3CBKB

Chagasin-cathepsin b
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
110
structure length
110
Chain Sequence
MSHKVTKAHNGATLTVAVGELVEIQLPSNPTTGFAWYFEGGTKESPNESMFTVENKYFPPDSKLLGAGGTEHFHVTVKAAGTHAVNLTYMRPWTGPSHDSERFTVYLKAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Displacement of the occluding loop by the parasite protein, chagasin, results in efficient inhibition of human cathepsin B.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Cathepsin B
total genus 22
structure length 110
sequence length 110
ec nomenclature
pdb deposition date 2008-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF09394 Inhibitor_I42 Chagasin family peptidase inhibitor I42
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2020 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3cbkB00
3CBKB 3M86A 2WGNB 3E1ZA 2NQDA 2OULB 3M88A 3PNRB 2NNRA 2H7WA 3CBJB 2FO8A 2C34A
chains in the Genus database with same CATH superfamily
4HMCA 4NZUL 4B9CA 4MA7H 1FL6B 2BRQA 2MPVA 4RISL 3VXRA 1P7QB 1WBXA 2ZP9A 3VYNA 2QZ5A 3VJ6B 4K73A 3PWUA 5J12B 1DSWA 3T0AA 2BVQB 3IU3A 4Z7VE 1PDKA 2DYRB 3AS2A 3S96B 4ZMNA 1UWXK 1OF2B 4G5ZH 1PG7X 3U1PA 5E00A 1I8LC 4PRHB 5KUMA 4JHWL 5F6HI 3IDNB 5CCJA 4J23A 5A16A 4XMTA 2FIKA 5LKNA 4N2AA 2HX8A 4MD0A 4G80B 3JWNC 3DARA 1X7QA 3ECQA 4HPYH 2A9NL 3RVVD 5E08L 4OQ1A 4ZTPH 2FWOB 2EXTA 2OXGB 1ZVHA 4X8GA 3IDUA 3C2AL 1FZOB 3TZVC 2QGCA 3V8CA 1MCHA 1HNFA 5GPRA 4XWGL 1WRFA 3SGKC 3CLWA 5JPNC 2GVYA 2ZYRA 1S9VB 4QYAA 3CFUA 2CSPA 5EC1B 2ICEC 3OAZH 3WTSA 3TM6A 4PJ5E 5FUOL 5D70H 3UMTA 3BDXA 2G2NA 2FEJA 3ES6B 2UVFA 1SN2A 3P73B 3PPSA 1GTFA 2E7BA 1F11A 4LVEA 1FIEA 3LRSA 1INQB 4HIHB 4QXUH 1ZSDA 5AYQA 1IC0A 4X98B 5I2IB 3U30C 1UCBL 4RAVB 2WQAA 3E7JA 2B14A 2ZP0T 1YY8B 5LN8A 5A2IH 1BG1A 1TU2A 1A14H 2AQRA 1PPIA 1Q9KB 4TQ8A 3RWJB 3DGGA 1SJEB 4S1QL 4OGYH 1N5AB 3PL6A 4LIQH 2PMZA 1CD8A 4TTDD 1E50A 4N8VA 4F8OA 2WNGA 3K6DA 1H3VA 2AXHA 1UD4A 5GHWH 5BPPA 4GSQA 2B59A 4G6AD 4G6FD 2QVFB 2BWQA 1QSEB 3Q5YA 4OF6A 1MCFA 2HXAA 3DO3A 1CE6B 3TEZA 2Y7SA 1LNUB 5LBGA 1SFHA 2W0LA 4ODHH 1C5CL 5ICXB 1A6PA 1QFOA 1T1ZB 2EDJA 5AW8B 4AK1A 3LEYH 1G7PA 3LV3A 3O3DA 2X4SA 4HT1L 3KLHC 2HTKC 4MNHB 4OGZA 2AK4B 1UXMA 3R8BB 4KDWA 3QWRD 4KPHL 3UZQB 4BXVA 4DZ8A 4PEEA 3VXUD 4BXSV 2WCGA 4A6YH 4L4VA 4WHYG 1EV2E 2KZWA 4D9LL 3MHZA 2XVBA 4M6OH 1RULL 3OB0K 1SQ2N 1AZZC 5KBPA 1E6OH 4UYQA 4A68A 1HJCA 1S5HA 2J8HA 2NW3B 2YWYA 5SWZE 1IBZA 1Z5HA 2YRZA 1HEZA 2ESVE 4NYLA 2ZD0A 4V1DE 1IRAY 2QLYA 3C5SB 1JN6B 5JO5A 3TS8A 4XNMB 4J4PA 3RVUC 1HYSD 3GZKA 5DUBB 4WI6A 1RURL 5FB8A 5I6PA 5FW6A 4LP4A 5GGUB 5CD3A 2AV1B 3VQ1C 4HBCH 4WSKA 4OGXL 2X4OA 2R1YB 2OYKA 5CJXC 2V3EA 4MXWH 2FEDD 5ISZD 3FTZA 4KZEH 5CJOH 4QKTA 5IW6A 1KZYA 3BCFA 4J3VA 1ZK9A 4JFDE 4FXGC 4XP1L 5GIRB 5K33A 3N1GC 3S6CA 1T04A 1FFRA 3M45A 3NDZE 3PQYD 3QNFA 3EYSL 3TH2T 3EDEA 1GGYA 3U1SL 1RVFH 1BF2A 2AK1L 1CIUA 3BAJA 3ULUH 5EDXA 2QGEA 4GQ9L 1BREA 5IHWA 4KKAD 5EN2A 4F37F 3TO4B 2DKMA 1M56B 4NENB 3VWKC 3HW7A 3C08H 4ZAKB 4TNGA 2YXVA 3IDMB 1S5IL 3QXAA 5FYLD 5C09D 3VVVA 4YHLH 1HCYA 4U6VH 3N44F 4QAMB 2VUOA 2WXPA 5KSVB 5IP4A 4RCAA 5GHWL 3BN3B 1KIPA 4HIJB 4X6DB 5B3SB 3RX5A 2BSED 4FL4C 1A3RL 3MRRA 3BD4A 4XH2B 1WZAA 4L3EB 3CLEL 4FL4B 3Q43A 2VL5B 3VQ2C 5C7ZA 3KWTA 4P9HC 3SJVD 3B1UA 5F44A 3S88L 3B37A 2Z0BA 3N04A 2EYTB 4MVBD 3BT0A 1CLYH 3B4NA 3IXTA 5FA4B 1PL3A 5KN5B 2Z1KA 2V6HA 3BGMB 5E6IA 5GGTA 5HTSA 5IB4A 5ACMA 5DQDL 5TK2A 3V4UH 4A2DA 4QRQB 4DT2A 2NY5C 5BMFH 2Y5TB 4WEBL 1LP9B 2Z35A 1QD0A 3T6XA 5IJKA 3QK0A 3T0ED 1LE9A 3HZYB 4M43H 1EWHA 3VI4F 3NABH 2E47A 3ABMB 3AWFA 3U7YH 4H8QA 5ESAA 3BEVB 3CFBB 1T7WA 3O3BB 2VXVL 2OI9C 3QZMA 5CEYB 2ALAA 2FATH 2E6QA 4N86A 1UT1A 4XTRC 3JVFC 4Z7OE 1KCRL 1E42A 5IVXE 1KC5H 1DQQB 3FHAA 4XP4H 1X7QB 4M8VA 3VFOB 5KSBB 4S10A 3IRCA 4L9DA 4PP2B 5I1GH 1HKFA 1QUNA 2MWCA 2GPZA 2WKGA 1P2CA 2YJQA 5FPIA 2LU4A 4JHUA 3S48A 2IANB 3L4ZA 4K3DH 1L9PA 3EGSB 2CQVA 3IFLL 4UOW0 2YD4A 4FQXD 4NPYA 4G5AA 2CKBA 3I6GB 5B7FA 5EULV 5I75B 3G04B 4Y2DD 5E8NB 4LSQL 3O2DA 4H8WL 2Y7QB 3MRCA 4G8EA 5DRNA 2A9CA 1I1AA 2OJ1A 3P30H 1QASA 3MUZ1 1BIIB 1M7IA 5K1VA 3ZDXB 5IOPA 4K94C 1JPEA 1WA1X 2CA4A 2GJ6B 3ZE0E 5BS0D 1M7DB 4DEPB 4NNXB 1F2QA 3OLIA 4OIFA 2H9GB 1MPAL 1JPST 3NFNA 4NI3A 1FL3A 1B0IA 5DHVH 1PD0A 2O5ZL 3LKPB 3B43A 3V5HA 1CS6A 2ZUYA 5JPMB 3TXAA 1JF5A 1G9MH 5KVGE 2D2CC 4JFFD 1NFIB 2Q76B 3MRMB 4IKIA 2X1XR 3U1QA 1ED3A 2EDBA 2FX8H 4XVUC 4ZO9A 3JTSA 1IKFH 5I30L 4JRFA 4U0RB 4HLZH 3VFPA 2W88A 3BZ5A 5CGYC 4ZUUB 4JN1L 5C08E 3VVWA 2V7HA 4ZUTA 1A66A 4UQ3A 4ELME 4EI5B 3CVIH 3IDXL 3MV8A 5DD6A 2ZZUT 2OJZL 1EZVX 3T6QC 3K4ZA 4JCMA 4Y9BA 4NKIL 1PFCA 1DQJB 3TONA 3BZ4A 1CN4A 2VDPB 3SDCD 1CL7L 5J13B 2WPGA 3ESUF 3REWB 4YIQA 5AW7B 3UPRA 3K6SA 3G6JE 5ECJE 1UA3A 1F58L 1G9EA 4RNRA 1E3ZA 2OCJA 4MQTB 4NJ9H 3CPLB 2X1OA 1VEPA 1J8RA 4LL9A 3REVA 1WO2A 1F02I 1IFHL 4GW4B 3PABB 1FNAA 2VE6B 3QJXA 4L2LA 5CZVH 4N2NA 4Z0BH 4R97B 1MWAA 1L9OA 3KVDD 4NBZB 2BSTB 1K4DA 5C0NC 3UYOD 4NOBA 5AOKA 4F57L 3IAPA 3CHOA 3HFMH 3NCCB 5BMFL 3BPCB 4PTTA 4LLAA 2P48B 2BXZA 3GJFA 3BHBA 3O0LA 4HUKB 4WI3A 4F1SA 2KERA 5D2NA 5AW5B 5GGSB 2GTZB 4R90H 3LB6D 2BY3A 4LEEA 1QW9A 2DQEH 4ODSL 4XCEA 3ECWA 4HKBA 3IFPA 4UQBA 2G3NA 1KCBA 3B2PA 2EC9T 1YJDC 2QLVB 2J4WH 2B1HL 3RHWF 4NHUA 4N0UE 1TF4A 2R1XA 3D4YA 3BAYA 4PJHB 4RSYA 1QNZH 1ASPA 5FOBA 1XEUA 5GJTH 1H3PH 1WBZA 2Z91B 5DR5L 1PLGL 1F3JB 4WK0B 1T20B 2VDPL 1KNOA 3KPRA 2R9HD 3DI2B 3IGKA 1VACB 4MAYC 4HX1B 1T03H 2GTWB 2P47B 4GRLA 1JWUA 1BAWA 2QVKA 1MXGA 2XZCL 1JPTL 2JIXD 1OSPH 4HKZA 4MXVF 4XC1L 1TQCB 2P42B 3FNKA 4CKQA 1CICC 1EJ8A 1LQSR 1MCRA 1UWEL 5ERWB 3UBHA 1IO4C 5D1XA 4P3DB 2A74C 3UTQB 4XN8A 1AKJD 4M3KB 1LWHA 2EDFA 1MFNA 1XZWA 2APXA 4NEHB 4CC0A 1P7QD 5J1AB 2VDMH 3BH9A 3MXVL 3ARFD 1YN6B 5DDHA 1PDKB 4HETA 5LXGL 3IMTA 5HJDA 1U8HA 3EJCA 1IBYA 1TZ8A 1U0QA 1TQSA 4LCYA 1WFNA 2XZQH 3EJZD 1RD6A 2VABB 5DYOA 5TGBB 1FN4A 2AQ3A 3C12A 4I2XB 1I3GH 3AWGA 4OF0A 4PJAA 4YBHA 1BZ8A 3ELAT 4NERA 4O02H 4TSCH 1FVDA 4OW6A 2XWDA 1AO7B 5E5MA 4PJ7F 5F3HA 3VSQA 5F7NC 5T1LB 3GMLA 4U3CA 1KLUB 3G5ZA 4G6KH 4PYGA 1QO3B 2P8LB 3H0TB 3U2IA 1KOAA 5CIPB 3ZSSA 4OCWL 1DEDA 3IGAB 3JWNG 4XCFH 2XCMC 1OGTA 5ENWA 5T3XD 3WS3A 2A6DA 1G43A 4XPBL 1BQHA 1PLAA 2W91A 3C8DA 5HYFA 4YHML 1BVLB 1JZHA 4MQXD 3A22A 4KUCD 2F9BT 2UY7B 1XF2A 1JPSL 4UNTA 1USQA 4E9RA 5JIMA 5IMKA 5HYJE 1EHKB 1NCUA 5KYXA 1QPXA 3OC8A 2HUHA 5C0RL 2WZAA 1IMHC 5E4EC 2XTJC 4CGUB 4YX2H 3BFQG 1E2WA 2K4WA 4HPOL 4ZTPL 5TJWK 1ZCRA 3DO7B 4OKVB 3VDCA 5JMOC 2XWCA 4Y5VA 5H35A 1Z9MA 3VFRA 4AEEA 4XXDA 3ARSA 4I4WB 1PZAA 1VERA 1BEXA 1MFBL 3CFNA 2O61A 4NUGH 3QUGA 1DLFH 4Z3GA 3WEMA 4GAJH 4M7ZB 3ZZQA 1J8KA 4X4KA 1M6UA 1Q9WB 5E24E 1QI4A 4G80A 4EZKA 4XOAA 4O4YH 1MLBB 4AYEC 3VXSB 1DJSA 3HZKB 4FXLA 3GYRA 3FN0L 1TJHH 4ISVA 4N8CH 5LBSH 2X6VA 3HMWH 4C47A 3LH8A 4YDKH 4AVJA 2Z92A 4HA1A 4XBMA 4N5EC 4KVNL 1QFWI 2V7NB 1XGUA 4EZLA 1HIMH 1UHVA 1TZHA 1K5NB 3KDMA 5E4OA 4YDVA 3S2CA 3IETA 2BVQA 1FHNA 3IU3B 2YQGA 1HHJB 1S7UA 5JUEH 4KOCA 3EFDH 1F2XK 1SJHB 5AUMA 5BRQA 2RMNA 5TPWH 5IHZA 5TDNB 2H9GA 3ZDXE 4PJEE 4LDLB 1DN0A 4J3OD 4PPTA 4HJGB 2DM2A 3P73A 3DRQA 2D7OA 4XN9A 3B7UX 3Q0HA 5DRXA 3N42F 2F5BH 4KTDL 3EBHA 3RI5K 5I76B 4GP8B 3ZTJG 4DEUA 2F54B 1PGRB 1MHHB 1CFVL 4MXQC 1HKLL 4OCYH 4KAQH 5FM5O 5IMLB 3UYRH 1YMME 3NZHL 1DQDH 1FZMA 2D7TL 4ODVL 3BGMA 3VCLB 2V8MA 4JDZB 3RBSA 2HYMA 3D33A 3IKCB 3PDGA 4FQJL 3EF7A 4N2KA 3SPCA 1AOZA 2ZX9A 4XZ4A 5CWSB 4R7VA 4MQSB 2EVFA 1M2VB 3ZIYA 2IPTH 2GFBA 5C6PB 4MS8C 4NN6B 4XNBA 4YHKL 2A77H 4JANA 5E2WH 4LFHG 3UAJD 2HFEA 3UPCA 4J6RH 4U1GC 3V0FA 1Z9SA 4BZ2L 3K2UH 1GA2A 5K59F 3CBRA 3WLBB 3QHZH 3MNZB 3VJ6A 1VCAA 3PHOB 5DR5H 3REVB 1RULH 3FYIB 3RA7L 3EO0B 9PCYA 1E6OL 3P2BA 5HHNA 1AYRA 3L7FB 5FS5A 3QNXA 2R4SL 3QUYB 1NCGA 3T3PE 1HN1A 1JD9A 3CC1A 4OCWH 2H1LM 4JDEB 2ZXQA 1KACB 1RUKL 4U2ZA 3VGAC 4LP5A 5F7FA 4QIRA 3R0MA 4BDVB 4M8UA 4K0OA 5FWRA 2J57A 3AB0C 5ICYA 3T8XB 2DQUH 2B1AH 5LWYL 1Q0YH 1S9YA 1SMDA 2VXSL 2H32A 1WS7A 4NQCD 4CSSA 4EQ3A 3CFKA 2AQTA 3C6LC 5E4IA 2DQMA 4PV9A 1R3HB 2NNAB 1JXFA 4BSJA 2BJML 3VGBA 4DQOH 1RZJL 4YZWA 3BDBA 3E6FA 4W6YB 1CDYA 4KGLA 2R1XB 4PJHA 1AC6A 3X1EA 3ES6A 5AZEH 3SCMC 5BOPA 2FJHB 4HIEA 4Q4IA 5KSBE 4TLKA 1BM3H 1U8QA 5D96B 1GZPA 3QRBA 3HZMB 1BGXL 2GITA 1F4XL 4B5ZA 4PP1C 2ZUQC 3K2KA 1EAQA 3BMVA 3L3KB 4J8RA 5BS0E 5TE6L 3P9WB 4R97C 1AZNA 1QEXA 3GT6A 1T66D 2BOCB 2BC4A 3QIUB 3HC0B 4I0PC 1YY8A 5DFTA 15C8H 3RNKA 2ESVA 4V1DA 4ZFGH 3AW5A 1P4BH 1RZJC 3U4BH 1HEZB 3QZLA 4CDGC 1FRGL 2NZIA 4XRCB 3S9DB 2FJFA 1SMAA 4HUVA 2YEQA 2XIBA 3GRGA 1MCQA 1KBWA 5ETUA 3ATDA 4HSCX 3ML9A 1U3HB 3DX9B 4OKDA 3V9CA 3K6IA 3K72A 4EVNA 5I0ZA 2X1PA 5J1AA 4U6HB 4YHLL 4BFFA 1N67A 3BAEL 5D1QA 1B4RA 4MXVE 4NQCA 2H45A 3CZUB 3A6CL 2A83B 1A6WH 2Z93B 1GVIA 1EERB 4TYUA 3WLWD 5DJXA 4KUZL 2NY2C 5AD0A 2E9JA 3N9GH 2MCAA 4YX2L 3NQKA 4JZNA 3GSUB 5KVMC 4HPYL 1Z3GH 3FB6B 2X4SB 4H8VA 3FRPB 4UNVA 1RMFL 4N2CA 5I1HL 3AZUA 3DYMA 4P06A 3QQDB 3KPRE 5D1XE 3EBIA 3A24A 3VGGA 3EO1B 4DWHA 2J1XA 2IAND 5FYJD 1OHQA 1ZHLA 3G7TA 3FCTA 2A6DB 5KSUA 3O6KH 4AENA 2X4UA 2W38A 4XP9H 5F89B 3FUJA 3CH1B 4PG2A 5D7LB 3ARBC 4YHNA 4LCWE 3VAEA 1D6EA 3U0PB 1MFCL 1HYSC 3RB7A 4BZ2H 4S0SD 4IOSD 3S36H 1WEJH 4IRSB 1KDJA 4WW1B 5E6IB 5L8LB 3MRBA 5IJVA 3ZHFA 2YKLL 4K5NA 1AI1H 3B56A 1OAYL 5E4EB 3HE6C 5ELIA 3P3UA 2CHZA 3SODB 4PG2C 3LKPA 1AIFA 2IDFA 2OW7A 1CJYA 1RIVL 2DWDB 5LGJB 5B4MC 2H6PA 2AJYH 2PPEA 1DE4A 3AABA 2AEPH 3OKLA 4A55A 2OK0H 2IWKA 5KG9A 2VDLB 4UANA 3MUUA 4HXBL 3MJGX 1NGYA 1SY6H 5JW5A 3K81A 2N4IA 1B2WL 4KTYA 4E41A 1UH2A 3PDDA 1TZOA 3OAYK 3BIAX 3QRFM 5FF6A 1GXEA 4QY8B 3QQ3B 1P7KA 4M1DH 1TZGL 1UJ3C 3VXSA 4OZGE 3D3VA 1U21A 5CAYB 4C55A 1CLOH 1HCVA 5DFWH 5DYFA 1KGUA 5D7LD 3NUKA 4HV8B 3KLHD 3GPSA 2IANA 1SUJA 2HKFL 3PIQB 4LSVL 3LEVH 5GISH 5J6GA 3RG1C 3EFFB 1YEIH 4K5PA 2YC1B 3FK3A 4M8QB 1RXLA 3BSGA 2UZXA 1MHPH 5SWQB 5IT2H 1T1ZA 4Y88A 1MNUH 2N0MA 5EBMA 5F9WB 2HCZX 4WO4A 3GEWB 4FAAB 1EEZB 3UP6A 4HBCL 5KS9A 4LARL 3S96A 4FULA 1HWGB 4XWOD 5IV2A 5JNYB 1X7TA 3BXNA 1LVEA 5FHBH 4O2FB 1CVRA 4R7NB 1FV1B 1DVFD 3SDAB 2CRMA 3WDIA 2ITCA 4L9LA 1J5IA 3V5HB 4FQPA 4N2LA 3EUUA 4OD2B 1BJMA 2NZ9D 2YAMA 5JXAH 5FA3B 2OTPA 2UYLB 5DQJB 3RWFB 4AEIH 3TA3B 4ELDA 3QI9C 4DO6A 5IVXB 2IAMC 5AVTB 3FCGA 3VRIB 1TYEB 5I75C 3EJJX 3ULUE 4UU9B 4NKOA 1X9RA 4D94A 1AFVH 5D72H 2F5AH 4KNTA 6CGTA 5IB3A 1O9VA 5IHHA 5T1KB 4HCRA 1U42A 1KYOK 4JE4B 3CHQA 1E27B 2AJSH 1WITA 4PW4A 1E9PA 4NZRL 1JN6A 4TRPH 3TTSA 3F7LA 3FC8A 3U4AA 3ZO0A 5KVDH 3LNHA 2HLEB 3O3EB 4N85A 4U7MA 4P2RD 3LKQB 4PRHD 1Z3RA 3GHBL 1HZHL 4G3YL 4XP5H 1U8KB 2CZNA 3QA3A 4IS6A 4UM9B 5E9NA 1DVFC 2G3MA 2BY0A 1UXLA 3DVGA 2DBJA 4OUUA 5E8PB 4UT6L 2I60H 2YK1H 4WUKH 3RVVC 2VDRH 2BPBA 5KAQG 5EMYA 3QHTC 5L2KB 4GQZA 3ZYJA 3NOIA 2BMKA 3ZDYE 4F15B 4FG4A 1WEJL 5T5FA 3ZTNH 4OQTA 2EO7A 3KM2A 5MP6H 4NWUL 3HA0A 1A6ZB 4E41D 3QDJA 1O6SA 4ZFQA 5ESQB 3MA7B 3QPXH 4Z7WA 4GIOA 1BZ7B 1M53A 1UJTA 1XSOA 3NN8A 4DN3L 5B39A 2MKWA 5D2LB 3D48R 2OMVA 4KKPA 1J87A 4WKXA 4AWJC 5H37H 5HI5D 3TFKC 5LNGA 2OMWA 2X2UA 1UACL 2Q86B 3BAIA 4Z3FA 1H9DA 8FABB 4YWGH 1XF1A 2X28A 4ODWA 4X6EA 3T6VA 1R3IH 5F1IA 4AKPA 3ALXA 1A25A 1D5IL 1KFAL 1PZSA 1U8PA 3MV7E 3OKNB 1PNDA 5C0BB 3TO4C 3WFZA 1FFTB 1QSED 3BPNC 2Q3XA 3X3FL 3BSZL 4J8QA 3U83A 4PJXF 3O2WH 1SOQA 4IM8A 4NQTA 5J4MA 4YL4A 5CWSA 3D39D 3IFLH 3WNIA 5HSFA 2DYPB 1SJVA 2B9AA 4OVUA 5T3XL 1DTUA 5K1NA 1NMCB 1XEDA 4EE2A 1JDCA 4IDLA 4XX1G 1MAJA 1I8MA 1TQWA 1U33A 1ZLEA 2PWDA 2XC8A 3LN5A 4WIQA 2AS5M 4P3CL 4AEHH 4TUKH 5C1MB 1BJ1H 2N7SA 1SF5A 4AQ1B 1IAIH 2WTOA 4LOFA 5BS0A 2NXZD 2R69L 1TFPA 2VDOB 1B0GA 1JV2A 1F13A 3DTDA 4QHMA 1N59B 2FUTA 2XKNB 2G9HB 3FHQA 1VJSA 1CF8L 1FN4B 5FLVA 2X88A 1JGLH 1IGTB 1WDAA 1KV7A 3NK3A 4ZMOA 2HFTA 2PCFB 3CSBA 4IBYA 1FH5H 3VH8B 3FCSA 4JRLA 2WQRA 1JAEA 35C8H 4RBPK 4URKA 1VRSA 1XGTB 4AE1A 1Y07A 5CMAB 1AYOA 3OF6A 3HLKA 3FPYA 4TQIA 1EDYA 3QUMB 5CIPA 4NZRH 1A3LL 1FI8C 1AAJA 2QEJA 3B5HA 4ANKA 2XLLA 4I48A 4XVJL 4ODUA 1EMTH 2OL3A 4PMFA 1Y0LA 4JW3A 4N25A 3B9KA 1AE6L 2NY4C 3SOBH 1FNGB 4ABWA 3DIFB 3NJHA 3QAQA 1BEYL 1X5HA 1F18A 3OR6A 5JPMC 3U4EA 3DO4A 4P48A 1YNTB 4W9GC 3G5WA 2GITB 4PBVC 3TIEB 3LKNB 4XPGL 3WYRA 1NBCA 2CCWA 5I76A 3GI8L 1BQ5A 5CZXC 4PS3A 3VXMB 4CILA 2HFGL 2QSCL 1OCWL 5KSVA 3MRQB 1P7HL 3EW3B 5HVHC 4S1DD 2OAAA 2R23A 5KTEH 4PSPA 1JK9A 1S46A 1KCVL 4L8DB 4IK6A 3VUAA 4AQOA 2GBUA 4AJWA 5F3FA 4ZMZA 4IHOA 1GW6A 4CSPA 3AT8A 1INDL 4YLBA 1HC1A 5J12C 3ABGA 2BNRD 5GRJH 3RX7A 4Y7MA 1JTTA 5J6GB 3DJTA 2G3XA 3ETTA 2ITFA 3HN5A 4HW6A 4F33B 3HTLX 4M8QA 5DSCA 2BLFA 3B6SB 4G11A 4M00A 1ZV2A 2XBDA 4AIEA 4KKZA 2CM5A 4KUCF 1QFPA 4YWGL 1J48A 2CO2A 3EO0A 4N0UB 1O6TA 3KGTA 2V9UA 4XPTH 1SGKA 2CIKA 3UAFA 1H0DB 2V2XB 3PGCA 3DOSB 5F1NA 4YPGB 3FH8A 4W93A 1U93B 4MLIA 4Q6YA 3E3QC 1NCDH 4BD4A 5CUSH 2OTWA 5TF0A 5CBAA 4GKSB 3FULA 5E7FA 3SPVA 1XQ4A 5D7HA 1UWEH 3MLTB 2WWNA 3ZTNL 1N5YH 3DX4A 4FA6A 5BW7A 4Z3HA 5D1XD 1JGVL 4GRMA 1ZAGA 4OUOA 1XZ0A 2VDQH 3T0EB 4ONGL 4HC1H 3QS2A 3AG2B 3HS9A 4OV5B 4H1LH 1B9KA 3FU7A 2F1AA 5IJBC 1XCTB 5DUMH 3C60D 3OF6D 3HHMA 3PWJA 4UQAA 3J7HA 1GZPB 2GJJA 4GRWF 4YLQT 4JRXE 1UVQB 5BUPA 1HOEA 2HWZL 3RWDB 5IQ7L 1CYGA 1JRHH 1GHFH 2EDHA 4YFDB 1FZJB 1FL3B 1ADQL 2ZX6A 1J1OH 3MMEA 3KYKH 4P5TB 5INDA 1V5JA 2RJMA 1BMGA 3RWHA 3Q06A 3QG6A 2OS7A 3FFCB 4X4MA 5IMMB 1CG9B 4EOWL 5LUMA 4PWEA 4AJVA 1IM9D 1L3WA 3TGXA 2X05A 1U2CA 5I1CL 3OC5A 2AI0H 4GMSH 2UZYB 1P9MA 2DH2A 4JFYA 2Y36H 1TZAA 1U92A 3EZJB 4Z78B 4YGAB 3TBYB 4J3UA 3TJEL 3D2TA 5D7IB 4UNUA 1P84J 3GFUA 2ITDA 4DP6X 2BSDA 1KDIA 1PX4A 1UKSA 1JI2A 1WGOA 1X9QA 2F53B 3EZ8A 3MUJA 3MXWL 5H2BB 5L4FA 3KHQA 5C0RH 4RFOH 3IF1B 5D7JA 1A14L 15C8L 2G60L 3BZEB 4XVTL 3IDIB 5LCVA 1CE1L 4J12A 4MCNA 2FGWL 3IK2A 3JSSA 2KPNA 5CS7A 4HLJA 3K6OA 1OW0A 4H8HA 1HL5A 2WQUA 4DN4L 2WN3A 3D2UD 3ETBF 4MA8L 3FFCD 5I71C 4GAAA 4UIMB 3D08A 4PW3A 4CA4A 4OZIF 1F45A 3ULVD 5EWIL 2X2HA 4JFED 4JFZL 4FEMA 3AS0A 5E6YA 2Q8AL 2C9PA 3EO9H 3L5JA 2AABH 3S97C 3BHBB 1A1NB 2EDMA 2YSTA 3FQ2A 3HS0B 4X4YA 3MX0A 4RGND 3BT2H 2J88L 4IHBA 3BKJH 1PAZA 2H3NA 3BPOC 2KZKA 2MOQA 1UGKA 4YAQB 3DUUB 1E4KC 2VMDA 3DTUB 4BZ1L 1GAFL 1JGEB 3SE9H 1Q9LA 4XX5A 5I6NA 1S3KL 1XCQA 3FQYA 4DEPC 1EANA 4GW5A 2XTSA 3WLBA 2ZX5A 3L8QA 3AMLA 2BSRA 2ITEA 3OKMA 5A2FA 4K3JL 2F54E 4HCGA 4L0YA 4N2OA 1QWHA 3FN0H 4N8CL 4P5SA 3F65A 4FA8A 1MFCH 3IGFA 3HZVA 4YBQC 1NBZB 1OAJA 2ORBL 2UXTA 5J89A 2ISDA 4LSTH 1IT9H 3D2UB 1UXSB 4V33A 4WNQB 3ZU8A 2BP0A 3VDAA 3RJQB 1G7LB 1FSKB 1LDPL 2IPUG 4XNUL 4RWHA 4BKTC 5TPWL 2P7TB 4KRNA 2K1MA 3CNKA 1Y18A 3ZPDA 1M2OA 3DWTA 5HHMB 4HSQA 5K9KA 2A9AA 2WV3A 5HHME 5EDSA 4BFIA 1B88A 3BRFA 3GZPA 1UKQA 3F85A 1KG0B 1ZHKB 3LYRA 2ZQKA 3O4LD 4PR5B 3W39B 4BRVA 1RLWA 3MNVB 4KAQL 3CFMA 1FLTX 1DN0B 1VHPA 3E80A 4KPHH 3OHMB 2YAOA 4QRRD 2VN6A 4MRBA 3BLPX 1FL5A 4I0KA 1DE4B 3ARTA 2ED8A 3OKLB 3ZDYB 4JQVC 2QPUA 3VFSA 3JTTA 5DD3L 2K8QA 2MIZA 4Q6IC 2BC4B 4HDIB 2QKIB 4FQCL 4G9FA 1C16A 4AMKL 2UY6A 3O8XB 4P5MA 4ZUSB 3WUWA 1A47A 1S7RB 4BQ9A 5LO7A 4J5VA 3W11D 2OPCA 1BW8A 2Y6SD 1KTJA 1N18A 3SDDA 4F7EA 4BH7B 4KH2A 4EMZA 1HH9B 4LLWA 5HY9A 3UBGA 3RTQB 2PCYA 2KKQA 1IM3A 5LVEA 2YPLA 4UV4H 1SOKA 3WCYA 1K5WA 4ZSOB 1CE1H 5D1ZD 4XN2A 1JI1A 4KO7A 1FC2D 4R4FH 2Z7UA 2FE0A 1SOXA 5E8OA 2V2XA 3PGCB 1CLVA 4UM9D 1SLVA 2E5EA 4OIBA 4BFOA 3QR1A 3F05A 4F7TA 5IHLB 1KCUH 2UZIH 5E8PA 1QI3A 5F9OH 2BXYA 3ASWA 1Z2KA 3DETD 1P6WA 3OAZK 1PKQE 2WJ5A 1QACA 5H35B 3ENEA 1NUGA 5L9DH 4X9IA 3VXUA 5DEZA 5L2KD 5EUKB 4R83A 3C8KA 1RJYB 2IOOA 1D5MB 1NFDE 3F58L 3EFFA 5GGRY 1R5IB 3ULVF 5TE7L 4OI8A 1CIDA 3M17B 1PZ3A 3N85H 2YN3A 3E9TA 5E6UB 5MEND 4ETYA 3NABL 1OOAA 3MRIB 3ROOB 5AZEL 2AK4D 1XCTA 4WI8A 4N9OB 1TLMA 5I8EA 4XBEL 3TIEA 3NYKA 3MZTA 4AGMA 4HISA 2IEPA 2OQJA 4LOUC 2IMNA 4JY4A 1OM3L 4KQ0A 1NDMB 2JFCA 1D9KA 1JVKA 1V7ML 3C6SA 5EZLA 1Z1WA 1P69B 4KBPA 4LRNH 4NZ8A 5EOTA 5FA3A 4F9PC 7FABL 1ZSHA 1KXTA 2BO0A 3A6OA 3V0DA 1A3RH 4AITA 5D71H 2OTUA 1NFDA 2F7QA 1G4RA 4ONHA 1HSBB 3DVFA 3SYAA 1X5GA 1N3NA 1KELL 4LU5L 1PX3A 3STZA 2KC0A 5JIHA 2X40A 4QXGH 4F2EA 2APBA 4XGZB 4I8DA 4A6YL 2ZYSA 4HF5H 1OF0A 3S3BB 3N1PC 4RWYL 4XAWL 4ZS6C 4NQEE 3UG5A 5JW4Q 5AW1B 3SBWA 4FQXA 4OU3A 4B3EA 4P57B 4NSKB 1JV2B 4OIAA 5HYEA 4L8CB 3NIDF 4FQLH 2UZXB 5EB9A 1SYSA 4PRHA 3IM1A 1AR2A 2NY0C 4HZ1A 3ECVA 3P4MA 3GEFA 4OD3H 5PAZA 1CFNB 1NUFA 2ZKHH 1NC2D 1N6UA 2SEBB 3LZNA 4WFHD 4NM4L 4OAWB 3NSJA 3ULSB 3ZDZB 2WZPD 1XGZA 5D7IF 1NIDA 3TZVB 2CCLA 1BQLL 2UXFA 3ZMNA 4OCRL 4U1JA 4Q9BA 4RDQF 2ENJA 5DZPA 5B8CB 2WHVA 5J6HB 1U2YA 4KJYA 1XGYH 4HH8A 1WT5C 4DVBA 3QXUA 4KK9D 3RPIA 4UZSA 3UJIH 5ITBH 2AJ3A 4UT7L 3FSOA 4HLEA 3QXWA 4QHUA 4IRSA 5DFVC 3RDTD 4N26A 3UEZA 4HUWB 2YR3A 3OTTA 3EOTL 3LAFA 2H32H 2Y72A 3SGDH 5I66B 4Z7NB 4L1DA 3RZCD 3OX8A 1FWXA 3ULUL 2YQ2A 4PJXE 4GH7B 1I8UA 2DWXA 2G9HA 2XKNA 1QA9A 3MBXL 1IE5A 2A9MH 3DJRA 3IBOA 3IJHB 1IEBB 3V6ZB 1IGTA 1PVHA 4K2UL 2BVPA 4LSVH 1PNCA 2BP0B 5E2VL 1IGML 2AJXH 2R0LL 1VIWA 3G6AA 3CDCA 3TBTA 1I8MB 3N43F 1LP9F 1T1XA 2DQIH 5AZ2L 4EVNB 5EEWA 1AS8A 1UCBH 2R2HB 1N8OE 1QEWA 4HFWA 3H1ZA 3ZKMD 1T7YA 2A83A 2DRUA 1HH6A 5CBEA 2J72A 2N1KA 4HKXA 4IDJL 4NUGL 3CZFA 4JG0H 3BPLB 2AP2A 5IEHB 2EH8L 3GSNL 1ZT4A 4PJ9B 1IBHA 2LU7A 3LKNA 5ISZE 5FO8B 3ERXA 5E9DE 1ZLWH 4XH2A 3QAZC 1KJVB 3MLRH 2Y3NA 1FAIL 5KANG 2OCFD 4OT1H 3QDGA 5DJ8B 3LS4H 3L1OH 4G9FB 1F97A 1ETJA 5HDBB 5AAMA 3T2NL 2A6IB 1LE5A 1I8LA 4BV1A 4ZAKC 2CCVA 6FABL 3N85L 3ET9F 3GHEL 1KB9J 4U31A 5D7LA 3MX0B 4ALAL 4BFEA 3AU0A 3QXVA 3QDME 2EE0A 1VGEH 1NAMH 3P02A 4W9ZA 3AREB 5AVZB 1JIBA 3LEXA 3QDMB 2JJWA 1S9KC 4PY8J 3LDBC 3WKQA 5K39A 3UYPA 5C9KA 1R19A 3UJJL 3FT3A 3CZKA 2R2EB 1BJ1J 1G9MC 4K7FB 4ONOA 3DDGA 4KITB 5AB2A 4HOZA 5C3TA 4LBEA 3E9UA 1OM3H 2A6JA 2CR0A 5EU5A 4MQ7A 4ZW6A 4XNZC 4XCNA 3ABKB 3MV7B 2B15A 2VQTA 1JJUA 5HGGS 4AW4A 3QUMH 5ADOL 1CLZH 1F8TH 3DVGB 3MV01 4F91B 1UURA 1FP5A 1UXSA 3EJSA 5EBLA 4XNQB 4ZO6A 4WHTA 3B2UC 4UZGA 2X89D 4PGCB 4KHTH 4G70B 4LF3B 1CBJA 3UCQA 4CL7A 4WHDA 2IWEA 1V3JA 2Z34A 1JS4A 1A9VA 4PJ8C 3FQUB 2P43B 1YQVL 4PS7A 1JRHI 1GYUA 4FC3E 5E2UH 4LKCA 4IIQB 1EZLA 1JZFA 2PCPA 2HRPH 2Z0UA 1A4KB 4KHXL 3QORC 1LWRA 3ZYIA 5C3IA 3LRSB 2J7LA 4Y1SA 1KWGA 3DUSA 4XPFL 3AWEA 4Z3IA 4H26B 4GSRA 2FYYB 3ZE2F 1IC5L 4NZFA 4Y4HC 3H7LA 4YFLI 4O9HH 3FB5A 2IBGA 5I74B 4GRMB 3CSPA 3W0WE 4CC4A 4WF7A 4XMKH 3CDGA 2NY5H 2VJ0A 1DEEB 2XQYK 2B4CL 5FCUL 4PJHF 3V6FA 4OV5A 3QPKA 1J0ZA 2Z4QB 2VQ4A 1B4JL 4LBAA 5L88L 3MJ7A 2HH0H 2HMID 2QV2A 4LHUG 1NDGA 2JI2A 2G60H 4G42A 2OMUB 5HHXH 3PDOB 5ALCH 3KM1A 2UZYA 2NY3B 1QWNA 3EJUA 3SO3B 5HHOE 5EO1B 2G75B 4KXZH 4QNPF 4AVIA 3THMH 3VMNA 4GLRH 3OKMB 5DHVA 4JRYD 2F19L 1U95B 1H6EA 2VE6A 1KBGL 4QGYA 3AUWB 4A2FA 1RVFL 2EZ0C 2YUWA 4N8VB 1XIWD 2B59B 4KO5A 4LIQE 5EUOA 3ZGHA 1AY1L 2X6BA 5FO2A 3GHEH 1QPKA 1M3IA 4JPSA 4BH8B 2JE8A 4BZ1A 5IUCA 4Y16A 3E2HB 3X14A 4MD5B 2QFPA 3GXFA 3FH7A 4MNQB 5GRJL 2WQXA 4DKFH 5L8KB 4FLOA 5IG7A 3QWQB 1R5WB 3PXHA 5I6XB 5EU7C 1RZKC 4F7PB 2A0LC 4FXTA 4RWYH 5HJ3A 2D4FA 5E95B 3K5RA 4NQEA 2XX0A 4HJ0D 5B39B 1AO7D 1QOKA 4M61A 1BBDH 1CDIA 3ABLB 2Y24A 4E0RB 3KD4A 3W2DL 1QX1A 2AK4E 3IE4A 2VKXA 4DHLA 4DTGH 1EFXD 4BYHA 2EVIA 2R0WH 4HIQA 3VD1A 2QQLL 2WVSA 2VC2B 4BUHA 3OKDA 3EGXA 3STLA 2ZCLH 5E99L 4F2MA 4OT1L 2UWEA 2FO4A 3FQXA 1NEZA 1WSST 3QO0A 4P2AA 1MFMA 3NJXA 4L8SC 3F5WA 4TULH 3D5OF 4ODHL 3PHSA 1UB5A 5JIKA 3VFPB 1XAUA 1BXXA 4FQJH 2R15A 4CN1A 2OLDA 4LNRB 5AW9B 1JOIA 4NO0B 1P6AB 1MFEL 1R5VB 4WNQA 1JE6A 2YPLB 4AGQA 3ZDYF 4X6CE 3X13B 1B0WA 4X80H 4XPTL 2VO8A 3WN5C 4FABH 2WO3B 3UO1H 3HR5B 3UJJH 3NESA 5D7JC 3TNNA 3L4YA 3TIDB 2FRGP 4NC0B 4NQDD 4R5XA 4XO3A 2QBWA 3RGVD 3SE3C 4Y2DA 2BIHA 3TA4D 3O2DH 3MUGA 4H0HB 2X7LB 2HVBA 4WY7L 2H6OA 3HG1A 3RWIA 4PJEB 4GW4A 2J1WA 3VFOA 2JKTM 4HIPA 3WN5A 4HWEL 4DIXA 5I8OH 4AYBA 1OB1B 1D5RA 1I1AC 3LQZB 2GYSA 4RGMC 5DJ0A 4QHNA 5E9DB 5IFAL 1P7BA 1JPGA 4ONGH 1QABA 3LKSA 3F6IA 1DVXA 3GI9H 3QUZA 4BEIA 2G5BA 4HS6A 2EYSA 4DZBB 4KKBC 1G9NL 2NR6D 4GBXC 4K3EL 5CLTA 4WW2F 4I1RA 3ZUNC 3CXHJ 4TL4A 4PRIE 1PIGA 3B9KB 4ONFH 4Y1AA 4N8UA 5E08H 1RZJH 3WJJA 3EOAA 4HZAA 2DQCL 5J56B 1VFMA 1VZIA 4X7DC 4KTGA 5CEXA 1C7SA 3DIVA 2FQDA 1A8JH 1HHHB 2FL5B 2RFXA 4QOKD 5JXAL 3V4VA 5GS1A 3FO0H 5ESAB 4TQPA 4A2LA 3V8OA 1P6FA 3L4XA 3T3PB 1ZHBB 4S0TD 3WFBH 4P5TC 5EBLB 3FKUS 4YGVB 1CQYA 2MQ3A 1YNKL 5FUZL 1DQKA 4Q74A 4BE5A 4OLVL 1FGVH 4O51A 4OI9A 2ALWA 2WNWA 3MLSH 4JRYA 1O7VA 1U8IA 3AAZB 1UOKA 4NZDA 3HB3D 4XZUA 2R4RH 5GRYA 5KW9H 2V2WA 4G7SB 5IEKA 1HILB 2CPUA 1FHGA 4P07A 3KR3L 4TNFA 3TBWB 2AV7A 1F4YH 1B2YA 5T5NG 4POZD 2JQMA 2CO7A 3QDHA 1H15A 1EAPB 4U1MB 2E9BA 4FHKA 1T5XA 4K23H 2C5DC 1AP2B 3FW6A 3KPQA 1ZEAH 2HAZA 4OTXH 3KCPA 4ZMWA 5T8IA 3MA9L 5FFGA 1M6OA 2J55A 5TF1H 3MRNB 1YEDB 3QDGB 3EYUL 3RVWD 3MLUL 3UX9B 3C8KB 4OB5L 5DJCB 3C6SB 2A6IA 2ZUVA 3BSZA 4Y19D 1BLNB 4P2OB 4ZMYA 1JYWA 4A7TA 1XHHA 5F2FA 1YPZF 2VXQL 2P45B 1EUTA 1J5OH 1YYCA 1EAJA 3ARVA 4XBGB 3K2MC 3SE8H 5KN5A 4R2GD 2GJ6A 4KJPD 3C09B 4UQ9A 4E36A 1YYLL 1LO2H 1A5FL 1XL4A 3GSXB 3SKOA 4CVXB 4L3ED 4HKJA 1FSKC 1TNNA 1QRND 2L8AA 4UTCA 4D3CH 3DVIA 4JM2C 2XJLA 3APNA 5T3ZD 12E8L 3B2MA 1ECZA 5TDOB 4KI5E 4QHLB 3MDJA 2B4CC 5FB8B 3UEQA 5I1IH 3A6BL 3QSKB 2J1YA 1SEQH 5E51A 4ADGA 5F7EL 4K3DL 4PCYA 3D30A 1TU2B 2NY6B 2WP3T 5D1XB 2FD6L 2OZ4A 2DL9A 5JTWA 2WW8A 2IQ9L 3RWHB 4KRPD 3HMXA 3BKMH 4K8RD 2K3HA 3QBTB 3EGDB 1H6TA 2JF1A 3KYMB 1EGJH 3PJSA 1QSFA 3MACL 2OMYB 3PHQA 4P57A 5I24A 4PCKA 4CGTA 3L1EA 1BXUA 3LVTA 1ORSB 3RB5A 3JV6A 5K9JL 3GHBH 1QW8A 4G3YH 4XP5L 3WS6C 3S8GB 2ZCKH 4B9JA 4M61B 4XOBA 4NZTH 2O5ZH 1TT6A 4QLWA 5T1MA 4ZBJA 1DDTA 3O3AB 1WG3A 1MJ8H 1SLXA 4HHAA 1DVSA 4KVPA 3LD8C 5I8OL 5DC4B 1PIFA 4E9YA 2VZVA 2HN7B 4JVPA 5EIIB 2X53A 3VXME 4YK4C 1JSYA 2PP9A 4G9FD 1AH1A 2GIYA 1ORQB 4MJHA 2GSGA 2OX5B 1SZNA 2L7JA 3HI1B 3I74A 1G7HB 3GI9L 4WWKD 3RPKA 1WQVT 5JIPA 1TTCA 5C71A 4UIMA 3QXDB 1N68A 2YRBA 4IKJA 4ZO8A 3FO2A 3L7EA 1BVZA 3TP4A 3GJEB 4PY7B 1CD1B 3N55A 2OMUA 1AQMA 3QXTA 5KUKA 3RIAF 4MB5A 1P1VA 4R4FL 2WLLB 2PTTB 4X5WB 1SUHA 1FNSH 4D9QD 1UEYA 4RGOL 1VENA 4KKLD 4XBPA 3F7YB 2COVD 1E8YA 1QUPA 1ZVSA 4P49A 4U1NA 5F9OL 5E03A 3L5HA 3RJDA 3ZSTA 3TO2B 3IBEA 1AXIB 2Y3AA 3JWOC 4ZYKA 3BZ4B 3WN5B 4GRLB 3SDXE 4PJGE 4L8CA 1QBMH 3O0RH 4RZKA 2JH2A 4FKKA 2IADA 2VN4A 4JO4L 2A1WH 4LDCA 5AYUL 5LBVA 3QIWB 5A2BA 2YK1L 1QVOA 2K6WA 4M7ZC 2C7UB 4WUKL 3T2OA 1KV3A 4W9IC 2IV8A 1N4XL 1WT5A 1YN7A 1O7DE 4IU2B 5LAPA 1WP6A 3NIFF 1NEUA 3HR6A 3WXVL 1QYGL 3LXAA 2DLFL 3MLXH 4PJXB 4TULL 1CGXA 2DQEL 2HFFA 1M71A 2XBZA 4ZZFA 4NWUH 1Z6JT 3E0GA 3L9RB 5I0XA 1RUPH 2BVTA 4JPQA 4EI6B 3LS5H 3QH3A 1U8OB 1JK8B 5IHBA 5J6HA 4YFEA 1J11A 1YC8A 2BIMA 3KPSE 5HXMA 4GI6A 2FO1A 2PCPB 5B1CA 3CZFB 4X5XA 2OYPA 2LLNA 5AOMA 1U8QB 1AZRA 4UMGA 3DDFA 4KC3B 5FGBA 2WZPA 2ZG1A 1QSFE 2WBWB 2VLRB 3Q2WA 4I2XE 1KFGA 4WI4A 2HT2D 3I50H 4MMZB 4AQZA 1LD9B 2CJTA 1HNYA 2HT3C 2KS0A 1X5KA 2W9EH 4E9TA 1HINH 5CU5A 5F7DA 3HOGA 3DX7A 4LVNB 1MOEA 1GZHC 3EDFA 4I0PB 4X4ME 2QADC 4RETB 1KCWA 2A9BA 3NGBB 5IGXH 3STBA 2UZPA 3WS3B 4Z18A 3GQFA 4AYFA 4HCRL 5AW0B 1DHKA 3AG4B 3G9AB 1DBAL 4X42A 1FIGL 1OARL 4HFUH 4OCXL 3X12A 3J8F7 3GMRB 1FYTB 4JFDD 5E23A 5CGBA 4Y1AE 2X3CA 4DESA 4KVCH 1U8JA 2XQBH 4IRSD 4UYPA 4DH2A 1NCWL 5IBLC 1TMQA 2GCYB 2GQHA 1UEMA 3CN4A 4XGZA 4TUOA 2CHXA 4Y8DC 1CGSH 1BD2E 2IV9A 4PRPD 3GDBA 2P9RA 1R33A 3L1GA 2CGRH 4OJAA 3QUYA 1DL7L 4IU3A 3DIDA 3QFJE 5JHDD 1YPZA 3WY2A 1G6RA 4Z7NE 2O61B 4XC3L 4HIXL 4N0YH 3X2QB 3WEXA 3GF8A 2L04A 3C5ZB 3HHSB 4L3CB 4PTUA 3OZKA 5B1JA 2KPWA 3KPMA 3AQDA 1TQCC 4HXAH 4OZHB 1FLRH 4QXTA 1NH6A 4PV8A 1J10A 2YPKB 5GGQL 5GJSL 4JRWA 5T1LA 3FUEA 5GSVA 3W9EB 5FECA 1OQXA 3D3VD 4X8XA 5ADPH 4BUGA 4XNDA 3MTXA 5B1BB 5CD5C 3BKCH 1GJIA 4XBGA 1E7UA 2E7MA 2FWLB 4C54A 1DQIA 2X89A 4Q8BA 4MCZB 1E2VA 2HZHA 2IO5A 1RSYA 3V4VH 4HAGA 3VCLA 4P9ML 1DBKL 3EOAB 3G04A 4LLMA 3FRUA 4IOFC 4JKKA 1F00I 4J3XA 4QLRA 2R56L 3ROOA 3BVWA 4NZTL 2V5SA 4RFEB 4HIEB 1NIBA 3DRQB 1EXGA 4Y9EA 1OGAB 2JMRA 3V5KA 5JQIB 1IGYB 4M6NL 1OWRM 1OTUC 1BPLB 4AJYV 1BAFL 2F54A 2ODIA 5IF0A 5FM5M 2CUIA 3IDJB 3QJOA 3GNMH 5BZWA 4XB8A 1XVSA 2OP4H 2K6ZA 3HI6H 3IJ9A 3IS1X 5EU5B 2B7DT 2YD3A 3MLRL 5KSAC 1MHCB 2OZNA 4JZJC 1OOWA 4U7SA 3FB8A 3UZEA 2CHDA 3L45A 4EPSA 1U8NA 4XZUB 4FZEL 4U6HA 4C59B 1VADA 4ALAH 1W15A 4WHTB 1I7ZA 4UT9H 5DO2D 1KXQA 3HZKA 2HFEB 1BVKB 3T4AA 3QFDA 1CDCA 2DLGA 1TVBB 4NCC2 4HOWA 4JKNA 3QO1A 4MZ3A 3WTTA 1UENA 5B38A 4JPVL 1FFPA 1RZFL 4LHUD 3NPSB 2IH1A 3SD2A 3NA9H 1F56A 3SYQA 1AHMA 4IIQA 5EUOE 1R3JA 2HLFD 1MIMH 4ODWB 4X6EB 2YFOA 5LGYA 4MB4A 4JM2A 5CJBA 1GYCA 1H3WM 2H0JA 4L9LB 4AZ8A 3QARA 4JFXA 4P2RA 2E76C 4PRPA 5IVXA 5LAXA 2Z7WA 3SBRA 4NJAL 1TTUA 1K4DB 4WCYL 2Y2WA 4YHNB 3RUGB 4OFYA 2FR4B 5JHLH 5IMLA 3QJZA 1R3HA 1OP5H 2X4PA 1T2QL 3GK8L 5HJ3B 1T5WB 4PRID 3D7PA 3T3MF 2Y0SA 3ABZA 5JPNA 2HJFB 1UD5A 4TSAH 2B5IC 5AZUA 1A4BA 4I3SL 1JXDA 1QLRA 4P4KA 1HU8A 4GS7C 1D7BA 2YXMA 2EYRB 3P77B 3RKDD 4HIXH 1SVCP 4QYOB 3NTCL 3MOBL 5BUAA 1JGDA 4C4KT 4H0LC 1ZS8B 3AMKA 2G4EA 2R7EB 5DD3H 2IG2H 5CEZL 4IKLA 3D8MA 3DHPA 3RTQC 1VPOL 2AGJH 2APFA 4P5RA 1PKQA 4KKCD 4GOSA 1UUSA 2HSIA 3V4PA 4EXPX 2P4AB 4M93C 5IK3B 5MEQB 3QO0B 5F0PB 2E27L 3QNXB 5SWZD 1TDQA 4IU2A 3N5AA 4JQIL 4N3TA 5F7KC 3MN8A 3D4GA 4EOWH 4QPEA 1OAZH 3DVNB 4KVCL 3VXOA 5ERWA 4YXHL 3GLEA 4KRMB 3GSVB 4YXKL 3NFSH 5DJ6B 5IHUL 1FGNL 3S3PA 1KF9B 4D8OA 2WUBH 3I75B 3CIAA 5CN2A 1MHEB 2L3BA 4EF3A 1KPUB 4LCVA 1JZGA 5KJ4A 3SJVB 1PQZB 1I8KB 1A6UH 3NIFE 4EIZC 5JMRA 1JDAA 3QRGL 2FYVA 4NUMA 4HEPA 1IKFL 3H7BA 1PTZA 1HXMB 4MAUL 1OM9A 1UKTA 5CN3A 3QCUH 2D3LA 2ENSA 2PO6C 1QMUA 3EO1A 4GSXA 3WMSA 2A1WL 1F90H 1JYXA 1ZHLB 1FRGH 2GSGB 2OX5A 3EFDL 4RDBA 3VFUB 2R2BA 5F93C 4H26A 4L1SA 2OULB 1KJVA 3CE1A 2VLKB 3WEOA 5HGDB 1FC1A 2HA1A 1KLUA 2FH8A 1U4FA 2RIKA 3G5ZB 3VE0B 4G8GD 2QVIA 5ADPL 1IC7L 2BFGA 4JO1H 2JB6A 4QDGA 4YN3A 3QG7L 2D7NA 2Y5QA 1E5ZA 4A66A 4BCYA 2XX1A 4X7SH 1J86A 1RJLB 3PWVA 3HC4H 3UJTL 5JQ6L 4LK4A 1AVAA 1CFQB 1WUZA 1W0WB 3A6CH 4DKAA 2WOYA 3CFEA 1RZIA 1IM9A 4ICWA 4UTAA 5ETUB 3H53A 3QC6X 1KXQE 4JS7A 4PBWD 2FJUB 2YHGA 1SBSL 4LAQL 5EO0B 5B7MA 5I18H 3RGVA 4F57H 4KZ0A 4N0UA 2CDFB 4WGKA 4ZXBD 2ICWJ 3MYZA 4JHBA 1I7RB 1C5CH 4DPAX 3IJYA 3MRGA 3ZKQD 3FMGL 1ASOA 1EO7A 5FYKE 2P5EA 5EBMB 5FEBA 3Q6GL 4DGIH 5TE4H 3PHOA 4I89A 3UTSE 4GT7A 1D3CA 2XWEA 4EUPB 1JZ2A 4HWZA 3DX6B 4L29A 4PG9B 3S8FB 4OZHE 2DQGH 4NGHH 3MCLL 3UP1A 1QR1A 4PGEA 3DK2A 3KNBA 2E9IA 4AEHL 1ZV5A 1A02N 3HG5A 3MRJB 3LJ3A 4HCFA 1SYVB 1N6QL 3VI3F 4Z3JA 3D87B 3VU2A 1X5IA 4RVBA 5EC1A 4WI5A 1T03L 1OTTD 3ULUF 1G7MA 2KMWA 5C07A 4UF7C 1AQKL 1MN4A 1R5WA 2RQEA 5HDRA 3FSZA 3BAWA 4JFUA 4MBOA 1N64L 3DBXA 1XGRB 2B77A 2ZWZA 1UZ8A 3L2LA 3V0EA 5A2JH 3FUFA 3AFLA 4HK0A 1TQVA 4DP8X 3JV0A 4H25B 3ZTEA 5C0BA 1P5VA 4MSWB 4UM8B 2IOMA 3LHPH 2GT9B 2PPFA 2C7FA 4FFVD 2C4XA 2YD2A 3O6FC 1BLNA 4NN7C 3LRLA 1XSJA 3GS0A 4U1SA 1I7UB 3A0OA 3WKMH 3ZXAC 4YXHH 4YXKH 4ACPA 2VDNH 4KXAA 1ZHBA 2P24B 2GJ6D 1RK7A 3QVAA 1JHKL 2NMSA 4APQC 3S5LG 1JGIA 2ZKWA 3PY9A 4MA3B 4ZW7A 4N1CA 2NT0A 5D9SB 4FQ1H 1NPUA 2BNQE 1YEJH 1D5ZA 3BVDB 1UOWA 4ZFGL 3TO2A 5JDJA 3S98A 1W2KT 4L1TA 3EYSH 3UACA 1WWBX 5F7LB 4QJ5B 2V5YA 3F7QA 5I17B 4ZUVA 3VTMA 5C07D 2Z3FA 4RGMB 3M1CA 1UATA 3GMQA 4PVNA 1Z66A 3JBG7 5IVNA 2A6KB 4FXKC 3CZGA 3OKEA 4R96B 5C0IA 3LXUX 4B9YA 1LILA 1NBQA 3KCPB 4M6AA 2WQSA 2E7LA 2X2JA 3WFCH 4BZYA 1DJYA 4AYDC 2F5AL 5DJ0B 5E9DA 1Q94A 5D96C 1YMMD 4PS4H 1BFOB 1HWHB 3RIFF 1WV7T 4WKZA 3NIGE 5B3JF 5IHUH 1CFBA 2X5PA 3JWOH 2AMUA 1LO3L 4R8WH 4NKOB 4CC4C 3J27A 4E9XA 5T1MB 4X9GA 1ZT7B 1NANH 2V17H 4RAUA 4CN4A 3KZ8A 2DQ6A 1IZJA 1NWOA 1KGWA 2VW4A 5J6SA 5CN1A 1RZFH 1HCZA 1CWVA 2G30A 3KGUA 3ARDD 3UYRL 5BNXD 4LEXL 4WJG3 1KPRA 5INDB 4UV7L 5AVQB 1GGBH 3RUGF 5EEUA 4NKMA 3ARRA 3UTZA 2XWRA 3EGXB 5JUEL 5I1EH 5JORB 4JDTL 4KK6C 1ITCA 3P3TA 5KYUB 4I87A 3RNKB 1SHWA 5J3HC 5A1AA 1DDHA 1NEZB 3NSYA 2L7EA 5DZVA 1D9KD 5L2KA 3BE1L 5T33L 4U1GB 1MCNA 5E5RB 4XBPB 3SE3A 3FHEA 1S2EA 4U6YA 3TPUA 2VZSA 4G7QB 3ZHKA 1CFVH 1AD0A 3X1NA 3AY4C 1BVOA 5FAAA 2XPZA 4H88L 1GKOA 2CDEA 4DK3A 2QKIC 3RVXD 1U91B 4LASL 1D5IH 1X7SA 4WUUD 4CKVX 7CGTA 5JHDB 2CO7B 1B9ZA 3V0HA 1HAWA 4UWQB 4QRUA 3AU1B 4RH4A 4BFBD 2VDNL 2HX7A 1VCBC 5LAXB 2QDWA 1QTSA 4PV8B 3ZKXB 2XI9A 5JR1H 8FABA 1IGMH 4L5FE 1ZVNA 2Q7YB 1J5OL 1G7JB 2EYTA 4XX1E 5HDLA 3FAXA 3T0XA 1A7NH 1HDMB 2MOVA 4JO2H 4NP4H 2ADFL 4ZDHA 1GHFL 2UV3A 2EXWD 4JGJA 3KJ4C 1JZJA 2AFNA 4K5LA 5EU6E 5C2BL 2E9GA 5DMIH 1SRDA 4NPJA 3PYCA 3OAWA 2ARJB 4WQOA 2FT8A 3T77B 2Y2TA 2OZ4H 5IQ9A 1TTGA 3RGVB 4F5CA 3ZMEA 2CPCA 2H2PC 3HI5H 1A4JB 2CGZA 2LLGA 2FTAA 5IFJB 5M94B 2DBLL 3G6JF 5I16A 4ZTOH 4A7SA 2J8UA 5AOZA 1UWGL 4JJ5B 3F7YA 5I5IA 5HHOB 4AQ1A 1NSNL 2X4RB 5GRUH 3MV9B 5DJ2B 2CRZA 3VFGL 3DNKA 1BOGA 2GEEA 4TVUA 4WRLA 1IEHA 5JZ7D 4G1MA 2APSA 3H6AA 3UCRA 5GZND 4E41E 1IBFA 3HZVB 5IB5A 4K94H 1F90L 3MOQA 3QDAA 4E41B 2X1QA 3ZDZE 5CFAA 1I4FA 1P7KB 2KLRA 5EU6A 1FPTH 4JX0A 3WNMA 1LNUA 3WUWG 1NAKL 2PWFA 1F4XH 2OBGA 2W0PA 4K71B 5HGHA 3VFNB 1KBPA 4FI7A 1B6DA 4KNSA 4L0PB 1IGFH 1PQZA 2ZUXA 4GEIA 5DVMA 4PB0H 1WWAX 1JPTH 5C09E 1OY3B 4MDJA 3V0AC 2QQNL 4KFZC 3VB9A 3JV5A 3ZZ1A 1IU1A 1XCWA 3HG2A 3Q8AA 2J8OA 3IDNA 4JG0L 1BFVH 5E6RB 4WO0A 3F00A 5AWNH 3Q5OA 1PG7W 5AB0A 5I8CA 3S3DB 3MV9D 4LKXA 1VB9A 2N56A 2R0KH 1E5YA 4RAVA 5FHAH 3KCWA 1M6OB 1MJJA 4X4ZA 1EDHA 1KLFB 1S5HB 4JO3L 2NW3A 3WNNA 1MFDH 4U3HA 4JZJA 4MNGB 3MCKB 2DI9A 3WTWA 2M8XA 3B5TA 4S1SH 3N1FC 4XAKE 3ZW3A 3TT3L 3LD8B 3LH9A 4ZPTA 2OW6A 5F6HJ 1OQOA 4AEFA 5ITFA 4EI5A 3GMRA 4HOMA 1LO3H 4R8WL 3H3BC 5BQ7B 2KYIA 1OGAA 3FTGA 4L8SB 1XGQB 4ADIA 2BVOA 3TBVA 2WLLA 5I0VA 1T4WA 3OG4B 1E67A 3FONB 1T89C 1P0SE 3Q1SL 1JZIA 3PUUA 4XVOA 5IMOA 3SKOB 3O3EA 1E4XI 2XSKA 2W65B 3LNDA 2XZAL 4L4VD 1SXSA 2BHFA 5CILH 3QYNA 4NUJB 5L8JB 2A99A 3IRPX 1S7QA 1U8NB 4Z7UF 5T1JA 3P3YA 1T89A 1NC2A 3QUXC 2YKLH 2KQMA 3ULUC 1AI1L 3MREB 3Q6FB 1QHOA 3O45A 4WO4D 1T0MB 4H1LA 5FUCE 4G6JL 4GQPH 3OPZL 4R2GB 4WUUA 4KOBA 2R27A 1D5XA 1S6NA 3OLDA 1CD9B 1WA2X 2AEPL 4FQHA 4JFPB 1JWMA 4D0DB 1FJ1A 2WBXA 3NTCH 1ONQA 3OVUB 5TTRA 3QUYD 4FP8H 1MRCL 3I6LD 5HHQA 4NYLB 1EZUA 1JK8A 2XV3A 3DBXB 4JK0D 5DC0A 5FK9A 3H7BB 2EUXA 4GUQA 4Q9RH 5KVEL 4JN2A 1AGDA 4HS3A 32C2A 3NIGF 4YHMH 5K59E 1AD9A 1N2RB 2VDRB 1KJ2H 1D9KC 4JKWA 3KPPA 2VSDA 5CINL 4AQEA 3DECA 5J3HD 3RX8A 4F8QA 5IFAH 3T6ZA 4KK6D 1RZ8B 4L0ZA 1AJ7L 1PMYA 3NJLA 1QQDA 4P2OC 2FT7A 3F58H 3QNYB 5EZOH 4AMWA 1AQDB 1MDAA 3UFIA 4LHJB 43C9B 2NSXA 4AYMC 4UINH 5DMGD 4WWOA 2HTLD 3U7WL 5T5FH 1SDDB 4NCDA 1WIOA 1ZTMA 3V0VB 4EDWH 1AOHA 4XBEH 4UQ3B 3GSNH 1NJ9A 1KCUL 2UZIL 1WWWX 3BWUF 1IM3B 3P0YH 3HZYA 3FO2B 4B97A 4GS7B 5LDUA 1JXJA 1Q72L 2CDFA 5EOQL 4Q6KA 1RIHL 4HGWA 4FADA 4ZOEA 2D03H 5CJ8A 4OGYL 2P46B 5IREA 3G5XB 4LCIL 4AM0Q 1V7MH 3SO5A 5CIPH 2GHWB 4QMEA 1NSNH 4EI5D 5D5MF 5JHAA 4DSYA 2C1OA 2HRLA 2N1TE 1DO6A 4F2ME 2F68X 2YEZB 4R3SB 5I1LA 1NAMA 3M46A 4WU7B 4C83B 5ANHA 4R90L 2V9RA 3NAAH 4V11A 3TASA 4N2MA 5BQDA 1KCRH 3WSQL 2NNFA 2F53D 2Q8BL 4HUNB 4ZOBA 4N28A 1DQTA 2R2BB 3V0WH 1RP9A 1FNEB 3RA7H 1H3PL 1X4XA 3POHA 4FJZA 4NENA 1I8IB 5T33H 2DEYX 4RRPA 4YPJA 1DSYA 1GAFH 3UTTB 2ZWLT 3QS3A 2K7QA 4K23L 3SDDC 1AXSB 1BAFH 2ZOKA 4UDUA 3IMWA 1RSFA 1RY7B 2PP7A 3EG9A 2X38A 1JNLL 2VW6A 3CZLA 3HN8A 1A6VH 4G9DB 2NY1D 4XP6H 4G8FB 3ME0A 4XNXH 3CTTA 1YUKB 4G71B 4PRAB 2WM0A 3GBMH 4JFEB 4QTHA 1XL6A 2R0WL 1SLWA 2YFNA 2FAUA 1ZPUA 2XN9B 2ZXGA 1QA9B 2WYZA 2Z7ZA 1E0OB 4JQVA 4QRTA 1N0LB 1R3KB 3NCWA 5F3BB 4AVKA 2ZSVB 4RGNB 2F61A 1SBBA 3QQ9C 5E6ID 4FNSA 2EICA 1P5UA 3T71A 2QHRL 2CK0H 5GS1C 4UT7H 2ZXAA 4LNVA 1D7CA 1GH7A 1O75A 3ZIMA 3K8KA 3SY0B 3P4OB 2V5MA 4PD4J 1EJOH 4M48L 4PH8A 1DQJA 5F7AA 3ZKND 5I1AB 1DSFH 4H8UA 4I3SH 4QRBA 5B21A 4CW1A 1T1WB 2F8OA 3G08B 1RK1B 3QJTB 3SCMB 2B0SL 3DX8A 1AKJB 4FLSA 2LV4A 2NY5L 1W91A 5C07B 5HDQH 6PCYA 4Z7VA 3RL2A 3S2AA 4OCRH 5KSBF 1SJMA 5FCUH 4CU8A 3NSDA 3QWOB 1JZ8A 2F8VA 4QRUB 2RR3A 1FVCA 1JZ7A 1KGYE 1QFHA 4PJ9C 5I1CH 1I9IL 3PHAA 5BZZA 5T1KD 4IKKA 2P5ED 1VFAB 5FXCH 1V05A 3AVEA 2P8LA 3H0TA 4MNQD 3P69A 4ZNEA 3J2PA 1G1KA 2PXYC 4GJTB 4JFXB 4P2RB 1MW2A 4OGXH 2WVVB 5C0JB 3VDBA 1NGWB 3HG1D 1RCYA 5DHDA 4EI0A 1A9EB 2WLHA 3OPZH 4WI2A 5D7IE 2WTPA 3U7AA 2YQ3A 1BZOA 4MNGE 3NVQA 4FYQA 3WGVB 2NUPA 2JLLA 3SDAC 3PF2A 3RY6A 2EDXA 5C0AD 1ID2A 3UPAA 4ELMB 3C60A 3LMJL 3OXRA 3DMMA 4MAZA 4ORGB 5EPMB 3MBXH 5I16B 4JPIA 4ZUWB 1LEIB 4OZ4B 1XB8A 2J25A 2KDGA 2PPCA 4LT7A 1FUNA 1D7DA 2VSCA 3FUKA 4AW7A 5DHVB 4CVUA 1RUAH 4KI5C 4C4UA 3GKWH 3VFWB 2XWBB 2GJZB 1TJHL 3DXAB 2CO3A 3GTTA 4J3OG 3HMWL 4U0QB 3IVKB 4ENZA 4G8GA 1S7SB 2VRQA 5IB5B 1A3ZA 5DFAA 3IDJA 5G5DA 2Z7YA 3F64A 4P5TA 1GC1L 4PWHA 3WNKA 1JG9A 4DCQB 5GSRB 5JW4R 1FCCA 1N5AA 5F6IB 4UILH 3EYVB 2WLZA 4TVPH 4JO1L 5HHMD 5EEVA 1CR9H 1K2DB 1PG7H 2WSDA 4N2BA 3MSPA 3U0TA 4AX3A 1OSPL 4XC1H 5HPOA 3EH2A 1HZKA 4PJ6A 3EFOB 1XF4B 4Y16D 2BHZA 4PJBF 2V9TA 1RIHH 4GAYB 1HX0A 2UUDK 3BO8B 2PWGA 5C0AB 4NQEB 3R1GL 2XQYG 3VNZA 1AIZA 1KWKA 5EOCJ 1GC1C 2QQQA 1G7MB 3QEUB 4FTVB 4BK4A 3KMDA 3ZY7A 1F4WL 2B1OA 4WSJA 4RAUB 4UTBA 5I15L 2A4ZA 4W9FC 3CC5B 4KROC 2VLRE 8PAZA 5CU9A 4RMQA 1YMMA 1OT2A 3CHXA 1IC7H 1CYWA 4LLVB 2V8LA 4NN6C 2BM3A 2CU9A 3PXJA 2EE2A 2I9LB 3VX0A 2JCCE 1PCSA 1LK2A 5DZAA 4XPAL 2H2SC 3BYTA 1F4AA 3GJFB 3HVDA 3NFPA 4F93B 1E9OB 5HI4D 2CALA 4J1UA 1DQLL 1KLGA 2WXOA 4FJ6A 5HVGB 3ZHLA 4HH9A 5HYQB 1IQDB 1FYTE 1M57B 3FOMB 3S36X 5L4MA 4HGWB 1WIPA 1QAWA 4U6XB 2ICWB 4D7PA 1R75A 4YHYB 5DMKB 4TLTA 4NQED 4FLRA 3GMMA 1ZOXA 3L4CA 1NCJA 1CXIA 2H2SD 2W9DL 1J88A 2LGNA 2A6JB 5F0LB 1JVOA 1CU4L 4YAQA 1YEIL 5BOZG 1DCLA 1R3LB 2DQUL 2DIBA 3NACH 3CH8A 3FQNB 1PBYA 1WH0A 3IJHA 3QFJB 4A2GA 5I1KH 2G2RA 5AVUB 5I8KH 3KJ4B 1DQQA 2Y9RT 5HHPA 1OK0A 3MOAL 2WWOA 1ZTXL 1XBDA 2A74A 1IUZA 3B5GA 3D12B 3EHBD 4N6QA 1EHLH 5BRZB 1XIWA 3HAEA 2Q2LA 5D5ME 1D5XB 5C9JA 2NY7H 4U6YB 2F7OA 4X4XB 1NANI 3L81A 4PD4K 2Z4TA 3WN6A 3HAEH 2QL1A 4LKCB 4GUPA 5F9DC 2K9UA 2X4NB 3MV8D 4YSUA 1ZIBA 3UMNA 2GTZA 3EYQD 2DWYA 3BP4A 5DO2C 3OKOA 1FE8L 2DMCA 5SV3A 1TNMA 3WHXB 3AITA 4FFTA 3FSAA 4MCYA 2B4CH 4QRSA 2P1YA 2EC9U 1W72L 3OZ9H 4DK6A 3VWJB 3HC3H 1T4KA 5D2NC 4OCLC 4PJ7A 3CN3A 2VIRA 3P0VL 1A2YA 5MENA 3LPGA 3MV7A 1ET7A 1QFUL 3GMNB 1O7DC 4UQDA 5SWSD 1S78C 2EIZB 4CVZA 4HDIA 1RIUL 3J07A 3MBEC 1KIRA 3PIQA 3WNJA 3O9WC 3Q2NA 5IEKB 2IDSA 3PRZA 4LRNL 4NAQA 3TEUA 4ZXBA 4ZUUA 2XZCH 2HLAB 5JOFB 1F4WH 5AAWA 4LOVA 1GOGA 3MV8B 3OB0H 4Y2DB 2X4RA 2HVKA 3PQYB 3HVNA 2W9EL 2R0KL 3GC3A 3LSOB 2PXYD 4FNLH 2YGPA 4LPUA 3H6JA 2GI0A 4QOKE 5HHNB 2WXKA 8CGTA 2W94A 4ELKA 1H3XA 1NFDF 4RIRA 4WFEE 4JRXA 2J8UF 4C83A 4XPAH 3BWZA 4DP4X 1S7XA 4QRRE 4JO4H 5EZJA 3ZDZF 4JFSA 1MI5D 2WLJA 3Q9PA 3VA2C 4M5YL 3E6HB 3VG0H 1AS7A 1GW0A 5HI3C 5DQJA 3II2A 4IGBD 2QFRA 1FNHA 5F3HB 5CCGE 2GJRA 5F88B 4C56E 5EU3B 1EVUA 2E86A 2R69H 4P46C 4P2RE 5AEAA 2JKIS 2QDVA 3DGDA 1GKEA 1Q94B 3KW7A 5E5UB 1CDJA 2DQJL 2EO9A 2VLJB 2ZJSH 3O2VL 1OAXL 5DU7A 5B8CA 1IKNA 5I23A 4CADA 1TCRB 3DRTB 4B3VA 2AEQH 4Q89A 4ZZKA 2Y7QA 1YC7A 3MRCB 1HNGA 1UB6A 3OPUA 3BQVA 4J3SA 3L3JB 3SGJC 3JUYA 1LO5B 4HGMA 2HT4D 5C8JB 2BJMH 4TQEL 4DQOL 5FO9B 3U2SA 3S37H 3HNSL 4GNKB 2FX9H 1U3HD 3CSTA 3MJ9A 3A4EA 4ZFZB 5KANI 4M5SA 4N8PA 1OCCB 3MV9A 3UXFA 3FS9A 3QB7C 4MDRA 1BOGB 4U0RC 1C9SA 4APQB 2H3KA 2ADYA 4PRNB 5F8RC 5F9WC 3VGEA 4JHWH 3BCDA 2VR3A 4WY7H 2VLLA 1PZ5A 3GI8H 5KVEH 1QBLH 3INOA 4LARH 4GAYA 4U1HA 2XXCB 3U4BL 2OL3H 1U2HA 2Z93A 5E9AA 1Z9SB 4FQHB 1H3TA 3ARWA 3II3A 4E9QA 5JW4N 5C70A 2Q2EB 3UZEC 4FXKB 4Z7VB 3VXTA 3KPSB 1GMIA 3LPFA 1MNNA 3P0GB 1AE6H 3CC5A 3O4OB 1KCSH 4PRHE 1VEMA 1CFTB 1U3YA 4WU7A 1HESA 3VFGH 2FK9A 2HN7A 4Z7UE 4PJ8A 4N0YL 5JOPE 1U8PB 2FJHA 4YUEH 1LO0H 3CPUA 4IBSA 3PABA 4QTFA 4L48A 1FLRL 3QUZB 4J8RB 5INCA 2BHUA 3AGVA 1N19A 1T22A 3CVHL 4UT9L 1F6AA 2PN5A 2AJVH 4S11A 3FB7B 4L18A 1OCWH 4GRWH 3ZX1A 2DS4A 3HRZA 4AIZB 4MNQE 4N6RA 5DC2A 3VGFA 2W9LA 3OXRB 1S8DA 4NB7A 1KYUA 2E8YA 4FMVA 4RA0C 5GS0L 3E6FB 3V55A 3V0VA 2ZCHH 3MNMA 3DC0A 2Z8WC 4XXCA 3LN9A 1ZVSB 3N41F 3RY5A 1K8IB 2O5YL 2JKLA 1TVDA 2AK1H 1YNKH 3FO1A 5FUZH 2DKSA 4ODVH 2VSKB 2IWFA 3ARFB 2VXVH 3C6LB 1RL1A 2NQ3A 3VFVA 3ZT7A 1OWWA 2ADGA 1X5ZA 4YJZL 3Q2CA 1CXFA 4EJ1C 2WNXA 3P2TA 2P28B 3KPRB 3SB3A 3ZDXF 5KJRH 3L7FA 2AJYL 1CZ8L 3HKFA 5AAMC 1IEAB 5EZIL 4L4TB 4E2OA 2VT0A 3O4LB 4I77H 4TS6A 3U6XA 2XPYA 3KGSA 1EO8L 3SYPA 1MCOH 2WXFA 5EU4B 1RI8A 5IW3A 3UROR 3B9EA 4IOSA 3MLVH 4RDQG 1EO5A 1YY9C 2XPGB 3WEBA 3MLUH 4NQCE 3U46B 2YUZA 4JPVH 2FX9L 5D1QD 3U0PA 1UZGA 5TH2A 1UADC 1VPOH 4F8NA 5M7QA 4MDJB 3ULUD 3SPHA 1FFOB 1C5DB 1TQBC 2KL6A 3E2HC 4U2YA 1AGDB 4HS3B 1MFAH 3MRNA 4KK5C 4E68A 3GO1H 1JV5A 2P5WD 5BV7H 4OM0L 5CNHA 2HKAA 2ICWI 2AEWA 4QTHB 4FTDA 2DD8L 2ICEB 3X12B 3MXWH 4HJ1A 3MOAH 2LVCA 3S34L 5CCHE 4BUQA 3APDA 3NJVA 4KJWC 2ADJB 1YHPA 1DFXA 3K1KC 1UWXH 2DL2A 1RAMA 3VM7A 4D8PA 2NY3D 4YGVA 3IKKA 4FNTA 5K1JA 1P5UB 4X5WA 3D39A 4O02L 4ZPTB 5ITFB 4L2YA 3GMMB 4E9SA 1E4XL 2F58L 4G82A 4NO0A 3NIDB 4HKJB 4HV8A 2NY6C 3P9MA 3H8NA 2FL5A 1WLHA 5D1QB 3QA3B 1NM9A 3POCA 2OMZA 2GJZA 3DXAA 4KZCA 2VDQB 4KDTC 5B1KA 2NXYD 1X4ZA 1RZKH 4BSVA 4OZFA 5BUGA 5IMOB 4CNIA 4Y4FD 3FU6A 2FHBA 5KBLA 2HB0A 2HKHL 3IPBA 1XH3B 1NGZA 4PFEA 4I0CC 2FBRA 1PAMA 4OKVA 4P04A 1BM3L 4UTAL 4LEBA 4AUUA 4TKWA 1J1PL 2OR9L 5IW1A 4OZIE 4IBTA 3MU3A 4XN1A 5GZOD 3TWCH 1DR9A 2V33A 2UWEF 1A6TA 2FX8L 1NGWA 3ZE1F 4JJOA 1QSVA 2W0FA 3IGLA 3OR7B 3CH1A 3BJLA 3Q8CA 3WTUA 4F24A 2EYSB 4DZBA 3H9ZA 5IB2A 5IG7B 1D6EB 5MP6L 3VI3A 4UOQA 1P4IH 1WJ3A 5F72S 3LCYA 5FKAA 3QFGA 3T0DA 1W0YT 5DK2A 3F01A 4M03A 3QQXA 4H8WC 4ETQB 3O6LL 1H3GA 4H2AA 3ZTDC 1MG2C 4HJGA 3ARBA 3DI3B 3GSNA 4O2CB 1BAGA 2CDGA 3LTVA 5FYLL 5JZ7C 2Z31C 4MRCA 2ATPA 2Q0ZX 3Q01A 5MENB 1GOFA 1G7HA 3W37A 4OQTH 4CBZA 1NGYB 4AQ1C 1NKRA 3ILQC 1R3KA 5F3BA 3RU8L 5A7EA 2AHIA 5AVRB 3K6FA 3ZYZA 1CD1A 4ZW8A 3FQXB 4QNPE 3U79A 4FKHA 4IDJH 2P5WA 1KTKE 4F9PA 5KSAB 1QSZA 1AMYA 5EPMA 1HHKB 3WDHA 3L1FA 5I1GL 5C0CE 2D3JA 4M29A 1J5CA 1OAXH 4EN3C 4LNRA 4FI6A 2GK0B 1EHXA 2H41A 2GFBB 5KYNA 4G42B 1FAIH 4GBXD 2KH2B 4LRIA 4NZUH 3EYFA 3JWNH 4XP6L 2NSQA 2WXGA 1IGCH 2FJGA 4YSSA 4DFIA 3WEXB 3CCHA 5F97E 3Q6GH 4DGIL 4LHUA 1BZ9B 3PV7A 2B1HH 1S3RA 3HB3B 4DKEH 3O11B 4EDXA 2VNCA 4PJAF 2FLRT 3N06B 4OV6F 3UTSD 3KPQB 4O2FA 2Q3ZA 3QQDA 4H44C 1NCWH 1YEDA 2J5WA 2FR4A 3GBEA 4HZLA 3Q13A 4LDEB 3K2UL 3VGHA 1ZLVK 5GGVY 1AGEB 4MJ5A 2O6FA 1NCAH 1UYWH 5AKVA 2BS71 3S5ZA 9CGTA 5HPMB 3HPLA 1CF1A 2X6MA 5KYWB 4MASA 1J0IA 3HE7A 2QKSA 2ZAIA 5F9JB 1CXHA 1IC1A 2MCPL 1DSFL 2B2XH 5I5RA 4PJ5D 1Y1UA 1TSHA 3IJEA 4PJCE 3NACL 3QDGD 1KTBA 3FOMA 2UXGA 1XR8A 2O4EA 2WANA 4XVJH 1EIBA 4XC3H 5FO9A 5I1IL 3WJJC 2C3WA 3GSXA 3IMRA 5C9JB 4C58B 1SDYA 1XF3B 2OJZH 3HNVH 5F7DB 3FO9B 5A2AA 3OZLA 1HAUA 2NX5E 2BSRB 4ZODA 1RERA 2VIRB 3V52H 4D2NA 1HHHA 1U8MB 2RFXB 2X3BA 3LHPL 1ZLUK 3FQ1A 4TNWK 1N59A 4NP4L 5F0MB 2XRAH 4PRNA 4ZD3H 4F7MB 3DSNB 3GXIA 3UTSB 5IMMA 1JCVA 1IAMA 4A6YB 2BRRL 4PQXA 3ZJAA 3QIBD 2GIXA 3ZL2A 1KPVA 4QWWC 1JTOA 2DIAA 4L4TE 3RDTB 3S5LA 5FYKH 4FFZA 1JXKA 3CN1A 3SO3C 4PJFB 3GBLA 3SKJH 2YXWA 2R1WA 4AGNA 2HFFB 1HIML 1KIUB 3HFML 5GRUL 3KXFE 3VXRE 2IAMB 1GCFA 1IC5H 5D70L 1G7QB 3KYOA 2WNKA 3GXMA 4G43B 4DN4H 4U4IA 4XE0A 2AV7B 5IESH 2JI3A 3PGFL 1NPNA 1PY9A 2E0PA 4OQTL 1YNTA 3BQUD 1QKZL 2DZEA 3D09A 1KTRL 4U1MA 4W81A 1BYPA 4RRPM 5EIQA 4KXBA 4JFHE 4IMKC 5E8EA 2HG5A 5MHSE 2CG9X 5FECB 5CEZD 3D50A 1WC7A 4HHWA 4X6BA 2ZOUA 1IE4A 4Q0XL 1CFMA 4OD2A 4TVPL 1EUUA 1RJZA 3T0BA 3VX1A 3VRJA 3M8OH 2EECA 3D51A 1D6VH 1TXKA 1Y0LB 2WWMD 1MAMH 5GS2D 3WGUB 1QSEE 1LM8V 5D71L 5DWUL 5ID0B 3IWVA 4IOIB 5GGTH 5HGBA 1RZIB 2KBGA 4E9VA 3QXDA 5L7XH 1BBDL 4PJBA 2J12B 3DBSA 3CFIC 3HN3A 3KWUA 1E4KA 1OPOA 3KXFA 2BNRA 3BIKB 4J6RL 1TETH 3NIDE 4QTIL 5PCYA 3UC0H 5LNDA 4P4KD 3C6LA 5BO1L 2CBTA 3UG4A 4TUOB 4GW5B 1P7QA 1WBXB 2ADGB 1SEBB 4MD4B 4WWKB 5E99H 3SDXA 3L17A 4CN6A 5BS0B 4PGDA 1OALA 2FB4H 1A7PL 2DMKA 2GTQA 4NPKA 2X42A 4HG4K 2HWZH 1IL1B 5DHYA 4APXA 5IKCA 4Y4HD 4NNPH 5IW6B 4JFVA 1O9WA 4I5BB 4N0CC 4N22A 5A3ID 4ANWA 4G8GE 1I3GL 1OD9A 2WXHA 4NKDA 2BH0A 1WD9A 4FFWD 3A67L 1E8XA 5DMIL 3ZMRA 1SPDA 1H6UA 2NX5A 1W8OA 3GLDA 3BUTA 3R1GH 2BVYA 1J0HA 5BRZA 1RK0A 2W0FB 4GRLD 5C6TH 1OGPA 3CUPA 3ISYA 3UG3A 3FU3A 3I75A 1GL4B 2IGFH 4KWUA 5IB2B 3KYMA 1KBBA 3NCYS 2BVUA 2FWUA 3QIWC 5TH2B 3QIWD 4QAWA 1B3JA 2X6CA 3K7UA 4D0CA 5HYSB 1UT9A 4HOXA 3HAEG 4RMSA 1CFTA 4K5OA 4EN3D 2G5UA 5FYLE 2L4OA 3IDIA 1AKJA 4GRLC 4GQ9H 4X5XB 3ROLA 3CVBA 4L3CA 2Y7NA 4PTUB 2GAZA 2ZICA 1YPZE 2F1BA 3IMSA 4AG4L 3ALWA 2V5TA 2VDKH 4HIJA 2MPAL 1EMTL 1J0YA 3B3BA 2D0FA 4R4ND 1ZLWK 3MFFA 3FL7A 4IIQC 1OP3K 2XTJB 3FT1A 5IWLA 3SDAA 1UH3A 4CMMB 3EOTH 4N2DA 4YZFF 3LRGA 4ZXBC 4QRRB 3OXSB 5TDPA 1EXUA 3MOBH 1S9VA 2LAAA 5I9QB 2OA9A 4DPBX 5J1SC 1C08A 1KB5A 5CR8A 2L7UA 5ACLA 1CG9A 2A9NH 3LXCA 4XO9A 2MCPH 4K2UH 2W9DH 3S88H 1U8JB 4PI2A 2H3NB 1DBJH 3CQPA 2A2QT 4KQ3H 2ETWA 4QCIB 3JWDC 2GCYA 4OLWL 4PLKD 4FG2A 2VLJE 3O8XD 4B7IA 4GG6E 1J1XL 4NRZA 4X98A 2AABL 5TK4A 5ICXA 2IPKA 2EDTA 1PKOA 1ET5A 4U1NB 1OSEA 2WWMC 4MX7B 2JLPA 2GKIA 3I6SA 5T5NF 2DF3A 1W72H 3OZ9L 1DJIA 2EILB 3OKEB 4IS6B 4UM9A 3SKNA 3JYBA 1G5AA 4F15C 2X9YA 2MQGA 2PPAA 5JXED 5IW1B 1AGCB 4ABUA 4OZGA 4JPWH 4S0HA 2XA3A 2J6EA 5KYYA 4Z77A 4PRPB 1U8LA 4WK2B 4OZHA 3ZE1E 2JK5A 3EYVA 4PB9L 3I85A 4JMXA 4KJYB 5F88A 3W9EA 1E7VA 3U9PH 1YMHA 3CDYA 1Z9NA 4X4XA 5D1QE 1M3JA 3PAZA 4PREB 1T21B 3EF4A 3KPSA 5LB1A 5GXBB 3GXNA 3NBNA 2Q10A 1L0YA 2X9ZA 5DC9B 1CGVA 4M9PA 4Y5XC 1ZEAL 3UTTE 3H9SD 1MCDA 5BO0D 3GSNB 3IDGB 3P30L 1LEGB 2PR4H 4LB8A 2NY3C 4F3FA 1NIAA 4G1EA 3ZTJH 3FO1B 2YPLD 4R5TA 2OK0L 2NXZB 4TNVF 1Q9LB 2MOGA 5C0GA 4K9JA 4MB3A 3RTQD 1N10A 2RHEA 4WFHE 4JY6B 1YMMB 5JORA 2O6CA 5DHMC 4ESKA 1W6WA 1RMFH 1M9SA