1ACZA

Glucoamylase, granular starch-binding domain complex with cyclodextrin, nmr, 5 structures
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
108
structure length
108
Chain Sequence
b'CTTPTAVAVTFDLTATTTYGENIYLVGSISQLGDWETSDGIALSADKYTSSDPLWYVTVTLPAGESFEYKFIRIESDDSVEWESDPNREYTVPQACGTSTATVTDTWR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords GLUCOAMYLASE
molecule tags Polysaccharide degradation
source organism Aspergillus niger
publication title Solution structure of the granular starch binding domain of Aspergillus niger glucoamylase bound to beta-cyclodextrin.
pubmed doi rcsb
total genus 8
structure length 108
sequence length 108
ec nomenclature ec 3.2.1.3: Glucan 1,4-alpha-glucosidase.
pdb deposition date 1997-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00686 CBM_20 Starch binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1aczA00
4NQDD 5GHWL 5F8QC 2IQ9H 5F7EH 4JHZA 5HXMA 3DX7B 5BMFL 2ZUQC 1I85A 4PRID 3MFFB 5GS0D 4WVRA 2MPAH 2KL6A 4M03A 1A6AA 5EU6A 1OSZA 2VL5A 5ADPL 2FEDC 3M07A 5FOBA 1RIVH 5C07A 5C92A 1GC1L 2X9XA 3NTCL 4HHAA 1NUDA 1S9WB 1F4AA 2CXKA 2VUYA 2VXQL 3X11B 5I6XB 2X5PA 2BJMH 3U4BH 1LK2A 1H8SA 3RY4A 1KPVB 1T89A 2DF3A 1UH4A 1PD6A 3IU4L 2X10A 3TJEL 5GSVA 1GHFL 3TBWB 4HGWB 5BXFB 2HRLA 1A7QL 5FECB 2ED8A 4G6FD 5F9DC 4YDLC 1GC1C 3HUJB 2P45B 4Q9BA 2VZ3A 3PF2A 3FOLB 1HYRC 3CIQA 4XAKE 4PJXA 5IIEB 3CXDL 3VWKD 3QIBA 2FHBA 3GJFH 4GBXB 2EIEA 1I3UA 1S7RA 4JFDB 4JO1L 5BS0A 2AXJA 1UB6A 4KUCD 3B3IB 5KS9E 4HUVB 4O9HH 2MKLC 4G7YL 4WUKH 4JZOB 4PJBB 5DS8A 3T09A 1BOGB 2EO1A 2R56L 3L3JA 2VLJB 5L2JA 5GQBA 1OAKL 5MERB 2D31A 1Q38A 1MWAA 5D8JH 5GJTL 2DWDB 3S4SG 5I1GL 2CLZB 5DWUH 1TPXC 1HSAA 3U7YL 4X5LA 3Q3GA 1DCLA 5K9KA 2VXSL 2R0KH 3U36B 4JQIL 1YEIH 3WKMH 1AGBA 3GSOB 2X4OB 4PRIB 5JW3H 1A14L 3BPCB 4F15B 4QRSB 4Y16C 5FUZH 4KY1L 1Z9LA 3O6KL 1FG2B 4K8RL 3TM6A 3HI6L 1MEXH 5KW9H 3G5VA 5KZCD 1E4KC 2NY4D 3BDYL 3NA9H 5D70H 1NGPH 1F6FB 4M8QA 3RVWC 2GUOA 5BJTB 4OLXL 5A16A 1JUFB 2UYLB 3M1BB 3BJ91 1YEEL 5B39B 5AYQA 1D6VL 5EBWB 5I1CH 1OT1A 2OK0L 2AABH 4P4KA 3HZMB 3RWCB 4WI6A 3VFGH 3U2SB 3V8OA 3DSNA 4HLZH 3QNYA 5KOMC 4RFOH 1KNOB 1NCAH 1FDLH 5C08E 1Y6NR 3L3GA 2BY3A 2VABA 4L4VE 1ZLSH 2I9LA 1WZKA 1MI5E 2OBGA 1I8MB 5IFJB 4IRSD 5H94B 1EZVY 2J6EL 5D7KE 3RY6A 4LVNB 3ZZ1A 3V0WH 5IR1A 3MNVB 3OL2A 3FOMB 3ME0A 4K3GA 4LSVL 2HVKA 3GO1L 2CIKB 2DD8L 2YEZB 2OL3B 5DFVD 1TJIL 4O58L 1HILB 1T4KA 5C0NC 5DT1H 3WLWC 1JMZA 1ZVSA 5D1XC 3VFPA 2VH5H 5FV1L 4E41B 3MLXL 2W91A 3HZVA 4DW2L 2BRRL 4P2RB 3TH3T 1FAIH 2D0HA 2BY0A 2NMSA 2YHGA 2YD7A 4WUUA 2CUHA 1DTUA 3L3OB 4NCDA 1C5CH 3UJIL 5L8KB 4ZO8A 3NA4A 1S7SA 5D1QC 3FL7A 3P4LA 2VOTA 2IANA 2NY4B 3HE7D 4Z7UB 3ABZA 5C6TL 2FX7H 2Z91A 1ADQL 1YJDH 3D69B 4X98B 3STLB 1T66D 5HDQH 1NUFA 3SGKC 4OLVL 1MCCA 5IQ7H 4UV7H 3ZKNC 5E8PB 1NGXB 3BQUA 2K1MA 4EQ3A 4FXGA 4Q6IB 2FIKB 3U4EB 4M8QB 5AYUH 1U8HB 2BC4A 4U3XA 4XHJD 3STZA 1UFUA 3ARZA 2WBJC 1D5MB 5DGRA 3KLDA 4U1JA 2MQ3A 4DTGL 3DVGB 4ZUSA 3L1OH 3RL1B 3O3EA 5IVXA 3OX8A 4I9WD 2G75B 5A2FA 4JDZB 4JPWH 3TEUA 8FABB 5HD8D 4PYHA 4PP1D 3BKYL 1IQDB 4PJGE 3MRGA 1ZHLA 5C0GA 4R0LA 3GSNH 3MRCB 4QNPE 1A7RL 4XXDA 4HH9B 5CP7A 4X4XB 4E41D 1T0MA 3WIHL 3DVIA 4V2CB 2N56A 3E3QE 4KJWD 2OL3A 2NR6C 3HZYB 1ZVSB 1CDBA 1E6JL 2PF6A 5BRZE 4BSVA 1EAPA 1H9VA 5HGDB 1GZQA 4ZUTB 1AGEA 3QXAB 4PJDF 2QSCH 4YNYB 3BRGC 3LKPA 4PGBB 2P46B 4QXGL 1G9NL 1JCKA 3X3FH 5BRZB 4WDIB 3BFOA 1N59A 3DYMA 4MCYA 1HKLL 3FB7A 1LE9B 1CFNA 1C1EL 5C0DA 4AM0B 1KEML 4UAOC 1AXSA 1JWSB 1K2DA 1OAZH 4G6AD 5BVJB 5CBEB 2RB8A 2A9NH 2XWTB 2A1WH 2X09A 5E9DE 5F9OL 2QADC 2CR3A 5HVHB 5DHVA 3AM8A 2CDEB 2OTUB 3MRPB 3V6OE 3EFFA 1U91A 1F11A 2BJML 3U4BL 5HHMD 4U6VH 5IMKA 3K80A 1HKFA 3G6JE 5L88H 3D85B 1DQLH 4I4WA 3OX8B 1FGVH 4NDMB 1HH6A 3UPCA 3DMMB 1UM4L 3VRIB 4Q74A 3V4UH 3ZE1E 2AW2A 1MFDH 2DQHH 5BMFH 2BNQA 3FQRB 5DD0H 3DXAA 5DGQA 1CT8A 2VIRA 3CXDH 1RFDL 1FH5H 4OLUH 4PJXB 5IIEA 2VDRH 3GI8H 4MJIB 3IS0X 1HIMH 5AAWA 2X4PB 4JRYA 2DQIH 1QA9A 4R7NB 4CW1B 3TN0B 5BV7L 1TZGH 3CFCH 1IBGL 4FZEH 5JW5A 1RIHL 3RIFF 4LMQI 5K59F 3FQUA 5GZOC 1S7VA 3Q5TA 3UEZA 1DDHA 3WFEL 1LE5B 4HWBL 3QUKB 4PBVC 3GUTA 3T0WA 4TUOA 4E42B 1MAMH 4ZUTA 1CGYA 3RGVC 5EOCH 3LKPB 4ODBD 3VFTA 4JFDE 3DO7B 4OZIA 4MXQD 3LD8B 4Z7QE 1F6AB 5CEZE 4U7MA 3QDAA 3WKML 4QYOB 2P24A 1EFQA 4GG8A 4YHKL 2NNAB 4G43A 4W6YB 3UPRB 4WFGD 3H9YA 5HI4D 3DBXA 4P57A 5CBEA 1YEKL 4PJHE 4GW5A 2Z8RA 4JFQB 5E5MB 2J4WL 1OGAA 4APQB 2AV1A 1CXFA 5D7JD 3NFNA 4HIXL 5HHMB 1JZ8A 3FB6A 4KPHL 1P84J 2V5MA 4V1DB 4RFNC 2CO6B 4IIQA 2WWKO 3VXSE 1RJYA 3JXAA 5DWUL 2R9HC 4HIHA 2EZ0C 4AIZB 1LD9B 3DMMD 5TDPA 1MCNA 4LLYA 1I7TA 3NH7L 1EHLH 1P7KB 3CLFH 1YQ2A 1JL8A 3JVGC 5EU4A 4XPHH 5FYKE 5EBWA 2AABL 3K2MC 1PLGL 4NQVA 4NC2B 4JB9H 5FO9B 2X4QB 2EC9T 5KSUB 3WUZA 4MA1B 5LBSL 1HWHB 2FD6L 4TNWF 3S37X 3MJ9L 1JTTA 1FDLL 1WITA 1KNOA 3EJYC 3HR5B 3VJ6A 4NM8H 3HPLA 3V4PH 3RTQB 3RP1A 4ZDHB 1J0IA 1GOFA 3LS4L 4JRYB 1CG9A 1ACYH 4YDVB 3RJDA 4F57L 2PTUA 3CVHL 4CGTA 4Z7WB 1R0AL 3OAUL 1KCUL 1FPTL 3GM0A 3MZGB 1IM3A 1XCTA 5HHVH 3BPNC 4BZ2L 3SO3B 3AS3A 3LKNB 4F2MA 4HAFA 1ZLSL 1WWBX 2WWKT 5IWLA 4HWEH 2C4XA 3WLBB 5C7XH 1XF4B 1X5XA 1KLUB 1UACL 1T5WB 4QRPB 3RX7A 4Y0GA 4MA8L 1LVEA 3FCTA 5DQDH 3O3BA 1S9KC 4EN3B 1IGIH 4R97B 3V52H 4QTHB 3HAEA 4ZS6C 4O02H 3U46B 4GQPH 1KF9B 1OGAB 2DYPD 1O0VA 5DUPH 1QRND 5JA9A 3NACL 1I9JL 2HH0H 4Q9QH 5A3IC 5HI5D 5INCA 3O8XC 3NIDE 2PYFB 3LH2L 3OKOB 1P2CA 2XIDA 1VFAB 4MD0A 4ZO7A 1MFAL 2R2EA 3T2OA 1DL7L 4EBQH 4K3EL 5DRNA 1YN6A 2EDXA 2XQYK 3CUPB 1JUFA 3DROA 5C6PB 3BVNB 3BEWA 1S3KL 5F7KC 4HIJB 1FCCA 4NZTH 1IGTA 1VA9A 2F19H 3K1KC 3SOBH 2F58H 1WIOA 1TJHL 4PJFA 4FQ2L 3W39B 5FA3A 4HG4K 3PWLB 3EDKA 3MRDB 1A0QL 3LRSA 5T1KD 1NLBH 3H3BC 5JORA 1V3MA 5AYUL 4NT6B 1LEKA 2P47B 1AJ7L 2HTLC 2J2ZA 2ATKA 3VXOA 4XXDB 1D3CA 3WIHH 4X9GA 3MROA 4K8RC 4XPAL 2PW1B 4JY6A 3QUYB 1FCGA 2P8PA 3L1OL 2R23B 1IM3B 4OV5A 4HHAB 4V1DE 1U3HC 2B8OT 2Y06H 3VWJD 3CFEB 2CMRH 4Y1AE 4L8SC 1FZJB 4PJAF 2PXYD 4NNXA 4UBDC 3HE6C 2MKWA 2L7UA 1KTKE 1IC7H 3VGEA 4NBZB 4J23A 4XMKL 1J8KA 4HCRL 1XFPA 4M61B 2IPKB 2BVPA 4MMXC 1QBBA 1T04B 2XTJC 1F42A 3BH8B 5IROC 2F53A 5GGSB 1HINH 1X4ZA 2ZCLH 4WDIA 3VXRE 1MJUL 5DFWH 1A7RH 1EO5A 3PHQB 4TRPL 1NCDH 4PBWD 3V6ZB 5A2JH 3JV4B 3VGAC 1NGYA 3QHFH 4F3FB 2I5YL 3PWPE 1NC2A 1FO0B 3WIIH 4PLKC 3NIFF 1FVEB 2GITB 1DBMH 4PJ8B 4G8EA 1JYWA 2VC2H 1BVKA 3MOAL 3MODL 3GMMA 3K2UH 1MCJA 2JCCF 3KDMA 4KK5D 4RBPK 5HHPA 2PTTB 1D5XB 3KNBA 3RNQA 1IAIH 4EN3C 4I77L 5EUOE 4KGLA 1MRCH 1D5BB 4U1NA 4U31A 2HLFD 2YPLB 4I4WB 3O41B 1K6QL 2ENYA 4O2FB 3JUYA 3C60B 3NCYS 4OFYA 4U1LA 2YD8A 3HRZB 5DJXB 1UT9A 2X4NA 4WWKC 3JUZA 5FOBB 2EDTA 2G75A 1CK0L 2YUXA 3MRDA 5EBGA 1RFDH 2CR6A 4OFDA 5HY9A 2CIKA 4PTUB 6FABH 3MUY1 3G6JB 4XCCH 3IDJB 1REIA 4P23C 4ZD3H 1JI2A 3MMEA 4WI7A 1AI1H 1IBGH 1AFVL 5JPNA 4U6HA 5ICYA 3MRCA 4JY6B 1ZT7A 2XACC 1A3LL 1V3LA 4HC1A 1F45A 2XXCB 5CZXC 3G6AB 4N1EA 1IQDA 2JJSA 4KKBD 5KJRL 3FB8B 3OXSB 5IESL 2ZKHH 4QEGA 4TVSa 4LEOB 1KXTB 3T8XB 4RAUA 4UV4H 3VFUB 4H5SA 4RZCB 1BQHA 3DLQR 3LS5H 3N1PC 1F13A 5EC1A 4JN1L 4KKAC 4HUKB 3ZYJA 4LHUG 1JFQL 3J7HA 2CJUH 1CT8B 4WTZA 3U0WH 3JV4A 5BO1L 5ISZE 1TZGL 4FZEL 1EHAA 1RIHH 3LMJH 3IGAB 2RFXB 3LKSA 5BOPA 2IMMA 3QEHA 3MCLL 3S37L 2RAMA 1NPUA 4PGEA 2ARJQ 3QG7H 1G0DA 1VERA 3MXWL 2A0LD 3EUUA 4U1KB 3AXLB 2HJLA 4YXLH 4FRWA 5DURD 5CHNA 3IFLH 2D4FA 4EJ1C 4LRNH 3VH8B 3HUJF 2ZUSA 5ID1A 1NC4D 1QOKA 1QFUL 2EH7L 1RZKC 3SE4A 4JB9L 5J06A 4G6KH 3TO4A 3RY6C 4BKLA 2C1PA 1QO3A 3GMOA 3FT4A 4H88H 3SDXE 4JZOA 4PJ7F 4P48A 5C0BB 3TZVC 4Q9RL 2AJXL 3K7UA 1WICA 1IL1B 4PJCB 1RJZA 4UIMB 3TPUB 3VFRB 3ZL4L 4AG4H 4ZNCD 3AAZA 2CLVB 2XY2A 5GSRA 4P3CH 4CVWA 4RFNB 4FTVA 1G7QB 2R4SH 4M1CD 1WAAA 5JO5B 2E6QA 3ARFD 3I6LE 2EDKA 3FN9A 1Y18A 4EVNB 3BQUB 1R0AH 1BQLH 3WFHA 4YAQB 4PJ5A 3DJ9A 1BAFL 4Z7WA 4UOJA 4W6WB 5FEBA 5GSVB 3CFDA 1F00I 4IMLB 4NWTH 3PWJA 3BZ4A 4LLYB 2J7LA 5BXFA 3OXSA 5BRZA 1I3VA 4LEOA 5DSCA 4PRBA 1Q0XL 3PGDA 4ODXA 3WUWB 4G5ZL 2DQFA 2ZOKA 3VFMA 1H3WM 4OT1L 4IRJA 4WI4A 4ERSH 1VEPA 5TQ2L 5L0QC 1MHCA 2AQ2A 3HKFA 3S36H 3HMXA 1DBBH 5D2NE 1DBKH 5CP7B 1ZE3C 3PABB 1CD1A 4KFZC 4O2CB 4ODHH 2VLKA 5FIEA 2VQTA 3V5KB 4BH8A 5E9DA 2IH3A 1LO5A 1QPXA 5IB4A 2W0KA 3DYPA 3V5DB 5LAXA 1XIWB 5D7IE 3QIWD 2NLJB 3SDXF 3K0WA 2NNAA 4GAYA 5H37H 1IRAY 1U3YA 4LPWA 5DRZA 5ADOH 1TVDA 1ES0A 3DUHA 4WO4C 2CGRH 5FFLA 4J4PD 5C0JB 2HFGH 4ZPTB 1CICC 1GPOL 1V7ML 4Z6AT 3V79C 5C09E 4MB5A 5KSBE 1S7TA 4R2GC 4XPGH 2BNRA 2YOCA 1MVUB 4MD4A 3W39A 3UJJL 3B9KA 5IBLD 3PE9A 3INUH 1AHWA 5IP4A 3FRPG 2XYCA 4HIIB 3HFML 1OAXL 4FTVB 3WIFA 5ESAB 3BWUC 3LH2H 4Y5VA 5D7LE 4DZBA 1VCAA 4GAJL 3MRIB 1W72H 1CTOA 3HMXH 4JFYB 3QWQB 5CD5D 4L1HA 4PJGA 2IEPA 2H32A 4OGAD 2MNUA 3H7BB 4MJ6B 1FZJA 1JZ5A 4YDIL 1E6OL 3SOBL 1H8NA 4ODWA 4G6JL 1XCTB 3TFKC 4HFUL 1JK8B 2OP4L 5IMLB 4KI1A 2YD3A 3CVHA 5IQ9B 4Z18A 1OAUH 2AQ3A 2RBLA 4R4BA 3ZMRA 2JELH 5DD1L 4YDVA 2E7HA 5L9DH 1NANH 1WZLA 4PJEE 4TRPH 4M5ZL 1BQUA 4GMTL 5CP3A 5JHDB 5M95B 3CLEL 4OCXH 4EUPH 3CXHK 4KRPB 2FO4B 3QCTL 5GS3A 2ATKB 3VXOB 1MUJB 2R2BA 2WBJB 4JDTL 3VFOB 2Y06L 2VXUL 1ZHNB 1FYTB 2CMRL 4KZEL 1H3GA 3KPRA 5T1DH 4XWOC 3O2DA 2QQNH 1WEJH 3SKNB 3PQYD 1I8KB 5FYLE 2Z93A 4FQ1L 4KUCF 4RGNE 3HPJA 4WI3A 3G5ZB 4ZFZA 1LE5A 1RMFL 4ONFH 5KS9A 3FOLA 5IHBA 1PY4A 1MRCL 1XGPB 1INEH 4LCIL 3VXME 2PYFA 5HDBE 3V0VB 4X6CA 1K6QH 2CXGA 3U46A 4AJ0A 1WFUA 2CRIA 2HT2D 4LDOB 1JPSL 1UB5A 3QEQB 1KULA 5MP6H 4FTVD 4Z0XB 3Q48A 3ARFA 5GGVL 4KTYA 1JRHH 4OLZL 1DBML 2VN7A 3IVKB 4U1MB 5JOPD 1JNHB 1HE7A 3IETB 5D7LA 1NDGA 4L8SA 1I1CA 5HSFA 4JO2L 1F2QA 2XZZA 4JPIA 2DQGL 1K5NA 2B4CH 3UTQA 1CLOL 3JWDL 1T2XA 4X6DE 5D2LE 2E7LA 4MZ3A 4NJ9H 1AD0B 2J8OA 4LHJB 5I1DB 5F7YC 4WW2B 2NQCA 3A6CL 4PY7A 2IAMA 3B9EA 4O4YH 5I71C 4IRZL 1DSFH 4FNLL 3MOBL 3M45A 1J05B 4OZHF 5ICZB 2XZQL 1M6OA 3F7PC 2AVGA 2OJEB 4M6AA 3QFDB 1J0HA 3LS5L 2K7QA 2NY0D 4PY8J 2C1OA 2Q6WB 1QA9B 4CW1A 1BVLB 4LKCA 2HTKC 4FQPA 5SX5H 3KYNA 1TQCC 2E9WA 2OI9B 3QDGE 3WYRA 2D7NA 2P5WE 3U9UA 2HJKA 4MAUH 4MXVE 2X2YA 4R6UA 2QKIB 1P4IH 3TBTA 1CFTB 3MFGB 4X0KA 1KPUB 3NCEB 1C16B 3MNZA 5AZEH 3ULUD 5C0AD 1A6WH 5C9KA 3LKSB 2VDNL 3WBDA 4R96B 1T03L 5C6WH 2XTLA 3QXAA 4Y19D 1ZXQA 3WHE0 3PHQA 3O6FD 5B38G 3QJHA 1KACB 4HH8A 5KTEL 4N9GB 5TGBA 2NTFB 4W4OA 3G5XB 4UB0H 2CJUL 4RZCA 3AU1A 4X6EA 2ORBL 1RQ5A 2V9RA 3TO4B 2R56H 5DZNA 1J0ZA 4L4VB 1BHGA 3ZHKA 2Z8SA 4MD5B 3ULSA 5EZOH 1A1OB 4IIQB 3GMNB 2QQLL 4QRPD 2CH8A 4HKBB 5H8DA 2VB5A 1NBVH 1X7QA 5FYKD 2R4SL 4N0FB 2NXZC 1UADC 3BGFC 1OCWL 5E00B 1CXEA 2B5IC 1NEUA 4YXLL 1OLLA 1A9BB 2VE6B 4M6OL 1QRNB 1EIBA 4PPTA 2YS4A 1A64A 4PTUA 1IFHH 1LO0H 4OZHE 5I8CB 2VLLA 5CZVL 4X7TA 1M7IB 1A14H 3S35H 4MS8C 4G6KL 5GXBB 2HT4D 4X5WB 1FNEA 1WV7T 3D18A 4CNIB 3VRJB 3NIFE 5DRXA 4FQXA 3UDWC 3CUPA 3BKCL 2AEQH 5C2BL 2BHYA 3C5SB 4N8VB 4KK6C 5E1AA 4AG4L 1EBPA 2Z0BA 4HK3N 4F58L 2ERJC 4ODXB 4CADB 3MV01 4I18B 3QO0A 4Q9CA 3KYNB 4OT1H 3UPAA 4ERSL 4RQQA 3NBNA 4NSKA 5I17A 5HHNA 4GT7A 1IE5A 1H3PH 2VDKL 2MCPL 1YEEH 1FZKA 1W0YT 4K9EC 5IW6B 5IHLB 4TUKL 2VQUA 5CJBA 3RVTC 1TVHB 1B88A 1CDCA 4Z7WE 3LQZA 4E42A 3H9SA 4DGVL 1I7UA 4NHUA 2VLMD 4UINL 3HZVB 1QQDA 5ERWA 1Q1JH 3I3DA 4Y89A 4PJ9B 4YE4L 2FEEL 4YHNA 3TO4D 4PGEB 2PXYB 4UI2A 5DO2D 2YBRA 2XNAA 4R0LC 2PO6B 3L5WB 4X99A 3IGAA 2IPKA 2HFGL 5I0ZA 1V7MH 2YA1A 2IBZX 4OZGE 3ARDD 3QB7C 3WSQH 1IGCL 1A1OA 4DWHA 5E5MA 2C3VA 2YA2A 5D72L 3CH1B 3FO0L 4Z95L 4ETQB 5FKPA 1T0NB 1KIPB 3OJDA 1CICA 1CGXA 4JKPL 4RRPG 1F6LL 4G8EB 4UILH 2Q8BH 1OF2A 1GIGL 4PJFE 3TH4T 1D5MA 3WJJA 3BEWB 3HE7C 2APTA 2YRPA 5H37G 1AGFB 1FYHB 1Z2KA 4KVNH 4PJFB 4CMMB 3BPOC 1P9MA 3PWLA 1UM6L 3ULVL 1FNEB 2XI9A 5KSUA 4G6JH 3FCTB 1BQHB 4D94A 1PDKA 1EGJL 2CLVA 5DR5L 1T5XA 4Z7OE 2VITA 4UV7L 5LG1A 4CRPA 5C0JA 3GMPA 4PGJA 4PV8B 1ZANH 4KTEL 5I1KL 5KANI 2AJSL 1N2RA 1OAXH 4MVBC 3AM8C 3MLYL 4Z7WF 1UVQB 4JKLA 4R8WL 1HZHL 1Q9OB 3RRQA 1IT9H 1EJOL 3SGEI 1CLYH 4GXUM 5JHDA 3QCTH 1CQYA 3C2AL 4UU9A 3GFUA 4JR9L 2HRPH 2WQ8A 4PP1C 1NMBH 2HJLB 2BXYA 1C12A 2GJ6E 2QQNL 4QRQA 5EU5B 4ODUB 4PV9A 1I3GH 1T1XA 2AGJL 3P4MB 4LGRB 4OLWL 4PJGB 1NMCC 1Z3GH 1IAIM 3LEYL 1ZHKA 1FNSL 5EBLA 3D1MC 3H7BA 4S1SH 1K3ZA 1I9RL 4XMLH 1INEL 4LCIH 2PYED 2XRAL 3DX6A 5JLZB 3B4NA 1AO7D 4H1LG 1NH6A 3M8OL 3L5WA 4X99B 4M5ZH 5GGTH 3BZDA 3RHWK 3DX8A 3VXUD 1NC2B 2ENSA 1GAFH 2NR6D 32C2B 1Y6KR 1XF2A 5F3HA 4KRMB 5MP6L 2YN3A 2V2XA 3ZYZA 3PWPD 3OKDB 4X6BA 3QIUB 4BUHA 1K4DA 4XVSH 1KJ2A 4M7LL 1WVZA 4PJ9C 4XAWH 3ZKMC 1HDMA 3FQUB 5DXWA 4LVOC 3TVMD 2YD4A 1C7TA 3GMMB 3T1FA 3EOBA 1JGDB 4J12A 4I9WE 3SCMA 1LP9A 3O4OC 3UBXG 5C07D 4YBLB 2A77H 1OAYH 3ESVF 4O5LL 5KN5A 3JWDH 4K9EL 5IB1A 1P69B 1I9IL 2XQBL 4Y1AD 4K7PH 4PY7B 3TC9A 2LAAA 1OD9A 3DMMA 4Y4HB 1ZA3A 2A9NL 4DK3A 5ICZA 4FFWD 5TQ0L 5F9OH 2IPTL 2XFXA 2ITCB 5D96B 2I9TA 3H42L 4H0IA 3BYTA 3IFOA 4X6DB 5D2LB 1IILE 4QOKD 1GGIH 4H20L 3DWTA 3F12A 5FKAB 1F4WH 5EO0A 2VQ1A 3NZ8A 3SDDB 3IVKA 5DJ6B 4BA8A 1P4BH 2NW3B 5FYJH 1WBYB 1CLOH 1T1ZA 3L3GB 4M7ZB 1FORL 2W9DL 3T0EC 2IH1A 4NC0B 2R23A 4YIQA 5KVMC 4U1NB 1LO5B 3CMGA 2AXFB 4KHTH 1U8OA 2YC1B 4NUJB 3ARSA 4BK4A 1C12B 3OPZH 1T03H 2Y07L 2Y7QB 2DQHL 4HS6A 1I7ZA 1BD2B 5IBUG 1CR9H 3ROOB 5DD0L 3VCLA 2ICEA 5GS0C 3IDXL 1L9NA 3FMGH 3IT8D 3PWJB 2X4TA 4OLUL 4CVZB 3VXMB 2HYMA 1NCTA 5LGKA 5ENWB 1VESA 4MX7B 4Z0BH 5C86A 5I8KL 3TVMB 1CBVL 1IARB 4NYLA 1FYTA 5SWSD 3SDYH 2IANE 2F74B 2J8UE 3K46A 4HJ0C 2FWOB 2HKHL 4OCSH 2F5BL 2QQLH 4HWBH 5SWZD 1BOYA 1WZ1L 1MQ8A 4WU7B 2BVEA 4NRXB 3RDTA 3PJSB 4U4BA 4OTXH 1BEYL 1UWEL 2DQTL 2YUWA 3I6GB 4M6OH 2OLDA 2K7PA 4CVXB 1N3NB 4GRMA 2PTTA 5FK9B 1BF2A 5D6DA 3HC4L 3Q6FA 4JDVB 3PWUA 3SHSA 5DTFA 1INQB 3VFNB 3D39E 5E8OB 4BKLB 4AY0A 3TH2T 4LSRL 3LEVH 5IMLA 1JV5A 5JOFA 1I7RA 2DLIA 1QFWM 5I75C 5F9WC 2M2DA 3VG9B 1A6TB 5DEFA 4HWZB 1C08B 3MV9D 2A9MH 2ZCHH 1V05A 1YEKH 1CN4A 2OXHA 3BKCH 5EFIA 2IAMB 1MJ8L 3BP7B 4DGYL 1XGUA 1KEGL 1MVUA 3MV7B 3VJ6B 4NJAL 1NBVL 1EEYA 3D3VA 1OL0A 3MR9A 4OZHB 1UGNA 1X5GA 2A2QT 4YDJA 3U9PH 3L3IB 3SO5A 3TIDA 5CHNB 1P84K 1S5HA 2M1KA 1OGAE 4HFWB 2ADGA 3T2QA 4QWWC 1AY1L 5GRUH 1FIGH 1TZHA 5F88B 3TBTB 4NHCH 3RVXD 4DGVH 2FX8L 3PV6B 5F7UA 5IBTH 4P5TB 2F9BT 3B8SA 1KFAH 4LKCB 3ROOA 3T8XA 4XBPB 2A6IA 5DJCB 1CXLA 5B38A 2XPGB 1EUTA 4P3DB 5H35A 4J1UB 4BSVB 3BE1H 4H0GA 5JQHC 2VZTA 3B9KD 1FC1A 4PGZA 3OAUH 5SV4A 4U1GB 5F9AC 4HUWA 4AH2A 2D3VA 4W70A 4NPYB 3FRUA 1T2JA 1D5ZB 3OGOE 4JPIB 4JFEA 2V17L 3QQ4A 1EEQA 2FO4A 3RKPA 1QP1A 1B4RA 4QY8B 3GI9H 4L8CA 2OQJB 1WBZA 2IBZY 1VPOH 3EYSH 5DVNA 2FECL 1DZBA 4JFEE 4TOYH 3BKJH 3ULVF 4RMWA 5J1TC 3PQYB 1OWRM 2VERN 4LQFL 4ZOBA 3ARDC 4Z77A 1S7TB 1OGTB 3GMNA 3L3KB 4PRIE 2XN9A 4X7DC 5DR5H 5E4IA 2H1PL 3KYAA 3STBA 2XG5A 5HYJA 4KXZI 1BP3B 4XCFL 5DUPL 3HB3D 5D5ME 5D72H 1CU4L 4Q9QL 4X9BA 4OD3H 1HH6B 1I8IB 5D71H 5J8OA 5E2VL 2BHZA 5IB4B 3EFDH 1IT9L 2NTSP 3BP6B 4TQEH 4Y4HC 5E8EB 4HJJH 1CS6A 2NZIA 1DL7H 3C2AH 2GTWB 4ETQA 4ZXBB 3BKML 1AHWC 5CZKA 4OM1H 1T7VA 1EO7A 3OGCA 3R8BB 4HUNB 4RGOL 2EYSB 4F7PB 4JM2C 4HZLB 2P1YA 4NNXB 4LVEA 4ZPTA 2QSVA 3JV0A 2BVUA 1N64L 3BP5B 3O6LL 5I0DA 3LQMA 3O4LD 3DIFA 1SM3L 3LZFL 1LDPL 2NY6B 5MENA 4OJFL 3BQUC 4KGJA 3C5ZD 3KJ6L 4KTEH 3EO1A 3FO9A 3CFIC 4U1IB 2G5BA 1M6OB 5DUML 4K3DL 4U2YA 1UEYA 3RDTD 1MSPA 1QLFB 2MQCA 3QZWA 1OWWA 5LGJA 5GRZA 5IGXL 1I7UB 2NYYC 1IAOB 1FV1A 2NPLX 1NMBL 5EO1B 1JNLL 3FQNB 1T0PB 1EJ6A 2DM2A 3MLRH 3MV7E 2VXTL 4ZFZB 3L3HA 2A77L 1WC7B 3REVB 5L8LB 4OCWL 4YHML 4OB5L 3NCMA 3O9WD 1HXYA 4OBRA 3TO2B 4P4KD 2JB6A 4B5EA 3I84A 2O5YH 2DIJA 4MXWH 3MLUL 4MQXD 5GGTL 4K7PL 4XBEH 2IGFH 2FB4H 4HUMB 4JAMA 1T3FB 2RHEA 4FOMA 7FABH 4C56D 3BSZL 3B6SB 1QTYT 4XAWL 3U7AA 1H15A 1LEGB 3CJJA 2ICES 5IKCA 3GSQA 4NQVB 4H20H 5T3XD 1F4WL 3VI3F 2G60H 4KAQH 2D0FA 5JXAH 3SEPA 5IEKA 3OSKA 1P4BL 3HLAA 3PL6C 1V7NH 3SDCC 3RTQC 3UZQA 1N6VA 1IC5L 3ISWA 3NIGE 5DRWA 2DI7A 4LHQB 3MLTA 4TSBL 4JANB 5DJDB 1R24A 1T21A 1A9BA 1P5VA 2VE6A 5DJZA 2YC1A 4YHNB 3MGAA 3G6AA 3N1MC 4YDLB 2ICWJ 1H0DA 3IFNH 1CK0H 4JHBA 3HC0A 3GIVB 4ZS7H 3RZCD 4WHYH 4EQ2A 3OXRB 1RIVL 1FC2D 3I75A 1FIEA 5IVNA 3VG0L 1K8DA 3CAFA 1CCZA 5F21B 3RVVD 3HNSL 4L9LB 3UYOD 4TUJA 5BS0D 3CFKA 4X9IA 1FORH 4XC3H 3IU4H 3TJEH 4LSUL 4JM4L 4JN2A 3QQNA 1ODAA 3O9WB 4AL8H 5BOZG 4P46C 3BP4A 3CC5A 3MRFA 3JTSB 4Y4FC 1OTSC 3UBXA 3MLWL 4K7PX 5HGDA 4KRPC 3A6OA 2R8SH 2YZ1A 4WY7H 3KR3L 3WFDH 5DJ2B 5HYSG 1BGXH 3C6LC 4P99A 4LDLB 3O3DB 3QJFA 4S1DC 1VACA 1C5DB 1P7QB 1MJ8H 3UTTE 4ZPVB 1UA6H 1A6ZA 1FFNA 4PJBF 4BUGA 1A9EB 2BY2A 3W5MA 1DLHB 4GG6B 5CGYC 3RVUC 3QG7L 1JPFA 1SVZA 1FLRH 4J4PA 5L7XL 2VDPL 4BSJA 2R0KL 1VFBA 3QDMB 2E9BA 3MSPA 3HC4H 2O61B 2ED7A 5I30L 3EYFA 3CNKA 2W0LA 3T65B 3MLTB 4ODUA 4Y16D 2CQVA 2ZZUT 2E7CA 2P44B 5CD3A 3HCVA 1NGWA 5DHYA 7CGTA 5DI8A 3I6LD 2DL2A 5GJSH 4PRBB 3CPLA 4JREB 4X4XA 2ZUTA 4OV6F 4IIQC 3J8F7 4DVRL 2OCFD 5K33A 1FYTE 4LHUA 1FZMA 5BW7C 3U0PB 3QH3B 4WHTA 4JKWA 5DEGB 2QKIA 5DVKA 5JZ7D 4LLUA 3SKOA 5GGUB 4AH2B 2ZUYA 5DQJB 5JW4R 3O9WA 3TIDB 4LU5H 3AB0B 4LCUB 4RFOL 3JTSA 5E6IA 1QFWH 4KROD 1G7IB 2D03L 1EA9C 3X3GL 2E8ZA 3TBYA 4XNZB 3V0WL 1N7ML 2GTZA 4C83B 5KVGL 1IJ9A 5HGHA 2B4CC 1KBGL 4JFDA 3SCMC 3PWUB 1VEOA 3N1QC 3GK8L 2J5LB 4N1CA 2VTFA 1OGTA 1R5VB 5HI3D 4PLNC 1MHPH 5CWSA 5F1IB 2VDML 4KRNA 4K2UL 2OTUA 4EI6B 4YEEA 3F7YA 3QIUD 5D71L 2X4SA 1T7ZA 5ICXA 3KPNA 3MJ6A 5DD5L 3EYSL 3LKOA 1JZ2A 2H2SC 4WI5A 1GC1H 4L4TA 3VXRB 4G3YL 5EH1A 3T0EE 2R69H 4HXBH 3GJEA 3EO0B 4EUPA 3R1GL 1HCFX 4GW1A 2EIZB 4XCEA 4RGOH 1T5XB 1AGCA 1KYOK 3L9RB 5JUEL 3RWGA 1IKFH 4KI5F 4YBQD 3D39D 1WFNA 5DRXB 5J9PA 1A7QH 1SBBA 4NYLB 2WW8A 1MCQA 3EYQC 3P9MA 4I5BB 1VADB 1KB5H 2FGZA 1TZIB 1W72L 3QH3A 4WHTB 3BX7C 3GMLB 4TQEL 3T0VA 3X13A 2EDOA 4OD1L 1QR1B 3E6HB 3QWRD 1ZS8B 5ANMA 2ZUVA 2ZSWB 3F65A 2R39A 4OM1L 2MFNA 2VR5A 4YDKL 2NW3A 4XXCC 1D9KD 3GHEL 4Q58C 5D7JA 2EXYD 4W81A 4ZQKA 1IGFL 5D1QB 2P24B 5IVXE 4UNVA 1LDPH 3NPSB 4JFEB 3O0RL 2HAZA 5FO7A 4HGKC 4LSPL 1BJMA 1FFQA 1EHXA 2O5YL 3UTZA 5HYFA 2VDOH 3T3PF 4F2MB 1U93A 2VXSH 4XBEL 3FJTA 2XWBB 4YR6B 5TFSH 3K81A 2JB5H 3TNMA 1WGOA 2V7NA 1RU9H 3WDIA 4R3SA 1U3HD 4PG9B 2KQMA 4UU9B 1HHKB 3HE6B 3NAAH 3ZDZE 1XF3B 4JKMA 5T3ZE 3VXRD 4XB8A 1SYSB 1ACZA 4YEFA 1FGNL 5HYJB 2F54A 3KPMA 1RZGB 4YHMH 2Z35A 1GCFA 3LB6C 1RUQL 1UM5H 4XBGA 2XTJB 1YEGH 5CEYA 2G2RA 2H2PD 3ARUA 5LKNA 4KKCC 1AGCB 4N8CH 4RMTA 4WGWB 5ITFA 3GSXA 5H35B 1BIHA 2DTML 1UZ8A 5IB5A 1OLZA 4PJ7B 4RMUA 1B0GB 4MCZA 1ZVHA 1NGXA 3GSWA 4IBLT 5FGBA 1SBSL 4UTAH 2XKNB 1L0XA 4PP2B 2IADA 5E2WL 1QRNA 5L88L 1EFXA 4P59H 2HLFC 4HW6A 1FGVL 5E6ID 3MGOB 3CFBB 3ZDXE 2DQFB 3ET9F 3DIFB 4Y2DB 1DSFL 4P2OC 1ZHBB 2PNDA 2R0LH 3F5WB 3QQ9D 5DMIL 5FHBL 5DRWB 3GB7B 4WJ5A 8FABA 2W0FA 4JANA 2IFFL 3KPQA 3UZVB 3AS0A 3LRHA 1YUHB 3TNNB 4IMKC 3MGTA 1FAIL 3PABA 3PDGA 4N9GA 5TGBB 3SDAB 5C70A 2DQIL 1MCPH 2EDWA 3BPLC 4JM2A 3NFSL 2VXVH 4F7TB 5GRJL 5L2KB 1FNGA 1IVLA 3THMH 1J7VR 1Q94B 1CFVL 3PP4L 2E7LC 5IW6A 3IXTB 1GGYA 3GDBA 3PIQB 2CKNA 4Z78B 4FQJH 2JIXD 4S1RL 3NCJL 4G9FD 4FP8L 1PAMA 1X7QB 4MB4A 3VE0A 1RZ8A 2VDPH 1G6RA 1I3RA 4LRIA 2H45A 4HKZA 2OI9C 2VR4A 2BVOA 2YPLE 4YHKH 1MCEA 5F7WC 5I9QB 1X5AA 1VB9A 2V9TA 1FJ1A 1IAKA 2GT9B 3Q2CA 2YKLL 4HKXA 5GJSL 1VKXA 1UZ8B 5IB5B 4AEFA 2EYRB 2XFXB 2XQYG 5I71B 2EZ0D 3DMMC 4XGZA 1DANT 1WLHA 1YPZF 4ETYA 5LGJB 2CDEA 4BQ8A 4M7JH 1A9EA 3H3PH 2XA8L 5MEPB 1K8IA 1OGAD 4P46B 1VENA 3MBXH 1I1RA 1AXIB 4Z7NF 2EDNA 4M43L 4GAGH 3ARQA 2ZPKH 1HWGB 5D2NA 5DQJA 3LPWA 2NY1D 3WHXB 4LF3B 5F1SA 2FD6H 3RNKA 1A2YB 1E0OB 1HH9A 3SDAD 2CDFA 4NKDA 3SKJL 2VLRE 2QHLA 1G7JB 5SWSE 1J87A 2NY4C 4FG6C 4PRAB 4XNYH 2X41A 1RJCA 3MV9E 2ZJSL 5HDOA 3W0WB 3NPSC 2D31B 1JBJA 3ZHDA 4IJ3C 1R6VA 4YK4B 1HNGA 4ZG1A 1RSFA 4Z7VF 3CVHH 3OF6D 1IGYA 1IGJB 4R4NC 4PS4L 2BDNH 4PR5A 4RAHA 3WJLA 4E5XB 1MELA 3ZDYF 1QZ1A 5DJAB 5IEKB 1OARL 4MDJB 3SQBA 5E99L 1CDJA 3UROR 4BFBD 4PY8I 4QRQB 1W72A 3CDYA 1KYOJ 3NZHL 3FQWB 1DLHA 3V2AR 1KSRA 2YPLA 4G3YH 5GRXG 1IZJA 4Z77B 5I15H 1D6EB 1VACB 4LCYB 2BNQE 1UACH 4QHMB 1IEAB 1QSEE 5JUEH 1XGYH 2FBOJ 1IKFL 4XRCA 3C6SA 2CD0A 4UZGA 3GKZA 1H5BC 1LK3L 1DQQB 4P9MH 1HQRB 1RZJC 3DBXB 4NPYA 1MAJA 3NACH 1KIQB 2ZG3A 3P73B 1MNUL 3HI5H 4TULL 4XX1E 8CGTA 4DKEL 4D9RE 2OZ4A 4O51B 3EDJA 4I5BA 2H3NB 1MJJA 4NUGH 3ULUH 2J88H 2E8YA 4UNTA 4WFFE 4WWKB 5E94B 4JN2B 5KOVC 1RJZB 1CL7I 4KJPD 3QAZC 4PLOB 4EBQL 5KN5B 2RQ8A 1JGLL 3LSOA 2BVQA 4IJ3B 2C4FU 3MRFB 3R1GH 3WIHA 1NGZA 2IQAB 5I75B 2YK1H 2QQKL 2MWCA 3QA3B 2ED9A 2NY2D 4NO5B 5E03A 2DN7A 4EUPB 1VEMA 1BPVA 3ZKND 1IGFH 1MAML 5KSAA 1LHZA 4CN6A 4LSPH 2QLVB 1YYMH 1S7UA 1KB5A 3P9WB 4P9HC 5I1KH 2VUOA 5IHZB 4C57C 4NQDB 5E2UL 4PJHA 1X6NA 3OAZK 4XPAH 1X5LA 1EJOH 3ARVA 3OXRA 1FV1B 5MEND 2H26B 2NY3C 3FQNA 1RPQA 4R3SB 3NAAL 4M7ZC 1NQBA 2GW5A 1SJHB 5EU3B 5CIPH 3DARA 4I48A 1U8KA 5BS0B 3RY5A 3PNWB 1F2XK 3BEVB 5SWZE 1NAMB 4EOWL 5FYJD 5HDLA 3O0RH 1IEHA 3SJVB 1T22A 3KS0J 1WBXB 1AKJD 1R5VA 5B22A 4XNMB 4OZ4A 1OTTC 4NN7C 4PJ5D 1DFBH 1DQTA 4I0PB 4PLKD 5TFSL 5DMGD 1S78D 1ED3B 1V3KA 2MQ0A 3CPLB 3L5HA 3X12A 2Q7NA 1OAQH 1XCQA 2F53D 3KWWA 1A22B 4MNQB 1BFVH 5GGRB 3OKNA 1RHFA 5GZNC 2DLFL 1M7IA 3H3KA 3K74B 4OZIF 1N8ZB 3L3HB 1F3JA 1MJJB 1T1YB 3BGMB 4XCEB 2NY2B 4I77H 3WHE1 1J0YA 5T5NF 2B2XL 2WANA 3L9RA 1Z9OA 3H9HA 3FAWA 4OGXH 3VRLE 4F7MB 4U0QB 2AXFA 1FPTH 1SJVA 1LO4H 2V5TA 5BQ7B 1C5BL 4FQXC 4OF0A 4HWZA 1BD2A 3DV6B 4Y19A 3ZLQC 4AENA 5MENB 3H42H 1XGTA 4HG4J 3L7EB 4NGHL 3E6HA 4HMDA 4NQDA 4H1LA 5AWNH 2FBJL 1SBSH 5F1IA 1R3JB 2OR8A 1MF2L 3QXTA 4KQ3L 1TTUA 5HYQA 3H0TB 3I2CH 2W9DH 1J8HA 4M93B 5DYOB 3TBWA 5MENE 1HSAB 5D7JC 1U41A 5FO8B 1KLFA 2XY1A 5HYSB 2DQEL 1M05A 1RUAH 1G7HA 1ZLWK 1WK0A 5HPMB 4R7DB 3PIQA 4OSUH 2H8PA 5IESH 5FHBH 1PQZA 2YMXH 1U8JA 5KSBF 1CR9L 3OAYH 4TUOB 3PWNB 3QUZA 4I0PD 2NY0C 1TQBC 4XBPA 2WZPD 3HMWL 3SQOH 5KSBB 4P9HH 4F7CB 1T6VN 4JFFB 4LFHG 1KCVL 2H6PB 5LVEA 3TNNA 2VXVL 1JHTB 1LQSR 4OCRL 3NCBB 5GRJH 2CKBA 3FN0L 1CFVH 4GQ9L 4PREA 3U1SH 5DLMH 4BJLA 3MZTA 2AJ3B 4M1GL 3HG1E 4NQCE 4CU8A 1TCMA 2C4FT 1X5KA 1A0QH 3VXSA 2DQTH 4XGZB 4POZC 1FFPB 4P2OA 4ZSOE 4ZFOA 4XT1C 3S96A 5JXED 2A73A 4HDIA 1S9WA 4N0YH 3C8KA 4QRPE 2YD5A 4H88L 2O5XH 2BSRA 3EYOA 4LPYA 4EIZC 3TN0D 2C3GA 4FFVD 5SWQB 5ID0B 1CXKA 3MRJA 1PG7W 3HTLX 3HUJA 4P4RB 3T0BA 3W0WA 1RJLB 3E2HB 3SPVB 4N0CD 4IHOA 3U9PL 3O4LA 1A7NH 5I8OL 4X4ME 4ZS6D 1AY1H 5ICYB 1G7MA 4UOW0 4CL7A 4NC1E 3SE9L 4GAGL 1TZIA 1VGEH 4D0BB 1OARH 4OIIH 1AD9A 1OW0A 2BNUA 2D7MA 3ILPA 4HT1L 4BSWA 5CD3B 32C2A 3GSUA 3GJFK 1C16A 4RNRB 1XF5B 2BCKA 2VYRE 2DWDA 3QDGD 3KPSE 1U8IB 3U6RB 4NOFA 2FJFA 4JFHE 2ITDA 3QIBC 2GYSA 2OMNA 3QIWA 3WMSA 2WLZA 4WV1B 4HQQL 4ORZC 3ULVC 3EYUL 3RWFB 5J3HC 5TPWH 1Z0NA 3GSOA 4DFIA 1FNHA 3K8MA 2Z31D 4OF8A 5EZIH 4I0CC 5CMAA 1A6ZB 3BPCA 1MNUH 3HI5L 3MV8D 4TULH 4WUUB 4L4VA 3MRLA 5TDOB 1U3HB 1ETZB 2PTVA 4NP4L 2XV6B 3F6LA 3NZHH 4S0TD 3D2UD 4Y5XA 1WF5A 2OL3H 3E2HC 3IU3A 3LSOB 4J4PC 2I9TB 2GTWA 1NJ9A 4NO2B 1BZQK 1PY9A 3ARGA 3BIKA 3DGGB 1SJXA 4WFED 3KYKH 1K4CA 1FO0H 4PG2A 3GHBL 4WTZG 5C0AA 3S88L 4P9ML 4Q6IA 1RK1B 5E8DL 3MO1B 4FA8A 4YK4C 3KLHC 5GS2D 4E0RB 2GY7B 1CU4H 4L3EE 4WNQA 1DQQA 4PLJD 1RJLA 2DS4A 2EDBA 2GFBB 4B41A 1CFTA 4X0KB 3WNOA 1B9ZA 3V6OA 1ZS8A 2XZCL 2Y7QA 3KYOA 3R8QA 3E0GA 3LKOB 3QI9A 5E1AB 3G04B 4BH7B 1B6UA 4LLUB 3TWCH 3WJJC 4I18A 3B9DA 2EE6A 3PWPA 4TVPH 4O9HL 4WUKL 1SEBB 3KPLB 2ADFH 4YDIH 3TVMA 1R3HB 3FT3A 4YFEA 1T5WA 4HC1L 4QRPA 5D8JL 1ZT4A 1MFEH 4C56E 1QSFE 5AUMA 5J1AB 2EC8A 4LLDA 3T4AB 5IM7B 2D9CA 3MCG1 4QCIB 3RUGF 4F33B 2QR0B 4HK0A 2AJZB 4JQIH 1YEIL 3GBLA 1TETH 3P0VL 2VZSA 2R4RL 2CUIA 2D7OA 4P23A 1KJMB 4XP1H 1DBJH 3DI2B 3ZYIA 1U6AH 2FX9H 4NRYA 4GKZA 2SEBA 5JNYA 5I9QC 3ARED 4MJID 4ACPA 4UBDD 1INQA 1I1AB 3OKKA 3VXNA 1WAAF 2DLFH 3MA7A 3EDEA 4K8RH 25C8L 4L29A 1EXUB 1HOCA 4JO3H 1UEMA 4U7KA 3Q3GB 2JJSC 4MQ7B 2P42B 3BD3A 1UKSA 1NCBH 1G0XA 4OFPA 5CZXD 1AQKH 3Q5OA 1HI6B 1HH9B 2ESVB 4CU7A 1FNAA 1KB9K 4IM8A 1U8PA 5DRZB 5EC2A 3MR9B 3IDNB 2BMKB 3SDCA 5I1CL 1YC8A 3GJFB 5C0IA 4MDIA 2R1WB 4X6CE 1BFVL 3MRHA 4WWKA 1OPGH 1JHLL 4G6ML 4I3RL 4NGHH 1U91B 5SX5K 4DN4H 1YNLH 5E2TH 3O45B 4YUEH 4PJAE 4KAQL 5T3ZD 3I75B 5ISZB 2CPCA 1T7XA 1MI5B 5I1IH 1VKXB 1MREH 1K8DB 2VLJE 3O8XA 4M1DH 2R29H 3BYYA 3JZ7A 3ZDXF 5TQ2H 3RUGA 4L9LA 4NM4H 5D7LD 5K9OA 4LHUD 4XP9L 4EKXA 1CFSB 4XVTL 1NBQA 2VABB 2Y1VA 3ARBD 1A4JB 1D6EA 2VDLH 4LPVA 5DHYB 2ADJB 3ROLB 3KHOA 4R4FH 1Q9LB 4ZUWA 3BESR 5C09D 3G5YB 3QFJE 5BZDB 2WBKA 1YEJL 2H26A 2V9QA 1KTRL 5L2KA 1MRDL 4RGNC 1I1AD 2ZNXA 2FJHA 4IDJH 2YEZA 3QUXA 3IXTA 5ADOL 5KSAC 4LIQE 3GUTB 5C6TH 3GGWB 4JM4H 1TENA 3U1SL 1NFDF 5T1KB 1HHJA 1F4XL 5L2KE 4KKBC 1GPOH 3L7FB 4Y8AA 5IQ7L 4HUUB 5FGCB 2FDBP 1P5UA 3X12B 1E4XH 5CJXC 1MIMH 3GB7A 4N5EC 3C8DA 3N1GC 1OF2B 3PGFL 1FG2A 4X4YB 1MWAH 2IC2A 4QHKI 3OB0H 4GS7C 2ZG2A 4F7EA 2Z93B 2WIMA 3EOBB 1RVFH 3QUYD 4GJTB 3OKEA 4EI5C 3MRRB 1XGPA 2EIDA 1EAJA 3O2VL 4HJGB 3VH8A 2AP2A 2F54E 4OCRH 5DA4A 1CLZH 2AK1H 3B5HA 2WUCH 3DTXA 3ZE0E 4IOFC 4Z76A 1X5FA 1NMAL 1FAKT 1I85C 2ICWB 3VI3E 1ITBB 1J11A 1W0VA 2R2EB 5AD0B 4HIHB 4LK4A 2JCCB 5FHAL 3VFRA 5L7XH 2Z31A 3VXPA 3GBNH 3LD8C 3T1WA 2YSSB 3SPVA 1Q9KA 4PRPB 4G6FB 1UWGL 2I60H 5C0ND 3WLWD 3P11H 4NBYB 3RUGB 3SJVE 3NABH 2A83A 2GSGB 4PB9L 1DEEB 1A6PA 4RISL 4WU5B 2EE9A 5FDWA 2G5BB 5ESQA 3UZEA 3OHXB 5C09B 1EMTH 4G42B 2UVFA 5F3BB 3K3QA 1E4WL 3FO1B 3SY0A 4GXVH 1WEJL 2DI8A 3BRFA 4HIEB 1K3IA 4U1HB 3CZJA 4RWHA 1ZEAL 4LVNC 4M1CC 4HLZG 4N0CC 4NO5A 5ANME 3S3SA 3GSNA 4ALAL 2AK4E 2N7AA 5F3HB 4XB7A 2YPLD 4OKVA 3U4AA 3KPPB 4G8GA 2LTQC 5T5FL 3KHQA 1T66C 2MCPH 5HYSA 3QUXB 3V4VL 3VFVA 3ZTJH 4F7TA 1A7NL 3QXVA 5IG7B 5I76B 3IJHB 1EAPB 2NY7H 5CINL 3OR6A 4XMPH 1RURH 1I75A 1HYSD 1VGEL 2BNRE 4NZJA 1G9ML 5DQ9B 4ELKB 4HT1H 1G7MB 4ZAKC 1QO3B 2HA1A 4O2EA 3BAEH 5FDYA 5EBMA 1A47A 1F02I 5FM8A 3LDBB 1JN6A 3C6SB 4OGAC 5KVGH 2YRZA 5HI3C 2F5AH 4XH2A 1R5WB 3MUZ1 5AAMA 5JORB 4ELMF 2YD9A 3EAKA 2Q76A 1FQ9C 1U93B 3DV6A 3OR7A 1ZT1A 1LEKB 4X6EB 3I50H 4KJYB 3HI1B 3V7AE 4WV1A 3V4UL 4PJ5B 1W0VB 4FNLH 4RX4D 4LP5A 3FO0H 3CCHA 3CU1A 4QF1A 1FL5A 4JVWA 1EUUA 1XAUA 1ZSDA 1GSMA 3UO1H 4A6YL 1QYGL 3T3ME 4GW4A 5KS9F 1WT5C 2AJVH 5DJXA 3QULB 2VLJD 4GRLA 4Y5VB 5C0CE 4DCQA 4N0UB 2OL3L 3N9GL 5ANMB 5KG9B 3WUWA 4FQHA 4WHDA 1Y0LB 2FGWH 3KAAA 4NN5B 5DJ0B 2I27N 1SHMA 3FFCD 4N1HB 4NQTA 3V6OC 1A2YA 3WFEH 2NZ9C 2AI0H 5C9JB 5F6HJ 4FS0A 2AEIT 1EFXD 4OUOA 2P5EE 5BCAA 1JYXA 2FO1A 1DJSA 5EOCL 1PGRB 1JHTA 5CKAA 5J12C 4JRXE 1NC4B 4PGBA 2HLAA 3QXDA 3BP4B 3OZ9L 3Q0HA 4A2LA 4Y4HD 1TETL 4BH8B 1DN2A 4M6NL 5J56B 1ZV5A 5KSVB 1DBJL 2FX9L 4PJDE 1ZLWH 4JR9H 1KJMA 3QUZC 1WIPA 4NRXA 4TVPL 5GPRA 3VGBA 2RJMA 25C8H 2PCPA 2WBWB 1JZ3A 3FTGA 4XCNA 5EZOL 1X5HA 5KVFH 4LFHD 4YH6A 5CMAB 2HVJA 2JJWA 3D3VD 4XMLL 3BQUD 4XNMA 1FNFA 5DD3L 2C9AA 5JOFB 5EIIB 1AQKL 1FP5A 3ARBA 3MRLB 3C9NA 5IHZA 3UDWA 3ZTNH 2HMID 1ORQA 3BZEB 2JB5L 1LO0L 3CZFA 3KWWB 4X4MA 5CZVH 3FT2A 3S35L 1I8LA 5D1ZD 3QUML 4Y2OA 1UB5B 3CMOL 2H6PA 1CFQB 4H25A 4Z7UF 2WWMD 4M6MH 1N5YL 4LAJH 1F3JB 1MPAL 2M26A 4P23B 4QRRD 1UCTA 1BIIB 5FA3B 4X83A 3P77B 2MCG1 1ZSDB 4LIQH 3RL2B 1S5HB 3MCKB 3V4PL 5L6YH 4NFCA 4F58H 3FZUC 1PKQE 5GZOD 3ES6B 3ELAT 3I9GH 3IDGA 2YD1A 3UYRH 1I3RB 1M7DB 3B2UD 1NL0H 3RAJH 4ZFOB 3AAZB 1HN1A 5KVDL 1ZHBA 3F5WA 1TCRB 3LAFA 3HPLB 5TQ0H 5TE6L 1P53A 2B7DT 3MLVH 4ONOA 4JFXB 3HZKB 1JYNA 3T4YB 1QSFD 4OAWA 3ZKQD 3EYOB 3MMEB 3VFSA 1CDUA 4YUEL 5GRYA 4GG6F 3QEGH 3QPQD 3EOTL 5CILH 3HZMA 3RWCA 3DHJA 3T08A 5SWQA 1L4IA 3WNNA 1J10A 2R29L 4DKDC 3VD4A 4QYOA 1YZZA 4LARL 4M62L 3RWEA 4U1KA 4R90L 1I1FA 4FABL 2F53E 1BM3L 1MI5A 4RIRB 4ZUUA 1OP3K 1SYVA 2OMBA 3UJTL 3OPZL 1NCNA 4YQXL 5F9JA 5HDBF 5CLTA 2LVCA 3BHBB 5EUKB 2HKFH 4QHLB 5J6GA 5BVPH 1G1CA 5I1EH 3C8HA 1QRNE 3E8UH 2W59A 4R96A 5K9OB 2H9GB 3L5IA 3T3PE 3NFNB 3C87A 4YZFE 3DECA 2IALB 1YN7A 2ZUWA 4BSWB 3KPOA 4KUZL 1YEFH 5I16B 5J13C 1MFBH 5D5MB 1D5XA 4Z7UE 5F9WB 4YJZL 1R3JA 5E0QA 4LSQH 4YGAB 5IMMA 1CLZL 2AK1L 2YXFA 2ESVA 3BD4A 4FN0A 2E27H 1B6DA 4NZTL 4WO4A 4EIGB 2GFBA 5C8JA 4R26H 4QNPF 4D8PA 1NEZA 3GBNL 4I8DA 1QNZL 2Z31B 2R1WA 2ZUQB 1UJTA 4JRXD 3C08L 3MV8B 2GJ6A 1J5OL 1F8TL 1P6AB 3MYJB 4HMCA 3MLYH 3H9HB 3TA3C 5C0EA 1N26A 1CLYL 5CJ8A 1FYTD 5HBBA 1IGTB 5KANG 1ZT4B 4NN6C 1PX4A 3TT3L 1HSBB 2OTPA 3OHXA 5C09A 4LLDB 4U3CA 2NX5D 1LNUB 1KN2H 1H5BA 2FL5A 2GK0B 5HHQB 3WNPA 4WW1A 2NY6C 4KDTA 1XF1A 4LASH 4ONGL 4IHOB 3QP3A 4XMKH 4OAWB 3LEYH 5F97E 1KT2A 2FNBA 2XXMB 1XZ0B 4ORGB 3BN9C 3BO8A 1CD1B 2E3VA 4O2CA 5T3XH 3QHZL 4PJIA 3TBVA 4D9RD 5EZLA 5DJ6A 2CK0H 5KAQG 4JG1L 5IVOA 1I4FA 3GSVA 5CINH 3NABL 2NCMA 1EVTC 3QAZB 4PB9H 4XVJH 3OR6B 4RNRA 3REVA 1J1XH 5DJAA 1GRWA 1QFHA 3SKJH 5JR1H 4JY4A 2FATL 3BWAB 1NBYA 4A6YA 1HXYB 3BOVA 2BNQD 4PGDB 4X6CF 3G6DL 5TDNA 4ZTOL 4OLYL 5DK0A 3IKKA 4JPVH 5EC2B 3DO3A 4NQCB 1A7PH 4UT7L 3VCLB 1S7WA 1O7SA 2Q1EA 3AUVA 5C0CA 3V6ZA 4K94C 3HZYA 5GISL 2UZXB 2VJXA 4BQ6A 4QXTB 2ARWA 1MLBA 5J11B 3FO1A 3SY0B 5IHUL 5T5FH 3VGGA 3IDMA 4GRWE 2VLRA 3V4VH 4G8GE 5IVZB 3O4LB 1RZGA 3ARGD 3OR7B 4U1GC 3RVTD 1YPZA 43C9A 3CX5J 2GJZB 3GRWH 1U8MB 1GGCH 1ROWA 2VLME 1RURL 5GGRY 3QEUA 3U7WL 4WEBL 3UYPA 2V17H 2QADB 4ZUVB 3RHWF 2NY0B 4PGCB 3S34L 5LCVL 5F8RC 4Q0XL 2AK4D 3TT1L 1XGQB 1MCBA 1TVBB 4MA7L 2IBBA 4MAYC 2APXA 1NAMA 3DOSA 5TF0A 5DO2C 5BS0E 5CSZB 1J18A 5I15L 4ZD3L 3CVHB 1U8IA 3N9GH 1PBYA 5SX4H 3FB5B 4PRPA 5E9DD 12E8L 1A3LH 3S97C 4BQBA 5MI0C 5ALBL 1JV5B 5ELIA 1H3XA 1OOAA 1UYWL 1AE6H 4POYA 3GEWB 3EFFB 4KZDL 5ACZB 5GHWH 5CP3H 3WS3A 4Y5YC 5A3ID 1AR2A 4P2RE 4OD3L 5ITBH 4KMTL 4DKEH 3WNKA 5DEZA 2AEWA 3LCYA 3UO1L 3QXDB 1QYGH 1WFOA 1A6UL 1JFQH 4PJIF 5IOPB 3NTCH 5FDWB 5LGHL 4HUUA 3VG9C 1X9QA 5ISZD 5KS9B 4GW4B 4NCC2 1NGYB 3MRBA 4JM2B 2HKHH 2OTWA 3GSRB 2G9HA 4R4BB 4X6CB 2EDDA 3ILPB 4L8DB 1YA5A 5GJTH 1DQML 3MCLH 3S37H 5D1XA 1PEZA 4JZJA 1W0WB 4NO0B 4EN3D 5I1GH 2UZYB 35C8H 1XR9A 1BEYH 1M71A 1UWEH 3I6KB 3U7YH 1J12A 1OTUD 4PTTA 2AV7B 3RDTC 4Z5RB 2CO7B 2ZSVA 4Z8FL 4PRHB 5JQ6L 3VXQB 1Q9LA 4UDTA 4ZAKB 5JW3L 1UH2A 1ZHNA 4L8SB 1JN6B 3OJDB 5F7FA 1D5BA 5GGQL 1BZ7A 1MLCA 4PJFF 5EUOA 2EDRA 1XCQB 1YMMB 3I3EA 2DBLL 3C60A 3IJSB 3MUGA 1S9YA 1R3HA 4MD4B 4D9LH 4NZUH 3SBWA 4P4KC 1SY6A 3SGJA 4N0RA 2DKMA 2D2OA 3D25A 3M17A 3WCYA 2MOVA 3U2SA 2R0ZH 3UPRA 3V0VA 4XVUC 2VITB 4J3XA 5ILTH 3UYRL 3G6JA 1B0RA 1JE6A 2V2TA 2A6DA 2BSSB 1DFBL 1ZA6B 1RZ7L 4FXGB 4P49A 5C0IB 4F8QA 3TIEA 2DKUA 5I8EB 3BSZH 1OAQL 2Y36L 1OM3L 1IL1A 3QCUH 3QUMH 2OR7A 4PJCA 1OB1B 5MEPA 1TNNA 5ACZA 3VMPA 1M7XA 5IBTL 4H26A 2EIZA 1MRFH 1PKQB 1I7TB 1NCAL 4AT6B 3VFVB 1DEDA 2VISB 3SDCD 2FIRT 2IPUK 4BFEA 4LIQL 5EU7C 1NGPL 4XP5H 2PW2A 4HJ0D 4YX2H 2J8UB 1CE1L 4M62H 1DLFH 5HGGS 3RWEB 3VGFA 3CGTA 5I1HH 3H0TA 1JPGA 1J1OH 1DBBL 3MRGB 4LSTL 5IK3A 1Q9KB 1DBKL 2UUDK 3BXNB 2P8MA 3BHBA 5EUKA 2P48B 1FSKB 1OHQA 5TE6H 5K93A 2MJWA 3PWNA 3QUZB 1KN4L 5HGHB 4NZRH 4KDVA 4LL9A 5KSVA 3IB4A 4K94H 2QR0A 3UJIH 1I1YA 5E08L 4RFEA 3GGWA 5HI4C 1QSEB 3LKNA 2FX7L 2FRGP 5E00A 4L3CB 1T2QL 4M5YL 5FF6B 1BFOA 4YFLI 3UJTH 1AC6A 1PZ5B 5B21A 3QEQA 3WNLA 4RRPA 2FJGA 2AJ3A 1CE6A 2FZ3A 4IRJD 1RZFH 5JDSA 4F7EB 4XCFH 3EZ8A 1CFQA 1PG7X 1HNFA 4MQ7A 4U0RB 3C08H 1CTNA 2XICA 1VGKA 4QWWD 3QEQE 1YYLH 4Y5VC 3VDAA 4P9HL 4LVHC 4GAJH 3G9AB 4AK1A 3HUJE 2C3VB 1C5CL 3C6LB 4R0LB 1GXEA 5DDHA 4LSQL 4OI8A 4OCYL 3WFHB 3IDGB 4MMZC 4M02A 1DUYA 1S9VB 4CU6A 2L4OA 1ADQH 4WW2F 3QNXB 3TZVB 3N85L 2VLRD 5EB9A 1ZWIB 3VXPB 5ETUB 2UWEF 4OLVH 3QG6A 3QNZA 3QCVL 5LJYH 4YBLC 2CRYA 3ECBA 4OI9A 5MI0B 5T3XL 3MPCA 1YNTA 3QHZH 3U36A 2DI9A 1Z6JT 1WUNT 4L3ED 2CK0L 4KWUA 1UC6A 4N5UA 2B0SH 2UZIL 4XWGH 1A7OL 1RIUL 1KB5B 4PJ8D 5CSBA 1B4JL 5I19H 3X11A 3Q5YA 2O5XL 4JDTH 1G9NC 3TT3H 3VW3H 2CK2A 1OP5K 1GL4B 1CFNB 4YHPA 3EYVA 4OLYH 3MLSL 2IG2L 1FBIL 1UXWB 2P7TB 5MEOA 1KELL 4QXGH 2VAAA 3ZYOA 3OJVC 3H2WA 2JCCA 2AXGA 2HT3D 3LIZL 3OAYK 5I76A 3C60D 3DUUA 3L3JB 4L3AA 4NN7B 2NW2A 2BVPB 1F11B 3U7WH 2B1AH 3AVEA 4YBHA 1X3DA 4OIIL 1DUZB 3SDAC 1PYWB 5LCVH 3O8XD 5C0FA 4QXUH 4D3CH 1DVFA 1NLDL 1JZ4A 4XBGB 4WTWA 2E6PA 1U3HA 4QOKA 1EHNA 5DA0B 4PB0L 4HEME 3QIUA 4DAGH 4XC1H 1FO0A 4D0DA 2KPNA 1G9NH 4ZODA 3DRQA 5IW1A 5F1KC 12E8H 1RZ8B 4JGUA 4NJ9L 4EDXB 4YO0A 3A6CH 3CCHB 4DGIH 1KEMH 1MFDL 4XHQA 3MOBH 1SY6L 3R4DA 5I73C 3QNZB 3S34H 5EU4B 1IEBA 4EXKA 5I1LB 5IVXB 1K5NB 2EECA 1IC1A 1NCWH 3FHAA 1HIML 4MAYB 4C56A 5LGHH 3WXWL 4Y5YA 3CFCL 5B38B 3MCKA 4OQTH 3CXHJ 2KKQA 3KYKL 4WCYH 4UIKH 4IOSD 4KK8C 4LSUH 5HGAA 1NBZA 1WT5A 3QFJD 35C8L 1XZ0A 4ORGA 5F3BA 5LWYH 2OJZH 1ZGLA 4YLQT 2YUVA 4P5MB 5ITBL 3FN3A 3TBSA 4L9DA 1KB5L 3GBML 3MX0A 2DLGA 4G8GB 1A4KA 5BZWA 5IWLC 2OZ4H 3O3EB 4N9OB 4OM0L 1AGEB 5IG7A 4YHYB 1XIWD 3O81A 4MA1C 2HFTA 4C59B 4YDKH 4K7FA 3U82B 5E4EC 3C5JA 4HEPG 2NY5H 2GJ6B 2J4WH 4UTBH 1UA6L 4TTDC 3W82A 1IKNA 5JLZA 3OAZH 2R1YB 4LSDA 3D25B 3M17B 2O93L 5E6IB 2BHUA 1BX2A 1CF8L 1FVCB 4OZFH 5H2BB 1U8NB 1K2DB 2DLEA 3O2WH 4HS3A 1BD2D 4B0MM 4NNPH 2D4DA 3L3OA 1PLGH 1WTGT 1EZVX 3KVQA 1U6AL 5GGQH 2BK8A 4POUB 1N3NA 1Z0MA 2N4IA 2FHCA 1MWAB 5F70A 3A6BH 4HXAH 3VXUA 2O5ZL 1LEIA 5CSZA 3S3PA 4XP5L 4R2GD 9CGTA 5EORL 1RULL 3O9WC 2R0ZL 2ZWLT 4JKKA 5JDJA 5CS7A 3QULA 5I1HL 4MQXC 1H3PL 2VDKH 3G9VA 4LSTH 4PD4K 3CLFL 1U36A 5FECA 5HHVL 3DYOA 4WGVB 1O5DT 1JP5A 5BVJA 5J7CC 3ZSSA 2EICA 2X4PA 3QCUL 4LGSB 1CD8A 1KJ3L 5J13B 1MLBB 4GG6E 3MJ9H 4Y1AA 4PRNB 2OYPA 2NX5B 3JWOL 2I26N 4ZFOL 1IGMH 3O6MH 5FM5O 3P9MB 4NM8L 1T1ZB 3SGDI 1N7MH 5C7XL 5FYKH 4JG0H 4EDWH 1NAKH 3QT2A 3OMZA 5F9JB 3IKCB 5EWIH 4W68A 1G7LA 4CMHC 4YXKH 4E41E 3GMRA 5CEZH 4HWNA 1T0MB 3LPFA 5DUBA 3B3IA 2ZOKB 1QLEH 4K2UH 5TE4L 4NKOA 2VLJA 4GRLD 4TSCL 2LU4A 3HA0A 1MVFA 5IFJA 3DI3B 1YYLL 1XGRB 4Z95H 5IR1B 4NZRL 4U1HA 3B9VA 4WFHD 4PJCF 4RGMC 4H8WL 3SGEH 3H6JA 4I0KA 3QI9C 1UJ3B 1YY9D 4P5KB 3THML 1MCOL 4WIQA 3N1FC 1RJYB 3QJFB 4J3WA 5DVOA 5HHPB 3MUHL 1TIUA 1URLA 4HFWA 3WNMA 1BJ1H 3C5ZB 3OJ2C 4UOW1 3VFTB 2A6KA 3P30L 4F37K 4AEHL 2WP3T 1GJIA 2HH0L 2CDGA 3ECBB 3RL2A 2A6DB 3MBED 4N8VA 4ODSL 3AB0C 1VHPA 3OKMB 4KRPD 1RVFL 5DD6B 1YJDC 2D7QA 5I8EA 1AHWB 3BH8A 2Z91B 2DKSA 1VSCA 4HF5L 5DK2B 2Z8WC 3TF7C 4WU5A 1EPFA 2J3SA 3S5LG 2QHRH 4L4TD 3ULVE 2F19L 1I8MA 2XKUA 2AGJH 3DETC 3BXNA 4HCRH 3T4YA 4NQEB 4M9OA 2QJDA 4X8JA 3W11C 1BZ7B 1XR8B 4Y19B 4PJXF 4L1DA 4TNVF 2D9QB 1YEDB 3RU8L 3SKMA 2ZOLA 1N59B 4JVUA 2WIIB 3D5OF 4P5TA 4GO6B 1NBYB 1IZKA 4XPTH 5DUBB 3DO7A 4OZIB 4N90D 1NLDH 4RA0C 5D7KD 2IAMC 1QLRA 4PJCE 1FE8L 1KC5L 4L4VD 4GXVL 2D7TL 3MLSH 5A2IH 5IJKA 4Y8DC 2D7PA 3QUMA 1P7QD 1FGNH 3B5TA 2APWA 4LOUD 4M48H 3MGTB 2PO6C 4U33A 1HXMB 4OZIE 5HHOD 3QZWG 3DSFH 4GG6A 1CICB 2GJZA 2P7TA 5J12B 3D69A 4X98A 3TBVB 4LAQH 1NCDL 2BDNL 1FL6A 3O2DL 1EERB 1NFIA 2IQ9L 3BUTA 3WFZA 3FB6B 3G5ZA 2B1AL 4MD0B 2O26U 1SY6H 2MHAA 2HWZL 4ZAKD 2XT1B 4QRUA 2MPAL 2Y23A 3RKDD 1J1PH 5D2NC 1BMGA 3U83A 1QG3A 1QSZA 4EI6A 3CU7A 4JLRB 1UCBH 4D3CL 3S98A 3O6FA 3OWEA 4BM7A 3MOAH 2HVJB 2VIRB 3HG1D 3WXWH 2BZDA 2P43B 4QKXB 2VXQH 5FAAA 3ILQC 4PBXA 1CGUA 1WWAX 3LN9A 4H8WC 3MRHB 5GS1A 4L4TB 3SCMD 5E2WH 4UIMA 4NKQB 1J8HD 3SE8L 4EZMA 3H9SE 3T77A 3P4NA 1CWVA 3ZKXC 4WFHE 2WSKA 4HV8B 2P4AB 3MJGX 1IAII 5LWYL 1QLFA 5FGSA 4YO0B 3SGKA 3A67L 4PJXE 5D1XD 2Q7YA 3LQAC 4UV4L 2B39A 3IDXH 4W4OC 3MRPA 4KJPC 2XWJB 5A1AA 4LCUA 3W9DB 4GFTB 3V5HA 4EEEA 3PGCB 4MHHI 4PJ9D 5D4QA 3ZKMD 4HSQA 4UDUA 2EYSA 4F7PA 1C8PA 1G0YR 3TO2A 4MJ2A 4HS8H 1NDMA 2IANB 1U92B 2HG5B 2V2XB 4XWOD 4B50A 4KK9D 3IRPX 3UAJC 2AI0L 3OJMB 5HHOB 4URTB 4XNUL 3QWOB 2X4TB 1D5ZA 5E8PA 3DUSB 2Q8AH 2HTLD 1TQBB 2Y6SC 4QY8A 3TLRA 4TSAH 4JPKL 4J8RB 5FO7B 4YNYA 1VFMA 1MAKA 4AIZA 1MJ7L 4E41A 5B8CA 4I3SH 3QUZD 2JLLA 3ZSTA 1G9EA 3MTRA 4FFWC 1P7KA 1HHHB 5FB8A 3UTSE 5LAXB 4JEGB 2QV2A 4LVOB 3KYMA 43CAA 3P9LB 3BDYH 3RIAF 4RA3A 1PSKH 2K9UA 2VKWA 2BX5A 1HHGB 1QEWB 2R0WH 1UZ6F 3GRWA 5E6IC 1XR9B 3EJZC 4DN3L 4X6DA 5D2LA 2KZ1B 2LAGB 5L2JB 3BIBX 2DAVA 5SWSA 3WUWG 3QDJD 1M7DA 3QQ9C 3WDHA 5IMOB 1FIGL 4QGYA 4ZXBA 4NWTL 4OLEA 4X7EC 5DRNB 4NHCL 5IKCB 4G8FA 1J9CT 3QIWC 2DIBA 5FUZL 2XG4A 3U48A 5ITFB 1MH5A 4M6ML 4X80H 2A38A 4OZHA 4HXAL 4AIOA 1MEXL 5F1OB 5KW9L 1CDHA 2AJXH 4FXKB 4RCAA 5ESQB 3QDGA 5TH2B 2ICEB 3KNBB 4HLJA 4G7VH 3TN0A 2GAZA 2P5WA 4P3CL 4QOKE 1RULH 3EO1B 4HGWA 3AGVA 1TTGA 1NFKA 1HHIA 1YNKL 5L8JB 1C5BH 1NC2D 5JIHA 3QUYA 2W65A 2OK0H 4TSCH 4ODHL 2B1HL 4X6FA 1JNNL 1JGVL 3F62A 3EDFA 1A5FL 1MY7A 3GI9L 2H9GA 4PG9A 4TN9A 3PJSA 3ZE2F 1JWUA 2OX5A 5B39A 3O6ML 1GOGA 4YHPB 4MNGA 1MCKA 4R9HA 5BW7A 5FCSH 4JG0L 3FRUB 2VAAB 3CVIH 4LARH 4WHCA 1BQHG 4M93C 4NHUB 5ERWB 3UP1A 4XP6H 2DQEH 5C0CD 4YXKL 3GSVB 3IF1A 5KVEL 5CEYB 1T3FA 2NXZB 1QBLH 3P9LA 5C0RH 4Y4KD 4MCYB 4S2SB 5TE4H 4P57B 3B8YA 4GRWH 4LPUA 5E2VH 1JWSA 3F7VB 4NUGL 3ULUL 4NT6A 1G6RB 4S1DD 4DTGH 1W8NA 2LFGA 2X4QA 2XTJE 2HT4C 4PD4J 1RD6A 4DFHA 3MO1A 3TIEB 1LO2L 1N6QH 4QTHA 4QXWA 3UMTA 2YK1L 5JO5A 2UWEE 2J6EA 5I2IB 3PDDA 1LNUA 4KK6D 2VLKD 3AROA 4KXZH 4XPGL 4JQVA 4LLMA 3B83A 1OAUL 5HPOA 2ILLA 3GSNL 2X4NB 4RDQF 4UQ2B 2EEAA 3KJ6H 4K7FB 3BW9B 5CAYB 2DM7A 2KQNA 4OGYH 1YDPA 2RCSL 5E2UH 3L5XL 1SEBA 5EZLB 3T0EA 5J4MA 1U95A 4HUXB 4LNRA 4U2ZA 3HNVL 2K3TA 1XH3B 4GG8B 2BP3A 5FUCC 2VDQL 4FMFA 4WFEE 3T2PA 1Q72H 4G43B 2P8MB 4GSDL 2J1KA 4JPWL 3D2UB 2GEEA 5D7IF 1AQDB 3JV5A 4PJ8A 4HK0B 4AQ1B 1J0JA 3QQ4B 3UCRA 3ARFC 3WS3B 4ONFL 2DOCA 3DSFL 5C0CB 3RL1A 1Y18B 4EVNA 3MJ8A 2ADJA 4QXTA 5EOTA 3BMVA 2ATPB 4PJEF 2GSIB 4NRZA 2B5IB 2X7LB 1A6VH 3RWIA 4L8BB 1F3DJ 2D0GA 4XVJL 4G8GD 3WFCH 5EG6C 5FO8A 3LKRB 1L7TH 5FO9A 1J1PL 3HNTL 3LHPL 2XN9B 4QOKB 4OLZH 4PGCA 5DMJB 2FH6A 2X05A 3FT2B 2QL1A 3VGDA 4LOUC 5ID1B 3MRQA 3S5LB 1AXTL 2CSPA 4NCC1 3RTQA 4JZNB 1PVHA 2AV1B 2EO9A 5CWSB 4F3FA 5JPNB 1FFOB 3T77B 1C1EH 3PV7A 2BRQA 1VFUA 4UUJB 5DVLA 2BFVH 2X4UA 1MLCB 1OAZL 1ZWIA 4G80B 4Z7NE 3WD5L 4NP4H 3SE3C 4KJQD 4P5TD 4KKNA 1ORSA 2BOCA 3JBG7 3LRSB 3WO4C 3NIDF 2WM0A 2NYYD 3AREB 4Z7VA 4JO2H 4HD9A 3FRPA 3VWJC 1U2CA 3DRQB 5IW1B 5JOEA 1EDQA 1CQKA 5CGMA 3SE8H 3RUGE 4NFDA 3S88H 3MRBB 3O3UN 3KLHD 3U30C 2BSTB 1RUKL 1RUAL 1F3RB 2OTWB 2VRAA 4NSKB 1NFDE 4NKMB 2XTJD 4J7RA 4WV1C 2Q8AL 4X5XB 3WXVH 4JPKH 3FO2A 3MRNB 3E6FA 1FH5L 5C0AE 5HI5C 3BPLB 3QFJA 1FSKC 2Q7YB 4DKFH 4WY7L 1NEZG 3KR3H 2AKRB 1KCVH 2JB6B 1BGXL 4MAUL 3L3DB 3EGSB 3TYGL 1YN6B 1YUHA 2P5WD 4NN5C 1YECH 3K8KA 4XTRD 4OKVB 5GRVL 1AP2A 5T33L 1JGEB 1X5JA 3FN0H 3VD5A 4HIXH 2XNAB 4LBEB 4G9DA 4ZO6A 1DQMH 1IC4L 4MJIA 4HBCH 4F9LC 5CEXA 4IS6B 1MFEL 1MHHA 1OTUC 4XXCA 1FLRL 1NUNB 2DM4A 4R7NA 3RPKA 1OCWH 3MA9L 5I1JH 1M4KA 2UY6A 4LLWA 2C5DC 3PG2A 4U0RC 1QSFA 4MSWA 5CIPB 3DX9B 4PJEB 5HHME 2KDGA 2V7HB 4CN1A 4DOHB 1CGVA 1KPRA 5I74B 5TE7L 3QEHB 2BVQB 5J57B 1JZ6A 5C2BH 1WQVT 5E5RB 3SN6N 1AD0A 4FXKA 5GS1B 3EJZD 3B9KB 4C4KO 2Y5TB 1ETZA 2GCYA 4GKSA 2APFA 3C5ZA 1FJ1B 1ACYL 1C08A 4FFZL 4APQC 4JFPB 1ZLVH 3VFMB 5DZLA 4OFVA 4XHJC 3BH9B 3IS1X 3MBEB 4XPHL 1FZOA 1Q0YH 4ZFGL 2ZSWA 2AXHA 3GIZH 1ERNA 4UT6H 1A5FH 5LBSH 1AO7E 5EU7E 1OPGL 4G6MH 1QPPA 1YNLL 4HWEL 3V5DA 5AZ2L 3K8LA 3MGOA 5JOPE 4RX4A 4NQEA 1ZAGA 5C08B 5DK0B 3W5NA 1QR4A 2VKXA 1IGIL 5TPWL 5DJ2A 2Z9TA 3ZKXB 5KVEH 4XNXH 4CBPA 4ONHB 3UTSD 4HPYH 1S8DB 4XP4L 2E7BA 3DX6B 2ZUXA 4P2QB 2HP4A 3FONB 1JNNH 1JWMB 4JCLA 3K4DA 4WWKD 2EXWC 1TJGL 1DE4A 2G5RA 4UINH 5IEHA 1Q1JL 1GGBL 4F37F 3VA6A 2W65B 1R3KA 4ZXBD 5ALCH 1WISA 4MNQD 5EZJA 2NX5A 1GIGH 5I6XC 5E08H 4YHOH 4HS3B 4U7SA 2DWEB 5C71A 4Z0XA 1LO2H 1UVQA 3LDBC 4MA8H 2BXZA 2F58L 5EPMB 5HJ3A 5CSGA 5DQDL 2XWJA 3KDMB 5GS0H 4YHIB 4FQ2H 1BVZA 1MCWW 2CKBB 3GMQB 3RVWD 1RK0B 3QXWA 1NLBL 1E4XL 1UENA 1QBLL 5C0RL 2HFEA 3PQYA 3QUXD 4B53A 3E3QC 5J11C 1AJ7H 1KJ2L 1KLUA 2AJSH 1F97A 2Y5TA 5C0BA 3L5XH 4R8WH 1ZA3B 1U92A 2HG5A 4GW1B 5GZND 3O4LE 3W9EA 3OG4B 1MFAH 4P2RD 4G9FA 5FM5M 5EBLB 4DZ8B 4KKAD 4G8FB 3TV3H 3P73A 4HX1B 1KIRB 1A3QA 3TWCL 4H1LB 2C3WA 4P5KA 1I8IA 5FM4A 3CSGA 3BPOB 3DX7A 2YPVH 4OIAA 2QSQA 3D2UA 4X4ZA 3KPSD 3CDCA 1J8HB 5DYOA 3FFDB 1F4HA 2BY1A 1K4DB 1MFCL 5DC4B 3QR2A 1WWCA 2IH1B 1AGDA 3OBAA 1K8IB 4QT5B 5DC9B 4JY5H 3D39A 3U30B 3M8OH 4P2QD 5IFAL 2VDOL 2B0SL 2GTZB 3KGRA 3QHFL 4U6YB 1W72B 2UZIH 4XWGL 5GGSY 4BFGA 4MAYA 4UQ2A 2FEDD 4NKIH 4XCNB 3T0AA 1QFWI 2YZ8A 3OQ3B 2DJ4A 3HNTH 3LHPH 4JFFD 4C4KT 2VDQH 5KBNC 5B3JE 3FT4B 1F5WA 2ADIB 4N0UE 3QJHB 4JM2F 4RIRA 4ZUUB 2BNUB 1FBIH 2LU3A 1I3GL 3GSUB 4OLWH 1IC7L 2Y9RT 1ZGLB 1IM9A 3B9AA 4OI7A 1QKZH 4NWUL 4PJGF 3JSSA 1FZKB 1UWXH 3LRGA 4ZTPL 4MD5A 3ULSB 2XN9E 3RFZC 5INCB 3ALWA 3CK0L 1A6VL 3KXFD 5DJYB 2WIIA 1T0NA 3Q6GH 4S2SA 1P2CB 2WUBH 4FQLH 3WIIL 3WFCL 4JJ5B 4J3OC 3FQWA 1I8KA 4WTXA 2VC2L 1JHLH 3HPJB 3MRKB 4HBQA 4HGMA 4NUJA 4XCCL 5GGTA 6FABL 5I1LA 1BJ8A 1GGIL 2OJEA 3BVNA 3ZT6A 5K9KB 3W2DH 2Q3ZA 1A8JH 1TITA 2YN5A 5JPMB 3QIBD 4YPGA 2PXYC 1BX2B 1CVSC 4Y5XB 1MREL 1CGSH 1IAIL 2AJYH 4NNYB 5IB3A 1Y6MR 4NQUA 3IDIB 4WW2C 3TESA 2Z4QB 3IU3B 1I9IH 4JFZH 4FQCH 1NJ9B 3EIFA 3GM8A 2NX5E 4U6XB 1A21A 4ODTL 3SJVD 3U0TA 3UBXI 3NFPA 3QDJB 5HTSA 4AQOA 3FFDA 5HVFB 1FFOA 2KBGA 3I85A 4DEPC 1NDGB 3FMGL 3HN3A 4Z9KB 4FQIH 5LQBH 3V7AG 4QT5A 3NOIA 2E5EA 5JIKA 2PUQT 3RX8A 1KTLB 2NY3B 5D93C 4KRLB 4Y7MA 5I8KH 1TVHA 1X4YA 1MRDH 3QO0B 3SDYL 4FHBD 4OZGF 3LN5B 3QDGB 5EO9B 5FUCE 2B20A 3UTPE 2X4RB 3VI4E 2FGWL 2ITDB 2DQUL 5HYJE 1QQDB 4WO4D 3EJJX 4KHTL 4XAKD 4PJBA 2UWEA 5GGVY 3NCJH 2Y07H 4KMLB 3QDMD 4FTVE 2ZKHL 3LV3B 1RAMA 4MNQE 4LCWD 3WEXB 1KXVC 1U3ZA 3GZKA 1GGTA 1MWAL 1HCVA 3OKDA 4X6BB 4KHXH 1W8OA 2EC9U 5FV2A 4NKMA 1G7HB 1EBAA 4Y4FB 5GGRA 1CIUA 1S7QA 2NXYB 2P5EA 4NO3A 3FO2B 4G6AC 1BVKB 3EHBD 1DN0B 1FHGA 1CD0A 3F6IA 5A2KH 5CIPA 4M9PA 3TYGH 1F4YH 1A1NA 2IFGA 4XNQA 1D9KC 2MHAB 4DGYH 5D1ZA 4Y88A 1N0XH 4XPBH 3H7LA 3ZL4H 1H3VA 1NMAH 3KLAB 5HD8C 3IAPA 1I1AA 3OKKB 3VXNB 1KEGH 3AMKA 5DFVC 3C5SA 3PL6D 4NKOB 1TPXB 4RDQG 3QDJE 4FFZH 2R2HB 2NTFA 5IMOA 3G5XA 4E0RA 4J8RA 1BAFH 3AU1B 2Z4QA 3P11L 3S6CA 4ZOAA 3VXSB 3GIZL 3IFOB 2CUMA 3S4SB 4YC2B 3BP6A 3MRIA 1ZOXA 4MA3A 3A6BL 1MY5A 2X1WL