 2AEPL 4WU7B 2AK1H 3D3VB 1VESA 1DQLL 5I75C 1D6VL 4M5ZL 2YPVH 1KTLA 4M7ZB 2H9GA 2YUXA 3CJJA 3NFPA 1QSZA 2J5LC 3O6FC 2GCYB 3F5WA 1F3RB 5D2NB 4F37F 5JOFA 4DGVH 5BRZD 5D9SB 2B2XH 4LPCA 3KGRA 3NIGE 2PF6A 3KPQA 3L7EB 4UTBH 4S1SH 2EO9A 2IAMA 4NKIL 1XGYH 5L6YL 4JVPA 5T3ZL 2VTFA 2OMNA 3BQUA 5E99H 1L7TH 5B8CB 1VERA 5GPRA 2GY5A 2MTPA 4MSWB 5GGVL 1HEZA 1Y0LA 4JDZA 1FZJA 1PZ5A 4BUHA 3UO1H 3QUKA 2EEAA 4NHCH 3QUYB 5D72H 4HWUA 1FSKC 2E9IA 4YQXH 2BNQA 1U95A 3L3OB 5IMMB 4K9EH 4A2MA 1QEWA 4LF3B 4Y5XA 3I3EA 4KTDH 5JA8B 3W0WB 3AGVA 2Y07L 3V6BR 4UB0H 4YWGL 1IQWH 2Q6WA 4CKVX 5FUCE 4OSUL 3D2UA 4CN6A 1SJEB 4PRPD 3KYKH 4FFWD 1JJUA 4K7PL 5MENB 3RNKA 4EIGB 4Y4HB 2P8PA 4YPGA 4M7LT 2YD9A 3A6CH 4OCWH 3TNMA 4PB0H 4LMQI 4G8IA 2APVA 2PW2A 1A7PL 2FBJH 1NCDH 4JFDD 1TCMA 1IC4H 4X5WB 3T0EE 3UPCA 3PUCA 2EIZB 1A14L 4WUKH 4XBEL 1KLGB 2R69H 3O9WC 4LCWA 3S5LG 3VRIB 3VG0L 5C2BH 5JTWA 4YBQD 4IRSB 3SDDD 6CGTA 3LKNA 1B0GA 4NQTA 1DE4B 5CJOH 5JHDD 4PREB 2EO1A 1OSZB 1CGWA 4PR5A 5HHMD 1NMBL 3Q0HA 4AYFA 5KS9F 5GISH 1OP3H 5H94A 2YD2A 2CGRL 3M1BB 4NJ9H 2YPLB 4P2RA 3KLHC 1B3JA 4FRWA 4Z7WB 3V2AR 5KANG 5I73C 4YHKL 5DUPH 3U0WL 3MJ8A 3TPUA 3OX8A 2VR4A 1LO0H 3WN5C 1RZKH 1EO7A 3LPWA 1XGUA 4MA3B 4D0CB 4FQLH 3LS5H 1DCLA 1S8DA 4HX1A 1MIEH 2OI9B 3WLWC 4LKCB 1VPOL 2XA8H 3PWVA 3W9DA 3UTQB 1A0QL 1T7WA 3PNWA 2OS7A 3QFJE 1QHOA 4XP9L 1TQBC 3B2VL 2UZIH 5DRZB 3D3VD 3PL6D 4AZ8A 3WJJC 2ZCLL 1LHZA 2BNRE 2KQMA 3KPRA 5GGSY 3QEQE 2VLJB 4PG2A 3B9EA 3ARZA 1EEYB 2XZCL 5FYKL 1DR9A 1T0PB 1R5WB 4FHBD 2AEWA 3MRNA 2KZWA 4M02A 1T04B 3MOBL 2UUDH 1FYTA 3VI3F 4HKJA 4JREB 4YHZL 3MRJA 4R3SA 4L8SA 1IGFL 2R0KL 1C5BH 1FZKB 2YMXL 5C0FA 4ZFOB 5I1AB 3BEVB 3DX7A 1HQ4B 1FV1A 1NL0H 4HFUH 1M7IB 2DQGL 1ORSA 4NM4L 5I75B 4QXTA 1N2RA 1A7QL 1I1AA 1EMTH 1YYMH 4M62L 2GFBA 1KN4L 4UT7L 5AZEL 3S37L 1KEML 3LKQB 1JYVA 3BT2L 3TV3L 3BP4A 4NIKB 4PJDA 4PRIE 5CEXB 4JN2A 5DJ0B 3P77B 4WFGD 4DQOH 2YD6A 3T65B 4JVWA 5GJSL 5BMFL 4Y1AA 1JF1A 1X3DA 1ZANL 3MBXL 2DDQH 4MWFB 3VFPB 5EUOB 3SJVB 3VXTB 3RTQA 1FLRL 4S1RL 1WZKA 2HFEA 1BM3H 3KPNA 3WLBB 4MJ5A 4Y4HD 3THML 3A67H 3U7WL 2IANA 1UKQA 2A77H 4HV8B 4PJAE 3LMJL 5JR1H 1A4JB 2C1OA 3KS0H 3MLZH 3RDTC 5BV7H 2EDHA 4L5FL 2DAVA 4KY1H 4EI5B 2AJZA 2Z92A 3CUPA 3OAZK 3TIEA 4D0DA 5IV2A 1V05A 1KJVB 2AEPH 3BEWA 3DETD 3UTTB 1J1XL 3TBVB 1DQLH 4B7IA 3RVTC 1D6VH 3QA3B 3V6ZB 4M5ZH 1S7RA 4HLZH 1NGZA 2FHFA 4L4TE 5CKAA 1X44A 3MO1B 2XG5A 1YEDA 4GAJL 2P5ED 4NNPL 4IRSD 3OGOE 3WHXA 1P1ZB 1HHIB 2WINA 3G5XB 3GSNL 5I71B 5IVZB 3EZ8A 2NZ9D 1S7QA 5DHVH 4NKIH 3T3PE 3CFBA 3GHBL 4CDGC 5L0QC 5L6YH 2EDBA 3MV7B 3QQ4A 2EYSB 5T3ZH 4Y16A 2GITA 2YPLD 4PJ7F 3ARDC 4HJJL 4WO4C 5GGVH 1KLUB 2ZUQB 1ETZA 3P9WB 5HHXL 5INCA 4NQEB 1JCKA 1AR2A 1M4KA 5CILL 4NWTL 3G08A 5JUEL 1ZLWH 4NQSA 1BX2B 3T1WA 1DQDL 1S7XB 3C6SA 2Y07H 2DWEB 9CGTA 4BFGA 4YWGH 1LQSR 2DTML 4OSUH 4HZAA 5IJKC 1W0YT 4M61A 5HHOD 3BD5A 1U93A 4K7PH 5FM4A 3NFSL 5I9QC 2AXFA 4R6UA 3DUUA 4FQPA 5HI3C 2J3SA 4QY8B 4QOKE 3CMOL 5DD1L 3UPAA 2D7OA 1A7PH 3OKDB 4NO3B 2W9LA 1UQSA 4PJ5B 5GGRA 1G7QB 2BP3A 1UADC 3Q6FB 1KG0A 3IU3A 3PP4L 2PXYC 1A14H 1WCBB 4HGWB 4XBEH 3ZTNL 4PJBA 1QP1A 2O93L 1W72B 5BZDA 4PV8A 3VG0H 5ANMA 2DLTA 1LEGA 2ITCB 3NABL 4J12A 2ED9A 3K46A 3CMGA 1E0OB 5HHOE 5ALCL 1FYHB 5HJ3B 4G9FE 1SBBA 1ACYL 2J8UA 4PBVC 3RVVC 5IF0B 4H26B 1NMBH 2BC4A 1AQDA 1B0RB 3QWRA 2IFGA 3SDCD 1J8KA 4A2LA 1N3NB 2CGRH 2NY2C 1F3DJ 4JFPA 5HTSA 1BQHA 3TT1L 4YHKH 3U0WH 3BGFB 2JELL 1JHLL 2O61A 2IBZX 1PKQE 2A6IA 4HBQA 5L7XL 4W81A 5K59E 1JGLL 1U58B 4LEXL 3SE4C 2JJSC 1NLDL 1KACB 4HGMA 4U1IA 4PJIA 4XNUL 3O41B 1R3LA 2YK1L 1AD9B 1Z9OA 1OP5K 1AKJB 1CFVL 2DKSA 1A0QH 1HXYA 3MNWB 5DGQA 1HSAA 1YC8A 4XP9H 3B2VH 3KJ4C 3UTTD 2ZCLH 1I8MB 3LN4A 4ODWB 3DO7A 5KVFL 5E8NA 4AQ1B 5I15L 1T0NA 1XEDA 4H1LG 4LDEB 4B5EA 5D6DC 3L1OL 1KJMA 2XZCH 3D39B 5FYKH 3ZT5A 4JZOB 5J6GA 4PD4K 1ITBB 1T1YA 1DEEB 1MWAB 4GRLB 3RIFK 5JORA 5IWLA 2XICA 3MOBH 5IB4A 1KNOB 4NPYB 3BRDA 2OTPA 1FL6B 4YHZH 2B0SL 4TUJA 4JZJC 3GIZL 1A6AB 1IGFH 2R0KH 2YMXH 1ULVA 5DEZA 3FB7A 4GKSA 3HE6A 3LD8B 4QHLB 4RQQB 1RU9L 4ZAKC 1XH3B 2APBA 3B9VA 2BVPA 3EFDL 3S36L 2DQGH 1K9TA 2JK5A 4NM4H 3C8KA 3SO5A 5IB2A 1SVCP 2Z8SA 1A7QH 3IDMA 4M62H 4ODTH 1KN4H 1M71A 4UT7H 5AZEH 1W8OA 4EUPA 4ISVB 4UMGA 1IJ9A 1PQZA 2WBJC 3S37H 4W6WB 4OCMC 1XGTB 1KEMH 3VFNA 3BT2H 3TV3H 4IJ3C 5C0AA 2GJ6A 1AGFA 2YD1A 5GGUB 4LIQL 1MLBA 5GJSH 4NZJA 4NQDB 2YC1A 5BMFH 3FHAA 1I9IL 1MCWW 4NZUL 2VLKA 4HFWB 1ZANH 3MBXH 5DEFB 5ID0A 2P8MB 4XHJD 1MPAL 5EB9A 1FLRH 1S7TB 4S1RH 1NUGA 2Z31D 4Y2DB 5IW1A 3THMH 3U7WH 2QR0B 5FXCH 1NC2A 3DJ9A 3LMJH 3TLRA 4GW4A 3VXPA 4NFBA 1I9RL 1AY1L 4L5FH 2HLAB 4IHOB 3O45B 5JOEA 3EBAA 5HVGB 3DYMA 1TZIB 4PJ5D 3DVGA 3CFDA 4RIRB 5AG9A 4OZIB 3GJFA 1J1XH 3QRFM 3FRPA 3ZE0E 3Q5OA 3QISA 2Z35A 5EOQL 4PRHB 5EO1A 3EFFB 1S9VB 4LDOB 4R4BB 3RHWK 4PJEE 3QDME 2AJSL 1R6VA 4NZDA 4R0LA 3C60C 4WWKC 3WIHA 5C8JA 4GAJH 4NNPH 5GS1C 4NP4L 3GKZA 5FF6A 4C59B 1S9YA 4N8CH 3ISWA 5EC2B 4L29B 3GSNH 4X4ME 3QXAB 2QJDA 1YY8B 4L3EA 5KSUB 3VA6A 4ZFFA 1P4LB 2IC2A 5BQ7A 3GHBH 3HLAA 1S7WB 2FHCA 3KPPA 2OL3B 4Z7UE 4HJGA 3D0VB 4HJJH 1JGEB 1F58L 3O4LB 3U4EA 1MAKA 1I7UB 5HHXH 1MCKA 2PXYB 4G8EB 4WENB 3H7LA 1F97A 2SEBB 2C4FT 4LLUA 5F72S 4PJXF 1NFDE 3RZCA 5CILH 1EEZA 3WIHL 4NKMA 4LVNC 1M6OB 4NWTH 1ED3A 3DVNA 5JUEH 4WI3A 4Z7VF 4QF1B 4U31A 3PDGA 5F6HI 4J2XA 5FDWB 3MBED 5CD3B 1G6RA 1JNJA 1DQDH 2Z91B 3DMMB 4C56B 32C2A 4Y4KC 1E4XI 3AREB 3JWOC 1K8DB 1P5VA 4HAGA 2HAZA 3OG4B 2BFVL 1RHHB 2DTMH 3PDOA 5TJWK 3T1FB 1UXWB 2V2TB 5ISZB 2BRQA 5E9DB 1KENL 1W0WB 3D85B 2CR6A 1VFBB 4ZUVB 4CVXA 5IIEB 2VDKL 5TQ2L 4YAQA 2VXQL 5T5NF 3D39D 5F6HJ 3CMOH 1DDHA 4I2XA 5DD1H 4EVNA 1I1YA 4GXVL 2ZOLB 4YNYA 3VXOA 3FB8B 3TJHD 4DGIL 3EDFA 2NY3C 5HYSG 1YEHL 3EOBB 3PP4H 4I13B 4QRRD 1NAMB 1ZLVH 3ZTNH 5I30L 1Z3GL 3F6IA 3JTTA 3KPSA 2PN5A 1NH6A 3S98A 2CMRL 3PWLB 3NABH 2YA0A 4OLUL 1MAML 2NY5C 1OAZL 3MRDA 3VGEA 1IAII 1KCUL 2A9ML 5GQBA 2I9TB 4AT6A 5I17A 5ALCH 4GKZA 3GI8L 3TNNB 1ACYH 3ARPA 2CXGA 1S7VA 1HN1A 3VXNB 4NQDD 1FP5A 1QBBA 4K8RD 5ITBL 2VDRL 2EDQA 5L2KE 3TT1H 4JJHA 1MHHA 1IGJB 1JHLH 2JELH 2ORBL 2FZ3B 2VN4A 3V7AE 4NUGL 3DURB 5L7XH 1JGLH 4LEXH 4Y2DD 5ITFA 1NLDH 4LVEA 4QTIL 1N6UA 1YPZF 2WMPA 4XNUH 3G5ZB 3VRJA 3WNOA 2YK1H 3EAKA 1ACZA 3FAXA 1CFVH 3FOMA 3GMNA 2XNAB 3BPOC 1CU4L 3TZVA 4YGVB 5JMOC 1I75A 4LLYB 2NY4B 3RFZC 1H5BB 1FH5L 1T20B 4PRHD 5DMGD 1HINL 4Y19B 5KVFH 5I15H 2BXZA 1J12A 2UVEA 3H9SE 3L1OH 2YZ8A 4WDIB 5DJAB 1L4IA 2VB5A 1JGDB 1OP9A 5E0QA 1DN2A 1UH2A 2AJ3A 1T7XA 3MMEB 2B0SH 5CEYA 2N56A 3HG1B 4C57C 3FQWB 3GIZH 5D70L 5MHSD 3VFVB 1U8HA 1RU9H 1A6VL 3S36H 3EFDH 4KI5E 1F6AA 1X5FA 4KUZL 4ZMAT 1YNKL 3MR9A 3P0YL 1QSVA 2YPKB 3BSZL 4P5MA 4TNWF 2WUBL 1EGJA 1LEKB 2MCPL 2GSIB 4MNGA 5I66B 4MNQB 1HSBA 1C7TA 5TH2A 1XF4A 4ORZC 2C26A 3I9GL 5GRXG 4Y5VB 5KSBF 4LIQH 5LAXB 4DCQA 2WZPD 4HIEA 3IF1A 2OTUA 1XZ0A 5T1KB 4KKLD 4OZFG 1I9IH 3B5HA 1CCZA 3SEPA 2NY7L 4U1LB 3CFKB 1F8TL 4H20L 3HS0B 1LE5A 1MPAH 2FCBA 4U7KA 5E9DD 1CG9B 4N90D 1FN4A 4N0UE 2AEIT 1A5FL 1FG2A 3F12B 1OLZA 4KK8D 3B9KD 4ZXBA 1EGJL 2C7UB 3PIQB 3NIFE 3TO2A 4EUPH 2V5MA 1I9RH 1AY1H 4JQVC 1PEZA 5F7NC 4LVNB 4X6EB 1T4KA 5EUKB 5FUCC 3OR6B 1AP2A 4O2CA 4OIAA 5C08A 1PGRB 1INEL 2CRYA 4WFFE 4WI9A 4WHYG 5TE7L 5CZKA 1V3KA 3E8UL 3FFCE 5MP6L 1UWEL 2X41A 3IS1X 5EOQH 1BREA 4QXUL 1BZ7A 1MOEA 3EYFA 1M1SA 5DJYB 2JB6A 2EKJA 5IMKA 3GUTA 1QRNB 4L4VD 4NP4H 3U83A 1MJJA 1N5AB 1BQSA 3HAEG 1KXTB 5DD5L 2FNBA 2ZOKB 2APWA 3I75B 5MI0C 4OD2B 4PJ9C 1H3GA 1X5KA 4I48A 1T2JA 5E00B 5DRNA 1ZT7A 4K71B 2DIBA 3X14B 1GOGA 3RVWC 1QSEA 2PYFB 3DTXB 5ESQB 3U2SA 1F58H 5GS0L 3GJFH 4NO0A 3KXFE 4EOWL 3QHFL 1ZT1B 1H8NA 3ARFA 3EO0B 3N9GL 3S97C 1ZGLP 4AIXA 1WJ3A 4M1CD 3WIHH 1N0XL 3PHOA 3HUJB 4H5SA 3W11D 5D7JB 2NZIA 3AVEA 4AM0B 1N4XL 5KSVA 1CGVA 1GC1L 4NYLA 3MRKA 5BS0E 2QHLA 3BPCB 5E1AB 4M8VA 2BFVH 3WO4C 5IHUL 3BDBA 3D0LA 1AIFA 2G60L 3V6OE 2NY4D 2PNDA 1KB9J 5FHAL 3BQUD 1KENH 4P3WA 2DYPA 2X4RA 4RWYL 2VDKH 1QTYT 3C09C 3X13B 3DXAB 5K9OA 5TQ2H 5J4MA 3RGHA 5T3ZE 2VXQH 2F53E 5D4QA 1ZXQA 1RIHL 1A7BA 1A1NB 4XPFL 4YBQC 4ZODA 3DLQR 2OM5A 4E5XA 1RSFA 4GXVH 3VMNA 1LE9B 1TMCB 3HG1D 4DGIH 1WBXB 5CS7A 4X6DA 3UTPE 1YEHH 3H7BA 4CVUA 5I30H 1T1XA 1Z3GH 3WNKA 4BH8A 4PTTB 5FEBA 3D2UD 2J4WL 3FB6B 2A0LD 2CMRH 2FJHB 1A1OB 4APQA 2GEEA 4YZFE 4OLUH 3V5DB 1MAMH 4UAOC 1OAZH 3CH1A 4XVUC 1IEHA 5IFJA 1HHKB 5I1IL 2A9MH 1KCUH 4QHNA 1TCRA 4N5ED 3GI8H 4Z7WF 4QRUB 3GIVB 4LSPL 5ICXB 4U6YA 5T5NG 3D87B 3MUY1 3VH8B 3SCMD 1IE5A 1IL1A 4NN6C 5T1KD 1AGBA 2Q87A 3D18B 5ITBH 5SWZA 2VDRH 3C5ZD 5MEPB 2BNQE 3OPZL 3PL6C 2ORBH 4R7NA 1AO7D 2RBLA 4AIZA 3FQUA 1YMMA 4NUGH 2UWEA 1XR8A 1QKZL 2G2RA 4QTIH 3VXRD 2BNUA 3SGEI 4Z7OE 2NY6B 2F15A 1J0YA 4F3FA 2XN9B 4NCC1 4XGZA 5CEZE 2XY1A 3MV11 3MRRB 3AU1A 4R2GD 1FFOA 1CU4H 2X6MA 4HUNB 1KJ2B 1BD2A 1T0MA 3PQYA 1FH5H 1HINH 4P2RD 3GM8A 1ZHNA 4TNVK 1HQRA 1U3HC 2CH8A 3MLXL 4HUUB 3WO3B 1MI5B 4PFEA 1ITCA 5F97E 3T09A 2UYLA 1ZV5A 5J06A 4M8QA 5JW4R 3EOAB 1G0XA 2B5IC 3ZKQD 5C9KA 2AXGB 5FYLL 4GW1A 2RIKA 5D70H 4LCWE 1QZ1A 2W9EL 1A6VH 4MD0B 2XTJE 4KUZH 4CW1A 1YNKH 1F2XK 3P0YH 1Y18A 3BSZH 3L9RB 1YY9D 1K4DB 1A3LL 2WUBH 2MCPH 3QUMB 5JDSA 3GNML 4PRAA 3RWIB 1WWAX 1QFUH 1CGXA 4U1KB 3ZKND 3JVGA 4X9IA 3G5YA 3I9GH 3UBXA 5D7JD 1N26A 2R2BA 1HNFA 3LEYL 4D8PB 2IBZY 5MI0B 1F02I 4ELMB 1UENA 3T0EB 5I8OL 1GZPB 5GZOD 3CDGA 4MDJA 4P99A 5FYKE 3RWFA 5ILTL 2NY7H 4BK4A 5F9OL 1F8TH 2R29L 4H20H 1RUKL 2Z93A 4OAWB 4PJFF 3WNMA 5HGBB 1XF3A 1BVKA 4XXDA 5D7LA 1A5FH 1S5IL 2F54E 3OAYH 5IEKA 3UEZA 2P49B 2V2XB 4G9DB 1EGJH 2HH0L 5C0JA 1I85A 1QVOB 2P24B 1TXKA 1Q9OB 3JUZA 1FFPA 1B6DA 1U2CA 3STLA 3KPRE 2QQNL 5TE7H 2ZCHL 4Z77A 3TC9A 5IB1B 3E8UH 5MP6H 1UWEH 4U1MB 4K7FA 2K3TA 4QXUH 1NPUA 3VXUA 3WO4B 1YJDC 2CXKA 4Z78B 3DX8A 4F37K 4JKKA 3I85A 1TENA 3N1MC 2QADC 3RL1B 4JE4B 1FYTE 5MEOA 5FYJD 5GGSA 3REVB 4WW2C 3BMWA 4G6AD 5DD5H 3VDBA 2GT9A 2BVYA 3QCUL 1RJLB 3LH2L 1XIWA 4MVBD 2IAND 5BOZG 1C08B 4R7DB 4FOMA 1W0VB 2NW2B 4QTHB 5GS0H 4JGMA 3QEQB 3VXMB 4ELKA 3BGMB 3G04B 4EOWH 3QHFH 4PJDE 5B38B 3N9GH 3OGCA 3JTSA 3DRQA 5HY9A 1N0XH 2NY6D 1BIIA 3KPOB 4ZSOA 2EYTA 4Y1AE 5FHBL 4PYGA 3SGKC 1IAIH 2HMID 2ICWI 1N4XH 3ZKXB 2X4QA 3BUYB 1GC1H 5F1KC 5HHPA 5IHUH 2EZ0C 2G60H 5FHAH 4GRWE 1Z0MA 1P2CA 3FB5B 4RWYH 2FH8A 5E1HB 4NBXB 4Q97A 4QRTB 2NCMA 5CSGA 5EZOL 4BZ2L 1MI5D 4PRIB 1RIHH 4XPFH 3DX6B 1P7HL 3ILPA 3ZTJH 4F7EB 3OKMB 5J8OA 4MZ2A 3KLAA 4NCDA 3QCVH 1RI8A 3FT2B 4ORGB 3SDCC 3F7VB 1QRKA 3WUZA 1FZMA 4HJ0C 1G7LA 1I7ZA 3QIUA 4YO0B 1KPVA 2ZUVA 3A6OA 4HKXA 3HR5B 2J4WH 1XMWA 4PJAB 3T2PA 4U3HA 1U3HB 5DQDL 3PV7A 2LVEA 5I1IH 3MRPB 3IDUA 3SDXA 3SGJA 1X5ZA 4LKXB 3MNVA 5BZWB 4FFVC 1A4KB 1C7SA 2NTSP 1BLNA 4LSPH 4ODBD 3BKMH 1XGPB 1JI1A 2P4AB 3FONB 1RY7B 3B6SA 1BQUA 3OPZH 3QUXA 2JLLA 2NQCA 4HT1L 5IMOB 3H0TB 3H9YA 3T4YB 4JPWL 1QKZH 3WUWB 4JKMA 4P2OC 1MREL 2VXVL 3T77A 4XCNA 4KQ4L 1Q9LB 2HT2C 3RWJA 2PO6B 4GXUM 3MLYL 2VDML 4C83B 3HI5L 2ADIB 1IQDB 4Q9CA 4JDVA 4JG1L 3S8WA 1F13A 1Q0YL 5C09B 1N6VA 3GKWL 1LILA 1CLOL 2Q3AA 3EO1A 3ULUD 4JO1L 1HXMB 4I18C 1FFNA 4OCRH 5DVOA 3E2HB 4JM2D 3S5LA 1J5OL 2R2EA 3MLXH 3UTZA 5IBTL 2A83B 4F15B 1ZAGA 1LO5A 1ZHBB 5I8EA 1JN6B 4Y8DC 1MCFA 3MGTA 5ALBL 2Q7NA 2WIMA 3U0PB 5EORL 3GMRA 4F57L 1U8NB 1CICA 3OKKB 3KPTA 5FYLH 3FMGL 5IB3A 3FT4B 3LQAC 4PJBE 2NW3A 4CN4A 1YQ2A 3VWKA 4L9LC 2WIIB 3LRGA 4GH7B 4MMZC 2UV3A 4OF3A 1IEAB 1QLFA 3NCCB 2W9EH 3UYRL 3QDGA 2VDLL 1CGTA 1EHNA 3VXMD 1QO3B 1JGVL 4QOKB 1A3LH 1UH4A 1V7ML 2ADJB 4ETYA 3P0VL 2J8UE 2Q76B 3GNMH 4RAUA 2C3GA 5A2LH 1U3ZA 1RJZB 4IDLA 4P46D 4WW2B 1RIUL 4I77L 3RKPA 3QI9A 5H35B 4Y2OA 3LEYH 3BZ4B 1JNLL 4XRCB 2L7JA 5I8OH 2FEDD 4EBQL 5ILTH 5F9OH 3MQIA 3QXVA 1T1WB 2R29H 1RUKH 1LGVA 4U2ZA 4X6CF 4PJIE 5I0ZA 4ZDHB 5JZ7C 1S5IH 4KU1A 2MKWA 1WVZA 4GKNB 5BO1L 4OZIF 4HIHB 2GHWB 2HH0H 3PP3K 4Y4FA 4P9HL 3TYFA 1R5IA 1TDQA 2W0FA 3IFOB 3B2UD 2CDEA 1J1OL 3JV5A 2QQNH 3IAGC 2ZCHH 4NC1E 1QFOA 1E4WL 5J3HD 3L7FB 5DHYB 3LZFL 1D9KC 1PKQB 1BVZA 1ZWIB 1JWSB 1VFUA 1WFOA 1LNUA 2CKBA 4FQXA 4LIQE 4OFVA 1X5AA 2AI0L 4UI2A 2BOBA 4XCFL 4HUKB 3H3PL 4LPXA 1IZJA 4RWHA 3QCUH 1HK6A 4KJQD 4NDMA 3LH2H 4Z95L 4HD9A 1JZ4A 4ZD3L 4MA7L 8FABB 2V7HB 3MBEC 4ZFGL 5E6ID 2WWMC 3FO2A 4XNMA 2FSEA 2QQKL 4HMEA 4NO5B 3VI4F 3CCHA 1KV3A 2RFXB 4BH7B 5C0AE 2GJ6E 3JXAA 3OHXB 5DUBB 4POZD 5D5MF 5DO2D 4MJIA 2VUYA 5GRVL 1KIPB 1WZMA 4FQ1L 2GJZA 5FHBH 2R2HB 2PO6D 2R15A 1EDQA 2VLKE 1RAMA 1OY3B 3W9EA 2GTZB 4ZPTA 2HVJB 3DARA 5C09D 2OX5A 5FO8B 5LGHL 2M1KA 1FIEA 2X1QA 4PJCF 4GOSA 3QIBA 1ORQA 5HBBA 5IVXA 1N0LA 3VCLA 4LPUA 1PFCA 4KV5F 4JM4H 3QEUA 5EZOH 4BZ2H 5JMRA 1KGCD 5DT1L 3ESVF 4JR9L 4JY5L 1G7IB 3TCLA 5EN2B 2ID5A 1K4CA 3LRHA 1INQB 2F19L 3RPKA 3S96A 1CFTA 1ZLUK 4P4KC 1CDGA 4F33B 3R06B 4TUOA 2EYRA 4JRXA 3GSXB 1QPPA 4K8RC 2HLFC 5FGRA 4Q6IC 3SKMA 3ULVE 2GYSA 4L3EE 1U8MA 3TBSB 2A1WL 5DQDH 2X7LB 5CJ8A 3JV4B 4LL9A 3D1MC 1RZKC 5C0EB 4J3WA 3CSGA 3QULA 3SE3C 3SGDI 1SYVA 4KTEL 3W39B 1IC7L 4CGTA 4FFYL 3TN0B 2PYEB 5AD0A 2H2SC 1XAUA 4JFYA 4KI5C 4OFIA 4XP5L 1MCIA 1XCQA 3O4OB 3O3EA 4S11A 4KC3B 3OSKA 3QDMB 5E56A 5IHZB 4IMLA 1CD0A 2Y6SD 3MRHA 3DBXA 2VKXA 3ZT7A 4DVRL 5CJXA 1UJ3A 4HT1H 1T1ZB 1J11A 1CXIA 2DM3A 4XNYL 2FO4A 4JPWH 4DVBA 3L3KA 3EYOB 5C0BE 4YIQB 3O3DB 1MREH 2VXVH 2V2WB 4P3CL 4KQ4H 2CRMA 4Y7MA 4LLVB 2HTKD 1PG7L 3BXNA 3MLYH 5D1XA 3HI5H 4N8VB 5HGDB 1BOGB 2OJEA 4JG1H 4Z7UB 3GMPB 2VAAA 1Q0YH 3ARGC 4XTRD 3U0TB 1DUYA 1XGQB 3GKWH 3RWCB 1H3VA 2X4OB 1CLOH 3HPLB 4M93C 4JO1H 4I4WB 3R0NA 3U30C 3SY0B 1J5OH 1NFDB 3V6FB 4KDVA 5D7SL 5IKCA 5IBTH 3QXDA 1J8HB 4GKOA 3HR6A 3BYYA 4JRYA 1KCLA 3EUUA 5DEGB 4ALAL 2R0LL 5ALBH 5I0DA 4C4KO 5EORH 4F57H 3LS4L 1YZZA 3I02B 4S2SA 1VA9A 3UJIL 1IGYB 3FMGH 5A2IH 4E41B 4YHIA 3U9PL 3EGSA 3KPSE 1CXEA 3IETB 4OM1L 4PGDA 3BH9A 3UYRH 4EN3A 4L1DA 4DN3L 2PTTB 5D93C 2VDLH 4KKLC 5DTFB 2XWTA 4OKVA 1YDPA 3VFTB 5CBAA 1D9KB 3G9AB 1JGVH 2EDNA 3CSYB 1V7MH 2XFXA 3P0VH 3QDJB 1K2DA 1R3JA 3IDGA 1E27B 3KJ6L 5KG9A 1RIUH 4N0FA 5EU3A 3PGFL 4I77H 4CVZB 1A8JH 3AB0B 2VQUA 3HE7C 4J1UB 3QQNA 2AS5M 1JNLH 5BV7C 5EZIL 1YEGL 5DDHA 1AHWA 4EBQH 5EO0B 3QPQD 1P5UA 5I1CL 3KNBA 1KIQB 5KS9A 4D0BB 4PLKC 1I8KA 2P5WA 4O5LL 4H1LA 5CSBA 5EU7E 4P23A 4RMQA 5KN5A 2ARJQ 4HUVB 1AQKL 1M05B 2BVOA 1FNGB 1RJYB 3P9LB 5BO1H 4IIQB 2Y9RT 4DZ8B 2W91A 3FQRA 3NH7L 4P9HH 1S7UB 5SWQA 3LKSB 1Q94B 4IMKA 3V6OC 1J1OH 5ERWA 4WO4A 1E4WH 5LWYL 2NLJA 1KT2B 3DNKA 1EXUA 1N8ZA 1I3RA 2YEZA 1LD9A 3LZFH 4LCUA 4W6YB 3T0DA 3CDFA 5CBEA 5J1AB 2G75B 1ZHLB 4WHTB 4U6VL 3KAAA 4Z0XA 1DLHA 2Q1EA 2AI0H 4I0PA 4XCFH 4KKAD 3H3PH 4QCIA 3H6JA 4R96A 4Z95H 2NXYB 5CLTA 2Y7QB 4ZPVB 1G7PB 3TN0D 2PYED 4ZD3H 2FLBT 4MA7H 2Y1VA 4XBPB 4ZFGH 3ZT6A 5IJKA 3MZGB 4E0RB 5FO9B 1CDJA 2JIXA 2ZKHL 2ERJB 2QQKH 2DM2A 4MNGE 2IAMC 4G3YL 4DJMA 2EXYD 3VGAB 3D69B 1IGTB 4PUBL 5T1LB 1FVCA 3H9SB 3HUJF 4JHWL 1F42A 4HZLA 1X5HA 4QT5B 3BQUC 4X9BA 3IXAB 1A9EB 5DMJB 4MCYB 1NDMB 5I16A 5IMLB 1HI6B 3KYNA 2WNGA 5LBSH 4FQ1H 3IJYB 4KMLB 2GUOB 1P9MA 4J4PD 3TH2T 3CFJA 5IVOA 5DK2A 3T3MF 2AXJA 1DN0B 5J13C 5DWUL 1JGUL 1KFAL 2BSRB 5LGHH 3DGGB 2CIIB 3IFPA 2HT4D 3P4MB 1U8KB 4Y5XC 2QSVA 3NIDF 3WD5L 3LQZA 3EOYG 4X7CC 4KROC 4MD4A 4LOUD 5C08E 4GG6F 4NM8L 2WK2A 4JR9H 4JY5H 5A3ID 1IFHL 1RZ8A 1HWGB 4ODXA 2F19H 1K5NA 4XPBL 3GSRB 3V9FA 3W2DL 4OUUA 5EBWA 4E41D 3UXFA 3ARGB 3EHBD 2OTWB 5ESVB 4N0UB 4M93B 5L2JB 3C5ZC 2E8YA 4N1EA 1AD0A 3MJ7B 2A1WH 3QDJD 1ZMYA 3T0VA 1CTNA 1U8OB 4KTEH 2ZG1A 1UYWH 1IC7H 1QSEE 4FFYH 4DWHA 3NGBC 3UPRA 2XTJC 4XP5H 2L4OA 5J9PB 5ESAA 3FFCB 3FOLB 2CK2A 3RKDC 1QSFE 4G6JL 1OLLA 4R2GC 1Q8MA 1CGYA 4RA0C 5F1IA 1R24A 3SDAA 4PJ8A 1TVHA 4LHJB 1UVQA 4DVRH 1VGKA 5DXWA 4AEIH 4H0HB 4PG9A 1F90L 1XF1A 5DA4A 4PJ7A 4XNYH 2GW5A 2X4SB 5FYKU 1ROWA 3O3AA 2BDNL 1JWUA 3QT2A 4P3CH 2VXUL 3BD4A 3UJJL 2FX8L 5D1QA 2ZG2A 1PG7H 1NEZA 2D7NA 1FVEB 2H8PA 5DS8B 3K4DA 3HE7B 5D7IA 1AXSB 5FGCB 2W59A 3H42L 2FIKB 5BV7B 5HYSA 3WNNA 4KJYA 4WNQA 3O2WL 4V2CB 5HSFA 1KB9K 5I8CA 2FR4B 5D7SH 2O5ZL 4NKOA 3SKOA 2VYRE 1RUQL 4U3CA 4ALAH 2R0LH 4HUWB 3RNQA 1Z5LA 3GBLA 4M9PA 3LS4H 4AH2A 1BVLA 2NXYD 4X6DE 4PG2C 3UJIH 3MA9L 3ZKNC 3VDCA 1BWMA 4XX1E 3U9PH 1QHPA 4DZBA 4OM1H 3DOSA 3OR7A 3IDNB 4NQVA 1C5DB 1N59B 5DHVB 4OFYA 4DN3H 3H9HB 5CD5D 4XZUB 3MRLB 2VUOA 1NGPL 1C12B 4L8SC 2IPKA 4UU9A 1MF2L 1BD2D 1HILA 3BDXA 3GDBA 3K4AA 1RUPL 4URTB 4PJGF 2QSCL 5DI8A 4ELMF 3KJ6H 1I1AC 3PGFH 2ZP0T 5FFLA 1I7TA 5SWZE 4WI7A 2GSGA 2P46B 1G7JA 5SV3A 4G6KL 5EZIH 5B39B 1YEGH 5JOFB 3EYQC 3EJYD 3O8XB 1YMME 1AR1D 1NFIB 3X12B 2UWEE 2XG4A 4GMSL 5I1CH 5BCAA 4WWKA 1GRWA 3KPQB 5E2UL 4UUJB 5F70A 5GS1A 5FYLE 5C07A 4O5LH 3MJ9H 3PWPA 4XP6L 2FBOJ 1J87A 4JHBA 4Q9QL 5C6WH 1AQKH 2WM0A 4LCYB 3V52H 1OB1A 2IADB 3RTQC 3NH7H 1R5VA 4JFEA 4G6AC 1Y0LB 3FQTA 4HEME 1FZJB 3IYLW 3PQYE 3ULSA 3ULUF 4JFFA 3VGBA 4X7SL 4MVBC 4JM2F 3TJEL 1G84A 1TJGL 3VJ6B 4U6HB 5LWYH 2BVQA 4WI8A 2WP3O 4X6BA 2QHRL 3VXSB 3SOBL 1P4IL 4Y5XB 4NRXB 3BN3B 4U6VH 1UCTA 3KYMA 1F4WL 4HDIA 4CADB 3VW3L 5CMAA 1U8QA 5D1ZA 2Q6WB 4KROB 3OJDA 2R23A 2R56L 1EUUA 3OQ3B 4OGZA 4Y4KA 4OV5A 4RAHA 1HH9A 2V7NB 3QJHA 4FABL 3MRCA 4OZFA 2R1WA 1PJ9A 3TNMB 3LKOB 2ZKHH 3LHPL 3ZLQC 4G8IB 5J6HA 4UIMB 3BOVA 4G3YH 3U6RB 1BJ1J 1IEBB 1MHCB 3GRWA 4M03A 4PUBH 4WW1A 4B50A 5DJXB 1NCAL 4Y16C 3GJEA 4ZUSB 1T66C 5F7DB 4NNXA 2YA1A 1H3TA 1G1CA 2D0GA 2Q7YB 1TTGA 5ADOH 1PVHA 4LEOA 1A7OL 5E03A 1I8LA 4KK9D 5DD3L 4NSKA 2XTJB 3T0XA 1Q0XL 1JGUH 1KFAH 1T3FA 5D7LE 5DQ9A 5DWUH 4ODUA 2B39A 3LKNB 1B0GB 5FK9B 4HUXA 1NUDA 3NA4A 2D31A 3WD5H 4PR5B 1YECL 1Y6NR 3HAEA 4MJ6A 3GRWL 1FL3B 2YD5A 4NM8H 2PTUA 2VN7A 3MZTA 2L0DA 5IG7B 4XC1L 3BP6A 1IFHH 3MJ8B 5ID1A 1SJHB 3VXUE 4IOFD 3C08L 1J0ZA 4XPBH 4E42B 4RDQF 3W2DH 3EJZD 4RX4A 1FO0B 1XGUB 1ZOXA 4NBZB 5E4EC 5EBLA 4LCCB 2EICA 1S8DB 2LE9A 3L3GA 4YBLC 5DVKA 3PWVB 2F54B 3W9DB 2EDKA 3V95A 1SY6L 4PGBB 1GPOL 4PB9L 3GSQB 2NY5L 2HJFA 5D6CB 5DJ2B 3LPGA 3PWJB 5DQJB 4NKDB 3CFEB 3ME0A 5F44A 5I19L 1T5WA 3TFKD 2QKIA 4YGAB 5F3HA 4LLMA 1WC7B 2CDFA 4G6JH 4W6XB 5ENWB 3O8XD 3V79C 4HMDA 3BP7A 1E28A 4ZSOE 1R3HA 1F90H 3QNZB 3VWJA 2FIRT 4L8SB 1N64L 1EFXA 2AW2A 4LHUB 2BDNH 4BQBA 5JQ6L 2VXUH 3DX7B 2FX8H 1FV1B 3FRUA 3NPSB 3IDJA 1OSPL 5KSAA 1ORSB 3V4UH 1VEOA 4PJXA 4RISL 1IAKA 1UWXK 1N2RB 2VDOL 5E5MA 3WXVL 4Z7VA 3H42H 3OG6B 4MHHI 5F1NA 2IFFL 3QUZD 3VH8G 4EDXB 2R1XB 4CJ0A 3O2WH 4WCYL 4O2FB 3U7YL 3B9AA 4D9RE 4PJDB 2IQAA 3WFEL 4JN2B 4JGJA 2NPLX 2O5ZH 3RWGA 4KZEL 1Q9KA 4MA1C 1U3YA 3P3YA 1ZA6A 2JTDA 3MRMA 4MD5A 4NC1C 5EOTB 2YXFA 3MA9H 4BFIA 2DS4A 4UZGA 1B0WA 5IWLC 3ELAT 3GSNB 3UAJD 2XZQL 5EC1A 5I1KL 5FECA 1RZGA 2VLMD 3TF7C 5DK0A 1GAFL 2RQ8A 3RWDA 1NGPH 3X11A 4M7KL 1MF2H 1YEJL 4K23L 5F3BA 3SO3C 3SDXE 4D0DB 3CUPB 1RUPH 3VGGA 5GRYA 5F88B 3HE6C 2QSCH 1QG3A 4F9PA 1FBIL 5BRZA 2HRLA 2J6EL 3L3IB 4OF0A 3VE0B 4BA8A 1D5XA 1OTTD 3F7QA 4ZFZA 4DW2L 3RAJL 3MUGB 1QLRA 2BMKA 2H45A 1OGTB 5KAQF 1HWHB 3VXQA 4G6KH 2AP2A 3MLPA 4DKDC 5BJTB 4NQXA 3WHXB 43C9A 5HYJD 2HG5A 1OTUD 4GMSH 4XCEB 5IHBA 5EZLA 5E2UH 4Q74A 4NQUA 4WGVB 4XP6H 3P0GB 1S9WB 4JZNA 3QDGD 2ARWA 1L0QA 4Q9QH 3SQOL 3QQ4B 4X5XA 2IF7A 4FZ8L 4F80A 4RBPK 4Y16B 4UQ3B 2E7CA 1ETZB 3E1F1 3TBWA 3FFDA 5TDPB 1YPZA 5JPMA 4X7SH 4M5YL 3S35X 3TJEH 3M8OL 1TJGH 1NCTA 5ICZA 5A2KH 1A22B 2VE6B 3P73A 2R9HC 5TF0A 1CFNB 1XF5A 4PRPA 3SOBH 1P4IH 1WZLA 3IDYC 5CHNB 2EC9U 4GRMB 4P5KA 3GB7B 4JPIB 3C6SB 4PRBA 1F4WH 3B43A 5FCUL 4RZCA 1OGAB 3F6LA 3TBYB 1DLFL 1B90A 2YRLA 3TWCL 4LLWB 2Y36L 2R56H 4R0LC 2ADGA 4DUVA 2XQBL 4O58L 2R1YA 3VFOA 4JFDA 1AGEA 3DROA 4LP5A 4FABH 4ZS6C 2I07A 4Y4FD 5KVGL 4O2EB 4FN0A 5B22A 3VMOA 3ULVC 4MQ7A 4HIJA 3LHPH 2FRGP 4OCYL 5CIPH 4HK3J 1EHAA 4YEFA 4ZG1A 1V7NL 1NCAH 5DGRA 4Z8FL 3SDDA 2XWJA 4WU5B 5L88L 2HN7B 3LKRA 1JTTA 4HWBA 4O51A 1NLBL 3DIFA 1FNLA 3PHQB 3MV9D 4PJBB 1A7OH 4TN9A 5F9DC 1FNAA 2MHAB 1J1PL 5BZDB 3MYJB 1NGYA 1MCRA 3RZCC 1LEGB 5DD3H 3CX5J 5DFWH 1G9NC 4ONHB 1FVDA 4W4NA 4MCZA 1Q0XH 2HT3C 4X99B 4IEFB 5KSBA 1JRHI 4AG4L 4UT9L 1EA9C 1DFBL 4JRWA 5JPNA 1YECH 3DI2B 1AQDB 2Y5TA 5B38G 5KZCB 3QEGL 3GRWH 1KLFA 5M94B 1SVZA 5BOPA 3C9NB 4BJLA 3DPBA 1BQHB 1MLCB 4XC1H 1PW3A 1T5XB 3PJSA 3U9UA 1EVUA 4JANB 4PBWD 4MX7B 3C08H 5J1TC 3EDKA 4WU7A 3D3VA 3PL6A 3BWAB 4JJ5B 4U1IB 4K3HA 3F7YB 4R4NC 3BIKB 4PJIB 4KDTC 4RMVA 2RR3A 3WDIA 5HGAB 2XTLA 4GO6B 2GCYA 5SWSD 1SY6H 3QIBD 1MFBL 4PB9H 5DMYA 2NY5H 3H2WA 5D9SA 3HAEH 3MRGB 1GGBL 2UZXB 3V8CA 3L7EA 5CP3A 5I19H 4WWID 4KZDL 2HTKC 1T0NB 4YHYC 5HI5C 5GGTA 4Y88A 3MRFB 3IT8D 4W70A 1KJMB 1X5GA 5J6GB 5B8CA 4KXZH 5EU6E 5JXAL 2F74A 2D7PA 1LP9E 4MJIE 3BPLC 3G6AB 4RDQG 4WTZG 3ARBB 1N64H 5A1AA 3QUYA 4TUJB 4CDHA 2XV6B 5IMMA 3L3OA 3EO9L 4GKSB 4OD3L 3HE6B 5JQ6H 5ICYB 3MOQA 1X5LA 2F5AL 1A6ZB 4NFCA 1OSPH 3OB0K 1ZHKB 4RISH 5IB2B 1BFSA 4LF3A 3RGVD 1G0DA 2VDOH 5F7KC 5IVXE 4GBXD 3RIFF 1HOCB 1KUMA 5DC9B 3WXVH 3KR3L 5E94A 2IFFH 5EU7C 4WCYH 5TE6L 3VFNB 3U7YH 1SJEA 3WFEH 4P3DB 3TZVC 4Y4HA 3O11B 5E8PB 4QGYA 5IQ9B 4UDTB 1LVEA 1RULL 1AXTL 3WUWG 3ZYOA 5GSRB 5ID0B 1G6VK 1HCFX 3LKPA 4KKBD 4JRXE 2QBWA 4FQQB 5IW1B 2Z9TA 5I74B 1KULA 1MFNA 1SMAA 2XZQH 5JW4M 3PGCB 4X5WA 2OZ4A 5I1KH 4GW4B 1YEFL 1GAFH 1B9ZA 2EIZA 5F9JB 1WSST 4PY7B 5FAAA 1WBZA 4ZO9A 1TITA 3QNYB 4M7KH 1YEJH 2D7QA 4K23H 3ZYZA 3BPNC 1II4E 3IDYB 3VRIA 1JNHB 5DRXB 2ZJSL 2P5EA 4IRSA 4Q6YA 1CL7I 3MNZB 5D96B 3GJFB 2J6EH 3W81A 1BJ1H 3Q5YA 4KFZC 2H3NB 4DW2H 5EO1B 3RAJH 4PREA 1ES0A 3BHBB 1EHXA 3DX9B 4CN1A 5CSZA 3M1BA 2YPLA 1QPXA 4Z7WA 1SJXA 3MC0A 2YA2A 3K8LA 4L3EB 1IAOA 4ZQKA 1O7VA 4G6FB 3CPLB 1GGTA 5DZNA 3SQOH 1QQDA 5KZCD 1IRAY 1NCNA 4FZ8H 4MA3A 1DANT 2EECA 4OGYL 1DBML 2ITDB 3BD3A 5IBLC 4LKCA 3DHJA 2G9HB 4LLUB 5D71L 3M8OH 3WS6A 4ZXBC 2ADFL 1F6LL 5DRZA 3RZCB 5DFVC 1T2XA 4NKMB 2IMMA 3CAFA 4JRYE 3DSNA 1SJVA 5KAQG 3U4BL 4JAMA 5C0BB 5GS0C 5HDBF 2NX5D 1WAAE 2A6KB 5FCUH 1DLFH 2WLYA 4KGJA 2X10A 1R5WA 1I1CA 3CZFB 4BFBD 1MJUL 2YRZA 5DD0L 3TWCH 4JHAL 2Y36H 1T04A 2VLRB 2XQBH 4O58H 3I6LD 2VZSA 3CGTA 5KVGH 4YAQB 2AERT 1FZKA 4YDVA 4ZFOA 5I1AA 3BEVA 3BP5B 4IRJB 1HQ4A 1GC1C 3NVQA 3VFRB 4OCYH 1M7IA 4EVNB 1CFQB 3ARBD 4YNYB 1V7NH 4Z8FH 2JJTA 2Z8RA 4NT6B 5L88H 3EZJB 3N1GC 1NLBH 4Y5YB 4X4YA 2FX9L 5DJ0A 4WTXA 3P77A 3ARFC 1J1PH 5KS9E 1N6QL 5A3IC 1ADQA 2P5WE 4YFLF 4YHYB 3BFOA 3O6KL 1GJIA 1H0DA 1WCQA 5HI4D 5C0DB 2DKUA 1S3KL 4MWFA 3VFPA 4KMTL 3SJVA 4AG4H 5D2LB 4WY7L 4ZFOL 4UT9H 5F89B 3EHBC 1E4KA 1DFBH 1KC5L 1S7VB 4FXKB 3QEGH 4HV8A 3ETBF 4PJFA 1NC4B 4LRIA 3IJSA 4F7MB 4UNUA 4EI5A 5E70A 4QWWD 1EAJA 1UGNA 5ITFB 1KJVA 3UTTA 2VABB 4OIIL 3TBVA 1OT2A 4LVHC 3QA3A 3V6ZA 1VADB 1GOFA 4QXWA 1MCPL 4KPHL 4LSUL 3FOMB 1S7SB 3MO1A 5ADPL 1MFBH 3NOIA 1EHLL 5HHQB 1EUTA 4KVCL 4XCYB 1IKFL 1HHIA 4PS4L 3G5XA 1A2YB 2P8LA 3VI3E 5JW5B 4KZDH 4APQC 4C58B 1VEMA 2EYSA 4RMTA 2BVUA 1MCQA 5GZNC 5JXAH 2GI7A 1FNHA 2AJ3B 4LSQL 1OD9A 3K80A 1FAIL 3QAZC 1A6UL 5EBMB 3LN5B 4ENED 4NQEA 3EO9H 4OD3H 5E2JA 2F5AH 4D9QE 2UZYB 1BX2A 4N1CA 4OGAC 4QRPD 1U6AL 4HCRA 4K7PX 3KR3H 2V6HA 3TT3L 5TE6H 3EDEA 1CD9B 4NRYB 2Z31A 2B8OT 5CD5C 1RPQA 2D9QB 1U8JB 4LPYA 1MFCL 2MOVA 1LEIA 1IARB 2NMSA 1RULH 3CNKA 3IFNL 5JOPE 1AXTH 4PP2B 1OD7A 4KRPB 4JGUA 2J12B 4YC2B 2VITA 2VLRD 3ZSSA 3TO4D 3KDMB 3OKDA 4NO3A 4N8VG 1FN4B 4PJ5A 4M6ML 1G7QA 2FGWL 4X6FA 3ZDXF 4ZXBB 1YEFH 4IRJD 3TO2B 1HZHL 1WCBA 4HGWA 1AR1C 3LAFA 1T4KB 1W72A 3QQ3B 2NY1C 2XYCA 1AP2B 3WIIL 2ZJSH 2ZSVA 2ITCA 4JO4L 4RGMC 2VAJA 4B7LA 3BAEL 4NOBA 1BZ7B 1KPRB 4WJ5A 4RMUA 4POYA 5IF0A 4H26A 1B0RA 1O7SA 3R8QA 1N3NA 1M7DB 4PJ7E 3MX0A 3JVGC 4MAYB 1CI5A 2VH5H 3P4OB 2Q3ZA 3GGWA 1RZFL 1A6WL 3UROR 3UTOA 3LB6C 4PIRF 1T21B 4I48B 1MY5A 1DBKL 3MODL 3AMLA 1QFWL 1W72L 3OXSB 4FG6D 4JO2L 4M7LL 1NC4D 4OGYH 1DBMH 3O41A 4L3AA 4NO0B 1FL5A 1QSFB 3BIAX 5D71H 5F93C 4OBSA 2ADFH 5CGMA 4WTWA 4WFEE 1I8MA 1I85C 1UG9A 4UOJA 5BXFA 3U4BH 1RQ5A 2ESVB 1C1EL 4HKBB 1GZQB 4YDLB 5C3LD 4NYLB 2KUTA 3MRKB 3D39A 1YUHA 1CDIA 4P48A 1MJUH 1DEEA 1MWAA 4GRLA 3D0LB 4JPVL 4XNXL 4G42B 4JHAH 5DD0H 1KNOA 1FL6A 4AL8L 4UTAL 1P6FA 4X8JB 3MXWL 1A6AA 2DQDL 4E9LA 5K9OB 4KK9C 1CR9L 1XIWC 1U9KA 4QRRA 2APXA 3AC0A 1PYWA 4X4XA 4L8BB 5JW3L 3V7AG 2YSSA 5J1SC 3WFZA 4ISVA 1K6QL 4UV7L 2AKRB 2MJWA 2FX9H 2C3HA 1T1XB 2W60B 4K2UL 5GGUA 3BN9C 1N6QH 5C07E 4NQDA 1RZ7L 3PWPE 3O6KH 3QIWB 3IKKA 4HFWA 5IFJB 1S3KH 1DBBL 4KMTH 4WY7H 1S7TA 4P5TD 1SBSL 2I60L 5IFHL 1KCVL 4JFEE 4U6YB 4Y2DA 1KC5H 1UCBL 1WGOA 2QR0A 3QAZB 4JFFE 3OXRB 4P57A 2LTQC 4KI1A 5CJQL 4KRPD 2X40A 4HHAB 1JV5B 4R7NB 4KKNA 1YMMB 3KWWB 1Z9LA 1J0IA 4RIRA 4OZIA 3V7MA 2BNUB 4OIIH 5DC0A 4F3FB 5DA0B 4JKLA 4PRHA 3ARRA 4DOHE 3EFFA 4K8RL 4HH9A 4R4BA 3C6LD 1MCPH 4KPHH 4XGZB 4LSUH 3HPJA 3MV8B 1FFOB 5ADPH 1EHLH 1PX4A 3PV6B 3MCG1 3ZKSD 3QDAA 4KVCH 1IKFH 1D6EA 3QIUC 5HGHB 4PS4H 5EC2A 4L29A 3QXAA 1LO3L 1BHGA 1ODAA 3L5JA 4YX2L 5KSUA 4CMHC 1ZHNB 4NRZB 1HQRB 1P7QB 1S7WA 3VG9C 1V3JA 5IW6B 2OL3A 3BZFB 3CH8A 4MAYD 3SGJC 3FQXB 3LRSA 2AJXL 1I7UA 2FGZA 2BSED 4LSQH 2SEBA 1FAIH 3X3GL 1A6UH 4OFKA 1CT8B 2XPGA 3P4NB 3TVMB 3OKLB 3QUXC 1M6OA 4TNVF 4QF1A 2RGSA 1AGCB 4Y89A 4DKAA 2Z91A 5D5MA 2RAMA 3DMMA 1L6XA 4BQ6A 1U6AH 5C0IB 4YHLL 3AREA 1NBVL 4KK6D 3TT3H 3Q3GA 4F7TA 1FIGL 1UXWA 4RA3A 3T1FA 3UAJC 4KVNL 2OL3L 2NY0C 3UBXB 2K9UA 2V2TA 4FQHB 5E9DA 2HRPL 3CU7A 4ZUVA 1VFBA 5IIEA 5GRUL 3F7RA 4PJCA 1MFCH 3CDGB 4MDJB 3B9KA 3IFNH 2DLFL 3WFCL 2VOTA 5HVHB 5FDYA 1CXLA 3ZHDA 3N1QC 1L9NA 4KQ3L 3GMOB 3ZO0A 2NR6D 3ZE1F 3U36B 1XF3B 4I5BB 2CDGB 3QYCA 5L8KB 4M6MH 2FGWH 1T7VA 1CICC 1JPGB 1HZHH 1NAMA 2A9NL 5I1JL 1HIML 4XH2B 3VWKC 3FAWA 1K3IA 3WIIH 4L4VA 4JO4H 5DRWB 4EXKA 4Z77B 3BAEH 1P7KA 2X70A 4HLZG 1RUML 3RPIB 2VQTA 2I9TA 3VXUB 3RIAF 3TNNA 5MERB 5T5FL 4XMLL 1EVTC 5MEOB 3B4NA 5GGSB 3QIWD 1YEEL 1RZFH 1A6WH 3QI9C 4FFZL 2O26U 1IGJA 4AEHL 2KQNA 1Y6MR 2ENSA 4HS3B 5I1HL 1KCKA 4BKLB 4LNRA 1DBKH 3MODH 4XWOC 1QFWH 1W72H 4ZO7A 2FL5B 3MROA 3UZVB 4KRMB 1IBGL 3K1DA 4JO2H 4M7LH 4PP1D 4Z7VE 4ZOAA 4YHPA 2Z4QA 4MJ4A 4DTGL 4M3JA 2MNUA 2XNAA 3ORJA 4RGNB 1BWWA 1Z0NA 4JFXB 4U6XB 4YGVA 5B39G 3T0AA 4X7TB 5FKAA 4P4RB 4Y4FC 4LLYA 4ZSOB 2EYTB 1WT5A 1H5BA 1T20A 4Y19A 5B3NA 4OZHB 4BK5A 3WFHB 1C1EH 4FA8A 4GS7C 3MV8D 5F9AC 3MFFA 5DD6B 2X4QB 5D7KD 3I6GB 2B20A 5HHPB 4R97C 4WDIA 5DJAA 3QEHA 4JPVH 4XNXH 3GZKA 4U1NA 3M17B 4K3EL 1JGDA 2LTQB 4FQXC 3SPVB 3S36X 4AL8H 4UTAH 4NCC2 2DLIA 3MXWH 1GL4B 1RK0B 3HG1A 1P7QD 2DQDH 1J10A 3VFVA 4YJZL 1CR9H 3SE8L 5J12C 3NN8A 5BRZE 5HYFA 5JW3H 3ILPB 4FZEL 4YK4C 5J57B 4CU6A 1WQVT 4M9OA 1NJ9B 4X7DC 1LEKA 4G8GD 3W82A 2GSIA 1K6QH 5FIEA 2K1MA 3TVMD 3HI1B 5I66A 4MNQA 5DJDA 3LY6A 1JI2A 4F7PB 3V0VA 1FZMB 5F7MC 1G7LB 2DB8A 3G6JF 4HKXB 1SMOA 4K2UH 4Y5VA 5IHLB 4TUKL 4GG8B 5LAXA 2JCCF 3RJQB 3SCMA 1T22B 1RZ7H 5T1KA 2BVEA 2ZSWB 2MPAL 1K8IB 4G43A 1DVFB 3C5ZA 3CFKA 1DBBH 3HS0A 2EDRA 2X1OA 1AO7A 1LO2L 5J89A 1CG9A 4GQ9L 1SBSH 2I60H 5IFHH 1KCVH 1JUFA 3GMQB 3VXRA 3F12A 1UCBH 3QO1A 5CEZL 1I7RB 1YPZE 4UBDD 4JCMA 5CJQH 1EEUA 3QIBC 3SBWA 2C7UA 3ES6B 4X6EA 2A74A 5EUKA 4PRPE 3OR6A 3TBTB 1T03L 5FA3B 3AM8A 2VWEE 3L5WB 2EDYA 2EDWA 1JFQL 3P2TA 1MEXL 1LK3L 2B7DT 3RWJB 4K8RH 4JVUA 2DLGA 3CSPA 2BY2A 3NA9L 4ODSL 5DJYA 3VD5A 1TZHB 4JFDE 2YBRB 3GMLB 4V1DB 1VSCA 3B5GA 4PJHB 4QNPF 1LO3H 4XNZB 1FFNB 3I75A 4NZRL 4YX2H 4TTDD 4XBGA 5E00A 1VFOA 4RMWA 5EULV 3UTZB 2DQEL 4YR6B 1YNLL 3X14A 1LO5B 1BFOB 3ALPA 1EH9A 3MGTB 2D7MA 3DTXA 4N5UA 4QLRA 4PV9B 1HCVA 2FWOB 1UFUA 2AJXH 4DFHA 1IKNA 4N0CC 4EKXA 1OW0C 1WK0A 2JKXA 4OFDA 3JV6B 2H1PL 3X3GH 2P48B 3QZWG 5JHDE 3WV0A 3V0WL 3VWKB 4OD1L 1SQ2N 5HHME 1GIGL 3T2OA 2C1PB 5C3TA 3CFCL 3A0OA 3HUJA 1BMGA 4FTVB 5CJXC 1I1RA 1UJ3C 5DF0A 2EXWC 5D7JA 3IXTB 1I9JL 5C0CB 2CIKB 4AM0A 5KSBE 4AEFA 3UTSB 4RGND 4YHLH 3ZDZF 1NBVH 2EDXA 2PETA 3BPCA 5DURB 3RVXC 4FP8L 4RAUB 2LFGA 1CE1L 4NQCB 3ZHKA 3L6FA 2XQYK 3TH4T 1FIGH 5D1XC 4JPKL 4KVNH 2OL3H 3KPMB 5EFIB 3FZUD 3TA3B 2HRPH 5C0NC 2ICWB 1MRFL 1SM3L 5GRUH 4C54A 1NEUA 3X13A 3I84A 4N9GB 3MLTA 2DLFH 4LHUG 3WFCH 5E8OB 4WI4A 1A1NA 2J5LB 3QUYD 5F71A 3O6FB 3CSBA 3FN9A 3D3VE 4KQ3H 2ZCKL 2EEDA 1LE9A 2DLEA 4GG6A 4AK1A 2DJUA 2FB4L 4X98A 1WBXA 2F5BL 2Y4SA 4AEEA 3W0WD 2A9NH 4PGCA 3HB3D 1ZGLA 5I1JH 1F45A 4PTTA 1HIMH 2H2PC 1FC1A 3FB6A 2W0FB 5K9KB 1A1OA 1CVSC 4EN3C 1N7MH 2NYYD 2VL5B 5MEND 1WWCA 1RUMH 3D48R 2PKDA 4R97B 4J3TA 2Q8AL 1F3JB 1FSKB 4QRUA 3GIVA 5T5FH 1LNUB 4Q9RL 4XMLH 5ICXA 3R1GL 3GEWB 5KOVC 3AMKA 3VH8A 2BOBB 3UC0L 5KJRL 3TCXA 1FC2D 3D18A 1YEEH 4P0DA 1DVFD 5MEPA 4FFZH 4AEHH 4XPTL 5I1HH 1NBYB 1AHWC 4YK4B 4K7PY 1FFRA 3VFWB 4WFGE 2WAHA 3F62A 1IBGH 4DUWA 3GSVB 5FYJL 4J3VA 2COQA 2C4XA 5FO7A 1MVUB 2XN9A 4R9HA 4DTGH 4P23C 3H3KA 3MLWL 2V9RA 3CCHB 3S34L 1J7VR 5EU6B 3QG7L 1OWWA 3WEXB 1LP9B 4MJIB 1KJ2A 1FGVL 5F9WC 4IMKC 3W9EB 4M1GL 2NNAB 1KYOJ 4P2QB 4HUMB 1MI5A 1IVLA 3O9WB 1T6WA 4PRDB 1MELA 4V1DD 5HD8D 4K3EH 1XF2B 1ORQB 2ZWLT 2AXGA 3WE6B 5E7BA 5D7IF 4J8RB 4I0PC 4MS8D 1KPUB 5IW3A 1S9KC 3N1FC 4KKCD 2P5EE 3SE8H 4MD0A 3VGFA 4XAKD 4FZEH 2OR8A 1KJ2L 3TCLB 2ZZUT 3L9RA 4ONOA 2NXZC 3BH8B 5T1MB 1K4DA 1CFTB 3QUMA 2K7QA 5I73B 3RWIA 2VLJD 4U1KA 5JLZA 2EYRB 3R4DA 4FTVD 3WN5B 2YPLE 3WYRA 2E9JA 2GKIA 4Z7WE 5C0CD 4PJGA 1UZ8A 4D8PA 4TUKH 3QXUA 4ELMA 3UTSD 1YMHB 2RJMA 5D2LF 1GZPA 1U8MB 3T0EA 1GOHA 4F7CA 5DURD 2MPAH 1IM9B 2OXHA 4NQCD 3D25B 3LSOA 1P9MC 1LO2H 3N1PC 4BSVA 3TA3D 3V4PL 1TQBB 4GQ9H 5SV4A 5K9QI 4UILL 4U1HB 1XCQB 5CEZH 2GIYA 4L8DA 4G9DA 3MLVL 3WFBL 3O6FD 3DBXB 2P24A 1U42A 1Q9OA 4CVWA 3OJ2C 1CXFA 1T03H 2FO4B 4DVBB 3L3KB 4PRNB 5IB1A 4KHXL 3REWB 1JFQH 1MEXH 4OUOA 1LK3H 3IDIB 4JM2A 4Z78A 1IGCL 3NA9H 4ODSH 3QO0B 4HK0A 5B4MC 1JWMA 3SJVD 3RL1A 3MREA 1H3PL 4D9LL 1DUYB 1UEYA 3REVA 2CRIA 1RJLA 4LSDA 1AI1L 1EAPB 1MH5B 4NZRH 4EZMA 5TGBA 3T04D 2DQEH 2N1KA 1YNLH 1VPOH 4EI5D 4JRYB 1W0VA 4QTHA 4OI7A 1WLHA 1MFEL 1ZLSL 3HZMB 3QCTL 3RVUC 3VXMA 3BGMA 3IJHA 3ARVA 1M7XA 3G04A 4S2SB 3ULUL 1EX0A 2H1PH 5B38A 1HKFA 3V0WH 2GAZB 3EIFA 4OD1H 1GIGH 3SDAC 4PJ8C 4PGDB 2FECI 3BH9B 3CFCH 2DF3A 4P46A 1FDLL 5I1DA 4WUUB 4QXGL 5AYQA 3VFUA 1I9JH 2XWTB 3VA2C 1FCCA 5CBAB 4XVSL 3SJVE 5FKPB 2VXTL 3BUYA 5C2UB 1WIPA 4CNIB 3RDTB 1R3JB 4FP8H 5D1QC 4XXCA 1CE1H 4LAJH 5KG9B 4JPKH 3MV7D 3OZ9L 4PJFE 5IUSA 2BY1A 1C8PA 1MRFH 3FB5A 1SM3H 2JB5L 4ERSL 3NCYP 4P2QD 4QRTA 3HNTL 4JY6B 5DDHB 1AHWB 1P4BL 4PRIA 3O9WD 4YEEA 3KNBB 2IH3A 3DX6A 3UTTE 5KS9B 4NQED 3RUGB 4YFEA 4F7EA 2ZCKH 3WJLA 3OKMA 1DTUA 4HS8L 4FMFA 5I2IB 2FB4H 2IPUK 2F5BH 3FT2A 4ORGA 3GSUB 1EO8L 3F7VA 5EIQA 3UDWA 2X5PA 5L0QB 4YO0A 1QYGL 4WTZA 2VDNL 5B3JF 3HR5A 2DMBA 1ONQB 3FL7A 5SWQB 5ELIA 3ARDB 4WO4B 4Z7NF 3WSQL 2FATL 3NAAL 4LLDA 4BSWB 3QWOA 3MRPA 1LD9B 4LKXA 2Q8AH 1OTSC 4FG6C 5IBUB 5BZWA 5B21A 4Q9RH 3FT3B 3R1GH 1YNTB 1XGPA 2D2OA 5E6IA 5IEHA 4I0PB 3UC0H 5KJRH 3FONA 4PLJD 1WIUA 4QCIB 1IM9D 4R96B 2BY0A 1WIOA 3L5HA 4U0QB 1URLA 4XPTH 5IMOA 3H0TA 3T4YA 3WUWA 2JIXB 5FYJH 1Q9LA 3FRPG 3WHE0 5I9QB 2PO6A 2DWDB 3NCFB 1MCSA 2WANA 4YXKL 1FJ1A 2ADIA 1IQDA 3MLWH 1FVCB 1UB5A 3ZYIA 1TLKA 3S34H 5C09A 2YD8A 4GRWH 3QG7H 4WFHD 3HC3L 1FGVH 4PY8I 1A02N 1HXMA 1FNEB 1NGQL 2EIBA 4M1GH 1NAKL 1IILE 3JZ7A 2A83A 5DK2B 2H32A 4GAGL 1JN6A 4PJ5E 3EDJA 1O0VA 3U0PA 3IFPB 4HPYL 4JN1L 5SX5H 4Q7DA 1U8NA 2DQFA 3OKKA 1OP3K 3FT4A 5DJ8B 3GO1L 4HWZB 3LQZB 5D1ZC 1OQXA 3ET9F 4MD4B 4UT6L 4Z5RA 4TVPD 2WIIA 1AKJD 4XNQB 3ULVL 1MCJA 1IEAA 4FS0A 3HHRB 4I1NB 2XKNB 2VQ1A 7FABL 3IS0X 3D9AL 5DMKB 5IM7B 4ZTOL 1U8IA 1QO3A 3BJ91 5HHVL 1RZ8B 3E6FB 1I3UA 2AV1B 2NY2B 4DGYL 4CMMB 4I9WD 4XWGL 4FQ2L 5FCSH 2YD7A 5EBWB 3NFSH 2ED7A 3CXDL 1EFQA 2HVKB 1RJZA 4WUUD 4JFOA 5DSCB 5H35A 4GRLD 2HJLB 3BZ4A 5AAWA 4EQ3A 1JF6A 1AD0B 1G9NL 4KDTA 3RDTD 1G6RL 1MHEB 1T1WA 3WBDA 1I8LC 4GT7A 3V4PH 3K2UL 3KJ4B 2X09A 1RURL 4UILH 1I1FB 3RVTD 3F8UB 5F1IB 2IALB 2UUDK 3WFBH 2ICEA 4HIHA 1CVRA 3VRLF 1UVQB 2W9DL 3E3QE 1BEYL 2FECL 3BW9B 3LV3B 3LEXB 3S4SB 3HC0B 3RWEB 1QACA 3QR2A 2BSSB 5A16B 5CLWA 4KHXH 2YXMA 3L7FA 4RNRB 3D39E 5DHYA 4HC1A 1NEZB 4XB7A 4Q2ZB 1IGCH 1RZJC 1ZWIA 4JZJB 5DJ6B 3RY6C 1JWSA 1D5BB 1OVZA 2OCFD 3L95B 3P4LA 4ZAKB 3EYVB 1H3PH 4O4YL 3ARDD 2E3VA 4D9LH 4KJWC 2HTLD 5EIVA 2DM4A 1PDKA 4HS6B 3UYPA 3CVIL 1AI1H 2VIRB 5CGYD 4QRRE 5IOPA 2BOCA 2WBJB 3ROOA 2BCKA 2OR9L 1U91B 8FABA 3MGOA 1JK8A 4IJ3B 1MFEH 1ZLSH 1CFBA 1Z5LB 3QCTH 1MHPL 1CXKA 4MB4A 3FN0L 3KYOB 3ULUH 3L3HB 5E5RB 4BH7A 1VKXA 4TQEL 3OHXA 5DUBA 3EYUL 3VDAA 4DZBB 1PKOA 1A7RL 1OHQA 4IOIB 4NQDE 1FDLH 1KIPA 4LHQB 4QXGH 4S1DC 5HI3D 3VWJC 2IPKB 43CAA 2GTZA 4XVSH 3MRBA 2HVJA 2VXTH 5MEQB 5KSAC 4IS6B 1JZ6A 1S5HB 3OZ9H 3HCVB 4X6CE 3MCLL 3HZVB 4B53A 1C16A 2JB5H 3O4LD 4I0KA 4ERSH 1H9VA 2PXYD 3L5XL 5JIHA 2CRZA 1P4BH 4ZOCA 2P42B 1CE6B 1DQJB 4OZIE 5EU5A 5LGKA 1NDGA 3C60B 4WWKB 4QHUB 5HDOA 4KMQA 3TM6A 1G7IA 5GS1B 5C07B 5EN2A 4HS8H 2DI9A 4PRHE 1INQA 4U1GC 1PSKL 5C7XL 4RRPG 2DD8L 2MCG1 1MRDL 1FPTL 4H25B 4HF5L 3DMMD 4C56D 1EO8H 3R06A 1OB1B 3ARED 1QYGH 2H26B 4JFEB 1D5IL 4NZUH 2VDNH 3FQTB 4LLQA 4U4BA 4JFFB 2NY2D 7CGTA 5E4IA 3TBSA 5ISZD 2AK4B 2X7LA 5CIPB 3WSQH 2FATH 3D85D 3JV4A 1ZLWK 5MHSE 3NAAH 2YUVA 5I6XC 4W4OC 3PHSA 1UM6L 3AS0A 3TN0A 2PYEA 4PP1C 2R4SL 4F9PC 5CMAB 1U8QB 5D1ZB 4DOHB 5IHZA 4H0GA 4Y4KB 3VI4E 1BF8A 5I76B 5J0BA 1T1ZA 4HH8A 4KHTL 2AJSH 2GJJA 3MRCB 5D5ME 3EYOA 2EIEA 2R1WB 4X4MA 4Y0GA 4DKEL 1DEDA 4A6YA 3VD7A 2V2WA 4LLVA 2HFGL 2EDTA 5E2VL 5H37H 1QFHA 1F11B 4YXKH 2FD6L 4J4PA 3CXHK 4ODVL 4WW1B 5IB5B 5E9DE 4N90E 4OZHF 3QG6B 3U0TA 3GJEB 1XGQA 3RWCA 2X4OA 3HC3H 4PJCE 3HPLA 2KKQA 5DVNA 4I4WA 1NGQH 3BDYL 3SY0A 4KV5E 1NAKH 1NFDA 2NY3B 3V6FA 2XKUA 1J8HA 4ZAKD 2W1NA 4GUPB 4GAGH 4ZYKA 5LGJB 3DV4A 5DEGA 1T3FB 4ODUB 4FFWC 5EG6C 4F8QA 2VZ3A 4HPYH 1RZIB 4JN1H 2VWEC 4X0KB 4A6YL 5IJVB 1IGYA 2D31B 3GO1H 5GRZA 1RHFA 5EU4B 4E41A 3UBXI 3HA0A 1CFSB 4UT6H 3T2NL 2VDQL 3U7AA 4N0YL 5GS2D 3IETA 3ULVH 4L4VE 2QQQA 2DICA 3ZTJG 7FABH 3E0GA 3C5JB 2PTTA 5HDLA 5DTFA 1B4RA 2MFNA 4ZTOH 5HHVH 1EK3A 3VFTA 4NN5C 4DGYH 1G7HA 4FQ2H 4XWGH 5TDNA 4Y19D 3QDJA 2F58L 4ZUWB 3AXLB 3CXDH 1WF5A 1E27A 1H8OA 3KPLA 1ZVHA 4OTXL 2H32H 1U8PA 3LEVL 2DQIL 1WFUA 4J1UA 3OKEB 1NGWB 3SDDC 4OZGB 1ZA3A 4JY4A 2OQJA 1G9NH 5EO0A 2HKHL 1G6RH 1KIQA 3BPOB 4D0BA 1RK1B 4KGLA 2P7TB 2QKIB 3K2UH 4WV1A 2ZUXA 4GAYB 1KBGL 3BUTA 3RI5K 2IPTL 1M05A 1FNGA 1MJ8L 2LAGB 4IIQA 2W9DH 1BEYH 2YUZA 3FO1A 3BWUC 4MNQD 4LPVA 1OARL 4NN7C 4ZUUB 4CJ1A 1Q94A 1JPFB 4TTDC 1H3UA 3WNLA 1KT2A 1OAUL 3FRUB 3WS3B 4F2MB 4BM7A 5J1AA 2G75A 1XGRB 1ZHLA 4WHTA 4PJHF 4AENB 3W5NA 4O4YH 3Q6GL 2AK4D 5F1NB 2OSLB 3HG1E 4M7ZC 3CVIH 1HYSD 3OAZH 4F58L 2IQAB 1G7PA 4ZPVA 5TFSL 1KTKE 4WRLA 3RL2B 2OR9H 3RWGB 1Q9KB 4XBPA 2KBGA 1J0HA 1I9EA 2HYMA 4E0RA 5FO9A 3RBGA