1ACZA

Glucoamylase, granular starch-binding domain complex with cyclodextrin, nmr, 5 structures
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
108
structure length
108
Chain Sequence
CTTPTAVAVTFDLTATTTYGENIYLVGSISQLGDWETSDGIALSADKYTSSDPLWYVTVTLPAGESFEYKFIRIESDDSVEWESDPNREYTVPQACGTSTATVTDTWR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords GLUCOAMYLASE
publication title Solution structure of the granular starch binding domain of Aspergillus niger glucoamylase bound to beta-cyclodextrin.
pubmed doi rcsb
source organism Aspergillus niger
molecule tags Polysaccharide degradation
total genus 8
structure length 108
sequence length 108
ec nomenclature ec 3.2.1.3: Glucan 1,4-alpha-glucosidase.
pdb deposition date 1997-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00686 CBM_20 Starch binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1aczA00
3O2VL 5EPMA 4CKVX 5I76A 1BQLL 3FFCB 1PG7H 1HHGB 2YPLB 2ATPA 4KAQH 4HH9B 3QDJA 4KXZI 2JCCA 3QJHA 4HXAL 1GC1H 1FV1A 2YN5A 3S8WA 3MUGB 2GEEA 1QRND 4JPIB 3SJVA 1YN7B 3CFKA 2PO6B 3I84A 1E4KC 3DNKA 4GRLC 4NWTL 5L2KD 3D3VE 3OAZH 4M6AA 3OMZA 3V0WL 2EXYC 1UQSA 3RNKA 3VFRA 3B2VL 4JHZA 4LGPB 1AXTH 4P48A 1ZA6A 4BK5A 1KTLB 1RZ8B 4ZS7H 1CE6A 1M7DA 1YDPA 3MLUL 1OT1A 3WL9A 2XT1B 1QNZH 1GGTA 1RUQL 2XTJE 4HS8H 4XAKE 4FMFA 1UWGL 2WUCH 3QXAB 3EYFB 4H0GA 4PJ8A 1DBKL 3MOAL 4F7PA 4JPWH 2Y06L 4NQVB 4Y5XB 5DJ6A 3EOTH 1LP9A 4ODTL 4ZD3H 2Y23A 3FRPA 4XXDA 1OQOA 2E7BA 4O2FB 5KJRL 1BMGA 3QQ4B 4A2MA 4G8EA 1K6QL 2NY6D 3C60A 5HPMA 5IJKC 3EDDA 4P46D 3O3UN 1TXKA 1HOCA 4DUVA 2X4SA 4H88L 4IS6B 1T03L 3KXFD 4K9EC 4XXCC 1BZ9A 2VLRD 5IB3A 2HRPH 1K4CA 5E95B 4ALAL 5DJ0B 1ACYL 1FG2A 3BKCH 1KPUB 4AYFA 1ZOXA 4TVPH 1INDL 4AL8H 2E3VA 1BLNB 5I1DB 3AB0B 2I27N 1V3KA 2R2BA 4YHNB 4BZ1H 1MJ7L 3NN8A 3PGDA 1OCWL 2AP2A 4HUWA 3MLRH 1BIIB 4LEXH 3WXVL 2IQAA 4M7KL 4JZOA 4U0QB 5A16B 4XPBH 2AV7B 4J2XA 2HKFL 5DDHB 4WU5A 4PRHE 2CLVB 3BMVA 3S4SG 2K1MA 4ZOBA 5INDB 3WFDL 4ELMA 4MX7A 1FDLL 5CZKA 1P9MA 1H5BC 3WLBB 1GYAA 4Y1AD 4R0LA 2PTTB 1F90H 3PWPB 1MFBH 3H42H 4Q9BA 3LN5B 1M71A 4XVTL 4S1DD 1KENL 1FNLA 5L8LB 4NZRH 3HC0B 2NTSP 4MZ3A 1G7HB 5C0BD 3VGEA 4JGMA 1DQML 3KPSB 3HZMA 3IDNB 2L0DA 1W8NA 1NBZB 3OG4B 1BEYL 1QSFD 4WDIA 4NYLA 1IGFH 1JI1A 3G5ZB 2ILLA 3MOQA 3W0WD 4J1UA 5DR5H 1RK1A 1J1PL 2ARWA 1ZHKB 4YIQB 5D1XC 4POUB 2C4XA 4RGOH 1ULVA 3B3IA 2VWEC 2XA8L 3T0DA 1CD1A 4MXQD 4CJ0A 5E9DB 3BKYH 4M6OH 3P4MB 2IFFL 3WHXB 2KBGA 4H20L 3O81A 3U7AA 2Z9TA 2UZXB 3GHEH 2DQTH 3MRNA 3U79A 4HJJL 2O93L 4LPXA 5GISL 1T04A 4UTAH 5C8JA 1E4WL 1E6JH 4M8VA 1ZHBB 3PGCA 4NGHH 3ZDXE 4RMWA 3I2CH 5HDBF 5IMOB 4NN5B 1YEHH 4LVNB 5JORA 3R8QA 1CT8A 2YD4A 4XCEA 2FX7L 3QQ3B 4I8DA 4JFFD 5F97E 4X4ME 2Y5TB 1K2DA 1IGML 3LB6C 2VB5A 3CK0H 4FQCL 3NPSC 1V7MH 1UM6H 2FBJL 2VDNL 4S1RH 4UDTA 1VEMA 5IMMA 3HCVA 1B2WH 3FQTB 3QQ9C 4JFDB 2JIXD 4UAOC 3BGFB 2B20A 5GIRA 4ZFFA 3BP6B 2FRGP 2I9TA 4XBPA 2VZOA 2VZ3A 1I7TA 1OL0A 4W68A 1KXTB 3QYCA 4FZEL 4BQ8A 1FYTE 4I0KA 5EB9A 4PP2B 5C0JA 5E8EA 3KVQA 1FFOB 1KIUA 5C0ND 2ZKHH 4NHUB 4XH2A 5E2WH 2DN7A 4LVOC 2IBGA 2A6DA 4PGBA 4OLXH 4K3DL 4TUOA 1WCBA 4HIJB 2BVQB 1UCBL 5I18L 2CRIA 4O5LL 4JFQB 3MRMA 4ONGL 5DHYA 5SV4A 4HIXL 4OLZH 3WXWL 5L6YL 3PQYD 2PKDA 3T3PF 1A1MB 3N1GC 3U9PL 2GKIA 4KXZH 3AFLA 2VDKH 2GT9A 4U05A 5C07A 4KKNA 3T2NL 1VHPA 1U2HA 2W07A 3HS0A 3LMJH 3KNBB 3HFMH 3T77A 4LEOB 5FV2A 1FH5H 3FQXB 4P3CH 4KHTH 5BZWB 4XVUC 1NMAL 4HIIB 1UYWH 3FT2B 2QKIA 4HV8B 2DQDL 3MROA 32C2A 4JAMB 1WIOA 3T04D 4KI1A 1WIUA 3TPUB 3AMKA 1U8JB 3UTQA 2EE9A 1U36A 5EC2B 4Y4FD 1N4XH 1UM4L 4DZBB 5EU6D 3P73A 4DCQB 1A64A 4LPUA 4KUCF 2EH8L 1YEJH 4JJHA 4PV9A 3S37H 2OR9H 2Z35B 5DJ2A 2HVJA 4NNPL 2AEIT 1FHGA 1YYLH 5F89B 2NXZC 4OCSH 3RY5A 4YR6B 3OKLA 4BZYA 3N1PC 4Z76B 3QIBD 4HS3A 4C4KO 3MFGB 3KPRE 4BUGA 2MCPL 5T3XH 3QHFL 4H25A 5DD6B 2R69L 3VI3F 5IG7A 1MRFL 3FMGL 3TYGL 1OGAD 3AS0A 4MA8L 2R4RL 4N8VB 4HPYH 1N64H 3KR3H 2J8OA 4H26A 4EI5D 2YRLA 5E00B 2BNQA 2FL5A 1A6UL 4JVWA 4OFYA 4HG4K 5JZ7D 4NQXA 3LRSB 1HH9A 5C0GA 2NZ9C 4L8CA 3EYOB 4YDIH 5DWUL 1W8OA 5GS0D 2AGJL 4LLUA 5D2NE 4P23A 5JQ6H 4N90E 5B8CB 3L3DA 1EJOL 4G7VH 4RGNE 2K3TA 4C83B 4PJDE 5MEQB 1NMCB 5F6HI 4ZFOB 3UTSE 5ABDE 5KW9L 1JWUA 1HQRB 3H9HA 1ZLVH 3IGAB 4GRLD 4HX1B 4J23A 1IBGL 2DQFA 3RWEB 2JTDA 3RWCB 4MJ2A 2RCSL 2EXYD 1MFEH 2GFBB 4KMQA 1ZA3A 3DRQB 1DVFA 1F6AB 1NC4D 4I3GA 2F8OA 4NDMB 5IBTH 1WK0A 4N0CD 5JMRA 5KZCD 2X1PA 3OB0H 3RAJL 2OTUA 1UM5L 1WBZA 3G08B 1A0QH 1KPRA 2UY7A 3AAZB 1JFQL 2AI0H 1P6FA 2P5WB 3MGTB 5CEZD 4IJ3B 3CIQA 5HYIA 4M93C 2R56L 4UNUA 2YD8A 4AQOA 4XBEH 2QQQA 4OZHF 2OSLB 1VFMA 1DJSA 2DKSA 1RURL 3U36B 1ZWIB 4GBXA 4GRWF 3QEUA 1S7QA 1TQBC 4WO4A 4XB8A 3KLDA 2F5BH 5H37G 3B9EA 2VLJE 2LTQB 4YHIB 3RY6C 5FDWA 1ZT4B 3HPJA 4M8QA 4JRXB 1MCKA 4D9RE 5JLZA 1CZ8H 3ZO0A 2XQYK 5K59F 1YJDL 4XNQB 1QVOB 4IOFD 1FNFA 5DD1L 5BQ7A 2FJHB 5JOPE 5ENWA 1B90A 3VD5A 2DQJH 1A14H 5J6GB 2JJSC 4YXHH 1JL8A 4JLRA 1F11A 4X7DC 5F7MC 1IM3B 4QHUA 4DUWA 1KACB 3N85H 5BMFH 5LKNA 1R3LA 3PHOB 5E24E 3DSFH 5GS2H 2IMNA 2WUBL 5D72L 3Q3GB 5IV2B 2ICES 4XWOD 4E41A 3S36L 2XZAL 3MJ9L 4YDLB 4QXTB 1MCRA 5D7LB 4ISVB 3RY4A 1UGNA 4OSUH 1JNNH 3RHWF 2LAGB 2PW1A 5MEPB 4ONHB 3LN4A 1QQDA 1D5BB 7FABL 2QBWA 2F19H 4DVRH 4HC1L 3AS1A 1FN4B 5D1ZB 3DUSB 5E8DH 3JVGA 4Z5RA 1D6EB 5KVEL 1JIBA 4DN3L 5SX5H 1CGTA 1CE1H 4PJBB 1WT5C 3SKOB 2Y6SD 4MJ5B 5I19H 4P4KA 4W4NA 5E1HB 1OPGL 4UUJA 3CJJA 4XT1C 4GXUM 4YHMH 5F21B 3LD8B 4LQFL 4HF5H 4HAGA 4LCYA 4ZO6A 3O3BA 5D1QA 4HKBB 1UWXH 5AYUL 1JF5A 3WEXA 5JXEC 4C56E 4G8FA 1MIEL 2Q7YA 4G43A 2FIKA 2ICCA 4L8SB 1LWRA 5F72S 2Q8BH 2ZOLB 1RIVL 4NZDA 2BP3A 4M43H 1YEDA 1T1WA 2OZ4L 2MFNA 1XGPA 3GI9H 3E2HC 2CLZA 1YEKH 3JXAA 1PYWB 4WUUE 4I4WB 4EDXA 2VDRH 4OGAC 4LPCA 2COQA 2EDDA 2W65B 3M45A 4PD4J 5DK0A 4RRPG 3UYRL 1RMFL 1OAQL 4AQ1B 3LB6D 5CWSB 3KJ4C 2IADB 4OCYL 4MJ6A 3CUPB 1TJGH 3RQ3A 5FUCC 2AQ2A 2F54B 3MJ7B 5FYKL 3BQUC 1R3IL 2RIKA 4PJEF 3H3BC 3QUZA 4ZFZB 5EZLA 1GGIH 1VGKA 3QXDB 4YHPA 4Q9RL 3VXUD 1NC2A 5I1CH 4PBWD 3BRFA 1W0WB 2WWMD 3MO1B 3B9AA 4JDZA 5HYSA 4QOKE 3LKSA 5T33L 1I7ZB 5KVGH 2V7HA 3D3VB 5HGAB 4Z0XB 1NL0H 4RX4A 5FCSH 4ZOAA 1N5YH 3QIUC 4I9WE 4POYA 3TLRA 4Z8FL 2YBRB 4QY8A 1N7ML 1MI5E 3T8XA 5E08H 2BERA 3WNKA 4UINH 5FGSA 2D0HA 6CGTA 2XTJB 4UNTA 3ZE0E 5AWNH 3BIKB 5F88A 2KUTA 1KLUB 3QUXA 3QJFA 1IGCL 1CFVH 5D6DA 2FECI 3CAFA 2BC4A 5DRWA 3CMGA 1G9EA 2G5BB 5GGTL 3ARGB 3MRHA 1AR1C 3VFUA 5J9PA 3TO2A 4OBRA 2HKHH 4KJWC 3HE7D 3W39A 5BVJB 4F3FA 1R3KB 2AXGA 4DKDC 5FDYA 1FNGA 4JG1H 3C09C 1GSMA 1JPTH 5I0ZA 1F4YH 3BT2H 1A3RH 4U6XB 1KCVL 4BH8A 4V1DE 4CU7A 3VXRD 4OF6A 1KYOJ 3HR5A 3T4AA 2D7OA 1EEYA 3MX0A 3BPNC 4ZAKB 4K7PX 4AIZA 2DLGA 5IMKB 4D9LH 3FCTA 3J7HA 1K8IA 1DQLL 4PJ9A 1AIFB 3MBEC 3D0LA 4PRHB 1IAIL 4K3EH 3CVIL 2NY2C 5F1IB 1RZFL 5JTWA 2WIMA 3FO0H 4KTDH 2ZSWA 3CFBA 2FGWH 1OSZA 2CIIB 5E6IA 1PGRB 5HYJA 1U8OA 3D25A 3HI6H 1RZIB 4H1LG 3QWOA 1K4DB 4P59H 5HHNA 1I9RL 1JZ8A 1H3GA 2XFXB 1AI1L 5FFLA 2QL1A 2X4TB 4GAGH 3CCHA 1BGXH 3BZFA 5JDSB 1RIUH 4EUPB 1L4IA 1QSED 1T3FB 2H6PA 4U2ZA 3TBWB 5IQ7L 4PJGB 1UACH 1MCDA 5GGVH 1E27B 1JZ5A 1TTGA 2CQVA 4JN1L 1GC1C 3SCMD 5L7XH 3I6LE 3T0VA 2SEBA 3BOVA 3VE0B 4BH7B 1TZHA 3BKML 4OD1H 4OLYH 4JKKA 1EH9A 4E0RA 3MGOB 3GGWA 1MFAL 1QR4A 1KJ2B 5DRNB 4WRLA 1EBAA 1DN2A 2ADJB 5ESAA 4L9LC 3KHQA 1ES0B 4U1NB 2AEQL 5I8CB 1A02N 4IIQC 3WFEH 4HKXA 4QXGH 1YMMA 1AGDA 5DTFB 5KOVC 3FN9A 4X6DF 4PJ5D 2JB6B 2BSSA 4HMCA 2AS5M 5TPWH 5CILL 1PX4A 1LEIB 2LAAA 1R3JB 4UDUB 3EFFB 2VDQL 35C8L 4CW1B 1IAKA 1FORH 4TQEH 4X7SH 3TBVB 3ZDYF 1BVLA 1MAMH 4EXPX 2PCPB 4FRWA 1VFUA 4J6RL 1GAFL 3W9EB 4PJAE 2QR0A 2J88H 4LLYB 3O3EA 1ZLSH 4L5FL 4UV7L 1TDQA 4WUKH 5J11C 1QFOA 1S7XA 4WFGE 2HTLD 1HDMA 4J4PA 4ZXBA 2EZ0C 1NKRA 1FYTB 4ODWA 4IMLA 2ZUSA 5BV7L 1CVRA 2OR7A 1U8LB 3FTGB 4I1NB 4CVZB 1ITBB 2HLAA 3VXOA 1RY7B 3H7BB 5E2TL 2R0ZH 3O11A 4MXWL 3L5XH 1IE5A 1NFIA 7CGTA 3WIFA 3O2WL 3G9VA 4NUJA 4U1SA 4WFFE 5IW1A 5J1TC 2VLKE 3BN9C 1MPAH 3H9SD 1CWVA 3PL6B 3SGDH 3P3YA 3S34H 4M00A 4XP1H 4AEIH 2XKSA 3ARZA 4G3YL 3LQAH 3QCVH 1WFNA 2WBJB 5C0CD 3GM8A 3I9GL 3DUUA 1L9MA 2OQJB 1FNSH 4RNRA 4RISL 2OYPA 4NNXA 5D8JH 1AGBB 3BZEB 1NGWB 2BRRL 2CKBA 5AG8A 5ILTH 4FXGA 2OMNA 1PG7X 3ULUF 4DAGL 5C09A 3A6CL 2FR4B 1N2RA 4XMPL 4YXLL 4LF3A 3ECBB 5EUKA 3BKJH 3F62A 2NW3B 3IDMB 1UZ6F 2J8UA 2OTWA 3KPNB 5HVFB 1IT9H 3CFDB 1JNLH 5F7HA 1KIRA 5EOCL 1ONQB 5F6HJ 5JXED 2YC1B 5F7YC 4PJ8C 4A6YB 4DQOL 4NRYB 4KK8C 5DD0H 2X9YA 5EBGA 5IGXH 5CSZA 3KPRB 3ZTJG 3ZHKA 3QEQD 3FO9B 5BRZE 3MRQB 4UIMA 5GZOD 4LLQA 3VXMA 4HSQA 3ULVH 4OD2B 2HVKA 4QXUH 5KSAA 5I8EB 1KTKE 5E2UL 1X6NA 1YY9D 5F7EH 2B4CC 3S4SA 4GQ9L 1TTUA 4FTVA 3ILQC 3CC5B 5ESQB 4RCAA 1CGWA 3STLA 3BQUD 3CFJA 5I15H 2P4AB 3MRCA 3D48R 3DRTA 3HG1D 2VXSL 1GH7A 5D2NB 5I16B 3O4LE 2ZCKH 4RGNB 4PJDB 3UTSB 3I75A 5K9KA 2IANA 1P1ZB 3IJYB 3ZYZA 5EWIH 4HGKC 4Z7WE 3C6LB 3QO0A 5KSVA 4NKIH 5DLML 1ND0A 5DUPH 1NMBH 1DUYA 1Z9SA 2AK4E 1TIUA 1Q94A 4FQJH 3BSZL 1BBDH 5HYQB 2BDNH 1B4JL 4M6NH 1ORQA 4W70A 5CJ8A 5I74C 4K2UH 1HYSC 2XNAB 3T65A 1YEFL 1VEPA 4R0LC 1OF2A 3V0VB 3HNVH 1PKOA 4X5LA 2HYMA 4RWYH 1ZS8A 5ISZE 3IXTA 2DI9A 4UV4L 3F7YA 1Z6JT 2O5YL 4H8WL 1KTDA 3VFOA 2FYYA 3HAEB 5LGJB 4HKZA 5C86A 3FT3A 5DQ9A 2R4SH 1WICA 4J3OC 1S9VB 1T80A 2CKBH 3Q0HA 1K8DB 3GSVA 1BF8A 4YBQC 4BQCA 4R4FH 1Q9KB 3T4YA 4KJWD 4FABH 4JR9L 5JNYB 2W92A 2XI9A 3TO4D 1DQJA 4RZCB 3GSQB 4P9HH 4AEEA 2FLRT 3PWVA 1JWSB 2VLJB 2FSEA 3E6FA 1H3UA 4GS7C 2VE6A 4JDVB 4U0RC 5A1AA 1MREH 2VQ1B 3VFGH 4HUXB 3FB6B 3NFSL 2H32B 5CKGA 2ESVA 3MNZA 1HNGA 4ODHL 4XP9L 4NJ9L 2VITB 5E8NA 1T0MB 4G9FE 2APVA 4WWKB 1Q0XL 1T1XB 3P9MB 5LGHL 4TYUA 3GMOA 5I8OH 1NAKH 3GJEB 4K7FB 1HIML 1JGUL 5EIIB 2P42B 2BCKA 3EOAA 3U7WL 1U8PA 3IVKB 3RFZC 3NCYS 4RFNB 2KH2B 4G6JL 3ZLQC 4X0KA 3LKPA 4F58H 1FAKT 4QRTA 4Y5VA 4JQXA 3N1MC 2ADGA 4KI5C 2QADD 1GJIA 1FCGA 3DMMB 4TSCH 4WEUD 1NDGB 4PB0L 3JV0A 2YK1H 3QA3B 4JZJB 3RI5K 4XC1L 4PJ7E 4BFEA 3F7QA 1T7VA 2X1QA 4U1KB 1T7ZA 1T7XA 1DUZA 3V4UL 3CZJA 5I9QB 1AQKH 4Q2ZB 3OAZK 4PG2A 1IC7H 1P2CA 3CVHA 4WI6A 3E8UL 1JF1A 5TF1H 3VGHA 1MJ8L 3ARDA 4LSTL 3P11H 1PBYA 4YC2B 5J1AA 4QRPD 1NCDL 5LWYH 5HDQH 3BDYH 3OJ2C 2EEDA 4S1QH 4XWGL 4C56B 4KKCC 3WCYA 4PYHA 5D71H 5CZVH 1C16A 2R1YA 3AU1A 1MHHA 4M4RA 3X11A 1U8QB 3LKOA 3DYMA 1AHWB 3MOBH 5TE6L 1ZT7B 1CBVL 2XWJA 4FP8H 4PJXE 4WUUB 3WKNA 3BFOA 3MACL 1A6PA 3WJJA 2G60L 4IMKA 4NIKB 4KKBC 5FA3B 1FZKA 4NN6C 1N6QL 4ZMAT 4WI9A 5LJYH 2PXYC 1D5XB 2W60A 4OCNC 2AJSH 5FF6A 2DQGL 1EIBA 2HH0H 2H41A 2VL5B 2QQKH 4OFPA 2W9DL 2MTPA 1G9NH 5GSRB 5F7DB 2G2RA 2RGSA 4TVPD 5T1LA 4G5ZH 4QOKB 1S3KH 4FNLH 4OCWL 2FZ3A 5JW5A 2E9WA 4Q6IA 5EBLA 4LKXA 1LEGB 3QFJE 3S37X 4Y1AE 5IOPA 1MCBA 4OZHA 5IB4B 2PYFB 5I1AA 1VGEL 4GW1A 4LHUB 4R96B 4R6UA 1A9BA 2X4QB 1MI5B 2BY0A 1IGTA 3L3OB 4MJIA 5EH1A 1L7IL 3IETB 5IBLD 2EDOA 3BWUC 1IGJB 5FKAA 2CJUH 4HXBH 1G7QA 4YPJA 4K23H 1FPTL 2HWZL 1IQDB 1V5JA 3KWWA 3LS5L 1WVZA 4HHAB 1LO2H 1VFAA 3QH3A 5JIIA 3SE4A 2D7PA 2P7TA 5SWSA 5FO8B 1T1YB 3LEXA 5C0FA 3SDYL 4HQQL 1FP5A 3QDJD 3UJTH 5K9OA 1CF8L 3CVHH 1PLGH 3SJVD 5IT2H 3K3QA 3PP4H 2JB5H 2OK0L 1H15B 2P5EA 3GUTA 3M17B 5CHNB 3MCLL 4JFOA 3FB7B 1RK0A 2JK5B 4LRNH 3GIZH 4ZPTA 1HCVA 1JGLH 2NQCA 5BJTB 4NOFA 4V1DB 1DVFC 3QUYA 2AERT 3WNLA 3IDJB 3DVNB 2JKXA 3CLEL 4JFFE 1NLBH 2NX5A 1WQVT 1GOFA 4IRJB 1AE6H 3EDJA 3UTPE 3VGAB 4LQ1A 5L0QC 4PJ8D 1Q9WA 3ZSSA 4TSAH 5HVGB 5K9QG 2MMXA 3TCXA 1AGCA 4Y16C 1LK3L 3QB7C 3G6DL 4KK5C 4M7JH 1EFXA 3OPZH 2Q6WA 3VRJB 3UDWC 4KJQC 3C5ZB 1SM3H 3MNVB 3C60D 4UILH 3LOWA 1F3DH 4HWZB 4YFLI 5HJ3A 3Q2CA 4GBXC 5I1LB 2A77L 5GS3A 4GLRI 1FZOA 1AC6A 1HZHL 4FXKB 4HULB 2VL4A 5HHXL 4P2OA 3UJJH 1FE8L 4PS4H 3TZVD 3C08H 3IDUA 3WFHA 2OXHA 3BYYA 1I3GH 4P5MB 1F3JB 5IFHH 5E5RB 4YK4C 3RVXD 1I7RA 2A73A 3Q1SH 3BD5A 5F9DC 4LCCB 4EN3A 4MDJB 1SMAA 3I02A 4DTGL 3PQYE 4GRWH 3QNXB 1J5OL 1F4XH 2EDKA 2R0KL 3L7EB 2CLRB 4WGVB 5DUBB 4OV5A 4L4VE 3AROA 3NFNA 1HYSD 3M1BA 4I18C 3OHXB 3QEHA 1YPZE 3MLSL 4PJEA 4EOWL 2G9HA 1A6TA 4LP5A 3ZKSD 4Y2OA 1KC5L 4IHOB 4Z7VE 4U3XA 2WINB 3KYMA 5TQ2L 5C0RL 3FOLA 2BSED 3MLYL 4NO3B 2R0LH 3LAFA 4P2RE 2W9EH 1YEEL 3SE9L 4U31A 4OB5L 5IF0B 2E8ZA 1DANT 1H3XA 4Z77A 1GZPA 4DUXA 5HHPA 3UZVB 3VWJC 4PD4K 1OTTC 1CD9B 4OUOA 5DHVB 2GCYA 1YMHA 3W81A 4PJBF 1OM3H 3I3BA 1U8NB 3BGMB 3TM6A 1F58L 1JPFA 1MLBA 2KZ1B 4P4KC 4PJAB 1WFUA 5H2BA 4RRPA 1YECH 3R8BB 5AD0A 1X44A 1MEXL 3VD9A 5MEOB 2WLYA 1NDMB 5E2JA 4CVUA 5D1QC 1J1XL 3QPQD 5H37H 3L5HA 1FL5A 4GUPA 2NNAB 1ZVSA 5FHAH 1U3HA 1EFQA 3BWAB 3HE6B 5HI4C 1CDHA 1BF2A 5C0IB 5I8KH 3U4EB 1I1YB 5ESVB 1R24B 1D5IL 1QPXA 1I8KB 3V6FB 4E42A 2YPVH 2VOTA 4FQIL 3QG7L 2XZZA 3VFMB 3MRJA 4F9PA 1QSZA 3LSOB 4Q9QL 3HMWL 4YPGA 3SQOH 4Y2DB 4L3EA 1OARH 4F8QA 2VLKB 2A83A 1SEBB 2AABH 4HIEB 1DBAL 4UB0L 3ALPA 4LFHG 4K71B 3RUGE 2DLFH 5EG6C 1F45A 2IGFH 3D2UB 3X13A 3QNZA 1S7VB 3QUZC 4AG4L 4WTZG 3GBMH 3JZ7A 1KLGA 1CICC 1JPGA 3KGRA 5JR1L 3HPLB 5E6ZA 3OKMA 4LLWA 5KVDH 2ZPKL 2UYLB 2EDQA 4ZDHB 3QIWB 1ZLVK 3U83A 4OGXL 3RVUC 5F3BB 4OQ1A 1UB5B 1TJIL 4XNZC 4QHLA 4R90L 1HHIA 5D93B 2CR6A 2FIRT 1KYOK 2WW8A 4G8IA 4M6ML 4RFEA 2XPGB 3U9UA 5ALBL 1J9CT 3FO1B 4WEBH 4XGZA 3X12A 2IQ9L 3EKCA 3SDAA 2A9NH 1EZVX 4K8RL 2WQ8A 4JFZH 5GGRY 5GPRA 3QUXC 3GMMB 5CEXA 5C07D 3DIFB 4O4YH 5INCA 1RULH 4ERSH 5BRZB 4YO0B 4HUMB 3GKZA 3MV01 3CX5K 1DTUA 5HHOD 1WF5A 3RVTC 3BP5B 2UVFA 1Z0MA 1KBGH 3EYSL 4QRUA 2ZG1A 1MJJB 5ICZA 1H8SA 1DBJH 4X6EB 1N6VA 4KKBD 1NEUA 3OL2A 1S5IH 4PRPE 5DJCB 3RU8H 3O8XB 3FRUB 1JI2A 3BP7A 3G6JE 4FQHA 1RUAL 4EUPG 5DJAA 1X5IA 4O58H 3IJSB 4PPTA 5CJQH 2EYTA 2YD2A 4H1LA 1KJVB 3O4LB 4F7MB 3NAAH 2F58L 1OOAA 3OQ3B 4YAQA 1X5FA 2OL3A 5FO9B 1QEWB 3RL2B 1M4KA 4Z7WB 3X3FH 4GG6E 4Z0BL 3IFNH 5JHLH 5DVKA 4GLRH 4JG0L 4PJ9C 2IAMA 4OCRH 2AK4B 4M5ZL 3DROB 5IVNA 1H0DA 5MHSE 4N0UB 5DQJA 2BFVL 3TN0A 4E9LA 4ODSL 3OR7B 3BZ4B 4RMQA 3KPMB 1UZ8A 5KSBA 43C9A 2FB4H 3KJ6L 4KZDH 1F3DJ 3B9KA 3O6FC 4ODUB 1XR9B 4XP4L 3O6KL 2I5YL 1YEIL 2Q20A 4PLJD 4LASL 5ISZB 2PYEE 3B5TA 1ORSA 2C7UA 5EU4A 3RZWA 5HGBB 2BNQD 3OXRB 1TVBB 4F7EA 1UVQA 3TT3H 2VDOL 4OFYD 3L3HB 1U3ZA 2AK1L 2MPAL 1G7IA 5DURD 1TZIA 4JO2H 1VSCA 2VWEE 3OKYA 4RIRB 4P23D 5IK3B 3BUYB 3ROOB 5IJVB 4MAYC 1IRAY 3KLAA 3SDXA 5DJ8B 4H0IA 1EEUA 3A6BH 5GGRB 4FFYL 5KBNC 1CFNA 2EDRA 2C1OB 1YY8A 1YNKL 1MNUH 5HI5C 5CKAA 2BX5A 5JA8B 5ANME 1UWXK 1NH6A 2WSKA 2ZUQB 4U1JA 4ZPVA 3LY6A 1HHGA 3ZDXF 1KELL 3TIDA 1X7QB 5SWZA 5I1JL 4PJCE 2ARJQ 1K9TA 4JPVL 3MUGA 4JPIA 1YN7A 4U3HA 3RGVD 2PO6A 4G9FB 1NFDA 3IAGC 1L7TH 1OQXA 4I2XE 1G7MA 5HGDA 1QBLL 5E7BA 2AEWA 4KK5D 3ULVC 4PGCB 5T5FH 4KJQD 1FC2D 2XIDA 4J3WA 1E28B 1SMOA 4XMLL 4UT9H 1I9IH 4HGWA 2YD6A 3D0VB 3UMTA 3THMH 3U0WH 4WO4D 2Y4SA 3OKOA 4BSWB 3QXAA 4OT1H 1QFPA 4H1LH 4O51B 4NOBA 3GO1H 4LSPL 4HJGB 4N0FA 2VH5H 2Z8SA 4Y5XA 1A22B 4J4PC 4MYWB 3MODL 2JF1A 1CLOL 2OL3H 1OAKL 5HGHA 2P8PB 1ZLWH 3QQ4A 5GRVL 2VO5A 4U1IB 5FUZH 1A6VH 1QLRB 3STBA 4MMXC 3BO8A 4MA3B 4LGSB 2DJUA 4ZUSB 4R2GD 3ZKNC 1EO8L 3BZDA 4IS6A 2X4PA 3OJDA 4DK6A 5FYLD 4D0BB 2AXJA 5CJXC 2VLME 4P4RA 1S7TA 3I85A 4KHXL 3TV3L 1B0WA 4GO6B 2R2HA 5GRUH 4ZO8A 2CRZA 1UB6B 1IQWL 1BLNA 2NY6B 4NHCH 4WENB 5DYOB 4E41D 4YQXL 3G6AB 4R7DB 4P46B 1BD2E 1P4BL 3N50A 2EH7L 1A3QA 4ZOEA 3BH9A 5H94A 3RTQA 2F5AH 4F9LC 2VLRB 4TOYL 5ADPH 4XNUL 1A7PL 2AV7A 1TJHL 4PJXB 3V4PL 3WFCL 1OAYL 1OP9A 2CLVA 2FATH 3BGAA 3MUHL 2XWBB 3DVGA 3VXRE 2GIYA 2YUVA 5F9AC 3VWKD 5FK9B 2APXA 1VACA 1I9JL 2YHGA 4FOMA 2DQUL 3QCTL 2NZIA 4P9HC 5ID1A 3CGTA 1KCKA 4MNQA 1HKLL 4OLWL 3DVIA 4G7YL 2J4WH 2V9TA 3GSXB 1RZKH 2O5ZL 4TSBL 1MUJA 2GJJA 1P4IH 3BDXA 3L3IA 1OAUL 2Y7QB 4Y5YC 5HGGS 3QFJB 4Y1AB 1Y0LA 1SBSL 3QNYB 5DC9B 3IFOA 3IAPA 2XXCB 5EOQH 4PJHA 4U7MA 1HEZB 5C0BB 3R06B 2I25N 3T0EA 5EO0B 4DEPC 3JWOC 1LDSA 5KSAC 5E9DA 4KKLC 4G8GE 4PG9B 2MHAA 4LDOB 1J0JA 1HN1A 2MNUA 5F9WB 3O41B 1QSEE 4MVBC 2ZWLT 5D6CB 1BFSA 1B4RA 3V6BR 1UFUA 3HAEG 4I48B 3D85B 1UA6H 3Q6FB 4ZYKB 1Q9LB 1GPOH 4FQ1L 3VFPB 2X4OA 3QUZD 4J3TA 1B88A 4PJDF 1BQUA 2IG2L 4APQD 1NC2D 1KT2A 2Y07L 1DBMH 3VXNA 3QDGE 1G7LA 1MVFA 1XGTB 1JMXA 5GGSA 1J12A 2NXYD 3FQTA 4RX4D 4LU5H 1KXQE 3MV8A 3MYZA 1YEGH 4XCCH 4JFYA 3AREA 3WNPA 4YHKL 3DVFA 4Z6AT 3G5VA 2I9LB 3ARBB 4GAYA 5IFJA 4JFFB 3CD4A 1UJ3B 1VADB 4P5TA 1NCNA 5T3ZE 2UVEA 1MIMH 3D39E 1RZJC 1A7OL 4E5XA 6FABL 1C5DA 2N56A 2NLJA 3SHSA 1S7UB 3QUXD 1WCQA 3BI9X 4ZUVB 2JIXB 2VUOA 3C6SB 2R39A 3CFEB 4JN2A 4WHTB 1N8ZB 4NHUA 4ZOCA 5DGRA 4HK0B 4HW6A 4ZNEA 1ZTXH 4CN1A 5JHDD 5I75C 4LDEB 3ZZ1A 3V52L 3IDYB 3V7AE 3ZTJH 4XCFL 1I85A 2AXFB 3K2MC 5ICXB 4X4YA 3TVMD 3RVTD 1MQKL 3DX6B 2DM3A 4R4BB 3DGGA 3MUZ1 4JFQA 5JOEA 1DDHB 5BS0E 4R97C 3NIFE 5CIPA 4Y4KC 1A1MA 4OLVL 2QSVA 3NCBB 1P53A 4MHHG 2YZ1A 5ETUB 4HAFA 1U42A 1NCBH 5FM5M 3ESVF 4QHMB 2VDMH 4OIAA 4LEOA 3VMOA 1AQDB 3X14A 3PJSB 1NCAL 1WC7B 2XV6B 5BZWA 5C0AD 5JPMB 1BWMA 3FT2A 2ZCLH 3IU3B 3B6SB 3PQYB 3E1F1 4JAMA 3H9SE 1JBJA 2ADFL 3IU4H 4HS6A 4HBQA 5D7KD 4PJ9D 3TPUA 1U8JA 2VZ1A 3E0GA 4H0HB 4AEHH 3OXSB 4L4VB 1KEGL 2CDEB 2Q8AL 1XF2B 4D3CH 1FBIL 3P77B 4DZBA 1YPZB 1FLRL 2ARJB 3BHBB 4XPTL 1QA9A 1ERNA 3C87A 1RZGA 1D9KA 5JUEL 2Z35A 4KRMB 5E6ID 1JGDA 1CGSH 4Y5VC 2VDLH 4Z7VB 4HIHB 2BY1A 2IBZX 3QO1A 4EIGB 2BOBA 4DVBA 5DK2B 3JV5A 3HI5H 5JOFB 2A74B 4Y4FB 1AXIB 4K3JH 3D9AL 4KK6C 4UQ2A 1RHHB 3DX9A 2EKSB 2Y36H 5EO1A 5FYJH 4PG2C 3DURA 4NBZB 3LEVH 3WIHL 5E4EC 3ARDC 1AGFB 4MA7H 4Z7NE 5K9QI 3WLWC 3QIBB 1EMTL 3EYOA 3WHE0 4EI6A 1RD6A 5EBWB 5IB1A 1INEH 1FVDB 3OX8B 2H3NB 1RZ7H 5LXGH 2YN3A 3RX5A 4K94C 1FFNB 4M03A 5MEQA 5MENE 4DGVH 2DMKA 5BXFA 1Z2KA 4XNMB 4F8TA 1JYVA 1I4FB 3ZT7A 1KN4L 1CL7I 5JPNA 4EI5B 4NKMA 3RA7H 2L7UA 3U1SH 4HX1A 3WJJC 3VH8B 3RWEA 3QUML 3PV6B 4X9IA 5FUCE 3DSNA 1V3JA 4M1GH 1QRNA 3RWGB 4JFXB 3HG1E 3ULVD 1RFDL 5DEGB 1MFDL 3MR9A 5CIPH 1CGYA 4MD0B 1DZBA 3GNML 3RUGB 3VA6A 5L2KA 4GJTB 4NDMA 1VENA 4IRSA 3MRIB 4I5BA 1I8IB 4BZ2L 3BJLA 4GH7B 1HSAB 4LPTA 2ADIB 4ZUTA 2DTML 2VABB 2VXVL 1MCPH 4WV1C 5C3LD 2VLLB 3AAZA 4Q0XH 2YSSB 2H1PL 3ARSA 3MGTA 4GRLB 4AM0A 1LDPL 5DD5H 2X4UA 5CJOH 1KIQB 4NP4L 1XF5B 3IDGA 1NBVL 4Q6IC 4GQPH 4LMQE 4ZXBD 3NABL 1NC4B 2OSLA 2YD1A 2DQEL 4D9QE 3U36A 4G80A 2WQRA 5KZCB 1CFQB 5B38G 2BSRB 3UPAA 3WKML 3K0WA 5FA4B 1DQDL 1H3PH 1LO0L 4Y19E 3BE1L 4JHWH 1NGZA 1QYGL 1Z5LB 4OZFB 5CBAB 1N6UA 1LE5B 2ITDB 1ZT4A 4R7NB 3ZYIA 3ZE0F 1CR9H 5HTSA 4HWEL 1HXMB 2FJHA 3EZ8A 1F4WH 1LNUB 1S7WA 2W0KA 5DVLA 4GKNB 4UIKH 4KUZL 2UY6A 3KYOB 5CP7B 4FFWC 3VI4E 3QDME 3LPFA 1U9KA 4HFWB 4LAQH 4NC1C 2NMSA 3EJZC 3L6FB 1HILB 3NTCL 3PHOA 5E8PB 1GGCL 5FO7B 3VG0L 4PRPB 5C09D 5I2IB 3UBXB 3SE3A 1S9XB 3G6JB 5IHZA 2E27H 5AZ2H 4QWWC 5E5MB 3WNOA 4NCC1 3L3KB 1XGQB 3L95A 3QUYC 5MEPA 4ONHA 4NKOB 1D5BA 5ERWB 1JHTB 3MZTA 4HUUB 5ADOL 1I3VA 1BWWA 1E6OL 3MZGB 4ELKB 3JV4B 2ZNWA 1JTPA 5D1ZA 1L6ZA 4YBHA 1WAAA 1JPSH 3MA9L 4GG6B 5B39G 1IKNA 2H2SC 3BW9A 1D6EA 1H5BB 3PP3H 2Z93B 3PDDA 5J4MA 5I17B 4N68A 2ORBH 4PJBA 4U6YB 4QRSB 3SKOA 3OTTA 1BREA 3DBXB 3W0WA 1F4HA 5L88L 3W2DL 5KSAD 3VG9C 1TVHB 4LCUB 2PYEB 2X40A 3EBAA 2R29L 2YA0A 3ULSA 4PTUB 4FTVD 4L8SA 1YUHB 4OZGE 3TJEL 2DQCH 1QR1A 3GB7A 2ZOLA 3CXDH 5D1XB 3REVA 1ZSDA 5EFIB 3LIZL 1BVKA 4EN3C 3EDKA 3EGSA 2YUWA 4QRPE 5FKPB 1HXYB 2IAND 1OLZA 1KFAH 4FQLL 3EFDL 3RIFF 5C2BL 5DMGC 4PR5B 2NY1C 1NSNH 5KANI 2UWEA 5DC4B 4IOIA 5E99H 3RPIA 4XCNB 5FOBB 3CUPA 4TPRL 3TYFB 5JA9A 2F54A 4JHAH 1FFPB 5ANMB 1KF9B 3FQUB 5EA0H 1SYSA 3MV9E 4ZFZA 3JWDL 1BP3B 4Z78B 3QEGL 4D0CA 1MHEA 3MRRA 2Z4QB 4W4OC 5FB8B 4PJCB 4R26H 2B5IC 5KG9A 2AXHA 3NCCB 3L9RB 3NPSB 3QPXL 3REWB 2R2EB 1X5KA 2XRAH 3NZHL 2WANA 1PKQE 2C1PB 1N5AA 1LO3H 2VERN 1OAXH 1E0OB 4I2XB 1W72B 4UAOB 2D0GA 5C08E 1FO0L 4RWHA 2IMMA 3OB8A 5ELIA 2BXYA 4YDKL 3HZYB 2AJYH 4G6KH 2FHBA 3JTSB 4IRZH 2LE9A 4X6FB 5A2IH 4PJAF 2YEZA 2B2XL 3TBTA 2AJXH 3R4DA 4DOHE 1DBBH 5C0DA 3EIFA 3QRGL 5ACZA 4OV6F 3PHSA 3D1MC 4DGYH 3O2VH 2A1WL 1PG7W 3H3PL 3O3DA 3PHQB 1BQLH 4LVOB 1INQA 1TQCC 3ARGA 4WWKC 4AENB 2D03L 1A8JH 3WNMA 4BQBA 4WTZA 4HXAH 1F5WA 1A7QL 5HD8D 1X5LA 4NWTH 3MXWL 1FFRA 1OSPL 1CDUA 2WUCL 3V0WH 4QF1B 3B2VH 1A4KA 5C9JB 2IH3A 4KWUA 3WUWB 4KUCD 4GAJL 3DECA 1BD2B 3G5YB 3MLUH 3ZT6A 3V9FA 5I1KL 2W0FB 3QG6B 3HE7B 2JCCE 1RUQH 2CGRL 5HYEA 1UWGH 4GAFB 4QTHB 1TETL 1XGYL 3HR6A 3UC0L 1DBKH 2ZG2A 3JUYA 3MOAH 4PP1D 2Y06H 5TH2B 3GSRB 4MLSA 4ODTH 4NKDB 2VISB 4NO5B 4PRHA 5D7JA 5KJRH 3RX7A 2V2XA 1K6QH 4PFEA 1J8HD 3VXRB 5D7IA 3TBYA 3V8CA 4H88H 1T03H 3VD3A 4RMVA 1RZIA 2NXZB 4MNHA 1K4DA 1CXEA 3ARDD 3MREB 4ALAH 2DWDB 1ACYH 2EEBA 2LV4A 3RNQB 2X4TA 3WLWD 3HC4L 3WS3B 1INDH 1LP9E 1PFCA 1P7KB 3BEVA 4I77L 3SO3C 3KYKL 1E27A 3P9LB 1MJ7H 1OCWH 2CPCA 4M7ZC 3AUVA 3WXVH 4FQQB 4M7KH 4JM2F 3VE0A 3V0AC 3MBXL 1RI8A 3F5WB 2HKFH 3GDBA 5L8JB 3ZE1E 2HTKC 2EO9A 1A2YA 4G8GB 1I7UB 3MGOA 5DT1L 2R1WB 1CYGA 3WFDH 5DRNA 3VFNA 1FDLH 1QSEB 4WFHD 5ECJE 1EXUA 1ES0A 4U1NA 4J3SA 1M6OA 5I8CA 4XVTH 1KENH 5B3JE 1ED3A 4GKSA 3K1DA 5DTFA 1G9MC 4Z7OE 3FONB 1DQMH 1BZQK 1SJEB 1R5IB 4YWGL 1F2XK 1NCCL 5GS1A 4KZEL 4X4MA 1BEYH 3LZFL 3QDGB 1G0DA 5T1LD 2EECA 5ID0B 4Z7WF 1A9EA 2CO7B 2ZZUT 3ARXA 4ELME 1LEIA 3WJLA 4CW1A 4JRYE 1JF6A 1J1PH 1NGXB 5DMJB 3D18A 1I8MB 2N4IA 1MWAL 3TN0C 2XA8H 2Z91B 3W9EA 2EDWA 2FCBA 3OKDA 5DJXB 4NKQB 3NPZB 4LCIL 2EIZA 3KDMA 2IFFH 3OGCB 4H20H 2QSQA 3B9KC 3FB8A 4MJID 2EXWC 2WIIA 4M93B 4K7PY 4MB3A 1J87A 3UTTA 4HJJH 3P0VL 3D39B 5CINL 5IB2A 5GISH 1E4WH 1X5AA 4B50A 2B4CL 1SYVB 4UBDC 1U8LA 2VQUA 4HUKB 1KB5L 3MRGB 2F9BT 2LU3A 3QZWA 1TQBB 2FX7H 1T5WB 3K8KA 1IGMH 2V2WB 1FZMA 3P30L 4XP5L 5C9KA 5BS0B 5EIQA 1X5GA 2FBJH 2VDNH 3TNMB 1OTUC 3EJJX 3FFDA 3P4OA 4PREB 2D4FA 1IJ9A 2F74A 1FIEA 3UYOD 5A43C 1CTNA 1NGPL 3HZKB 1G1YA 2VTFA 1CDCA 5EN2B 5E2WL 4JZNB 3QUYD 3CXHJ 1ZHLB 1RZKC 3GMNB 2NX5D 5J06A 4FZEH 4RAVB 5T3XE 5C3TA 1NCWL 1T4KA 3BZEA 3MV7A 1NGWA 3H9SB 2H2SD 3CPLB 4JPKL 2X4RB 5DUML 2AV1A 4CL7A 4K3DH 1EFXD 4KI5E 5IB5B 2FX8L 1UCBH 5I18H 4O5LH 4ONGH 3CH1B 3O3AB 3VXTA 1XGUA 4HIXH 3KPNA 5LAXA 3WXWH 1H9VA 5L6YH 4MQXC 2QEJA 4LLAA 5EZIL 3U9PH 4P2OD 4FA8A 1T0NB 3T2NH 3MRFB 1HHJB 3TCLA 3W82A 4PJ7F 2IH1B 2X42A 2W0LA 4YHOL 2F15A 15C8L 3FO9A 1KNOB 4Z95L 5CUSL 1QFWM 2NTFA 4LHJB 1UXSA 4OD2A 1NMAH 3MRLB 5CEZH 5I8EA 2DQDH 2DD8L 4ETQB 2DMBA 1LE9A 3PABA 1W0YT 4LNRA 2C3VA 1D6VL 3OR6A 1B6UA 1UM4H 5DO2D 1TZGL 5B22A 4QRQB 1XCTA 3PDOA 4TVSa 2EH8H 2F53E 2HRLA 1I1FA 5D2NA 4NNPH 5MENB 5DI8B 4WIQA 2JJWA 3FQRB 3IJYA 4MA1C 4UOJA 3O4OC 2BVUA 3RTQC 2BNUB 3C6LA 5KSUB 4PJXF 3KJ4B 3VXUA 5HHVL 3DX7B 3I50L 4HPOL 2MCPH 3QHFH 3BQUB 3MCG1 4YDIL 2R69H 3HG1B 1MRFH 3FMGH 3TYGH 4MA8H 2R4RH 3V0VA 3IRPX 5JQ6L 2XZQL 4ZQKB 2AVGA 3BIAX 4OQTL 1A6UH 5I71C 3MJ9A 1XT5A 1JWMA 5DWUH 3B8YA 4I0PD 3GMPA 3HAEA 4PRBA 5LGJA 1S9WA 4HKJB 3LN9A 2AGJH 4XPGL 3IAQA 3QIUB 3V79C 1U3HD 4HC1A 1EJOH 3FQNB 5A40E 1E4XI 2B39A 5KW9H 3ORJA 5GRXG 3VRLE 5CZXD 1AKJB 2ZSVB 4RDQG 4ZS6D 3A67H 3PG2A 4Y19B 3T0EC 5LQBL 1EEZB 1IBGH 3GSQA 1Z9MA 4JDTL 4L9DA 1JWSA 2RCSH 5I66B 5J6HA 3SE8H 2DM2A 4CJ1A 1P7QD 2VQ1A 2HN7B 3FB6A 3SKMA 3RAJH 4WW2A 1UKSA 1UM5H 1G6RL 3NZ8A 1JFQH 3CZFB 3QDMB 1T0MA 2NY7L 1F8TL 3CLFL 3QDHA 2R56H 5FECA 2QTEA 2OZ4A 2GAZB 1JNJA 3UPRB 3C09B 3GJEA 1ZT1A 2HT3C 1CXKA 5EIIA 4PV8B 1RURH 4OJFL 3A6OA 5FGRA 1VPOL 3L5WA 4UT6L 1CZ8L 1C08A 2MWCA 3BPNB 1IAII 3AREC 3ES6A 4RDQF 3S5LG 2BNRE 4CMMB 4ZG1A 3DMMA 1T2QL 3ARQA 1O7VA 5EIVA 1XGRA 2H9GA 4P5TC 2NY5L 2CK0L 2NY2B 4O2CB 4KV5E 3LEYL 1PAMA 3SDAD 1Y18B 1RAMA 5DD1H 3S88L 3VW3L 5HYFA 1S5HA 4MD4B 5JO5B 1BX2B 2QADB 4F33A 1DFBL 4JREC 2DM4A 1I85C 5ALCL 3SDCA 3O8XC 3SCMA 1GZQB 3H2WA 1MVUA 4P5KB 3U7YL 3ULUL 1LD9A 2WUBH 4X80L 5D72H 2X1XR 2NW2B 3S36H 2XZAH 1AO7E 2O26U 3P4NA 4PRID 4OZGB 3MJ9H 3N0PB 4L8DB 4GXUN 1U8QA 3HAEH 3CU1A 4OLUL 5TQ0L 7FABH 3SN6N 2APWA 1BZ7B 4HC1H 1ZLWK 4QRPB 2R1XA 1WBYB 2GYSA 5GGTA 4UMGA 5KVEH 4L9LB 4TUKH 5FA3A 2IF7A 1Q9OB 4PJ5A 4DN3H 4HG4J 2IAMD 3LKRB 4E41E 1C12B 1HH6B 1QHPA 1R0AL 3OKEB 4IIQB 4NQCA 1AP2A 1OPGH 3KPPA 4U7SA 1YPZF 3MV9B 4LQFH 2NCMA 4KFZC 3EYQD 4YNYA 1D9KC 2FBOJ 2NR6C 4YGAB 5AYUH 3TH4T 4Z7VF 1AY1L 2EXWD 5IVXE 5AAMA 1MIEH 3E6HB 4FQXC 5IESL 1LEGA 4KC3B 1PKQB 1T20A 3VH8G 4AZ8A 4D2NA 1RIVH 3EO0B 2OZ4H 1TJGL 5C08B 1S9KC 4R8WL 5DVOA 5TDNB 1GGBL 2Z31A 3LH2L 2NY4C 4C4KT 1TNMA 2O5XL 3UYRH 4QRRA 5K9JL 4HUVA 1RMFH 4MS8C 1OAQH 3L3OA 5J11B 2R8SL 3IDIB 3ZKXB 4X9GA 4JY6B 4OCYH 4DOHB 1NBYB 4F2MB 1OTUD 2Y5EA 3CSYB 5FYKH 3O6LL 1R3IH 1IQDA 4YFEA 4QYOB 4HHAA 1R5VB 1TVDA 1QUNA 4Q9RH 3EJYD 4AT6A 4QT5B 2YPLD 1BQSA 5SWZD 5T33H 3VGBA 5HPOA 2NYYC 3TA3A 1QFUL 2PO6D 3TH3T 4KPHL 1KGCD 3ULUD 3U2SA 5CHNA 3T1FB 4KRPD 1J11A 5B38A 5EPMB 3MLXL 1HHKB 1N7MH 1RVFL 2HJKA 4V1DA 5I76B 3RUGF 3PWJA 3IDJA 3DVNA 1N59A 3QDJB 2JCCB 5LVEA 1E4XH 1FV1B 4IRJA 1J86A 3CFKB 4GRMA 4YX2L 1NGYA 1IGCH 2R0WL 4FMKA 1UQSB 3RNKB 4CDGC 5AUMA 1A47A 3I6GA 3VFRB 5GGTH 3O2DL 4U7KA 3DV6A 1ETZA 3UBXG 3C5ZA 4HWZA 1NUFA 3FN3A 1YDPB 3HZVA 3WL9B 2AKRB 1BQHG 2NY6C 1MWAB 4PB9L 4X6BA 1NUNB 4PJ8B 5EORL 4F7PB 4LSDA 4ZTOL 4P5MA 1LP9B 1R6VA 3AM8A 4X99A 4XBGA 4PRDA 1KCVH 2YR3A 2P1YA 4G8EB 1C1EL 3V5KA 3T0XA 5HPMB 1KOAA 2X4SB 1AJ7L 3KG5A 3EOBB 3TWCL 1U41A 1TCRA 1MHCB 1DQLH 5JW4Q 1BZ9B 4OGZA 5J3HC 2DI7A 5IB3B 1K4CB 5B39A 1IAIH 3CVIH 3DXAE 4OGYL 2E7LA 3ABZA 3C9NA 1EDQA 5DUBA 1RZFH 5BO1L 1Y6MR 1ZK9A 4OUUA 1SJHB 3SE3C 3G6JF 3PWPD 2DBJA 4WFED 3NN8B 4CRPA 4XX1E 4GSDL 5KTEL 4HUWB 3S3PA 2WINA 2IQAB 3WNNA 4JZOB 4MNQD 5D7KE 1MJUL 3PE9A 4KK9D 5F7FA 4PLNC 1UH4A 3KPSD 4WU5B 1KJ3L 5IR1A 4GG8B 5IQ7H 2DJ4A 4ELMB 4GG6F 2FH6A 5I74B 1QOKA 4MX7B 1IKNC 3UO1L 4JRYB 2JJUA 4X6CA 3I3DA 4JN1H 2J5LB 4R0LB 3JBG7 1U95A 5CGMA 5HYJE 1M71B 4LSQL 3BGMA 1T7YA 4B53A 3BKMH 3GBLA 1H3VA 2EEAA 4XTRD 5T1KA 4F80A 5EO9A 1GVIA 1MFAH 3T0ED 5IM7B 5E9DD 1S7RB 1YC7A 4WDIB 5J12C 4NYLB 3CU7A 4U6TA 2NNAA 5L9DL 2AEQH 3C2SA 4NWUH 3HE6A 2ENSA 2FX9L 4MXQC 3TP4A 4J1UB 3TO4A 1NAML 4LCWA 2PR4L 3HLAA 1RK1B 1FJ1B 4OZ4A 3UZQA 5ESVA 4EQ3A 3V6FA 4NN7C 4Y0GA 3U30C 1CD1B 4OIIL 3D5OF 4HZLB 4OZIE 1JGEA 2H8PA 4POZD 1X4YA 5CILH 3WN5A 2VDQH 35C8H 4WI3A 2VLKA 4LSVL 3TH2T 4GS7B 1SEBA 4U0RB 3QXWA 3LQMA 5FYJD 1I3RA 1T04B 1T89A 1GAFH 3P2TA 3PGCB 3ELAT 3MV8D 1YMME 5F7KC 2W9LA 1WEJL 4L5FH 4OTXL 4UV7H 4XCEB 2MQ3A 3WFBL 2CH8A 4PJCF 4P5TD 1ZXQA 1K2DB 3HPLA 1OW0A 3EYVA 3ULVE 4JFPA 4UDTB 5BV7H 5IMMB 2UYLA 3HCVB 3FOMA 1JHKL 4XC3L 1CLZH 3VXSA 3NFPA 5E2TH 4MXWH 3U0PA 2BK8A 1MCJA 4HFUL 3WUWG 5DSCA 4ZFOL 5F3BA 2A6JA 5GIRB 2E6JA 2I9TB 4OD3L 3O2WH 2K9UA 4XBPB 5C0NC 4U1MB 1I7TB 5EUOA 4DFIA 3MLVL 2XPGA 5E8OA 3MXVL 4ENED 5C0JB 3QR2A 5E8EB 4L8BA 4DFHA 4G3YH 4NC2B 2A6DB 4JM2A 1U91B 3I9GH 3L3GA 4RISH 3HMXL 5LBSL 1AR2A 1WCBB 4D8PA 4LK4A 2EDNA 3MRMB 3KLSA 2BRRH 5D70L 1MJJA 4TULL 4ZUUA 2RFXB 1IT9L 4DAGH 3A6CH 2W1NA 1UH2A 4XMPH 4YXLH 2GT9B 5DJCA 4MQSB 4U1GC 3HS0B 4NO2A 3V8OA 2F53B 2XZCL 4LRIA 3S35L 3BP4A 2GTZA 1AFVL 5EC1B 3SDDA 1NCTA 3GMRB 4F7MA 1J8KA 1WUNT 2NR6D 4OFIA 5EOCH 3OJVC 5FO9A 4DQOH 3MROB 3W5NA 5DD3L 3NA9L 4NN6B 2PXYB 5C09E 1XMWA 1G6RB 2AK4A 4P2QA 3IKCB 1YZZA 5D7JC 1A3LL 2XKNB 5AZEL 4NPYA 3P73B 4BFGA 3U48A 3C2AL 2APBA 4WJ5A 1QKZL 2J8UE 4PV9B 3D6GA 5DJ2B 2GK2A 3QIBC 3DJ9A 5E2UH 3IF1A 2BY2A 2ZOKB 4GQ9H 2B0SL 2DKMA 2V17L 4HWNA 3OKLB 5IW6B 3B5GA 3HUJA 3NCJL 4NQEE 1GOHA 3L3HA 4HS3B 3RDTA 1C8PA 1GHFL 4ZUWB 2D7TL 3RL1A 1V7NL 2VXSH 2HMID 4H25B 5DF0A 3VXME 1D5ZA 5I73C 5JZ7C 3PP3K 5IK3A 3OKNB 3ROOA 5IJVA 1UCTA 4QTIL 1N26A 3RJQB 2CUMA 5DLMH 5GS0C 1ZMYA 2ATKB 4H26B 5GGUA 2W38A 2NYYD 1A7BA 1F4AA 3BSZH 1NFKA 5FM4A 5C0GB 1B4JH 4L8CB 4PRNA 4L3AA 5DURB 3LRGA 3ARRA 1YEFH 4R9HA 4LLUB 5HVHC 4P23B 1EZVY 3L3DB 1G7JA 3WIIL 4JB9L 3WDJA 1MSPA 4IRSD 5EOTA 2IANE 1JWUB 4UV4H 4JFEE 1U92A 5EBMA 3V7AG 3H9HB 4XNYL 2O5YH 4H8WH 4JVUA 1U8KB 4G9FA 4N0CC 2DQFB 1LGVA 5DS8A 3GI8L 3PWNA 3WJLC 1ZA3B 1DVFB 3IB4A 3PWLA 2P8MA 4JR9H 4S0SD 3C5SB 2OTUB 1WBZB 2BNRB 1VFBB 1KPRB 5LCVL 4BSWA 5L0QB 2D7MA 4O51A 3CXHK 5TDOB 1S8DA 4HJGA 3VXPA 2LU7A 2DDQL 4PGDA 4PJ7A 1JN6B 4Y16B 2XN9E 1NAKL 3JWOL 1OGTA 3NFSH 3TZVA 4R3SA 1DP0A 1IAMA 1QLRA 4NCC2 4ODHH 4XP9H 4GBXB 1PEWA 4NJ9H 4NSKA 3QEUB 1Z9OA 4ACPA 1RUKL 3MUJA 1MLCA 1Q0XH 4D0BA 5LGHH 4Q6YA 5CFHA 4IOFC 5J3HD 4FFVD 1HIMH 1HK6A 2XG4A 4TTDD 5FDWB 4YK4B 3HPJB 4YDJA 3NIFF 4M8QB 2BHYA 5JLZB 4G6JH 1AO7B 3OG6B 5BQ7B 4R7DA 2ESVE 3ARFA 2X9XA 1KJMA 5F8QC 1A21A 3GRWL 2VR9A 4N9GA 3QCUL 5IEKA 4XWOC 4PB0H 4JLRB 4PJXA 1F11B 4XC1H 4EEEA 5D1ZD 3V4UH 4I18B 3OV6A 1R3HA 3MA7B 3SGJA 5GGVY 4LPWA 1H8NA 4E41B 3P0GB 4WI7A 4WY7H 5D71L 3E8UH 1RJYA 1RZJL 5FK9A 2HFGL 1MJ8H 4LSTH 4CVWA 2YUZA 4PJGE 3P40A 3LN4B 1NCDH 3VFWA 3T3ME 2Y6SC 4P57A 1RJLA 5IVXB 3C8DA 4XWGH 3MYJA 3VWJB 3PXHA 4Z5RB 3QFJA 1HHHA 1UH3A 1YQ2A 3F12A 4JKLA 1ZANL 5TE6H 1CBVH 3BH8B 4P4KB 4UUJB 4FFZL 3GJFB 2Y72A 4LCYB 2G60H 3O3BB 5D1QB 4PG9A 3W11D 1N6QH 5T1DL 3WEXB 2UUDH 4F7CB 3TC9A 4G8FB 1JJUA 1OVZA 1U8MA 4G43B 3U4BL 4Z7NF 2Y9RT 2DQGH 4OIBA 3M8OL 3Q6FA 4EDWL 2F54D 1Q9LA 4ZYKA 2W9DH 4G9DA 1KG0B 1YEDB 1XGPB 4W6XB 1P4LA 3MTRA 1J0HA 1RUML 4X5XA 3VFVA 1QP1A 2CLZB 4EDXB 3UYPA 4U1HA 4YDVA 4OCWH 4WTWA 3QULA 1OY3B 1A7RL 4MJ6B 1VGEH 1HSBA 3MLZL 2WWMC 4GW4A 1T1ZB 3GMQB 4X4ZA 4LAJH 4U6VL 3QUZB 1QO3A 1VGKB 3GEWB 1BAFL 1T66D 3RIAK 2I9LA 1KCSL 1L7IH 1MCFA 5DK3A 1CICB 4JDZB 5HYSB 4JKMA 4MDIA 5F44A 3LKSB 5TE7L 1DEDA 2VYRE 1KJ2L 2XTJD 2HWZH 2V7HB 3LS5H 2AEPL 3LQZA 1S7UA 4PJFA 4LFHD 4ZUVA 2X1WL 3C6SA 3CFEA 4HK0A 3MV11 3U46B 3QI9A 3ARGD 4QY8B 4XNZB 3SDYH 3T8XB 2AXFA 5ICXA 4HQQH 3EUUA 1CF8H 3DLQR 4Y4HA 1NCUA 4K94L 2YOCA 2VXTH 2OK0H 2J2ZA 2IFGA 5CBEA 5CSGA 5HHOA 3MCLH 3NIDE 3QUXB 2ZUTA 1RJZA 3QJFB 5TGBB 3DTXA 2HJLA 3HE7C 4KMLB 2YPKA 5ETUA 2BC4B 3EHBD 3ZE2E 2FWOA 5LGKA 3CLEH 5SWSE 3S5LA 3TO2B 4WW2C 3BJ91 4ZAKD 1NAMB 3MLWL 4NC1E 3W39B 3VI4F 3HNSL 4F3FB 1GGYA 3B6SA 2X7LA 3BPLC 3N9GL 2YMXL 5CSBA 2AXGB 3QQNA 1Q72L 2DKUA 2P5EE 3DXAB 1LK3H 1PSKL 3G6DH 5D7JD 4PRHD 1WZ1L 3OXSA 2E9IA 2E8YA 4KY1L 1FSKC 4JANB 1OP5K 2YUXA 4BH8B 1YPZA 3FO2A 1IGYA 1FVCA 4D94A 3HR5B 3T4AB 4BSVA 2A77H 1EEYB 1HZHH 1YNTB 4AIZB 5HHXH 2L7JA 3GMLB 4HIHA 1FE8H 4FS0A 1N3NA 1K8IB 3MMEA 4P2RA 1CN4A 5DK2A 4PJ9B 5JOFA 2ICWI 1C5CL 5A2JH 1I8LA 3PWUB 3H8NA 2A6IA 2G75A 4NRZA 3CFBB 5GHWL 1OSZB 3ALWA 5HYJB 3O6FB 3D25B 2OJEA 2VXQL 1S9YA 3NBNA 1CK0L 1J5OH 1IEAA 5HHNB 5DVMA 2R0KH 5IQ9A 1AGFA 3SDCC 3WS6A 5ACLA 3V5DA 3SCMC 3ZTNL 3CCHB 3BZFB 3HC3L 3QFDA 3MLSH 4B0MM 2CXKA 4OZGF 1A1OA 1KC5H 1OP3K 1DE4A 3BYTA 1IKFL 5TQ2H 1BBJB 1BOGA 4MAYB 3MLYH 4CNIA 4YUEL 1YEEH 3SE9H 3S36X 1OTSD 4OB5H 1F02I 1TZHB 5CJ5A 4OZIB 4E0RB 3UTZB 3GGWB 2D4DA 1BECA 2ICEA 4WW1B 3VH8A 2CUIA 4A6YL 5ESAB 5DMIL 1IILE 1KXVC 3RWGA 3RGVA 3BDBA 3RWJA 4X8JA 3RUGA 1F58H 1I8IA 1T0PB 4HKXB 1SY6L 1YMMB 1MEXH 1Z0NA 2ADIA 5BVPL 5M95B 2VABA 3QXVA 5ITFB 3HB3D 2APTA 2VLLA 1J1XH 2BSSB 3DETC 3UROR 1OT2A 2HFTA 2J12B 2H26A 1NUGA 3UTTD 1WV7T 1XF5A 1YNLL 4TUJA 1VKXB 1UADC 1IAKB 1TITA 3BAEL 4L3CA 1BVLB 3CMOL 1D5IH 2NPLX 2HTLC 5A3ID 4RMSA 2BSRA 2QR0B 4FQIH 3QG7H 2Z31C 5FA4A 2DTSA 4Q9QH 3HMWH 1Z5LA 5CBAA 1S7XB 3NH7L 3VJ6A 1JK8A 1HDMB 3R0MA 2AJUL 2ICWA 3CFIC 1LE5A 2ITDA 3ME0A 2IBZY 4UB0H 3PL6D 1MAKA 4ODWB 1K5NB 4IMLB 1T2JA 5IJKA 4IBLT 5K33A 4AG4H 5BW7C 2HLAB 3LKNB 1LNUA 4JO3L 3O11B 4P9MH 5F9OL 2R2CA 2WBJD 4WI2A 1YYML 4M1CC 5JR1H 1FZJA 4NUJB 4BSJA 2RQ8A 4L3EE 4NRXA 2X89A 2ZPKH 5IW1B 3TA3C 3MV7D 4OLEA 5FO7A 3IXAB 3EO1B 3UBXA 4OGXH 3G6JA 5I1IL 2O61A 5H35A 1TJIH 1F2QA 4CGTA 1IAOA 4R90H 4I3RL 1BQHA 3DUUB 1TPXC 4M6MH 4RNRB 5FYJU 1JHTA 1RIHL 2DQIL 5ALBH 2D31A 2JCCF 3VWKA 1JGVL 4NNXB 4ELKA 5C7XL 2IQ9H 3NGBC 4K8RH 2CKBB 4NQSA 3UAJD 1XFPA 2CIKA 3STZA 5C09B 1VFOA 2BVOA 3MRBA 4LF3B 3T2QA 1QLEL 4QRSA 4JCLA 5EUKB 3ET9F 1NJ9A 2J8UB 3FAXA 2X9WA 4X7TB 3EYSH 2A9ML 2BJML 2OTWB 3RVWC 5AEAA 4HT1L 4XRCB 1TVHA 3ZMRA 4LCUA 1KIRB 1IARB 4YGVA 5GZOC 4PTUA 4Y5YB 1H3WM 2MQ0A 3Q5OA 3V2AR 1YUHA 4NQEB 1RUAH 4M61B 1LP9F 1KPVA 5CSZB 1YY9C 5EFIA 4KMTL 4EBQL 4UIMB 1WISA 2F58H 4LLQB 4OM1L 3VXMB 1G84A 3P0YL 2HVKB 4DEPB 5KSAB 3UTSD 1ZEAL 4Z0BH 3ESUF 3S4SB 5BV7C 3MLTA 4JG0H 4PR5A 3C6LD 4LSSL 1QG3A 4FTVB 4M5ZH 3ZE1F 1BVZA 4MXVE 2E7LC 4APQA 1JTOA 1WBXA 3B83A 5FOBA 2BFVH 1RV6X 3TYFA 1FL3A 4ODSH 3STLB 2BMKB 2VSDA 3SGDI 1FFPA 3CFJB 5ANMA 1XCQA 3MRCB 3KJ6H 4JO1L 3DRTB 3NCEB 4NFDA 1CGVA 5FYLH 3MJ6A 4XP4H 1T6WA 3O6KH 5B3JF 2I5YH 1YEIH 5F9JA 2IANB 4LASH 4JFEB 4Z7OF 5KSVB 3L9RA 4XCYB 1ND0B 4M62L 2EC9T 2VDOH 3REWA 3SPVA 3TFKD 1DUYB 2AK1H 2MPAH 5IVZB 2C1PA 1Q94B 4NFBA 1SVZA 3FN0L 4ELMF 4ONFL 4MD5A 3GSOA 1YQVL 5KSBE 4OI7A 1OF2B 4N5ED 5IWLA 1ZGLA 3X3GL 1U2CA 4HCRL 4YHYC 3WMSA 1JVKA 4TRPL 1IVLA 4X6FA 1MY7A 3JUZA 4FFYH 1ZS8B 5DFWH 4LSRL 3UCRA 3IXTB 4F7TA 4P2YA 1Z3GL 4KVNL 4UOW0 5JHDA 3F7YB 1XR8A 1YNKH 4L1DA 3ARVA 4RAUA 4P49A 2UZIL 3TVMA 1KTDB 3VFOB 2FYYB 1KN2L 2VLJD 5I30H 1UG9A 3FT3B 2XN9B 1CFBA 5DQ9B 4KVCL 3TO4C 4D9RD 5I75B 3L7FA 1EHXA 2NY3D 2B1HL 4M48L 1KELH 3GSVB 4ORGA 2V5YA 5I1JH 5JOPD 3ILPA 4JPVH 2VXUL 5B4MD 3ZT5A 3SDXE 4JO4H 4R97B 3T0AA 3F7VA 3THML 1DQJB 4Y4KB 1CXIA 1A6WL 2VR5A 3WN5C 1G9ML 2FSEB 1QBLH 5C0AA 4P3DA 4QF1A 3WUWA 4KROD 1REIA 1T7WA 4XMLH 1T89C 3UEZA 2EIDA 1BD2A 2ESVB 3MNZB 3BRDA 3T1WA 2HJFB 5SWZE 4L29A 5E8NB 4JE4B 3CX5J 2DIJA 3V6OA 4LSPH 3DMMD 5FYKD 3VU2A 1NFDE 5TH2A 1MCEA 4OFVA 3GMOB 3MODH 3ETBF 1CLOH 4BM7A 3MJ8A 1OAKH 2GUOA 2P45B 1OW0C 2QADC 2BCKB 3EOAB 4NQDA 5MP6L 4MNGA 1S7SA 2EYRB 3TGXA 1EO8H 9CGTA 3F58H 4HLZG 4X0KB 4M5YL 4QRTB 4Y5VB 2ADGB 4KI5F 4WI5A 1Q38A 5E94A 2ZUWA 4KHXH 3SDCD 3TV3H 4DWHA 3KHOA 4BJLA 4KRNA 3PNWA 2GJZA 3DX8A 1B0RA 1IQWH 4JY4B 1J0KA 4XVSH 4ODXB 1A6ZB 4YQXH 1CXFA 1DUZB 3IYLW 1P4BH 2VAAA 2EH7H 3CDGA 5DJZA 4PUBL 3P9LA 4X7FC 3OSKA 1P2CB 4FQQA 1JF1B 3MRPA 3OBAA 4H8WC 3ISWA 4TOYH 4XNUH 5E4EB 1A7PH 1TJHH 2CUHA 3ARDB 3IFLL 5D7SL 1RU9L 4TTGA 3V4PH 3WFCH 1OAYH 4WUUD 1HCFX 4HMEA 5MERA 1RQ5A 1R5WB 3KS0H 1DCLA 1KIPA 1C16B 2R1YB 3AU1B 1MHHB 5DGQA 5DMKA 2XQBL 3X11B 1I9JH 3LKOB 4NQCD 2DQUH 3QCTH 3TEUA 1AD0A 1MELA 4OBSA 2I26N 2XWJB 3SDDC 1HKLH 4OLWH 1SJEA 5CGYD 4G7YH 1VCAA 2OJZL 4LBEA 2O5ZH 5F1SA 3SY0B 1KULA 3DETD 4TSBH 4LLVA 4MSWA 4PY7A 1OAUH 4QOKD 1FZKB 4MCZA 1LO5A 2W60B 1SBSH 4UNVA 5FF6B 4XPAL 5IFAL 4WFEE 1I8MA 3VFTA 4L4JA 3ZKXC 4I9WD 2Z91A 4WNQA 2Z31D 4QCIB 4DN4L 4MNQE 4WV1B 3RKPA 1MI5D 2G2RB 4QRRD 3IRZA 1MOEA 5L8KB 2FZ3B 4AJ0A 5I1HL 5JW5B 4Q6IB 1IGIL 5IOPB 3RVVC 5I1AB 1LK2A 3MRDA 4FQ1H 5IBLC 1JZ4A 4GRWB 4GW1B 4O9HL 4PJHE 2IG2H 1CVSC 1UEMA 2Y07H 1FIGL 2ID5A 1A9BB 3T0EE 2J3SA 2HT2D 1IGTB 3W9DA 3VRLF 3MNWA 4M1CD 1M05B 4RFOH 4U6HA 5FKAB 3RY6A 4B41A 5BS0A 3TA3D 2VR4A 3WIHA 4PREA 1OLLA 3VCLA 1VFAB 4YHKH 3QH3B 2ICWJ 4K55A 2KQMA 4LGRB 2P7TB 1YN6B 4V1DD 5SWSB 3S3JA 4JZNA 3U4AA 1ZHLA 3LEXB 3O0RL 1J1OL 5F8RC 5C0FB 2YKLL 1IC4L 5K9OB 4RAVA 4IRJD 1A7OH 3QXUA 6FABH 4GKZB 5FYJE 4PJIE 2P24A 2P5EB 3GUTB 1S78D 3QAZC 4X9BA 5TE4L 4EVNA 5IKCB 4OAWA 1RK0B 3CDFA 3V52H 4ZPTB 2XOTA 1MRDL 4BKLA 4X7CC 4XCFH 4DKFL 3QUMA 3QUYB 5IB5A 2I07A 3C5ZD 1MQKH 1BFVL 3HNTL 3RVWD 4FXLA 4QHNA 2X4NB 3MPCA 4GMTL 5IBUB 4OLVH 2HG5B 3C60C 1M7XA 2FJGB 4S2SA 1HINL 1AGCB 2IH1A 4KV5F 4ZNEE 1KEML 4QNPE 4LLMB 2VDPL 1KCUL 2Q6WB 2GSIA 3TZVC 1CDGA 3MRKA 1NCAH 3RIFK 2IPKA 5I1GL 1ZLUH 3MRLA 1FZOB 3VG9B 3I6LD 4RBPH 3RVXC 5J57B 2R9HD 4P2OB 3RWFA 2LU4A 2FHCA 5CEYB 4XPFL 2FGZA 3WFHB 4ZNCD 1KEGH 2Q8AH 1FBIH 3HRZB 5CMAA 1FLRH 4XPTH 1I7RB 1I1AA 5JUEH 4EN3B 1MRCL 5MENA 4NFCA 5DI8A 1MCNA 3ARFC 5KN5A 4N0UE 1FFQA 4MCYA 1YC8A 4CADA 5F7WC 1P9MC 2BNUA 2NY1B 5DC0A 5FM5O 4UQ3B 2J5LC 3BPOC 4K3HA 1P6AB 4N0YL 3SOBL 1FLTX 3D9AH 5E5UB 2Z0BA 3NFNB 3QEHB 4KJPD 3SGJC 5CAYB 2DAVA 1A6TB 5BCAA 4NBYB 2PETA 12E8L 1MHPL 5IIEA 3WIHH 2CDFB 3KYMB 4KTEL 3FOLB 2B5IB 4X4XA 4ZQKA 2IALB 5T1KD 3RWDA 1MCHA 4I3SL 1EMTH 2ZG3A 2KDGA 4IDJL 2FD6L 1FRGL 5IVXF 1GZPB 2DLIA 4WFGD 5HHPB 4Z77B 4JQVA 4LLDA 4HKJA 2CDGB 2HLFD 3QIUA 3BXNA 2DWEA 3HE6D 4LCWD 2GCYB 5EU3A 1YMHB 3QPQC 3MFFA 4U2YA 1Q1JH 1MLBB 1KN4H 3GSUB 1H8OA 5H2BB 3RBGA 5AD0B 2DJSA 4WU7B 3ROLA 1A5FH 3QUMH 1CG9A 2DLHA 2ZNXA 3NOIA 5HYSG 1ZGLP 4Y2DD 1FL5B 4TNWK 1ZVSB 3RWHB 1RFDH 1MFDH 2VLKD 3KS0J 3GNMH 1TQCB 4JGJA 5GSVA 5GGQL 3HHRB 2J6EL 4BZ2H 1MCOH 2ZJSL 3QRFM 3G04A 4KRLB 2DTMH 1W0VB 4E42B 2VXVH 3D2UD 3HI1B 4NNYA 4YHZL 2H1PH 3CZFA 1YA5A 2L4OA 4LPVA 1LDPH 2XWTA 4NP4H 4YPGB 4OCMC 1NBVH 4L3EB 1U8IB 4CAGA 3UPRA 3DPBA 4DGIL 1QRNE 2A83B 3NABH 4R4NC 2DQEH 3H6JA 5L2KE 4HWBL 4MQ7B 25C8L 3WKMH 5F7UA 3AS2A 1ZV5A 4JRWA 1DQDH 3VXSD 3X13B 3QNZB 1LO0H 3BE1H 1J8HA 1QYGH 2HFFA 1QBML 1KLGB 1EVTC 1JPGB 3ARYA 3MBEA 3BPCB 3QUKB 4O2CA 1FNEA 2C9AA 3OKMB 4LLWB 1G1CA 4HWEH 3DO7A 4C54A 5KVFL 2PF6A 3I6KA 3O45A 5FCUL 4PGJA 4KUZH 1IC5L 2P43B 5J8OA 1BX2A 4JM2D 5BRZD 1PEZA 3QI9C 1F3RB 5CD5D 5F96L 1HHIB 1FO0A 4G8IB 1DL7H 3KLHD 4Y4HC 2AQ1A 4N1HB 4U4BA 3U9UB 3U6RB 4KJYB 3NTCH 4X98A 3D69B 3KXFE 4XGZB 3X12B 1GGCH 3VG0H 3SO3B 1U8HB 3Q6GL 2VLRE 5J89A 4N8VG 5CEXB 1C7TA 3LV3A 4M7ZB 5INCB 5M7QA 2Q1EA 1TNNA 3HKFA 5ADOH 3O4LD 3SDDD 1E6OH 5CCKL 1IL1B 1AGEB 1EUUA 3MA9H 4XAWH 5ICZB 3DV4A 2BVPB 4L9LA 3CH8A 2P47B 1LEKB 3UJIL 5JMOC 3LKRA 2AK4D 5C1MB 1C12A 2DRUA 4P2QD 4KH2A 4FQHB 3BP7B 1KB9J 2EDHA 2BOCA 4YZFE 5GRWA 5DJAB 2DQCL 5FOJA 3MV9A 3G5XA 4H1LB 5L88H 3TBSB 1DLHB 3W2DH 2M8XA 5SWQA 4YAQB 1Y6NR 8FABB 2R29H 1WAAE 3E6HA 5ISZD 1XIWA 3TJEH 3H3KA 5C0BE 1PKQA 2GJ6A 4ESKA 2AJVL 1OB1B 3RDTD 3RVVD 3VDAA 1G7PA 4PLJC 1DN0A 3LIZH 4WI4A 1QSFE 3TN0B 5C08A 4LVHC 5EA0L 1UZ8B 3W0WE 5CJBA 5KSBB 1CD0A 3NACL 1M7IA 2I60L 2Q76A 3B9KB 3OKKA 4FQLH 1QFWL 3EFDH 2X09A 3U0TA 5C2BH 1F00I 2OTPA 1U93A 3R1GL 4G6FD 4JY6A 1ORSB 2C7UB 2DI8A 4P23C 1SJVA 5EU4B 1IM9A 1NBYA 3GSNL 4F2MA 1UVQB 4TPRH 4F7EB 4NZJA 2DYPA 4I13B 3CSYA 4L4TA 4QYOA 1Q8MA 1TZIB 3JWDH 3QEGH 2IC2A 4QT5A 5GRZA 4FG6C 3QPXH 3SDXB 3NZHH 2PW2B 3VXQA 1CFNB 4OZIF 2UWEE 4G9FD 1CDJA 4HBCL 3V5HA 2RAMA 1FO0H 1CL7L 2OM5A 4YDKH 1BHGA 3L1OL 3RGVC 3LKQB 2UUDK 1HHKA 4U1JB 5F1NA 2FEDC 4ZPVB 4NO0A 2VZSA 2B2XH 3TIDB 5SWZB 3SKNA 5H8DA 5FHBL 5GRYA 3QRGH 1NFDB 2Z92A 4OKDA 4OI8A 2WMPA 1G7MB 2A1WH 5DRXB 5HGDB 4KRPB 3H3PH 1Q0YL 4WO4C 3ULVF 1EJ6A 3S96A 2D03H 5TF0A 4RMRA 1A7QH 2X5PA 2OMBA 1SQ2N 2GITA 4CU8A 3ZDZE 3LPWA 4HGWB 2FEEI 3RZCA 3MXWH 2AKRA 4XVJL 1OSPH 3TPKA 3OKOB 1MWAA 4AMKL 4N0FB 2ITCA 5MI0C 4R2GC 3OAUL 4TNVF 5HGHB 2UV3A 4GMSL 4GAJH 4JCMA 4JY5L 5I1KH 3BO8B 3OGOE 3LHPL 5E2VL 1NGQL 3ARFD 2CGRH 5HY9A 3T0BA 1TETH 1XGYH 2X4PB 1PQZA 3EOBA 3UC0H 3OJDB 1MHCA 3SGKA 1IEBA 4P4RB 5DJYB 1KB5A 1S7TB 1U3YA 4LDLB 1D5MA 2R2HB 1RHFA 1B0GA 3O9WA 1SJHA 5I6XC 5E0QA 5GGSY 2VJXA 2JE8A 4XPHL 3BH9B 5EU6E 4DW2L 3JVGC 4MA1B 4WI8A 5H94B 3O4OB 3RTQB 2LVEA 3ZHLA 4KQ4L 3HC4H 4KDTA 4I77H 3VWKC 1PVHA 2ZP0T 5DZLA 4GG8A 4X5WA 3KYKH 2D9QB 2QSCL 3DVGB 3QFJD 4JRYA 5D7IE 4PLKD 2AJ3A 5FYKU 3PUCA 4I0PA 1VACB 1WWAX 1JZ7A 2Q86B 3MBXH 3NCYP 5ID1B 2FJFA 2J8UF 4MNQB 5I71B 4XI5C 5DT1H 3SBWA 1OGAE 1HI6A 1I3UA 4M7LT 5IM7A 2VSCA 4CN4A 3DHMA 1S7RA 2EDXA 4MQTB 1MUJB 2B8OT 3KPQA 3L3IB 1TLKA 1Y0LB 1FJ1A 3D85D 2VKXA 1WFOA 3IFOB 1MCSA 4PJHB 4YWGH 1NCCH 4KZEH 1P7QA 3T0EB 4HZLA 3LZFH 2MHAB 5KAQG 4ODBD 3LDBC 4R4ND 4EQ2A 4S11A 4APQC 1MWAH 2C4FT 3UXFA 4G6ML 2JLLA 4FZ8L 4OKVB 4LCIH 2X4OB 1SEQH 2BHZA 1XH3A 1KLFA 1U58B 2NXYC 1HQ4A 4C59B 4JJ5B 1KT2B 3ARBD 3VXNB 2A0LD 1G7LB 3P0VH 5CINH 5SX4H 3NMEA 3UTPD 3ZSTA 5GGSB 2B4CH 4PJIB 4GW5B 3FB5B 5DEFB 5CEZE 3OF6D 1KB5H 4YE4L 4LL9A 3MV8B 4NM4L 1CLYL 3PIQA 3OB0K 4JFYB 3AREB 3FZUD 5IWLC 3ALXA 3AXLA 3G5VB 3QI9D 5F1KC 4GAYB 5IFJB 5F3HA 1DLFL 4U1MA 1JUFB 3P30H 4XP5H 5D6DC 3UTOA 1JE6A 4P5TB 4Y4HD 5KAQF 3UTTE 1UEYA 4E5XB 4BFIA 1C5DB 4MMZC 1URLA 2NLJB 3TVMC 4LSUL 4UTBL 5GS0L 4OQTA 4ZTPL 4JN2B 1EEQA 1NGPH 3F7PC 3JTTA 4J8RA 5A2LH 3RPKA 3FL7A 2V7NA 4HZAA 1U91A 4JREB 4DJMA 5AG9A 8CGTA 4PRIA 4X4YB 2DBLL 2V5TA 4ZSOE 1NCWH 1X5HA 3DGGB 3BX7C 2RFXA 2ED8A 5CIPB 3TNNA 2A6KA 1AXSA 4JPKH 4X6DA 3DARA 1BFOA 5DEZA 5DUMH 2WP3T 1SBBA 1M1SA 2PNDA 4L4VD 2X70B 3VRIA 2R23A 5T1MA 2FX8H 2F53A 4NT6B 3OJMB 5FIEA 3X14B 5EC1A 2G5RA 3GMRA 3ARUA 4IOSD 1CFTB 3BUTA 5EZIH 5CEZL 3MV7E 3V6OC 5TDPB 4HS6B 4P2RD 2PXYA 5E6IC 1G6RA 3IKCA 4DZ8A 4YHOH 3BVNA 15C8H 2XKNA 4XZUB 2YXMA 4Z95H 5CUSH 1JRHI 5HHQA 1BM3L 3V6ZA 1FVEA 1QA9B 1LVEA 1RZGB 4DKEH 1D9KB 2KZWA 1DSFL 1JGDB 4K9EL 2DD8H 3GBNL 3LQAC 4YHLL 2ZOKA 4PJGF 3QO1B 1A1NB 1D6VH 4FQXB 2BOBB 4PGEA 4DVBB 1GIGL 1TZGH 4F15B 5IW6A 1QACA 4NQUA 3T3MF 4HDIA 4LNVA 5SX5K 2GK0A 3IFPA 1BJMA 3TIEA 4ZUWA 2AJZA 1DEEA 4UU9A 4UQ2B 2VNCA 3DX9B 2NY4B 1EAPA 2VRAA 5EO1B 2VN4A 3DURB 3OKNA 4FG6D 3MCKA 4K8RD 3RJDA 4U1LA 2ATKA 5EZOH 5HHVH 3I50H 4OF8A 4HPOH 1CGXA 3FFCA 4U49A 2YPLA 2VN7A 3WE6B 4EI6B 4HH9A 5IB1B 5AAWA 5F71A 3QSKB 2XZQH 3ZL4L 2FEDD 2WZPD 5ITBL 5BXFB 4HGMA 4OQTH 5DMYA 5JPNB 4NKMB 4LHQB 1CQKA 3LPGA 1U8KA 3A67L 3VXUE 4D0DB 4XPGH 1KTLA 1RZ8A 2IBBA 3DI3B 4RGMC 1QRNB 2VC2L 3SE8L 3MR9B 3EYFA 5L2KB 4UT7L 4HEME 4ODVL 4IRSB 4F37K 4I5BB 4NQVA 3V95A 5GZNC 3C5SA 1XEDA 3NCMA 4ZXBC 4ZUTB 5IHLB 4HLZH 5LQBH 4O2FA 2BNRA 1VFBA 4JHBA 4JDTH 4LPYA 1JMZA 5TDOA 4AM0B 1GXEA 2X4UB 4C55A 1JN6A 4Y16A 3IDGB 1GRWA 1IFHL 3UDWA 4G80B 5DJ0A 1G6RH 2P48B 5JXAL 1KPUA 3MC0A 2NY7H 1X4XA 4NM8L 1F8TH 2IPTL 3CLFH 5I1DA 1NGZB 5D96C 3EYUL 1MFCL 4YHNA 3WSQL 5IBUG 2X89D 3KXFB 1BIIA 4OJFH 1P69B 5C6TL 1W72L 5A16A 1VPOH 3NIDF 4UT6H 1AO7A 4PRPD 3CSGA 4OCXL 4NUGL 5DDHA 4Q97A 3ZE2F 1S7WB 4QEGA 2MCG1 3GSNB 3KPLB 5INDA 1T2QH 3KPTA 4HMDA 1MQ8A 3WLBA 4M7LL 2RHEA 2NY5H 2PTTA 3IDXL 2CK0H 3PWPA 4KGJA 3LEYH 3LN5A 3DYOA 4JQIL 2EE2A 1JHLL 1CS6A 5C2UB 3L3JB 3S88H 3HC0A 4I18A 1G7HA 3MA7A 4I0CC 3VW3H 3DUHA 4IEFB 4LIQE 3KPSA 3IDNA 5IHZB 2EC9U 5MHSD 4OCLC 2QQNL 1DFBH 3EO9L 1NBZA 3T2PA 5ALCH 3G5ZA 3L95B 1KCLA 5FYKE 4NZUL 3IJHB 5FM8A 4XI5D 4A2LA 5IHUL 1X5YA 3U7YH 1ZHKA 3ULUH 3O6ML 4YIQA 3S97C 5IVXA 4X80H 4M1DL 1Z9LA 2PYED 4O2EB 3VWJA 1A7NL 1NLDL 1QPPA 3BW9B 3M07A 4TUKL 2QLVB 3P4MA 3WHXA 5DVNA 3AY4A 1LO4L