3CBKB

Chagasin-cathepsin b
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
110
structure length
110
Chain Sequence
MSHKVTKAHNGATLTVAVGELVEIQLPSNPTTGFAWYFEGGTKESPNESMFTVENKYFPPDSKLLGAGGTEHFHVTVKAAGTHAVNLTYMRPWTGPSHDSERFTVYLKAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Displacement of the occluding loop by the parasite protein, chagasin, results in efficient inhibition of human cathepsin B.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Cathepsin B
total genus 22
structure length 110
sequence length 110
ec nomenclature
pdb deposition date 2008-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF09394 Inhibitor_I42 Chagasin family peptidase inhibitor I42
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2020 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3cbkB00
2OULB 2WGNB 3E1ZA 2NQDA 3M86A 3CBJB 3CBKB 2FO8A 3M88A 3PNRB 2NNRA 2H7WA 2C34A
chains in the Genus database with same CATH superfamily
3P3YA 4JN2A 3K72B 4O51B 4P5KB 3UEQA 1KIRB 4PWHA 4RQQA 3V6ZA 4X2UA 3QP3A 5H37H 3O6LH 4FNUA 3GYRA 2OSWA 2BSRA 2DBJA 4KQ0A 4TTDD 1QKZL 1WWBX 1X7SA 1KG0B 1RU9L 1JDDA 4B41A 4D0DA 4NQTA 3MKGA 1Q0YH 4POZC 1ACYL 4Y4FC 4AEHL 5EZJA 1TLKA 1I3VA 3D18B 2R1XA 3VXME 1NIFA 2B5IC 1L9SA 3C75A 1GOHA 3HRZC 4BZ2A 8FABB 1X9UA 4G9DB 3C2SA 5J3HD 2WB7A 3CVBA 3JWNC 1QYGH 4P9HL 3LN5B 3C08L 3ABZA 5INCB 5J8OA 3DKHA 2PXYD 1E27A 2FBOJ 4XCNB 2BH0A 2R4SH 2YKKA 3NRFA 1WAEA 2H32B 4Q2ZB 3BD5A 1YNKH 2A83B 3PXLA 3O8XC 4L8DA 3VB8A 3MI6A 4FN0A 3SYPA 2YPLE 1SEQL 4OD3L 4WUUB 4TNFA 5FO9A 5I8CA 1F90L 2KMWA 4GS7B 2KZ1B 2NY5H 2X4OA 4MJ4A 5FYJH 4A7SA 4UYPA 4UB0L 2DWEA 3VXUD 2X7LB 5JXAH 5DUMH 1HI6B 2DTMH 1IM3D 2XWTB 2DL9A 2PYEB 3TBWB 1RV6X 3CBRA 4N24A 5FKAA 1IE4A 2VXSH 4GKOA 4HUUA 3FXIC 7PCYA 5LWYH 1KIQB 2XWBA 1C12B 1W0WA 5HGAA 2EQDA 1L5GB 2LTQB 2OYPA 4FOMA 4XWOD 3V0EA 1A7OL 1AXIB 2Q76A 4HAGA 4U4IA 4U1NB 2JXMB 5EF0A 1E27B 3QVAA 4OM1L 5KTEL 4XP1H 2ZXWB 5DC4B 5H35B 4HCRA 4U7SA 3BKMH 5DRWB 2F54B 2VLJD 4K07A 4MD0A 3KD4A 3VU2A 3TFKD 4RZCB 2DQGL 4A6YB 5FGBC 1Q9LA 3OPZL 4X5QA 2X2YA 1IKFL 1CXLA 4HJGB 4X4MA 5D7LE 3NJIA 1JHLH 1MFBL 4PWEA 2K70A 5ILTH 3F01A 4APQB 1S7XB 4JFYA 3D48R 4E9QA 4TQIA 4AK1A 4I2XA 4L9DA 4PJCB 3BWAA 1KIQA 2XWBB 3V5DB 4GMSH 4NEHB 5CN2A 4KV5F 4WGWB 4HP5A 1L4IA 2DMCA 4LSDA 2YRBA 1BF8A 3WJLA 3P3TA 4N2CA 4HPOH 1GVIA 2CBMA 4AXWB 4WLCA 1PD1A 3CMGA 3HN8A 4PJXA 3VE0B 2DY2A 4WI6A 4ZMXA 5EUKA 5E6ZA 3G6DL 3T8MA 4L8BB 4FTVE 1UJ3B 4NKDB 4ODHL 4NPYA 5ICYA 4LSVH 2OL3A 1F6FB 4KK9C 5F9WB 5IQLA 3WIIH 4A6YA 1DZBA 4OCYH 3N85L 1JCKA 1Q1JH 2AJ3B 5A6LA 2CBQA 3J27A 3LB6D 1MCHA 5D8JL 5EU3A 1MN4A 3ZTNH 5I6XC 2Y7QB 3BVUA 2ZOOA 4UQCA 3RA7H 5IFJA 4NQEA 4APQA 1L9MA 4LASH 1A6UL 5I5RA 4OD1H 4S2SB 3UP6A 3T1FA 4O00A 3STZB 1CMOA 3HC0A 3J07A 2AJVH 3LMJL 4O5LH 1IO4C 1JXFA 2AITA 2UYLA 1JNHA 2WVVB 5CGMA 5GJTH 4OD1L 5ISZD 4KROB 2WXJA 3L3KB 3CVDA 2R2EA 5D2LA 4RH4A 2DKSA 2GTWB 5JW4R 2G5BA 1XF2A 4KY1L 3I6GB 1GL4B 1MLCA 1QHQA 1AQMA 1Q4NX 1MCLA 3IWVA 1NMCB 4RRPG 1MCKA 4U1SA 4N3UA 5DUBA 5AB0A 2AXHA 3TA3B 2EIZB 3I6SA 4OJCA 4CDHA 3D50A 1NTDA 2E75C 4P4KB 5JXED 2Z4QA 2ZE0A 5ETUB 2OR8A 2L7JA 1FNAA 3L6FA 3HHSA 1JFQH 1E9QB 5GGSY 1MELA 4L3FA 2YD9A 3HC0B 2Z35A 1M6OB 3IF1B 1VESA 1ED3B 4ZOCA 5IY5B 3OKKA 4PJEA 5AVTB 1FNSL 2NY0C 2VQUA 3QFJB 4CADB 1EHXA 4DUWA 4S1DC 4WWOA 3F7LA 3T2NL 1R3KB 4PJ8D 3LH9A 2DBLL 3BW9B 1KJ2L 3V79C 2C4FU 3NK4A 3MJ9H 4YDZA 2XUWA 5I6OA 2JJUA 1JNLH 1JWUA 2FWSA 1IARB 2XN1A 3SQRA 1M05A 1PTZA 3ARFA 4KJWC 3CFTA 4XXCC 4MLSA 4MLIA 1UG9A 5KTEH 4LVNB 1IBZA 4LKCA 3WJJA 1QO3B 4KY2A 1ORSB 1D5MB 3P11H 4GSXA 3UC0H 2JKNA 1WCQA 3NSXA 3SSGA 1T04A 4IK7A 4J3TA 3BKML 1I3GL 4P2RB 5IB3B 2ITEA 3RVUD 3ZDXB 4HF5L 4M1CD 1P9MC 3SDCD 2M26A 3TH3T 2MOQA 4EIUA 2VDQH 3CPUA 1E43A 4Q8BA 3AS1A 4GRLC 5E1AB 2YAOA 4JKKA 4GFTB 1KYOJ 1H15A 2CAKA 2HG5B 3QJHA 4M3KB 3BGMB 1UT2A 4HHGA 2FJGA 5FA4B 1OSEA 1ZS8A 2B2XL 2VDNB 4OCRH 4PTUA 3V4VA 4ANXA 3JV0A 4N2MA 4NZTH 4N0FA 1WZAA 3PHOA 4UB0H 5HGHB 2IALA 3RZCD 5DZLA 4XOAA 1FFNA 1XGPA 5KZCD 3CU7A 3H4FA 2XZCL 3TBVB 2NNCA 4L9LB 4PRIE 2FJFB 3ET9F 1W6WA 2J73A 2VWEC 2NT0A 3F12A 4GW5A 1U8IA 3SPHA 5HHVL 3OMAB 2BVUA 1GJUA 1ZV2A 2CJSA 4J5VA 4JJ5A 2VMEA 3H9YA 1JHKL 2DL2A 2HN7B 3DX7A 4IOFC 5E2WH 3QWRA 3MHZA 3W39A 4OCMC 4ZUTB 1HWHB 3K6DA 2PYFB 3LZQA 1RCYA 3D30A 4XMKL 5E2UL 2ZX5A 5ACLA 3RX7A 1OLLA 3S34L 4C54A 3AB0B 4G42B 4TPRL 5ESAB 5ISZB 1FORL 1T7ZA 4IDJL 3MRNA 4OCSH 1MW0A 2MQGA 4MQ7B 4WFED 5C09A 2Q3XA 3ULUL 4OLYH 3INOA 3QUYA 4XX5A 3ARBC 1PW3A 4Y4KB 4DPCX 4FHKA 2NY3D 1CGTA 1ID5I 4E9TA 3NEXA 2F54E 1U93A 2FE0A 3MRBB 2R4RL 4Z3IA 1BBDH 1DBAH 2FTAA 3DX2A 5T8IA 2P4AB 1HVXA 3MLZH 2EUVA 3BVNA 2Y5TA 3UPCA 3VQLA 3FTGA 1TQCC 5J56B 4QRQA 3DVGA 4L4VA 4F3FA 3BO8B 3CG8A 5HHXH 4DJMA 1L7TL 1S7RB 2EEFA 4I7ZC 4BXSV 2ITCB 1UVQB 2VC2B 5D1QE 4J1UB 4GUOA 3VFVB 2GJPA 2E4FA 5D2LE 5ESVA 1ZV9A 2BSEA 2E7BA 3RIAK 3O6FB 1SXNA 5ADPH 3WMPA 2CO4A 1YPZB 1UD2A 4FZ8L 3FQRB 5KJ4A 4LHJB 4OFDA 1MVUA 4I77L 5K9OA 3O81A 1MQKL 3SQOL 4NUJA 2DQUH 1G1CA 3MC0A 4IGBC 4Z5RB 3CFJB 4D7BA 4DGYH 4YVNA 5B3JF 4MSWB 1KLGA 1VADA 4LO9A 4HWZA 5KJ7E 1VKXA 3KL3A 1MUJB 4IM8A 4QHLB 4HC1L 4R0LB 3MXVL 2R7EA 1KV7A 3N1QC 4F15C 4OZFG 1JXDA 1EGJL 2BIHA 4DP4X 2HSIA 1OTSC 4FNTA 5H4YA 5T1JA 2PCXA 5CZKA 4HWEH 4MD5B 5F1NA 1E6JH 1OT4A 2PYED 2V9RA 1P7KB 1RZ8A 2N56A 2VXTL 3SDXB 1EXGA 4P04A 3ZIMA 4MA7L 2PO6D 3U46A 3WUZA 2MCPH 4H8VA 1KWKA 1B6UA 2JELL 1KCRL 3JTTA 5DR5L 5JPMB 1E3FA 3CFBA 1J9SA 2WZPA 4I48B 4Q9QL 1GYVA 4AGMA 2FIRT 3MJGX 2ICWJ 2VLJB 2IADA 1R3HA 1ES0B 2BPBA 1PBYA 1S3RA 4YSRA 2WIIA 2R29L 3HE7A 5CP7B 5J89A 3O11A 3Q43A 4F2MB 4DPRA 4DH2A 1J5DA 1JPTL 2Q87A 5FDYA 1WK0A 3MXWH 4Z77B 4TNWF 3MV9A 3RB7A 4RDBA 3DJSA 3GB7A 1EEQA 5D7JB 3T5WA 3UROR 5KVGL 5AYUL 2MWCA 2ICEB 3LPGA 4B60A 1Z5HA 1FLTX 5DJ0B 4X9BA 1DJZA 1H0DB 1IFRA 3QXDA 4FS0A 4TUKH 5C6PB 4YEEA 4JFDD 4J3BA 1P7KA 3B3BA 3ILEA 3K2MC 5JIKA 3B7SA 3AC0A 4ABWA 5D2NE 1AGFB 5C0GA 4TNGA 5HGBB 4XOBA 5LHDA 3NN8B 4PI2A 1NGWA 4CJ0A 4JAMA 2LVEA 4HH9B 1TJHL 5D7KE 2P3YA 4OCNC 1JHLL 1MCNA 4LSTH 5KSAB 3BP7A 1QBML 1KBGH 3RVVC 1ES0A 3BVTA 4IU3A 2UY7B 2OXGA 3QJOA 3ULVD 3OMIB 4AEIH 2ZP8A 1Y0LA 4KQ4H 3B9KA 4OQTL 3CJJA 1N4XL 1MH5B 4MVBC 4MJ6B 4OIIH 5IJVB 3JBG7 5A6MA 1ZXQA 2W07B 3ECBA 4YSOA 3GBDA 3U0WL 5I1KH 4GINA 3C60A 2DWTA 4V2CB 3SKMA 1YYCA 4DKDC 3O6KH 1YQVL 1FVEB 3MNMA 4GG6B 2ESVD 2HT3D 4LLUB 2O5NA 3TF4A 3GKWH 3QH3B 3LX9A 3QWRD 3VWKD 4XXWA 2N0MA 1NGYB 2A9ML 3D07A 1AQHA 3QK0A 4ZS7L 1IGTB 2EIJB 2D4FA 3O2WH 2J6EH 4GXVL 3SPVA 1I8AA 4KITB 3PDGA 1T4KB 1FG9C 2F1EA 4AVKA 4DN3L 1DEEB 3DPBB 4LDLB 4BKTC 3U9PL 1EHLL 5KYWB 2AJSL 5DEFA 2ED8A 1UWGH 2KT6A 1SEQH 4OD3H 4LNRB 1FNFA 4G7VH 2Y4SA 2EADA 3KGUA 4PQXA 1LK2A 2OYLA 2Q7NA 2A4ZA 3O6ML 4Z7IA 3KLQA 3R8QA 2OR9L 3STLB 3HC3H 1AZCA 3TO4D 4Y7MA 4O4YL 4QOKD 1AQDB 1CXFA 1Y18A 5C08B 4UU9A 4F57L 1F3RB 3ZO9A 4K5PA 4IJ3B 4MGXA 5DD6A 4K2UH 3DNKA 2WIIB 2YFOA 4PLNC 3FO2B 5GRXG 1YEGH 4HUXA 3BMWA 4CMMA 4CN1A 3U7WH 1GYUA 4L2YA 1TJXA 3GTNA 5TQ0L 5CUSL 3ETSA 2IH8A 1RU9H 5HHMB 4PY7A 4M6MH 4U6TA 1OSPL 4NQUA 1CE6B 4YHMH 3GSWB 3CFNA 1XIWC 1V05A 2PWDA 3QPXL 4CVXB 4Q6IC 5HP5A 3UZEC 1N7MH 4C55A 4JPKL 1TNMA 4PJHA 4Y5XC 1WZ1H 2UZIH 5DQDH 1KJMA 1QWUA 3VACA 2GBAA 4K3JL 1R24B 5I16A 5LG6A 1Z9OA 4E41B 1RURH 4AYGA 2QFPA 5CF3A 4HA1A 4OV5A 2BSRB 1OWWA 2IPUK 3UO1L 4OGYL 5SWZD 2EDMA 2FHCA 2VLME 3PGDA 5EORL 2IXQA 2E7CA 1LE5A 2NR6D 2VZSA 4RA0C 1U91A 3ULVH 1MAKA 5KAQG 3QZWA 4AC2A 5DS8B 1T83A 2VZOA 3DETD 4N9GA 5F7AA 3QIWD 4YVUA 5IB4A 3T3PF 5LNGA 1J1PH 3D5OF 4N5EC 4MAYD 3WG7B 2V7HB 4HPOL 5D7IE 4D8PA 6FABL 3F5WA 4A2HA 5CJQL 5BCAA 5IHHA 3GMOB 5SX4H 2Y1VA 4NFBA 4G5ZH 1XR9B 5FM4A 1XSOA 2QBWA 2EDBA 2C9SA 5I8EB 3SE4A 2HRGA 1Q94A 3MV8D 3KZ8A 1KDJA 2W9LA 3SPIA 3EJZC 1FZJB 5ELIA 2X87A 5SX4I 1TJHH 4JCMA 1YY8B 3KLDA 3WGUB 2WAHA 2WZAA 3SCMC 1FAKT 1M57B 1NFDF 1NGZB 4R2GB 5J1AB 3LVTA 4LF3B 2QV2A 1MFNA 1UM4H 3VXSB 1PZCA 3AGWA 1G7PA 4IBLT 4L37A 4IKKA 4I1PA 3L2LA 5AW0B 1XGTB 2AXWA 2JH2A 3SGKC 4K23H 3S2CA 2IBZY 3L4TA 4IIZA 3HI1A 4HUMB 4RAUA 5IGXH 1GOFA 1I8LA 3QEGL 2ADIA 3QUXD 4D9QE 5D71L 5BZXA 3KE0A 1AG6A 5DDHA 3WNKA 2IPTH 3LQAH 1A6VH 4WSGA 2DLTA 4QXGH 3DYMA 4TLKA 2Z31B 4PD4K 1CBVH 3RI5K 3DO3A 4FXGB 2E7LC 2X4UA 1JE6A 1MCBA 2VDQB 3C6LC 4WEEA 2AW2A 1AOHA 2ICWA 3AMKA 4BXVA 4A7TA 2VR9A 1JGUL 2WXRA 3PAUA 3DTXB 3MPCA 4JLRA 3S5YA 4QYOA 4KJQC 2YRPA 3JWDH 3PABB 1QSEA 4ODXA 3TYFA 4EKXA 2EUXA 3APCA 1RUKL 2CO3A 1F11A 1NGPL 3B7RL 1S9YB 4YDKL 3C60C 5EDSA 1U8JB 1F4WH 2HT4C 2DYPD 2JB5H 5CM1A 2EZ0D 4FQQB 1NFAA 4HLJA 1CFVH 1WG3A 5J6GA 5BNXD 2D7OA 2YN5A 3N1GC 4PGJA 1ZJAA 4J12A 4M8RA 2NNXA 4J39A 1HYRC 4AJVA 4MCYB 5J9PB 3VFMB 2WXMA 1TYEB 2OJZH 2VR6A 1YEHH 1SM3L 3FONB 4BD4A 4G9DA 4GUPB 1MJUL 1Z9PA 4K8RH 4N87A 2QL1A 1U3YA 4ILDA 4ZPTA 2R1YA 5HHPA 1EAJA 3UADA 5I17A 3D2UB 4AEHH 1URZA 3EOTL 3P0VL 3SQOH 4WV1B 3TH2T 4LCWE 3V0JA 2HT3C 1MCWM 4JHAL 1ZLEA 1FNGA 1UJ3C 3HZVB 5E08L 4IRJC 2COVD 3HMXH 2EEBA 4RGMB 1QSFB 2MCG1 5IESL 4D8PB 3IJ9A 3GNMH 3IJSA 5JO5A 2O5XL 3VX1A 1P69B 3ULAB 3L3OB 2CKBA 4WAFA 3P3RA 1MCEA 4O02B 4YHKH 3BDYH 1JBJA 4BV1A 5SV4A 3NACH 4PGCA 4ZUUA 2FT6A 2RTTA 3TOPA 1JNHB 2A6JB 2OJEB 2P5WB 2JCCF 3QR2A 2F58L 4N5ED 2G5UA 3MREB 2FO4B 3RGVA 1P5VA 2AF2A 5DC2A 1R5VB 1MCCA 1MAMH 1A5FL 1NAKL 4R84A 5FA3B 2HXAA 1MLCB 4RSVA 4BH8A 4G9FD 1OAYH 2H6OA 5DD0H 1ID2A 5DF0A 4NPJA 3ZDXF 2PNDA 1BA9A 5I18L 3B83A 1QSFA 1A14L 1SJVA 4J23A 3KPQB 1GJWA 1UXWB 1G6VK 4FNLH 4JY6B 4F9PA 5JYLA 1B0RA 3RVWD 3KBFA 1KGXA 3PJSA 2AJZB 5HHQB 4AMXA 2HTKD 3DIFB 3WS3A 2X4UB 4Q74A 4PJXB 2TSBA 2LAAA 4WI7A 3P4NB 2ESVA 1SYSB 4JFOA 1JHKH 5JHDA 2IPKB 4WU7A 4CW1A 3H8NA 3SDXF 1MRCL 3FRUB 1M6OA 4N8UA 3K2KA 3QJSB 1BZ8A 5TDOB 4PJIB 4YX2H 1Q0EA 2F74A 4TNVF 3WN5B 2UXGA 4ZMNA 2X4NB 2IQ9L 4IS6B 3K6FA 4JJHA 5AOIA 4AENA 1C5DA 2R9HC 2WLMA 1U8JA 2X1OA 1ILSA 1RP9A 4XPAL 2YSTA 1ZLVK 1Z9MA 2GCYB 3R1GL 3NJKA 1JZ8A 5K1JA 4U1KB 5C9KA 1ZLUH 1NCBH 3FTUA 3U30C 4L4TA 3ZUNC 3OKMB 2GK2A 5D7LA 4NUGL 2NDFA 2HT2C 4XZUA 5DFTA 3MYZA 4P3CL 1A02N 4GMTH 1W72L 3MOBL 2YD5A 2BZDA 4JPVL 4FZEL 1GTNA 4FNRA 3BVDB 3VFOB 1L3NA 4H88L 4MNGB 4XMTA 3MCYA 2ERJB 5FS5A 4RDQF 1OOWA 4KO9A 2CO1A 2PW2A 2YC1B 2A6KB 4JKNA 3WN6A 2ZX8A 5F7DB 3U30B 2V5YA 4KQ4L 1C5CH 2BW5A 3AXLB 1H15B 3IJYA 4Y1TA 5DJDA 2CCLA 4HKBA 3GMMA 1UACH 1ZIAA 1SVZA 4KVPA 1CL7L 5DUBB 1K85A 5DMIL 3ZDZE 3DX8B 3ZW3A 4EI5D 2C1PA 4ZNEA 5AAWA 5I66A 3KS0J 1X9QA 2O1AA 4OLZH 4Y1AB 1KJ2H 3CFCH 4JE0A 3TBVA 3LSOA 2DEYX 1KGIA 2L0DA 3GS7A 3QA3A 1JHTB 2ZUTA 1UEMA 3E3QE 4G8IB 1ZA6A 5AW6B 5ANMA 2XN0A 4FTVB 3AITA 3ZZSA 6FABH 1D5ZB 2Y7MA 4QXWA 2K6YA 2YJLA 4P3WA 3PL6D 3KYNA 4MMYA 3T2OA 2WMPA 3U0PA 2BWDA 1OKEA 1BEYL 2OL3L 2YUVA 3X1NA 5IHZB 3MCKB 4MJ5B 5GZNA 3B37A 2QDWA 5H2BB 5DQ9B 1DJSA 2VLLB 3C5ZC 5GS3A 3TIDB 5IFHL 3DIFA 2NY7L 2KC0A 3OB0H 1DVFC 2C9PA 3NSJA 4B0MM 1U2HA 4ICWA 5DRXA 1YPZF 1Z66A 3DVFA 2EZ0C 4QTFA 5TK2A 2ICEC 4YSEA 2ZICA 2Z7UA 3X3GL 4JPKH 4QHNB 4XHJD 3UMNA 4ZMPA 2A73B 4YBHA 5AKVA 4BDVA 3NGBC 4NWTH 1QMUA 3V4VL 3IRCA 4LOUD 1GGCL 4PRDB 4KBPA 1NAML 2ZKXA 4TF4A 1LP9A 3IBOA 5ACZA 1P7QA 1B6DA 1WGOA 3PXHA 3U7WL 1I31A 5E5MA 1YNLH 5HSFA 1OPOA 4MMYB 4HC1H 4P07A 2DDQL 1BQKA 4HHAA 3TA3A 2K4AA 1FRGL 1XF1A 5CEZD 1KELL 2NUTB 5DD1L 4NQXB 4DZBB 2CHZA 2IAMD 2PP9A 3QHFH 2VXQH 3ZTJG 5GGVL 5GS1C 1GZHA 2DQFB 4HJJL 4L9LA 2O5ZL 1HFUA 5IBLC 2LU3A 4B5EA 2Y7QA 2W5PA 4LSSL 2F08A 2N3JA 5IT2L 2BNQD 3O6FA 4Q0XL 1WIOA 1SDYA 2VN3A 3WY3A 1UWGL 5I1EL 4X4KA 3MLRL 2O6EA 4LKXA 4GRWH 4XMLL 1TU2A 4F37F 2D8KA 1LGVA 3VNZA 2FZ3B 1LO2H 3GSNH 3HE6A 4IU3B 4O2CB 4TNEA 3O8XD 4H4NA 1R0AH 4UQ3B 3RURA 2Q2EB 3Q5TA 4HWBA 4PJCE 3G5WA 5IROA 3I3EA 1NLBH 3EJPA 5LXGL 4H25B 1R3JB 5D1QD 1WUZA 2AVGA 1WC7B 2CK2A 3QNYB 4F7TA 4FQHB 4GKSB 1A6WH 4WHCA 4YC2C 3QUXB 1KT2A 3WKYA 4JBSA 1O5PA 2OBGA 4XBMA 1W0VB 2ZAIA 4UINH 4IMKA 1D9KC 3T6QC 1ZDSA 3NTCH 3IDJA 5FYJU 4HX1B 4HXAL 1K8DB 4IK6A 5I28A 3ARBA 3OKLB 3N0AA 4BZ2L 1CK0H 3NRPA 5HYFA 2NY0D 3N55A 2Y2YA 4XCFL 5F96H 4E41D 2HJKA 1SJEB 5D70H 3X2QB 4UOJA 1HSAB 3LJ3A 4HD9A 3RWGB 2EICA 3VFTB 3S34H 3KH4A 4M56A 4X6FA 1CBJA 3UC2A 4D8OA 4PVMA 3KYMB 2ZOWA 4HKZB 4WFHE 4GB9A 2ZKHL 1OEZW 1MG2C 4OGAD 5HJ3B 4RGOH 4R4FL 4YUEL 1JPST 6PCYA 1MCPL 2ZT9C 1EMTL 4KGLA 3ZKSD 2Q3AA 5LWYL 1I3UA 4KX9A 4XO3A 4N8VA 3U9UB 4YDJB 1HXMB 5C97A 1C16A 2R2BA 1BFTA 4WDIA 1KEGH 4L8CB 2Y69B 2WIMA 3OAYK 3QIWB 4LBAA 2FB4H 3F3HA 5H94A 3QXDB 3QO0B 3NJFA 2I60L 2J1XA 4D3CH 5FW7A 1X5LA 1G87A 3HCVA 3DV6A 1H5BB 3O2VH 2XG4A 2RR3A 4M7ZC 3L2NA 2CNZA 1DN2A 2EE6A 2XTJD 1HEJC 1JPGB 5EC2A 5FYKL 3RDTC 4AIOA 2FX9H 2R4SL 1JGVH 1PDKB 2BP0A 3QQDB 4UT9H 1DFBH 1GGIH 2UWEE 3CZSA 3WFEH 3BLKA 3QQ9C 4DP9X 2X9YA 5L9DH 2XZQL 3VXMB 4PJGE 3MA9H 4TSCH 4YS4A 1SUJA 1JNJA 3QUML 4Q97A 4WFHD 5IJVA 3LB6C 2WTOA 4PJ8C 5TH2B 3B8YA 2PTTA 4QRPB 2UVFA 2XXCB 5JHDD 3CFBB 3VGFA 3KWXA 2YMXH 4J3XA 5L8KB 3NFPB 4NCC2 1K3IA 3AWGA 5GHWH 4MD5A 2VR5A 3HPLA 4PS8A 2OMWB 4GKNA 2QPFA 1R3HB 3GI8L 3QORA 1ULVA 3K8KA 3ZE2B 1QKZH 4FA8A 2Y1ZA 4U7MA 1PJ9A 4UV4H 4XO4A 4RISH 4CVZA 3MLVL 2H0FA 1T20B 4YDNA 4HJSA 2ZPKL 4JPQA 1JNLL 2WBXA 1CLOL 3ARGC 3MJ9A 3OKDB 2LR4A 4U6YA 1WC7A 3QNYA 2ZCLH 2NDGA 5DZ9A 4U3SA 2A6DA 1XF5A 5DEFB 3MJ8A 4HKJB 4GW4B 1HNYA 2J8UA 1AGEA 3IJEB 2WUBL 3T8VA 5ADPL 2ZAHA 3FC8A 4HIXL 1V7NL 5I0XA 1EHNA 1WFOA 1Z3GH 4OZGE 4KVCL 3EJYC 3QXTA 3HN5A 3KYAA 1UWEH 4BZ1L 4YZFF 2C3VA 1LEIB 2AJXL 2V37A 1XHHA 3FQRA 3KW8A 4FG2A 3UTTD 1J8HB 1G7HA 2CGRL 4PGEA 1YEEH 2AV7B 3KM1A 3EYUL 4HS8H 3ULVF 4BUQA 3ZDYB 3WKMH 5DJ2A 4Z5RA 4PJHE 5C8JA 3B9KB 1I53A 4HSQA 2R23B 1XIWA 4HULB 2W65A 2ESVE 4OZFA 1CGUA 3L1FA 4AH2B 3GFUA 2W07A 3ECBB 5EZLA 3T08A 3O6FC 1MZZA 4U6YB 3ZL2A 1U93B 2Z31A 3Q1SL 4EBQL 5BW7A 3ARGB 3FTZA 5D72H 2BP3A 4F80A 3OLGA 5INCA 2OXGB 1F8TL 2JWYA 1J9QA 4NO2B 2BM3A 3HAEH 2P7TA 3WFZA 4N1EA 1NPJA 5DLML 4RX4A 5E8PB 3TA4D 1EAQA 1NGYA 1VFBA 3FTGB 3U1SH 4N5UA 2BVQA 3BFQG 3GBNL 4V11A 4X5XA 3FT1A 3EADA 4OLVL 4FYQA 4PTTA 1AGDA 3IGFA 3LMJH 3ESUF 5JMOC 3SKMB 3QZWG 2FR4B 2FWOA 3N04A 1BFVH 1LE5B 3UIYA 4NJAH 3OGCB 5DJ2B 3T4YB 4BFOA 1OF2B 4KKLD 4AW4A 1UWFA 2X89A 3ZYOA 1OSZB 1U8KB 5C2UB 1X9RA 4I1RA 5D7JD 3L7EA 3LS5L 5J5EA 2AK4B 1J1XL 4QPEA 2B8OT 4XNQB 2YJQA 1A1NA 1FAIH 1WIPA 5HHOE 3V9EA 3QBTB 3B1TA 4OVVA 2XTJB 3HEIB 2ZUWA 4POUB 4PJ5B 1OGTB 1DE4A 2X4SB 2BS9A 3FN0H 3MBEC 1SJMA 4M93C 1DLHA 3OLDA 5EA0L 1E2WA 3FU6A 5T1LA 1S7WB 3RAJL 4AQZA 3DX9A 4XVJL 3IMUA 3LIZH 3DDFA 3FB7B 2F9BT 3LZLA 4ZO7A 4WJG3 4CMMB 5CNHA 1P5UC 3NN8A 1H3PH 4X9IA 2J44A 5DQJB 3MBWB 5E4EB 1KIUB 1CT8B 3HI5H 4FKEA 1WFIA 4FFYL 5D1QB 1HH6A 3QQ9D 3NJLA 1F86A 1FNEA 3NCYP 3AJ7A 2Y36L 1J9TA 4YSTA 2XXGA 5DD3H 3G08A 3N9GL 4A04A 3MUY1 1VPOL 2KBGA 3MV11 3ZIYA 3BKJL 1GYWA 4HFWB 2NX5E 5E1IA 2HAZA 2XV0A 1RPQA 4OGXH 3OBAA 2JLPA 2AGJH 3VUAA 5DURD 3CD4A 3OZLA 3X11A 1EEYB 5AFAA 3GMLA 1XSKA 2YQ2A 4CVXA 4HK0A 4B5ZA 5JIMA 2OI9C 3UAJD 5FYJE 1P1ZB 4LSQH 4PRHB 3A4FA 3VYOA 3BZ4B 3VTMA 4FFZL 3O9WA 5KSBE 2UXVA 3PABA 4XMXA 5AB2A 4QYOB 4M9OA 4ONOA 2H1PH 2X4OB 2A6IA 4UBDD 1BPLB 3NCXA 5DK2A 1WAPA 3TZVD 3TH4T 1S9YA 2W38A 4KI5E 3RGHA 3D6GA 2X09A 4FG4A 2CSPA 4LSRH 1ORQA 2WNXA 3HFMH 4NT6A 4UM9D 1QBLH 5KSBF 1FNSH 3P1VA 5C0FA 5JW4M 4XVUD 5E8PA 2WCPA 3WFCL 4AG4L 1MQ8A 3CLEH 1G0XA 1QD0A 3TFBA 4GP4B 2IPUG 2PF6A 1S7SA 2B1AH 4Z76B 4JVPA 1NQBA 4K3EL 1E42A 4W9KC 5D4QA 5AOKA 1R34A 5AOZA 4MZRA 4BGDA 5T1MA 5C09D 2P24A 1FAIL 1Y6NR 1W8NA 1JYNA 2FHFA 4YBQC 5JIHA 3F83A 3WFHA 2OCFD 4LLUA 1MW2A 4OZ4B 1TKWB 2DWXA 3II3A 4ZFOB 3RWDB 4PJBA 4TMPA 3P73A 4KY1H 4HGMA 4L37B 4PJXF 3VGEA 1IGMH 1NM9A 3WFCH 4B3VA 3MV7D 3CFDB 1OHQA 2WQWA 3DPDA 2OSXA 3T65A 5JOPD 4O02H 3TO4A 1UWXK 4ANVA 4OM0L 4LGSB 4XNXH 3IGLA 1QSFD 5DMJB 1G6RH 1JL8A 2XI9A 3M86A 3NPSB 4MJID 3X14B 2QADB 1F1AA 4PS4H 4YE4L 1BVNT 3BGFC 3PIQA 3SE8H 3TZVC 4X6CA 2CHDA 4JK0D 3VWJB 4N20A 4JM2F 3TCLA 1U3NA 5M7QA 1Z6JT 4PJ9B 2YBRB 1HHJA 3QIBA 4FTDA 3GXUB 5C9JA 4WY7L 3B7YA 4WENB 3RFZC 4X5RA 1UXWA 3GZQA 3RL1A 4DEPB 1CE1H 1A2YA 2APXA 4N1CA 1CDBA 1IEAB 1BOGA 1EH9A 5JOPE 3QE5A 1U8PB 2TSAA 4MJ2A 2Z8RA 5D6CB 3IDMA 4AJYV 4ZMYA 2ZXGA 3WSQL 4S10A 2OFQA 1HS6A 1FVDA 5F89B 3V0HA 43C9B 3WLWC 1A1OB 4YDIL 4EI6B 3KYNB 5L6YL 1HYSC 2EIDA 1OL0A 2Y06H 3AY4A 5HGGS 4DWHA 5T33L 3RFRA 4UT9A 3GUTB 1C1EH 5DCCA 5F9WC 1X5HA 3VXRD 4MJ5A 1C8QA 3KCWA 3LN9A 3HC4L 5E2JA 5EA0H 3U4BH 3BX7C 4ZFOL 4XAWL 1CFQB 4YWGL 2VJ8A 4O02A 5GS2H 3C9NA 3L4UA 5DT1H 2Y2WA 2YGNA 2RACA 4KJPC 12E8H 4ICXA 3RL1B 4Y9CA 3H3BC 2GUYA 2K7PA 2OXHA 5J4MA 3RL2B 2IQ9H 1TVHA 1WS7A 1UC6A 3HBQA 5T1LD 1IEAA 3MCG1 1Z9NA 4HMEA 2NRDA 3ULUH 5D1XA 1AR1C 1UZ8A 3DVNB 4GAYA 1U8OA 1N8ZA 2D2CC 4IIQC 2HA1A 1CCZA 2CA4A 3I6KA 3CSFA 2AK1H 1IC4H 4HH8A 4KKLC 1ACCA 1B0GB 1IAOB 2P80D 2YAEA 3MR9B 3QFJA 5E5RB 5GRUH 2UY6A 3FB6A 4OFKA 2IFGA 1LYQA 1M9SA 5LJYH 2VAJA 4JZNA 5BVJA 3U4EA 1ERNA 2AJUH 4J4PD 4NI6A 1B0RB 2YC1A 1ZTXL 1UCBL 2WLYA 3FB8B 2F53A 4ODUA 3VWKB 4HGKC 4NO5A 4P2OB 3SDYL 4A67A 4UT9L 1GKOA 1JGDA 3MQIA 1MHPH 3OPUA 1WAAF 3TO4B 4H2CA 2CG9X 4LHUG 1CDGA 4CN4A 2C1PB 3APMA 2KPNA 2F61A 1TZOA 3QFDB 1LO4L 2F74B 1D9KB 2PW1A 5C70A 4X0NA 5AVWB 2EJ1A 2ZWSA 3GXMA 5KN5B 1KN4L 4U1HA 1HHIB 3UTSA 2ZKYA 2B2XH 4J6IA 4OCRL 4QOKB 3P4NA 4XC1L 3I6KB 5IR1B 3LEYH 4X6DA 4NGHL 3J7HA 2FJSA 4LESA 5HD8C 2ICWB 3WIFA 3S3SA 3NIFB 5I8OH 4Y4HA 1NCJA 3KXFE 1S7QA 3ZDYF 3HAEA 1V7ML 2VRQA 3BUQA 4G7QB 2XWZA 4LAJH 4G5AA 4OFIA 3BQUD 1ADQA 2P52A 4PGBB 5I8OL 2B15A 3NIDE 5D70L 4M7LT 1DQIA 4APXB 1JZ6A 2PO6C 4HJ0D 4L4TB 5F96L 3BZEB 2VLMD 4F92B 2NZ9C 3BWUF 4NQDD 3U2JA 1ZDQA 4PRDA 2NR6A 1Z32X 3SZ6A 2ZCKL 4QRBA 1FNLA 1L9NA 2BDNH 2NY3C 1MJ8H 3CLWA 3FQWB 2WN3A 4MYPA 3O3EA 3LXUX 4AIXA 5C6WH 3ARTA 2QGDA 4ZTOL 1BAGA 4MXVE 3QEHA 1WZKA 3NA9H 1VFUA 4N9OB 2DBLH 1GW0A 4LL4A 1IFHH 4WWPA 1MFCH 3OJDA 3DUUA 5EEWA 1EEUA 4BSVB 3ZE2F 3BAIA 4LZKA 5I1IL 4FKKA 1XEUA 5E9NA 2VTFA 2CRYA 1BJ1H 4LKCB 4QYAA 4GBXD 1FG2B 2Z3FA 1N10A 4HCGA 1UKQA 1CF8H 1S5HB 3MLXL 5DZAA 3WELA 5IHLB 5ICZB 3FOMA 3L45A 5E2VH 2FX9L 3E6FA 3CSPA 3ISWA 4A7GF 3L5JA 4JPSA 1VZIA 1WV7T 1VZHA 3KBPA 1F6LL 1NFDA 2AP2A 1G9MC 4XPGL 3SDAA 5IHZA 4HG4J 5DI8B 1YYML 4TSAL 2OLDA 1WPCA 2VLLA 1T1YB 1UT1A 3EKCA 1MHHA 1S3KL 3GQFA 4U6VH 1FV1A 4DETA 3CZFA 3TJHD 4G6KH 3VTAA 4BEIA 4CMHB 1BD2E 4GIAA 2EE3A 2VYRE 4PU2A 2X05A 4V1DE 2QKIB 4HV8B 5D7LB 5DWUL 3FU9A 2IALB 3RVVD 1DVFA 4KPHL 1EO5A 4BZYA 4YIQB 1MXGA 3QUXC 1OGPA 3MLTB 4FL4C 5JXEC 3VXRA 2CDGB 2F7PA 3AS2A 4NKOB 4NNXB 1N18A 1PGRB 1U8CA 1IGYA 1WA0X 4OF8A 4AYMC 5CIPB 1KB3A 3I9AA 4EN3C 1I85A 4YDIH 2E8YA 1Q9WB 5ITFB 4I3GA 1T2QH 1I7RA 1PD6A 2D2OA 4JDTL 4A68A 1FFTB 5FCSH 4Y4HB 1MXDA 5DA4A 4B27A 5BMFH 1E3XA 4GIPD 4RVBA 2ZUUA 2ED7A 5CCGE 4OCYL 3UFIA 2K1MA 1MH5A 3VMPA 1JWSB 1Z5LA 5ES4B 2PWGA 2PYEE 1R6VA 2VQTA 2DS4A 1I3RB 2ADFH 4X8XA 5D1ZA 3J2PA 2Z91A 5EORH 3QJRB 3P0YL 4LL1A 1MHEA 4LRNH 2H3XC 2GCYA 3QRBA 4MB3A 4P05A 1XR8A 3ZGIA 3JUZA 5DJ6A 3ZVVA 3MLSL 5KW9L 2IJ0C 3MMEA 4CC1A 1G4RA 1TJGH 5CMAA 3RHWK 5FFLA 5C0AD 1DVSA 1RJLB 5JW3H 1NCOA 1E9PB 5CGTA 1FQ9C 1YRKA 4BSJA 5EOTB 1ETJA 1R1CA 3SY6A 2G4EA 4Y2LA 4HC1A 2BP8B 5AW2B 3VM7A 2CJUL 2AI0L 3WDIA 4CC0A 3NZUA 1VACB 5C2BL 5I76A 5E1HB 5IT2H 1QFWL 1S6NA 4MXQD 3VD2A 4YXLH 5DTFB 2A2QT 4Q89A 3BPNB 2CCWA 4X4YB 4JO8A 5CR1A 4HJJH 1F13A 2ARJA 4FABL 4AW7A 3CHQA 1G7JB 4NZRH 4Z3TA 1CDHA 3HI6H 1WFNA 4PBVC 3G5YA 1UYWL 1VENA 3O0LA 3E6FB 1UZGA 2A74C 3MCLL 5FV1L 2ARWA 5EO1A 1X5GA 5HDQL 5TE7L 5E6IB 1FL5B 3K46A 3ZHFA 1THAA 3DHJA 1HJBC 1F18A 2OMWA 2FQFA 5F6IB 4RMWA 1XZ0B 4ZTPH 3WLWD 2VXSL 5DZPA 5IW1A 4DN4L 1XD1A 3UTQB 5C0DA 2DTSA 3QDME 5AB9A 3VRIB 1A1NB 5HHME 2FX7L 1G5GA 3DHPA 1MREH 2WLJA 4GBXB 1DVUA 3VSTA 4FQLL 2OTWB 3ZN6A 2Y72A 2X0WA 5E8OA 4EI5B 5L2KE 1JYXA 1Q1PA 3WTVA 1BJ1J 4PJDB 4PJHB 4JREB 3UL4A 3ZDYE 2ARJQ 3A3YB 3CDGA 3TBTA 3LKNB 5I1JH 5JHMA 2OCJA 5E6RB 3AQZA 3GMNB 1TNNA 1VJSA 2NY4B 3GS0A 3NJJA 3LNFA 3QO0A 4G1EA 4O2FB 3H3KA 5EHFA 3IFLL 1J8RA 5IJBC 2CJ3A 1U8NB 2A74B 1SVBA 4ZQKB 1QAWA 3F62A 3RX8A 2GAZB 3HB3C 5I5MA 5FFOA 3OKOA 1V3JA 4W6YB 5JW3L 1JGIA 3QWOA 1UXSB 3H9SE 3RYMA 5C2BH 4NYLB 2BERA 5E00A 1PD0A 2X1QA 5DD0L 2LVCA 3B9KC 3K4ZA 1K5NA 4NHCL 3GSRA 4R90H 1OT1A 4BCYA 5EIQA 3UTTE 1TZHB 4ZFZB 4M4RA 1U6AL 3BCFA 2FWLB 2VN7A 2VE6B 3HBPA 3QUMA 3LIZL 3QWQB 1NA8A 1E4XH 2NLJB 3GSQA 1LO0L 4ZMLA 2C4FT 2IANE 3FN0L 4IEFA 5I19L 5T3ZE 2E7HA 1OQXA 3UBXB 1Y7VA 5LQBL 2FWOB 3BZFA 4WWKD 3CDCA 3G04A 2BK8A 4D0DB 4XCEB 3HPLB 3NCWA 3FF8A 4U0RB 1DUZB 5DD6B 4EZMA 3MGOA 2GK0B 1WUNT 3SBPA 1DVFD 5LAXA 1QSVA 4QI3A 3RZCB 3AQDA 4DGVL 1IM9B 1JZEA 5DDHB 4GQZA 3K6IA 1MEXH 4CSTA 1X5ZA 5C0BB 4ZUSA 1KXTA 2WO2B 4PJFE 2B9AA 2ETWA 2D9QB 3GO1H 3LN5A 3ML8A 4QKXB 1FVEA 4IDLA 1JK9B 3BP4B 4HLZG 3TV3H 4GG6A 3BZ5A 1IGFL 5ALBH 2VLKE 3EOTH 4UTBH 3F85A 2DIAA 5D2NB 2G9HA 3I3DA 4DP2X 2HRLA 2RJMA 2OZ4L 3GSUA 3IDIA 5K9KB 3DX9B 2IH9A 2L04A 4K9EC 2VISA 2X2JA 1QUPA 5DQJA 1B90A 4FI8A 5HDBE 3QUZD 4WNSA 1OK0A 2X1WL 2DWDA 1EZLA 4DERA 1CGSH 4I87A 4BK8A 1V3LA 3ZE1E 5DJXB 2ITDA 2IBBA 3CZJA 2QGBA 3MLYL 1RZ7L 3WEBA 3VTTA 4OF3A 2GY7B 2D7TH 4F2ME 1PQZB 3WJMA 2WSKA 4KRNA 3GC3A 2MPAH 1KIRA 3VSQA 5TH2A 5FWRA 1A7RH 4MA3A 4WVRA 3WIHH 3D0AA 2MHAB 2N0KA 1U3HD 5DK3A 3X11B 3LDBB 1BFSA 3ULUC 3WKML 4M48H 2CGRH 2EEDA 3O2DH 2YXFA 4WJ5B 2NZ1A 3VB9A 1I1YB 1RZIA 2Z6FA 4PJEE 5I1LA 2ICCA 3FBKA 4K7FA 5D5ME 1RZGB 5EZJB 2DEXX 4G8GE 5J57B 3U7YH 3VWJC 3KPNB 1UWXH 2NX5A 3WXVH 4GNKB 1I9RH 2IDFA 1NSNH 4JZJB 5IHBA 1A7NH 3BOVA 2O5YL 2Q5BA 3OGCA 4NM4L 3L3HA 1IC7L 1MAJA 2QSCH 1NWPA 3QDAA 3T4YA 2RMNA 2V3FA 1E5YA 1BFOA 1OTTD 4L8SB 4UQIM 2HZHA 1OGTA 2XX0A 4JM2C 2O5XH 3H7BB 2JVUA 4KRLB 3ZU8A 5L0QB 2R0ZL 4Z23A 3NCEB 4XNQA 4XO5A 4FLQA 2BIMA 4WEBL 3RVXC 1I7ZB 4X6EA 1SMAA 4DVRL 2IV8A 3DK2A 2PTTB 3LRSA 9PCYA 5HJGA 2P24B 1ZT4A 4QF1B 4WJKB 4ZXBB 3SCMA 1F4YH 4NQDA 3VI3F 4PCYA 4XMKH 1T6WA 2AFNA 1MJUH 4FNPA 4K8RL 1FFPB 2H9GA 1S8DA 2QPSA 4WUUD 1SM3H 2CPCA 4MQSB 1YEHL 4GS7C 1KJ3H 1SDAB 2NPLX 2RHEA 1WAAA 3A24A 3AUWB 1EEYA 4IQHA 4DGUA 2ZG1A 1FZMA 4UV7H 2YIHA 1G1KA 1QR4A 1A25A 4GQ9L 5FUZH 4Z7NB 3Q8BA 2G9HB 5JZ7D 2BNQA 2VSDA 2FGWL 2J8HA 2O30A 3FONA 3LNGA 4JVUA 5HYSA 1Y6MR 3SYQA 3KWWA 4M9PA 5C71A 3Q8EA 3WNJA 5IQ7L 3T04D 5JIDA 4X6CB 3POCA 3QB7C 4P2QB 1UOKA 2VABB 3FT4B 2I7SA 1KG0A 4DHLA 4XNAA 1GA2A 4FP8L 5K1NA 2QPUA 3A23A 4LCIL 4JCWA 2ZX6A 2Q7YB 1LLAA 2Z8SA 5FK9B 3MX0A 4L4VD 2OMBA 3ZMEA 1AR1B 5BQ7B 2C7UB 2AV7A 3BKCH 1W8OA 3IDYC 4NNPL 3LQAL 3BLBA 4RRPA 3CFUA 3H53A 1KFAH 3CAFA 1ADQH 4PR5B 4UWQB 1EJOH 3WHXA 5CSBA 3OAZK 2BY2A 3BE1H 2B16A 4LCUA 2GBTA 1INDL 4OI9A 3ARBD 4R7NA 3KWVA 1RY7B 2AEWA 1AXSB 3GRWH 4F8TA 5F3BB 5E03A 4JHVA 5DD5H 3P3UA 3QS3A 4P2QE 4CAGA 1JVKA 3VCLB 5JW5A 5KZCB 4CJ1A 3FNKA 5JHAA 2ZONA 2R0KH 1CT8A 5BRZD 1AGDB 1RSFA 5IMMA 1BXAA 4ONFL 4X98B 1BYOA 4L8SA 3KPQA 1G7QB 1RJYB 1IT9L 2MQ0A 3MUGB 1KBPA 3GK8L 3K0WA 4L4VE 1JGEA 4WFFD 5CIPH 2AJYH 1LK3H 5JA9A 2BHYA 2QGEA 2PETA 5IJCC 4MNGE 2B1HL 3WIHA 3D2UA 1T89C 1P1VA 1T04B 4CL7A 2CXGA 4W4NA 1GZPB 1VA9A 1NDMB 3SGEI 4BE5A 4KKRA 5AD0B 4DP7X 2XZAL 1DQVA 1XCXA 5SWQB 4RBPK 5HTSA 4QAMB 4RFEA 3MFFB 4GG8A 3PP4H 1O6VA 2XTLA 3NPSC 2VT0A 4LVNC 1SJXA 3I02B 1S4IA 3PIQB 2FYYB 4I18C 4Y5YB 3FMGH 1T03L 4YGAB 5JOFB 2PXYB 5GRWA 4U1JA 4R90L 2RQEA 5EPMB 3VH8B 4WI3A 2GIMA 1KELH 3NEEA 1WA2X 5E4AA 2A0LC 2G2NA 2A1WL 1DQKA 3OKMA 4I13B 1SPDA 3TBSB 5GS0D 2E56A 4LVOC 1LP9F 1A2YB 4N6RB 1ZHNA 3Q44A 2X4TA 4FYTA 4UZUA 2ATKB 2KZKA 3B1UA 5EU4B 3W2DL 3JVGA 1DLFH 5I8KH 3MVSA 3CHPA 1S7SB 4Z76A 4XNYH 2JI3A 3AG2B 3PPSA 4WV1C 4TOYH 1S9KC 4Y16D 5DYFA 3TVMC 1UM5L 3RGBA 5KVGH 5IIEA 4LP8A 3ZR6A 4MNGA 3EDJA 3OKKB 4PJEB 2Q8AH 1J7VR 3NIDF 1N8OE 2FIKB 2YKLL 2QHLA 4FQJH 3VGAC 3IRZA 5L8LB 5CEYA 1K2DA 4LP4A 2EYTA 3CU1A 1LEKB 5KEZA 3C2AL 1RMFL 2B7DT 4J3SA 3GDCA 4LSVL 3HVNA 2YGPA 4B9PA 2ZUQB 4OFYA 1IGCH 3MRRA 2NR6C 1EWHA 3U9PH 4OKDA 1CQYA 1EVTC 1JWUB 4N86A 1QFOA 3D34A 4PGZA 2X9XA 3BWSA 3ILDA 2EH7H 1QVOB 1DSWA 1KTDA 4XP5L 4ZFQA 1E5BA 5AQ0A 2O6FA 5I8KL 2D7QA 3B34A 5KYYB 4DAGH 1CDIA 5FO9B 1OE2A 2DQCH 1XBDA 3MV01 3IDXL 2A77H 2A0LD 3VFGL 2GTQA 3FN3A 1OTUD 2EH8H 4HFUH 1ZXKA 1WAAE 3BVNB 1OSYA 4LQFH 4TQEL 4P2YA 1SBSH 4N0FB 4ZZFA 4XH2B 5HGHA 4DUVA 3O45B 4XZUB 1C5BH 2WBJC 2I7OA 2P45B 3WE1A 5EF2A 2AEQL 1AZVA 1YJDL 4DTGH 5GZOA 3DXAA 1ZK9A 4PJGF 4UOQA 3SKNA 3Q8CA 3L6FB 3EJSA 4LCCC 5DRXB 5JQIB 1IX2A 1S5HA 5KWYC 1CI3M 1H6TA 5ICZA 5JIQA 2CO7B 4HVBA 2Q76B 1RULH 2ZUYA 4JM0A 4Z8FL 2I69A 3NK3A 3DJ9A 4K15A 4Y88A 4DVBA 3QWNA 2DN7A 4RX4D 1AS6A 1QUNB 4LVHC 4ZSOB 4OVUA 3OAYH 3D3VE 3T2LA 4QNPE 1JRHH 3N9GH 5HXMA 4UIKL 4NRZA 4NN7C 5IKCA 3CZFB 3X1BA 3C6LD 2WCSA 3FDWA 3REWA 3VGHA 1E4WH 2LFEA 2OCCB 3MLZL 1J1OL 1CLZL 5BRZB 3V0DA 4ABUA 4NHUB 1EDQA 3CVHH 4X4XB 5FYJL 4BK5A 3HS9A 4JRYB 1E65A 4FI6A 5DO2C 5AYQA 4Y19B 1RMFH 1JHTA 5MERA 4N2BA 4PHZA 5AVUB 3GMRA 3LN4B 3OWRA 4NQVB 3RIFK 1LXMA 2WLHA 3DVNA 3VGBA 3RY5A 1UD6A 3SKOA 3W82A 2C26A 3UO8B 4JM4H 3AG4B 3EG9B 1HCZA 1I7RB 4I4WA 3THMH 1AO7B 1B4RA 2P5EA 3IF1A 2DYPA 4M5YH 2CPUA 2OK0L 3ECQA 5CZXC 3BAJA 4E2OA 2CDFA 2E27L 2VDNL 2MKWA 5GRVL 5ESVB 1G9EA 3QDGB 4NNYA 4QIRA 2OSYA 2CU9A 3OJDB 1BQLL 2AQSA 4HALA 3FFOA 1FL6B 1GSMA 3ARWA 2EE2A 2WXNA 1T2JA 5EBLB 1OW0A 2X0UA 1KB5B 2X40A 4F3FB 4Z0BH 1O6TA 2CUIA 2WKGA 3NQKA 1YMHB 5EU7C 2DM4A 3KDMB 4GLRH 3NFSL 2ITCA 2D7MA 7FABH 5BUPA 1MF2H 3DX1A 1NCCH 2QVFB 1MQKH 1B2YA 2ADGB 3IGUA 4M3JA 5F7NC 3NJHA 5C07D 1Y07A 4B9KC 3GGWA 4QHLA 3X1EA 1E30A 2GTWA 1U8MB 3QZBA 3R7RA 3SPCA 1LDPL 5AZEH 4GQ9H 5CEZE 1OD9A 4FJ6A 4PJFA 5E2VL 5F1IB 1FFOB 2N4IA 3L5WB 2QKIA 4HV8A 3RKPA 4XH2A 5IB3A 3MLXH 3QXAA 3MR9A 4M1GH 3E8VA 4YQXL 2JQAA 1A3RL 5I6LA 3ILQD 3TONA 4ZXBD 5SX5H 4Y2OA 4LLMA 2P47B 4Y5VB 5KVDH 2CJTA 5IW6B 1TTBA 3UDWA 4OI8A 1HZKA 2WB1A 2AXFA 5B8CC 5CIPA 1Q9OA 5ETUA 1ZT1A 3LRHA 3DRTA 2FECL 2H6UA 4PV8B 2IWEA 5GGSB 3QUYB 4ONFH 4LKXB 3RVXD 2WBWB 3QH3A 4RESB 1BJ8A 3UAJC 2KKQA 3MLTA 1W91A 4JM2D 3ESOA 1H8SA 2ZCKH 2LW3A 5MENA 4ERSH 3FT3B 4NNXA 3ZBMA 1YAZA 2ADGA 4OAWB 3FT9A 1NBYA 4FQCL 3VFUB 1SDDB 3ELQA 2GHZA 3CX5J 1OCWH 1OAZL 5D1ZB 4XMPL 1Q8MA 3LV3A 3QEQA 1C08B 4FQHA 2ZQKA 4NM4H 2QSQA 4JFFB 3M7OA 2YEZB 3ETBF 4WGKA 4I0KA 1G7LB 4UQ2B 4EAEA 4GQRA 4BYHA 2WN2A 2UZXA 1TOXA 3RWIA 4UTCA 4MZIA 3JWDL 3S5LG 3PG2A 2PTVA 5E0FA 5L9DL 4NGHH 1FNHA 1R5IA 4G42A 4FTVD 4TRPL 2LLGA 2VNCA 4UMGA 1I7TA 1KLUA 3Q9PA 4TL5A 3JWOL 1SQ2N 2B59A 2HFEA 3VW3L 3DHMA 5EU6E 5L2KA 3O3DA 4XN5A 5D93C 5C0GB 2ARJB 4YO0A 2YAQA 3BRDA 4G59C 4HG4K 1PLGL 1BM7A 4UI2A 4Y19D 3IDNA 1BSIA 4PBDA 5IB5A 3C5SB 3QEGH 2QQKH 3MSPA 3VU1A 2AKRA 3BIBX 4WDIB 4DOHB 2BVYA 3RWJB 2Q1EA 3RTLA 1I1AD 1QQDA 3FQ1A 1MRDL 2B3RA 4V1DB 3RY6C 5BRZE 1UZ6E 1FZKA 2A9NH 3EH5B 4M61B 5E1GA 2VJ0A 3REVB 2JKJA 3GPSA 4K71B 5D7KD 1ZGLM 4GSDH 4P2OD 4N2OA 1LEIA 4M5YL 5LGYA 1DVTA 1R3LB 1UVQA 4RMBA 1G7IB 4L3EB 3K6OA 5JHLL 3MNZB 4BK5C 4LOEA 3VI3A 4DGIH 3S9DB 2YARA 3AREB 4KUZL 1MHCB 2YEVB 4QTIH 1BVNP 1G7MA 1N70A 1FNEB 5AUMA 3KVPA 2J8OA 3SCMD 2V2XA 1HT6A 2V7HA 5DJZA 1CI5A 2R0ZH 5DZNA 3H7BA 4TS6A 3F7YB 3OXSA 1NBVL 4WO4D 4X7TA 3T8XA 3H9SA 3I75B 1ET7A 2PWEA 1W2KT 1DHKA 4WWKB 5IMKB 3DA0A 3QDGD 4B7LA 1E8WA 2G3XA 4JRWA 1FSKB 5DVLA 2H47C 5T1KA 5FKPA 4ZW5A 2WINA 3T0EB 1FIGL 4YSCA 3IGKA 3FT3A 1ZRUA 4EN3B 4WKZB 1D5BB 3EGDB 5ID1B 4QT5B 5BXFB 4FFWC 1ASOA 1G7PB 1YNTF 3IPFA 3ECVA 2P8LB 1D5XB 3VXNB 2VR4A 2KQMA 5T5NG 4I1NB 1MFEL 1RLBA 3L3DA 2AAVA 8CGTA 2W9DL 4F5CE 3MO1B 4ZFZA 4MAUH 4R2GC 1NGXA 5D1ZI 2ZAGA 4S1SH 3OR7B 5AAMA 2NLJA 1HQ4B 3VFSB 1AS7A 4P2QA 1F1DA 2VZTA 3O0RH 2NYYC 5FOBB 4LSSH 2CQVA 4AZ8A 1XXFC 2J2ZA 1XGQB 4NO0A 1NL0L 2EH8L 3FFCE 3HG1D 5DS8A 4G80A 4ONHB 5SWSB 2KZWA 2DD8L 3PUCA 1RIVL 4KU1A 1RIHL 1N6QL 1IL1B 2XNAA 4P57B 4XPHL 1HX0A 5AKTA 1X9LA 2JCCE 4JZJA 4PWGA 2XOTA 1AGFA 3MROB 3PV6A 3V4VH 4X99B 5J3HC 2J55A 3D85A 3TBWA 1RK1A 4KH2A 4DW2L 1SXSA 3ATFA 5FR3A 3BHBA 4KRPC 2Z7WA 3NP3A 3GXPA 3PV7A 3ZTNL 4C56E 4L5FH 1KJVA 1H6FA 1AXSA 1U8QB 3CN3A 1PKQA 3VJ6A 1NFDE 4NBXB 1WITA 15C8H 4X6EB 5J13C 1G7JA 4Z0XA 2D3JA 3LXBA 2V2WA 3UBFA 1U0QA 3GJEA 5AVSB 5MEOB 4N2LA 4UT7H 2AZAA 1I1CA 4WK4B 1XD0A 2JLLA 1JI1A 3HZMA 4JHZA 4Z7UE 5E4EC 4OF0A 5C3TA 3NP4A 5GSVA 3ZR5A 1Q9LB 4HLZH 1FVCA 1UYWH 4DKFH 3FFCD 3HG1E 5A2LH 3SD5A 5D7IA 1SXZA 4K5OA 1IAKB 2J1ZA 3KLHC 1QABA 1XGTA 4K55A 4AG4H 2CCVA 5LBSA 3UTQA 1HINH 4U49A 3FHEA 3Q48A 4U33A 3MV9B 3PGFL 5C0FB 3BUTA 3QYCA 4Y5XB 2EDWA 1VERA 2AV1B 2Z93A 1FI8C 4UNTA 2ID5A 4HCRH 3MTRA 5HYSB 3W5MA 4JGJA 1SOSA 2ORBH 2LFGA 2DM3A 1JPSL 1WJ3A 3HMXA 4JG9A 5DMKA 2ROXA 3BAXA 1E67A 2OX5A 3S0PA 4XNZB 4U6HA 1UKSA 5FDWB 1D6VH 2XX1A 4LLYB 3ENEA 1KZYA 4FQQA 4OBSA 2XXMB 4AM0A 1I8UA 4OM1H 3RBGA 1AO7D 4FF9A 2DQJL 3B9EA 3WDJA 1C5CL 1OIOA 4OZ4A 4AKPA 4ZFOA 2AGJL 4HCIA 2DH2A 3U6XA 4XGZA 5C0CB 1ASPA 2ZTBA 1M6UA 3MZGB 4X6CF 1DBJH 1BIHA 2N01B 4Y4HD 1VPOH 4PR5A 3UJIL 1BVLA 1ACZA 4TYUA 2XG5B 3O6FD 5K33A 1XR9A 4AMKH 2VR3A 4ESKA 1ESOA 3N50A 3V4PA 1NCBL 4HS6A 2APSA 1BZQK 2C9UA 5TDOA 3WXWH 1QZ1A 1N3NB 4Z7UA 1KTCA 3BEWA 3GSRB 1GGBH 3KDPB 2GFBB 2PCPB 2YEQA 1QW8A 1CGWA 2YHGA 3RWCA 1IL1A 1PG7W 1WT5C 2R1YB 4ES9A 3MRPB 4WNJA 1MIEL 4ZMTA 2VW4A 1H6EA 2CRIA 3P2DA 4XNZC 4EDXA 4EF3A 3L3IA 2X9ZA 4ISVB 1QZNA 1GKEA 3DETC 4DEUA 4OZHF 3EUUA 1PX4A 2VAAB 4H8WH 1P7QD 2V8MA 3CVIH 3L3GB 4Z7NE 2BO0A 2EIZA 1X4XA 1YO4A 2XU9A 4XMVA 3WY1A 3PWPA 4XGZB 2P49B 3TJEH 1DUZA 5HJBA 2EIBA 4PAZA 4ELMA 3HHRB 3P9MA 2V4LA 4LGPB 1FLRL 1XGRB 2VDMB 1LDSA 1TZIB 4P5RA 3E6HA 5MEOA 1DBML 3D39A 1A4BA 1FVDB 3NIGB 1BFVL 2OZNA 2YPLA 5F89A 4TL4A 4XN1A 2BSED 3QO1A 3EO1A 2HVJB 3GXTA 1BBJB 2W95A 3V0WL 1XQ4A 3RGVB 2CHXA 4MMZB 4JO2L 2AERT 3MV8B 4YOKA 4H2AA 4A6YL 4B97A 3CZNA 3O3UN 1TQTA 3DBSA 3EBGA 3S37X 5J6HA 2VAAA 2XA8H 3EJTA 4X5WA 3ZQWA 2E86A 3MRQB 1IBHA 4XBPB 1I8MA 2P8MA 3W0WB 3FPXA 2X1PA 3EFFB 5FUZL 2AV1A 2YD3A 5T3ZH 1Q9KA 4JHWL 1MDTA 3H2PA 4YHYB 5BOPA 4J2XA 4R97C 2P5EE 1PAZA 3X14A 3UZVA 2JCCB 3QFJE 4EOWL 1BX2A 1WS8A 4MRCA 4FAAB 1MWAH 1QNZH 5H35A 5KBLA 3S3JA 3CZKA 3SGJC 1D5ZA 3D4GA 4N2NA 2X1XR 4YNYA 1UHVA 1OAKL 4NDMA 4QKTA 5A3IC 2QPDB 3CIAA 4IRSD 4MYWB 3MV9E 3V0WH 4X8JB 5DEJA 1YN6B 3ZMRA 4HIXH 2HKFH 1EO8H 3LRGA 4YGVA 4EZLA 2Y0SA 3R7QA 3HS8A 4P23C 1BOYA 3G9AB 5L2JA 3NVQA 4OLUL 5K69A 4TVSa 3UIZA 3WS6A 1AACA 2IC2A 2R39A 5FA4A 4KPHH 3V4VB 4GQQA 1V5JA 3F7RA 2MTPA 1N5YH 5EU6A 5GGVY 4YFDB 1WSST 4YJZL 3V2AR 2XFXA 2WJ7A 1N3NA 3IS0X 4Z7UB 1IC7H 2R27A 5T1DH 5JTWA 2A3TA 4LARH 4DEWA 4P4RB 1A7NL 1UADC 1F4WL 2FJFA 3LIUA 3KWWB 4HGWA 2VSMB 3GIVB 1CFTB 1ZEAH 2OTUA 1J0HA 1KXVC 2O61A 3H9HA 4PJAB 1AD0A 3PWNA 3VXOA 4L5FE 3U7AA 3FT4A 2X44D 1DJHA 2IH1A 4EQ2A 2JB6A 3G7TA 1RVFL 4JFEB 4FXGC 3WHE1 4KTYA 2VLKB 2JTYA 2KDYA 3IU3B 4IBVA 3I9IA 3DBXB 2DI8A 4RAUB 4MDJB 3HLAB 1BV8A 3TN0C 2OP4H 3ZKQD 3AM8A 3HUJF 5K59E 1IBBA 1NBZB 4R26H 4ELDA 2GITA 4U3XA 2ICES 3BRGC 2IPTL 1ZLWH 4LLWB 5FHBH 1MCOL 4JFDE 2FBRA 1N5AA 3DURA 3QT2A 1KGUA 1GYCA 3MRFB 5A2AA 1QFHA 1OD7A 2JSFA 3B9DA 2IVFC 5I66B 5GGRY 1TQCB 3NCCB 3UAEA 5CEYB 4PG9A 4AITA 3FQWA 4BSWB 3EBAA 1R47A 3MRCB 4JG0H 3CZGA 4H20H 5TF0A 2XC8A 5IKCB 5GGTA 4B0MB 4B96A 1JDAA 1QW9A 4YFEA 1XX9C 4NQCD 1EZSA 1Z2KA 12E8L 4H8PA 4ENEC 2FIKA 3RJOA 4F37K 5A2BA 3MRMA 1E8XA 5F9AC 1GC1L 2VDLB 2OS7A 3RWEB 1U8LB 4XXCA 3W11D 4POYA 1JZ4A 1E90A 3BYTA 4OJYA 2YS4A 3TIDA 1IGJA 5GS1B 1X7TA 4RETB 5MERB 4K7PH 4XRCB 4CVUA 2R0WL 4Q52A 1EO8L 3CSGA 5BPPA 2JKRM 3KS0H 3EH4B 3QQ3A 1RHHA 2H2PD 4WRLA 1QWHA 1VFAA 4D7PA 5CEXA 1HSAA 4YHLH 5J6SA 5T3XL 1CLCA 3KM2A 5JPMC 3D3VD 4MZ3A 5C0JA 1P9MA 5T3ZD 5T5NF 4JQIL 5H4ZA 2CO6A 5JZ7C 3FRPB 5GISH 2CGZA 2DI7A 4X4YA 2NY3B 3G6AB 4AYBA 2GBVA 1Q72H 5HJ3A 3VH8A 3ESVF 1CL7I 3N42F 5E5MB 1A6WL 3EJCA 3US1A 1M71B 3RIKA 3QIUA 1FF5A 3KEDA 4AI7A 4QO1B 5L4IA 4JZOB 1LEGB 1PZSA 1MCSA 1XH1A 2WLNA 4IBTA 2JV6A 2RFXB 2H4EA 5E6IA 4F15B 1OE1A 4ATWA 1SXAA 1RERA 3NRQA 2JI1A 3COOA 4FXTA 1OLZA 4KDTC 1U2YA 3MV7E 4XWGH 3FPYA 1G6RL 4L1DA 3V0VB 2E27H 4MTMA 4UDUA 1DBKH 3A21A 2OMUA 4HD5A 3PAZA 2WHVA 4M7ZB 4O2EA 3LRMA 2JJSA 2VDRB 3TNMA 5F1IA 3WNLA 4BFIA 3ZL4H 3P30L 4XODA 1RIHH 1U9KA 1LJMA 5JHLA 2V9UA 2WTRA 5TQ0H 5CO1A 4P9MH 1ROWA 1FP5A 1YEGL 4YLQT 1EIBA 3OV6A 4Z77A 4K2UL 4QHUA 3RJDA 2BIIA 5IW6A 5EIIG 1J12A 3MACH 1TTFA 2WXPA 1Z9LA 2FEEL 4XPFH 4F7EA 1MG3C 4PJ9D 1F0LA 2YOAA 1XCTA 2QADD 1R3LA 5E9DE 5F6HI 3WU1A 2UWEB 3TCTA 3GMMB 4H8WL 2XV3A 2FATL 2DLHA 2VMDA 1EHLH 4MAUL 1A4JA 1KB9K 2CK0H 5ACZB 3ZZ1A 3EHBC 4OAWA 1C1EL 4AQ1A 2AJSH 2VXVH 4LCWD 2GSIB 1C5DB 1MCWW 4LFHD 4J2QA 4LOVA 3QG6B 1GGYA 3X3GH 3KGSA 4HBQA 1TFHA 2BOCB 3GZOA 4NYLA 4JFFE 1O0VA 3RWFB 4JRXD 2CIIA 4Z9KB 3RWEA 2WINB 2BJMH 4XXDB 5I1KL 3AB0C 3I50L 4Q58C 4PJ5D 3EFOB 3SKNB 5E8EB 3NJVA 5BZDB 1X5AA 5DQ9A 4EZJA 3U36B 4HAKA 1NCWH 3MRNB 1PX8A 1NKRA 1RHHB 4HIPA 1BVKB 4KNQA 3UJTH 1R5IB 1U8MA 4CKQA 4X7DC 2IAAC 3RTQB 2XKNB 4MNQE 2ALWA 1QFPA 1VGEL 4Y7OC 2R2HA 3X12B 1HXYB 4PS4L 4KUCF 4E9XA 3SKJH 2X3CA 4RA3A 4DAGL 1M71A 4TVPE 4LSTL 4XNMB 1VZGA 1ZT1B 3ZHLA 1KCLA 5E56A 4URKA 3QEQE 4JRYA 1PJWA 3RPBA 1UD5A 3OD3A 1ZKAA 4FQ1L 2X28A 2EDHA 4NWUL 1MZYA 3LKQB 3FO0L 4X0KB 3RU8H 3IM1A 5JORB 1JK8A 2H0JA 2KLTA 1N64H 1LM8V 1QTYT 3BSZH 4G8FA 1K72A 3TA3D 4N25A 3D3VB 3RPIB 4PV8A 3GMNA 2K8MA 1KC5L 1A4CA 2NXYB 1CG9A 2RCSH 1PFOA 2YKLH 2CZNA 32C2A 1FFRA 2FO1A 3MXWL 4BM7A 4JPVH 3RJQB 2G75A 3M8OH 4U1GB 4Z7WF 2YN3A 3DC0A 1M1XA 5D7EA 3K6SA 4G43A 4GKZA 1T22B 1AKJD 3VFUA 3ZT6A 2QQLL 1PKQB 2EKJA 3G5YB 3VJ6B 1BQHA 4IBQA 4YXKL 2GUOB 1A1MB 2X4PA 4L3CA 4XB7A 4F9LC 3OF6D 1VLXA 2R69H 1C08A 1ETB1 1KCRH 4L3ED 4MCNA 5JR1L 3REWB 4ODTH 1B2WH 4QHMA 4PG2A 1DE4B 2X3AA 2X4SA 4HKXB 1I1YA 2IWKA 2MNUA 3IPBA 1ZEAL 1INEH 3SDXA 5EN3A 4ZUWB 1P4BH 3O4LE 3QFJD 1MWOA 3GXIA 1PY0A 4KQ3H 4L29A 4KX7A 2EUWA 1PPIA 1HZHH 4XN4A 1DJGA 4QRUA 2Q6WB 3WUWB 2DWEB 1GPOH 2J1WA 1T1WB 2P8LA 1AAJA 1KGCD 4HX1A 4FMFA 1QNIA 32C2B 4Y16C 5C6TH 3QZLA 4LSQL 5MI0C 2PYEA 1A66A 3A47A 3H0TB 4FI7A 1J8KA 1LO5A 2B59B 3VYPA 2NNFA 2XWDA 3MUZ1 1F4HA 1UCTA 3V5HA 4PLOB 4QRAA 3EFOA 5FB8A 4LLMB 4NKMB 5FGRA 2D03H 1CF8L 2ZSVB 3E9UA 2Y1YA 3L54A 4G6MH 4GUQA 5IFAL 5G55A 2XY1A 4PTTB 3K2IA 4HJUA 3BP4A 3FO1B 1KBWA 1KXQA 2VDRH 4HS3A 2Z31C 3K80A 3PXJA 2HYMA 2NYKA 5C0IA 1NCAL 3JQOB 2VO5A 1IT9H 5D2NA 3SB3A 4F7MB 3FK3A 5TD4A 4JO4L 3VI4A 1FL6A 5CJXC 5EBLA 5GGRA 4BRVA 3L1OH 3PLYA 5BOZG 2WQAA 5FW8A 4OH2A 2NYZA 4PWIA 5J1AA 3UBGA 3BD3A 4G6JL 5C0CA 4CGTA 2H9GB 1OP3H 3CSYA 1SDDA 5ALCH 3UTSD 4NFDA 1BM3H 1G7IA 4OSUL 4U4BA 2WK2A 3QNZA 2X41A 4H5SA 3LD8C 3N40F 1THCA 3ZRFC 1G7MB 1MF2L 3DECA 1SVCP 3KNBB 1CLOH 4JO2H 3TIEA 5ENWB 1FORH 4MJ6A 1GAFL 4JFEE 1TZHA 1A21A 2P5PA 3L7EB 1S7VB 4HDIA 3V55A 2J4WL 1U8QA 5CN3A 5MEND 5IESH 3HVDA 3FZUC 1DL7L 5FUOH 4ZOBA 4FJYA 4U2ZA 4TNVK 5CLXA 3TPUA 2C34A 1B2WL 2EDJA 5MEQB 1GH7A 2GT9A 4NB7A 3SYOA 4KUZH 3A4AA 4Z3EA 1KYOK 2PCFB 5B4MD 5IG7B 2V2TA 4IU2A 5B38B 3OX8B 4HIHB 1JOIA 1M1XB 4FLRA 2DMHA 3WDHA 5BS0E 2ZWLT 3PWUB 5IFJB 2I27N 2X7LA 1WTLA 5IOPB 3EOAB 3JTBA 5IVXB 1R33A 2XKUA 2Y24A 4HQQH 3EXLA 2KLRA 3F58H 3L16A 3OAWA 4Y5XA 2PP7A 3E2HC 2JB5L 2ZSWA 3PHAA 2KYIA 1AQKL 3PREA 1RZQA 1C12A 3BPLC 4M7JL 5AAMC 3O9WB 1KENL 1U58A 3IB4A 4A2EA 4PB9H 1X44A 4W68A 2WO4A 3AXHA 4HJGA 3KR3L 4NWUH 3QEUA 2M8XA 1UCBH 1KJ3L 4PY8I 4BIKA 1AKJB 3WNIA 4LLYA 5F9OH 5TE6H 2R29A 2A9DA 1ZCRA 4D9LL 4OTXH 4HUWA 3SE3C 3WO3B 4PJIE 4ZMWA 1KEGL 2WNWA 5GRUL 4HF5H 4E68A 1NJ9A 4L1SA 3B3IA 3W0WA 2ENSA 1OSZA 1U8KA 1J0IA 3OAUL 5BS0D 4J3WA 3BHBB 3WJMB 1CBVL 4ZFFB 1K6QH 3WO4C 4GAAA 5F93C 2FEDD 4HT1L 5LB1A 4ZAKB 5DFWH 5F1KC 1RUQL 2WUBH 2W1NA 1BX2B 4ZMAT 4QRTA 5IEKA 3BAEL 5B39B 5IGXL 1SZNA 5I30L 4TLTA 4X50A 3GSNB 3LH2H 4WJ5A 2XT1B 1CLVA 3HNSH 2GJ6D 3OXRB 1GAFH 3DTXA 4PB0L 3OAZH 3TEXA 4L23A 1DLHB 4PJ9C 1W0YT 3BEWB 5C0RH 4YWGH 3SOBL 4I9XA 2UWEF 4X42A 4HCRL 2Z1KA 4NC2B 1HILB 2I07B 4X6CE 2Z1PA 2E46A 4AYFA 3UYRH 5G4MA 5DHMC 3DV4A 4RMUA 4WIQA 1JZ7A 4WW2C 2WC7A 4FGMA 3KWUA 2CKBH 3BPCA 2CR3A 3D33A 3PAVA 4L3EA 1F3JA 1D7DA 3L3DB 2AS5M 2CGYA 5GJSH 3RWDA 3V0IA 1IGIH 2X6VA 2HG0A 1DO5A 3GMOA 1NC4B 3PQYB 4I88A 2DIBA 4YHPA 1AGEB 1FJ1A 1HHGA 2E9JA 4IKJA 3EO9L 4M8QB 3N1MC 2G5BB 1XF2B 1TMQA 1ZWIB 4R8WH 1E6OL 3HG1B 5CJBA 3TWCH 4EIBA 3LXAA 1AI1H 2IPKA 2ZXQA 4WU7B 3CN0A 1JV2A 1JGVL 1QWNA 4HOMA 4NQDB 3UO1H 3ZYJA 4EUPG 2WVVA 1XT5A 2C3VB 5D2LF 3WN5A 2F6AA 3GMQA 2N7SA 2VLKA 5AALA 3KAAA 1YEJH 1H3VA 4IRZH 4XNUL 2W91A 2F1BA 5KBNC 4P4KA 2NT1A 7FABL 5LN4A 3S35L 2D4DA 4HIIB 3BWUC 4P9ML 2SEBB 3B8SA 5CZXD 4ZO6A 1AP2B 3NAAH 3D85B 2UZYB 4ZAKC 3UOAB 3V8OA 4B9IA 2FJGB 1OM3H 5DGQA 1KTLB 4NSKA 4ABQA 1F6AA 4BBWA 5EC1A 3ETBJ 3L08A 2ISDA 1OZUA 5FO2A 3ULVC 4C58B 4ODWB 1AXTL 1IGFH 4HU8A 4Q9RL 4YAQA 1VDGA 1UJTA 2VERA 2XG5A 5KUMA 3MNVA 4HFWA 3BPOC 1KEML 2IF7A 4RQQB 1RZJL 2VM9A 4XCCH 4WO4C 3W56A 1EAPA 5SWSE 3AWFA 2XVLA 5H37G 2YR3A 5GSRA 1DCEA 4YNYB 4ANUA 5ICYB 4CC4A 4PRBA 5DFVD 3KPLA 3WFHB 1SNRA 3S35H 5IEHB 1QPPA 3AY4C 3BC9A 4MX7B 3VXPA 3MNWA 5IVXE 5DVOA 5EU3B 1D2PA 3D08A 3WV0A 1BD2A 2AQRA 1GRWA 3L3IB 2YSSB 3C60D 1PY4A 4WK0B 3V5KB 3B2XA 1F6AB 4APXA 1SF3A 3NQIA 5IMLB 1TCMA 1UZ6F 3K8LA 3PV6B 4JN1L 2Z93B 2OW6A 2X4TB 3ZE1B 4JX0A 5EUOB 2NSQA 1JN6B 1TPXB 1W80A 5HVGB 1XEDA 3TZVB 2DICA 1G0DA 4LCCB 4E9RA 5K1VA 2J1KA 2NW2B 2B4CC 1WZMA 3CDZA 3SPJA 2H1PL 4MWFA 3CBKB 5DHEA 4KKZA 2HVKB 4NX0A 4PRBB 3WTWA 3VX0A 3VVWA 1CD1B 2VQ1B 2YWZA 3IPEA 1CYGA 2HLAA 2AEPH 1F58H 3P4MB 1K4DB 4FXLA 3TF7C 3PPEA 4ECNA 3RGVC 3ALWA 2IO5A 4YHPB 1S7RA 2GEQA 4AQEA 3IMVA 4KXZH 1WGVA 1NBZA 3H6AA 3BKJH 1KJ2A 3MRRB 1E7VA 3LH2L 4MBOA 3V6OA 1NEZA 3X3FH 3KPPB 1TDQA 4FYRA 4JFWA 2G9KA 4WW2F 4P9HC 2GSGB 3FFCA 1HSBB 2F18A 4UILH 3GXFA 5D5MB 4U1NA 3GMQB 1HQRB 1S5IH 3PE9A 5FHBL 4GEIA 3GSVB 3SQBA 4FCAA 5C86A 3IDXH 4ZPVB 2HVBA 5GRJL 2A6KA 3C6EA 1X7QB 5FYLE 2UZPA 3IN0A 4R83A 3MRPA 5KAQF 4WFGE 4PB9L 2XZZA 1U3HC 1OANA 2XQYG 4WTZG 4TUKL 3QUKA 2UZYA 3D4ZA 5IR1A 5EEZA 1VKXB 1T1XB 4S0TD 1PG7H 3HNTH 3BCDA 1FE8H 1HEHC 1T5KA 3UYPB 2XYBA 3FTVA 1U3HA 5DURB 5BO0D 3B5GA 4E0RA 2ATKA 2P5WD 1BZ7B 1F3DJ 5INDA 4HYTB 3EYFB 5SWZB 2AAAA 4XPFL 3MCLH 3ZSSA 3F7VA 1JWMA 1F3DH 1AFVH 4XN7A 1XGUA 4MBRA 5D7HA 1U8CB 1I4FB 2IAND 2Z4QB 5IHWA 5DWPA 3UTSE 3A4EA 2NSXA 3CK0H 5EU6B 1WTGT 4IOIB 2WLKA 1PAMA 2BCKB 3TO4C 2D7NA 2ED6A 5FLVA 2Y7SA 4I48A 4FXKA 4HZAA 5E8NA 4PCTA 4Z7WB 4OY9A 4ZBJA 2JQZA 3ZL4L 3N44B 2BFVL 3G5VB 4U6XB 5AAPA 2VN4A 4HOWA 3U0TA 3IAQA 3QUKB 1A6TA 3O6LL 4PN6A 4GRLA 2GFBA 4KMLB 2K6ZA 4F1ZA 5C0BE 1PLCA 4WFGD 2X4QB 4PJDE 4ETYA 3BH9A 4KDVA 1MI5D 1NMCC 3K1DA 3U48A 4QHNA 1QBAA 1TJGL 1HIMH 4ANWA 1Q9KB 5FUCC 3SDAB 4LCCA 5KVGE 2Y22A 3L4WA 3GMRB 1HC1A 1BXUA 2XN9D 1JYWA 4YPGB 5HGBA 3QQXA 4N26A 4C4KT 2WXQA 1WISA 2WXGA 2BSSB 1MOEA 1QRKA 2NY2D 3S2AA 3MRIA 4L3AA 1X5IA 1BM3L 2E9IA 4Y9FA 1J0KA 4QJ5B 3QEQB 3ZHNA 3BT2H 4S11A 1QBBA 4QHKI 2N7BA 2E9GA 1XB8A 1T1YA 3ZKXB 3IVKA 1QPKA 2NX5D 2YEZA 1OGAA 5DHYA 5DRZB 1L9TA 4A37A 5HVHC 1MPAL 1YY9D 2NQCA 4PJGB 4NENA 3KPOA 1U8PA 3NYKA 3BZEA 2GJ6A 4JHAH 4UCFA 3H4HA 1JD9A 1OZTG 4G6ML 3BD4A 3P0VH 2B77A 1NIBA 1CYXA 1YMHA 1LD9B 2PTUA 1H9VA 1TLMA 1ZA6B 5HVWA 5KS9E 5JXEA 2G75B 2EE0A 4BGLA 2IMNA 4H20L 1BD2D 4FJZA 5ITBH 5DFAA 4NM8L 4FKHA 4R7DB 1SOQA 4YX2L 3CVIL 1FPTH 2C4XA 3UYPA 5GRZA 1P6FA 1MFDH 3IJ7A 5DJ6B 1JP5A 3DBXA 1P4BL 4G6AC 4AKOA 4UM9B 3EYSH 3WIFB 3P9LA 1XSJA 4R4BB 3S98A 3QPKA 4TUOB 4NN6C 2WD0A 3QI9D 2Z34A 2FSEB 3S36X 5EUOF 3BGAA 2YD2A 1QO3A 2F19L 2J57A 4MD4A 2OMNA 2MJWA 4U6XA 4MQ7A 1U92B 4FMVA 5I75B 5DJAA 5BJTB 1RJLA 4ZMVA 3S4SG 5KG9B 1BQUA 4NQSB 3LYRA 3ML9A 2ZG2A 5EOTA 1JGLH 3LHPL 1SRDA 3QRFM 2RGSA 4D3CL 3WY2A 5IJDC 3MRDB 3HMWH 5DK0A 1KC5H 3VXTB 1XMEB 3EJUA 2OV0A 4NO5B 4P2OA 2ATPA 4E9SA 4MS8C 3VDBA 4KKQA 4WWKA 3RUGF 1MFUA 2JQMA 2WLLB 5FKPB 5JDJA 1YNTA 3OHMB 4HLEA 3IU3A 3T1WA 1XZ0A 1NC4D 1ZT7B 4QD2E 1AGBA 2ZOKA 1FA4A 2CDEB 3MGTA 3MRGB 3A6CH 1D9KA 2PW1B 2D31B 2VDQL 3K8MA 4WWID 1S9VB 4I9WE 5BV7H 3OKNA 1YC8A 3QCTL 4XBEH 4WZ9A 2HKFL 4K3DL 1BJMA 1J8HA 1EV2E 3PGFH 3QG6A 4X7CC 5B1CA 4Y2DD 3NJMA 2ZNXA 2HFEB 2IWGA 1N6UA 2H2SC 4NXKA 1YJDC 4NLAA 3TIEB 4J8RA 1YJDH 4DTGL 4J6RH 5A40E 1Z0MA 2HN7A 5LDUA 3W39B 2PR4H 1T1ZA 4KV5E 5DK0B 3VXTA 4QNPF 4HJ0C 5GS0L 1RKRA 1DSFL 2Q86A 2YA1A 3KPOB 3QAZC 3HBZA 2GJ6B 1FV1B 1YECH 2XWEA 4JG1L 1KT2B 4BWTA 5B4MC 3FAXA 4E5XA 5HYIA 2DZEA 3VRJB 5E8OB 4K8RC 2VXVL 1NOAA 2P5ED 4JVWA 4OZHA 3C87A 4KVNL 4MS6A 5CP3H 4I0PA 3DSNB 5I6KA 3QJTB 1QPXA 2WSPA 3UBHA 2UZIL 4JAMB 1IGJB 5DQDL 5GS1A 1KCVL 1R0AL 1QFWI 2DWDB 4JQXC 3ME0B 3FUJA 3QIUD 1RIUH 1Q0XL 4X83A 5DTFA 4YMPA 4FRWA 5IVNA 2GTZB 2K3TA 4AYDC 5FM8A 1T66D 5DJYB 2XY2A 3LQMA 3M17A 4N0UA 4W9IC 5D55A 1XAUA 3BUYA 2UZXB 1IU1A 2XJLA 5JORA 3DX0A 3T4AB 1UFUA 5CJOH 2FATH 4P5SA 2A4CA 1MKFA 4AJWA 4U1LB 4GAJH 3D3VA 4PJIF 3RPIA 1CE6A 4NOFA 4Z0XB 1JZ5A 3MACL 4AT6B 4U1MA 4UNUA 3L7FA 1RZJH 4GIOA 1GS6X 3T3PB 4BFKA 1U92A 3IFPB 4GAJL 4NZRL 1SN2A 5D7IF 1CLYH 5CLZA 4S1RL 4J3OF 3GSOB 1CVRA 5B7EA 2J1YA 3DV6B 3H3PL 4F58L 4XXWC 1MVUB 4NQSA 1ZE3C 1CZ8H 3W11C 3EYVB 5HI3D 1TQWA 2W9DH 5CMAB 3I2CL 1IQWH 2GUOA 3BZFB 3QIBD 5AOMA 4KK5D 2EE9A 2XPZA 3D8MA 1JZIA 3GRWA 1PX3A 4XVTL 1A6UH 5I5JA 1N0LA 5I82A 1USQA 1E2ZA 3CCHA 5F88A 5I75C 4LRIA 1NDGA 3DJTA 3Q9QA 2ZOKB 2IG2L 2QLVB 2GI0A 5KW9H 3ARXA 4ZUSB 2PMZA 4NQCE 4BFRA 3SE4C 2ZG3A 5AW8B 3STLA 2Z0UA 3OKNB 4JQIH 2IFFH 2IANA 5CJ5A 3B5HA 1T0PB 1XSIA 5T3XH 1WWWX 2JCWA 4ODHH 4BFNA 3G6DH 2QV4A 4ALAH 2G60L 1H3XA 3RZCC 3O6KL 4Z78A 1JV5B 4LLVB 3D69A 4PV1C 3ARVA 1RJZA 3HE6C 4Y16B 2ADIB 1BECA 4ZQKA 1MLBB 2MNWA 5BMFL 3GK8H 4F7CA 2AXJA 2WVSA 4JE4B 5IROC 1T2QL 4IGBA 4JDTH 1RZKH 1LO3L 1ZGLP 2H6PA 3KLHD 4YK4B 3GM8A 4DP6X 4NAQA 4AQ1B 3OMZA 1EGJA 4XCNA 4RGND 3QPXH 1RUPL 5BV7L 3RDTA 3RVUC 3CN2A 1XR8B 2Q10A 2WO3B 4MA3B 1ND0A 2VLRA 4G2AA 4JANB 3LQZA 1I8KB 3DIDA 3BE1L 4C83A 5G5DA