3CBKB

Chagasin-cathepsin b
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
110
structure length
110
Chain Sequence
MSHKVTKAHNGATLTVAVGELVEIQLPSNPTTGFAWYFEGGTKESPNESMFTVENKYFPPDSKLLGAGGTEHFHVTVKAAGTHAVNLTYMRPWTGPSHDSERFTVYLKAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cathepsin B
publication title Displacement of the occluding loop by the parasite protein, chagasin, results in efficient inhibition of human cathepsin B.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 22
structure length 110
sequence length 110
ec nomenclature
pdb deposition date 2008-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF09394 Inhibitor_I42 Chagasin family peptidase inhibitor I42
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2020 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3cbkB00
3E1ZA 2NNRA 2NQDA 2OULB 2H7WA 2WGNB 2FO8A 2C34A 3CBKB 3M88A 3PNRB 3M86A 3CBJB
chains in the Genus database with same CATH superfamily
4XAWL 1DL7L 2G2NA 1DVYA 2TSAA 2GJ6D 2N0MA 1VACA 3HJ0A 5CSGA 2BWDA 4NP9A 1FVCA 2A38A 3MTXA 2CPCA 2XWBA 1AHWB 4OLEA 4ONGH 4IBZA 1BEYH 4ONOA 1BF8A 4WJKB 2JKSA 2MPAL 3ZX1A 1ZD6A 3KR3L 4UCFA 5C70A 3C60C 4G70B 3ARDB 4Z7WA 1DDTA 1JF1A 1O5PA 5HJDA 4BH8A 5IQ9B 3RVTD 2BMKB 4N85A 1KBWA 2CA3A 5E99L 5DA4A 4M43H 1HYSC 1PMYA 2N3JA 5HHVH 2JIXA 4X8CA 5AUMB 5CD3A 2BS9A 2XN9B 3GJEA 3GRGA 1M9WA 1BQKA 1MSPA 3SO5A 3TIDA 4OCRL 4R2GB 2WMPB 4R4NC 5EU6A 4U7MA 4ZBJA 2OMBA 4DO4A 3GINA 4PJGB 1MAMH 3CXHJ 1A7NL 4PJFB 3B2DC 1MJ8L 1T04A 4MBOA 4MS8D 4QRUA 3E3QE 2BOCB 3OXRB 4OFYD 4A2LA 3TT1L 1BIHA 3BGAA 3RWGA 4KH2A 4LBEB 2WN2A 2QMKA 4IJTA 4Z7VB 4BFNA 2ZQKA 1W16A 2JTDA 1U8KB 4P23D 3PL6B 2NY3D 4ENZA 3BVNA 3JV4B 4X98B 3V7AG 3P4NB 5FR3A 3K2UH 2H6OA 3C5JA 1JZ6A 1IBDA 1SPDA 4GMTL 2BSRB 4R0LA 5IMMB 3I2CL 5LCVH 1JV2A 2EZ0C 3NYKA 1IQDB 1V7NH 2WQWA 1UB5B 5E5MB 1DJGA 4XB7A 1URZA 3RVVD 3IJYB 3LD8C 1KXTB 1YUKB 4JFQA 3VGDA 2LAAA 2TRHA 3CN0A 1W2KT 2XACC 1LK3L 5TFSL 5CR8A 4WU5A 5JXAH 4FC3E 4NFBA 2OL3A 3VD2A 1CCZA 5H37H 3U9UB 3ZT6A 3ET9F 1ZLSL 4KPHH 5EC1A 1X4ZA 2DYSB 1P5UB 2XWJB 4PREA 5DRWB 3TA4D 5IQ9A 3QUYC 4GG6B 1OCOB 4BIKA 5ALBH 4M7LL 2XYBA 1IJ9A 1GGBL 3NCBB 4EN3C 4X9GA 4Z95H 2CSPA 3CUPB 4WI8A 5DMYA 2EP6A 1OCCB 3K2IA 1X9QA 4Y9CA 1X7SA 3JWDC 4NHCH 1QBML 3B56A 5I5JA 3RZCD 3BIAX 1U4EA 4OZHB 3SDAD 3ZUCA 4CSTA 2JKIS 1HK6A 3U2SB 2X87A 1EUTA 4P2RB 2Q5BA 5SWZB 4LOVA 2EDWA 3D87B 5JHDE 4JMXA 2B1AL 4DKFH 2XG4A 3GSXB 4EDXB 1XBRA 1O7VA 5F1IB 1ZSDA 2LHAA 4ZPTA 4LBEA 2MCG1 4OZFB 3QFDB 3QRGL 3Q44A 2WP3O 2FQGA 3O2DA 4GQPH 4NO5A 3ULVE 2BHYA 2E9IA 4PY7A 3SE4A 4LLVA 1YEEL 4IBQA 4A2MA 4FCHA 1G9MH 1RZIB 2NQDA 1KEGH 3PGDB 5IMMA 3BH4A 4DKEL 4PVMA 2OMYB 4MNHB 5E5MA 1NOLA 1CYWA 5ECGA 1L9TA 3RU8H 3CZJA 2DYPD 2PP7A 1RULL 2NXYD 3VFWA 2GVYA 4ZMXA 3IJYA 1FLRL 3PQYA 1KXTA 4NBZB 2VLRB 4DPRA 5FKPB 3T8VA 5L8KB 3KPTA 2VDLH 4UILL 3UJTL 4APQD 1HXMA 3GB7A 3U9UA 4TSBL 3G6DL 5DVNA 3VXTB 1K3IA 3H9SD 3WFCH 3V0GA 3Q01A 1N68A 5T3XD 1JPST 4GG6A 4OV5B 2N1TE 3ELAT 2L8AA 4G59C 1YHPA 3J27A 3EO1A 2W9DH 3QUZA 3TA3C 1TCRA 4WK2B 3CUPA 4U1KB 2Z7WA 1GHFL 3SKMB 4AQEB 3DOIA 1WHOA 2X4TA 4OJDH 4I3RL 4X5WB 3WNJA 5KJ7E 5A6MA 5IHBA 1ET7A 4M93C 1OALA 1I8MB 1Q0YL 3NCYS 1QASA 3PHSA 1JL8A 4NI6A 1WWAX 4OGAD 1T4WA 1YEDB 4AYMC 2J1YA 4J3SA 1JPSH 4H25B 1HL4A 4HPOH 1BD2E 3SPVB 3CCHB 3PUCA 1XGUB 1MJUL 3H9HB 5MEND 3D08A 1JPTL 4U1MA 2W59A 4OZFA 4NKIL 2YAOA 3QFDA 5E9NA 1RZ8A 1WS8A 1IAIL 2FSDA 4NUJA 1PZBA 1ZT1B 3APDA 3EZJB 4AH2A 3VFMB 1I3RB 1I9JL 1ZPLA 2QR0B 3F6LA 3L3IB 3AG3B 3P3UA 4PRIA 4TRPL 2BRRL 3D0VA 1C5DB 3QR0A 2R83A 1RURH 4IRSD 4MB1A 4GG6F 1GZHA 3VU1A 4M6NL 1TJXA 3EFDH 1C7SA 4HUVB 2GY5A 3CZLA 1NEUA 3QDMA 3FPXA 1UWEH 3GSVB 2JK5B 5C0BA 4A66A 2VLRA 3EAKA 1GCYA 1SXNA 2KI6A 1NJ9B 3AT9A 4GKZA 4N25A 3NCEB 1C8PA 2AKRA 3BC9A 4FTVE 4GQZA 3P11H 2PABA 1T1WB 3NFSH 4M61B 1S3KH 4QCIB 4X2UA 1B90A 4GKNA 5JW4Q 3NJGA 4QOKB 3VXTA 2IGTA 4S1QL 2XQYG 3K4DA 4FABL 3LQAC 2WZAA 3IE4A 1KBPA 4PV9B 3VM5A 1YEFL 3H8NA 3KYMA 4DW2L 3FN0H 3E6FA 3RYMA 3VWJD 3SGKA 2DDQL 1EX0A 1JDAA 2R4SL 4ILDA 3WKYA 5EIVA 4A6YH 2CO7B 1ZHNA 2HAZA 2XZQH 3EGXA 3OKOB 4PIBA 3T0WA 3ZDXF 4TVPL 3EBIA 3HZYA 4UWQB 3LEXA 4Z7QE 1IE4A 5TF1H 1I8MA 1R0AL 2J4WL 5FDWA 1LMKA 2F54D 1D6VL 5MI0C 3S8GB 4YHKL 5IVNA 2GSIB 2R23A 4RNRA 4PQXA 4OGZA 1H8SA 1IFGA 3SY6A 5JW5A 4JDTH 2FYYB 3CCHA 1H19A 1XGUA 3SE3C 3H9HA 5DZAA 2C4FU 4A67A 5I15H 1FJ1A 3THML 1MF2L 2QLYA 2ENSA 5EBWB 2EINB 3HRZA 1ZA3B 4RMVA 4QT5B 3O6FB 1ZT1A 3GSNL 5IJDC 4EI5A 4Z8FL 2QR0A 4F2FA 1XXDC 4XXWA 4ORGA 2R1YB 4PB9L 5FFGA 2EKSB 3CXDL 1HQ4A 3QDJA 3Q43A 1JXJA 3MLZL 4XO5A 2GEQA 3QXWA 1JTOA 3LKPA 4HX1B 1MWAA 4JO8A 3T4YB 1B4RA 4HUVA 2FO1A 4DN3L 3PJSB 3II3A 3RL1B 3FTGB 3NRPA 3IWUA 2ZSVB 3H4HA 3TVMB 1AGBB 3V9CA 1WUZA 1Z9OA 2DQIL 3NSCA 1T1WA 1DVFB 4HVBA 2GI0A 2VXSH 3BP7A 2YD7A 1L7IL 3OAYH 1E40A 3GSNB 3DYPA 2WBJB 1G7LB 2QGEA 3D3VE 3KYKH 3MLSL 4GSQA 1CYXA 1IV8A 4A39A 2Y1ZA 1XQ4A 2Y5QA 2Z0BA 2ESVB 3O4LA 4EOWL 4M7JH 2IAND 3HNTH 3FTXA 3P4OB 1MW1A 4MLIA 4MJ2A 3VSTA 2VW6A 3FFDA 2VJ8A 1A6UL 4EZJA 4JFPA 1WD8A 1P9MA 3C5ZB 4NQVB 5C0AE 4OZGB 3VSUA 5BS0E 2B9BA 4CNIA 5FFOA 2D8KA 4OD3L 3MN8A 5H2BB 5I17B 1IKFH 2AK4E 5BQ7B 4JY4A 4JM4H 4BFIA 5IHZA 3NIGE 3GSRB 5C3LD 4RSYA 4WO4C 5C1MB 5L88H 1R3HB 4LVNB 4OCSH 4P5TD 3TPUB 1Q0EA 1UA3A 3NJNA 4Q9BA 4BZ1H 2BCKB 2XPZA 2HVBA 2Y9RT 4AYSA 4LLAA 4L4VA 4YSPA 4QT5A 4QLWA 2PPCA 4HGWA 1QYGH 2W8CA 2J8UB 4IS6B 4GQ9H 4OLUH 4NM8L 3LEVL 4N0FB 2AJVL 1RUQL 2GUYA 4HMEA 2YPLA 4KKCD 5TDNA 5I19H 1E5YA 4DTGH 1QNIA 4JW3A 3WXVL 3SE8L 2EKSA 4EBQL 5J6HB 2EDOA 2NUTA 4G1EB 1OTSC 1HC1A 6TAAA 3B8SA 3KE0A 1G7QA 2XWZA 3MV9E 3VGAB 1AGCB 1P6WA 1IEAA 3T4YA 3FF7A 1HI6A 1DO5A 4KITB 1L9OA 5M7QA 4PS4H 1MCHA 2RCSH 4K9EL 4F7PB 4EE2A 4PI0A 3DMMB 1XR8B 2CK2A 1YN7B 2K9UA 2XSKA 3BPNB 3DNKA 3GSNA 4GAFB 3W2DH 5LQBH 3IXAB 3KPRA 2OM5A 4HUXB 4Z7OF 2B77A 2OR7A 1JZGA 1Q9OA 4FXGC 3DX7A 1QSFB 3P4OA 1SHWA 5L7XL 1OARL 1RU9H 3GIZL 3ULUL 4PRPB 3TCXA 2FH8A 3MRQB 2IDSA 3GRWL 5H2BA 3ARGD 4XX1G 2WZPD 1CDHA 5BQ7A 3DV4A 3OGCB 2R39A 5CNHA 3ILQC 4B9YA 3GSRA 4J3OC 1HXYA 1IILE 2OYMA 3QZLA 4CJ1A 1R3HA 3S0PA 4ZS7H 5DURD 3OC8A 3AY4C 3WE6A 1X4XA 4V2BA 1MRDH 2XZCL 2NYZA 1LP9E 1U2CA 5I6NA 3BN9C 5DLMH 4PWGA 4HS8H 1IC7H 2B16A 2ZAIA 4J4PD 3BWAB 3R7QA 5IB4A 1KB5L 4JQIA 4Y4HC 3ZSTA 1MW0A 2CLRB 4QXVA 4Z7IA 3QCTH 4JM0A 5J6GB 5DO8A 4G1EA 4CJ0A 4O5LH 4PJBB 5TQ0H 4FNQA 3MLPA 2WAQA 1AGCA 3FZUD 3HW7A 3BUPA 1HHJB 3O9WC 4KOCA 3U0TB 3EYOB 3OSVA 1N4XL 4NQEA 4PWEA 3UZEA 1HH6B 3A4EA 3QZNA 4OLYH 3RX7A 5EZJB 4F7PA 4CRPA 1WAEA 3DMMA 5B4MD 3FQNB 1PZAA 3FMGH 2Z91B 4K3DH 4P3DB 6FABH 2QZ5A 1LO0L 5F21B 3VXPB 3AS1A 3PV6B 1IGML 3IXAA 3RVXC 1NCWH 2GT9B 4HUXA 1ZY9A 4J2QA 5JDSA 4WW2C 4XO8A 4D9RD 2I5YH 1XF5B 3T6XA 3OKMB 3D51A 2C9VA 3LNHA 2ODHA 4NRYA 2Q8AH 1THAA 4JO3L 4XNUH 1A6VL 3MRQA 4ZMNA 2BFGA 2BHZA 1ZAGA 3CGTA 5GPRA 1EVTC 4DEWA 3FQ4A 4W9HC 3EH5B 3VXME 4JKPH 2GTWB 2CJTA 4JM2A 3GBNH 3DGCR 4XP6L 3T8MA 2CPUA 3OR7B 3UPRA 2O5NA 3MNDA 5E9DD 4XVUC 4MNGB 4P2QE 5FK9B 4F80A 3MOAH 4RFNC 5L2KA 2ICCA 5E9AA 3JWDH 4NDMB 2R1WB 2XTJD 5EO0B 3DX1A 4HFWB 1AOHA 1BM3H 2DL9A 3F7YA 4OKVB 2X88A 3Q6GL 5MEPB 1ZVNA 3GM8A 2OJ1A 2XU9A 1KTDA 1A21A 2XWTB 3NABL 5DQ9B 2Y7OA 4AIZB 3EYOA 3MRJA 3EF7A 3HNSL 1R3IH 2E8ZA 4FQLH 4LU5H 3Q2WA 2OSLA 1E28B 1EEZB 1MCRA 2Y2YA 3AUWB 1Q1PA 5HHOE 5IHUH 3PWPB 5KN5A 1N0LB 4RQQB 5EF1A 3P9WB 4GSUA 3S96A 1CVRA 1KG0A 2IG2L 3PV6A 4JM2F 3CFJA 3S6CA 4DP9X 1KB5A 3CC5A 2ZYRA 3WLWD 4JDEA 3Q6FB 2CKNA 5IY5B 2UY6A 2AEQL 4MDJB 2X6BA 4K8RC 3OKMA 4TS6A 2Q87A 1LO5B 1WWBX 2IAMA 1XH3B 4LHJB 4PJ7A 5DD1H 1EJ6A 4AC2A 3PJNA 3ULUF 1AXSB 2CCWA 5JW3L 3C6LA 1NGWA 4AI7A 1YY8A 5DJ0B 5I1EH 2FBJL 1TTAA 4OSUL 4MCYB 4LCWE 2VJXA 2DQFB 3DGGB 3RGBA 2NNFA 4N68A 2G9HB 1ZE3H 3BPCA 3FTSA 5A2BA 1H8NA 1SMDA 2ZNWA 3GXIA 4A7VA 3CDCA 2V37A 1GPOH 3T2OA 5FB8A 3CU1A 3MBXH 1J8SA 2X89A 4HFWA 4L3EB 3NA4A 5I1AA 4NZDA 1YNLH 5AD0B 4HLEA 1K85A 3U25A 3CK0L 3UTTD 5F96H 4RGNB 5DR5H 2XWTA 3MJ6A 4PP1C 1TZIA 8FABA 3KD4A 1NC4D 4MVBC 1JGDA 3CFQA 3IETA 1EEQA 2J55A 5KAQG 2AAAA 1O5DT 3II1A 4PJ7F 3W0WB 2AERT 2HFGH 2PYEE 3FAXA 4UYPA 3LTVA 4K7FA 1N0LA 4N2LA 4RQQA 3VTTA 3RPIB 3CBJB 4PY8I 4WWPA 1D9KC 2ZYIA 2OXGB 1TQCB 2J88L 2FVNA 2DWEA 3Q6FA 2CBQA 1MCIA 1SUHA 1KLFB 1CFVL 2EADA 2BDNL 4NQXB 3LNFA 4XPGL 4L1DA 4LZKA 2DBLL 3PQYD 4DVRL 9CGTA 4N2HA 1PD0A 4X6FA 1ZSHA 1KCUH 3WY2A 3KPNA 4H8PA 1BOGA 1EXHA 2KLSA 4F7EB 1M53A 3BESR 1U58B 4KI5E 1WBYB 4ES9A 4M5ZL 3JVGA 5E1AB 1F4XL 1I8IA 3LQAH 4ZTEA 3P3SA 3QUMH 2E3VA 4YXLL 3T0EB 4Y2DA 5ID1A 4ZUSA 1FNGB 2DQFA 5ILTL 5E4OA 4M8VA 5J3HC 1ZJAA 3HBPA 2QQLH 4ZSOA 2NSQA 3R8BB 1CT8B 2GIXA 4PTTA 2YGPA 3SQOL 2H0JA 1F42A 1MLCB 1HZKA 4XO4A 3HE6A 3FUFA 4L9LC 5F7KC 4FG0A 2IJ0C 5T1KB 3IN0A 3UX9B 3W1ZA 3V8CA 3F7QA 5DMKA 2WUCH 2D3LA 1OP3K 3G5VA 3RY6C 4HJ0D 4XN8A 3QAQA 4KROB 2CXGA 4XC1H 2C3VA 3H3PL 2QSCH 2CRIA 4N8UA 1BSIA 4DCQB 4B27A 4PI2A 5L2JA 4PVBA 3FQYA 2EXWD 4EVNB 4PRID 1I1AC 3HKZA 3RPIA 4IKNA 5CEYA 1WTGT 1WZAA 1J9QA 4I13B 2CD0A 5IM7A 3FF8A 2ADFH 2R0KL 4M48H 2LTQB 2XXGA 1BYPA 3OAZK 4ERSL 1HEHC 2Y0SA 2CIKB 3QDMD 2BRQA 3ALPA 4L4TE 5C0BD 4F8PA 2YAQA 5DVPA 3OKLB 5L0QB 1ND0A 1TJGL 4N5EC 1CLCA 3L3GB 1S7SB 3WKQA 2VRKA 4FQ1H 3BPLB 3BSZL 4OFDA 2VQUA 1DJZA 1YEIL 1NGPH 2F58L 1TTCA 2JLPA 15C8H 5CJQH 3OKYA 4UT7L 4G1MA 5B3SB 4M6ML 4HAFA 1CQYA 3P1VA 4JFDD 3UACA 1MQKH 3V4VH 1OQOA 4J23A 1MLCA 4GXVL 1DBAH 1UASA 4LBAA 2QBWA 3REWB 1MUJB 2B3RA 5I74B 3S3SA 2X4PB 3VI3A 4ES8A 2F6AA 4AGQA 3BHBB 2OX5A 5I30L 1BAFH 5HSFA 4J39A 4Q4IA 3MRBB 1F0LA 3ZE0F 3VRIB 3H6JA 2VR5A 4GAAA 4U33A 5IB3A 2W65A 1EBAA 4EI5D 1R6VA 4HUMB 1A6PA 4LLMB 3I84A 1M6UA 1C5CH 1J0HA 1LO3H 4F5CE 1T6WA 1VERA 3QDJD 1FSKC 1YYMH 4TTDC 4KQ3L 1OV8A 1ZWIB 4KZDL 3K2KA 2R69H 5B8CB 4NN7C 1PG7H 4N0CD 4KKPA 2WLKA 4LHUD 3WMSA 3TBTA 3OKLA 4O02A 4IGBC 4Z7UA 1Z5LA 4JVPA 5AW4B 3ZT5A 1NCCH 3ZMEA 4WJ5A 1KFAH 3VGFA 5GGTL 3QUHA 1IFHL 4KQ4L 4G7YL 4NNXB 2X1XR 5E94B 1G4MA 4YWGH 4XCNA 3VI3F 1SQMA 3UP1A 2EE3A 4KKLD 4RFEA 2ILLA 2Y72A 4LSVH 1D5MB 2N0KA 3KYOB 4G8FB 3O4LD 4L37B 1JF6A 4MB5A 3PREA 1SYVB 2X4RB 4NPYA 4F93B 1UM6L 1TSHA 2EH7L 4Q0XL 4WWKC 1KTCA 2GJ6B 1PIGA 3TWCL 4U1JB 3UROR 4HG4K 4XRCB 3ESNA 4J3OH 4DVBB 4ZQTA 5CSBA 1DBKH 1MRFH 5GGVY 3UJJH 4M3KB 1JPFA 4YLBA 5KSBE 4G7QB 5KYXA 4LGSB 3VFOA 2ICWB 2CDFA 1XF4B 3P77A 3O2WL 5A6IA 1GGCL 1HL9A 4L4VD 2IPKB 2ORBH 2HN7A 4Z7UF 5IG7A 3OKNA 5E8NB 4XN1A 1AHWC 2VXVL 3PGFL 4YPJA 4CMHB 2YD6A 4LSTH 5T3XH 4A1RA 4YFLF 2ROYA 2YQ2A 3ARDC 3MDJA 1FFQA 4F7MB 4H1LB 4AQ1A 1Q72H 1CDGA 4Q6KA 2O6PA 3MJ8B 5GZOD 2NDGA 3DGDA 3LKQB 4FFWD 1JK8A 1S78C 5EEVA 4X83A 2HLAA 4ACPA 4ZOAA 2DLHA 5DJ6A 4BUGA 3KDPB 2HP4A 3MOQA 4DIXA 2VH5L 1VPOH 3F58L 2F0CA 3EYSL 4IRJA 4JANB 3L4TA 3MLWL 3HAEG 4QRAA 4R2GC 4RMSA 4UIKH 5HGAB 5A2KH 2O6DA 3BT0A 4NO0A 3NZHH 3PWVB 5KANG 4X6CB 1WA2X 1E4JA 2NY3B 3VD3A 4NNXA 5E94A 5I1GL 1ERNA 2KPWA 3K4ZA 4KDTC 3HA0A 2GBTA 2X3AA 4CN6A 3KPRD 4HWBH 3CBRA 2CGRL 1F11A 3QJSB 4MXQC 1D5MA 5TDPA 3REVB 5C2BL 2IALA 2AEWA 2A0LC 4CVUA 4L37A 2FE0A 4QHMA 3MRFB 1S5IH 4LMQE 4KXCA 5EIQA 3P0GB 1HKLL 3D4ZA 3PL6C 1J8HE 2NY0B 4V1DE 5EN3A 1CI5A 4W4OC 1Z2KA 3EOAB 4AG4L 2WINB 2ZJSH 2R8SL 2HKAA 2BSBA 2EVFA 2VCOA 4I0PB 5E7FA 3FRPG 4MRBA 4XODA 4AJVA 5HYQB 2NZIA 1YYLH 3PXHA 1C7TA 4LOUD 4MKTA 2C9XA 1P0SE 5D7LA 1I9RL 1XF4A 1CN4A 3GEWB 1SDDA 1DFBH 2L7JA 3DPBA 3EG9B 2H8PB 3FT0A 3K1KC 1H9VA 1SJEB 1MFDH 5E8NA 1NFIB 2F5BH 4GRMA 4UI2A 1UOWA 1Y1DA 5TPWH 5DJZA 2EIKB 2QPDB 1KXQE 4XP9L 1P5UC 4ISVA 4KDVA 3U6RB 3MJ8A 3MUHL 3ZTEA 3WTVA 4G6JL 3QXTA 3P9MB 4XMLL 3GHEH 1NCUA 4AENB 2WTPA 5IBTH 5ERWA 1BEXA 5EMYA 1A4AA 3OAUH 4W70A 1LEIA 4NQED 4FF9A 5IVOA 5IKCB 2MIZA 1N8ZA 3IB4A 5BOJA 5DO2D 1IM3B 3PWVA 3GUFA 5CMAB 3QQ3A 1KTRL 1RZ7L 1RHFA 5AKSA 4YVUA 4D9QD 2WJ5A 4GMSL 4YFDB 1L9SA 4Q6IA 3WO4B 1MEXH 2QVTA 2K3HA 4XP4H 4Y16A 3EYFA 1A8ZA 2YRBA 2LU5A 1ET8A 3REVA 2YKLL 1C16A 4AX3A 1GGTA 4K8RH 2ICWI 5ITFB 1FNFA 3MRFA 2BW5A 4J3XA 4X9FA 5B38G 5LAPA 2NXYB 4FLQA 4C59B 4Z3TA 1C12B 2Y69B 3BZFB 3D9AH 4G80B 1N70A 4PCKA 3HIZA 5DK2A 3VH8B 3EOAA 2EQDA 1QG3A 1KN4L 2X2IA 2WINA 2VUYA 4YDIL 2VMDA 1KC5L 1CGYA 3W9DB 1R33A 4I0PA 2XTSA 3ECBB 2H32A 3TYGL 2CXKA 4JM2D 4HUKB 3DLQR 4UTAH 3UGXA 4Z0XB 1IGFH 2B08A 1Q0XL 4HEPG 3U1SL 2JE8A 4ZW7A 2QL1A 4G6AC 4GSXA 2X1PA 1YRKA 2GI7A 4R4BB 4RDQF 5HHMD 5CZVL 4KVNL 2WD0A 1A0QL 4D7BA 2PR4L 2G60H 1J0KA 4P5MA 3QARA 3DURA 2R4RH 4R96B 4YEEA 2DH2A 4XCEA 1KTKE 3LX9A 2HFFB 3U6RA 3CU7A 3IXTA 1FBIH 3MRNB 1MDAA 4QPEA 4P0DA 3TF4A 1OB1A 3B2UD 1A6AB 1KCVL 4H5SA 2XA8H 3SCMC 1BVKB 1OO2A 4I2XE 2H0FA 2DOCA 2R2EA 4FFZA 4RIRB 2FEDC 4LCIH 5IKCA 4ZDHB 5DK3A 4Z5RB 5BZWB 5CMAA 3ZDZE 1EJFA 2MTAA 3UBXI 4JUTA 3ILPB 4LRNL 5EOQH 3T3MB 1AG6A 5GRYA 2O6FA 1Z3GL 4ODVL 4IRSB 4U7KA 2A6IB 2ZYSA 4LNRB 2VLJE 4Z7WE 3SBRA 3DUUA 2CRMA 4M3JA 5BV7L 1W0VB 4KNTA 4JN1H 2IAMD 5KVEL 2OR9H 4QNPF 1P84J 3MV8A 4KY1L 1GIGH 4KK8D 1UH3A 3OSKA 4DP6X 3E8VA 1BFTA 4KVPA 3LNIA 3B6SA 1FZMB 3IDNB 4Z0XA 3RBSA 3WO3B 2FJUB 1U8NA 1K4DB 1LO2H 1BMZA 4NRXA 3SYAA 1NPJA 3WN6A 1IUZA 3LS5H 1E65A 3BQVA 2YRZA 3UADA 3NG5A 3FCSA 1IC1A 2P5EE 1P1VA 4QYOB 4R96A 3UL4A 4I18A 3CDGB 4XPBL 1VEPA 1U3HA 2X89D 3ENEA 5BV7B 1F3RB 3N43F 1IFRA 2HFFA 5ICXB 3VFGL 5I73C 4Z76B 1EXUB 2F54B 2JCWA 3AADB 5T3ZL 2YLHA 3EO0A 3MRNA 3VXSA 5LGKA 4FNLL 1BVKA 5JUEL 4I0CC 1TJHL 5CCHE 2Q8BL 2P5PA 4GUQA 3IMWA 2ZUSA 4HP5A 2W9LA 5JOFB 4ZDHA 3FUJA 2CUIA 1SHXA 1YC7A 5BZWA 1B2WH 3H85A 1ZV5A 3ETBF 3N85L 4M1CC 5IREA 3I9IA 3GYRA 1J48A 1MJJA 5C0EB 2YS4A 3DTXA 3GKWL 1LDPH 4TKWA 3I02B 1QWHA 4G7RB 3QEUB 2C4XA 3CPLA 2IADB 4QF1B 3SDYH 3D4GA 4Q56A 5FO7B 1JNJA 3I9GL 3O6FC 1NIBA 3L4ZA 4XN4A 2C9QA 4HBCH 3NA9L 3OKEA 1G0XA 3BKCH 3OG6B 4FQCH 4NQCA 4P4KD 1QW9A 4X4YB 3SYOA 3TT3L 5EUKB 3K6SB 4A7SA 1UTDA 2XN9E 1B4JH 4OW6A 1RLBA 1F13A 3MA9H 1BFVH 5EU4B 1JHKH 4JY6B 2HT3D 4PJGE 4K9JA 3IDNA 1T89A 4PJFE 4Y2DD 1GMEA 1T7ZA 4FFYL 1JP5A 2YEZB 3TVMC 1B9KA 4FEIA 3ARXA 5CILL 5C08A 4Y2OA 5B1CA 1BXXA 1DVFC 1NCAH 4OF7A 1O6TA 2XXCB 3K8MA 4HCRH 4HIQA 2K6ZA 4Z7VE 2WBJC 3CDGA 4NRZB 3K8KA 1GKOA 4J27A 5ICXA 1J05A 2G0LA 1EXUA 4FQHA 4Z76A 1U8MB 4XMVA 4HSAC 2A9NH 4M5YL 2Y2WA 3KDMA 5T1MB 3TM6A 4GYBA 2P4AB 4YZFF 2XIBA 4OD1L 1CDBA 4W9IC 3APNA 4FP8L 3C5ZC 4HMCA 1LE5A 2R56L 3KYNA 3HG0A 1W0WA 5M94B 2CO6A 4XE0A 2GKIA 5GIRA 5FHAH 4AIXA 2BWIA 4L9DA 1AY1H 3GXUB 3U7AA 4JS7A 2RJMA 1G9NL 2XKSA 1MHPL 4TQ8A 1K5NA 1DQQB 1CBJA 4QF1A 2OZNA 4ODHH 3DECA 3BZDA 2XX1A 2NY7H 3TC9A 3T0AA 3IDMB 1N0XH 4H88L 5HY9B 5F1NB 1ZCRA 2BW4A 4X4YA 4G6FD 4J3BA 3VD7A 3T4AC 2CM5A 2JI3A 1N6VA 3O3EB 4AZ8A 3NBNA 4ZO8A 1E9PA 4OZHE 4YQXH 4OIAA 1WBZB 5EU4A 4LSRL 4NP4L 1JS4A 3VGAC 2R7EB 1YLBB 3QI9A 3S5LG 4HGKC 4NS0A 3SKOB 3TBBA 1REIA 4G6ML 1DN0A 4P2RE 5SWZE 2YEZA 3PNWA 4G3YH 4MDIB 3O6LH 4WENB 3KJ4B 3IVKB 3VMOA 3FCTA 3N44F 3LN5B 4Q9QL 1ACZA 1OCWL 1M7DB 5TE6H 4HOXA 3QUGA 3QZPA 1WD9A 3M8OL 4NKMB 3BPNC 3DBXB 1BPVA 1LWHA 5BVJB 1A6WL 2DTML 2A9ML 2NX5B 2M8XA 3GO1H 4NQDD 4ONFL 5A7EA 1NCJA 4AITA 2EKJA 1A1NB 4P99A 4OLVL 3V5HB 3B9KB 3HVNA 4MJID 4XHJC 4Y5VA 3LNGA 4B9IA 3LH9A 2E4FA 5FO8A 4X7SL 2FJGB 2OMZB 2VLRE 1AD9A 2YBGA 4K9EC 2X0VA 1GL4B 1QMUA 1HZHH 4PJ5A 1O0VA 2F53B 4MMYA 5T33L 2ZPKL 4QHUB 5DD5H 5T1LB 4OI7A 3PXLA 4UAHA 4E5XA 4PLKC 4DQAA 4ECNA 1N5YH 5D2NA 4ZUTA 1TITA 3GHBL 5HY9A 1S9XB 3DROA 4G6KH 2LW3A 4XAWH 2UV3A 1DL7H 2BSEA 4JQVC 5IROD 1SEQH 1U8JA 2AJ3B 1CE1L 1JG9A 1G0YR 4R90L 3O3EA 1FNEA 7PCYA 3KLHC 4KK6D 2MPAH 5C0NC 3ZRCC 3KR3H 1MHCA 1X5KA 3SKOA 5EZLB 2Z93B 4PW3A 5E99H 3L7FB 4FA7B 4MDIA 2WLHA 4U1HA 4YHOL 3ZL1A 4NXKA 3EJZC 4PYHA 4WFFE 4AGLA 1D5RA 1FZOB 2EDKA 3KBEA 4OCRH 5BW7C 1ZHLB 3DXAB 1ETJA 3IMSA 5D5MA 3SGJC 1DE4B 4UOQA 2AV7B 3HI1B 3QUKB 1X9UA 1VENA 5C0FB 1R17A 1A7NH 2F7OA 4N9GB 3VGHA 1MJ8H 3VA6A 5KEZA 2W92A 1A1NA 1UT9A 1VRSA 1KDIA 1HCZA 4N8CL 1OK0A 2P46B 3SB3A 3TT1H 1UH4A 1TYJA 2VL5B 5KYWA 1D6EB 4Y2LA 1E2VA 2DM3A 4AE1A 5EEZA 1IGTB 3KHQA 2W91A 4HAKA 2X05A 3RWEB 3TP4A 2G5RA 3SDXB 4K23L 4NFCA 1E0OB 1OANA 3IAGC 5EEYA 3A4DA 4XBGB 4QOKE 5D7EA 5T1LA 4GMTH 2WNWA 2F18A 4TQIA 3X1GA 2VO5A 1OK8A 1RLWA 3BXNA 4IRJD 4AE0A 2G3MA 3TEZA 2GG1A 3ABKB 1LK3H 4LDEB 4NO0D 3U30B 1XSJA 5D5MF 4NNYB 2DN7A 2RD0A 3FOMB 3OMZA 1W91A 1G7HB 2BJML 5FGSA 2NY2B 4X0KA 3MGAA 4YXKL 3QIBD 4WRLA 2KC0A 2Y3AA 1JN6A 2WLIA 4OJAA 2Z93A 4E41A 1HH9A 4OZFH 2ZKWA 4NOBA 2DW5A 1QHPA 5GS0C 1X5AA 5D72H 3VFUB 2YAHA 4R3SB 4NLAA 1GGBH 3CD4A 4TUJA 2E7BA 1JZ2A 1F4HA 1FZOA 3QS2A 1ZHLA 1QBMH 2DWSA 3WIHL 1AZUA 1DE4A 1ECZA 1KY6A 1CICB 4L8DA 5C0FA 4TVPE 3TNNA 3D6GA 3RWHA 2H9GA 1MHHB 4N9GA 3LKNB 5ACZB 3DX9A 4ZYKB 5IJBC 8CGTA 1R34A 3W5MA 3EYUH 4WWNA 4I1RA 1BZ9B 4HK0B 1S7UA 1ZDQA 1W8EA 2B1AH 5ENWA 3NEXA 3RFZB 3W11C 4OI9A 1TTFA 1D6EA 5C6TL 2NY5L 2VQ1B 4B5EA 1ZPUA 2CNYA 2ZYHA 4LKCB 4HH9B 1OAZL 3BAWA 2C3HA 4IU2B 1U92B 3S37L 4IRZL 4ZQKB 3M88A 3BJLA 4OUUA 4NLHA 4XBGA 4PYGA 4P57B 1QNZL 4NZTL 1LDSA 2HKHL 4DKEH 1WUNT 5INCB 3HS0B 1KCBA 1HL5A 1HWGB 5F8RC 3FTVA 3UTTB 5FOBA 1NBVL 1RULH 3MCKB 5FWRA 4DO5A 3NCCB 1NC4B 1CS6A 1FLRH 2ESVE 4BM7A 4HHAA 3CHRA 4HJJL 4A7TA 3UJTH 1OSEA 1WH0A 4HKXB 4W9LC 5SWQB 3P3TA 1TU2A 4LPYA 4OZGE 2X6VA 4TSBH 3G6DH 4YVNA 4UDTA 2LU4A 2X09A 5GSVA 1EHLL 1WICA 4RGNC 3ZZ1A 4XXDB 1TVBA 4EUPG 1IARB 1WTLA 3CLFL 1PKOA 4JCLA 2MCPL 3ZY7A 1F90H 2YSSA 1I7ZB 1S9WB 2DLTA 4ZMVA 3D7PA 1GHFH 4YDZA 4I3RH 4DP4X 1IAKA 1TQCC 5KAQF 2J8UE 2Y6TE 3QEQB 1Q0YH 1CICA 1QEXA 2ZONA 4E9WA 3KXFA 3DSNA 4LCCB 1MAKA 3PS6A 5HYSB 5IK3B 1RMFH 4U4BA 3UXFA 1DEEA 2GBVA 3RFZA 1XFPA 5GQBA 2Q76A 1MJUH 1RUKL 1JPTH 2G5BA 2HJKA 3DX0A 4NKIH 2VQ1A 2XBTA 4ZT1A 3FU6A 5A6LA 1IAIH 5D1XD 3D1MC 1I9JH 4IU2A 4TRPH 5ELIA 1HOCA 2BRRH 4P2OB 3EGSB 3T0EC 5E1QA 1RZKL 5FAAA 2P26A 5TF0A 1PTZA 1OXYA 2W0KA 4M6NH 5DHYA 2KZWA 4LLQB 3K6IA 5D8JL 4L2YA 1QSFE 1AIZA 5ESVA 4XN9A 4CKQA 4HKXA 1MVUA 4PRPE 3D0LA 4XAKD 5TDOB 4S1QH 4FABH 5EO9B 1NMBL 3L3HB 1T21A 5SX5H 1MCEA 4KROC 5IB2A 2IWEA 3PDOA 4DW2H 1YEFH 1KCSL 4LDOB 1NEPA 2DDQH 4UMGA 4FYRA 4TLTA 1WIOA 5E1GA 3DARA 5JQIB 5IVZB 1YEKL 3OBAA 1CGWA 4GRLA 3IKCB 1S9WA 1PYWB 5I16B 4KK9C 3IGAB 1T5XB 5CGYC 3CFDA 4JFXA 4YHLL 2HYMA 4MS6A 4QWWC 3ISYA 1FVDA 1R0AH 2J4WH 1U93A 1D6VH 4ZUWB 2WQUA 4GLRI 4XMZA 3I9AA 4YHKH 4QAMB 4LCCA 3QFJD 4N2AA 4YSCA 5HYSA 4QHKJ 4PJBE 1JZEA 1RFDL 5L0QC 2R2HB 1S9KC 4F7CB 3THMH 1MF2H 4M7KL 4KTDL 4YK4B 3B7YA 4ODWB 3SEPA 3QRBA 1TEGA 3GSNH 4JFDB 4BSVB 3O6KL 4Z8FH 1IEBA 3WLBA 2XI9A 4GP5B 3GMOB 3FQUB 4HD5A 3NK3A 3UTZA 3E6HB 1BXVA 3CXDH 3GIVA 3VXSD 1MY5A 4HIIB 2YAMA 4JO1L 4U6HA 1HSAA 3MLZH 4LLQA 5AEAA 2HJLB 3GMPB 3ZK0A 1P7KA 4QRSA 5HI5C 1PPIA 3AT0A 2C9SA 3PXJA 5CS7A 2BVOA 2F8XC 5HPOA 2ICEB 3K91A 3FCBA 1KULA 2DQIH 3UTSA 5I74C 2Q2LA 3DC0A 3RJDA 2J72A 5TDOA 1U41A 3MLSH 3MRDB 1FC1A 1PY4A 3LJ3A 3BYYA 1R3LA 2K70A 2I07A 1X3DA 3OJDB 3MRMB 3IFOB 5JR1L 4KY2A 1DQJA 1PYWA 4LHUB 3F64A 3QPQD 4JQIH 4MNGE 4NQCD 5I0VA 4UQ9A 5I6MA 3K46A 3WNOA 2DQMA 1LJMA 3TBWB 2GFBB 1RZPA 1K72A 1N2RA 2Q7NA 2VXQL 1WZLA 1SVCP 2B15A 1DQDH 1F41A 2XJLA 5D7JB 5B8CC 4F9LA 5MERA 2CBMA 4PRBB 1DVUA 7FABL 2R2HA 1IM9B 1OOWA 3L5WA 5C08D 4AW4A 2NXZD 4XN2A 2YO3A 3RDTA 3F01A 5JXEC 1I8LC 4PN6A 4NM8H 1MXGA 1Q9KB 2AJVH 1RUQH 2FQDA 4HWZB 3NJVA 3MRIA 1OEZW 3PWPE 3SE8H 5KVMC 4EBQH 3QJFB 1S7RA 5E2VL 4HIIA 1UGKA 3X2QB 3IDJA 5EBGA 3AG2B 4JRXA 1I7RB 3AC0A 4N5UA 1E4XL 1P4BL 3VNYA 3BAIA 4NO2B 3S4SA 2ZOUA 1FPTL 2WBWB 3QPKA 3ZVVA 1HXKA 1P69B 4YX2H 1KBBA 4OIIL 3QYNA 4K9EH 1NFKA 3HAEA 3HHMA 3B34A 5DHEA 2OAAA 1JNHA 1XD1A 5EHFA 1F58L 4C54A 2IO5A 5F7HA 4KQ0A 1RPQA 1WG3A 3FN3A 2GJJA 3DUSA 1C1EL 1QBBA 3NMEA 4CMHC 1OARH 4PP2B 5AZUA 3GRBA 3EDJA 5K59F 3ULUH 3SGEH 1H0DB 3L45A 2MOQA 1JZ8A 3MCG1 1JUFA 4JHAL 1DQTA 3GRWH 1BP3B 3AABA 3GC3A 3V4PB 4L3EE 2GAZA 2VR8A 4QHPA 1KYDA 3ETBJ 3QIWB 5D7JA 1I1FA 3QI9D 4PRBA 1XH1A 3V0JA 4HISA 3FRPA 1IM9A 2XZCH 2IH3B 4RGNE 5DYFA 4JG9A 5JPMA 5E8PA 1A22B 3COOA 1CXLA 4OGQC 4UINL 3WTTA 5DS1A 3BUDA 2WZ5A 1IB5A 1BM7A 2VMEA 2NY3C 4M4RA 3W0WE 1WFIA 3ZRFC 1KB5H 1M2OA 3AU1B 2AF2A 3SYPA 1AANA 3MQIA 4ZUVB 2NZ9C 4LLDA 1U42A 2VXQA 2GCYA 4F57L 4QYAA 3WFDH 2GHWB 2FJSA 3I6LD 1ZS8A 2NY0C 4NO2A 1MCJA 3VXUD 1N4XH 3LXCA 3MODH 5ANME 3QQ9D 5JOPE 1CBVL 1VFBB 2HT4C 2YXMA 3BW9A 4TQEL 3ZYJA 3ZZQA 3KBFA 3K6OA 2ZUUA 2BNRD 3BQUA 5D71L 5DJAB 2UWEB 1EA9C 1CJYA 4PJ5D 1LO0H 4ANXA 2YGOA 4PHXA 5AVZB 4G43B 1NCBH 2CBTA 3NH7L 3ZTNL 4BCXA 2PP8A 3T3PF 3BVDB 3G6AA 4OGXH 4YHPA 1G7MA 3PWLB 4I9WE 4PJXA 3LHPH 4RRPM 4QXTA 4YBQD 3T0EE 1PFCA 2V5MA 4PP2A 1U8QA 4LSPH 3L16A 4LEOB 5EFIA 4Y8DC 4JO3H 3ZHKA 3SDAC 1A6VH 3AREB 2EDXA 2ZTBA 5DGQA 1PSKH 4S10A 4PRHB 2J73A 3MA7A 5F8QC 1CFSB 4B9KC 3WL9B 1F4YH 3BH9A 1NAML 3QIWA 1JDCA 3OL2A 1JVLA 2KS0A 1NM4A 1G7IB 4OD2A 4R7NB 4XP6H 1MI5A 4YLQT 3G6JB 3F7VA 3TZVA 3EFOA 1QABA 4OF0A 1UEMA 3PWUA 3VE0B 1J1XL 3FRUA 2O6EA 1WPCA 3UZVA 3QULA 3KS0J 2KL6A 3M1CA 3MKGA 1NCGA 3L7EB 5DJCA 5DC0A 1M6OA 3WO4C 3N40P 1SOQA 5DS8A 4JPQA 4GAGL 2X4QA 3QORD 2F9BT 5EBLA 2Z92A 4Y4FA 4DPCX 3BEVB 4PJXF 3CDYA 2NXYC 1NAMB 3NABH 3Q8CA 2AJZB 4QIRA 4JREC 4OR1A 4G8GB 3ARSA 3BVWA 4GEJA 4APQC 2CCLA 3HNSH 5HYEA 1E4XI 2DEWX 5K9KB 1AGEB 5D7IB 2A74B 1CXKA 1H3XA 4YL4A 1XGYL 2JJTC 1UACL 3CJJA 1TNMA 2IG2H 3QGVA 3KL0A 3GKZA 4XP1L 4V2CB 1MDTA 2KZ1B 1ZVSB 4J6IA 3O41B 4B5ZA 1JGVL 4QXUL 3VTMA 4MZ2A 1I9EA 1ECYA 4XGZB 5JW3H 3IN2A 4OQTA 5BOPA 1BG9A 5I8KL 4CA4A 2IDQA 5F70A 1SF5A 2FBJH 1KBKA 4OSUH 5AOMA 3VRLF 3LZFL 1G7IA 4E41D 4R7NA 4XXCC 2DH3A 4Z7NF 3STBA 4Y0GA 4U1SB 1E42A 3PF2A 2WLMA 4ZW3A 5ISZB 2VABA 4ZO7A 5BZZA 4LARL 2EVIA 4LDLB 1RZJL 4EIZC 5BRZA 1DLHB 3LRSA 1MW3A 3VXRA 1R19A 5KSUA 1T2XA 4XVTL 2WIMA 5HHNB 2X1OA 4IRSC 5A40E 1UH2A 2WC7A 2C5DC 2CGYA 3CK0H 1E7VA 2XX0A 1W9XA 4YS4A 4Y5XB 1BZEA 3QJTB 4XNMB 3O45B 1U36A 1RSFA 1KIPB 2CQVA 4OLXL 5K9KA 1AGEA 4PD4K 4KMQA 3C8DA 4G8IA 2ZWLT 5EOCL 4GRWB 2VZOA 3V0WH 1KB9J 5HYJA 2J88H 1VFAA 4F15B 3QNYB 1AJ7L 1CFVH 4UAOB 2Z8RA 1ZVSA 2EXTA 3E8UL 4PLJC 3WJJA 5GGRA 2DBLH 1Q8MA 4DVRH 5BV7C 3VFPB 2X4OB 3X12A 4WW1B 1NMCB 2IGFL 3ARPA 4DEUA 2QQNL 3T77A 3ARZA 1YN6B 2ALAA 3TYFB 2Q2EB 3LN4A 3MRKA 4M5ZH 2GJ6E 5JLZB 1F4XH 1KGWA 3RL2A 2A6DB 4YXLH 1LD9A 3KBHE 5AWNL 5SX4H 3FO0L 4OCYH 4G11A 5ICZB 3HZMA 4K7PY 2ED6A 3WUWB 4J5VA 3GMRB 1YPZB 2MNWA 3ZTDC 5A7BA 4K5MA 1TJIL 1Q94A 1D5XA 4IBTA 4IM8A 3L5JA 4P4KB 3SQOH 3P0YL 3A67L 3CHOA 3ZDYB 3I75A 4GFXA 4MA1C 4ADJA 2UZYA 3ZTJG 2PW1B 1IBGH 3NESA 4NCC1 1E2WA 2AGJL 2OA9A 1GRWA 1NSNL 3H3PH 3O45A 4PUBL 4BINA 3PHAA 4CL7A 1KT2A 3ARFB 1SOSA 1OHQA 3DVGB 3L54A 2BVPA 4X6CE 3UAJA 4IOIA 4MWFB 2VN7A 1D7BA 2UUDH 3CHQA 5KG9B 3Q2NA 3HG2A 4N8VB 1P7QB 5C0DA 5J4MA 3S8WA 5AB0A 2O1AA 2BVTA 4MDRA 4WW1A 4L5FL 1AIFA 1TJGH 4JBSA 2PXYD 1KTLB 4UNIA 1T2JA 3BSZH 3FU9A 3I3BA 3RIAK 1E5CA 3NIFF 4NUPA 4DPAX 3B9EA 2F58H 5EU5B 3QJHA 4UT7H 3BFWA 4M6MH 1XGRB 2VUOA 4IHOB 2EVGA 1AHMA 2XKNA 4GRLD 1YPZA 3EF4A 3IDYB 1OB0A 2VKWA 4NZ8A 4U49A 3VFTB 3I50L 1NBQA 5H35B 2X4SA 2WNXA 3KW8A 4GXVH 3MFFB 3H6AA 4H20L 4I77H 4X0NA 3VB9A 1TZAA 2IQAB 4MD5B 1SEBA 3V0FA 5KSAB 5IGXL 1IZKA 3L9BA 4RCAA 2ED8A 4APXB 1Z3RA 4BWTA 5C92A 5CGMA 1GY2A 1Y6KR 1SF3A 4NZJA 5I30H 3TS8A 3TCLB 1E50A 2QGBA 5KVDL 3VFSA 1WT5C 1FG2B 3FB6A 1E8YA 2Y36L 4WI7A 1UENA 1U91B 2VITB 4QTFA 4ZAKA 1EDQA 4F9PA 4MWFA 4Q89A 3GMLB 1LMIA 2ZX6A 4LCUB 1MCPL 4NQDB 4KQ3H 4YGAB 4BQ9A 4KZDH 5KG9A 3CHXA 5BUAA 3BRFA 1KGJA 3KL5A 2NTFB 2ODIA 1V8HA 4IMLB 4N8VA 5LGJB 1QSZA 3V5KB 1QRNB 5TH2B 3RWIB 5ESQB 3ARGC 1A2YB 3U0WL 3KNBB 3KPSD 5KSVB 1YQ2A 3T6VA 1DYZA 4XNDA 3B7SA 1RZGA 5GGSY 1QO3B 4U6YB 4N90D 2H3KA 1EWHA 2ZIDA 4KQ4H 5GGTH 1WYJA 5LWYL 1L3NA 1E6OL 3MBWA 4WU7A 5E08L 1COBA 3B9KC 3LH2L 3ZN6A 1VJSA 2PO6B 2VRQA 1FE8L 2Y7MA 1D2OA 1XGRA 3JUYA 4JMNA 4J4PC 5T1JA 1TZHB 1QFOA 4JFVA 5I6XB 1UM6H 2CHWA 1SDAB 1OW0A 2EH7H 4C55A 4Q0XH 4H1LH 1YDPA 2E7MA 4PJ8D 3U6XS 5TE7L 1CTMA 2X1QA 1ZXQA 2H3NB 4NZUL 4APXA 1IZJA 3GBEA 1BVNT 3FZUC 4MXVF 1UM5L 2AJXL 4ORZC 3CFBA 2YWZA 1IJNA 2DWDB 3O2WH 4YFEA 3FT3B 1FG2A 1GGCH 2EIJB 3EDKA 1EHXA 4U1LB 4YSQA 3AROA 3HCVB 1EANA 1NLDL 2OMUA 2V6HA 2VXVH 3PGFH 4QRBA 4BJLA 3AUVA 5I1CL 5I9QB 1ZDSA 3CXFA 3I3EA 1UB6A 2FZ3B 1GZPB 3WKNA 4LCUA 2IH9A 3T3ME 4OZIB 1IE5A 1RCYA 4JRXD 2E7CA 2FHCA 2AMGA 2VH5H 4E42B 3EYSH 2HFEA 2NNXA 1QRNA 4ETYA 2JQMA 3HR5B 3RWIA 3ELQA 5LDUA 3FFCB 1KELH 3G04A 3I9PA 3P3YA 2X44D 3FB5A 3FFOA 4OCLC 3BFQG 2EYSB 3WFHA 5JW4N 1AR1D 2IH1A 5I1GH 3IJEA 3JXAA 3KPMB 2PO6A 1GW6A 5C2BH 3FB7B 2XVGA 4C8XA 1B0GA 4F7TB 5DLLA 4PMEA 1TZHA 1XVSA 1HKLH 2X4NB 3KMDA 1DSWA 2PP9A 1T0PB 2R0WL 4NZFA 4A38A 4DP1X 2DBJA 1VFOA 3GF8A 4AG4H 2R8SH 3N06B 1U4FA 3UEZA 4ZRGA 4BZYA 3EGDB 5KYNA 4IOSA 2ATAA 2DQTL 3EIFA 2H3NA 5KVEE 4FQIL 2C34A 2ZE0A 4BHUI 4ETQB 4WNJA 2F54E 2PUQT 3QIBB 4FQQB 3C09B 1VADB 3FSWA 2MQCA 3GZPA 1NDTA 2F7QA 2V2WA 1U0QA 4BGLA 4O2CA 2CJUL 1PL3A 3GBLA 2BP5M 4TLKA 4KHTH 3TH3T 1A02N 4IU3B 3ZYOA 5MP6L 5DEZA 1AE6H 2NY2C 4PS7A 2D9CA 4XP9H 4PFEA 1X7TA 3E0GA 1VFUA 2C1PB 2M1KA 4JJHA 1MOEA 2I60L 4G6JH 1GOHA 4XMLH 4GQQA 3VSVA 4TOYL 2V2TA 4U31A 5DRNA 4E42A 1VSCA 1X5GA 5T3ZE 4UNVA 1U9KA 1X7QA 4L8CB 1RPKA 2MJWA 3LQZA 4J6RL 4GG8B 4BFKA 1RZ7H 2D3JA 2KERA 2EYSA 1SN0A 5DA0B 5SWSA 5A2LH 1ORQB 4AYEC 1H3TA 4GMSH 3KPMA 4NWUH 2BHFA 2ADGA 1D2PA 3TXAA 1ZTMA 2A9DA 4TQHA 1HEZA 4HPHA 1S9VA 2YKLH 4O00A 4ZMPA 5FXCH 3BIKB 4EUPA 2APWA 5JIKA 5AG9A 4ZW6A 4HF5L 3C2SA 2XFXB 1N19A 2DPKA 2AW2A 1FIGL 1KN4H 3AXLA 1XTMA 5E6SB 4YDIH 3BP6A 5HDBF 1XF2B 3HKFA 3W9EB 1RIVL 3HS0C 4UUJA 5CN3A 1JK9B 3TYGH 3JBG7 4ETQA 3VYNA 4FQQA 4U6XB 1MI5D 1Q0XH 4XBPB 4AMXA 3U1SH 2HX9A 1YAZA 4S11A 3V2AR 1QAWA 3BWUF 2BSTB 3DRQB 4CC4C 3QO0B 5CZVH 4KVNH 1QSED 1A0QH 2NY5C 2PR4H 3LB6D 2Q86A 2AMUA 2ATKA 3VD9A 2GSMB 4PGDA 2J8OA 1JRHL 3L2NA 2B1HL 4DO6A 3N42F 35C8L 4PBDA 3O3DA 5MHSD 1FYTB 2QKIB 3C87A 1K8DB 2N1KA 4FMFA 4KXZH 5IJKC 4Y4FD 4NCDA 2WYTA 1KBGH 1NTDA 3EOBB 3IJHB 5DK0A 1NEZB 2W95A 5INDB 1DVTA 5FYLD 1BREA 3S36H 3ULAB 4GG8A 5D1XB 3VFRB 1OTUC 3LV3A 3QDGD 4LRNH 3TO4A 5HP5A 4GT7A 3U46B 1E6JH 1Z3GH 5DZLA 1KGCE 1RUPL 5EC2B 1D5IL 4OLWL 4JE4B 3JWNH 3RWDB 1QVOB 5I1DA 3X3GL 1OAUL 1CF8L 2NQ3A 3T6QC 3MRRB 5BV7H 3T2PA 1KJ2A 2PPDA 5E6IB 5FM4A 4MA8L 5KVEH 4HKBB 4D0CB 1D5ZB 4P2OC 4TLSA 3T1FA 1UURA 4AYDC 1XF2A 4KY1H 2HPTA 3W9EA 5I0YA 3O81A 4MB3A 3CVHL 3U2IA 4MRCA 3NACL 1JK9A 4W9EC 2D2CC 4HJ0C 1XZ0B 4BFGA 5L8LB 3S88L 1JNNL 2G3NA 2NX5E 4XBPA 1XGTB 4LSSL 4CAGA 3C2AL 3QO0A 3DWTA 3JTBA 2RB8A 3LQMA 5BRZD 1Y0LA 2D31B 2EXWC 3OHXB 4FQJL 4JFEA 3UTOA 2ALWA 2HTLD 4PGBB 3VXRD 4XPBH 5H94B 3T0XA 1WZKA 1TZ8A 3VFGH 4FLHA 3FB8A 3D2UB 5T3ZH 2F53E 5AB9A 5HVWA 1RZKC 4AV5A 5CJXA 3CIQA 1GC1L 5ACMA 4J3OG 3CVHB 4AXWA 3QFJB 2R0LH 4FNLH 1SOKA 4LE8A 4QRPB 3MX0A 3EOBA 2EDEA 4HQQL 2DD8L 1TJHH 1IIIA 3RA7L 1NEZA 4MYPA 2Q8BH 3NJIA 1S8DA 1J0YA 1KXVA 5I76B 3ZZLA 1JOIA 1Q9WA 4D8PB 2CKBL 4KUCF 5IJVA 2FT7A 3SDDD 1OPGL 1LE9B 2EAEA 2VERN 3GKWH 2VLKD 2HVJA 4K3HA 4NHUB 1X6LA 1J12A 5EC2A 2VLLA 4L8BB 3Q5TA 4KKQA 4YK4C 5EWIL 3I9GH 3SYCA 4H4NA 4A55A 4YSEA 3TH4T 4AOFA 5E6IA 4HKBA 3RWCB 4GW5B 3TT3H 3OQ3B 1JVKA 3KGSA 1ID2A 3DXAE 4AKPA 2ZOTA 2CKBB 1EO5A 5F88B 4FQPA 3C6SA 1MHEB 2ICEC 4FFYH 1PJ9A 5H37A 1BVZA 1L9RA 5CILH 2G2RA 2FO4A 1I8AA 1F6AA 3RVWD 3OHXA 5CO1A 3I6KA 3TO2B 1TUPA 5GZNA 3SKNA 4KU1A 5H94A 3FT2A 2QSQA 1Z0MA 3IFPB 4U4IA 2ID5A 2GJRA 1EFXB 3SDXE 5JNYB 4ZTPH 5C6PB 1ZIAA 2YKKA 4M5YH 4UQ3A 1JRHI 3CVHA 4N0CC 2B5IB 4OD1H 3HC0A 3LSOA 4RVBA 5JMOC 4FP8H 5C0IB 5DEFB 5IEHB 2RAMA 2R56H 4BWUA 2UYLB 3H42L 1XIWD 2A77L 1GSKA 2BC4B 3LH8A 1PLGL 3F84A 3OZ9L 3VGGA 3VQLA 3FUNA 5FA4A 2AFNA 4X4ME 1U21A 2HH0L 3JTTA 1G9NH 3I6GB 1X5ZA 4KKLC 3PWJA 4NHUA 1NDMB 3FHEA 3RG1C 1SYSB 1MHPH 1OSPL 4L8BA 4S0HA 3UH8A 2MEJB 2OKMA 4O2EB 3ZE2B 4X6DB 1FFNB 2VDML 1BFOA 1MKFA 4H88H 4HT1L 3GD1C 4LLYB 1DANT 4X50A 3LXAA 5IHHA 4X9IA 3SYQA 3GZKA 3ZKND 2JKJA 1D3CA 4PJ9B 2V3EA 1G5GA 3VFNA 5E1HB 4OIFA 5DRZB 4NP4H 3SPHA 5E4EB 4Q9CA 2D7QA 4G6MH 3SQRA 2YQBA 3CLEL 3UTPE 4I5BA 3QQDB 3ULVL 5AOKA 4Q9QH 1T0NA 1OCWH 4ODXB 3WIAA 4MMXB 3ECUA 3PP4L 2BLFA 4QRRD 3VJ6B 3M8OH 4KTYA 5TK4A 4NPJA 1G6RL 2VDMB 2J25A 1WIUA 2ATPB 5GGVH 5HI3D 4MMZB 5GGSB 1A6WH 2F15A 3WV0A 5GZOC 4FFWC 1H8LA 5BQDA 2I9TB 4ONFH 32C2B 2YMXL 2XV3A 4XP5L 4DGIL 2OQJA 5F3HA 4OLVH 2IIJA 1HYRC 1L5GA 5HDWA 5SV3A 3UTTE 5IEHA 3IEAA 1F3JB 3Q0HA 4DEPB 2JLLA 4BQ8A 2CLVB 1ADQA 3N6YA 2BC4A 2BP0B 4NI3A 3DRTA 4XB8A 4ENEC 4O4YL 1QR1B 3ZRSA 1J0IA 1Z9LA 5DSCA 3JVFC 5GXBB 3DIFB 1NKRA 1T1XA 2EUVA 2P8PA 3W82A 1KWGA 4QJ4B 1G6RB 3GBML 1SYSA 2AZAA 4EXKA 4MAYD 2D73A 4H8HA 5C09B 2BY3A 5I8EB 3TU6A 5CLWA 2D3VA 1N59A 3BOVA 1XF3A 4R8WL 2HVKA 3HPJB 4ZFFA 2VN5A 5D6DA 1CD0A 3LKRB 1G87A 4I85A 4GSDL 1WFMA 4EAEA 4R90H 5AYUL 2BNRB 1NIDA 3O3UN 3HLKA 4AYGA 2A7BA 3QEQE 3Q9PA 2B59A 4YE4L 3HI6H 1PLBA 3ULSB 5HVFB 2V17H 4WWID 4IEFB 3BGMB 3IDGB 1CB4A 4NYLA 4YHOH 4L18A 5AL0A 1UCBH 2UXFA 4NZRL 1HHKB 1XCTA 4ODXA 5CM1A 2EEBA 1KPRB 3VXNB 5EA0H 3G7TA 4IBWA 3CFIC 3V6OC 5HGDB 4BXSV 4NX0A 5DUPL 1FNLA 1IC5L 4MMZA 5FYKU 3DK2A 4PV1C 5LN8A 3U83A 2I9TA 3OZLA 5DHVA 5JHAA 2L3BA 2X42A 3TBYB 2R59A 3S3DB 4N8CH 4DUVA 5JHDA 2HMIC 1O6SB 4YHIA 3TF7C 4HKJA 3AREC 4GI9A 5D1ZD 2XNAA 4TXVB 1XR9B 3TNMB 4UDUB 2ZOOA 3L4VA 1QR1A 3EJRA 1K6QL 3QO1A 4K23H 3IFLL 2ADJB 4Y19D 5KW9L 1YO4A 1VLXA 4AQ8C 3CQQA 3QORB 2F61A 4QKTA 2V3DA 1B6UA 5DJ8A 5IFAL 1URLA 1UXWB 2QVMA 3ES6A 4XR8C 4Z3HA 4G83A 3SSGA 3DO3A 3OPUA 5KBLA 3LKRA 1I85A 2Y24A 3N04A 1B9ZA 3HE7D 3NIDB 3FW6A 2ZG2A 4PM1A 4PEEA 1CD1A 4BK5A 3VD5A 1QLFB 2BJMH 5EIIA 4YXKH 3KPQA 2O72A 2EEDA 4IEFA 3BGMA 4HS3B 3STZA 4M8QB 4KKAC 4S1SL 1HHKA 1PZUB 1K2DB 3MGTA 1QZNA 2A74C 3ULVF 3TLRA 4GLRH 3TGXA 3P2BA 1MRCL 1PNCA 2RALA 2WJ7A 2EEFA 5CU9A 4JPVL 5AB1A 4JFDE 3VX0A 3WIHH 2A83B 4Z7QB 2DYRB 4IOSD 1J0JA 3LYRA 1KACB 2IBGA 3HZKB 3ZOAA 4AT6A 1JZ5A 1R5IA 4HC1L 4OZ4B 3L5HA 1BD2A 2WLLB 4FA8A 4JZJA 1K8IA 1QLEL 2P5WB 2V7NA 5C6TH 4D9LH 5K9JL 1JWSB 2CH8A 5IQNA 2ENJA 3C60B 4XCCL 3H2WA 3MMEA 5HTSA 2YXWA 5A2FA 3S37H 4IRZH 4BE5A 4KJWC 2X12A 4BRVA 4GBXA 4JLRA 1QD0A 5AOLA 2MOVA 1QNZH 1DDHA 2K7QA 4NZTH 1ACXA 2HKHH 5C0CB 1BLNB 5AAPA 4K5PA 4TUOB 1NBVH 1MIEL 5IT2L 1FGVL 4GW4B 2WXNA 5JW4M 1S7XA 1ILUA 3HUJB 3NZ8B 4HIJA 4HJJH 2BSSA 4KK8C 3VMNA 1QLEB 2OP4L 3MNWB 4YPGB 1R5VA 2R1XA 4JDVA 5B1BB 1Z66A 4QY8B 1H5BA 2F08A 2WTRA 5SWSD 5FOJA 3H0TB 2CO4A 3L95A 4Y5XC 3D69B 4JGNA 4I48A 3STLB 3DJSA 5DQDL 3ZLQC 2EO7A 3CLFH 3TV3L 2UY7A 4LOFA 1B0WA 3VSQA 2K9FB 4OGYL 4X7TB 3R0MA 5B1AB 3T65B 1JCKA 2QPEB 4JVWA 4M6OL 3K0WA 3NCWA 4YAQB 1K2DA 1CXIA 1RZJC 1J1PL 4WEUD 3NCXA 4JFOA 4PVLA 3U2JA 1H15B 4P5KA 2VW7A 5BS0B 1B3IA 4X5RA 2H45A 4F15C 2EDHA 3HZKA 1NCOA 4MSWB 2XY2A 4NO3B 4UAOC 5C97A 5BZDB 2I27N 2ITEA 2JJVA 4B9ZA 4OZ4A 2WLLA 5AW8B 4JK0D 1LK2A 1CFQA 4A2HA 3OGOE 2GUOB 1CFTB 1JWSA 1FNAA 3ROLA 3C60A 2GSGA 2ZXAA 5IV2A 1F18A 4LF3B 4LLWB 1AO7B 2Y7LA 4HJGA 1R9FA 4NENB 4KX8A 5H4YA 2FR4B 4ESKA 5E8EA 5DZOA 4WFHE 3U36B 1XSKA 2OZ4L 1LEGA 4UM9A 5LG1A 1WC7A 5F9JA 5D8JH 4P4KC 4O51B 3BFOA 4HC1A 5C0GA 5IBLD 1OZUA 3IFNL 3IF1B 3OLDA 4Z7QF 1A9BA 3QFGA 4HU2A 2HCZX 4QY8A 2FL5B 3MNZB 4MNQB 5I75B 3TO4D 2HT3C 2H47C 3H0TA 1NMBH 1QLRB 3FO1A 4FNSA 3D3VA 4Y2DC 1A14L 3F5WA 4TNEA 5KTEL 2FT8A 2EIBA 4RMTA 3RGVB 3M86A 2SODB 4H2AA 4X7TA 3FN9A 3L2LA 4MX7A 2D0HA 1YEKH 2JB6B 3ARFC 2H6UA 2FBOJ 1JDDA 2RGSA 4YHLH 1H15A 2H7WA 4KUCD 5C0AA 5IQLA 5BS0A 1FL5A 4TNGA 2PXYB 4HJUA 5CLTA 1EH9A 3TEYA 5DFAA 1TTRA 2VDOL 1XHHA 4MSWA 2M2DA 2QT6A 5D1QD 1ET5A 1LWJA 1RFDH 2P80D 3V5DB 4AVJA 2EUZA 4C4KO 2GUOA 3DUHA 4KTDH 4M7KH 3CSYA 3ROOB 2PKDA 1SZNA 4JFED 3QUYA 4PCSA 1KJVB 3HVDA 4ZG1A 3O6KH 5HHQB 3PHOA 3QDAA 4M5SA 1BQHB 3V79C 2K4WA 5C8JA 2J1WA 2BY0A 3SPJA 3TA3B 2ICES 4EN3A 2UWEE 5DMGC 3JSSA 5GHWH 3V6OE 3FH7A 4JO1H 2VDOB 3K71B 3IDYC 3MV9A 3QJVB 4E9LA 3V4UL 1UUNA 3LKOA 5KSAC 3WTUA 4XZUB 1XSOA 4N0UB 2FL5A 3NP3A 4JPWL 2A6JB 3UYRL 1QTPA 4PRHE 3NIGF 3KCPA 4KV5E 1DTUA 4XTRD 3WIFA 5CBEB 2OMWA 3KVDD 1TCMA 4XWOD 2CJ3A 2H1PL 2JB6A 2I9LA 1LL1A 2YWYA 1JHLL 2AXGA 3G6JE 3OXSB 4PPTA 5GGUA 1UVQB 4QAWA 5CIPA 4C4BA 2Y1AA 3AG4B 4DKAA 5CCJA 4RBPH 4W93A 3O0LA 5FM5O 3WFZA 2VXQH 4FG6D 4NSKB 4POZD 1NAKL 4P3CL 4PR5B 4KTEL 5J0BA 1AI1L 4Y4KB 2FIRT 4N2DA 1QTSA 2B3IA 1F5WA 3V5DA 7FABH 4HIHB 3DX6A 1E4KC 2YD2A 4HULB 1XGQA 4OZFG 3D09A 3ROOA 2K45A 4G8GE 4YR6A 4GIOA 3QVAA 4TLUA 5GZND 5IR1A 1NGYB 1TDQA 1MZZA 2FQFA 5D7IE 3TA3A 1EHNA 1BIIB 2VSMB 4N2OA 5E2VH 4HFUL 2WO4A 5JIIA 5IW3A 4UT6L 2CK0L 3O8XD 5KBKA 2MRYA 3RI5K 5I6XC 1P4BH 3RKDC 3K6DA 2WLYA 2KH2B 3BYTA 5IROC 1MCBA 4G5AA 3AJ7A 4OIIH 3CVBA 4YO0B 4N0UA 4YBHA 3QUXD 4KK6C 2BVUA 5KVFL 2NW2A 4P4RB 3TBVB 2VC2L 2X6UA 1F58H 3SKJH 2FQEA 2W80C 1PCSA 5IQ7L 1F1DA 5T8IA 5A43C 3AAZB 1C1EH 1LP9F 1OD7A 2EDBA 3HG4A 4RAHA 3U4AA 5IFJA 5I9QC 2LABA 5ISZE 3OKDB 5F0LB 1NA8A 1HWWA 1J86A 3U79A 2QQKL 3VXOB 1TFHA 2CR6A 2ZSWA 3ISWA 4ONHB 3SE9L 3W38A 4AVKA 1P2CB 4NSKA 4AYFB 3CFCL 3VXMA 2NLJA 5EF3A 3LKSA 1EGJL 4B3EA 4DP8X 3BZEA 5ICUA 3D5OF 2VC2B 3F7LA 3GT6A 3QUMA 4UINH 1X5FA 4P2QA 4G8EB 4ELME 2JKNA 2FRGP 5D2LB 5E8OA 2PCPB 1K3ZA 1NGYA 5AL8A 1BBDL 3PJLA 2VDRL 4I4WB 4CVZB 2V9TA 3RP1A 4EIBA 4KMTL 3QIUB 1RHHA 5DU7A 4GRWE 2DQ6A 3LHAA 2X0UA 3WGVB 3FQTB 4F57H 2K4AA 4WHTA 3MREA 1VCBC 2JKWA 4JAMA 3NRQA 1MCOL 5E8DL 2AK1L 1O75A 3UDWC 3G5WA 3K72A 5DVLA 4WUKL 3M07A 1B88A 1X5LA 1N64L 3PFUA 3OR6B 2FH6A 4WI0A 1SM3L 1KNOB 2ENPA 2VRAA 3UO8B 1J8KA 4TQEH 2JB5L 1WZMA 4FL4B 3SE3A 2VN4A 5D71H 5HHOA 1WRFA 2Z0UA 3QIBC 1OAQL 1JXGA 1CIUA 2N56A 3C09C 4M7ZB 2QGCA 3TBVA 3ZTNH 3NH7H 4X7CC 5KZCD 1XH0A 3EDDA 4UQCA 3K7UA 1ORSB 5I6LA 1CUOA 3IKKA 1DZBA 1RK1A 4XMTA 1MIML 5JORB 1FFPB 4XH2A 2WWKO 1AFVL 2OJEB 1YPZE 4ONHA 4J28A 3TL5A 3GLEA 1TQVA 1I8UA 5F7UA 1MJ7L 3GSWA 3GSQB 1NAMH 1LNUB 2A6KB 3ZDYE 2BIPA 1NANI 1IX2A 4NN6C 5G2NA 1WCBA 3F12B 3VXQA 1JGUH 2J6WA 4LCWA 5DCCA 1PG7X 5HGBB 4KKBC 2DQCH 1AGDB 1ZA6B 2I7OA 5B22A 5E2WH 3UZQB 1T3FA 1LVEA 5E23A 2PCPA 3UBFA 1A9EB 1M7IB 1CYGA 3X3FL 4RWYL 3QNXA 5B38B 1XXFC 3FQWB 5LHDA 2QADB 4GQRA 2P8LA 4FHJA 4GAGH 4BUHA 2QSTA 2Y2TA 3OM3B 5JHDD 1IGYA 1FN4B 2OBGA 3D18A 5BJTB 2LE9A 4WO4A 1A1OB 1QSEB 1OY3B 1S9YB 4PJDB 2VZTA 5TTRA 2PYEA 3IRZA 5KYUB 1T5WB 1HL8A 3FO2B 2VXUL 43C9A 3L13A 4Q6IC 1XGYH 2JXMB 4WUUB 1F56A 4W9DC 2DLFL 1I7TA 4CADB 2BNUA 2XG5A 3PHQA 5KANI 1BBJB 3QG7L 5CGTA 2RR3A 1AMYA 3FONA 4XP1H 5CJ5A 4OI8A 3C9NB 4BZ2L 1MLBB 3H7BA 3HC3H 3S35L 2DQDL 2ZP0T 3X11B 1B2YA 1FFPA 3JQOB 4UBDC 5ETUB 4Q9RL 1LXMA 2OJEA 5GRVK 1UG9A 1VZHA 2YRPA 3WBDA 2Q0ZX 5GRJL 1N6QL 4FKEA 1OKEA 4XPFL 3O9WB 1RK0A 3IJSA 3TASA 5I8KH 2GITB 3QDGB 5FKAA 5J57B 2A6KA 4KK5D 1UZ6E 4L5FE 4N1EA 1N3NB 3LZFH 1L4IA 2ITDB 1WITA 1LO4H 4HS6B 5HGBA 1HHGB 3MUGA 2HB0A 3FSAA 3MLUL 2B4CH 1TEFA 1KPUB 3JT2A 4LARH 2ZOWA 5D1XC 4M8UA 3QQ4B 4GRWH 2X4UB 3QG6A 1LGVA 1M7IA 2EE9A 3GI9L 4WSGA 4FXGA 2WQXA 2NNRA 4XVTH 5EEWA 3T1WA 3GXTA 5F7DA 5LAXB 4GSRA 4ZPVA 2W60A 4M1GL 4QO1A 3BEWA 3RTQD 5LNGA 2O4EA 3AWGA 4NQDE 1NOAA 4DOHB 3GZQA 5AB2A 3EOTL 2DL2A 4WFEE 4UOW0 1SMAA 2AXFB 3T8XB 5K39A 2X1WL 2PTTA 4OLXH 2AXWA 1QRNE 3AY4A 4BQ6A 1NC2B 3L1OL 3MRCA 4KI5F 5EOCH 5IEKB 5KVDE 4GBXD 3EH2A 1JGEA 4MD0B 1YJDL 5E6YA 4LDCA 3T2NL 3SDCB 5FC9A 1AJ7H 1MG3C 4JB9H 2F74B 4Y4HA 2D2OA 4GI8A 1AAJA 3DV6A 4Q74A 5J12B 1HHIB 4L4TA 3CVIL 1R5WA 2IGFH 4MQ7B 2YD0A 5IW1B 2JI2A 4FTVD 4NWTL 3O9WA 3HG1D 1PQZB 5C2UB 2UZXA 3FK3A 3UC0L 1N3NA 2VLKB 3BKJL 4QRQA 2EEAA 4P9ML 3GJFB 3GNML 1AZVA 3H56A 1EZVX 1HHGA 1H3WM 1P4LA 3B9AA 5AW9B 1USQA 3CFEA 4GI6A 4J3OF 2JJSC 2P3YA 2K6WA 1TJIH 1ZT7A 2X4UA 3HFFA 3H7LA 1UM4L 3C8KA 3OPZL 4FHBD 4HWBA 4JRWA 4WW2A 4DH2A 3P0YH 4KDWA 2CMRL 2XJKA 5DMIL 5GS1B 4ZD3L 1CURA 3A67H 1CXEA 3GGWB 1N7ML 3RX5A 2A4ZA 5HD8C 5T5FL 1EIBA 2DEXX 3Q05A 1PDKA 4G7VH 1FL3A 1GC1C 4J8RB 4XT1C 2AGJH 4OZIE 1TLKA 1NSNH 3DSFL 2AXFA 2IOOA 4PUBH 7TAAA 2BVQB 1PZ5B 1ZV9A 1T1YB 5E00A 2VDPH 4XN7A 3SPIA 2D0FA 2YD8A 1CG9B 5I1JL 1HKFA 3FFCE 4OV6F 3F62A 3MYJB 4MD0A 4MLSA 2Y3NA 4AGPA 2FLRT 2EUWA 1BPLB 2AQ1A 4UM9D 3ATEA 1WSST 1A9VA 2NW3A 1HIML 3V7AE 4L5FH 3N2JA 1YEGL 2VISA 4WW2F 4XPTL 5DJXA 1PQZA 1OLZA 4PLOB 2YMOA 1WBXB 2WV3A 5HPMB 2B5IC 4LLUB 1Z9SA 2CO3A 2SEBB 2AP2A 3D3VD 5EV7A 1MG2C 5CEZL 3MGOB 1ICTA 4LXFA 1L6PA 4ABVA 5C9JB 1PY9A 3MCLH 3WNMA 2EZ0D 3D12B 1G7JB 4LSUL 4V1DB 4TNFA 1JNLL 2APFA 5FYJL 4W6YB 5C0AD 4H20H 4PTUB 3MRPB 3U48A 2XV0A 3L1FA 5IGXH 1G5AA 4AIOA 2AK4D 3PWNA 4QHNB 2V9QA 2WXLA 5FCUL 2PWEA 4J8RA 4JKMA 3RQ3A 43CAB 4HIXL 5KSBA 4WHDA 3WEOA 1U30A 3EKCA 1HINL 5KVDH 1SJHB 4PJ9C 2H6PB 3WEXA 4KAQL 2L4OA 2BVQA 4DSYA 3MRLA 2W9EL 3QUYD 4N2BA 1WVZA 3SGDI 1T1YA 2Y36H 4QRRB 1PKQB 1RY7B 2FHFA 4LGRB 1KN2L 2ARJQ 2YXVA 3ALWA 3HMXL 4F1ZA 4HUCA 4EN3D 2FGWL 3SJVB 3SQBB 4Y7OC 5TD4A 1ED3B 4S1DC 1UHVA 4O2FB 2D7PA 5T5FA 2EE6A 2BK8A 4MMXC 4L9LB 2ZWZA 2EH8L 1I53A 4KI1A 5DJYB 5F6HI 2R0ZH 1ZGLM 3EYQC 4CMMB 1DVSA 1M57B 3JYCA 5KYYB 3U0WH 5CU5A 3IE9A 1TG8A 4K94L 5DHDA 2BXYA 1OP9A 1BWMA 1WBXA 1KPVB 1IBHA 4G8AC 5F3BB 1EEUA 3HB3B 1VCAA 1E6OH 3D34A 5F7EL 5E08H 2F68X 1WISA 3A47A 3LH2H 2AQ2A 5KSBF 3CH8A 4MAYB 1FE8H 2BIQA 1MFCL 3BCFA 2BX5A 3NZUA 1KLUA 1D9KA 2WVUA 4URTB 1DBBL 5FGRA 5DJDB 1RAMA 3WGUB 3B2PA 1G7JA 1J8HA 4V1DA 5LKNA 1CVSC 4H8WL 4PTUA 3MRPA 5TE7H 1Y18A 1QRKA 2XWDA 3FU5A 3MC0A 3NSXA 4ZO6A 5HBBA 2G2PA 4NZUH 4Y1AB 3UCRA 1FYTE 3OV6A 4NM4H 3L3JA 4YUEL 2AJXH 3SE6A 3QXAA 3L5XL 1FL6B 1I8KB 1FVEA 3BO8B 1OAKL 1X5HA 1IBBA 1NLDH 1PKQA 4UZUA 2VW4A 3F04A 2B39A 4BWWA 1YY9C 5F7YC 3B2VH 3VFVB 1KXQA 5D1XE 3JV6A 3E9UA 3MI6A 1FDLL 3KPPB 1KYOJ 1ACYL 4JHZA 4N0YH 4RLDA 3LCYA 4YBQC 3IDUA 4JL2A 2JV6A 3QHFL 4AEHL 5IMOA 1OSZA 1QQDA 4PGCB 4L9LA 1PZCA 1S7WA 2EDLA 4LPTA 1IC0A 4GKSA 2ZOLA 1OAXL 1V27A 5KYYA 4RMRA 3RY6A 1W15A 4PV8B 2CZNA 5I8OL 3GFUA 2IWGA 1OGPA 1U8PA 3WIIL 4TNVK 3FO9B 4XAKE 1MCDA 3D39D 4MKMA 3X17A 1JGIA 3C5SA 3OF6A 3WJMB 4BDVB 5C7XL 3HMXA 1QSVA 1P1ZA 4FFVD 1I1AA 1NPUA 2EYTB 4EI6B 1RUAL 1UD3A 3AGVA 5LGYA 3F05A 2R0WH 5IMLB 3SODB 2V7HB 4NN7B 1JSYA 2TAAA 2VDNL 3B2XA 3HE7B 3QORC 2DQTH 2YC1B 2XPGA 3IU4L 4FQIH 3VXMD 5E6RB 4IGBB 2FJFA 3ARBB 3N0AA 3PDDA 3DVIA 4LP5A 2VIRB 3G5ZB 1BAGA 3QFJE 4GO6B 3NT0A 4CC1A 4QRPE 4FQXB 4ZXBB 5C71A 4WSKA 1FZJA 2RQ8A 3EADA 4S0SD 5MP6H 1U8OA 2PPEA 4QJ3B 2HRPH 1U8LA 4X5QA 4X6EB 4NJ9L 2X41A 3EUDA 3KPPA 5J13B 4Q2ZA 1OP3H 1E2ZA 2RACA 3OX8A 4JZOA 2P7TB 2QGDA 2I60H 4HCRA 1IGJB 4WWKB 5AVSB 4FI7A 4PGCA 4TOYH 2NNAB 5CINL 2ZWKA 4GB9A 2PCFA 4PWFA 2F8VA 4I2XA 1A7QL 3NEEA 4C83B 3TEUA 2D7TL 4FYSA 4YH6A 1GOFA 4MQSB 4U0QB 4HZLB 4DZBA 1FC2D 4J6RH 5HHOD 5J8OA 4NIYE 4NGHH 4RRPA 4AQAB 1U95B 3P73A 3WJMA 1JXKA 4UANA 5EOTB 3OAZH 1FO0L 1G4RA 2VLJA 3P30L 5ICYB 3KVQA 4HF5H 5E56A 5B7FA 1MFAL 3CAFA 4HWNA 2L7EA 2EIZB 1VZIA 5DC2A 3QNFA 1VGKB 1MNUL 4DT2A 1CIDA 5L9DL 4PWJA 3ZKMD 5KOVC 4FJYA 1Z0NA 2EVJA 4IGBA 1LHZA 1DVXA 1EMTL 1BF2A 3U4EB 3UBHA 1QBLL 3PCYA 4LCWD 3FQRA 4OFIA 5EO1A 2KT6A 3SPCA 3CH1A 5F1KC 4BH7B 1FO0B 1VDGA 2IXQA 5D1ZI 1II4E 3MO1B 2P5EA 1B0IA 3ZDZF 1YZZA 5TK2A 3ZYIA 5KJRL 2B1HH 35C8H 3ETSA 4L1TA 4X6EA 1PW3A 5K9OA 3WY4A 3QZWB 3BAXA 2HJFA 1J5DA 1YMMD 2IC2A 3CFKB 4EMZA 3TX4A 3LIZL 4R84A 4WWKA 4R7VA 5F6IB 4B0MB 2NNAA 1E30A 1H3PL 4Z7WF 1GYAA 1BQUA 3ZE2E 4C83A 4JO4L 4NNPH 4WO4D 4X6DE 4P49A 3OKKA 4ZFGH 2PYED 2FWOB 4OCNC 2XV2A 3VWKD 2A73B 1FRGH 4RBPK 3RIFK 1XD0A 3HMWL 4XOCA 5BVPL 4GP8B 4J7RA 1JV5B 1RUPH 1AHWA 1A6ZB 1D5IH 4OLWH 4XI5D 1INDL 3KPLB 1PLCA 1UYWL 3X3GH 1CMOA 3ARDA 3ECVA 1CF8H 1XGPB 2BMKA 4I0KA 4M62L 2EIZA 4MA8H 2ZUTA 4HWEL 3VNZA 1VGKA 4MASA 1RERA 5AUMA 2GTZB 4Y88A 2ZWSA 3VQMA 4HUWB 2XN9A 4KI5D 4WF7A 3CVHH 4K3EL 5DJ2B 5IB5B 1KWKA 1NUFA 2WMPA 2R15A 3M7FB 3S88H 1E4WL 1JNNH 4PJGA 2V3FA 2CDEB 2VOTA 4KTGA 1L0XA 3GLDA 4K7PH 4PJFA 4XX1E 1CDIA 2WLZA 3C2AH 5D6CB 1CWVA 4KDTA 3HRPA 5B39B 1FO0A 2BOCA 3OXRA 4AIEA 5I75C 1WZ1L 1KYUA 3RUGB 2WBKA 3F8UB 5J9PB 4Z7VA 5GRUL 4JG1H 3V0EA 4H1LG 3RGVC 1U8KA 2FECL 1NCDL 3A4FA 3PL6A 5A2AA 1KGIA 4W4OA 3JV4A 4HXAL 4X98A 5D1QB 1MAML 1CDCA 3P4NA 3N9GL 3R06B 3G08B 4HQQH 1JWMB 2BSRA 2DD8H 3GTNA 5C09E 3ILQD 4J3OD 1IQDA 1Z32X 3B3BA 1JE6A 1UB5A 2HLEB 3GM0A 2V5SA 3L9RB 4RDQG 4Z3GA 1P84K 2PXYC 2BY2A 5AAMC 3VXUE 2CKBH 3B5HA 3NJLA 3QXDB 1H6FA 3BN9D 1PLAA 1ZANL 2A99A 5CCGE 1RUML 2V5YA 2BNRE 3GS4A 5IIEB 4PJGF 4XNQB 2OYLA 1YCSA 2VQTA 3ME0B 3V0HA 1INEH 4PJFF 3F6JA 1QPPA 2MNJB 1P5UA 2XWJA 2YGQA 4UZGA 4UZSA 4Y4HD 1DUYB 3MTRA 4WIQA 5DRWA 3LIZA 3PLYA 4P46D 5EWIH 4ABQA 2CR3A 5LBGA 4L4TD 3VX1A 3W39B 2A9CA 2Y6SC 3D2TA 4Z7VF 3U1QA 3SCMB 4DFIA 1T7VA 1JHTB 1AC0A 4BKTC 3H53A 1F4WL 4OZHA 2AABL 1PS3A 3BZ4B 1UADC 5EZPA 3RIAF 5LJYH 2CDEA 4IMKC 4PG9B 3U2SA 2FLMA 4ODTL 4P2RA 5IESL 1AD0B 1ADQH 2E75C 3EJYC 5SWZA 4XNYL 5B39A 3GSXA 3RVXD 4EDXA 3BVXA 5F1IA 5ALBL 5JZ7D 1ML0A 4M1DL 4C56D 3DBSA 3CTTA 1ZLEA 4DQOL 2VO8A 2WXHA 4TTGA 5E4AA 1TPXB 1EAJA 4DF9A 3HNVH 2H5UA 5GISL 3G5YB 3HPLB 5C6WH 1YUHB 1RZIA 1JD7A 5HI4C 2VNCA 3B8YA 1T22B 3PGDA 3SY0B 5FLUA 1KXHA 2OMYA 4MNHA 2OTPA 3RE0A 2GPZA 4QGTA 3H42H 5DD0L 2FEEL 1BZ8A 2A77H 1PLGH 1PU0A 3G9VA 3OZ9H 3QXDA 2D4FA 5FKPA 1ADWA 4FMKA 1AZBA 2HH0H 1U3JA 2Y7QB 4Y4KC 1I1YB 4OZHF 3NIDE 3F85A 4RAUB 3MRGB 3D85B 4F8QA 4GEIA 1FYHB 1JZ4A 1OSPH 2NNCA 4N20A 2ERJC 5B3JE 3O8XB 1KEGL 3G9AB 1BF5A 4IBLT 1TR7A 3BSHA 4OV5A 5I73B 3TEXA 1KCRL 3VH8G 1DJHA 3CZFB 5F7AA 1HEJC 2APBA 1NWOA 2LLLA 3T6WA 3W39A 2YMTA 4PJ8C 3BJ91 3SCMA 4AM0Q 5DHVH 4HJIA 3QUXB 3BAYA 4U1KA 3SKMA 2IBZX 4AQEA 2WXFA 4X5WA 5FIEA 4B95C 1BHGA 4IK7A 1GY1A 2WGXA 3EHBB 4FJZA 3QYMA 4DGUA 5AOJA 1ETB1 2VSKB 2VR4A 1YEDA 5BRPA 3CLEH 1KBVA 4H25A 4LOEA 3ULVH 3SPVA 3O11B 4KVCH 5HYFA 1ZT4B 2P5WE 4BFJA 4XNZC 4PJEE 2AQPA 4I3SH 5EF2A 3ZL4L 4K8RD 4JPIB 1S3RA 3VFMA 1I3RA 3L3IA 5DT1H 2OK0L 2VMCA 2OMXB 2YMXH 3LPFA 4XP5H 4JO2L 1C5DA 2ITCB 4DGIH 2FECI 4LGPB 5C0CE 4GAYB