3CBKB

Chagasin-cathepsin b
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
110
structure length
110
Chain Sequence
MSHKVTKAHNGATLTVAVGELVEIQLPSNPTTGFAWYFEGGTKESPNESMFTVENKYFPPDSKLLGAGGTEHFHVTVKAAGTHAVNLTYMRPWTGPSHDSERFTVYLKAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Cathepsin B
publication title Displacement of the occluding loop by the parasite protein, chagasin, results in efficient inhibition of human cathepsin B.
pubmed doi rcsb
source organism Homo sapiens
total genus 22
structure length 110
sequence length 110
ec nomenclature
pdb deposition date 2008-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF09394 Inhibitor_I42 Chagasin family peptidase inhibitor I42
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2020 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3cbkB00
2C34A 2FO8A 3CBJB 2NQDA 2NNRA 3E1ZA 2WGNB 3M86A 3M88A 2OULB 3PNRB 2H7WA 3CBKB
chains in the Genus database with same CATH superfamily
4TL5A 4Y5XA 5I1AA 1UM5L 4KZEH 3LDBB 3OR6A 4B53A 1P7QD 2K8QA 4R4FH 3Q44A 1E27A 5T3XD 1F6AB 2NR6A 3A21A 3CUPB 4JW3A 3HZVA 4NKOA 4GBXD 4P5RA 4EI5A 2X2JA 2W8CA 3VMNA 1MCEA 1JI1A 5B3JF 3QYCA 4K3EL 3TVMA 1FGNL 3TO2B 1EZVY 1LWRA 3ARWA 3GIZH 1PG7X 4PWJA 4M03A 4RMTA 2W95A 1Z5LB 2OMXB 4M6NL 4O51A 4HEMA 2AK1H 5DJ0A 4WNQA 2EO7A 3CH8A 1KFGA 5F1NA 2W60B 2XG4A 4JHAH 5ICZA 1ZA3B 1VFAA 4QT5B 1J5CA 4E41B 4UQBA 3BP6A 1E5CA 3L95B 1CICB 2BHYA 2UXTA 2JB5H 2EIEA 3VFWB 5F7EL 1N26A 1U8NB 2Z91B 4ZOEA 4F7PB 3BKCL 4XR8C 1RUKL 3APMA 1RUMH 3CFKB 2VAAA 3GNMH 2AEWA 2KZWA 2DQUH 3LXBA 1OZTG 4M8VA 4PYGA 5MERB 1MAMH 3RVVD 3PWLA 1UOKA 3NFNB 2HT2C 3RKPA 2XNAB 3RI5K 1E7VA 1T5XB 1WA2X 5AW4B 5JXEC 1RIVL 2R1XB 4K2UL 1P7HL 5ES4B 1G7MB 3RVWC 4BFEA 4M00A 4AC4A 1UXSB 3GD1C 4Z3TA 1JMZA 3QQXA 4DZ8A 4QYOB 2XBDA 3I6GA 4XC3L 3TZVB 5FKPB 4X9IA 2K8MA 5D7IE 3ZTNL 1MVYA 1TSHA 1XBDA 4L4TE 3AM8A 4IIZA 3S34L 2FECL 4BFNA 5HYSB 4AG4H 2YGNA 1KEMH 3AQDA 2EIMB 2DQDH 1HKLH 5IVZA 5D2LB 4S1DD 5E2WL 3MROB 4IDLA 5AKTA 1U8MA 5T3ZD 5GISH 5KW9H 5I1DB 2B2XH 5ANHA 1SMOA 5HYJB 4IMKA 1JXGA 1MNNA 4AKOA 5KYWA 2VCOA 2EEAA 2O5ZL 3GSWA 1FFNA 2E5EA 1S7SB 4FNSA 4NRYB 4DUVA 4ZS6C 2P5EE 2VLRB 4U1KA 5B1JC 3V4PB 2L8AA 5JQHC 2BFVL 3QEQB 4MZ2A 4Y89A 2YIHA 3MOBL 4JFQB 5CEYA 5MENA 1JK9A 1XWVA 3MLZL 1KACB 4J8QA 1M7IB 2FJFB 2QQKL 5BV7C 5F7HA 4PJAF 4KK9D 4GKSB 3EJRA 2ZP8A 3U9PH 1R3HB 1OAKL 3NCYS 1I7UA 3E80A 1B9ZA 1KPUB 2H2SD 4X6EA 1BXVA 1ADQA 2V9QA 4OFKA 5EZLB 2R1WA 1X9RA 5F88B 3CFJA 3QWRA 1TJXA 3F6JA 4JFEB 4TTDD 1H19A 5E6SB 5JNYB 4FP8L 3FCBA 5SWZD 5GS0L 1B6DA 5SWSE 5KN5B 2OMWA 3D5OF 4LNRA 3N1PC 2JI2A 1GGCL 4RQQB 2LAAA 2NZ9D 2V2WB 4G7RB 1JFQH 4ZBJA 4HZAA 3DX3A 3IFNH 3NRFA 4B95C 2KL6A 2R2HA 4X6FB 5CSBA 1P1VA 4A68A 3ABMB 3A67L 1BZ9B 3CU7A 3MRNA 1ETB1 4JPSA 4Y1AB 1D7DA 3FSWA 2XHNA 3MYJA 3RIFF 4YHNA 3ZR6A 4FQJH 1HHGA 4H1LB 3N40P 4YDLB 2VDQB 3EGSB 4NCC1 4PB9L 5PCYA 3STZA 5CGBA 2CKBH 4HUVB 4NZDA 2BNQD 3QDHA 3EAKA 1MFAH 4ZMNA 2JXMB 2VZVA 4MMXA 1AZBA 1YN7B 4HUKB 4OD2A 4WW1A 2B9AA 2OMNA 4OIFA 5EO0B 3U4EA 2J1YA 3MO1B 5ICUA 4FA6A 1I1AA 5E5RB 4DKTA 3AZUA 4KRPB 5BNXD 1JYWA 2E7LC 1MN4A 2Z8RA 3VRLF 1EAJA 1ORSA 3SBPA 4P07A 4DN4H 4MXVF 4OB5H 4E9VA 1G7PA 3ZZ1A 1BXAA 3EYVB 1V7NL 3ZSTA 4AL8C 3NIFE 4AYMC 2ODIA 4I3RH 5KVEH 3SKJL 1S7UB 4DAGL 5T1LA 3D0VB 5CLZA 4E9SA 4F8TA 5B4MC 3LDBC 5MEQB 2K45A 1T1ZB 1I9RL 1NEZA 4MJ5A 5TQ2H 4HXAH 5E1IA 3T0XA 1QR1A 4OGYL 4ZUTA 3ROOB 2AGJL 2EKSB 3GINA 4HUUB 4HK0B 5LBVA 4PWHA 3MRCB 2ALWA 2BK8A 4WUUB 1Q8MA 2QHRH 3GBDA 3LZOA 1WCQA 3ALWA 4XXWA 2R4SH 4MDIA 3IJ7A 3PWUA 3SJVB 1L9PA 2YJLA 1HEZB 4PJCB 4RDBA 1L7TH 1MHCB 2V7NA 4IBYA 5T3ZE 1AAJA 1I8MB 1MXDA 2MCPL 1PZ5B 5M7QA 3OKYA 5TQ0L 2I7SA 1W72B 3DOHA 3FN9A 1F3JB 4C58B 1AFVL 2OJEB 5BZWB 1ZVSB 4O2CA 2PCFA 4N0CC 2UZPA 1QW9A 3PDDA 4GAFB 1WG3A 2HG0A 3GZQA 5ACMA 4W9JC 4OZ4B 4DPAX 4QRQA 3UYOD 3U9UB 1QA9B 3D7PA 3OKEB 2J6EL 1AP2B 4KPHL 4DPCX 3WDJA 1ROCA 3LAFA 3VWJA 1CURA 4DGVH 3Q8EA 4TQEH 5K33A 3IWVA 1XR9B 5KTEH 2C9UA 4LARH 4JB9L 3L16A 5LN4A 3BXNA 5A3IC 4MMZB 4XX5A 1XQ4A 3L4TA 4H44C 4NXSA 2MKWA 3S4SG 3TZVC 3WFDH 3D3VA 1F8TL 2YD2A 2BY2A 4NBXB 4BFKA 4KNQA 4AZUA 4PJXF 4HXBH 2WP3O 4Y2NA 1ZPLA 2XX0A 1OPOA 1SN2A 2B1HL 2A74B 4QXUL 5HHNA 1E65A 1F11B 3TBBA 4MCMA 4M93B 3SQBA 2WXMA 4JANA 5GGTL 3H0TA 1BQ5A 2R56L 4PHZA 5I1JL 1INEH 1N19A 1NGWA 4B9ZA 1X5XA 2K9UA 2Z92A 3OWRA 2ENPA 3BGAA 4FMFA 2VL5B 5T1KB 3BAWA 4F15B 2ZAHA 5BRPA 1ODUA 4YSPA 4GQRA 5E51A 4YHLH 3NSYA 4KNTA 5I15H 2CU9A 4OV6F 4OJYA 4NRZA 3UJJL 4YXKL 3IMRA 3WU1A 3ZDXE 3GUFA 1IM3D 4M7JL 2TRYA 3HPJA 5EZOL 4XCEA 4FMVA 2BNQE 1UUSA 4I4WB 1PBYA 3W9DA 2CLRA 2APXA 2EYTB 1RMFH 3DROA 3SN6N 4NQCD 5I1KH 2M83A 3VAEA 3ZKNC 5A2AA 1J9SA 5JQ6H 5GQBA 2DJ4A 3SDYL 3UAJA 2ZG2A 1T89C 3NFSL 4L8CB 3QEHA 1D5ZA 4B27A 5DGQA 1YEJH 4XNBA 2YXVA 5AVSB 4HEPG 3QFJD 3WNJA 4GRWF 3V0IA 5IOPB 1CZ8L 2DL2A 3QCUH 3BAJA 2BS9A 2ZYRA 1XAUA 1SXZA 3TV8A 1D9KB 4W9ZA 5C6PB 3APNA 3ULAB 1E30A 2JCCF 1Z7JA 4MAYA 3ZRCC 1S9VA 3NIGE 2IH1A 2GUOB 3OJDB 4PMEA 4K9EC 3ETBF 3IF1B 3GT6A 4XCCL 4LEEA 4A1RA 1NMBH 1REIA 2XETA 4UT9L 1B0RA 4PBWD 4XP9H 2DI9A 4XODA 2ODHA 5IMKB 2V3FA 3WMPA 5DD3H 4BHUI 5F7AA 4AKQA 4JG0L 1JGDB 4YDLC 4I77L 3DHJA 4JO4H 4PJGB 4M6MH 3ZO9A 3PHSA 5TGBA 2GCYA 5DDHA 3US9A 4DERA 1HYSC 4CKQA 2FO8A 5GRXG 4PJFF 2QSCH 3QFGA 4KQ3H 1HHKB 2BVOA 4DGYH 2AV7A 4RFEA 5HGDA 4LLYB 1KTLA 5E8PB 2MOVA 5EIQA 5CGMA 5J3HC 1AJ7L 4KRPC 2BIQA 5J9PA 4FC3E 3ULUC 1TETH 1I3RB 1GJIA 2QVKA 2VN6A 5DJXA 1W8OA 4KROB 4QIRA 3ES6A 2BSEA 4JVPA 4LESA 1X4ZA 1HJBC 1D5MB 1L7IH 4OQTA 1XH2A 3FT3A 3GHPA 1UXMA 4FJYA 2K0RA 3A0OA 5AKVA 2W38A 3C5SB 1CLOH 4XBMA 2C8NA 4XPBH 1DDTA 5T1MA 1BZDA 3F12B 2ZJSL 1BD2D 4G6JL 1A7BA 4F8QA 4ZMTA 3HG3A 4M29A 3AREB 2XV3A 1VACB 2J7LA 4Q9QL 1I9JL 2M8XA 5KSAD 4BZYA 2ZCLL 3EG9A 1CR9L 3IGUA 2QL1A 2XA8H 4P3DB 4JFZH 1TKWB 2YRLA 4HPYL 5HHPA 4TS6A 3IVKB 2Z35B 1N12A 3Q0HA 1YNLL 3RIAK 3BQUB 4FTVB 5EU6A 3LXCA 3WIIH 4OLVH 5FCUL 4H20L 1Z2KA 1C12A 2X1WL 3G6DH 5D7LE 3DV6A 4HQQH 4IBVA 2AK4A 3MZTA 1NQBA 2HLEB 1N59A 4I3GA 4BRVA 5D6CB 2CJSA 3DJRA 2IQ9H 2YD1A 3AY4C 4WUKH 2OKMA 3V52L 1Z9NA 2Q3XA 5I1HH 4HF5L 1KIQA 3KHOA 4C4UA 4CW1B 2XG5B 2WLMA 3GYRA 2KLSA 3IKCA 4MA7L 3B56A 3CLFL 4MMZC 4Q6IA 4HUWB 4BCZA 4UNVA 1K8IB 1BZQK 1A4KB 4NQCE 4YBQD 4PRAA 1RQ5A 3SY6A 3FBQA 1X5HA 5IWLA 4G8EA 3BMVA 3WS3B 4NKMA 3ZDYF 4YDNA 3WFZA 2OSLB 1A9BA 1W0WB 2ZOOA 3ECWA 2NY7H 1X7QA 5JO5B 4NQDA 4BUQA 4ENEC 4L29A 5JIIA 3T8MA 4M5ZH 4GI8A 4BZ2A 3D0LA 2J5LB 4XBEH 2QGEA 4HKBB 4PRNA 7PCYA 2A74C 3MJ7B 2JCWA 4ZFFA 1G43A 2A5UA 3OG4B 2ZSVB 4UT7H 3T3ME 3PWJA 1M9WA 4M93C 3QEGL 1LGVA 2WW8A 1QRND 1PCXA 1O6SA 2XBTA 1OAUL 3FN0L 3BWUC 3PHQB 2OW6A 3H9ZA 4Z3GA 1CJYA 3OKDA 2NUPB 3LKRB 3NQKA 4UOJA 5I19H 3MRMB 5ADPH 1ZV2A 5EBGA 5F9JA 1AI1L 3VXSA 4JFFD 4F15C 3HHRB 5HDWA 1AS8A 4HIPA 4AYDC 4L9LB 2E74C 1AKPA 2XWEA 2KBGA 4HFWA 2XZCH 3PV6A 2P46B 4Z77A 2G75A 2WUCH 4X42A 4BK8A 5CN2A 2OTUB 3X12A 2Z8WC 3FUIA 3TBVB 2AV1B 4HAFA 4NQXA 3NJGA 4P2OD 3Q2VA 1KENH 1DQLH 2VH5H 4NQVB 1QKZH 1IGML 2HX8A 4AMKH 2NW3A 1YAIA 1JNLL 1H8NA 1OK8A 5I30L 1OB0A 3VH8B 1S9WA 1JGEB 1UVQA 4RX4A 5CCKH 2G2RA 3K72A 1RZGB 4N4YB 3HNVL 4UYPA 4P06A 1LE5A 4X2UA 2F7QA 3VXRA 3EXJA 2FR4B 1A6PA 1BIIB 4MSWA 2IQAB 3QXAB 1G6RB 4P2RD 4UQEA 1J12A 5AALA 5KYXB 3IMUA 1J0YA 1D9KC 1MH5B 4I5BB 4AITA 3ZL4L 1CQKA 4HZ1A 1EHLL 2WWOA 3CJJA 4U0QB 3QUXA 2QADB 3R0NA 4Q8BA 4OIIH 2PXYA 3WOVA 1N68A 1J1PH 3L2MA 3LH2H 3W57A 4ZOCA 1W9XA 1GR7A 1X5KA 2RAMA 4O58L 1OF0A 1IIIA 3CVHB 4MJID 4PRBA 4GXUN 3T0AA 3TL5A 2EILB 1MFEH 5D5MA 4XXCC 5EFIA 3FUHA 1A9VA 3MRFA 4PJHA 3T6QC 5F9AC 4OTXH 4AYID 5BOPA 1TZOA 4UYQA 2ZTBA 1BAWA 3WD5L 4J12A 4TUKH 5ICXB 3TO4D 4D0DB 1E8YA 3DPDA 2LT9A 4WEBL 5CJ8A 2UYLB 4PSPA 2GJ6A 1R5IB 4JKNA 3QZNA 3KZ8A 3TCTA 3V5DA 3UTTD 1ADQH 1EO8L 1H0DA 1ASQA 1IBHA 2OMZA 3UC2A 2Y9RT 4P2QD 4PJBE 2OCFD 3BUBA 1CF1A 3PNWB 1PEWA 4R6UA 4E5XA 4UV4L 5HDRA 5FR3A 2D3NA 4KROC 1RSYA 3SQRA 1JNJA 3S5LG 2PCPA 3N5AA 5F7KC 1TUPA 4XO9A 3BZDA 4OM0H 3BFQG 3VGAB 2XZQL 1OTUC 3GSOB 5ADOH 5I76B 2VLJD 3ML9A 2IAMD 1KCRL 1RP8A 5I8CA 2J12B 3N1GC 1NICA 4JM2D 4LOUD 2F8XC 5HI4D 5DZ9A 3GMOB 2A9NH 4K73A 2AMUA 1T4KA 3MV7D 4A7QA 3ESVF 4KVNL 3HNSL 1QHQA 3HOGA 2Q10A 2WKGA 1RUQL 3X11B 5AZEH 4LKCA 3AREC 2VJXA 5DA0B 3KCPA 1JZDC 4YXLH 2VJ0A 3CXDL 1YPZA 4P46A 4HIJB 3B6SA 2XXGA 1A4BA 4L4VD 1MRDH 2NY4C 1W6LA 1G7IB 1SHSA 3FFCB 2XQYG 1U8OB 2EH7L 2XJLA 4YGAB 1DLHB 2X10A 3BQUC 3MLVL 1OT2A 3BE1L 1LE9A 3ZE0B 4DKEL 1QRNE 1WA0X 4MB5A 2H3KA 1PL3A 3E9UA 4OJFH 2D9CA 1F00I 2X28A 2RCSH 2YK1H 5FA4B 4TVPH 5IFJA 4TQHA 2COQA 4ORGA 5KJ4A 2VXSH 3QUYC 4OZGE 4JFFE 3FB6A 2UY7A 1U95A 2WZ0A 5G5DB 1AR1D 3U36A 2L3BA 1NC4D 5IW3A 4G1MA 2H8PA 3F65A 4U31A 1EHAA 2HH0H 3BZFB 5CILL 4UTBA 4P2YA 4F7KA 3BKML 1DVFD 1XDTT 2CDGB 2LFGA 1OSPH 4HT1L 5ECJE 5HY9A 4W4OC 5K9JL 3TH2T 2WMPB 1MCWW 3VFVB 2XKNB 3HEIB 1RUAH 4RCAA 4LLQB 4JHBA 2HWZH 1DQJB 3GK8L 1MFVA 3UTQB 5IEKA 5J4MA 4LL4A 3KBEA 4LO9A 3TA3A 1N64H 4TRPH 4Z9KB 4FNLL 2QLYA 1I9EA 2O5XH 3GSQB 3MNZA 5FO2A 1X3DA 5DQJB 5HDQH 1V3JA 2N59A 3PREA 1F4WH 2J5LC 3V8OA 5EF1A 5EV7A 3VTAA 3APFA 2PYFA 3E8UH 1MQKL 2YUZA 4QMEA 2VR8A 2R0WH 5J6GB 4P2RE 1YYLH 5D8JL 1FUNA 1YVLA 3V6FA 1NCCL 1UA7A 4UV7L 3TBYB 1KGYE 3V0FA 2FB4H 4ERSL 5DVLA 3NZUA 2JH2A 5AOIA 4QCIA 2W0FA 1LK2B 1YY9C 1CGYA 3TOPA 3BRFA 5LN8A 5D4HA 5IBUB 3OMAB 1WAAA 1U6AL 2NX5E 4BDVB 4L9LC 3SZ6A 7CGTA 2M1KA 2Z93B 1VGKB 4AQ1A 2XWJA 3G6JE 4F33A 2HT2D 4MJIE 4PJDF 1B4LA 5EUKA 1F90L 4MQ7A 3UYRH 4X4ZA 2YGPA 4JRFA 5JXED 1WCBA 4U3SA 2FLRT 3LEXA 4LOEA 5D4QA 4RSYA 5C08B 4AE0A 3DMMB 1NCWH 3RVWD 3IGAB 2EE6A 3EUUA 4ZG1A 5DRNA 1BLIA 2Q3AA 4F3FB 1CXLA 4HGWA 1MCHA 3W0WB 2F8VA 3V9FA 3S4SA 1KB5B 2OZ4L 5JW3L 2A0LD 3UTTE 2BLFA 4NSKB 4C56E 1EANA 5LCVA 4TOYL 1AANA 3WSQH 3LZRA 1SXSA 4P2QE 4XCFL 3V0WL 4PRIB 2JELL 1HHHA 3EYFA 2GJPA 2JNZA 3MLSH 2AXFA 4APQB 4G6MH 1P69B 2ZKHL 1AZRA 1P1ZA 5F1IA 2KT6A 2Q76B 3PY9A 1ITCA 1H15B 4TXVB 2CJ3A 2A73A 2VLJE 2DOCA 3UTSE 2QADC 1NBVL 2HX7A 4QXGH 1NKOA 2F19H 3JYBA 5C0AD 1M7DA 4ZS6D 5JHDA 2YKLL 3KBFA 5IESH 4ZAKA 2P26A 4WY7H 2MKLC 3KL0A 4EI5B 2R59A 2V2TA 2OJZL 4HAKA 1GPOH 5KVFE 1I7RB 4GKNA 1NCIA 3TVMB 4TSCL 2E75C 3UDWC 3PWPD 3IPEA 1X4XA 4LHUB 1QTYT 3OGCB 3F85A 2AZUA 4XPHL 4TM9A 4O51B 1FLRL 3MKKA 4WNQB 1EMTH 4JL1A 4L4VE 2CBQA 5F1NB 4NIKB 2XG4B 5ICZB 1KLGA 4QTHB 1VFAB 3PABA 4OGAC 4Y2OA 3VM7A 5AZ2H 1KGIA 3CMOH 5A43C 3BP6B 3GJFH 3EOBA 5IHUL 1XR8A 4YSOA 3QUML 5FUZL 5EC2A 1KB9K 3JYCA 2EDHA 1D5BB 4OLWL 4G9DA 4KTDL 4OT1L 1J1XL 1RPUA 1WT5A 1FAIL 2JI1A 4AM0A 4F9LC 3BKJL 3X1NA 1E43A 4EO5A 2YR3A 1SJXA 3LEYH 3QO0B 1QUNA 3VGAC 1I8KA 1IEAA 5I74B 5JHMA 4TSBL 4QRRA 3QPQC 2IG2L 3QBTB 5IQNA 3SE8H 4Z7WF 3TV3L 2OPCA 5FDYA 3KPPB 5ESVB 4XP5L 4XN1A 4G7YH 2UZIH 4ZO9A 1FDLH 4JRXB 4ZFGH 2PCYA 3I6GB 3ZE2B 1M1XA 2CGRH 5KSBE 2C34A 3P3TA 5AVYB 3BD3A 4G7VL 4AH2A 5BJTB 5IREA 1BVLA 1NPJA 2W94A 4LXFA 3U6XA 1YEIL 2H1XA 4PBXA 2DWSA 4U6VL 1INQB 3NCCB 4N2OA 3HNTL 4NN6B 5IVZB 2X53A 3DHMA 1X5ZA 4AKPA 2JKXA 3SPJA 2OMVA 2HFFA 3DSFL 1M9SA 2BMKB 2MEJB 2JKTM 3GSWB 4W9FC 5DRXB 1CGSL 2AJXH 2B1OA 3BKYL 4M5SA 4XBGA 4R7DA 1X9UA 3TLRA 1N6UA 1P5VB 4ANXA 4U1KB 3HAEG 4MVBC 5BPPA 4OQTH 5ID0B 1JGIA 3KXFD 3WCYA 5HP5A 5D70H 1JGLL 3K1DA 1S8DA 3ZDZB 3LMJH 3SPHA 3FAWA 3L1OH 4N6RA 1MDAA 5C2UB 5B4MD 4GSXA 3L1GA 3TPKA 4D8PA 2F1EA 4GAGL 1MW0A 2QDWA 4PIBA 2VLKA 4ELMA 4X6EB 3UJIL 4QNPE 3KJ6H 2IALB 4OIAA 1GL4B 2Q7NA 4LF3A 2BOBA 3WGVB 4L1TA 1B6UA 1HSAB 1UXLA 1ZT7B 3EKCA 2EDKA 4I8DA 4P48A 4UILL 1XBRA 3VW3H 3D50A 1UHVA 4LNRB 2EIJB 4XWGL 2QV2A 3BP5B 4F7EA 4E41D 3R4RA 4FG2A 5ALBH 1JPGA 3U7AA 5CJ5A 2IBZY 2PWDA 3KPRB 4TQPA 3GMMB 3SYOA 3UABA 5E08L 4AQAB 2OMUB 2ZT9C 2R0ZL 4ZMAT 1I8IA 5EZJB 1MI5A 2R15A 2VDNH 5CLTA 2P52A 3C2SA 3FBKA 3MRNB 5D1QB 5J1SC 4N0CD 4EDWL 1IFRA 5E6YA 4ZMQA 3V95A 1BZ7A 3O3UN 5ETUB 1JPTL 4BQ6A 2AERT 4U6YA 5FA3B 3STZB 4Q6KA 4YSSA 3MLWL 2O4EA 3DMMC 1J8HA 3PWPE 3CZEA 2H47C 1E42A 5A3ID 1P2CB 4X4MA 2E27H 4MMXB 3RB7A 4WW1B 3TZVD 4A7VA 4A67A 2BNUA 4MS6A 2OSYA 1I1AB 4ZMVA 3R06A 4BZ2H 4ODVL 5IB1A 1QFHA 5L9DL 4G3YL 3SYAA 3ECBA 5F8QC 3X17A 2XPGA 3VXNA 3FW6A 2DQEH 4ZXBB 1MCJA 5DEGB 1VB9A 1BVNP 2DQHH 1H8SA 2IADA 5T3ZL 3WUZA 5FM5M 5HYJD 4JPVL 3AXLA 3MA9H 2X0VA 3VX0A 2CCLA 1PFCA 2RQ8A 5K69A 3DBXB 4HP5A 5E5MA 1QEXA 1NGQH 1NEZB 1V7MH 5D2NA 4W4NA 2Q20A 1QR1B 2NR6C 2VLRD 1J88A 4KBPA 1GGIL 4LSQL 4EI5C 3QEQD 1PS3A 5KUMA 4UQ2B 1CLYL 2NT0A 3TVMC 3GMNA 4MNHA 3MLPA 3U2SA 1VFBA 3GRWA 3LRGA 2NPLX 5GGTA 5AYQA 2W0KA 3O45A 1PZSA 1TG8A 1PKQE 4MDIB 4NGHL 1BMWA 2OTPA 1XSOA 4LRIA 3IJ8A 1NFAA 2FJHB 3ALPA 3ZKND 2V7NB 5JR1H 1SDDB 2WY3B 4FZEH 4HJTA 4HVBA 5BS0A 1JV2B 4F93B 2NZ1A 2XVBA 1CG9B 1L9OA 1LO3H 5ESQA 1WC7A 1M56B 3HBZA 4JFED 3ZQ9A 1LO0H 1IBDA 1KBGL 1OT4A 5L7XH 1VERA 2FNWA 2GSIA 3SQOL 1U3NA 3P9LB 5DMKA 3RGVD 2CNYA 1ZJBA 1KJ3L 5I74C 1YLBB 3EF4A 3KXFE 4X4XB 5JIKA 3VWJB 3PP4H 4Y9CA 1VFMA 4HWZB 3O3DB 2AC0A 1NCTA 2QT6A 3G3LA 1BQLL 1E40A 1ZD6A 4Z7OF 1J5IA 1E4XI 3BXNB 2VXUH 5I75C 4JKWA 3V5KA 3LEVL 3FOLA 3VMOA 3RL1B 4JFVA 4E9LA 4GI6A 3FOMA 4YSRA 4CC4A 3CHOA 3AM8C 1DBKL 1OGTB 2EXSA 3E2HB 1FHNA 4MA1B 3OVUB 5D7SH 1W2KT 4J3OH 1DN2A 5GSVA 1HYSD 4NN6C 4OGQC 4JFUA 3V7AG 5I82A 3H42L 2VJ8A 2DICA 2Y2WA 4JANB 2A4CA 1F56A 3H0TB 5CZXC 2DLHA 5INDB 3OKKB 2YD0A 4UT9A 2WC7A 4E41E 4HU8A 4R4BA 2PWGA 3B3IB 4JVUA 3VG0L 5J3HD 1TZGL 2KQMA 2Q6WA 1N5YH 3S35X 3ULUD 4FFZH 3CZSA 4PTTA 4JVWA 3V0AC 3S5LA 4FQIH 2RH0A 4PRDA 1AS6A 3EYUL 1XGUA 2H1LM 1WFMA 5H94A 3P4OB 4XPFH 4G42B 3IJYA 3KE0A 1T3FB 5B3NA 3IXAA 4NWTL 1CLZL 1E4KA 1HNYA 3FUKA 2CLRB 2ED7A 3Q3GA 3DROB 4OKDA 4PS7A 3P2DA 1YJDL 4GEIA 2J57A 3UADA 5K9QI 4CN4A 1BYNA 3AQZA 2BH0A 3C5ZA 5KVDE 1LQBC 3QEHB 1D5ZB 1TNNA 3U2JA 2VDRL 1K6QL 4BSVB 4GB9A 2WWMC 3KWWA 5I5JA 4WF7A 1JZIA 4Y4FB 3S2CA 2XQYA 3FU3A 1FVDB 3SJVD 1HWHB 4HKXB 2IBGA 2CK0H 5D2LE 4A2GA 2DMKA 2TAAA 3I6KA 5GJSL 4NHUA 3FQUB 3P2BA 3PDOB 1S9VB 4P5SA 5HYJE 2IH1B 2JLLA 3KL5A 1XCTA 2D73A 2Y7LA 4DPBX 4KHXL 4LQFL 1GGUA 1AQDA 5HHQA 2D8KA 2NY6B 4N0YL 5D1QC 2HN7A 2E7MA 2WZPA 5IK3A 2VLRE 4ATTA 4UTBH 3MLYH 3CAFA 5LBSL 3VFSA 2ZKMX 2DQIL 5I1IL 1RK0B 3QEQE 2A2QT 3IGFA 3MZGB 5EIIA 1HL5A 2ZE0A 2EIBA 2VDOL 2WCGA 3R0MA 3IE4A 4HZLA 5HYFA 3ZRSA 4UBDC 1CU4H 1CTMA 3D25A 4Z5RA 4HOXA 4MMXC 5C09B 5SX4I 5HGDB 5FM4A 3HKFA 1RU9L 5F96L 5ISZB 3QHZH 1KTLB 4YN3A 4OLEA 1I1AC 1Y0LB 2H41A 3JTTB 4NOBA 1IFHL 4ENED 1CL7H 3UZVA 4XGZA 2C3XA 4JFEE 3U30B 5IT2L 5DJXB 3RB5A 3US1A 1YNTA 4G71B 4I18B 4PJ7A 4WNJA 5FIEA 1UM5H 4J7RA 1K85A 4WWID 1BOGA 1G1CA 4AYEC 2X9YA 4TL4A 2FO1A 1N2RA 4OF3A 4WHDA 1QBAA 2VERA 4IRJB 2EEDA 2BP0B 3L3GA 5D7KD 4ODUA 1ED3B 3D30A 5HDBF 2BCKA 1CDUA 4DEWA 3AADB 4E2OA 3FTVA 3KS0H 1LXMA 1FGNH 4X6DA 3CXHJ 5T1KD 2F58L 2B8OT 4QUOA 1G0DA 4NKDB 1DBML 1ZVYA 4M6NH 5K9OB 3VD2A 1TQBB 4HBCL 4M9PA 35C8L 3US0A 3CFNA 3M8OH 1JXJA 3LHAA 4Y1AE 4XO5A 5JPMB 3MNMA 2RACA 2BSRA 4ABVA 4JUTA 1SOKA 2IH8A 3A6BL 4CNIA 4XNMA 6PAZA 4IEFB 4XXWC 1I85A 3V0VA 3BKCH 1IARB 1RUKH 5A2JH 4R26L 3TEUA 4F9PA 4QTIL 1MCIA 1JCVA 1OSZA 5KOVC 3LQAL 2HPTA 4AW7A 2C9XA 2J3SA 4BUGA 3IDJB 2X89A 1SJHA 1QMUA 4WKXA 2AK4B 3O3EB 2HZHA 1I1RA 3H4HA 1RIVH 3ME0B 2HVKA 1MRCL 4K2UH 2FK9A 2EDRA 3GJEA 2X6UA 4HKJA 3MRLA 4N5UA 3I02A 1D9KD 1O75A 1KIQB 5TE4L 1PDKB 2VERN 1ZA6B 2GG1A 4XC3H 3VWJC 4BWTA 1BXUA 2ZCZA 3GS7A 3NJKA 3S34H 3OTTA 4NIYE 3EJZC 3G5WA 4AIOA 4Q6IB 2AF2A 2R2CA 4R7NB 5C0JB 4PRAB 5E2WH 2A6IB 1HCFX 4H2CA 4JM4L 4MA3A 1A9BB 3E2HC 3HKZA 3N55A 5FGBA 5CD3B 4MA1C 1X7QB 4ALAC 3D85B 5DA4A 4PRNB 2KLRA 1UJ3A 4WUUE 4ZFFB 2O5ZH 3VI4B 1H8LA 4MNQA 3CQQA 2P45B 3RWEA 1WITA 5EZIL 1JWMA 5F9OL 5BUGA 3SJVE 2DWTA 4FQQA 1E9PA 1PD6A 1O6SB 3OX8A 3RKDC 1MLBB 4PJCE 1U2YA 4WW2A 3QG7H 5I5RA 1OWRM 3VXSB 5F9JB 1BEYL 2XC8A 4YUEL 2MSPA 2O26U 1TTGA 4KROD 4LDOB 3PV6B 3PUUA 2K7PA 2RR3A 2VN3A 1U8IB 1OTUD 1QSEB 1SJEA 3CN2A 2YQGA 3PAVA 1OAKH 3ESMA 4X6BA 1LO2L 3H9SD 2X4SB 4LOVA 4FLHA 4HIXH 3B5HA 4IYKA 4YDKL 2BVTA 3OKLA 4H25B 4NKIL 5GHWL 1S9WB 2WVVB 5I6XB 5IZ7A 3EHBB 4P5TA 5CEZH 3VFPA 5GS0H 4HS6A 3ARED 3UAJC 1OARL 4CN6A 3K72B 1PIGA 4WTQA 5C0IB 1GGCH 4AJ0A 5C8JA 2X44D 3VXRB 2JJWA 3ZOAA 4EDXA 5B38G 4OJEH 1HQRA 2NY4D 2VMEA 2ZSWA 3EOYG 4N2MA 1XHHA 2CA4A 4FTVD 3MCLL 4HWEL 4NO2A 4YHOH 1S3KL 5D7KE 1Z1WA 3GMPB 3CBJB 3O2WL 2AMGA 1YEFL 3NJFA 2MCG1 4CMHB 2NY6C 3QUYD 3VMPA 4XXDA 1WBXB 4PRBB 3LPFA 3S35L 2BSDA 1Y1DA 2YAPA 1RAMA 5EFIB 1BVKA 2AAVA 4TUOB 1DJXA 3MRFB 4DF9A 2VW7A 4B9CA 3DUUB 1NANI 1NFIA 4OIBA 4UDTA 3K71B 2QQLH 2L7EA 3UJTL 2VR7A 3V5DB 1WLHA 1ZLEA 4W9EC 5IQOA 2BY0A 4AIZA 4JFYA 3K6FA 5ALCH 4XNAA 4RISH 4X4YB 4PGJA 2CHWA 1V7NH 4ZDHA 3OZLA 1AD9B 4OZHA 5CZVL 1Y7VA 2HKHL 1NGYB 4DAGH 3U30C 3VTTA 4GS7B 4LSPL 3OLGA 1TTBA 2DLEA 3L45A 3N41B 4I18C 4BSJA 2PCPB 1I9RH 4U1MB 3CZFA 2EXTA 1LP9F 3AROA 1AQKL 2X70A 1IILE 4Y4KA 2AGJH 4QAMB 5I8CB 4XMPL 1YY9D 1ZRUA 3IDGA 5CN1A 3C8HA 3O4OB 3ZE1B 1JUFB 3DOSA 3ZZLA 1FH5L 2G2NA 2BDNL 2ROYA 4LVOC 1R24A 3QDJB 5DJAA 1TQBC 5DT1L 5D9SA 5E8EA 3WG7B 1CYGA 1JVLA 5JPMC 4JLRB 2VUYA 1OZUA 1YPZB 4W6YB 3B6SB 4PLNC 2MCPH 1TITA 1NCOA 3BPNB 4PJGE 5E5UB 4NO5A 5E1AA 5AOMA 5TQ0H 1AFVH 3VCLB 2P4AB 2JJTA 2Y69B 4S0SD 3U1SL 2VUOA 3V10A 5DHMC 2ZICA 1D6EB 1BM7A 5EZPA 5F7UA 2X0UA 2NUTA 2N4IA 2HVJA 5AG9A 2J6EH 3BVXA 1OTTC 4KPHH 2Y07H 4DESA 2WM0A 2XPYA 4NQED 4B7LA 3MRDA 1HCZA 3OM3B 5LUMA 3FB6B 3AMLA 4LLVA 4O02A 1H3PH 4JB9H 2OXHA 5DRWA 1JZJA 5EBLB 3U36B 4MD5A 4G1MB 2PMZA 4GLRI 4HWBA 4N8CH 4EI6A 2QADD 3T0WA 1ANUA 2BVUA 4MS8C 2YD4A 4HHWA 4WZ9A 3SGEH 2WOBA 1HOCB 2EUXA 1KIUA 4P5KA 3M7OA 4Q6IC 4QDGA 4PRPB 1CFNA 2B1HH 4QXUH 1HU8A 5IEKB 1A3RL 4AYGA 2Y0SA 1BQUA 3QZLA 5IWLC 1PG7H 3TA3B 3GRWH 5GGTH 5I1LB 4JBSA 1NBQA 1ADWA 3CHPA 3WUWA 1GYUA 3R1GH 3U4AA 3FN3A 5I1JH 4IKNA 3V7MA 1WFIA 5LAXA 2PYFB 4AIXA 3MA7A 5F1KC 4JO2H 2GBTA 4WFFD 1UYWL 2G4EA 4HV8A 5FFOA 2PO6D 4OGAD 2D0GA 3V6FB 1E4HA 1EK3A 3M6DA 2VQ4A 3KS0J 4FTVE 4KU1A 1CYWA 1KBWA 4JE4B 4QCIB 2W0FB 2B0SL 3MACH 4PP2A 5LQBH 2I07A 3GFUA 4MZIA 3DYPA 2O6FA 4M7JH 2OM5A 2BERA 1L3NA 1QUPA 4Q4EA 1RZKH 5EZOH 4AQ1B 3LKOA 4MWFA 2H2PC 1SLWA 4QWWC 2J1KA 1WCBB 1KPRB 4U3SB 2QQNL 4RMSA 3LEXB 3QPQD 3SDYH 3NFSH 4L4TA 5F71A 3WXWL 4B0MB 3DX8A 4XMKL 4OF0A 3E0GA 3FFDB 3OAUL 3QUMA 3L3HA 5I6XC 3S4SB 3EHBC 2F1BA 2ZYSA 4JRLA 4BFBD 5KVFL 3HVDA 1CZ8H 4WQOA 4NENA 4LVNB 2VQ1A 2AQNA 1IMHC 1QYGL 1ACYL 5IJCC 1U92A 5FECA 2Y22A 3EYFB 5CMAB 5GGRA 2E76C 3KVDD 3ZBMA 4KTEL 1IAKA 3FFCD 2CO4A 5LLIC 1YRKA 2GHWB 4UT9H 5F1IB 1P1ZB 3TF4A 3FQYA 2P5EA 3MRBB 1ZANL 3D4GA 5L4MA 1R0AL 4ICWA 3KPSB 4FRWA 4GSDL 4U4IA 3VD9A 2P43B 3FTZA 4JG0H 4X6CF 1QWUA 4I77H 5JHDB 4ES8A 3UG3A 1WZLA 1COBA 1X6LA 4ZAKB 3ZYIA 4CMHC 3S8FB 4BD4A 4MVBD 3AWEA 2IOIA 3QFDA 5BQDA 2JJSA 3L5WB 1GKOA 4DUXA 4GKNB 3HHSA 3P9WB 2UXFA 3CWGA 4ZFZB 3EW3B 3LXAA 3DI2B 1PG7W 3N43B 1AE6L 1AJ7H 2FZ3B 1EHNA 1XGYL 4PJ5D 1OP5H 4Y2OB 5JXAL 2EIZB 4G83A 5EC1B 1BX2B 1KC5H 5SWSA 4R5XA 3C12A 4KH2A 5EC2B 3T6ZA 5DJ6A 4G9DB 3WN5A 1N0LA 4NPYA 4GS7C 2ED9A 4Z6AT 3ZJAA 1G7HA 1WDAA 2LW3A 1LVEA 1QUNB 5M95B 4YOKA 2ZJSH 5F93C 1P7QA 4JEGB 1ODAA 3WIAA 4Q9CA 5E00A 4JFWA 3KM2A 1I9JH 2CGYA 4MASA 3O4OC 4FQPA 4GT7A 4XVUC 2ZCLH 1KB3A 4ETQB 5JOEA 4RH4A 32C2B 1JZHA 4NP9A 4HPYH 4KOCA 3EO1B 3ASNB 3VVWA 5BZDA 2EEFA 1YNLH 5FHBH 1BVLB 3B8YA 2XQBH 1FC2D 3RDJA 2QFRA 1P4IH 4MXWL 2D2CC 3S98A 3RWDB 5C08D 3DMMD 3BPNC 3EYSL 5FCUH 1AMYA 1MCWM 5C86A 2WXFA 5E23A 1BG1A 3W0WD 4GG6F 2YXWA 2ENJA 3HI1A 3SBQA 4ZMOA 5HI5C 2CO6A 1EBAA 1S5HB 2I25N 3V52H 1UWGL 1XIWD 4AEFA 2AVGA 4G8IA 1V05A 3MR9A 2NY0D 4PRID 5KYUA 3ENEA 4R7DB 5IHHA 4OCYL 3VGGA 4Z3JA 4Z7VB 3A4DA 4MA7H 1WBZA 4NS0A 1MFUA 3CLFH 2AVFA 2DQFB 4AVKA 2ZOLB 1Q4NX 1S8DB 4E9TA 2IMMA 4ODBD 3ROLA 4NQUA 3ULUF 1H5BA 4LPUA 4S0HA 3BOVA 3C60A 2RFXA 2AFNA 5I73B 3MRKA 5J11B 3NCMA 5EUOB 5CIPB 1PY4A 4D8PB 2JMRA 3CN1A 2AEPL 3B43A 2NR6D 1O7SA 2XRAL 3SDXF 2VLKB 3SPCA 4R7LA 1KYAA 4EI5D 2BSTB 3LZPA 1EVTC 2NNCA 3MI6A 2LLNA 4IGBB 1FNEA 3IDNB 3KHQA 3MRJA 1MSPA 3QQ4B 3TA3C 3TVMD 3QEGH 3QA3A 2JV6A 5DFTA 4LHUD 1NBYA 2FX9L 1CD1B 1OAUH 3ARBB 3FN0H 2EYRA 5FGRA 2EVJA 5K1NA 1A7RL 4HJEA 4MDJA 4H8UA 4XNUL 2IOMA 1CGVA 1AI1H 3QAZB 3FFCE 4PS3A 3SSGA 3I9IA 1R6VA 1JGVL 5KUKA 3QG6B 2X4OA 2FEEI 3ZE0E 5J7CC 1WJ3A 4U2ZA 5DHVH 1JWSA 1I8IB 2VN4A 1DBBH 3VFOB 1EXUA 4WO4B 1NLDH 4X9FA 5F7NC 3I9PA 1HH9B 4D7PA 4QLWA 4ACPA 1S9XB 4AQ1C 2I9TA 4YWGL 5I30H 1JNLH 3ZTDC 2JK5A 3MTRA 1BZ7B 1N4XL 2CH8A 5FW7A 1OQXA 5EEWA 3MOAL 1JG9A 1TQWA 1SJVA 2E9JA 1L3WA 4JZNA 4AGLA 4K8RH 3W9EB 3MNVB 3HNVH 4JGJA 1WYJA 2OK0L 1GY1A 4JRXD 4PHXA 4TNVK 4I0KA 1K4DA 4OFYA 4KK5C 4XI5C 4AJWA 5IY5B 3AJ7A 1TVBB 4LVNC 4DH2A 4RGMB 4D8OA 5IB1B 1EHLH 3X1BA 4F37K 3ECBB 4M4RB 3VXNB 1E90A 1IIKA 4UNUA 4KKZA 4L05A 1HS6A 3BDBA 1KCWA 2G3MA 1U3HB 1QPKA 2DMCA 1FPTL 3SBWC 4ADIA 3QQ9C 2GJJA 4W68A 5CZXD 5E94A 2B39A 5DLLA 2YQ3A 1BFOA 1K4CB 3IRPX 3KWUA 5D2NB 4M1CC 5HHVL 3AU1A 1ULVA 1CFTA 1XH1A 2FX7L 4ZAKC 3QR2A 4OZIF 1QX1A 2Z7UA 3WD5H 2Y6TE 2CXKA 5HHXL 1T2QL 3DK2A 3UO1L 1IAOA 5C7ZA 3GMNB 1L0XA 4MNHB 3FB8A 4AL8L 3O0LA 4WI0A 5J6HA 1UZ6F 3HCVA 4EBQL 4P49A 1HINL 1B90A 2WXNA 1EEYA 5C08E 3L4YA 4D0BB 2YOCA 3NQIA 1W8NA 2F7IA 4UV4H 4QHLB 4L1HA 3W0WE 5AD0B 1U8QB 4N2HA 1CFSB 1DQQA 1WC7B 2GSGB 5F6HJ 2E7BA 5F89A 2XZQH 3QWRD 3B2MA 3BZEA 2SODB 2WWMD 3CQFA 3ZT5A 1C08A 4DP8X 2CDFA 4K3HA 3CSYA 4PRIE 4ZO8A 1HZKA 2X4UA 3MC0A 2IGFH 4MKTA 1XF2B 3M45A 4J27A 4GXVL 4XO4A 3EDEA 4R0LB 3I3EA 2HRLA 3HNSH 4KVNH 4ODHH 5JIHA 4B7IA 1RUQH 1TU2A 4BA8A 2H6UA 4P5MA 1KY6A 1DJYA 2XBZA 1WFTA 4BJLA 2K6WA 5FF6A 2AI0L 5HHMD 4MNGA 1BFVL 3BUDA 3T3PB 2WKLA 2Y5TA 3CXDH 5FXCH 1OAZL 4QXVA 3WJLA 1MVFA 2JFCA 3LN9A 2RMNA 2Y5QA 2ATAA 2J43A 1JYVA 1Z32X 2BS8A 4K5NA 2OL3A 3NK3A 3P40A 1L0PA 1RV6X 2EH7H 3NCBB 4U1NA 3BE1H 2VQTA 4Q58C 5GGVL 4DKEH 3GMQB 2YD5A 5GSVB 5EIVA 5L2JB 1AOZA 2F15A 3GO1L 1JF1B 4HEME 4LDCA 3WFCL 4B96A 3DECA 4LK4A 1OM9A 2B59A 2X2IA 5KVDL 5F3BB 3RZCB 2X12A 1FZKA 2R29L 3K6SA 5CCGE 4R4BB 4ZMPA 1I1AD 3GZKA 4S1RH 4AGNA 1JFHA 3MPCA 1JDAA 1P6AB 5LBSA 4EKJA 5CILH 5H4ZA 4GW5B 4JQVA 4PTTB 1RULL 3BKMH 4HT1H 3S5LB 1CD9B 3ZGIA 1W8EA 3HI6L 4Z7AA 3F04A 5K9JH 2IWGA 3VE0B 1CFBA 1A9EB 1NCGA 1SDYA 2YBGA 2JTYA 5JQIB 4UOW0 3GK8H 4IOFD 2LAGB 1E8ZA 2GJZB 5I73C 2DD8L 5J11C 1CD0A 1UWEL 4KH9A 2WLJA 3Q3GB 1TQCB 3Q06A 2GVYA 5I5MA 4ADGA 4PJEA 1ZT1A 2XU9A 3ATFA 5CCHE 3V4PL 4GRLA 5D7EA 2YBRA 4JRXE 5B21A 4HJ0C 3C5ZB 5E9DB 5ABAA 4IGBC 1WFOA 3ZE2E 3D2TA 2J8OA 5D8JH 1NCCH 4UV7H 3FQNB 2HPOA 4UM9B 1AGBA 2EE3A 4ERSH 3PQYA 1YQ2A 1M6UA 3CNKA 1JZ4A 5DUBA 3BPOC 5D7LA 1SDAB 3GSUA 3QAZC 5G2NA 3EH1A 3I6KB 4Y19B 4NHUB 1U6AH 3CCHA 2XVGA 3ZYZA 1HWGB 5EO1A 1CQYA 5J56B 4G5AA 1F90H 5AKSA 3MN8A 3DDGA 1TMQA 5AAPA 3OPZL 4KAQL 4O02H 2X4TA 4P4KA 2HN7B 3L3IB 4JR9L 1OGAB 3VFSB 4KO6A 4BA0A 1FFOB 1QEWB 5GSRB 1D3CA 3VWJD 3ZDZE 3FH5A 2CPUA 2R9HC 4K9EL 3GRBA 4TOYH 3QZWA 5TE6L 4P59L 4XCFH 3D25B 3EJZD 4Z5RB 4LLWA 3O11B 2JELH 4KQ0A 4C59B 2FQEA 1Z9PA 4U6XB 1XH3A 3VRJB 4YFLI 3BT2L 2FIRT 5IR1B 1AGEB 2ZKHH 3COOA 2C1OA 2VDQL 1KGXA 4RGMC 1WICA 3BYTA 3UZVB 4PJIA 2WVUA 3NP4A 5CSZA 3RUGF 3VDAA 1NBVH 1RKRA 1YNTB 2W9DL 4N2KA 4PJ7B 3KG5A 3F7YA 2N1KA 2OULB 3WS6A 2DWDA 1U3HC 1N2RB 4LAJH 1IGYA 1SLXA 1FG2A 3RDTA 3RKDD 5AAWA 5GZNA 2OJZH 4AQOA 3KPRE 4TSCH 4X6DB 3U6RA 5L2KB 5D2NC 1JXKA 1OCWL 3VYNA 4CVZA 1MCKA 5C0RL 1J8KA 2GK0A 1RCYA 1L9TA 2VXVH 5D1XA 3MJWA 1FLRH 5D1QE 3IFLL 1IAIM 1Q9OB 3LNDA 3O9WA 4XOAA 1VEPA 5KSVA 3WTUA 1S5IL 2BSRB 2I69A 2AKRB 1MREL 3S3CB 5IHUH 1A4AA 3HRPA 3KPQA 3JTBA 4TUJB 5GGSA 1YHPA 3QUMH 2WBWB 1DVUA 1FL6B 2E86A 1CBVL 3S3JA 4RGNB 4OLWH 1G5AA 4KTDH 4LRIC 1J1XH 5FYJE 4YIQB 3LIZL 1FAIH 3NCWA 3OHMB 3RNKB 2EDJA 1XVSA 3UAJD 1E4XL 4HIIB 1FN4A 1SJHB 3L7EB 5IVXA 3RFZA 2C9VA 1WWBX 5CKGA 1SHXA 2HVKB 4RAUA 4TSBH 1NL0L 1NBZA 2IG2H 4IQHA 4L1SA 1K3ZA 4JKPL 4NLHA 3TV3H 3GJEB 1ZIAA 3LRSA 1SXCA 3VU2A 4XP5H 1RZKC 5D93B 3MRRA 1SXAA 4WHYG 4R0LC 4IBUA 4PYHA 4KHTH 4PBVC 4FXLA 4MAYD 4NERA 3SYPA 1T2XA 1W72L 4G7VH 4OKVA 4NZRH 5DMGC 5DJ8A 2DL9A 1YEIH 2IXQB 2DH3A 4JQIL 4ZUVA 2WGNB 3C5JA 3QJXA 1QLRA 1R19A 3HNTH 1FVCA 1T04B 4X8JA 1RJLB 2OMTB 2ORBL 4CC4C 4JFOA 3U48A 4FQXA 5LNEA 4BH8A 4CSSA 4Z18A 4EXPX 1HKFA 3JQOB 1ZVHA 1SM3L 1FGVH 4JHVA 1DFXA 3GJFK 4PJBA 3C2AL 3FRPA 3M17A 3QW9A 3V0JA 3BH8A 3FSVA 4LBAA 3RWEB 3SDAB 5JHLL 1CGSH 2P8LA 3BKYH 1CT8B 2EDFA 3V5HB 2X6AA 3RZCC 1TCRB 4JKKA 2HKAA 3IRZA 4BRJA 3GUTB 1IAII 2QPDB 1JGLH 2K4AA 3GXPA 5F7WC 3CQPA 3DYMA 2BSED 2J1WA 2MNWA 2R7EB 2B7DT 1CTNA 2A9BA 2R27A 1ROWA 1SJEB 2WOYA 3FSZA 4GAGH 4X4KA 2ED6A 2HXAA 4B5EA 2WJ7A 3UJIH 3D87B 4JRWA 2EDXA 1IT9L 5E8OA 1HHIA 1ZIBA 4MAZA 4B9YA 3C6LB 2Y1AA 1MRFL 2Y5EA 3KDPB 3OKLB 4A7UA 1AOHA 1TQCC 5JW4M 4YXHH 3PJSA 1PZCA 4R4FL 5CJBA 2WSPA 4LRNH 2IPUK 1FNLA 4RRPA 3RNQA 4UILH 1KYOJ 3C5ZC 4MA8H 3DTXB 4YPGA 1SMDA 1GYAA 1NUGA 3IAPA 3QWNA 4XWGH 2GT9B 3F5WA 4PSRA 2VM3A 3GIZL 3P1VA 2FX8L 3ATAA 2J8UB 3IMWA 4FABL 2ZSWB 5F7MC 1L9SA 3TNMB 3LKQB 4OZGA 4NDMA 4EE2A 1YEEL 1KT2A 2YN3A 3B9KB 4HX1A 4JFFA 1GYVA 5FV1L 2KMWA 4W70A 3QUGA 1JPTH 1BEXA 2AK4D 3NJVA 4FG0A 1OTTD 2JQZA 3O8XA 4IW4C 2HJFB 3M1BB 3HUJA 3HAEB 4FCHA 2OBGA 5DFWH 4P2OA 1V10A 4EVNA 1MAML 2YD6A 3UMTA 4KRNA 2PABA 3HMXL 3CXHK 5C92A 2NSXA 1OGPA 2VM9A 4UDTB 4XB8A 2ATPA 4NXKA 1GJWA 2J8HA 4ODVH 1GMIA 5F3FA 4HW6A 1SJMA 4G3YH 1MHHB 5F0PB 5B1BB 1F02I 2V0AA 4LZKA 4Y8AA 1NMAL 4H0LC 4ZDHB 2V37A 2GTQA 4MQXC 2FSEA 4JPQA 4NQDD 3BH4A 3D85D 2HRPH 5ID1B 1O5DT 5TD4A 1CXHA 4BFJA 3CE1A 2XYBA 3EJPA 4XX1E 1UD5A 2UWEB 4FERA 1BF5A 2ZOTA 3RPIB 5FPIA 3CZFB 2V9RA 3OKMA 2NX5A 4LFHD 5GISL 3HLKA 2B2XL 4LSQH 3F7VA 3HBGA 1CLYH 3I2CH 5TF0A 3EBIA 5FDWB 5I1GL 3SO5A 1QVOB 3VXSD 1BVZA 2ZCHL 2L0DA 4B9GA 4NGHH 2MHAB 4X9BA 4UM8B 5DJAB 2G5BA 5IJDC 2D7TL 5D9SB 5A2CA 3SGJC 2H2PD 2KPNA 4QWWD 2E8YA 3P0VH 2YFNA 4PLKC 2G60L 3TEZA 3B7UX 1O6TA 4XAKD 4G5ZL 4C56A 4OFDA 1I85C 5FGCB 4U1SA 4WJ5B 2QMJA 4ZPTB 4FEIA 5BO1L 4RGNC 4F9PC 1KIRA 2FVNA 4ODWB 1KBGH 3U0WL 4HUNB 4RX4D 5EU3B 4DVBB 3EHBD 5KYYA 1YECL 5IQ9A 5C09E 4NO3B 3KGTA 3O3AA 3BEVA 1VZIA 4MCZA 1KJ3H 1H3WM 1GW0A 1T83A 2VDMB 2WK2A 5H35B 5ISZE 1ZXKA 4PY8J 3VXRD 2QELA 5KJRH 1DZ0A 5ABDE 4OLYH 1MY7A 3UTSA 2IAMA 4QRPB 3DK0A 2DS4A 1KG0B 1Q9KA 4LLVB 4O02B 1BQLH 4PV9A 4JM2A 5DRWB 1KJMA 4ZS7L 2DF3A 5D93C 2L7QA 4MD5B 4XN7A 3DO7A 4NX0A 4NBYB 3LEVH 3SGDI 1AXTL 4EI6B 4WHTA 1NFDA 5ESAB 2QPUA 1RK7A 3O6LL 1USZA 1NIBA 4YLBA 1NOLA 1KDJA 4EAEA 3IFNL 4K8RC 3MLTA 4H2AA 1OE2A 4N2FA 4UT6L 4L2YA 3C75A 1Z5YD 2B4CH 4KC3B 3OC5A 3TTYA 1TR7A 3H42H 1T6WA 3MJ9L 5FGBC 5JIDA 2Y7QA 3OHXB 1XL4A 1Z9SA 1BMZA 1DZBA 4N24A 4G72B 3MA7B 4DQOL 3VG0H 3EO0B 1TZGH 1OQOA 3SDAC 4HV8B 1XAKA 3BIKA 4WI3A 4TLKA 4HSCX 4NC0B 4XNQA 4WEUD 4E9RA 3BEWB 4RETB 4FZ8H 2KKQA 4TNVF 3T77A 5LHDA 2I27N 2I07B 2FJSA 3UTZB 1P5UA 2C9QA 2ADJB 2AK4E 3UOAB 2ZF9A 4TMPA 1N70A 4F37F 4KVCL 3D08A 4NWTH 3FMGL 4YHIB 4MWFB 1MEXH 4OB5L 1YJDH 5E4IA 3VSVA 4L3FA 1MCFA 5KSBA 4I3RL 2CR6A 1DBJL 4L4TB 3C6LC 1XF3A 4XVSL 4YSAA 4GYBA 2VDRH 1K6QH 1KGUA 3KW7A 3PWNA 4XVUD 2Z7YA 4JZJB 1RIUL 5FB8B 3PAZA 4GAJL 2FLMA 1TLKA 2XN0A 3B7YA 3EDDA 2Z1PA 1UGKA 4N2IA 3P4NA 5HTSA 3ZIMA 2E7CA 5I18H 4URTB 3T65B 2TSBA 3SPVA 5CS7A 3CFUA 1U92B 1UOLA 5AYTA 5PAZA 4O2EA 1OEZW 4ADJA 3V6OE 1BF8A 2R4SL 2OR7A 1F6LL 4KHXH 4LQFH 2EEXA 3VI4E 3GSNB 1IKOP 5GRVL 4YJZL 5HI5D 3B9KC 1J8RA 1A3ZA 1L7TL 4N28A 1E3ZA 3UBFA 5LBSH 3VGBA 4BK4A 2DQIH 2HT3C 4TSAL 5I1IH 4LCCA 3RPKA 3W56A 1G7LA 2VDOH 3EYOA 4A7GA 4EIUA 4R84A 3T5WA 5JXEA 4XRCB 3VXSE 1G6RL 1A25A 2V7HA 1J18A 4HFUH 3QUHA 5E8NA 4W9DC 1LEIA 3HHSB 3LZNA 3KGRA 4RVBA 1I4FA 4UQCA 1S7TA 4WSGA 2C5DC 1QSEE 2B5IB 4A39A 1RU9H 2NLJA 4XP1L 1EQWA 3HFFA 4DGVL 4XAKE 1IFHH 2Y4SA 2W1NA 1BJ1H 3H3BC 1JTPA 1G9HA 3ZDZF 1NIEA 4PRPD 3CVHL 5K39B 5KAQF 5IT2H 4LCUB 1EO7A 1BBJB 3ZY7A 3AS3A 3TA3D 5EEXA 1NKRA 1ET8A 4DP6X 4KZCA 3UBXG 2EJ1A 4DP0X 4HETA 4UZSA 1S7WB 2EVFA 2D9QB 3DURB 5AVTB 2CSPA 3LRHA 1X5JA 2F58H 1FI8C 4QOKA 4UOW1 4NAJA 4EF3A 2UZXA 4FL4B 2UXGA 4M3KB 4Y4KC 1UXWB 4NP4H 5E00B 3VTMA 1TO4A 4HBCH 35C8H 4JKMA 2WIIB 4FHJA 1MY5A 4RESB 4N87A 2YC1A 1VRSA 3A6BH 4L8BB 4I2XA 3PWPA 1AG6A 1HXMA 1KYUA 2WJ5A 3QNXA 4R26H 4QTIH 5BZDB 4LMQI 4YHLL 3LQAH 1KLUA 3GRGA 3I9GH 2PUQT 3LHPL 3E1F1 5DS1A 4GT0A 3RHWK 1KWGA 4M4PA 3ZIYA 4HOZA 5C2BL 2A6JA 2F54B 3VXUA 2FYVA 1ORQB 5HPMA 5JOPD 4NAMA 4DSYA 2LVEA 5FO8A 1MRCH 4S11A 2HLFC 4OZFG 5I1KL 3LS4L 1FHGA 1JPFB 1T7YA 4KK5D 2E6PA 4RFOL 1S9KC 2IJ0C 4XI5D 3HE7A 5C0CB 2FBRA 3QCTH 3X14B 3F7KA 1TZHB 4G8IB 4PJAA 1LLAA 4AVIA 1QLEB 2Q86B 2LVCA 1YEJL 1J05A 1AACA 1MNUH 3MRQB 4FNUA 5JPNA 4CDGC 1MW1A 2E9WA 1UKTA 3A4EA 2BVQA 4MB4A 3FO2B 1WBZB 3DYOA 2IDQA 3QT2A 5DUJA 3DSNB 2FD6H 4JK0D 3QQ9D 3ROLB 2KLTA 3C8KA 1H5BB 5EEZA 5JDJA 2H32A 3C60B 2RFXB 3NJXA 4LLAA 3S3PA 4Q56A 3S97C 1BJMA 1ZTXH 3L54A 4M1CD 5JHDD 4ZAKD 1JE6A 3ZE1E 1FVEA 1SF5A 4G6KL 1EUTA 1TVHA 4N8VG 5MEOA 2BZ7A 1FL3A 2R2EB 5EOCL 2BWIA 5GIRA 1FNEB 5K59E 5EZIH 1JHKL 3R19A 3QDJE 5F9OH 5DD3L 4BYHA 3OHXC 3CX2A 2GFBA 1NBYB 2HFEA 3NBNA 2EYRB 5JW4R 3NZ8B 1T20A 1YPZE 3QB7C 5F21B 3O6ML 1OAJA 2OS7A 3NACH 1PZUB 1YEHL 2X1OA 2HB0A 1BEYH 4YUEH 3M86A 1OP3H 1A4CA 4PWIA 3P11H 4AGMA 4NUJB 1T1XB 1U8LA 4MLIA 4DP5X 1YUKB 1JZ8A 2X4OB 1OO2A 3V0DA 3MREB 3EH2A 3H2PA 3WE6B 1TOXA 3HZKA 2QDVA 4WI8A 1LO2H 2AW2A 2IPKB 4EIZC 1FZJA 3I9AA 2HA1A 3FONA 4YDKH 1QFUL 4U3XA 2I9TB 4QXWA 2JK5B 4AUUA 2CCVA 3QC6X 2ZYIA 4NKIH 4FQCL 5GHWH 3FT9A 2V9UA 1P4LB 2VDLB 4DP4X 4QRRD 4DEPB 4DGIL 5GRUL 5J13B 4Q52A 4XPBL 4ZI8A 2I85A 3TO2A 4JZJC 1ZHBB 3LY6A 1P4UA 1K4DB 3ARTA 4PRPE 1GGBL 1BVOA 5CEZD 2OMXA 3FB5B 2DQTL 3MCLH 2EC9U 2W60A 3NIDF 4HWEH 1ZA3A 3W5MA 4K94C 4QT5A 1F41A 1S3KH 2BOLA 3OL2A 2ZWSA 3L95A 5AKRA 3O2WH 1CICA 2DH2A 4F2EA 4JFZL 1YEFH 1RXLA 2Z91A 1DBAH 1U8NA 3DDFA 3PV7A 3QPXL 4GSUA 5FLUA 4F7PA 1T7ZA 1KB5L 3CFKA 4HA1A 5EU4A 4PGBB 2PPAA 1UOWA 2YLHA 4YEEA 5E94B 3S35H 2LU7A 3T0EA 5JUEL 1IQDB 1BFOB 2VDPB 3NFNA 2DAVA 2JJUA 2XNAA 4K7FA 3ZYJA 3AU1B 1CFTB 3SO3B 2FATL 3G6AA 1F1GA 2FSDA 4ONOA 3NPSB 2NXYB 1F97A 1WAAE 3UJTH 4WV1A 4GAAA 4LNVA 1KJVB 2IQ9L 2XN9A 1IAOB 3NRPA 5HYQB 1UXSA 1JF5A 2OMBA 3FB8B 3LPOA 4WI0B 2B5IC 5DZOA 4KO9A 4QYOA 2CDEB 4WK2B 1MJJB 5FOBB 4XP6L 5EOTB 1IM9A 1KPVA 3TZVA 1FFPB 2R29A 1HI6B 3HRZB 5A6IA 4LLMB 5CZVH 1M71B 5JOPE 5HYSA 3AG1B 1NOAA 1NIFA 2BRQA 1TO5A 2VLKD 3B7SA 3GHEL 5F1SA 3DX0A 1DQQB 4J39A 5JIQA 5F89B 5EEVA 4LPWA 1FSKC 3IXTB 1AQKH 3MROA 5B38B 3R4DA 5I1DA 3VQ1C 1PPIA 1YA5A 2NY7L 4YDMA 5C07B 5HYJA 2OYPA 1L9RA 4I3SH 1QABA 4XTRC 5BXFB 1FH5H 4UT7L 1PZ3A 1S7SA 4FL4C 4NRYA 4R5TA 1MJ7L 1BGXL 2BDNH 3QZMA 1TU2B 3SGEI 2VLRA 4P5MB 3U83A 5DT1H 3KPSE 5BZZA 2ZYHA 1FYTB 4HU2A 4MNGB 4XE0A 1S2EA 3QRGL 5JHDE 4H26A 3FU5A 1P7BA 3IJ9A 2JKIS 2X5PA 1M7IA 2OL3B 2FJFA 2XZCL 3VO0A 4U1NB 5DURB 3U1SH 4ELDA 1JNHA 1ZHLA 1MLCB 1ZLUH 1WFNA 2MPAL 2BNRB 3EJYC 2R9HD 5B22A 1J8HD 1KPUA 3MGTA 3UO8B 2J25A 1T89A 3NH7L 3II3A 2WLYA 4LMQE 3L13A 5F88A 2B59B 3Q2LA 1E3FA 4FULA 1FZKB 5CCKL 3K6SB 3RWCA 4J3TA 5CHNB 1H8OA 5JHAA 2DMHA 1XMWA 2PWFA 5KN5A 4CVUA 1DE4B 4NZTL 4PJ6A 3DXAB 3FU7B 3HIZA 1LMKA 4RQQA 2V2WA 4J8RA 4HHAA 3N44B 5A7BA 1F1AA 2EE0A 4YO0A 3WKYA 5C9JA 1U3HD 2DJSA 5KBNC 2YLKA 3VXTB 3D12B 4XN5A 1G9MC 4WNSA 1BZ9A 1S4IA 1H5BC 2WXLA 4M6OH 3UZQA 1A3RH 1DVTA 5G4NA 4TLUA 3C60C 3X13A 5C71A 2ZXBA 3AY2A 4G6FB 1BJ1J 4Y1AA 3Q5YA 1I1FA 2P48B 4Y4HA 1J1PL 4H1LA 1PMYA 3LH2L 4YDZA 2FEEL 3EGSA 4PJEB 4KX9A 4Y8DC 3G08B 2C1PB 4UTAA 3TU6A 5IFHH 4GIPD 2JCCA 4PG9A 3ZKMC 4UOQA 1UYWH 3MV11 2BWQA 3GHBL 3QORB 5CEZE 2JXMA 1GZHC 1SFHA 5L88L 2Y7NA 3BUPA 2COVD 1WIOA 4GKZB 4OTXL 1AGBB 2P8PB 3PQYB 1DO6A 3OKNB 2N7AA 2DLFL 3L3OA 1Q94A 3GKWL 5DUBB 5EO0A 2J72A 4M7KL 2X87A 5D7LB 3A6CL 4BQ9A 3GSUB 3WKML 2BC4B 4CSPA 3CCHB 1ADQL 1J0HA 4GFXA 3B3BA 5EO1B 4JFXB 4QAWA 5AG8A 4OVVA 3LQZA 4PJFA 2QQNH 3EYVA 4A2HA 4HUXA 1WF5A 2X4TB 4QGTA 1S7UA 2RTTA 4HLZH 3WXWH 3D9AL 1H9VA 3OAUH 1U9KA 4Z7VE 5MEQA 1T1ZA 4OM0L 3ULVC 5KVFH 3ROOA 4DEPC 3LIZA 5H37G 3B9AA 5J13C 4CA4A 5DMGD 1QYGH 2X4QA 3QARA 4HCIA 4HUUA 4LPVA 5LBGA 1ACYH 5D4JA 2DV6A 3DARA 2A9NL 5LGYA 5EUOE 2A9AA 1FNHA 4KTEH 5CLXA 2WXRA 4WUUA 5E4OA 1UCTA 1YN6B 3CVIL 2VLKE 2ILLA 4YHKH 1JRHI 2C1OB 5IB2A 3TC9A 2DYSB 3FXIC 2EYSB 2UY6B 4TNGA 8CGTA 1R0AH 4PJIB 4PN6A 2F1AA 2XIDA 4C8XA 5FYJL 1I8MA 2P9RA 3F7YB 1PZ5A 3SB3A 1MRDL 1W72A 4UINH 4HGMA 1CFMA 1I3GH 3RDTB 5BZWA 1ZVSA 4BFOA 1LDPH 1YUHB 3TBCA 3AITA 3AY4A 1QFOA 1JZ3A 1QI4A 1ETZB 1RZJH 4OZ4A 2F7RA 4CVZB 3VM5A 2YK1L 4GUPA 3U9UA 3OKEA 1BYPA 1AP2A 3SO3C 3DJ9A 3FU6A 2XIIA 5I0XA 5D1XB 5E6IA 3ZPDA 4W9GC 3NPSC 1AE6H 2NXYC 4KMTL 4WFHD 4HS3B 5KSVB 1V3LA 3JWNG 3ESNA 2B4CC 1HNGA 3TASA 5JXAH 2J56A 5CGYC 5JHLA 1D2OA 4NJ9L 2H0PA 4IS6B 5GGSB 3D06A 3HRZC 1QW8A 3CFBA 5EBMB 4Z7UF 2ADFH 4L3EB 3T8VA 2YEVB 1RZIA 3VFNA 2Z4QB 3C5ZD 2F68X 1XL6A 5IVXB 1OOWA 1U3YA 1N64L 3L5XH 4TRPL 3L8QA 2L4OA 2O5XL 3CBRA 4GI9A 1NBZB 3GXUB 5HDQL 1BYOA 3UTOA 1N5AB 1WS8A 4YVUA 1PZDA 2R0WL 2VL5A 4M6AA 1T5WB 3T2QA 4AEHL 1U8KA 2ZG1A 3DBSA 1GCFA 3DOIA 2FB4L 4OW6A 4OKVB 1J9TA 2WQ8A 3FHQA 4NC1C 4BE6A 5DJ8B 3QDGA 1FFQA 1UWXH 3LZLA 2AAAA 2V5SA 4MXWH 5IMMB 4MQTB 2DLTA 3C5JB 5D2NE 2VZUA 1QLRB 3EYSH 2WZPD 1A8JH 1FVCB 1TDQA 5HDLA 3PDGA 2O93L 2OTWA 4ZZFA 1T0MB 3FQWA 4JFOB 1M7XA 3S88L 4QTFA 2EXYD 4I4WA 3AT8A 2EYTA 2CIIB 2FJGB 4L5FE 1OP5K 3UYRL 4AYSA 4XVTL 2VO8A 2QZ5A 3M17B 3IETB 5D5MF 1UWGH 4PWGA 4R7VA 3BH8B 1PJWA 4FLRA 4P2CG 4K7PL 4PJHF 1IC0A 1R17A 2P8LB 4M43L 2XQYK 2QQQA 4P05A 3D05A 4OCYH 4HIQA 1YYCA 3UBXA 3MLUL 3S7GA 3VXMB 4J3OF 1FLTX 4C83B 4ALAL 4MQXD 1D9KA 4KJWC 4JQVC 3PE9A 2DIJA 3L7FB 5LO7A 4KRMB 3HMXA 3U82B 4FAAB 1K5WA 5DHDA 5ITFB 2GUOA 1PLCA 1V5JA 1A0QL 1IRAY 2O61B 1A22B 1INDL 3CZUB 2XRAH 4G6ML 3ETTA 4Y16A 3RURA 3TF7C 5E8OB 3RE0A 3AABA 2O6PA 5DD0L 3QULA 1LEGB 1YY8A 2F19L 3PJSB 2FX9H 1JGDA 1TZIA 5IKCA 3T3PE 3RNQB 3UXFA 4WU7A 4WY7L 2FHFA 4XNUH 1A6UL 4IBZA 3QORC 3U46B 1HHKA 3LCYA 4PLKD 4YNYB 1JGVH 3FO0L 3L9EA 4LEBA 3PXLA 4KXZI 3W11C 5K9KB 3MVSA 4LLYA 3V8CA 3VRIB 3W5NA 2CBMA 2VR3A 4RGND 5E8PA 3U6XS 5HGHA 2WP3T 3N9GL 4OZFA 1EMTL 1IBBA 4HD5A 5AENA 3GI9L 2BSSB 4NDMB 1I3RA 1UUNA 3TP4A 1OL0A 5GRJL 3FC8A 4N6QA 1B4JH 4YWGH 1XSJA 5AZ2L 1JYXA 1FNFA 1N4XH 3AVEA 1A1OB 3OSKA 5L6YL 2X42A 2UVEA 3RLSA 3HUJB 3ECVA 3GMRB 3CHQA 5ITBL 3GEFA 3X1FA 5ERWA 1JVKA 4WSJA 1JZ7A 1ZWIA 3C5SA 3QIWB 2OK0H 4KO7A 3LEYL 1IKFL 2H32H 2KS0A 2DYPA 2GTWB 3F12A 3G5VA 1QTSA 3V0HA 4XZUB 2C3GA 1DR9A 4BKLA 1GS8A 3SE6A 3EZ8A 3IRCA 1LO5A 3AREA 2ENYA 4Z1PA 4AQZA 4K8RD 4G7YL 1T5KA 1C1EL 4X50A 5D7JB 3CBKB 3DX6B 4OBRA 3L81A 3ESOA 4YE4L 5E9DE 2CGRL 3IVKA 2Z35A 3BQUA 3UTPD 2AQQA 1ID5I 2XXFA 4IK7A 4MNQD 1QSFB 1NA8A 2J1XA 3WS6C 4FKEA 5J57B 2X9WA 5HHVH 1TPXB 3OKMB 3UEZA 2O6DA 1Q0EA 3RDTC 5AAWC 1Q1PA 4Z76A 4Y19E 2AP2A 5D6CA 4ZNCD 2F7OA 4H8HA 4K4KA 5HHXH 1T2QH 3V0EA 3Q1EA 1F4AA 4U0RB 4UT6A 3CDZB 3EJQA 3VD1A 3ZT7A 2NNRA 4AL8H 1HEJC 3MJ9A 4EBQH 1HINH 2VSDA 3QH3B 3BN9C 4ONFL 4U1IB 2XG5A 3AUWB 5D1XC 2EC9T 1OT1A 3ATEA 2G5BB 3F7QA 5INCB 3D34A 3PP3H 3NA9L 1OGAE 2DEWX 3MUHL 1Q0YL 2ZXGA 4WGWB 3RFRA 4PREA 2XICA 1XZ0A 4HUWA 3RAJL 3FB7A 4Q89A 1A4KA 4U6HB 2B15A 3C6LD 1PF3A 1WQVT 5CUSL 3RG1C 4KX8A 5JO5A 5AQ0A 4ZQTA 5KYYB 2XFXA 3HZMB 1T03L 1LHZA 3O3AB 4HKBA 1MJ8L 3BEVB 4MCZB 4GXVH 2FH8A 3BDXA 3MJ7A 2ZSVA 3FTGA 5CEXB 1DSWA 4NPKA 1FWXA 5E2VL 1P7KA 5CSGA 3MBXL 3IMTA 1VGEH 1F5WA 3IDIB 2AI0H 3PHQA 4PV9B 1BFVH 4ZUWA 5ABZA 4I87A 4PJ7E 3VW3L 2NUPA 3LKRA 3RU8L 4Z7QF 3ZR5A 3DO7B 3MRMA 2QSVA 1NFDB 4L9LA 1DL7L 3D4CA 3KCWA 3TBTA 2HT3D 2NY5H 1EEQA 4IOSA 3O3BB 2DM2A 2KC0A 3BZ5A 1L5GB 5GGVH 3MLTB 4X6DE 3TEYA 2OTUA 5L2KE 3VJ6B 1B0GB 1G4RA 2AV1A 3WFEL 1IAIL 1JZEA 3GO1H 4YHZL 5E8DL 2Y7QB 1GGTA 1PYWA 1Z9SB 3FT4A 2R29H 3WFBH 1A7NL 2ICEB 3MODL 4JNXA 2GBAA 1CIDA 3HE6A 3NJMA 3OJ2C 4F2MB 2IOOA 1JS4A 1VIWA 1KYOK 4NYLB 4PJDA 2Z31B 2MOGA 2G9HB 3CD4A 1RULH 4R83A 4XNQB 2FR4A 4F27A 2O30A 3AS0A 3HI6H 4MGXA 5I26A 4AUJA 2IQAA 5I0YA 3LKSB 1G6RA 3QXAA 4DOHB 1JYNA 3HHMA 4PY8I 5KYXA 4AK1A 5DFAA 1ID2A 1MH5A 3E9TA 3K3QA 3EDKA 2WBJB 4MZRA 1AZZC 2MCMA 2DD8H 4DGUA 4IJTA 3WLWC 1UWEH 4LCWA 2KPWA 4AZ8A 4HULB 5IGXL 4KDTC 2WQRA 1MHPL 2AQ3A 4YHPA 4AOFA 3GS0A 3WE1A 1WWAX 4Y4KD 3WBDA 1SZNA 4C4KT 2X1XR 1JI2A 3CVHA 6CGTA 4QJ3B 2APFA 1YMHA 3ZQXA 4X99A 1TJMA 4HMDA 1OSEA 3IFOA 1NGQL 3V4VB 3UDWA 2XVLA 4U1HB 2HRGA 1CXEA 4PIRF 1F58L 5ICXA 3P4NB 4D0DA 4E42A 1N7MH 3ILDA 3POCA 2DIAA 4IIQA 1O9VA 1ZE3H 3BVDB 2Y1ZA 1FO0B 2VN7A 3VDCA 2KZBA 4KZDL 1E2VA 4O2EB 4X5XB 1JV5B 1YEKL 2OZNA 1SEQL 4A2LA 3UTPE 4KNSA 3L9YA 3OPZH 1HL4A 4KAQH 5BRZA 1AZUA 3Q9PA 5J1AB 3PNWA 1OIOA 1KCKA 5DHXB 3KBPA 5JR1L 4F9LA 1LO3L 1SUHA 1G7LB 3EYOB 3O8XC 3GSOA 4OCSL 1KF9B 1LO0L 4WTWA 1DQKA 3TBSB 4P59H 5F1OB 3F7PC 3QIWC 1M6OA 1I4FB 3GMOA 2CRYA 5A16A 1S7TB 2KI6A 3QRLA 1EAPA 1ETA1 2VW6A 3A23A 3GM0A 3FU8A 4GRWH 5LDUA 3INUL 1YCSA 5EN3A 5FC9A 1J5HA 3BT2H 4H1LH 1QBLL 3GWJA 3BFOA 2VDQH 4QXTA 4UTAH 2GY5A 3K0YA 4DNLA 3MNWB 1HXKA 4FX5A 2W9DH 4YE0A 2Z6FA 3GTNA 1CBJA 2YAMA 2WAHA 2X40A 4Z3HA 3Q2CA 1V27A 3Q2WA 1N6QL 4Z7WA 2NYYC 1U8OA 3TTSA 1N8ZA 3IJEA 4KKLC 4WJKB 1DLHA 1N8OE 4ELMF 3WFHA 5TPWL 1FIGL 2JLPA 2XA3A 2H9GB 2J8UE 5EMYA 1OCWH 1CFQB 4KKPA 4QOKB 3I84A 2W59A 3VB8A 1TPXC 1XT5A 2UZXB 2F9BT 1JP5A 2XWTA 3IFLH 2ITDB 4U0RC 5EF0A 3S3SA 4X9HA 1S5IH 5G5DA 2YC1B 4DN3L 1VDGA 1MREH 4I2XB 4FG4A 1QAWA 1CBVH 1HXMB 3ALXA 1QBBA 2ATKA 4FFYA 4TPRL 2FYYB 4YL9A 5KBMA 2CWRA 3VFTA 3MLRL 3GSRB 3VFVA 4PGCA 1KLUB 1IBGL 3LIZH 2UZYA 2XKNA 1AGCB 4DP9X 3A22A 1IEHA 2NTFB 2ZPKL 4LLQA 4POYA 3E3QE 2JF1A 3UTQA 4L4TD 3B9DA 5M94B 4N2NA 1PX3A 4Y1TA 3VXUB 5HPMB 2IDCA 1HHJB 1XXFC 5DVKA 4H8VA 4PWEA 2P80D 1NL0H 4H8PA 3BISA 4JKPH 5DQJA 5FV2A 1A2YA 2EQDA 1IQWL 3HE7B 1HL8A 1CDHA 1T83C 4FA7B 1R4XA 4ZW3A 5J6GA 4PJAB 2WXPA 3FQRA 4JO1L 3KR3L 1S9YA 5JPNB 3TBYA 4XAWH 3RVUC 1W72H 2BVQB 5LG6A 1LK2A 1TTRA 4J3BA 1J86A 2UWEE 1KCBA 4JQIH 3RIKA 4FS0A 4JMXA 1UT1A 1FZMA 1GOHA 3J07A 4NOFA 4X7TB 3OWEA 5F7YC 2H32B 2ORBH 1OD7A 2Z93A 1VGKA 5SX5H 4XNXL 3AACA 2Z8SA 1SVZA 1S7XB 3D4YA 2ESVA 1E28B 2Y23A 1SM3H 5MEOB 1TVHB 3C2AH 3NDYE 1KNOA 5I2IB 3F7LA 1FL3B 5C08A 2DWYA 5GIRB 5AEAA 2FT7A 3CSTA 3JVGA 3IGAA 5JHLH 3SCMA 4F3FA 3HPLA 3Q05A 1OAQH 3W0WA 1ECYA 1T0OA 1OWWA 1UC6A 1T20B 1KB5A 3QNFA 2IO5A 4NSKA 3VFGH 3J8F7 4B9JA 4PH8A 5FGCE 3REVA 1JZ6A 2Z31C 3CFTA 1I1CA 1Q1JL 4XCNB 4PRIA 4A2EA 4XNYH 1U8LB 1MDTA 4HC1A 3WJJA 4F8NA 2NSQA 3QHZL 5HGGS 3TJEH 3WIHL 4APQA 1XF5B 3HZKB 3TYGL 1FE8L 5CLYA 4AGQA 4U2YA 1H15A 1FZJB 4IHBA 1RZJC 1IT9H 2WBJC 3B2UC 3FONB 1MRFH 4QRPE 3F58L 4HUMB 5ACZB 1D6VL 4XTRD 3OG6B 1GOGA 2MQGA 1D5IL 5IHBA 1G6VK 1M1SA 2BP5M 3QQDA 4LL1A 3E6HA 3OJMB 1U8HB 3QZOA 1O9ZA 1IZJA 3M88A 3DGDA 1MPAH 5A40E 2RIKA 1I7RA 2VITB 15C8L 1ZGLP 4CL7A 2FX8H 1I1YB 3B37A 2FT8A 3KLKA 4LHUA 2GAZB 3OGCA 4UNTA 4FABH 1BPVA 2CHZA 4JRYA 3LKNB 3T9WA 4MJ2A 5DJYB 5LNGA 3M8OL 4M8QB 4YGVB 2R0LL 1YEEH 4QTHA 3EJYD 3KLQA 4YZFE 3T1FA 5I0ZA 2EICA 2WXOA 2F54D 5T5NG 5SX4H 2QPEB 5GPRA 2H6PB 3SODB 1X44A 3LRKA 3B5TA 1GGYA 1D5BA 5EU4B 1L0QA 1WGOA 3RWHA 2GI0A 2WXGA 5LCVL 3T0EB 5C0CD 3QXTA 2AJSL 4LCCC 4EQ3A 5IB4B 2YEZB 3LNEA 3QO0A 4K7FB 3HMXH 4X9YA 3G6AB 4NFDA 5DZVA 4YPJA 4PS8A 2FEJA 3WY4A 3O2DL 4WV1B 2XN9B 3KPPA 2YQ2A 5ESVA 3KBHE 1G7JB 1V3KA 3LD8C 3ARQA 4JRXA 4FXTA 3I3BA 5GGRY 3C60D 3KYAA 2DI7A 3VYPA 1NBCA 1IM9B 1ITBB 1KPVB 1NMAH 4BBWA 3K1KC 3WENA 1P4BH 3WDHA 5BJTA 4X5WB 3QJOA 1INQA 4GEJA 1FV1B 3QQ3A 4P4RA 3BYYA 4IJ3B 4X5RA 4PM1A 3CSGA 4WTZA 1RL1A 4OZFH 3V7AE 5I1GH 2BMKA 3QI9A 3B34A 4KXBA 4I1NB 4PI0A 1KCSL 2V17L 3CDFA 2ZCHH 1HFUA 3ELAT 4M7LH 4PJXB 2I5YL 5DRXA 4IK6A 1OY3B 1P5VA 2D7TH 5GZOC 4A6YB 2HTLC 5ID0A 3QG7L 1ACZA 3EGXB 1TIUA 3L08A 4U4BA 1L6XA 3THMH 2R4RH 2G60H 3SBRA 2EDOA 4GIOA 4Z3EA 4ZX6A 2QEJA 4G5ZH 4H26B 3UGXA 5ICYB 3LRLA 4OAWA 2ZWLT 4AV0A 2PPEA 1UQSB 1O5PA 2BIMA 5BO1H 3U0WH 1VLXA 2NDFA 1RZ7L 4K5OA 4GKLA 1JNHB 1ZHLB 2IFFL 4OFIA 4TKWA 5BQ7A 3ULVD 1YECH 3MGTB 5T1DL 4JDVB 2IALA 2FHBA 4HIXL 2DKMA 3HJ0A 2HAZA 4O00A 4OFYD 3CVDA 5CEZL 3RWCB 1HSAA 1XGRB 1ZT7A 3HE7C 4ZS7H 5JZ7C 1IZKA 3Q2NA 4ESKA 3PPSA 4ZX5A 3FULA 2D0HA 2NXZB 1AXTH 5TJWK 2PPDA 1PSKL 3BP5A 4J8RB 1FYHB 1X5IA 3I50L 4HHAB 4N25A 5JPNC 3O6LH 4YO0B 3KPRA 3GMMA 4ELKB 3GXNA 4PFEA 4AQAA 5DC2A 4RIRA 4BFFA 5C9JB 2OMUA 5T33L 5I6PA 5JA9A 5EZJA 4BH7A 5FW6A 4MZ3A 4UT6H 3UZQB 5D1QA 3X13B 1YNTF 2AQ2A 2ZNXA 4YHOL 3CHXA 4GRWB 3MJ9H 1I1FB 4LLDA 3FT1A 3KVPA 4JQXC 4Y4HB 4ZMXA 2FBOJ 5EU7C 5ETUA 4OJDH 2J55A 2CGZA 2CALA 3OB0H 3ETBJ 4FYTA 4CBZA 3MJGX 5FA3A 2QKIB 4X0NA 2JCCB 2NXYD 4DQOH 4PG9B 1QR4A 4IKIA 4KXCA 1NZRA 4M7ZB 3BRGC 2O5YL 1HH6B 2ZP0T 1P2CA 5CGYD 5SWQA 3DX9B 4AMXA 4LEXL 1OP9A 3UYPA 1NUNB 3L3OB 1Q94B 1DLFL 5G55A 4DEUA 2CD0A 1AGFB 2KZ1B 4G82A 2QR0A 1H9DA 2QQLL 2F54E 1JN6B 4APXB 3OGOE 3TYFB 4KVCH 2ARJQ 2QTVA 5KANG 4ZXBA 3FMGH 5DEGA 1YEGH 5ALCL 1EHKB 4RISL 3LQZB 1ONQB 5C0CE 4PJFB 4AI7A 2P42B 2DIEA 4HUXB 1A6VL 5B39G 3H55A 4IU3B 1UD3A 4B9PA 4ZPVB 1DBJH 1FQ9C 2CG9X 4XVSH 1YNKH 3DBXA 1IGTB 1RIUH 1A7QL 5DQ9A 3PFUA 4GAJH 4MBRA 1H3XA 9CGTA 1KGWA 1WZ1L 3GXDA 2J88L 4UQ2A 2X4QB 4HS8H 3A6OA 3RYMA 3S5YA 4R90L 3ARRA 3L17A 3W81A 1BECA 3AFLA 4PB0L 1ZSHA 2A3TA 2FJUB 5CKAA 5IB2B 5HXMA 1NANH 1MG3C 4BINA 4LB8A 2FJHA 2BNRD 4FI7A 5B7MA 1SDDA 1JV2A 4FXGB 4KI5F 4TSAH 1CICC 1CG9A 5DLML 5GS3A 4K5LA 2XOTA 1G6RH 4V2CB 3P9LA 4WU5B 2WUBL 3T0EC 4LSUH 1OHZA 2Q1EA 3HC0B 1M57B 2NY5C 4KJWD 4GUPB 4TNWK 4X4XA 2FEDC 3WY3A 2Y07L 5KBKA 3LNIA 4XP1H 5E6IB 4WW2F 1CPUA 2CM6A 4HWZA 1TFPA 2DWEB 3O3DA 4WV1C 5CU9A 3VYOA 1F2XK 1H3PL 2LHAA 3VUAA 2VISB 4RGOL 5I24A 3CVHH 5C0EB 1G7QB 4OH2A 4BELD 5CFHA 3S36X 3ULVE 3RL1A 4G6FD 4N8CL 1KV3A 2IDSA 2K4WA 4KUCD 4FLOA 5FUOL 1NGXB 4WFGD 4DQAA 2F18A 4U7KA 1OGTA<