3CBKB

Chagasin-cathepsin b
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
110
structure length
110
Chain Sequence
b'MSHKVTKAHNGATLTVAVGELVEIQLPSNPTTGFAWYFEGGTKESPNESMFTVENKYFPPDSKLLGAGGTEHFHVTVKAAGTHAVNLTYMRPWTGPSHDSERFTVYLKAN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cathepsin B
publication title Displacement of the occluding loop by the parasite protein, chagasin, results in efficient inhibition of human cathepsin B.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 22
structure length 110
sequence length 110
ec nomenclature
pdb deposition date 2008-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF09394 Inhibitor_I42 Chagasin family peptidase inhibitor I42
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2020 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3cbkB00
3E1ZA 2WGNB 2C34A 2NNRA 2NQDA 3M86A 2FO8A 2OULB 3CBKB 2H7WA 3PNRB 3CBJB 3M88A
chains in the Genus database with same CATH superfamily
4OZ4A 4S1QL 4DEWA 1YYLL 3OKYA 4N8CH 4NYLB 3D69B 4NO3B 4IBWA 3MJGX 4HUVA 4ZFOL 2HUHA 3LN4B 1FL6A 3LMJH 3LEYL 1U95A 2IF7A 1JPFB 5BUPA 2VZUA 3QHFL 3BP7A 1YQ2A 3B7SA 5D7JC 3QJOA 1WICA 5F0MB 4NCC2 5C0AA 4JX0A 5TE7L 4R4FH 4OIFA 3RX9A 1G7HB 1ZT4B 3KVDD 3LKQB 4AQ1B 2EYSB 1KELH 2YHGA 2DTSA 3D51A 2JQAA 1BXXA 2PR9A 3LIUA 4F8LA 4XP5L 1IFHH 2ZJSL 1Q94B 3AG3B 3IT8D 4FZ8H 3T4AC 4DAGL 1TQTA 3FUFA 3FFCD 4Z78A 4XNYL 3WUWA 1KXQE 5BW7C 5J5EA 2R29L 5JLZB 4RGND 4TOYL 4E5XB 3ILPA 1PU0A 1ZCRA 4NQQA 4DO5A 3QIBB 4QRUA 5BVPH 4IBYA 5EIVA 5DZAA 1DUYB 4K15A 5LQBL 4NO0A 3U2SB 4GUOA 5EULV 3Q48A 5BJTB 3B4NA 4WO4C 4DGIH 3F6IA 1PBYA 4GKNA 3HMWH 4MZRA 5CEZL 2VXQL 1JRHL 1MLCA 1CXLA 1PSKL 5KSBE 4UQEA 4D8PA 1BM3L 1K4CA 4PJ7E 5HHOB 1ZOXA 4HEPG 4JHZA 4XT1C 3IN0A 1ZHLA 4FAAB 1HXYA 4HUXA 4KC3B 3QNYB 4RBPK 4RETB 1I7UA 4MNQB 2Z31B 5HD8D 1XBDA 1PZ2A 2Q1EA 3MNVB 5CJQL 5C07A 3U79A 5H35B 1W2KT 4ZMZA 2OV0A 4NO5B 1XTMA 4F7PA 2UZIL 1HQRA 2V9QA 3BKYH 3DOHA 3PHOB 4OZIA 3QJXA 2DQEH 1AZUA 1EV2E 4F3FB 1EJFA 1T6WA 5IJVB 5I71B 1EDHA 1G7MB 4X5WB 4XNQB 2P8LA 1GGBL 1CT8B 4Y2DA 3O3BA 4F37F 4UIMA 3V8OA 2AJZB 4NPYB 1LD9B 1KCVL 2V2WA 2R0LH 2Y22A 2WLLB 4ZXBD 2DQGH 2BHFA 1F41A 2FBJH 3MV01 4ODVL 2F8XC 1KB3A 3D12B 4PJEE 4AX3A 4HJ0C 2CIKB 2OL3L 1GS6X 4M1DH 5F7FA 2R4RH 2Y6TE 4A66A 4EAEA 4EDWL 5LG6A 4LCIL 5L2JA 3M46A 5J1TC 3BN9C 1J18A 5I1JH 1RD6A 2Q3XA 5L4JA 2FSDA 2X3BA 4P46C 5IMOB 1TMQA 3PNWA 2MSPA 4N2AA 3KXFB 4NPJA 1KJMA 2MOQA 2ZONA 1T1XB 3QJFB 3O3AA 3ARPA 4X42A 1EVUA 4ZAKD 6CGTA 6FABH 4GG8A 4P3CL 1UASA 1A2YB 2EXWD 1UD8A 3EYUH 1M6OA 5E8EB 5DJCB 3LKNA 3P3YA 2G60H 1L7TH 3AREC 3FQWB 1YC8A 5EFIA 4Z1PA 2BIHA 3ECBA 5CSGA 4URKA 1DBKH 4HJ1A 2E6QA 3U1SH 3DIFB 4YR6A 1FFNA 3MBWB 3GINA 4R0LC 3BZ5A 4IMLA 2NYKA 2EO7A 1O75A 1DLFH 1T4KB 1X4ZA 5FUCC 1XIWD 1S7SB 4XCEB 4C59B 3EZJB 1HH9A 3B34A 2I32A 2DEXX 3MLYL 1MI5B 2X4OB 4TSBH 2OMTA 3VX0A 1YO4A 1HWGB 5IHZB 2CM5A 2W81C 3BD3A 3KPRB 1D9KD 1NDGB 2DLFH 3P0VL 1QR1A 2K9FB 2DKUA 2PTTB 4ISVB 2R2BB 5CFHA 2X12A 4KDTC 1E5CA 5I1GH 1G9ML 3UGEA 1P0SE 3ASOB 3H8NA 2Q7NA 4MQXD 2OR9H 1BQKA 3HBQA 4WTQA 5I74B 5CCKH 5IVXE 4ETYA 4JRXB 3RILA 4PR5A 3AGVA 3UOAB 2HB0A 1NAKH 4WJ5A 5CIPA 1KPVA 3RWGB 1UH3A 3EO0B 4PCYA 5E2JA 4IBQA 1YEEH 4RFEA 3BMWA 1M56B 5ESVA 5ICZB 2PWFA 2V17H 5EDXA 2CUAA 2NDGA 1TQSA 5ICYA 5T1DL 1LDSA 3QEQE 4OF5A 5DJ6A 5HGDB 5AW5B 1CFNB 4N1CA 3SKNA 1AGDB 3NJJA 4B60A 4WJG3 1UZGA 4H26A 3L1OL 4QNPF 4NC0B 1T1YA 1E30A 4KRPB 3FO1B 3UO1L 4PPTA 2O6PA 2Z8SA 3DHPA 2X1QA 4FFYA 4O51A 3UXFA 1BV8A 3BWZA 1CK0L 3GS0A 1JIBA 4HIXH 1BJ1J 2O6CA 3BP5A 2VLRE 1GOGA 1S6NA 2AABH 4P9HH 1X6LA 2FEDD 2XWBA 5JOPE 5AB9A 5E0FA 3QUXC 2FATL 1ZA6B 4O4YH 1HHKA 1N6VA 2OLDA 3U4KA 3B6SB 1A14L 5E8DH 4QLWA 2W95A 3DIDA 4JFOA 3FN9A 4XZ4A 1O5DT 1P7BA 5IVOA 5E2WL 1MJUL 5HHME 1W0WA 1IGJA 4J2QA 4M7JH 1NDMA 4MMZB 4PRBA 5IF0B 3RB7A 3VSQA 3QIUA 5JXAH 1HJCA 2VUYA 2WV3A 5F0PB 4LOFA 2HX7A 3KJ4C 2H4EA 1YMHA 1DBML 5B1KA 1L5GA 1TT6A 1TXKA 1INQB 4H20L 3LPFA 3MCG1 1FL5A 1FRGH 5BO1L 4AGNA 5F7UA 5F7WC 4OZHB 1YMMA 4XWGH 1X5AA 1F4YL 2AK1L 1A7OL 1GL4B 1M9SA 4YDJA 3GMQA 3FU0A 4XOAA 4AJWA 1DLHB 1UACH 3VE0B 4OLUL 4GFXA 2ATKB 3DO7A 4GPVA 1CDCA 4WUKH 4LSRH 3QP3A 4YBHA 1RJZB 4MQSB 3G5ZB 4YO0B 4ZMTA 4RRPA 4NZDA 3D4YA 3QUMB 4YVNA 3O6LH 4FDWA 5DD5L 5FCSH 4AITA 1QATA 3QCUH 4DGVL 3OHXB 2J6EL 4FLQA 2DWDB 4HWBA 3RVVD 3IMSA 32C2A 3DX2A 4KAQL 5G5DB 5C3LD 2ZCHL 1MVFA 3WHE0 4K3JH 1T3FA 1XF2B 3UBHA 4XMPL 1KC5H 2WKGA 1OGTB 2E9IA 4PB9L 4TL5A 2W0FA 4XCFH 1QACA 3S3BB 1PNCA 2EYRA 4S1SL 3TU6A 2HH0H 2NNFA 4L37A 3K2MC 3T0WA 4K8RC 1IRAY 1RHHB 4DF9A 1R3JA 2G9KA 4CUCA 4NGHL 5D7JB 1SYVB 3NRQA 2CO1A 1PAMA 5CZKA 2Z35B 4QWWD 4C47A 4LLAA 2WXOA 2Q6WA 3VXMD 2DEWX 3FHAA 1ZTXL 4N5ED 1NSNL 2H0FA 2XTJD 1NAMH 1NKGA 1I1AD 2FZ3A 3NOIA 1UZ6E 2I69A 3GLDA 5DO2C 5AZUA 3MBXL 2EVGA 2Y07L 4HIIA 2QV4A 3KPSE 4RDQF 4Z7UA 2QPSA 5EBMA 5EIIB 2XN9B 4LL1A 4X99B 2UVFA 1MW1A 5HDQH 1S9WB 3UG5A 1MIML 2WJ7A 4POYA 1GHFH 4HJJH 3TCLA 2O5XH 3IF1A 4UQ2A 1RCYA 2Z1KA 2VN3A 4JEGB 4XBEL 1JPSL 3C5ZB 5DJ2B 2H41A 2IPKA 3WGVB 5FK9B 5EU4B 4LCYA 3BH9B 5FGCE 4WI4A 3NCEB 1W72H 4DZBB 1JHLH 3I6KB 1L9SA 5SX5H 5FF6A 3LRLA 4YFLI 3BDYL 3NH7L 3TBWB 3ABMB 3T8XA 1JZHA 4MCNA 1NIBA 4R6UA 2PMZA 1QQDB 3NDZE 3KH3A 4JE0A 4WU7B 5F9OL 2J1YA 1JNNL 5J6HB 1F45A 4Y4HC 2QQQA 3W2DH 1WVZA 4AWJC 2CAKA 2NY5H 4ZFOB 1SNRA 2BOBB 5IMLB 5KSAC 1N64H 3GFUA 4K8RH 2VISB 3WNNA 1H8NA 1BDYA 4UV4H 2JB5L 3O3EB 4GJTB 2P5EB 4CRPA 2XPZA 1DANT 1UJ3A 2BFGA 1SJMA 1JPEA 4YZFF 4NCDA 4XR8C 3ZZLA 3ASWA 5AALA 1BAFL 5HHQA 1RPKA 4J3OG 3QDGE 4O02A 2NX5D 1FA4A 3F7VB 4XPGL 4XAKD 4QXWA 5EZLB 1EEZA 5LVEA 1ETJA 3QRFM 1HAUA 3AXHA 1RUAL 4PV1C 4U1GC 1MHCA 2YAMA 4JM2B 2QGDA 3T2QA 3VFPB 1WHPA 3KPLB 2X3AA 3WLWD 4JFFA 4N90D 2VGLM 2PO6D 3VRJB 4PRHA 1CPUA 4TQEL 2CLVB 2F5AL 2M2DA 2BNRB 3O4LE 1WAEA 5IG7A 2DD8H 1HWWA 1L0PA 4MB3A 4MXWL 4UB0H 2JKTM 3NCYS 3UJJH 5IVZA 4LU5H 2BWQA 2AV1A 4Z7WE 3EJYC 3BVNB 4Q58C 5JUEL 2IQ9L 3SDYL 2CHWA 4HV8A 2DH2A 5K1VA 3F65A 5EN2A 1JV2B 3VXSA 3SYCA 5I66A 1A7RL 1RIUH 3EJZD 2EC9T 3C2SA 3V5DB 4ZD3L 2P52A 4H8WL 2R1WA 2EXYC 2NY6B 2R59A 5HGBB 2KZKA 3HG3A 2C1PA 4GMTL 3GXPA 1I7ZA 2WXRA 4R0LB 3N1QC 5GS2H 5DEGB 2CNYA 3ABKB 1FNEA 1R5WA 1WH0A 1XCWA 4OF0A 2VSCA 5T3XL 3ULSA 3N9GL 4Q6IC 3VDAA 1PKQB 3L17A 3GGWA 5DD6B 5EMYA 3ZMEA 3CN3A 4Y1AE 1JZ6A 4ICXA 2ITFA 5HDRA 2HFFB 4GIAA 5I1HH 5F9JB 4Z3IA 3ZLQC 5C70A 2OL3B 3T3PB 3FT4A 4JPQA 1A8JH 4PJ9C 5CSZA 1U42A 2XACC 3VRIB 2ZSWA 2VMCA 1PLGL 8FABB 2GFBA 5DWUH 5JXED 4UF7C 1XT5A 1I8LA 2YEVB 4UT9L 2PW1B 3AACA 2PXYA 4KK5C 2LU3A 3GS4A 3L4WA 1UH4A 3MRMB 3C6LD 2Y3AA 4OQ1A 5MI0B 3GI9H 5FO7A 4JMXA 5IB3A 2P5WB 2ZP0T 4G11A 1F1DA 1S5HA 3US0A 2AEPL 5EEWA 2XNAB 1F6FB 4Z5RB 4WCYH 1MW2A 4HCRL 1MY5A 1JHKL 4FJZA 2YAOA 2WBJA 3QJUB 1I9JL 2DLEA 3TWCH 4JANB 2BXZA 4R90H 2EH8H 1T1ZA 1K6QH 3UADA 2FSEB 2FQDA 4P2RE 2ZYIA 4OSUH 2GJ6A 5GZND 3HPJB 4H8WC 3HTLX 3UBFA 2PCYA 4X6CB 3KGTA 3LS4L 2I60L 1R1CA 3BT2H 5JHDB 1F90H 3M7OA 1JD7A 5FDWA 1FYHB 1ZPUA 1QBML 5IB1B 1MRFH 4NQVA 1JK9B 3TPUA 2EDNA 3HKZA 5I18L 2ZKHL 1EUTA 2DYPA 4G42B 3PWVB 1VSCA 3MV8A 4BFKA 1N4XH 2JXMB 4JO4L 2EDJA 4YSSA 2IPTH 1A6UL 1G7PA 4LCCC 2HMIC 2F8VA 3VYOA 1P69B 3EYFA 1J9CT 1R47A 2O5YH 3US9A 2C9SA 3WNKA 3O11A 4P2QB 3AU1B 3ULUE 1IMHC 5FO9A 3PV7A 2GEEA 4EZJA 2OR8A 2IQAA 1JXDA 2FH8A 3DMMD 4G72B 4XN5A 3HG0A 2DWTA 3MRCA 4J39A 1RUQH 3REWB 4H88H 1JK8A 2C9UA 4HXAH 4IOIA 1WP6A 2OTWA 5FB8B 4M93B 4IJ3C 4MAUL 4JR9L 3IGKA 3O6FD 3QFDA 3DC0A 3Q0HA 3WHXA 3T65B 2ESVA 3IGFA 3WJJC 4IU3B 3HC3L 5IOPB 1WCQA 4FOMA 5DDHB 5E5LA 3V0JA 4M48H 4HUWA 2X70B 3PP3K 2MEJB 4IU2A 2XPGB 5DC9B 3CLWA 3RIAF 5JZ7D 2HX9A 5D6CB 3WAKA 1MJJA 2OXGA 3EW3B 4IRJD 3DTXA 4L4VE 4J8RA 4PTTA 3LPWA 3PAUA 4WUUA 3WV0A 1WSST 4HUKB 5IUSA 1ZIBA 3VTMA 5AD0B 3A24A 1ORSB 4XHJD 1SEBB 4P59H 1FLRH 2ZPKH 4ADIA 4JKLA 1O6VA 4ZTEA 1I85A 1DQQA 5A6LA 5KZCD 5DT1L 1NOFA 2ATPA 1UVQA 3MBEA 4P5TC 3V9CA 4PRAA 2CMRH 2CHDA 4LSVL 2OSWA 2EZ0D 3T77B 4ZMYA 1FPTH 1JVKA 3X1NA 1AGBB 3PPSA 4L3AA 4PTUA 1VHPA 4AYEC 4D0BA 3HLKA 3OQ3B 3CDFA 1OB1A 4KY2A 4ENED 1N8OE 5MP6L 4KV5E 2BVQB 4RA0C 5ETUB 5IKCB 1LDPL 2V5YA 1VZIA 4KDVA 3HJEA 3ZHLA 5G4OA 1GSKA 1J8HB 3QQXA 4H1LA 3SDXB 2Q10A 1BLNA 1UWXK 1WEJL 1KMGA 4NAMA 3FN0H 3KE0A 3A4DA 4LVNB 3I75B 4OM1L 1OAJA 4OCLC 5CJXA 4QRSA 5EC1B 4HGMA 4X6FA 3RPBA 3C60C 3V6OA 1GRWA 1B9ZA 3KWWA 5GJTH 4ZOCA 4Y5VA 3ZZQA 5SV4A 2UUDK 4LCWA 4X7TB 4XO5A 3QO1A 4FNRA 3RB5A 5C09D 3M1BB 4MBOA 3I84A 3I50H 4MCZB 1AD9B 3CUPB 2AQSA 5EU6D 3UAFA 1CF1A 2YQ3A 4AMWA 3IXTA 1U8LB 4MQ7A 1N67A 1EBAA 5HHOE 5LCVA 2FL5B 3MLZL 1V8HA 5HYEA 1URLA 3CQQA 1QSZA 1A3RL 4AOFA 1FL3A 1TNMA 1BVNT 4MNQE 4HX1B 2VL5B 4RMUA 1JZFA 4AE0A 3WTVA 4W9HC 4UBDC 4U6XB 1PY0A 1M7DB 3AU0A 1A7PH 4FFWD 2AK4A 4M7KH 3VFVB 1LXMA 2XLLA 4IBVA 1ET7A 3S37X 1MZZA 5CAYB 2YRZA 2G2RB 3VXQA 5FFGA 2QQLH 3V0VB 4OV5A 1GYCA 1IGML 2JTDA 5CEXB 4OAWA 5LGKA 1KEGL 4K73A 3OKMA 5EZPA 3II3A 2XWJA 4A2FA 2DICA 4PIBA 4F8TA 3QIWD 4OUOA 5A2LH 1F11B 3QUYC 1UA6L 5CLXA 4ZNEE 4Z76B 4X9YA 5IEKA 2HVBA 1MFBL 2OSLB 2BDNL 3I85A 2BX5A 2OJEA 1AQKH 3UX9B 4GRLD 2VN6A 1DVFA 2HG0A 3CN1A 2G9HB 3JV6B 1I7RA 4D2NA 4KI5C 1TCRA 4NT6B 2ZP8A 3QS2A 4YDZA 3KXFE 1G9EA 3FTSA 1C8QA 1PX8A 3QARA 5D6DC 1DUZB 1RSYA 3RGVD 3DVNA 5MERB 1KBBA 4ZOEA 4A37A 3CZNA 1XTLA 5JQ6H 2QT6A 1N3NA 4PJ8A 4F9PA 4G83A 4PGDA 3D08A 4HW6A 3PHSA 4QT5B 4CKQA 5ILTH 4LPXA 1WIUA 2XWEA 3RUGB 3TEYA 3Q05A 1X9RA 1OD7A 3EGSB 4P3WA 1NCNA 4OGXL 5H37A 1IAOB 3QCVH 3DHUA 1SBSL 1U3HA 5HDBB 5M95B 4MS8D 3UJTL 3GHEL 3L16A 1LEKA 2QQKH 2Z93B 1ROWA 3VFRB 4WEBL 3FQTA 2M83A 4LBAA 4OCYH 2GAZB 2F7OA 3MRJA 1GA2A 5ICXA 2GIMA 2PW2A 1G87A 2H32H 4DIXA 5D4QA 1F5WA 2UWEF 1ZVSB 4Q6IB 4L8CB 4ORZC 3V52L 2WLZA 4AUYA 2JIXD 5JW5B 3BVWA 3FK3A 1MI5E 3PYCA 5L6YL 1NGPL 2E46A 2IDUA 2X1WL 3SODB 3VXRA 3WE6B 2NXYC 3WIHA 4JS7A 4J3OD 4PRPB 4L18A 4XNXL 5KSUA 2IVFC 3P2TA 4N2EA 3RWIB 3D0VA 3MLVH 1Q0XH 1OGPA 3H2QA 4HWUA 4N0YL 3KPRE 5HYJB 3EOAB 2E7MA 5F8RC 5HI3D 1A4JA 5CD5D 2A6JA 3RYMA 2R69A 2NTSP 4AMKH 3K6FA 1R3KA 3LNHA 1Z9MA 4F5CE 3QO0A 4CVXB 4OJAA 5A3ID 1OF0A 1QLFA 4GO8A 4PJDB 2CA3A 2X9YA 4FLHA 5HY9A 2PTVA 4JRXE 3MRFA 2K6YA 2YBGA 1B4TA 4XE0A 4KNUA 1I8IA 3F5WA 3S5LG 5TPWL 4IRZL 4EZKA 1UXWA 2P46B 3FO2A 3P9WB 3QQDA 4G8GA 5BRZA 4RAHA 2V2XB 1J0ZA 4MXQC 2YPVH 3JWOL 2PLTA 1XH2A 5FHAH 4JQVA 1QLRB 5E2VH 1O7DE 3ZVVA 5JOFB 3UH8A 5BOPA 2GUYA 4OT1H 4ATTA 3KLQA 3KPOB 1RJYB 2WBXA 3WJLA 2BFVH 1KTDB 4JY6A 3FO0L 2J44A 2ADFL 2VC2L 4Y4KD 1TJGL 4YX2H 3WSQH 1A6VH 4DGYL 5AQ0A 2LU4A 4XPAL 3RPIB 3BLBA 1LEIA 4DKTA 3D39D 2ZUUA 1FH5H 4FJ6A 4XB8A 5JIHA 3BAWA 2ZD0A 3BZEB 2APTA 1XEDA 3KBFA 3Q13A 4FQHA 4K9EL 5FW7A 3K72A 2FHCA 1KYOK 3APNA 4LCCB 2TRHA 3CFCH 4MMXC 1CLOL 3BP4A 5I2IB 3GLZA 2IFGA 3G6JF 4FL4C 3LVTA 4G3YH 4HFUH 5DURB 5HDWA 1C16B 2ORBL 3DURB 2YRLA 2D2CC 4DQOH 1HT6A 2CJUH 3QXUA 4P99A 5LKNA 3ZN6A 4PUBL 1HXMA 5DI8B 3S48A 5E2TL 2VKXA 1RMFL 3KYMA 3L5JA 3T3MB 2DL2A 3QG7L 3NCBB 2C7UB 3VD9A 2QV2A 4B41A 1HEHC 4FYTA 1H8OA 1QD0A 2A6IA 1XMEB 3SCMD 3UTZA 4BFJA 3WTUA 1BVKA 3VD2A 4IJ3B 1RV6X 3BQUC 5F1NA 4OZHE 2NCEA 3UYOD 2QR0A 2D7TH 2VDML 4TV3A 5F9WC 1F3DH 4XP6L 2IFFH 4YPJA 3U83A 4JFVA 4PWIA 4MCMA 4UT6L 3CSYA 2NNCA 2UXVA 2AW2A 2HSIA 4M7ZB 3F84A 3JWOC 4OIBA 4HPYL 3KHOA 2A6KA 1L3NA 3TO2A 1HEJC 2SEBA 3ZDXF 3EYSH 3MSPA 3NFNB 1ZLVH 5EUOB 3I2CL 3W82A 1G6RA 4R7DB 1B0IA 1S9YA 4JGUA 5F7EL 2UWEA 4X80H 4XI5D 3OVUB 2YUZA 3SDAA 1CXFA 2NR6D 2VAJA 5CILH 3T0EB 4EUPB 4LHQB 1P7QA 2WXNA 3EF4A 3QRLA 2OMVB 3B2MA 5E99L 4K9EC 3WFCL 1T80A 2BXYA 4IKIA 3GSWB 2HN7B 2YZ1A 1A3LL 3Q1EA 3CXFA 4FQIL 3ZRCC 1FCCA 3V79C 4KRLB 1F8TL 3GO1L 1AIZA 4JHUA 1V3LA 2GYSA 2E7BA 5DRZA 5LBSH 4DOHB 5CZVL 1RZJL 2HVKA 1JV5A 4YLQT 3F2LA 4QLRA 3H0TA 1CYWA 4FNUA 1IM9A 2BSRA 5JW4R 4LVOB 3P4OB 4JO1H 1YLBB 2PYFA 2GSMB 4YE4L 3RL1A 1UT1A 2EKSB 4U6VL 4XBMA 3CXDH 3L5HA 4LF3B 1BOYA 1S5IL 4WNSA 2GK0A 2K3TA 3OC5A 4LSUH 2IMNA 4B3EA 3C60B 3X14A 5LAPA 5E5MB 2WANA 1H6UA 2OMZB 3MV9D 3IFOA 1D5ZB 4XCYB 4F2MA 4AK1A 5D2NA 1IEAA 5KYXB 4XNZB 1CG9A 4Y16D 5E6IC 3A6BH 2WC7A 2VQ1A 3QZOA 1CE1L 1T0NB 4MZIA 1GS8A 1OTTC 3HI5L 3QI9A 4G6JH 5ICUA 3B9KD 5IB2A 4FNLL 1Y0LA 5A2AA 1OXYA 3RWEA 3PABA 1T5WA 3LQZA 1OPOA 1BQHG 3LS5H 5AWNH 2VERN 2LAGB 3BAXA 3G6JA 2BSCA 2VXVH 3H55A 3KPQB 1A1NB 1B0WA 4KQ4L 2CKBL 2WMPB 3WKPA 2AJXH 4U6HB 4UV7H 2DWYA 1YNTF 2P5EE 1RZJC 2R2EB 4JZOA 3HA0A 3ZPDA 2D9QB 1BEYH 1IT9L 3PFQA 4WI9A 1SQMA 3QEQD 2RB8A 4HCFA 4JGMA 3TA3A 2C9QA 3P4NB 4X4YA 4JZNA 3DHMA 4GXUN 4I18C 5F3HB 5LB1A 3N91A 5KAQG 3FRPA 4K7FA 3IDNB 1O7VA 1I3UA 3ROOA 3GMRB 2X1OA 5C9JB 2VZ3A 4NQUA 4F7CA 5D93C 4HXBH 35C8L 5ECGA 4OLZH 5FKAA 2FO4B 2BIOA 4ZO9A 1A4KB 5JOPD 1LYQA 3LNGA 2FTAA 3QUGA 3TN0C 1C5BH 1ZXKA 3LRSB 5CCHE 3IN2A 4I48A 4J2XA 1QHOA 3Q6FA 4Y9EA 4HWZB 4OF7A 1RIHH 2BNRE 2X6VA 1OEZW 3QJQB 5CEZE 2DW5A 5HHMD 4O5LH 4NQDB 4Q9QL 2Z9TA 1KTKE 2X4SA 1MFDL 2RFXB 4L8DA 4BKLB 4GQPH 2RR3A 1JZ7A 2CBPA 2ZWKA 4X6DF 4AZUA 1ESOA 4LOUD 5KVFH 1U6AL 4RMVA 3SE8L 2UXGA 3HVNA 5FYLH 1A9EB 3MJ6A 1J5IA 4MYWB 3W57A 4E5XG 4QTFA 4HVBA 1JGIA 5AAMA 3JTTA 1KCLA 3KL3A 4F9LC 5IWLA 4TN9A 5FUCE 3DNKA 1TJHH 3ZIYA 4XPFL 3I6LE 2AJYL 1PKQE 2OSXA 4YK4C 2DDQL 3W39B 4ZW5A 1R24A 2ZCLH 4IIQA 4DKFL 5C0NC 4JO3H 5FEBA 2BSTB 4DP9X 4BKTC 2B1AH 1CDGA 1P6WA 4GW5A 4HH9A 1DO5A 1IQDB 1OM3H 2MQ0A 2G4GA 2WBKA 1TVBB 1CFSA 3T3PE 5SWQB 3OWEA 4UWQB 5DUBB 3WFEL 4QXGH 4L0PB 2Q5BA 1IGYA 3HZYB 1JF6A 3T9WA 3ZDYF 3B9VA 4WK0B 1NINA 1E6OH 2OKMA 3LVEA 2XFXA 4WW2F 5I6NA 3BVDB 4J6IA 2GCYB 2VRQA 4G6KH 4HULB 1DVYA 1U8CA 2IXQB 2P5WE 1UWXH 1AQDA 3UTTB 1MFCL 1A7QL 1YY9C 4HHGA 3SN6N 2TRYA 3H54A 1K8IA 4WI3A 5ERWA 5DRWB 3HE7A 3ARVA 5IJDC 4QXUL 3MRDB 1JE6A 1ZHKA 4JCLA 3IBOA 3WMSA 1FNFA 1XZWA 3U0PB 1DBAH 1LM8V 3HS8A 4R9HA 3KNBA 4N2FA 4I77H 4AEIH 1AGFB 5B7FA 1CR9L 1KT2A 2DJSA 2VDQH 3CFKA 5GRZA 3TNNB 3JUYA 3VM5A 3WLBB 2A83A 3HE6A 4MAZA 4P5MA 2EDMA 4R7XA 3KPSD 2IGLA 4LLYA 4BE5A 5INCB 4X6CE 2QADC 4DSYA 4YS4A 5C0RH 4MNGB 1QUNB 2I9TB 1YNTA 2Y7QB 1E9QA 5EWIH 5JHDE 2N3JA 4JPWL 5MHSE 1UYWH 4EIUA 5G4MA 2D7NA 5DUML 4PJAA 4K5MA 4YSQA 1FV1A 1JF1A 4XPBH 3CG8A 1LO3H 1C12B 4EI6A 4U2ZA 5AUMB 2B59A 4Y2OA 4DHLA 1UKSA 3ZDZB 2HFTA 3I02B 3DROA 1OAYH 1LO5B 1KULA 2JJSC 4UQ3B 1T0MB 2X10A 3QORA 3BRFA 4WTWA 4JFZH 4P2QE 2IAMA 2NY4C 5TF0A 4K3EH 1LHZA 3HZKB 3FOLA 4NUJB 4Z3FA 1ZHBB 2BNQB 1HS6A 4JHWH 3P3UA 3N04A 3Q2NA 1NEZB 4Q74A 3NQIA 4OQTL 4U3SB 3PP4H 2XC8A 3AITA 1YG9A 4WU5B 5KVGH 1NCAL 2IH3A 3BEVB 5A2BA 1DE4B 4OFVA 4PBDA 8CGTA 1MF2H 3BQUB 2X87A 4XNUL 1EO8L 4NQSA 4X6DA 3TV3H 1JZ2A 5F9WB 3RWFB 1UXLA 4FQXD 3RTQA 2ID5A 2BVTA 1AXTL 1KACB 2WM0A 4AXWB 3QDGD 1ZSDA 4TVSa 4A68A 3KBPA 3H3PH 2BC4B 3BE1L 5DVOA 3BISA 1TKWA 2F7IA 15C8L 4HETA 2BP5M 3P2DA 5FA3B 1WLHA 1J1OL 2NNRA 1AP2A 5DJDA 4R2GD 3CHPA 2ZXQA 2C4XA 4GRMB 4XO8A 3BGMB 2R0ZH 5GZOD 4MAYD 3ET9F 5TFSL 2VC2B 1FAIL 4LLWA 5AB1A 4LLVB 4LP4A 4XNMA 5D4JA 1ILUA 3T2NH 2PWGA 5J8OA 3GJFB 4YGVA 3HLAB 2HKFL 1QUPA 1MQKH 3J27A 1KGCE 3LXUX 3O9WD 2VDKH 3OG4B 2XA8H 3EYVA 3DX7B 1KTBA 4U31A 4M7LL 1C5CH 3ULVC 1BBJB 1XGPA 4A6YA 4DGWC 3ME0A 1SDAB 4FXKC 1XGYH 3QZWB 4WW2A 4N0FB 3CDZB 2OAAA 1TQUA 3BHBA 1A5FL 4RNRB 3T2LA 2PCXA 4P04A 1OZUA 4JVPA 3ZE2F 1NCHA 1TO5A 4PY7B 1J8HE 2C8NA 1AXSA 4MFHA 4RWHA 3QH3B 3FPYA 1EZLA 1NC2A 3JT2A 4NM4H 1SFDA 2L3BA 2WB7A 2CM6A 3NCCB 4Y1AD 5DQJA 2XV6B 3M17B 1JZ4A 2JKXA 1K2DA 4HIJA 4XBPB 5I17B 1ZPLA 2BERA 3KEHA 2ITDA 3SDCC 1EX0A 3HRZC 3TCTA 2P45B 1I1YB 1FQ9C 3VXNB 5FA4A 4XVJH 5I26A 3ARFC 2J12B 3BFOA 3PHAA 2HJLB 2IBGA 4JRWA 3UFIA 2CUMA 4BFBD 4CAGA 5C0CA 1QZNA 2VR9A 4ZUWA 5E6IB 3C9NA 1KIPB 4P2OD 3V55A 3PGFL 5ABZA 3RDJA 1RFDH 1LE9B 2EDRA 1U3JA 4P5KB 1S8DB 2DZEA 2R7EA 5CZXC 1ZHNB 3LRGA 5I0VA 3K7UA 5LUMA 1LO4H 1PNDA 2R0WL 3QC5X 4NC1C 3THML 3SPVB 4OZFB 1TF4A 3SOBH 1E8WA 3NIGF 1U21A 5I24A 1CCZA 1QMUA 5I76A 3ULVH 4DESA 1XCQB 1HL5A 5EU7C 4N2IA 3MRKB 4KZCA 2ZOKA 3SE6A 1KFAH 2R56H 2GSGA 4P2RD 2E5EA 2YK1L 3WENA 3CC1A 2JI1A 1XZ0B 1F3RB 3QNFA 3WTTA 3PDDA 3HNVL 1GSMA 3KPTA 2ICWJ 1MXGA 1NC4B 3NTCH 4TNEA 3TVMB 3VAEA 3VG9C 5JIIA 3MRPA 1ZTXE 4I18B 2APBA 1VFBA 1TG8A 1KYDA 2A99A 1H9VA 1CGXA 2A6DB 1N6UA 2Q7YA 3NEOA 3MA7A 2NQ3A 4FFVD 5KYUA 5D93B 3BVVA 4FLOA 3IU3A 3TO4B 3TBYB 5BMFH 3B2VH 1CE6B 4LGRB 1XL4A 2CSPA 2FJFB 4K9JA 3ZQXA 4F8QA 5HHPA 3WFDH 1NBQA 1F18A 1FH2A 1IBFA 2DI7A 4TNWF 3SE3A 2I07B 3VYNA 2PCFB 1AZBA 1E90A 1OTUC 4NUGH 3UO8B 4P23A 5FOJA 5IB5A 3ZO9A 3KLLA 1BWMA 2HVJA 3N06B 4RX4A 1ZD6A 4ZQKA 3ULUD 1U8KA 4UM9D 3RUGE 4ELMF 1AD0B 1J5HA 3GSNA 1JTTA 4OB5L 4N8VB 2OQJA 1U8IB 1FIGL 2XZQL 2FX8H 1BXVA 2IADB 2IWGA 1RVFH 1DN0A 1RK1A 5HDBE 4JRYA 5CBEB 3TC9A 2JI3A 3CVHH 3D4GA 3I3DA 3MXWL 5EIIG 2OTPA 3BZFA 1B4JL 4J3BA 2F53A 2N01B 2AJSL 3AT9A 2ZNWA 1KPUA 3CDGA 5C0EB 1QFPA 4YHYC 3L3JB 1AS7A 2QDWA 3QG6B 5H8DA 3DVFA 4TUUA 4FJYA 2VKWA 1PGRB 4HT1H 3BDBA 4EZLA 1OM9A 1NEUA 2BRRH 3S3CB 5LXVA 2A38A 1BZ8A 1T7WA 2K6ZA 3B9AA 3LRMA 3SE9L 4CDGC 1NOAA 3NESA 2YJLA 4FKKA 2VR7A 1JERA 1IC0A 3SY6A 4TNVK 4PRPE 1JXJA 5T1MB 1H3PH 3QEGL 3GMNA 1RULL 1UOLA 3B2XA 3KWXA 4NFBA 1MFUA 2XV3A 5AW0B 1QRNB 2AJUL 4JJ5B 2O26U 2Y23A 5HYJE 2MFNA 3REVA 5EPMA 2XWDA 2D31A 1GTNA 4ENZA 2AXFA 2BJML 1Q9OA 1SRDA 4KBPA 3NG5A 4YHLH 1IAII 4FTVD 1S46A 1ZWIA 3WKML 1J8SA 1XGQB 4L8SA 2E76C 4F8NA 2P7TA 4PJDE 3F3HA 1NEPA 4G71B 4CNIB 5JOEA 3U4EA 2HLAB 1QLEH 4Z7VB 3P9MA 3SPJA 1PKOA 3X11B 1GJWA 5TE4H 3LZRA 4H25A 2X4RB 4WVRA 3VFTA 3L3KB 2FQEA 2IDTA 4WEUD 5HHVL 4U1MA 4KJYA 4Q7DA 2AXJA 5MEOA 1NLBL 3LX9A 3H4HA 5IROD 3EJTA 3N44F 1LK2B 5KSVB 4EN3D 1I1FB 2QADB 2HTLD 3DRQB 3QIBD 3QNZB 4Y2DC 1G4MA 4LKXA 1IZJA 1U8HA 1J1PH 2XXFA 3L9YA 5EEXA 5T3XE 1BYNA 3PXHA 1TTGA 1JGLL 4JY4B 4LO9A 5HGHB 1HXKA 2JI2A 1AE6L 1KCSL 3ARDA 5HHOD 3VVVA 3VH8A 4NQEA 2B2XL 4RMWA 5FYKH 4XO4A 3CBKB 5HYSG 4MNQD 2Z31D 2A9MH 4HIEA 2YD9A 2DOCA 4G5AA 3WGUB 4MRCA 5CP7B 3BXNB 1AOZA 1EK3A 3MJ7B 4LAJH 3T3ME 1A6ZA 1X5ZA 2VSMB 1QO3B 2NXZB 5CBAA 4MQTB 5DJYB 4LOVA 4DK5A 3CFQA 1OCWL 2W59A 4ELMA 1H3UA 3IAPA 3MFGB 4PVLA 4RRPM 5E1HB 4G9FA 4NP4L 3UPRA 2P44B 4C4KT 4YLCA 3DWTA 3NIFB 2H9GB 3KAAA 4IKJA 3WTYA 4FMFA 4AQEA 2XETA 4JFPB 4BFEA 3OXSA 3STLB 5EF1A 4ODTL 1TPXC 1AGEB 3S34L 2DQCL 5F6IC 1FFTB 1P4LB 4LQ1A 4N22A 3BW9A 1WWWX 2HLFD 4FFYL 3S4SA 4DCQA 3F7YA 4PJGB 5EUOE 1MFAH 1TTUA 3L9RA 2WTRB 3OR7A 3KXFD 4MJ4A 1HI6A 4AQAB 3GJEA 1H3GA 3ISYA 2CGRL 4JVWA 5E00A 2XJLA 1ES0B 3T0EE 4YDVB 3IJYA 5ID1B 1WISA 4XXWA 4OIIH 1JFHA 1OW0A 3C6SB 4TKWA 3V6BR 2EE0A 5EO9B 1E2ZA 2GI0A 2GSIA 4HKZB 4LCUA 5KVEH 2XXMB 3IMWA 3ZE0B 1HX0A 5B1BB 3DXAB 4DOHE 5EC2A 4AYGA 2AQ3A 3UDWA 4NUMA 3MO1B 3AT0A 4K5PA 5E8NB 1KXTB 2FYVA 1UQSB 4XPTH 1OSZA 3RDTA 4QMEA 5HDLA 4L4JA 1F4XH 1Q9WB 1XSIA 1HZHH 1LILA 4QXTA 5F0JB 2YQGA 1MVUA 4G59C 4HLZH 4J1UB 1R33A 4M6NL 2VZ1A 5ALCH 4E41D 1C5DA 5EO1B 3IJ8A 5F6HI 2Q8BH 5E9NA 2BRQA 4LHUA 1XDTT 1IAKA 2FH6A 4AYDC 1MI5D 3N42F 4DP4X 3QSKB 3CFEB 3X3GL 1U93A 4Z95L 3BUPA 1MCPH 3MX0B 2J8UB 3HRZB 4AH2B 3UMNA 5AW4B 2YOAA 3TJEH 5HHXH 4FFZH 3KPRD 4YXHH 1LK3L 3FB7A 3BGFC 2WUCH 4ZQTA 3ARFB 3H2PA 4M9PA 5GXBB 2WCPA 3L3GB 1VGKA 4ERSH 1BMZA 1FO0H 1GAFL 2VITA 2OJZH 3GIZL 4EJ1C 2EC8A 1OP3K 3TA4D 3BKJH 2FIRT 2VRKA 3DSFH 4G7QB 3V0AC 3WHE1 4C55A 4D94A 3TFBA 4HEMA 3LXCA 1LP9F 2OTUB 3IYLW 2L8AA 4WI0B 3CZFA 1TEGA 3ZR5A 3H9YA 3CN2A 1HK6A 4JRXD 2V2TA 4ZX6A 4YHZL 5DD3L 5E7FA 3FT2A 4N2DA 5J1SC 1JMXA 4NKMB 2VDLH 2LV4A 1HNGA 1L9PA 4JAMA 5B7EA 3QIUC 3RNKA 3F58H 1FE8L 2Y1AA 5JYLA 3PQYA 3D34A 2KHAA 5SWSD 3MXVH 3V4LA 4AGOA 5I1AB 4FCAA 3VWJA 2IH1B 5CJBA 1EHXA 3IKCB 1ADQL 3MGTB 1XAKA 1BF2A 4XBGA 2W1NA 3HJ0A 5L4IA 5LWYL 3K1DA 3KYOB 4PGBB 4NZTL 3M07A 4NZUL 2FLMA 2ZKYA 3VXUB 4KVNL 3BZ4A 4PREB 2CK0L 3MCKB 2ITCB 1E28B 1OAUL 1PZBA 3MVSA 5EORL 2MCPL 4KI5E 5A2KH 1L9TA 2E9GA 3QDMB 3WD5L 4JB9H 5I6KA 5LXGH 4S11A 5PCYA 1I3GL 5JNYA 1PLBA 3PCYA 2NZ9D 3S3DB 3UBGA 5IHBA 4DTGL 1WBZA 5L2KA 2E9WA 4QHUB 3CD4A 4KMTH 4KJPD 1OCRB 1FBIH 3IKKA 4NQDE 1YNKH 4HMDA 5I73B 3CH8A 2P1YA 3CVIH 4L1TA 3RA7H 5CP3A 5ANMB 5JQIB 2E7DA 2ZG3A 3GLAA 3K81A 4G5ZH 5DD1L 4PGJA 1C7TA 4JG0H 3ZRFC 5DEFA 1SJEB 4BCZA 4HUVB 2X7LB 3A4AA 5CEYB 4KTEL 4YNYA 1FFPA 1FL6B 4BZ1L 4N20A 3LTVA 1FDLH 2XQYG 1KDJA 2EH7L 3QWOA 3E6FA 2ENJA 4DP7X 3BP7B 5A6MA 4ORGA 5EUKA 2VXSL 4BZ2L 1G9HA 2WLHA 4HP5A 5TD4A 3DGCR 2JKNA 5C0AB 3P69A 3MQIA 2CCLA 3MROB 4AENA 1I82A 1J9SA 3T0VA 2BS8A 2ZXGA 4O02L 1LO2H 3UZEA 5CS7A 4M6OH 4Q0XL 5I23A 1L6ZA 2COVD 4I87A 3SKOA 1JD9A 1HCVA 1BVOA 1F13A 4Z78B 1YRKA 3WUWB 2H7WA 1CC3A 3TJPA 1JNLH 1IC4H 2ADJA 3DX4A 3S2AA 5HVFB 3ILPB 1U2YA 2GJJA 2YFNA 4XC3L 1KCUL 5T33L 1SHXA 4HISA 4KHTL 3BKCH 3K1KC 4NO0B 2Y1YA 3QJVB 4GKNB 4N68A 4P2AA 1MLCB 5I19L 2HT4C 1WZ1H 3VM7A 4D8PB 2DF3A 4BA0A 3FB8A 3RZCB 1K4CB 4HWBH 3UTTE 4XCNA 5D7JD 3F6LA 1ZHLB 1HXYB 2AJ3B 4YSPA 5GRJL 4U6YA 4HUXB 1YY8A 2VMJA 1A6TA 4JFXB 1LP9A 2YMXH 5C07B 2UYLA 3WS6A 7PAZA 4F7PB 1HQRB 2E3VA 4OZIB 12E8L 1GYVA 2XCMC 2ZUYA 4TUJA 5IGXH 2IALA 1UJ3C 3FOMA 4AIXA 1XVSA 2P8LB 1J9TA 2P49B 1TZHA 2X6CA 4MNGE 4Y2DB 2ZCZA 3I3EA 4JCMA 1TTBA 4Q9RH 4UIMB 3WMQA 4B3VA 1L6PA 1P4UA 1SOXA 5IHWA 1OAQH 3BVTA 3AABA 1LLAA 3ZRSA 5C0JB 2DY2A 3C5ZD 2HG5B 3F01A 1WFMA 2WXPA 3KEDA 4P05A 2F68X 3WXVH 3NK4A 3UEQA 4TRPH 2IGFL 1QA9A 4WDIB 4X7SL 3ARRA 3I74A 1NDTA 2OI9B 1PZ5B 5CJ5A 5LGHH 5L2JB 2YGVA 1X9QA 1JDAA 1VLXA 3U0WL 2UVEA 2B39A 3ZDZE 2UY7A 4YSEA 1W0YT 5IOKA 1A9VA 5E6SB 3PNWB 1Q90A 2OYLA 1KJMB 3QA3A 2DWXA 2OW6A 3DSNA 1JYXA 1ZGLP 1UHVA 3O3AB 3L3DB 3ZKQD 2BNQE 1XH1A 4QD2E 4TLTA 2CIIA 2W8CA 4NNPL 4P0DA 2CRIA 1EJOH 2CJ3A 1M6OB 2I26N 2P5ED 1REIA 5J12C 3LKNB 4BHUI 1M3IA 4FQ2H 5E08H 3OZKA 3MNWB 3ZDWA 5IVNA 5IESL 3UC2A 4PD4K 2CO2A 5CFAA 5BZDA 1SQ2N 4HKXA 3VGAC 5E9DB 4HJ0D 1TPXB 1BOGB 3T6WA 3C5XA 3RVUD 4GSDL 3K71A 1DSYA 3DBSA 4IMLB 4PGZA 4GQ9H 5F6IB 2R0KH 4JN1L 3BSZA 3HN3A 4PS4H 2UZPA 2IDQA 2ED7A 3BN9D 3L5IA 3GMMB 1ET8A 3QJRB 4JM2D 5DMGC 1KBWA 4NKIH 1XGRA 4D9LL 1RKRA 2JKWA 3I9GL 5IR1A 2VH5H 3WY2A 2VLJA 4OH2A 4GKZA 2DQJH 1TETL 3OZ9H 1CFBA 3WUZA 2BNRD 2X5PA 1SDDA 3GXUB 3HAEA 3NFSL 4XHQA 3A3YB 3GJFK 5DJ8B 5CEZD 1P84J 1I8KB 1EEQA 1G0DA 1FCGA 2ZXEB 5B1CA 1PDKA 4DZ8A 5GS3A 4O9HL 1ZS2A 3LHPH 5EO0B 3ATBA 3NJXA 1I8LC 1OL0A 2NYYD 2B20A 2PXYC 3O0RH 3TT1H 5ISZB 1U8MA 3BUYB 3LNFA 3O81A 4N6RA 1UD6A 1PZ3A 4UOW0 4OU3A 1TQVA 5IW6A 1XXDC 4YHIB 2NY6D 1UM5L 2CR6A 2KDYA 4APQA 5I1EH 2XN2A 5F1IA 3A6OA 3BP6A 4QKXB 5D1XC 4PR5B 4ZPVA 2MNUA 2WZPD 5CIPB 1KPVB 3BRDA 2WBJC 3I6LD 3KYKL 3P4LA 4RFEB 4PVMA 1J5OH 4AYFA 1MHPH 3I6GB 3PPEA 3R0NA 3ELAT 3B7YA 3VFOA 1L7IH 1U9KA 2J20A 4POUB 5IBLC 5DU7A 3VD3A 5ICYB 3MAWA 4RQQA 4DPRA 1A6AA 3DETD 4WY7L 3E80A 2LTQB 4IOFC 4XC1L 2GPZA 3SKNB 1JBJA 1KJ3L 3N1PC 4LSDA 3WDJA 1F3JA 2QBWA 1S3RA 1T1YB 2DQFA 4FQCL 2ARJA 3E3QC 5J1AA 4O51B 2HAZA 5D1ZA 3WXWH 3KWTA 1U58A 1J1XH 1QBLH 2EDWA 2GIYA 4JFEA 4U1LB 5D1QB 2APWA 3BP5B 4F8OA 2P5WD 4XMVA 1JPGA 1SEQH 3AM8A 4U0QB 2WXFA 3X13A 1HHKB 1MQ8A 1JXGA 2EDLA 2UX7A 1NMAH 4M29A 4ONFL 5ACMA 3BI9X 2QVFB 4GXFA 4MJ6A 1IEBA 1IGJB 4P9ML 4NQCA 1NDMB 2APXA 4PRBB 4G7RB 1A6WH 3D3VA 4ZRGA 4R8WL 3FQ4A 4PW4A 1GTFA 4M5YH 3H9SB 1K3IA 1FL5B 2AXGA 4KJQC 2FGWL 5LG1A 1YN6A 1YMMB 3VB9A 5JHDD 5F88A 4YBQD 6PCYA 5IFHH 3EHBC 1YNLL 2IIJA 4YDJB 3GMQB 4GP8B 4EUPG 1C08B 4F2EA 2RCSL 1GW0A 3DO7B 2FBOJ 2EADA 4DP1X 1E40A 3L4VA 1DL7L 2D0HA 2J56A 1ASPA 2ZXBA 4HOWA 4XN7A 1IAIH 1YJDH 1BQSA 2NY7L 1UA3A 3B5HA 5LCVL 4B27A 2D0FA 2C9XA 32C2B 1I85C 1KIUA 3GHBL 1J5DA 4IRSA 4RMRA 1Z3GH 3MBEC 3FTXA 5K39A 2KS0A 4G6AC 1JWSA 3IFNL 1AHWA 5I8KL 2VT0A 5GRXG 1KCWA 4PP1C 2EYRB 5ADOH 1ZGLA 1ZLUK 1N0XH 3SJVA 4L37B 2JQZA 3OKLA 2WIMA 4I3SH 1NJ9A 2YMTA 3V6ZA 4AUUA 4E42B 2VR3A 4UNIA 1VFUA 1J05B 4KFZC 3ES6A 3FW6A 2EDOA 1KXHA 4OCXH 3T4YA 2EXSA 1RZIA 5IFAH 1PD6A 2FZ3B 5GGQH 4YH6A 2NY0C 4QTHB 4LASH 5FW8A 5BS0A 1HVXA 2MMXA 4OD3L 5DRXA 3O6ML 3IE9A 5CJXC 3QWRD 1IILE 3FT9A 5I0ZA 3V0WH 4Z7UB 4BFFA 1XB6A 4X0KB 4NJAH 5DLML 1IE4A 1KBKA 1QRNE 1OT4A 3T0BA 3RIFK 3U9UA 4LBEA 4G8AC 3D09A 5EZIH 5HXMA 4Y5VC 1KGCD 1SZNA 1K4DB 1RK7A 3G5WA 3N6YA 3TCLB 4AM0A 2RJMA 3OL2A 3ZE1F 3QYNA 4PRIA 1EWHA 3D85A 2EE3A 2IPKB 1Q9KB 1H8SA 2BVYA 1D2OA 1A1OA 3JTBA 3VD7A 3VG0H 4AW7A 2QHLA 3G9AB 4K8RD 1OGAA 2EDEA 4FABL 3ROLB 1EBPA 2ZP9A 3QUHA 2KC0A 5GGTA 3PWPA 2MPVA 3W9EA 5F7DA 3WI9A 4Z7VE 5KYWA 3HUJF 3GI8H 4X98A 1IEHA 3AXLA 5DR5L 4ZUSA 2O6DA 2VDPL 3H1ZA 3H9ZA 4OM0H 3SGEH 2GB2A 2Y7MA 1JYVA 3TYGL 4HEPA 2ZOWA 1R5VA 5DO2D 5GHWH 3H2WA 2ZSVA 5EBWB 3GBNL 1LO0H 1JTOA 3W9DA 3EGXA 4G7SB 1UJ3B 5HJBA 1JCKA 2DWEA 3FQ1A 4LAQH 4MA8L 3D2UD 3W0WB 4R8WH 4EI5A 1ZLWH 3DI2B 3AS2A 3WIHL 4ZFZB 3R1GH 4GNKB 4N2GA 4O02B 3ARZA 1NFIB 3KCPA 1OKEA 2D4FA 2DQDH 2DTML 4ZJ9A 4L3EA 3MHZA 4ZAKB 1EEZB 1PIGA 2FO8A 4YEFA 4DVBB 4JDZA 3JT0A 5LBGA 1MHCB 5I15L 3NAAL 1DVFC 3B1TA 3AQYA 3AXIA 4TSCL 1JN6A 2ERJC 3D07A 4S2SA 2B5IB 2ZWNA 1QYGH 5DWPA 4JFFB 4CN1A 4IDJL 4Y4HD 1AHKA 5JXEA 1PZAA 5ALBL 4F9PC 4PJ8C 5KS9F 2EVJA 2N59A 1MUJA 2DBLL 4XVTH 5GS2D 3C6LA 2WNKA 4O2FA 5IVZB 1MFEL 3FCTA 3D9AL 2AV1B 2FVNA 4IBZA 4U33A 5DK2A 5D5MF 3FQNA 5EN2B 5C3TA 1VEMA 4P46A 4QYAA 5I66B 3O8XB 3IFLH 1U3HC 3IDYC 4CA4A 3C6EA 1WZLA 4I9WE 3NIFE 4P5SA 1ED3A 2IAAC 4M61B 2R15A 2R1WB 4WENB 4NB7A 3JWDL 2YSSA 3WEOA 1I4FA 1I7ZB 3GXMA 4K7PL 1SY6L 3MJ9H 3QZLA 5I8OL 4QO1A 1FNEB 3LXAA 1TVDA 3B43A 3VU1A 7CGTA 2J88H 1JZEA 4PJGE 3MRQA 1ADWA 5FM8A 1ID5I 4LDOB 3GGWB 5AYTA 1XGZA 2VIRA 3NZ8A 1WWBX 3ZT5A 2P8PB 1KY7A 5GSVA 4HU8A 3PL6A 4MBRA 4CSTA 3FT4B 2CU9A 4IOSA 5FOBA 3INUH 1AR1C 5CSZB 3K3QA 2ZSWB 3QUZA 2JCCF 4Z7QB 1EEYA 3ZE0E 1IGFL 1TITA 2PXYB 2Y0SA 5DZVA 3DXAE 4LPVA 3U25A 3GLEA 2HPOA 5FO7B 3ZTNH 5IB3B 4D9QD 2FB4L 3VWKC 4M6ML 4WFEE 1S5HB 5HPMA 4M1CC 2W65A 1VAHA 3PUCA 4LSSH 5E5UB 1J87A 1D2PA 1Y7VA 3OJVC 3U36A 5DHXB 4DO6A 3KYNA 3DMMA 1HNYA 2XZZA 3PUUA 1KENH 1WFOA 1S7WB 2BVUA 3OAYK 3HUJA 5H37H 3L4XA 1T1ZB 1WT5A 1YEHH 5G2NA 4JQVC 2NLJA 3GZOA 5CD3A 5AVRB 3BFWA 4PRPD 2J4WH 1AYRA 2JKLA 4Y19D 3WJLC 3ZSTA 3KS0H 3P40A 2J8UE 1CL7H 1DYZA 1G6RL 1GY2A 4KUCF 5HYJD 2G2PA 2ZQKA 1YYCA 1X7QA 4JKPH 4QRQA 4JY5H 2FX7H 2IAND 4PV8A 4NQVB 1BSIA 1EAPA 4PG2A 4PJFF 5JA8B 1NEZG 4LRNH 5CN2A 5A2JH 3MV8B 1OSPH 1G7PB 2HKHL 3GD1C 3TZVC 5TQ2H 1WBYA 4WWPA 3EYFB 7PCYA 4NC1E 2CLRA 3U9WA 3MLTA 5FV2A 4HOXA 4OLYL 3WU1A 4B9PA 3ZK0A 3LIZH 3ILQC 2R69H 3LDBC 5EU7E 1X7SA 4UI2A 1RUKH 2X2JA 1RU9H 2IQAB 3FU7B 3MRCB 2OMYA 4OLWH 5KS9A 4A38A 1JHTB 1S78D 1QI3A 2J1KA 2WO3B 2P28B 1MNUH 1XSOA 2OTWB 2NW2A 4MA7H 5EU5A 3ABGA 3WHXB 4XP1L 3TGXA 1ZK9A 2AEWA 1OAKL 5D5MA 1SXNA 5T3XD 4BUQA 1X5JA 4HUWB 3ARUA 1E3FA 3VXUE 4DW2H 2ROXA 2R8SL 3H85A 3MOBL 3HN5A 2OXGB 1JWMA 1KLUA 3DTXB 4J8RB 4PTTB 2HMID 4O2EB 3QDME 3NACH 1F42A 1VPOH 4WUUB 3T71A 4MKTA 5IJCC 3QK0A 5DURD 4AQOA 3P2BA 5GRVL 2XTLA 1KB5H 1JVLA 4PJIF 1TJIH 3QZWG 4JW3A 2WHVA 3SDAC 3MOQA 3MUZ1 5ADPL 1NL0L 2LLLA 2EYTA 1DQQB 4D0CA 5EU6A 5ANME 5E1AB 2ATPB 1UVQB 3MBEB 1CF8H 4HIHA 3KM1A 3KR3H 4GIPD 1CTOA 2XTJB 1Z1WA 1BIHA 3HFMH 3M7FB 5HVGB 3E2HC 4D0BB 2JCCA 1W72A 2DLIA 2CRYA 3KJ6L 4B5ZA 3TV8A 1OB1B 3AUWB 3RWJA 4HJEA 5C0AE 5GGRA 1DEEB 1QSVA 3AGWA 1GCFA 1DSFL 2NQCA 2XU9A 4IEFA 4N2OA 1CO1A 4H1LB 5LGJA 1BLNB 2NZ1A 3G04B 3U7WL 2J55A 2X3CA 5C0IB 2WCGA 2N1KA 2OZ4H 1J10A 3FT3A 4AEFA 1PQZA 2WLMA 3L3OB 4LSQL 2YAFA 1P53A 1AH1A 5KJRH 4QRSB 3P4MA 4XP4H 4WI6A 3FCUB 3CCHB 4X6FB 1NGXA 1G7LB 1EGJL 1WC7A 2V5RA 2V9RA 3E8UH 2H0JA 3TBVB 2FE0A 1KEMH 2C9VA 4G80A 1IC7L 3HBGA 4OZFG 1UB6B 4GRLA 1E7UA 5TE6H 2AP2A 5D2NC 2DJMA 2OPCA 2CR3A 1KIRA 5AYUH 3CFTA 5E5RB 1NWOA 1BVZA 5KVDH 3IXTB 1ACCA 4Y4FA 4DJMA 2VDOH 3QI9C 1ND0B 4FQLL 3L95A 1UT2A 4PJFA 5SWZB 1OIOA 1U8JB 1FL3B 1MJ8H 1XHHA 4XVSL 4A2HA 1DJIA 2WAHA 3DX8B 5C07E 5E24E 2CO7B 4HJGA 2IH8A 3BVXA 3MLPA 4OZIE 4N2CA 3VXQB 1R3HB 1OPGH 4OV5B 4N9OB 2YD5A 5T3ZH 1KZQA 3C60D 3G5YA 4OAWB 1DJSA 1E4KC 3GSRA 2W9DL 4JUSA 2P5PA 2XWJB 3TA3C 4Y5YA 1IGCH 4NNYA 4HZAA 5FHBH 1JGUH 4RGMC 3EF7A 3TLRA 1OAZL 1G9NC 5IEKB 2ED9A 5LAXA 3PIQA 5KSAA 4O58H 1VEPA 1AANA 2DBJA 1YEKH 4N8VG 3S8FB 1AJ7L 2Q0ZX 5C92A 2VO5A 1I7RB 1OCZB 2ERJB 1NCDL 4OGYL 5LJYH 3QXDA 5I9QC 1KGWA 1Q4NX 4HGKC 3AZUA 4Y8DC 3DVNB 3LEVL 4UBDD 1JPTH 3TX4A 3VDBA 4K3DL 1B6DA 1N3NB 1TQBB 4LCVA 4PJ8B 4X9HA 3RIKA 1GYWA 4PJIA 1N59A 2D73A 2Z8WC 4AVIA 4EKXA 3ECQA 2VXTL 4M5TA 4X8JB 1Z9LA 3UABA 3WIFB 5I8EA 2CLZB 3SZKC 4C56D 3HVDA 4OVVA 1DFBH 4XN9A 4KGJA 4UUJA 5LNGA 4OCRL 3NJKA 4R26L 3S37L 3WY1A 3Q2CA 2VDPB 3OGOE 2BIPA 5HJDA 4PS3A 1UURA 1LEKB 4LVEA 3IDIA 4UTBA 4G82A 2I9LA 5AAMC 5E9DE 1EJ6A 5ICXB 2PW2B 4RAUA 5IWLC 1IGIL 1MCIA 3FYEB 5E95B 1F00I 3CTTA 3U0TA 1PTZA 4BK4A 4XTRC 4AYMC 4YXKH 4FXGB 4KI5D 2AI0L 2WTOA 4UZGA 1ZSHA 4NOFA 4HJUA 5KBMA 5GQBA 1JUFA 3NCFB 4IIQC 4OKVB 3VXRB 1URIA 1B2WL 1G9NH 4KQ3H 1HHJB 1ZRUA 4U1NB 2C9PA 1ZLUH 5DSCB 5KANI 1KSRA 5KSUB 1T83A 3D0VB 2XZAH 4NQDD 3EH5B 1AR1B 5FCUL 5IVXF 4JHAH 3UGXA 4ANKA 1H0DB 1KJ2H 2ICCA 4GAAA 4ZS7L 5IQ7H 1BFTA 1XR9B 4ZW7A 1HQ4A 5GISH 5ISZE 1R3KB 2CHXA 1F4WH 3QZPA 5PAZA 3C8KB 1F4HA 3EFDH 4FZEH 1QLFB 4JMNA 1U8OB 5HTSA 1PZDA 3C09C 3STZA 1D5IL 5I1IL 4ZG1A 5HY9B 5INDB 1NBVL 3U7YL 4AKOA 3MRFB 4W9JC 4PLKC 2X2HA 3SQOL 3HE7C 1FLTX 3F5WB 2XKSA 4PJ9A 3S8WA 3AMLA 3FO2B 3IGAA 4G8GB 5F96L 4Z7OF 2X4TB 1CFQA 1QEWA 5MENA 3STBA 3SCMA 1P9MA 2DQUH 2G3ZA 1MW0A 4FI8A 3V9FA 5TDNA 2IOOA 3GC3A 4M8QA 1DHKA 3HE6C 5DYOA 2NXYD 5J13C 3R4DA 4MASA 1TLKA 5E8PA 4GAGH 2FHBA 4J3TA 2APFA 2Y36L 4OI7A 3CLEH 4JY6B 1TYEB 2GITA 5CWSA 4GG6B 3CHOA 3VO0A 5DTFA 1AC6A 3NSXA 4XMLL 1WITA 3FSWA 2C3VA 1LEIB 1I9RL 1A64A 5D1QE 3V4VH 1J86A 4FQHB 2HP4A 1KZYA 3O45A 2IBZY 2UZYA 5K9JL 5J9PA 1A0QL 2JELH 3P54A 4YHOL 3UTTD 3ALXA 3ZUCA 1X5LA 2OULB 4PLJD 4PJ6A 2Y25A 3VFUA 1AI1H 3O6FB 3QORC 3S98A 5KOMC 2IAMC 2F7PA 1HXMB 4OFYA 2AQ2A 3F00A 4MXQD 1YQVH 5B8CA 3KYMB 3QDJA 4ODSH 4GW4B 4IRJB 4MD5A 2DLTA 3H9SE 3PFUA 4YUEH 4L0YA 1GKOA 1BVKB 3NIDF 4HF5L 1YMME 2QR0B 4TQIA 2DIBA 2FX9L 2K3HA 3A23A 3RTQC 2HFEA 4ZO7A 3CZJA 4F15C 4AE1A 4KHXH 3DBXB 2DQ6A 2MH4A 3CSYB 4L2LA 2ZYRA 1BZ9A 5I6OA 3DVGA 2A6KB 3OKKA 4M43L 4ZTPH 2IEPA 3WIIL 5B4MD 3QNXB 4AKPA 3TO2B 4YBLB 2SEBB 5AW6B 3U9PH 2YAQA 2XQBL 4B96A 4NSKA 2C3GA 2KERA 3QRGH 4PP2A 3UG4A 2B08A 1G6RB 3K5RA 1DZ0A 4TUKH 4A67A 1S9YB 4JCWA 2XZCH 3S36L 2UWEB 3UGUA 2EUVA 2FECI 3SDAB 4W68A 1HYSC 1BEXA 2BNQD 2J25A 5T5FL 2X09A 2WB1A 3X1EA 2YD0A 4X5RA 1KB9J 4ZMXA 5I30H 5LN8A 1XAUA 4N9GA 2FWSA 2NRDA 2PTUA 4DPCX 4ZZKA 3DOIA 3F04A 4Y1SA 3JZ7A 5IVXA 1W0VB 3L2LA 3BQUD 2HT2C 3H3BC 4POZC 1VCBC 1PY9A 5K1NA 2DQTL 5DRZB 2O61A 5A7EA 5BZWA 4WW2C 5F44A 2HVKB 2VDNL 4A39A 3ARYA 2W07B 3ML9A 5AVQB 1RK0B 4MSWA 3H0TB 1QSFA 5EEVA 1IM9B 3H3KA 5TF1H 5E9AA 1Q1JH 2BSRB 4P5TA 4I0PA 2QSTA 4HAFA 4W9EC 4WNJA 2HJKA 2X4NA 2AITA 4JDVA 4JFWA 1OP9A 4KQ0A 2PYFB 1AG6A 2C3WA 1GY1A 3O3DA 5AVZB 3O3UN 3RL1B 2Z65C 1SXBA 2WP3T 1K3ZA 4FMVA 5KTEH 4LEXH 2GK0B 3FQUB 4NM8H 4Z7UE 4ZO8A 3VVWA 4Q2ZA 1BQUA 3VMPA 4J12A 2XBZA 4HYTB 3R7QA 2ALWA 3TH3T 2JTYA 4JZJC 4JQIH 1KN4H 1X5MA 2HT3C 4HZLA 3IFOB 1NGZA 1T03L 2VLRA 4AL8C 3FMGH 1R9FA 4FRWA 3VXPA 3B2PA 2NNAA 4GBXC 4TPRL 5D70L 4HUCA 2VJXA 2VM3A 1QI4A 4DP8X 2VQ1B 4Q89A 2MKWA 3OAYH 1ZT7A 4UNTA 4MDJA 3QI9B 2E7LA 1M7IA 4M4PA 4M3JA 1S9XA 1F1AA 4UQDA 1Y0LB 4TULH 3SBPA 3RWEB 2WINB 3PABB 1T5WB 4ZFGH 5J6GA 3LQZB 1Z32X 5DQ9A 3RBGA 1BJ8A 3JZYA 2CE6A 4I89A 1HHHB 4NFCA 4A6YH 2XQ0A 1XF3B 3TBTA 3G5VA 5C2BH 2Q8AL 4P5RA 4PRDB 4JZOB 1NGYA 2Z4QA 3BC9A 4G8EA 3SBWA 3WN5A 5IW1A 4LSPL 4G7YL 3DLQR 3TA3B 1RUMH 3W0WE 4YDKH 4Z7IA 3MRGA 4KVCL 4X4YB 2Y7SA 5I1DA 4RGMB 3ZMNA 1L0YA 1X4XA 4NP9A 3CSFA 2A77L 4FA7B 4N4YB 4G8IA 3FRPB 1ZT1A 2VTFA 1FP5A 1UKTA 1IGTB 3ROOB 5E6ID 4BRJA 4ACTA 4F7CB 1P6FA 5E4OA 1TTAA 3SKJL 3CC5A 1OTTD 3T8MA 2WQAA 3D30A 1VA9A 4X4ZA 3T0DA 4N8PA 1YEWA 4J3XA 2ALAA 5HI4C 5I9QB 4JFFE 4Z7WF 1GGIH 3MRHA 3PWNA 2QPEB 4I48B 3SE3C 1WAAF 2F1EA 3Q6FB 5FYLD 5IBUB 3WEBA 4AL8H 3IETB 1M7XA 4P23C 1DDHA 1FNHA 5KJ7E 4WJKB 3QUYA 5DHVH 1XH3A 5HHNB 5E2UH 2X4SB 3QBTB 1CLZL 4L8DB 4UT7H 4LPUA 2D3JA 3FZUC 2FIKA 4WSJA 2P9RA 2X42A 3MCLL 1PAZA 2CALA 3V4PH 4BSVA 3GNMH 2H3XC 2WZ5A 2WO2B 2XRAH 2WSKA 1NC4D 4KKBC 4H4NA 5DUPH 3WUWG 4DKEL 4FERA 5KEZA 3AW5A 1SMAA 2P80A 1AO7A 1VADB 1QPPA 2JKIS 1Z2KA 2A3TA 1BXUA 2AGJL 1A65A 4G6ML 5EA0L 2MIZA 1TZIA 1CIDA 5CNHA 4RISH 3GMLB 4BH7A 1HJBC 1BMWA 3TN0D 1D7BA 2CDFB 4LQFH 1R24B 2YPVA 3FS9A 4NZJA 2C5DC 1MCCA 1G5GA 4HH9B 1B88A 1THCA 3JQOB 4X6EA 1CFSB 1SHSA 5AVYB 4PJCF 4LARH 3WN6A 1G43A 1BG1A 4ZUVA 1MIEH 1XX9C 2EEAA 1IBZA 2AJVL 4PWFA 3ZKXC 2IDSA 5I82A 1X3DA 1VB9A 3P30L 1Z5LA 1FORH 1VGEL 1Z9NA 4QPEA 4P2CG 4L8SC 1MRDL 3OSKA 4KOBA 1U2HA 5FFLA 3BUQA 3DX9A 2C1OA 3ZGIA 5ESAA 4B9IA 5I5JA 1N0LB 4XN1A 5CINL 3LN5B 3HE7B 3MLWH 5D7LD 5JR1H 1ZHKB 3FTUA 3GSNH 3GS7A 1FNSL 4TVPH 2BSED 4Y4KB 3Q6GH 3VDCA 3WJMA 4D0DA 1RZGA 1XF1A 1RZFH 3KNBB 3HC4L 1BAGA 2WLIB 3HG5A 4ZMVA 3KLHC 1MFVA 3D39B 1KT2B 2ZOTA 4HC1A 3VNZA 4UTAH 1CLVA 2VE6A 2A83B 3NCJL 4JO2L 4IK7A 3HPLA 2GJ6E 4P5MB 4YFDB 1XB8A 1D5XA 5FGSA 1M1XB 1FZJA 4LLYB 4V2BA 2CO6B 2VJ8A 2YRPA 3DI3B 4OR1A 4L1SA 1QRND 1MDTA 1YNTB 3IDMA 1E9QB 1YECH 3FJTA 3QXVA 3RFRA 3SDDB 1CD9B 1QPXA 4KY1L 2BOCA 3MV7A 2VUOA 4YZFE 1A9BB 5EU3B 1NM9A 3EH3B 1MHEB 3C75A 4PI2A 4PJAB 3IU4H 1JF1B 2CUIA 3HG1D 4F7MA 4NWTH 5IHUL 3Q3GA 3L5XH 3MV8E 3D50A 5AW2B 3N85L 2B0SH 2YPKA 3ARDC 2HTKC 2B59B 3ARGA 3HZ3A 3O4LA 3DGGA 4Y2OB 4W9DC 4XXDB 3WL9A 3DROB 3PGCA 1EIBA 4DPAX 2XXGA 4HD9A 3F7QA 3ZTDC 5HVHC 3MUJA 3QORB 3V0GA 2CKNA 2IAMB 3FRUA 4Z7WA 3FOLB 5EOQH 3EUDA 2QMKA 1EJ8A 1Y18A 1WAAA 3QR1A 4NJ9L 4FC3E 1AKJA 1J0IA 1YYML 1NA8A 3HG4A 1SDYA 3CIAA 4Z0BL 7FABL 4ZTOH 2EUWA 1PG7H 2PNDA 4FHKA 3OAUL 2AVFA 2FYYB 3GSUB 4GB9A 4MMXA 1MCBA 1CLYL 2QADD 4NX0A 4JRLA 4Y2LA 3KH4A 4ZX3A 1DVXA 4X6DB 2RA1A 1LTXA 3RTQB 4L5FH 1KCBA 3JYCA 4JJOA 4N2HA 5LBSA 4F15B 3IRZA 1E5BA 1ZSDB 2MQCA 2Z91A 3B3IB 5GGVL 4EEEA 1MRCL 2IG2L 4PS8A 4ALAC 1TKWB 2VOTA 3P0YH 1A66A 2XG5A 5HYIA 4K2UH 2ZX5A 1AP2B 2GC7C 1QAWA 2OFQA 1N10A 3EH1A 4NDMA 1HU8A 1DFXA 1MWAA 5DJDB 4WUUE 5AVWB 4BQBA 2F58L 4HPOH 5C2UB 3G08B 4WFFE 1C1EL 1ETZB 2GHZA 2NY4D 4XNMB 3SYOA 2R9HC 4YGVB 1EHNA 3K91A 5AVXB 5AOJA 3D52A 4XXWC 2RBLA 5GGRY 3IRCA 2EO1A 3K2IA 2VXUH 2H3NA 2NTFA 3IBEA 3MRRA 5SWQA 1MCOL 1CD8A 2NXZD 1KYUA 3EYVB 2XTJE 4PJCA 3Q9QA 3UZVA 3SQBA 4PLNC 4DN4H 4G2AA 2Y1ZA 3FO9A 3CBJB 2D03L 5CKGA 1HIMH 1X7TA 3BEWA 4A6YB 4FS0A 3UDWC 3ARBC 4Q14A 4YQXH 5B38A 4I9WD 3RDTC 5BZXA 3BHBB 3UYPA 3H42H 2GW5A 4RFOL 1ZV5A 5E94A 1MEXL 1FGVH 4PB0L 4R3SA 1NWPA 3WFHA 2H1PH 3UZQA 3WEMA 1GH7A 3MV9B 5DS8A 4H8HA 3P3RA 4LLDA 5AOIA 2XSKA 1BF8A 1NCBH 1NC2B 4AG4L 2HFGH 3PDOA 5DQJB 4R83A 4NHCH 3UC0H 1K2DB 2GTZA 1F02I 5C08A 3CFUA 1LVEA 4Y5XB 1J9QA 1ASOA 4KK9C 5F3BA 2ITDB 3ARSA 4MJHA 4ALAH 1SJHA 3B1UA 4HQQH 2DM3A 3AB0B 5BVJA 4LCWE 1JZIA 2OBGA 2WXMA 3GPEA 4K71C 1DQIA 1PG7W 4OD1L 1AR2A 5C0CB 3RY4A 3N0AA 4JFYB 3C9NB 2NY2C 4GW1A 2JJVA 5SWZE 4WFED 1G7QB 2GTQA 2K7QA 5EBGA 5E8OB 4B7IA 2R7EB 4Z3HA 4OGZA 5L0QB 4JG1H 2DKSA 2GUOA 4LLUA 1TEFA 1QKZL 3AG1B 2BMKA 1DQDL 5ELIA 5I1KL 3D06A 4Z7AA 3VCLA 3ILEA 5DGRA 4XO9A 5DS2A 1P4BH 4MJID 3OWRA 3QEUA 1LE5B 3WFBL 3CX5J 2W9LA 4FNTA 1TQWA 4HBCH 2YARA 2ZOKB 4KOCA 4WLCA 3TBSB 3VUAA 4RRPG 1HE8A 3VWJC 2VDNB 4JFDA 4WWKA 5FS5A 5JO5A 1J12A 2JB6A 2Y4SA 3MNMA 2VABB 4O00A 4GXVH 1NFDF 1NLDH 2AFNA 2NUPA 3RVTD 3RWHA 4EDXB 4FP8H 2BCKA 4L9LB 4YAQA 4YDIH 3DK0A 3ARFD 4L4VA 4UIKL 1RP9A 2Q7YB 1BBDH 3MA7B 5IT2H 5GRUH 4YHMH 4D7BA 3BIKA 3IU3B 1PEWA 4BXVA 5C7XL 3AT8A 3PJSA 3EADA 4FFTA 5HHPB 4RGNC 1UGNA 2VLME 3PHQA 4X6BB 3QHZH 2QGCA 1CD0A 1M05A 5D9SA 2DMGA 4JKKA 5C6TH 5CUSH 4K94C 1CXHA 2Q9OA 1DJGA 4P23B 3IS0X 1PS3A 3LN4A 1PJ9A 2XBTA 2YO3A 3LH2L 3N3EA 2Y6SC 5I1LA 1JAEA 4F24A 4A63A 3C08H 4NO2A 3Q2LA 4LPYA 2K4WA 4K23H 4MCYB 1RK1B 3N43F 1PFCA 4WI5A 4AVHA 3PGDA 1ZT4A 5E56A 2EYSA 2RD0A 3L3IB 3ESVF 4CN6A 2H6PA 5HVWA 2F53B 1T2QH 3CDGB 1PD0A 1Q94A 3VXUD 3TH4T 1LEGA 2K6WA 3L81A 4PJ5A 4UAHA 5LDSA 3MLRL 1I9IH 3QDMD 2WWMD 2IWFA 2W9EL 25C8H 4NZRH 2WYIA 2E27H 4KK6C 1M2VB 4ZDHB 5CR1A 3VXRE 4WHTB 4X9FA 3U2SA 1DUYA 4XAWH 2WAQA 4LSTL 4PY8I 4V2CB 1Y1DA 1DQLH 2YKLL 5D7IF 4ZXBC 4R84A 3GMNB 1B0GA 1YEIH 3ECWA 3A21A 2I5YL 4JREC 4QHLA 3REVB 3P11L 3LJ3A 3QXAA 5FUZH 2D31B 1NMBL 4B53A 4ODUA 1SHWA 3NZSA 1UWGL 2AC0A 1PIFA 1Q9OB 1ZVYA 1T89A 4QY8A 3TYFB 2EE6A 2K78A 1ZWIB 5J3HC 4F1SA 4L8SB 4ZX5A 5CZRA 2DH3A 4K94H 2P7TB 5MEPA 5E6ZA 2IBBA 3U4EB 5H35A 4P4KA 3U30C 1EO5A 4KNQA 2FT6A 5IBTL 5C0AD 3P9MB 3D87B 2CGYA 3S88H 3LQAC 2EXWC 4G8GE 4JM4H 1EDYA 1Q0YH 5AVSB 4F3FA 1FHNA 2JKRM 3QHTC 3WS6C 3OF6A 4XNQA 1CT8A 4UDTB 4U1MB 1HINH 3CFDA 5MEOB 1KPRB 1LD9A 3MPCA 4NPYA 2M1KA 1XFPA 3PAYA 3UACA 4ES8A 1HWHB 1OHZA 4Z8FL 3LZOA 3WFBH 1F0LA 3FKUS 2CIKA 4GG6E 4HA1A 1JTPA 1CGVA 2Y06H 4QAMB 5IQNA 4NO0D 3P0GB 2ITEA 4OLVH 1X5KA 1N2RB 1NFDA 5IMOA 4GKSA 1E4XI 3EH2A 1USZA 2Y7LA 3K6OA 4RFNC 1DCLA 4HDIB 5FM4A 1KTRL 1S7RB 3RZCD 3VH8B 4EN2A 3U48A 2HRPL 4JKMA 3L2NA 5EOCH 2PR4L 4YHKL 1HL9A 3MA9H 5JQHC 2YAPA 4OI9A 3TTYA 1U3ZA 4HIEB 4WSKA 5HVHB 3VFWA 4UOW1 1D9KC 4RZCA 5C07D 5E8EA 3UBXB 3JV4A 1UCBL 3RRQA 3LZFH 2UZXA 2W0LA 3GT6A 1Q8MA 1JGVL 3RGHA 1FNLA 3HI6H 4KZ0A 1A6ZB 3S7GA 4KVPA 4UCFA 5CBAB 1NUGA 3MLSH 3GXNA 4XGZA 1JYNA 1SOQA 1ZLSL 2DMKA 4GQQA 3DIFA 4C54A 1L9MA 4Y2DD 3MBWA 4EE2A 3LQAH 2C9AA 2VZVA 1B3IA 4G9FB 1T4KA 4UOZA 4OUUB 3RX5A 5EDSA 4ONGL 4WHDA 1S7SA 5I5IA 2ARJQ 4XCEA 5AZ2H 1V7NL 5DJ0B 1U36A 3GBLA 5FWRA 5FYJL 3T2PA 3B8SA 2XOTA 3BUBA 3S4SB 3QGVA 4LRIA 1MZYA 2QTEA 2L4OA 1QG3A 4MDIA 4OJFL 3H4FA 5JHLA 3L9RB 2JF1A 1HI6B 2UWEE 4OLXH 5HYQB 3B37A 5E00B 1ZGLM 3A4EA 4ISVA 2A1WH 2WQSA 3IJYB 3TCXA 1GGCL 1TTRA 4HWEL 5D7IA 4J8QA 3BAJA 1NIDA 2X89A 1CN4A 4F5CA 1INEL 3GK8H 2GSIB 2FEDC 3FU5A 4PHXA 4DO4A 1G0YR 1PZUB 3R4RA 2Y72A 4LIQL 3RWGA 1UM6H 2A74B 4ETQA 3QWNA 3EO0A 3ZTEA 4M7LT 2X44D 4N8CL 4APQC 4QXTB 4S1RH 1MVUB 1EDQA 5BRQA 1RLWA 3G6DH 4AQ8C 2YJQA 3TIDB 3LMJL 5I8CB 3CQPA 5HGDA 3F05A 1F3DJ 4LHUB 1OAXH 3DV4B 1IAKB 2WYTA 3KWVA 4TM9A 5A43C 4R4FL 4FXKA 1KELL 1I8MA 1M57B 1IFHL 2X9XA 1SLVA 3CMOH 4J7RA 2BHYA 1CS6A 2P42B 2YEZB 4FZ8L 3BSZH 3MLUH 4K71B 5AW9B 2XTSA 4MLSA 1VGKB 2L7QA 2NNXA 3TT3H 1BQLH 5ISZD 2VITB 4BCYA 3LQMA 2NY2B 2Y1VA 3HRPA 5GRVK 5BVPL 2OP4H 3CZFB 1HKLH 3AM8C 3HAEH 3U6XS 3B56A 4MMZA 4APXA 4DGIL 5FAAA 2NY1C 3HMWL 1A7NH 1WWAX 4PG9A 4DK6A 4QJ5B 1KNOA 3P3SA 4JAMB 2O5ZH 1DVSA 3RNKB 1ID2A 3X17A 3QS3A 1WRFA 1DQMH 3MYJA 2H45A 4LL4A 3VE0A 4JM2F 5AOKA 1FZOB 2E75C 4PJBF 2KMWA 1RZKC 1YAIA 3BKYL 4QWWC 1RJZA 2DQEL 2QPFA 4AM0Q 3B2UD 1I1AC 3RTLA 3V5KA 2EDFA 5D1QD 2GEQA 4AJ0A 3OMNB 2EIMB 4JQXC 3JWNH 4BSWB 2ROYA 4EOWH 2DWDA 2R0LL 3K6NA 2DQGL 5G5DA 1TIUA 2FBJL 4GMSH 1U8NB 5JNYB 1PX3A 4M1DL 2R4RL 3QVAA 5L2KB 1WBZB 4KROB 3A22A 1FNAA 4BH8A 2ZX6A 2VDRH 4OGAC 4U0RC 5I1JL 4IRSC 3QIUD 3KW8A 4FD0A 1RSFA 1RHHA 1T5XA 3DVIA 3O41A 4H1LG 4ZMNA 3TF7C 4Q9BA 3T6VA 3GZPA 1IIIA 3H9SD 1AHWC 1SYVA 3QAZC 1R0AH 1T5KA 4U1IB 4YNYB 1DVTA 4L29B 6FABL 3NJMA 2O1AA 4EBQH 1YMMD 3NBNA 3OLEA 3QWOB 3LXBA 3E6FB 4BGDA 4CC4C 3EYUL 3KGRA 1EPFA 3VJ6A 3L45A 1D7CA 2LHAA 4FHJA 5JIPA 2R83A 1L7TL 1KN2H 2G60L 3QQ9D 4KRNA 3CN0A 2LAAA 1W91A 1O5PA 3BX7C 3OPZH 1XGTA 1CUOA 4J6RH 1RI8A 1DBKL 2XN9A 3HCVA 1FC2D 4U7SA 5D72H 2KLTA 3U1SL 1RZKH 1S9WA 3SKOB 1V55B 4FTVB 1LL1A 4KTDH 3L1EA 4XVUC 4H8UA 1DLFL 2J7LA 2YGQA 2LT9A 3B3BA 5DJ2A 6PAZA 5FK9A 3BH9A 2IV9A 3JTSB 2DM7A 3X1FA 2FWOB 3I6KA 1SGKA 5CR8A 4TSBL 3BJLA 4XNBA 3TBWA 1IJ9A 1TTFA 1AIFA 4UU9B 3WLWC 1QQDA 4HS3B 2WQUA 2PO6C 2K1MA 5J6HA 2YLKA 4B6ZA 1TNNA 2BHZA 3F7RA 2DLFL 3MU3A 4H0GA 5IIEB 2BOBA 4EN3B 5IMLA 3S96A 1A6TB 1EVTC 3KW7A 5I1GL 2VISA 2UYLB 2OR9L 2BVOA 1HDMA 1V05A 1S7UB 5CCKL 1AQ8A 3D39E 4TSAH 3LKSB 1SLWA 4ZMLA 1EANA 1NAKL 4TUJB 3QZNA 2IALB 2WSPA 1EFXA 3FOMB 3F7VA 5DQDH 5KWYC 2I24N 3OKEA 1YEEL 5EZLA 5KBLA 1RAMA 2WZ6A 2V17L 5C1MB 3RI5K 3WKQA 4EI5C 5GGUA 2R29A 4NN7B 1RIVH 4JM2A 4PJBA 4PJAE 3GBEA 3KPLA 2HT4D 3T04D 1MFMA 3IJHB 2MPAH 5JDJA 4RFNB 5DJZA 4KUZH 2CLVA 5GRWA 5H37G 4ZFQA 5CXPA 2CG9X 1HEZA 2B1OA 4L3FA 3QA3B 4MWFB 2JLPA 4E9VA 1UT9A 3T6QC 4HIXL 3DSNB 1IBHA 5JXEC 2AKRB 2AABL 1GZQB 2BZCA 3GSXA 4P9HL 1XSJA 4CMHB 9CGTA 2WY3B 2CIIB 2KH2B 4O4YL 3C6LC 3DPDA 4E9SA 5FPIA 2VN5A 2CHZA 3QZMA 2COQA 5E8DL 1CGSH 1QASA 3CZEA 5AVUB 5GGTH 1JFQH 3L9EA 5HGBA 4MB1A 4M7JL 4X6DE 3QJSB 4Q9CA 2D0GA 3W0WD 5DEGA 2VWEE 5D71H 5JXAL 4BM7A 1EHKB 2LR4A 5HYFA 3HS0B 5BZDB 3DUSA 4HKXB 1PKQA 4ZMPA 3W5MA 1QBBA 1XCXA 3K71B 1FRGL 4LDLB 3LSOA 4XE5B 2HFFA 1KF9B 2QGBA 4M1GH 5TQ0H 1UB5B 3P77B 4XWGL 3RQ3A 2I85A 4ZW3A 2DYSB 3CU1A 3FHQA 5IR1B 2OL3A 5BV7C 1UACL 4JFFD 2VLJB 1Y6MR 3CFIC 4M56A 1RERA 4PRHD 4WUKL 5DZ9A 5KN5B 3MUHL 2KDGA 4LSRL 1W6WA 2QHRH 3L7FB 3PL6C 1QNIA 3V9EA 1SDDB 3HAEB 2CO4A 5T1LA 2PW1A 5BQ7A 3O6LL 3CQFA 3MRMA 4DERA 2CBTA 2DQMA 1BD2B 2Z7UA 1PDKB 3QCUL 2P5WA 3QUZC 3EOBB 4FFZA 4DZ8B 2OS7A 2OX5A 2FWLB 3FHEA 4WNQA 4E41B 3SDXF 1MCWW 5H94A 2VN7A 4HS8H 3GRWH 1QFWI 1FO0A 1U8MB 3DJZA 3KPPA 3O8XD 1H3WM 3K8LA 4K3JL 2NT0A 1BP3B 1CU4H 3UIYA 4AIOA 4GQZA 2AEQH 1KC5L 4JANA 4P9HC 1UG9A 2C9RA 3H7BB 3IJ9A 3D0LB 4APQB 3BP6B 4XCFL 3RKPA 1FSKC 3DMMC 2HH0L 3ARQA 3MV9E 2K8QA 4OFIA 5D55A 4QXVA 4H7VA 2QVIA 3HPJA 3T8VA 3F62A 3LOWA 2ZX9A 5ENWA 4AYFB 3S35L 3AWEA 1WT5C 4GRWB 4DN3H 2X9ZA 3VFOB 2EILB 3WNIA 3ZKMD 1H5BA 1F2XK 5JHDA 4U3HA 3BAYA 1A6AB 2C4FT 2B15A 1JVOA 1NAML 4Z0XB 4UYPA 1SN5A 1JK9A 3CZUB 5JZ7C 4X7FC 1F3JB 2DQFB 2ARJB 3CMGA 4YC2B 4AQZA 3TOPA 3DIVA 5D1ZB 1UD3A 1R3IH 5C0CE 4PH8A 5BV7H 2PXYD 4PG2C 4ZS6D 4JFEB 1K8DB 4QRTA 5HDQL 4NN5B 1NIEA 2WNGA 4YDLC 4LVHB 1GHFL 4HJJL 5SWSB 2O5XL 1E5YA 3BUIA 3OAZK 4P2QA 1JPGB 3INOA 4KJWC 5IMKA 1D5MB 2NY1B 5F71A 3X13B 1G1YA 2AERT 1SN0A 3GTVA 2YD8A 1W72L 1JHLL 1LGVA 1INDH 5CU9A 1HL8A 3M45A 2JJWA 3QJHA 3REWA