2EVFA

Structure of a ndt80-dna complex (mse mutant ma6t)
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
303
structure length
290
Chain Sequence
VILTQLNEDGTTSNYFDKRKLKIAPRSTLQFKVGPPFELVRDYCPVVESHTGRTLDLRIIPRIDRGFDHIDEEWVGYKRNYFTLVSTFETANCDLDTFLKSSFDLLVGRLRVQYFAIKIKAKNDDDDTEINLVQHTAKRDKGPQFCPSVCPLVPSPLPKHQTIREASNVRNITKMKKYDSTFYLHRDHVNYEEYGVDSLLFSYPEDSIQKVARYERVQFASSISVKKPSQQNKHFSLHVILGAVVDPDGIPYDELALKNGSKGMFVYLQEMKTPPLIIRGRSPSNYASSQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell cycle/dna
molecule keywords 5'-D(*TP*GP*CP*GP*AP*CP*AP*CP*TP*AP*AP*AP*AP*C)-3'
publication title Principles of Protein-DNA Recognition Revealed in the Structural Analysis of Ndt80-MSE DNA Complexes.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 86
structure length 290
sequence length 303
ec nomenclature
pdb deposition date 2005-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05224 NDT80_PhoG NDT80 / PhoG like DNA-binding family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1390 Mainly Beta Sandwich Immunoglobulin-like NDT80 DNA-binding domain 2evfA00
2EVIA 2EUZA 1MN4A 2EVJA 2EUXA 2EUVA 2EVFA 1M6UA 2EVHA 1M7UA 1MNNA 2EUWA 2ETWA 2EVGA
chains in the Genus database with same CATH superfamily
4EOWH 4WO4D 2A4EA 3MUHL 4JB9H 1E5CA 3HE7C 4RMVA 1X7QB 1ZTMA 3LIZL 4DK3A 3H9SE 2F9BT 4LSTL 5GRYA 4QT5A 2VLLB 4DW2L 2K6ZA 2ZOOA 3VSTA 1HFUA 3WJMB 3MQIA 3C75A 4AI7A 5D1ZA 2LFEA 4NAQA 5BZDB 3S98A 4M5YH 3G6DH 3GM8A 2A9BA 3QJHB 1P7KA 2EYRA 4APQB 2GJ6A 5BV7L 1I1FB 1NCIA 1Q94A 2MCG1 1URIA 3OL2A 4G3YL 3G7TA 3DRTA 2QL1A 4GKZA 4YE4H 3OKKA 4R96B 2ZCLL 4B3VA 4W4OA 3BZ4B 1L7TL 1QBLL 3QUXB 4OQTA 3QUZD 4TTDC 2OJZH 4X0KB 1QLFA 3NSFA 4N3TA 4HT1H 3RHWK 2F54A 3LRLA 1N0XL 2UXVA 3VGEA 1SHMA 1G7IA 4ATTA 1MCKA 4G8GB 1DUZB 4PJDF 4RAVA 3BO8A 3HG1B 4X6CA 2JKWA 5I75B 3RY4A 2WZ5A 2HX9A 3G3LA 2A77H 5E1AB 1WG3A 4Y4FD 5DZPA 3GJFH 4JO4L 5MP6H 2B3RA 4GAYA 2DQFB 1YHPA 1H3WM 2H8PA 2QHLA 3VE0A 2V2TB 2FX9H 5C07D 3CSYB 3HMWL 2AMUA 5B1JA 2VUOA 2HFFA 4HWUA 4FYSA 3S5LB 1QSEB 2YFOA 3TYGH 2P46B 3FN0H 4XXWA 2ESVB 3HC3L 3DRQB 5F9DC 2GEEA 3TYFA 3HE6B 3MRFA 2XDHA 2ZX7A 3O8XA 4A04A 1Z66A 2EXWC 4Z7UE 4ENEC 4LSUH 4DEPC 3UC0L 2VXSL 15C8L 4G80A 2OX5B 3UPCA 1IJ9A 4DP9X 1KY6A 2I9TA 4L4TE 1MAMH 4C56D 1GIGL 3S35L 1JVLA 4OCMC 4NUQA 3WIFB 5A43C 3C5ZA 3K7UA 3CFDB 1CE6B 1A7QL 2X4TB 3CFMA 4U1GB 3VXRB 2OJ1A 3NJFA 3MUJA 2WINA 5HGDA 5FUZH 2BO0A 1JP5A 4KH9A 4G72B 3EYUH 3ULVL 2Q86A 3SGEI 1EFXD 3SGDI 5D55A 1NDTA 1DQLH 4PHXA 4ZXBC 5L8KB 2DICA 2Q9OA 3NT0A 3MLSH 2Y2TA 3RZWA 3KYNB 4KUZH 1H8SA 5IG7B 4UDUB 1NGYA 3RI5F 3GWJA 1AXTL 1CZ8L 1QWUA 1IIIA 1JGVH 4K5NA 5DUPH 5E70A 5ITBH 5FW8A 4OM1H 1N6QL 5F6HJ 4AXWB 3G04A 2J12B 1KGXA 1X7TA 3U7YL 4RESB 5KSBE 3QYCA 1YECL 3SDDA 2YUWA 2HJLB 2VDKH 5L7XH 1PG7W 5L8LB 5CCKL 4WW2A 2PW1A 3PS6A 4S0TD 3O0RH 1OQOA 3GMPA 4UNUA 4KQ4H 5J11B 2IEPA 1FV1B 2FX7H 3MRNB 3PL6C 1KNOB 3VA2C 3EHBB 4QYOA 4TUUA 4Q9QL 2FIRT 3F58L 2A7BA 4XBPA 3GEWB 4N68A 4HHAB 2YGQA 2JCCE 1EH9A 3DLQR 4KK5D 2XU9A 1GGCH 3VJ6A 4AITA 6PCYA 5J12C 5DVPA 2X6AA 3OAYH 2IVFC 2RBLA 1WHOA 2QQNH 3LZFL 4QOKD 5I5IA 5IMKA 5I1CH 3CVHL 2IV8A 3BDBA 4NN7C 1GCYA 4PJGE 1BQ5A 4L8BA 5KYNA 5H37A 3VXUD 2J8HA 4XRCA 3MRIB 5GRJH 4JGNA 2N7AA 4N8PA 3UZQA 5I1DB 4ZUUA 4YUEH 3TPKA 4JM4L 4AGLA 4X42A 5GGRB 5L2KA 4NUJA 1CPUA 3ZW3A 3D85A 1B2WH 1N9PA 4GQZA 1EEQA 1JWMB 4MJID 3RBGA 4CVUA 4DESA 4IJ3C 3D08A 1R3IH 3C09B 3BKML 3DIFB 1KTRL 3BE1L 1OLLA 3W0WE 3WEMA 2ZNWA 1B6UA 2JIXD 4LLVB 4UT6H 3HUJA 5HI4D 4KBPA 3WL9A 1TJIL 4PRPA 3BN9C 3WMQA 3HN3A 4OLVL 4UQAA 1D7FA 1LEKB 1IGIL 2KLTA 2UYLA 2K6YA 1NMAL 3CHQA 3L9RB 1H5BA 4DPBX 4YDNA 4F8TA 1D5IH 4JPVH 1OLZA 5CD5C 1SLXA 1D6VH 1J9SA 2YD8A 4Y2OB 3LD8B 1MHHB 3NFPA 3WLWC 2MCPH 4YQXL 4AUYA 1W8OA 4FG2A 3K74B 4Z0XA 4X9YA 1FA4A 3EYVB 4MRBA 4QIRA 4HIHA 1U30A 5AAWC 3IDJB 2P1YA 3O3DB 5CINH 4D3CH 3BAJA 3TNMA 5M94B 1BG1A 1HH9A 4KTGA 3G08B 3WDJA 1WA2X 2VQ1A 4NDMA 2PO6D 4P2RB 1RK0A 4XX5A 4U6HA 3KEDA 1W72H 1XGUA 3INUH 3KJ6H 5DXWA 5AALA 3M46A 4QRAA 3IGKA 4ANWA 1F4WL 2O5YL 4MJ5A 1QABA 3US1A 5ADOH 3WNIA 4AEHH 3QAZC 4L5FL 1MFEL 4F9PA 2DEWX 4ZSOB 3DVFA 3ZHKA 4PAZA 2DM2A 3DO7A 5LNEA 5D2LF 4FFYH 5KVGE 1HYSD 1IC7H 3L4ZA 3DXAD 3ARGB 3PF2A 1BLNB 3NQKA 2Y5TA 2OJEA 3FPYA 5CCGE 4JS7A 1UZ8A 4LGPB 4POUB 2QVIA 1E6OL 2ZQKA 5D4JA 3RTQA 3WTXA 4Q9CA 4WK4B 5CJXA 4GLRH 4ZPVB 5FCUL 4FXKC 4ICXA 2OAAA 2VUKA 3QZWG 1CLZH 1AY1L 4XCEA 5IIEB 5D7JB 1Z5HA 2YIHA 5B7EA 1T3FB 3DTXA 2QKIC 2PABA 3UZEC 3UTTD 2AXFA 3DROA 2XXGA 1LM8V 4FNLL 4PJCB 4C47A 4NI3A 3O2WL 1H15A 2IDSA 4FG0A 1JE6A 4LSPH 3UP1A 2VDPH 3KCPA 3TX4A 5TE6L 2VKWA 4QY8B 3PWPB 1U8IB 4XN1A 1OO2A 5DMJB 4XP1H 1LILA 4OTXL 1NPJA 3QCVH 4Z0BL 3UG3A 4AJ0A 3OB0H 3BAEH 5CCJA 4XOEA 1QA9A 2PWFA 1RZJL 4A6YA 3EYFA 5DHYA 4FLRA 4RDBA 1HU8A 3T8XA 3ZJAA 4NWUL 1UQSA 4OAWB 4XX1G 3NABL 4X6EA 2XVGA 4XO4A 5HHME 2WTPA 3B8SA 1UB5A 5MENB 3OWEA 5KVDL 5D2NC 3U0TB 3VWKA 2XBZA 1P2CB 1ZLEA 3QDJA 3RDJA 1PTZA 2E0PA 2QKSA 1DSFH 4WW1B 4G6ML 4B0MB 4KZEH 2ENYA 5IB5A 3ILQC 4MJ6B 2AQ3A 3ZKND 3I6LD 5MERA 1KACB 5MEOB 5D7LD 4POZC 2EIMB 4XPTL 4M8RA 4HFWA 1NGXB 5JIKA 2FSEA 5SX5K 2BVPA 1D5BB 4ATWA 2YGPA 3H9HA 2RACA 4M8VA 4NPJA 1LP9B 1FSKC 5H35B 4FTVE 2UVEA 1P7HL 3B2UD 3V5DA 3P9LA 3IDMB 2DL9A 3WXWL 2TRHA 4HIIA 4LMQI 1Q38A 1NM9A 2WWMD 5CUSH 4KK8C 1BQSA 1OB1B 4OCSH 3MRQA 4OQTL 3IVKA 1UM6H 3NA9L 1MJ7L 3QQ3B 1KTJA 4I3SL 1EA9C 4WI2A 4LASH 4HJTA 2VQUA 1BBJA 4ZD3H 4N0FB 2NLJA 2W1NA 3FQXB 2FT6A 1BOGA 1KLGB 2YA1A 1RFDH 2E9BA 3GRBA 3WD5H 3WIHA 2KT6A 1EJOH 2F7IA 1JPFA 1EHXA 3LHPL 2XN9A 5AW1B 4JAMB 3O3EA 4LEBA 1G7MA 3RWGA 5ESAA 2D03H 2HN7B 2P5EA 4JFED 5FO8B 3CFBB 1NLBH 2WWKO 4EKXA 1VIWA 3EO9H 3KM2A 3DPBA 5D8JH 4DKDC 2WQ8A 2VC2H 4XCYB 2BHYA 3NSDA 3VQMA 1MFCH 3EXJA 3FB7B 2X4UA 4HH9A 4R7VA 2IOOA 5I30H 3HAEB 3MKGA 2WXMA 3OAZK 1UENA 5DJ0A 3VI4B 4IBLT 3IFLL 2DS4A 1MCOH 4XBMA 1PEZA 5TQ2H 4YHPA 5EEXA 5JLZA 3IJ9A 1JNHA 2HG5A 4FYQA 5AW5B 2R0WL 4LNRB 1JXKA 1R5VB 5GGRY 1NFKA 5CHNB 2NY6D 2E75C 1HH6A 1CD9B 1MCCA 4RBPK 2NYZA 4KFZC 4UZUA 4DOHE 2P47B 2RB8A 3IETB 4LHUA 3LIUA 3B7TA 4ODTH 4WJG3 3DJRA 1OP5K 4E5XA 3I50L 5E9DD 3HNVH 4G6JL 4XBGB 4MASA 4X99B 5DJ6A 4IHOA 2CDFA 4BFRA 3MV8A 1WD8A 3BUQA 4HWZA 3ARBA 2DLTA 3VWJD 3I85A 4BFBD 3D06A 3L16A 5FC9A 3U1SH 1JRHL 3HPJB 4PGCA 1XTMA 3ULUC 2EDOA 5DURB 2W0PA 2GHZA 5FYJD 4HJSA 5C0DA 4D9LH 4J5VA 4JFFB 2IWGA 4P46A 5KVEH 3QI9B 1T2QL 4YBQC 5H37G 3VXOA 1ECZA 2YD1A 3UJJL 1OW0C 3QC5X 2A3TA 1DZ0A 5EOTB 32C2A 2IWFA 3BLPX 1BZOA 4NKMB 4AMKL 1AS7A 5E6RB 2JLPA 1TJHL 4Y2LA 5FO9A 3VYNA 3UC2A 5C07E 3L45A 3RU8L 4ABWA 2WZPA 1NCAL 3D51A 3D50A 5I23A 4L4VA 3ABMB 3CIQA 2WQSA 4WGWB 3R7QA 3TFKD 1QNZL 2XZQL 1MIML 3VXQB 1U92B 5K9OB 1G7JA 2P7TA 2X4QA 3OB8A 4NP4H 2RCSL 1UH4A 2AK4E 2V0AA 3QGVA 2GEQA 3UIZA 5IESL 4ANVA 1G1KA 3BJ91 3WY2A 4F8OA 4N26A 2Z8WC 5IMOA 1M71B 1TG8A 4C56E 4N9OB 1CGSL 1M2VB 2B8OT 1C16A 5GRWA 3BZEB 2I5YL 3NK3A 1FFTB 1QI4A 3H42H 2QTEA 4H0LC 4NQCD 1LWJA 2DJ4A 2GBVA 4L18A 4DN3L 4P2QB 2XWEA 4RMWA 1HWGB 2WSDA 3MHZA 2V7HB 3WOVA 2QBWA 3ARPA 1IFGA 3FONB 5CZVL 5A3ID 4W9HC 3I9GL 4UV7L 1AP2A 1XSIA 3MRMB 1FJ1A 3SY0B 1FF5A 4YHLL 3V6OC 4D7PA 4NQUA 3D39A 3Q0HA 4MQ7B 1Z0MA 3U30C 1NFDB 1T1WB 1BFOB 1UH3A 1TYEB 1VESA 4MZIA 1MI5D 2QMKA 1IGFH 1HHHA 5FGBA 4EDWL 3CLFL 4KV5E 5DD5L 5L6YH 1ZHLA 1K5NA 3QIWD 4ABVA 1A2YA 3LRSA 1W0YT 4TSAH 3RIAK 1AKJA 1G7QB 4U1KB 5JDSB 4B27A 3ZGIA 1S9YB 4PRDA 5I0ZA 1GMIA 3US9A 4LAQL 2G5BB 2XWXA 1ZVNA 3GTNA 3QISA 1F4HA 1VF5C 1ZLSL 1FNAA 4B53A 4P23A 2HT4C 4A7QA 6FABL 4BHUI 1OXYA 5CJQH 1TVDA 1SY6H 1F41A 1GGBH 4K3DH 2FD6L 5E7FA 4PM1A 1NEZA 5ICZA 1YJDH 4P4KC 1A7NH 4U7KA 1TQUA 3SB3A 3N1FC 3W9EB 4M4PA 5C0AD 4DN4H 1R5IA 4L1BA 2CDEB 4PW3A 4XWGH 3GUTA 4BFFA 1JI2A 2X89D 3DIDA 3GHEH 4P57A 3B3IA 2CKBL 4IU3B 2A6IA 1MWAH 4QOKE 4C58B 5MEQA 2XWJB 3QB7C 1ICTA 2NTFB 5I17A 4IMKC 1FHNA 2OYMA 3GBML 3F7YB 3VXUE 5F3BA 1B90A 1J8HA 4UBDD 1BF8A 4YLCA 4TNEA 2EICA 3WY4A 2CO7A 4KRPC 4BK4A 1GYCA 1YYML 1YPZB 1CBVH 1QLRB 2WC7A 1A7RL 4H5SB 1V7NL 1FVCB 4PQXA 1MQKH 1ZA6A 2QGBA 4A38A 5A2FA 4NC1E 1NKGA 1KMGA 3TO2A 3MRPB 3E8UH 3B5HA 3P11H 3N50A 3O2VH 4GAGL 2R2HB 2MFNA 5I18L 5C0FB 4PPTA 1PQZB 2GSIA 3L48A 4QRRB 5JHBA 4Q9RL 3K2UH 3CMOH 3AS0A 1JF1B 1JG9A 1BIIA 2MPVA 2XG4A 3UGUA 2TRYA 2IALB 2YZ1A 3DTDA 1QATA 3GTTA 4Y4KC 2JKRM 2ADFH 1K5WA 4KX7A 4H25B 2F6AA 3L9BA 3X3FL 3BIKB 1B0WA 3ARYA 5EZLA 4JQIH 1VB9A 1HOCB 2V5SA 1T22A 1V3JA 3EFDH 4FDWA 5K9KB 5DVOA 3TJEH 1CUOA 4A6YL 4GRWF 1I7UA 4Y4HA 5KS9B 4QJ5B 3WUWB 4WUUA 5CNHA 1GS6X 2X2HA 1Z5LB 1I8LA 4U3HA 4EI5D 1S3RA 3P77B 1ND0A 5IHZB 4MXVF 1XCQB 1BZ8A 2OL3H 4G1EB 1G1YA 2H0EA 5IJVB 5T5FH 4BA8A 2A9ML 3QO1B 4KMTL 4KO5A 3UBXA 5IMMB 5EFIB 12E8L 5KANI 2EYRB 4GKSB 5I71C 4Y5YA 2X2IA 1CLYL 4JZOA 1QI3A 2DQHH 3DXAE 3G6JA 4JHAH 3MUUA 4L29B 1YLBB 2E7HA 3MBED 4JFVA 1D5RA 1EX0A 1A25A 1U2YA 1A6TA 1II4E 1P5VB 3AMLA 5DO2C 1RMFH 3OQ3B 4IDJH 2DEXX 3MBXH 2F8IA 1XWVA 1ZVSA 4MB1A 1IKNC 4JN2A 1KWGA 4NKDB 3FO1B 4X6CB 2NZ9C 5HYIA 3MJ9A 1RZGA 3TNNA 2ITFA 3K71A 1RJYB 5FUOH 5BCAA 2HRLA 3UTTE 4JKLA 3TEUA 1N2RB 3OHMB 1ZJBA 4AT6B 5DLLA 1K9TA 2CA4A 5DZOA 5BJTB 5JXEA 5FW7A 4PY7B 1QUNA 4IOIA 3BDYL 1BQLH 4HJ0C 3RYMA 2KDYA 4KPHL 5D1QC 1RULH 5EUKB 3BQVA 3BVUA 5E2UH 3ZPDA 3GKWH 5AVQB 4FFTA 4CVWA 3PWVB 2DMCA 4ELMB 3CFKA 1NCGA 3SKNA 1OTTD 2YRLA 2D0GA 3K0WA 4NQDD 3DSNB 3NN8A 1D2OA 2X7LA 3WS6C 1M1XA 1VGKA 4LHUG 1XGTB 4YEEA 4NKIH 5C2BL 3T2NH 5B21A 1GYWA 4E5XG 3QR2A 1YJDC 3Q44A 3KR3L 1QFWH 2K6WA 1J8KA 3CXDH 1QR1A 1Q0XH 2CLVB 3BPNC 3M1BB 4KNSA 2P4AB 2WYIA 4M62L 4YDIL 4U31A 4R3SB 1GAFH 2ZUTA 4NZRH 4FQLL 3Q8EA 2APSA 3VI4F 3D69B 2BFGA 1D9KC 5DO8A 1WV7T 3CDZA 3EZJB 3O11A 3CG8A 4XHJD 4U4BA 2CR0A 3HE7B 2OTPA 2LW3A 4L4JA 2H2SD 2BZDA 4OCYH 2B2XL 4FKEA 3I6LE 3FT3A 4PRHB 5D7LE 2LV4A 1KOAA 1T0MA 4PJFA 4TNWF 2K9FB 4OJYA 3VCLB 1FNHA 2J1YA 2H1LM 3C9NA 3LKOA 2A74A 3TF4A 4EXPX 5KYWB 3QEGH 2KZKA 2J7LA 3QJFA 4V33A 1S3KH 3KGRA 5CJBA 4MD0A 2A0LC 4B41A 4KKBC 1PG7H 4AX3A 1U8PA 2YPKB 3IGFA 4F7EB 3ZO9A 3X17A 1SMAA 2DDQL 2SEBB 3BAXA 3AUWB 2NT0A 2NY1D 2ZUVA 1Q9OA 5CIPB 4R4FL 3BW9B 3HZMA 2MHAB 2OMYB 3TH4T 1PLGH 2GFBB 4JANA 4ACPA 4OCXL 3ZKSD 3TM6A 2Q7AA 4KC3B 4AIZB 3BZFB 4YIQA 5IMLA 3KPQA 3PABA 2EC9T 2HPTA 2B9BA 1HDMB 4J12A 5IVOA 3RVWD 2IGLA 4JFEE 4H0HB 1L0PA 3TV8A 4AQ8C 1OOWA 2XWRA 2FE0A 3F85A 1OSZA 2ICWB 1MCNA 4JZNB 2VDML 4NFCA 2DI8A 4K7PH 3MLRH 1BVNT 2K78A 3T4YA 1U8KA 3GDBA 3NRPA 5EZJB 2YBRA 3WIAA 2Y1VA 2LU3A 3SDYL 2GIXA 4J23A 2WMPA 3LS5L 2I24N 3OHXA 4G7YL 3QULB 1KIQB 5IBTH 3E80A 3RBSA 4JRXD 5LG6A 4ZOBA 2TSAA 1GZHC 4ZFGH 2EP6A 1C12A 3HZYB 5EDXA 3T0AA 5FKAA 1QACA 3LRMA 3FB8A 4P0DA 4N6RB 2EYTA 1HNGA 4JPKH 3TEXA 1GC1L 3T0EA 1FFNB 1KCRL 3RUGB 5HYJB 2IADA 2DIBA 4YSTA 5EH1A 5T1KB 1EJ6A 4HW6A 4DPCX 3QBTB 5E9DE 4U1SB 3MOAL 3HZKB 2H26B 4OJCA 3T2PA 1ZHKA 4DZ8B 1IM3B 1E3ZA 4AG4L 5BS0D 3W5NA 1TTCA 1NEZG 2OS7A 4RWHA 5C7XH 2CMRH 3O6KH 2WTRB 3WMSA 1EWHA 4FQ2L 4LSVH 3W56A 2GG1A 3X3GH 3SCMB 5D71H 4ZXBB 4A7VA 4OV5A 1GGUA 3RNKB 3HLAA 2DKSA 4QTIH 3PGFH 1OGAA 4KXZI 2JELH 1UYWL 2BPBA 4L8SC 2M8XA 2OXHA 2HUEA 4KO6A 5FYJE 2HFEA 1KPRB 4L8CB 5IROC 3HNTL 4F20A 1L0YA 3NCWA 2C34A 4KQ3H 3GXPA 3TBYA 5K59E 3F01A 4PD4J 4Z7VE 3UAJD 2HVJB 2V5YA 1UWEL 3NZ8A 3GHPA 1OPGH 3HC2A 3P4MB 2AQ1A 4ODHH 5IJKC 2UWEF 3D48R 4JUSA 1BSIA 1FVDB 1OAXL 1THCA 4FNUA 3K5SA 4A63A 3N3EA 5L2JA 1VLXA 3PL6B 4HWBA 2X3AA 1DBML 1PFCA 4Z1PA 2NCMA 4I2XA 3RDTC 4RAHA 2MQGA 1SRDA 5KVGH 1D6EB 4FMFA 1M7DA 4E2OA 3PFQA 5DFTA 1AGDB 2EDQA 4ZUSB 2V33A 4KHXH 1ZIBA 3C6SB 3QCTH 1XCWA 4ONFL 5TF0A 5J12B 4DZBA 5TFSL 1KJ3L 2VISA 4Y1AD 1AAJA 1ODAA 2WQXA 1P6AB 4IGBC 5CSGA 3VW3H 4NN7B 2PP9A 1WTLA 3BP5A 1R3JA 2XY2A 2XX1A 1H15B 3B3BA 5ACMA 4Z3TA 1A4JB 2Q20A 5HDWA 2YD7A 1YPZF 4J6IA 4K2UL 4U33A 1JFQL 1Z9SA 2DB8A 3MUGA 1FNSL 4FZ8H 4MNQB 4NQCE 4QAMB 4LARH 4WGKA 2F74A 2DWEA 4KXDA 1FFPA 1KIPA 1BBDH 4IJ3B 1J1PH 1FGVH 3V6BR 2R29A 1A5FL 1UOVA 3CN1A 2Z0BA 4B97A 4AM0Q 1AGEB 1KJVA 2R0LL 1MI5E 3F83A 2FO4B 1XF4A 2X9XA 1UM5H 2AGJH 1OTUD 1GHFL 1ZPUA 4PB0L 3VMPA 4M8QB 1FL3B 3BQUD 4I1RA 4PJHE 1RK1B 3NCJH 4QHMB 1RJLB 4LBAA 5CP3H 5ES4B 1RIHL 4K3GA 1LD9B 2FB4L 3IMSA 3GBEA 4ETQB 5IQOA 4MS8C 1CU4H 3E1F1 4O51A 5KS9F 2VNCA 2VZ1A 3RWHB 4X7EC 4JPWH 1I3RB 4DIXA 1SJVA 4CC0A 4OCRH 1GH7A 3C2AL 4Z7NB 5C0AE 5DJZA 2WB7A 2BVPB 4M7JL 2IBBA 4Y2DC 2M26A 5AZ2L 4HH8A 3D2UA 4WENB 1XMWA 4KUCD 3QAZB 2CKNA 4ZMTA 1LXMA 2CLZA 1AFVL 4IJTA 3GSNH 5IJKA 3IS0X 2Y9RT 3Q8AA 4GXUN 3VYPA 4AM0A 5C2UB 3B37A 3OXRB 5BW7C 5AQ0A 4FABL 3KDMA 3MRQB 1FORH 1SLUA 5C08D 3A4EA 4TNFA 4Z7UA 4W9EC 1XIWD 2GHWB 4LOVA 4JLRA 1O5DT 2NLJB 5KN5B 4L4TA 4PB9H 4PTTA 3P4NA 1P4BH 3MJ9L 5LN4A 5LBSH 4X6CF 4FXKB 3DK2A 4ZAKA 1A3QA 3N91A 3QHFL 1B4LA 3MOBL 5I66A 3TONA 2P43B 4LRNH 4PWGA 2QKIB 3GXFA 4LL4A 3WAKA 1EHAA 5K1JA 4DHLA 4WI6A 1R6VA 3W1ZA 4Z5RB 5I19H 5JR1L 4RX4A 5EEYA 3GNMH 3NH7H 4XNBA 3IDXL 1F3JA 2IH9A 2BS8A 3ZL1A 2HCZX 1HL8A 4ZDHA 1WF5A 3Q8FA 3FCTA 1AG6A 3K80A 2VDKB 4ELMF 2UX7A 4HGKC 2CM5A 1T1XB 4P04A 1NKRA 4Z3GA 1YNLL 1NAKH 4IOSD 1OF0A 1KCWA 3X1BA 1LHZA 3EFFB 5EIIA 4N0YL 4E9SA 1UJ3A 3BD4A 4NUGL 5E08H 1UXSB 2JQAA 3VD4A 1AZNA 3B2PA 3KH3A 4HJJH 2XZAH 3SD5A 4F2MA 3LXBA 5AVRB 1AACA 3MXVH 3TP4A 4JQVA 4BKSC 5ID0B 4ALAH 5T5NG 3AAZB 4TNGA 4XH2B 3V9EA 3ARFB 1XGQB 4S1DC 1TENA 4XPGL 1ZLUH 3FU8A 4N1HB 5D2NB 1LNUA 2LT9A 1EXUB 4EN3D 1IAIH 3FHAA 3GSQA 3LYRA 3T6VA 4FQCH 4HWZB 5IB2B 4IKLA 1P53A 1GJUA 2YN3A 3ENEA 5LQBH 3C8KA 1B3IA 4UIMB 3SSGA 2A6KA 1U8CB 1JJUA 3X14A 1G0YR 3BYYA 3TBCA 2AI0H 3DO3A 4X9GA 3O9WD 2AXGA 1T04A 3FCGA 4MA7H 3VXTB 4MWFB 1CFTA 2VDNH 4XC3L 1PD0A 2XPGA 1FSKB 5DF0A 3KPNB 4UQ2A 5AB9A 1YEWA 3A4FA 4U6YB 4AYGA 3PPSA 5FHBL 3V7MA 2WYZA 1NC4B 5EA0L 5FO9B 1MNUH 2R1YB 2ZOWA 1FFQA 1WZKA 2AEIT 1Q1JH 3UJIH 5DI8A 5DJAA 3JVGA 2OLDA 4AH2B 3KPOB 5CLTA 4YSPA 3QUYD 4NQDE 4GMTL 2Q3AA 4WK2B 2XIBA 1AQHA 5J4MA 1T1YA 3MROB 5D5ME 4LLQA 3RVVC 5BOJA 1O6SA 2R1XA 3CDGB 5SWQB 2KBGA 1JGEB 1KCVL 2EACA 4CVZA 1JD7A 5JPMC 1OHQA 1W72B 4FS0A 3BH4A 2IXQB 3SDCA 3UEZA 1EERB 4G70B 1N3NA 3IFOB 4B6ZA 2OCCB 3KE0A 4ZUTA 3PWUA 3WLBA 2DY2A 3AVEA 5IW6B 1M7IB 1J7VR 1F3RB 2IANB 2OTWB 3FTUA 4PWFA 5A7BA 1GCFA 4P5RA 4IBQA 4W6XB 5J3HC 4UYQA 1R19A 3OKNB 5GGVH 4XP9H 3RUGF 1QW8A 1U4EA 4QD2E 3PGCB 5C0BA 3GSXB 1AGBA 5GS2D 1TJGL 1XO8A 4I1NB 2I85A 3FUFA 5FXCH 4P9ML 4ZMLA 2ETWA 2R56L 3WS3A 1FBIL 5TDOA 4GEJA 3M07A 1D7BA 3WTVA 3EO1A 1SN5A 2ZUQC 2EEDA 2DLHA 3FH8A 1V3LA 5CGYD 1AYRA 2EC9U 1FL5A 2VL5A 3GIVB 5IQ9B 2FUQA 3BVVA 5C0JB 3IDYC 2YLKA 2NY5C 4C83B 3KYKH 4WSGA 3MLWH 2VDPB 2BJMH 3IK2A 3Q6GH 3T1FA 4E9XA 3Q2LA 3VXNB 1WBZB 4WCYL 2Y06L 7TAAA 2HTLC 2PWHA 2IH3A 4PS4H 3SYQA 1ZANH 1P4IL 3GUTB 2CUHA 1ZHBA 3TA3A 3VX1A 1K8IA 4OZHA 3VFWB 3VFSB 4IDLA 4RMRA 5B3NA 1AQ8A 2LHAA 3UEQA 4G42B 5F1KC 2ITDB 3MNDA 4HWBL 4WO4C 1MCWW 1TU2B 3SGJA 2XWBA 3F00A 4XMZA 1PJWA 2RMNA 1W8EA 2WLLB 4YHIA 1R9FA 1TNNA 3B7SA 4ALAC 4U1JA 4WEEA 4XMLL 4HCRH 2XETA 1TQVA 2CO7B 4X6FB 5I1JL 2CGRL 2UY7B 5F6IB 4IS6A 4QGTA 4P4RB 2EILB 1DBJL 4JRXE 5CN3A 1BVLA 2APXA 4MAYA 5BRZB 5KSUA 4PJBB 4OZIE 3T8VA 3AQZA 2E5EA 3RY6C 3KPRD 4MD4B 1GPOH 5BUGA 2JKLA 1UOKA 1JZDC 5EEZA 2WXRA 3QH3A 2C9AA 5CZRA 1N26A 3A47A 3L81A 5EWIL 1JL8A 4YSEA 3BKJL 5HD8D 2YAEA 3QS3A 1LO0H 1TQTA 1E50A 3OKDA 4U6XB 5BS0E 4H20L 5CEZD 1NL0L 3QUZC 1F45A 3ECQA 3PJSB 1KB9J 2R29L 3ZDXF 5K9QI 3ZT6A 1ZSDB 5BV7B 3BUDA 3LVEA 2MQ0A 4OW6A 1JUFA 1RPKA 5KJRH 3LKNA 5C0CB 3HI6L 3N42B 4OQ1A 5DA0B 1HCZA 1G9NH 5JIDA 2AV7A 2DBLH 3SJVA 4HKXA 3U30B 4GSQA 1BMWA 2HTKD 1TZHB 2ITCB 4Y4FC 1F3DH 5FAAA 2EH8L 3N6YA 2GJPA 4ELDA 1CL7L 3VGHA 1QPXA 1IB5A 3HOGA 4QDGA 3HHSA 3ZTJG 3EKCA 2A6JB 2KQMA 3IKCB 4X6BA 2BMKA 3ARED 3JWOL 3D4YA 1BVKA 5E51A 4JHVA 4B9CA 1ULVA 4GMSL 1XH3B 2OR8A 4UUJA 1KXHA 2JB5L 4CW1B 5DHVH 1INQA 3DJ9A 3BEWB 3BWAB 2VC2B 1ITBB 1U8HA 1XAUA 3LNEA 3O45A 4M1GL 4P4KB 5GS1C 4Z7NF 5MEQB 2EADA 2OW6A 5HHPB 4TTGA 1HNYA 3QAQA 4APXA 1CGWA 3N2JA 3Q9QA 1ORQA 1K2DA 2AJZA 4ZMXA 3FCBA 2CGZA 5JTWA 2F5AL 4I87A 4Y1AE 3OKMB 1OK8A 4JQXC 4JG9A 1J9RA 2IF7A 3HRZC 4WJKB 4YLQT 1JXFA 3A67H 5ALBL 2OK0L 1H8LA 4N4YB 5F8QC 5F7FA 4XZUB 2XJKA 4HU8A 3E6FB 4HKBB 1BQRA 1OGTB 1OGSA 2MTPA 2ZXQA 3D0VB 4CNIB 4DF9A 1CXLA 4KRPB 2X3BA 2X4RA 2NNAA 1HWWA 3KH4A 4PGEB 5EIIG 1TZ8A 3MN8A 2R23A 5AW7B 3RGVB 4OZGB 1A6AB 2G9HA 3CUPA 5AYUH 3IJSA 3V0HA 4D7BA 2P48B 1L9PA 4XVUC 2BC4B 2I07B 1YMHA 1NCBL 2V2WB 3KLAB 3BVXA 4PRBB 3IMVA 4UM9A 2FHCA 5G4OA 5HDRA 4GRLA 4Y4KB 3KL3A 5DQ9A 2YEZB 1PZ2A 1GGTA 2W9EH 3R1GL 4W9KC 4XXDA 1HHJA 1CC3A 2VDOH 4NAJA 5DJDB 3DGGA 3DVIA 4XWOD 2GY7B 4L1TA 4JL1A 3BGFC 4KK5C 2ZX9A 4OGAD 3WFHA 1PBYA 3BSHA 2DQIL 1C08A 3MJ6A 4L3CB 4N22A 3DV6B 3BD5A 3BT2H 1A6VH 2QADD 3LQZB 2CCLA 4NI6A 4TUJB 5FYLD 3HC0A 2B0SL 3WO4C 5AFAA 4FULA 2Q1EA 2QLYA 3U4BH 4AL8H 1AQDA 1XD1A 1RZ8A 4OD1H 1PW3A 1O6VA 1OARL 1U3NA 1FG9C 2ZUXA 3C6LB 5E2VL 5ABZA 1MN4A 5SV3A 4GFXA 5I71B 1J9CT 4KHTH 1IC4H 2BVOA 4N2DA 4GS7C 3QRGH 2QQLL 2WYHA 1UWGL 5DEFB 5T33L 5C08E 2Q8AH 1WUZA 5HI4C 1KJ2A 1XD0A 2AK4A 4MB4A 3TURA 2E6JA 4J3BA 5KBMA 2AJXL 2ZG3A 2Y25A 1FYTE 3CFEA 1WE5A 5I28A 1RIVL 1GL4B 1FRGL 1HAUA 2MPAH 3U2SA 2B14A 4YXHL 1PSKL 1U3JA 4HP5A 4KNTA 3DUUA 3O4LB 4N0UB 1G9NC 5IFAH 5DJ8B 1QRNB 3UYRH 4O2FA 5EB9A 4MDIA 1WAAE 3G6AA 2D31B 1YEHL 3IJYB 3SPHA 1OSZB 5EULV 5GS0L 4AVJA 5T3XL 1DR9A 4NJ9H 3T4YB 1ETB1 5E8EA 2IFFL 4OGXL 4OCWL 2XICA 3FSZA 4HC1A 4WI3A 3CDYA 3D30A 3L5WB 3L7FB 4X5RA 3CZFB 5D1QB 2FDBP 2JTDA 4JRYB 2YBRB 4R4BA 3ZSSA 1INEH 2F53B 4WDIB 5IEKA 5KSAA 3ARUA 1PKQB 2PO6C 4R0LC 5AEAA 3GIZL 4F7PB 3LN5B 4Y16D 5F7LB 4G7QB 1YY9D 2WLMA 5JA9A 3HZVA 1VSCA 3DDGA 1TSHA 2XFGB 4LSQL 3U48A 1GS7A 2OTUA 4FQPA 4I88A 1HSBB 5J9PB 1BYOA 3P73A 4KK9D 4S0HA 1NCWL 5E0QA 3UBGA 4Z23A 3U9WA 3OX8A 1VFBA 2VM4A 4WKXA 1YN6A 1HYSC 2UUDK 1HKLL 3BPNB 3BCFA 1HHKB 43C9A 3QNYB 4DKTA 3BVTA 1BZ7B 4RNRA 1S8DA 4YC2C 4UTAH 3WFDL 1IAKA 4I4WB 3BLKA 1D9KB 1DL7H 1R24B 3F65A 3AY2A 3ZHFA 1MWAB 1OT4A 2OULB 1F1GA 4JHWL 4YE0A 4A7GA 1XBRA 1NFIA 5HBBA 2HJKB 4FL4C 5A6MA 2O5XH 2BIMA 2FEEI 1DJWA 2E59A 1XGRB 4KAQH 1OGAB 1J1OL 5D1XD 1SMDA 5CM1A 2WTOA 4MAUH 4TKWA 2X2JA 4XPFH 2VXVL 1DFXA 3IF1A 3II2A 4UNTA 1B6DA 2DH3A 4FHKA 4GW4B 4H1LH 4PS3A 4PU2A 5GSVB 2APBA 3VXUA 5B3JF 4H88L 1RHHB 3KLLA 5B7MA 1MPAL 3V7AG 4XO5A 4BM7A 2CIKB 2NXYD 2AZUA 1G4RA 2BIHA 3ATEA 3H6AA 1KBVA 4J3VA 1CQKA 3FFCB 1PY0A 3LDBC 4K8RL 1SF5A 4ONGL 5KEZA 1XF3B 3P4OA 4NM4L 1IGYB 2VZSA 3V0FA 4RMBA 2IBZX 1RIUH 2YGOA 1JF5A 4X2UA 1IE4A 3ULUF 4PJAA 1KCSH 4L8DA 4E41D 1MWOA 3FS9A 4U1IB 1TEFA 3JTTB 2RALA 5GHWL 1MFDL 1KBWA 3BCDA 3UACA 5IF0A 1JZ5A 2VSKB 5D72L 1P7QD 1RURL 2DQTH 2E86A 4YR6B 1BWMA 1KPVA 4PJXA 2PTUA 5E8NA 3OXSB 1YG9A 2X1WL 4V2CB 4BBWA 3GSOA 1FNGA 5JIHA 4A39A 4M7LT 1SYVA 3OR6A 3QNXA 2VIRB 2Y1YA 3BP5B 4S2SB 3DOSA 1UZ6E 4A2HA 1X5AA 3LOWA 4W9DC 4ODWA 1AI1H 2OL3B 3ZKNC 4AL8C 4IMLA 3H9SB 1QX1A 3VFMB 2CO6B 5DGQA 2WXKA 4S1QL 2G9KA 5HSFA 2XC8A 4PJBF 5DMKA 3EF7A 2AVFA 3ISRA 4UV4H 4LEOB 4Z78A 3UADA 1NEPA 4HKJA 3CN4A 2WQVA 4DKEL 1U8NA 1WBXB 3B2UC 3L95A 2WXQA 3LRHA 5JO5A 1CFVH 1J1XH 2E8ZA 3EYOA 5ANME 3V2AR 3V55A 2BP3A 3W9DA 3ECBB 1KDIA 1E43A 1IGTB 2WWMC 1YVLA 3DXAA 2GUYA 3GGWA 4JO2L 5I1IL 3QYNA 1H3XA 2JK5B 2B08A 1OVZA 1CE1L 4NBZB 2YFNA 3MGTA 4HHGA 4TQEL 4YSRA 3WXVL 2YAFA 4DP6X 1ROCA 1E9PB 2OZ4H 4J8RB 3B6SB 4UT7H 2BRRH 4QRUA 2OV0A 3MCLL 3GXMA 3PNRB 2ZP0T 3N42F 4N5UA 3LSOB 3ABLB 4XVTH 2XQYA 4GY4A 1C5BH 1XH2A 4K7FB 2ZYIA 3I3EA 4JREC 4KROD 3UABA 4PJ7B 2N56A 5DVLA 2ZWNA 5EU4A 2FJGB 4L8SB 2QSTA 3UTTA 2O61B 4FQIL 4TSCH 4FNSA 3JVFC 4UOJA 3R0NA 3VI3E 3MCKB 2P8LB 4RAUA 2EE6A 4F7MA 4W81A 1IQDA 5IKCA 2CLZB 5AOJA 4MSWA 5TE4H 1SDDB 4YFDB 4F9LA 2NY7L 2KL6A 4LEEA 4LCCC 4UZGA 1F4XH 2BS9A 3Q5TA 4OH2A 5J6SA 3MYJB 3FQYA 2IH8A 1CCZA 2EVGA 1A21A 1WS7A 4QRQB 3TBWB 3NCEB 2OR7A 3RDTB 5GGQH 2EKSA 4CMHB 1JHLH 2VABB 3ZUNC 2NY6C 3QC6X 4BFJA 2ODIA 4NO5B 4PTTB 3AUVA 1PY4A 4Y7OC 4PJEE 3KPRE 2IQ9L 2F8XC 4XCCL 2O5ZH 4P9HH 5KG9A 5BVJA 1Z9OA 4IGBB 2BLFA 3IN0A 4YZWA 4EZKA 3W5MA 2XZCL 4Z3FA 4R97C 3NMEA 3EDKA 1L9OA 3TO4A 1TTBA 3VWJC 2CG9X 3QG6B 4M7KH 2UY6B 5CEZE 4OZGF 1NMBL 3CH1A 3UO1L 3OLEA 5ESQB 3X13A 1VFMA 3F2LA 2EYSA 1I1YA 4KJPD 4BKTC 2MCAA 5JNYB 4LLDB 3L2LA 4H7VA 4I0CC 4ZK8A 5KSBB 3N5AA 1DQJB 3VG0H 3PGDB 3JV6B 5AOLA 5C09A 1PF3A 1XZ0A 1CXEA 1I3GH 1ONQB 35C8L 3MV9D 3QDMA 4TVPH 3TBTA 2Y7QB 1JAEA 4JR9H 3O3BB 5I1HL 5CJ8A 4I3RH 1GGIH 5FYJU 1CT8A 1JPGA 5F7BA 1KTBA 5LWYL 5IT2H 1LNUB 5JMOC 3TFKC 3IFNL 3M8OH 4BFNA 3L08A 1KN2H 4HUWB 1JGUH 2JCCB 2R2EA 3TA4D 1AXIB 2FZ3A 4Q4IA 1R5WA 2EDJA 5FO7B 4AUJA 2MEJB 3NCFB 1QLEB 1I4FA 4NO0B 25C8L 2W65A 4KVPA 1QASA 4M61A 1C1EH 5AB2A 4KKQA 3TJPA 2LAGB 2UZYB 4PJGB 4Y2DB 3TZVD 2X4SB 5TGBA 3JZYA 4NYLA 3KXFD 3BVNA 4PP1D 5I8KL 2D3LA 1BVOA 2E7CA 2G75A 4O58H 1BFSA 5CJOL 4J3XA 1QHOA 1GKEA 1T6WA 2X4PB 3CBRA 1JZIA 1SF3A 3FMGH 4QRTB 1NCTA 4FFWD 5A3IC 5CP7A 4DFIA 1SOSA 2DD8H 1CGTA 2QEJA 4KVNL 3W0WB 2BVQB 4Y19B 4EQ2A 3CK0L 3GJEA 2CK2A 3BOVA 3VXSB 1U3HD 1SM3L 1F6AA 4MJHA 2VE6B 3RVXD 4DKFL 4XMPL 5IVXE 4QLWA 2DWXA 2GJZB 1M3JA 3WGVB 4DQOH 2J88L 4ZFFB 4KY1H 4NRXB 3QIWC 2Z64C 4FXGA 5L9DL 2H6OA 1QSFD 5E9DA 2G5RA 4JFUA 4XP5L 1THAA 3VRLF 5FGCB 3D4ZA 3SQRA 3A6CL 3ULSA 2C26A 1DCLA 4JDVA 3U1QA 5FIEA 1AD0B 4FQHB 4HC1L 4ELKB 2KC0A 2GVYA 2BSBA 1V5JA 4F7TA 5I1KL 5AENA 4AZUA 1QUPA 4DP8X 1JXDA 4TOYH 3NP3A 3ROLA 2ZOLA 1EMTH 3VXMA 2XFXA 1HEZB 5I8CA 4H0GA 1EEZB 4Z7VA 3CSTA 2DIEA 5KBDA 4XNZC 1IBHA 5EBLA 2AQNA 1JNLL 3R8QA 4YXLL 1UB6B 5FYLE 3CQPA 3QIUA 3T65B 4IKJA 1UXWB 3QJVB 3BX7C 2Z93B 3ZHDA 1Y07A 1G84A 1D5MA 4UBDC 1S7VB 3MFGB 3I9PA 4IBYA 5GXBB 3ULVD 5I76B 2J8UE 1J5OH 2NW3B 2D9QB 1VCBC 3JWNG 3QR0A 3VGGA 4BQCA 4P9HC 2P5WD 5AW9B 4PJ8A 5GRUL 4LU5L 4AEIH 1RD6A 4OGYL 4MB5A 1MF2H 5AUMB 2C9UA 5F1OB 4PVMA 4FFZL 5HDLA 4YO0A 3HTLX 2Z91A 4KDTA 3WFEH 3VRIB 1SVZA 4L9DA 3AG2B 1AJ7L 3FAWA 4BWTA 4Z7AA 4ONHA 4RFOH 3AG4B 3H0TA 5KBNC 1HINL 1I7TA 3EJSA 5A2KH 1IVTA 4IRSB 3JSSA 5KYYA 3U7WH 1TCRA 2JB6B 2YRBA 4M93C 4HEPA 3ZX1A 5G5DA 3CFJA 1CD1A 4FKHA 3BC9A 1JYVA 3BISA 3QFJB 5TF1L 5HHVL 5D4IA 1U93B 4JFZL 2Q6WB 2UZXB 3TEZA 2JKXA 4WTWA 1OCOB 4Z3IA 3KS0H 3UDWC 3CPLA 3JBG7 1ADQH 4B5EA 4XVJL 3VRJA 3L54A 5CR8A 5ECGA 3UFIA 1ORSA 4I0PD 1AGCB 1MI5A 4EI5C 2Z9TA 3CN0A 3QPXH 3WNKA 2EVJA 4C4BA 4OI7A 5EU6D 4QXGH 3L3IA 1BVLB 5HDQH 2DMHA 2GI0A 3TVMA 4NRZB 2XQBH 5D93C 4E42B 5HHMB 3FBQA 4K3JH 3FOMB 1AQKH 4GSDL 4P5TD 5CN2A 3UJTL 1CFSB 2VZUA 2CIIA 3E9UA 4LIQE 3UIYA 3X12A 5JPMB 1KGIA 3QEUB 5EBGA 5DJXA 2YUXA 5AW2B 5L88H 1T5KA 2AC0A 4XO9A 1SGKA 4G6KL 1BAFL 2JI2A 4AZ8B 1NC2D 2CHWA 4FYTA 5EU3A 2XQYG 2GUOA 1LEGA 3K2MC 5I0VA 1AIFB 4NIKB 2OMVB 3GSNB 4QO1A 3CC5B 2PYFA 1CXKA 4NGHL 3HG5A 3U36B 5IUCA 1SHSA 1HSAA 2X89A 2CDGA 4FTVB 3L3GA 1RKRA 4NCC2 3STLB 4JG5A 3NTCH 1UFGA 5D1XE 4HKXB 4ZMZA 3WTTA 1WH0A 4WSJA 2VJXA 2WLJA 1NPUA 4KQ0A 4XAWL 4OD3H 1KCKA 4KJYA 4NENA 2G2RA 1YDPB 3PHQB 1U8MB 2YMOA 5GZOC 1MREH 5EOCH 1WD9A 1Y18A 4G5AA 4J28A 2XQYK 4G8FB 1V7ML 2ZXCA 2ZUQB 3LHAA 4Z7WE 1KG0B 3DX7B 1KTKE 2WP3T 1SJEB 4BUHA 3CCHA 1XCXA 3IDYB 1OTTC 4UUJB 5D4HA 1ES0B 2W0LA 4PJ7F 5H94B 3SBWC 5F7MC 4E41E 2Y5QA 3OJDB 3RG1C 3RWEA 2RIKA 4QYAA 5D7IE 4HQQH 5C6WH 3SBQA 2AZAA 3GINA 4WFED 4W9ZA 1XQ4A 4OF6A 3S88L 3EYQD 4GQRA 3J07A 4K7PY 3GBNL 1CICA 4EZLA 2WPGA 4NRYB 2BVYA 3GHBL 1S9WA 5DUJA 5F1IA 1G7PB 3FTVA 4N5ED 3OKOA 3EOBA 4WO4B 5FM5O 1SHWA 5F7EH 5BQDA 2RTTA 4XHJC 2BSRB 5TDPB 4OSUL 1F6FB 2DWDB 3LX9A 3RURA 5F88B 3P0YH 5C0RH 2QPDB 4NNPH 3V4VA 3D8MA 5B8CC 3GJFK 1QTYT 2A77L 4NXKA 4KKLD 3X1FA 2PKDA 4OJAA 4YSQA 2QGDA 3IJHA 4WNQA 2GY5A 2W60B 2XN0A 3KLQA 4DOHB 3AG3B 1CGVA 3NZHH 1KULA 1Y6MR 2OPCA 1BLIA 2FX9L 1EEYB 5J0BA 1F8TL 4M03A 1Y6NR 3INOA 4X5LA 4O2EA 4HGWA 1FH5L 2VITA 1KUMA 4DO4A 2BP0B 4PREB 3MBEA 1O5PA 3EG9A 5DD1H 5HHOB 2VDNB 2JXMB 4NXSA 2NY1C 3UTSA 3AS3A 4V1DA 1KT2B 1KGCD 3QUZB 1T5XA 3MBWB 3B4NA 5E99L 2YC1A 1RZFH 3AC0A 2PXYD 3W39A 4YEFA 2HH0L 5HI5C 1XSKA 1BFTA 5KJ4A 3C8DA 3V52L 1AGFA 3LKPA 2GI7A 5KSBF 1WZMA 4ZO7A 4XB8A 8CGTA 3GDCA 5E5MA 1AHWC 4X4XB 3L3OC 3RVWC 4Y4FB 3FFOA 1H3PH 2ADIA 3IXTA 3JTSA 5I8EA 3CBJB 4YZFE 4RFNC 4R7XA 1J0HA 1HS6A 3APDA 4LPUA 2CRYA 5C07B 3MLSL 2Q0ZX 4UOW0 1G9ML 1MCPL 1EO8L 3M1CA 1HZLA 4KUZL 3GYRA 2KZ1B 2JCCF 4Q0XL 3VGBA 3FUHA 1JGVL 2HLEB 5ITBL 4OM0H 3HJ0A 4L23A 1SXAA 5JYMA 2WLHA 4OLZL 1XB6A 1YEKL 2BNQE 3FRPB 2DKUA 5GS1B 1CIUA 2VDKL 3JV0A 2DQJH 2JNZA 4PJGF 2YUVA 1UWXH 3DURB 4PRIA 3UBFA 4C56B 2CSPA 3O0RL 3GXTA 4NZFA 1RUMH 2GSGA 3V0WH 1AMYA 3FULA 4L3ED 3PHAA 3WSQH 2FX7L 3TBVA 4HV8A 3FT2B 1NCCH 43CAB 3IM1A 1Y6KR 3HRZB 2B16A 3SO5A 5CCHE 1U3ZA 1RP9A 2F54D 3V4UH 2RA1A 4GW5B 1E4KA 1I1AA 2QTVA 4AYEC 1EFXB 4ORGA 2EABA 5F0MB 3V0DA 5IEHB 1JWUA 2F15A 4MZ2A 5FFGA 3HNSL 4LCUA 4LOUD 5B8CA 1WBYA 5FA3A 3BMVA 3NEEA 1HC1A 1N6VA 1T20B 2QQNL 3ESMA 3N40P 5GGTA 2ENSA 1X9LA 3MZTA 4GG8A 2CK0L 1DLHB 2WQAA 3BGAA 3O3UN 4XVSL 2AJUH 3VXPA 5GRJL 1LK2B 4XE0A 4JY5L 4QWWD 4ZUWA 3UAJC 3VH8B 1CFBA 1U21A 1E8ZA 2VXUH 2Z35A 1E4XI 4CN1A 4CJ1A 1Y0LA 2V3FA 1TITA 1R3IL 1YN7B 3AS1A 3O8XD 3MV9E 5I16A 2BSSA 3HPLA 4G8IA 3PWNA 3WJJC 1LO2L 5KZCD 4IM8A 4HK3N 5CXPA 2VR3A 3KLHD 3ZYJA 1OF2B 3MODL 5LAPA 4ZFOB 1AE6H 1Z9LA 3BGFB 1U91A 3C5ZD 3V6ZA 1G7HA 1FL6B 1HCFX 1D6VL 2VXQA 4HAKA 2ADGA 2GIYA 4KRMB 5E2JA 4DGIL 1TLKA 3ATFA 5I9QC 1F4AA 1BGXL 1CVSC 1T66D 4HEPG 1KLFB 2AJYH 1SXNA 4QOKB 4Z76B 3WO4B 3WUZA 4R7DB 4JKPL 2DQEH 2M1KA 5E94B 3KXFE 1HT6A 3RNQA 5F1NA 2WNGA 5FHAH 4X6DB 1T0NB 3FH7A 1WCBA 3HW7A 4GS7B 1BIHA 4XI5D 1C8QA 1E4WL 1CF8H 5HHQA 3ILPA 4MJIB 1CXHA 4UTBH 4NPYA 5LCVH 1T21B 1JWSB 3KJ6L 3ZE0E 5C97A 1ECYA 2EE0A 4ADIA 2JIXB 5HDBE 5DZNA 2C3GA 4JFPA 3SDDD 3B2VH 1U8OA 2R69H 1ZT4A 4M3KB 3PXLA 1SOKA 3U6RB 4DP2X 1H6EA 1FQ9C 5F72S 3ARDC 1MW1A 1OTUC 1IC7L 2BWIA 3ZTDC 1QSFE 2JJVA 3BQUC 4NKOA 1LK3H 5CILL 4DK5A 5BS0A 5IV2B 4NUPA 4M02A 3MFFA 4JZJC 3PUUA 2E76C 4HIJB 4JN1H 3QRFM 4X5PA 4Z95H 3QZLA 4O5LH 3LKRA 2Q8BL 5F7YC 2J20A 3KPSA 4B9ZA 1S5HB 3FUKA 3FU0A 5FYKH 5GZNA 3VQLA 1RUKH 4HDIA 4MKMA 3SQBA 1I8UA 4ZJ9A 2GTWA 2CUMA 4QHKI 4QXTA 2B5IC 5GS3A 3BP4B 4R9HA 2PO6B 4R0LB 5EUOA 5J89A 3D18B 3IGLA 5B7FA 4GIPD 2AJSH 2B7DT 5FLUA 4JY4A 2K1MA 1WP6A 4LSPL 3UAJA 2VDPL 3PPEA 5L2KD 4PGDB 3D85D 2AJ3A 3VSVA 3AS2A 1G6RA 4ZT1A 1RU9L 4DGYL 1O9WA 1FZKB 4NJAH 5KANG 3CZSA 2FWSA 3U0WH 3MJ8B 4XP1L 2E7BA 3VNZA 3OB0K 3HVDA 3GGWB 3DX9B 4HG4K 3H54A 5FM4A 3SEPA 3U1PA 4G9FD 1T1ZA 1VACA 1Z32X 4YC2B 5DTFB 1WT5A 1XIWC 3PIQB 5F3HA 3SE4A 5GS2H 4I9WD 3S3BB 1RZPA 2K8QA 3FTZA 4WU5B 1SMOA 1IM9A 2BDNH 5GRVK 3GSWA 4FL4B 3CXHJ 1DSYA 4P2CG 3GMQB 5I2IB 4LSSH 5GRVL 4PS8A 5IW3A 5ABAA 3IGAB 4CMMB 1T89C 4XMXA 4GXUM 4YDJA 1MCJA 2X4NB 1J0YA 5DK2A 2LQRA 3S3JA 4JG0L 1E5YA 3VFVA 2D2OA 5ISZA 5BO1L 2AJVL 1FLRL 4NSKB 3RX7A 4KK6D 1SJHB 1HXMB 2RJMA 2X0UA 4NQXA 4W93A 3QZOA 2QQKH 4CA4A 3P30H 4LKCA 3ME0A 4LRIC 1BX2A 4X9BA 3ES6A 1D5ZB 1DDHA 1NLDL 3L1OH 4KTYA 2H3NA 2XKUA 5GSRB 3HI1A 3LDBB 1EGJA 5EO0A 4JM2A 3T4AC 1S7TB 3D25B 4A37A 4HWEH 3EZ8A 1SEBB 3CZUB 5IB4B 4H2AA 3Q5OA 3CSBA 4HJGA 5JW4N 1LEIB 2JKIS 4F15C 5EU6E 4HUVA 1Z3GL 3G5XB 4NO2B 1FE8H 1RZ7L 2VDOB 3QZMA 3X1GA 1C5DB 1A9BA 4NPKA 1WYJA 1UM6L 4NIYE 3SYCA 2DBJA 3WE6A 3DDFA 5IGXH 2W91A 1QWHA 4HJUA 4ZD3L 3RTQD 4LCYA 1EHKB 1YNKL 3II3A 4EN3C 2YD5A 4P3CH 1O9ZA 1B0GB 3V4VL 2DM7A 3P54A 1I9RH 2IQAB 2ARJQ 3PY9A 4WQOA 4YN3A 4Z6AT 4LQFH 5EG6C 5T1MA 4WI8A 4Y9GA 5D7LB 5CEYB 1OSPH 2NY0D 4Q6YA 4IBUA 2D03L 3E6HB 4ZUVA 1PZ3A 2DIAA 2JJSC 3TWCH 5A6IA 2B4CL 5GGVY 5SX4H 4AQ1C 5EF2A 5D8JL 4NEHB 3DX8A 4URTB 2VC2L 4N0RA 2HFGL 4NQQA 3UBHA 5CEZH 2Y6SD 4MQXC 3VGAC 3D0LA 5I30L 3JUZA 2FX8L 1BMZA 1OD7A 3EDJA 3TIDA 4U6TA 4D0DB 4G7RB 5JPNA 2WWOA 3ZT7A 3S2AA 5TQ2L 4X98B 4S1SL 3CVDA 1ZWIB 2D7QA 3I75A 1QW9A 3V4LA 2FL5B 2HA1A 4LESA 1FYTA 2HVBA 2P8PA 1NANI 3QUYC 1FN4A 3LMJH 2A9NL 3HZ3A 1ZTXL 2ZX8A 5DVNA 2F1EA 4JREB 2KPWA 3CVCA 3KPMA 3VWKD 1UCBL 3BDXA 2ARJA 1BJ8A 1DEEA 4RRPG 4JFEB 2CRIA 2W07A 2VLJD 4L5FE 4LLUA 3MXWH 4PCSA 4ZZFA 4WJ5B 2K0RA 4C55A 3K91A 2DQMA 3CNKA 3BD3A 1A4KB 1L9RA 5ITFA 2NCEA 3FCSA 5FB8A 2OSYA 2Z92A 3FOLB 3JZ7A 5IB1A 4BQ9A 5ICYA 4JG1H 2WBKA 3U1SL 3RVTD 1DO6A 4RFEA 3NZSA 4YSDA 4LCCB 2E9WA 5C8JA 4IOSA 1X5FA 1LMIA 3EH2A 3UGEA 3P2TA 2BIOA 1L9TA 1TTRA 4MX7B 4QCIA 1XF5A 2A6DA 4O4YH 4P5KA 1V54B 3RL1A 1VFAA 4AJWA 3GC3A 2IH1A 2I7OA 4HS3B 1P4LA 5H2BA 4B60A 4G1MB 4KNUA 4MMZC 4YGVB 1UVQB 4LVHC 4GUQA 1S7XB 5AOKA 5IWLC 2EDXA 4YPGA 2Y69B 5JHLH 4OLUL 4FCHA 1JXGA 1PAZA 4LF3A 5GGSA 3F5WB 5INDA 1ZAGA 3Q6FB 1BZ9B 4HU2A 2VOTA 3L3JB 3WBDA 1M56B 5CGYC 3FZUD 4JDVB 2A83B 4M6NH 4R97B 5DUML 2MSPA 4H1LB 2XN9D 3VWJB 1YEGH 5GGTL 1DHKA 4XMVA 4J3WA 4DAGL 3FU6A 1KGCE 2P5ED 3WKML 3F7PC 1B0RB 1OE2A 4ZW7A 4KV5F 2R4RL 3O9WA 3SDAD 1EVTC 4M9PA 3BSGA 4HUUA 3NIFE 3PFUA 4JFSA 4TUOB 3SPVA 4AYID 4OKVB 4HUXB 1IQWH 4UU9B 4XN7A 3H42L 5ILTL 1WGVA 4PEEA 1DE4A 4Z7VB 3S34L 1AZZC 4P05A 4XHQA 3HS0C 3WNNA 3FHQA 3OAUH 2IDFA 2XWTA 1A7OL 1H0DA 5KVDE 2ORBL 5EEVA 4X5XB 4MDRA 5D70L 1D5MB 1DVXA 1OGPA 3IAQA 1IT9L 2Z4QA 2KPNA 2HVKB 2NX5B 1KGYE 4M00A 5FYLH 1L3WA 3L6FA 5DZAA 4A7GF 2VXQL 3BVWA 4YHML 5L6YL 4NP9A 1V8HA 2VMFA 1T83A 3NOIA 4QXWA 5LHDA 4GP5B 1CQYA 3BAWA 4XXCC 3OJMB 3EJYD 3N43B 1FYHB 4ZI8A 3T0VA 1H19A 5JHAA 4YL9A 4CADB 1JMZA 5AW0B 3V5HA 2ZNXA 3QNZA 4XX1E 2WOBA 1TZIB 4HCIA 4RZCB 2WO3B 3S2CA 2NY2D 2MQCA 3ARBD 5I6XC 4L3EE 4AKPA 4BZ2H 5HD8C 5EC2A 1GGBL 2WNWA 3QCUH 1GRWA 3ZL4H 4NQCB 4PLNC 3SDXA 1OE3A 3JV4A 4NZUH 3I6KA 1HOEA 2F54E 4MDJB 5D9SB 3T8MA 2NZIA 4P46D 4DN4L 1VAHA 2CLRA 5HGBA 2CBQA 2L7EA 4HOWA 5D6CB 4YXKH 1WJ3A 3FO2A 5DRZB 2DM4A 3BSZA 1KXQE 1NJ9B 2HTKC 3IFPB 4AYBA 3VM5A 1PZ5A 1NH6A 2R0ZL 5F9OH 4B96A 2HUHA 3QJZA 3UCQA 3QIWB 4P2OD 4I18A 2WZ6A 4PJHB 4L4VD 4AY0A 1M9WA 4C4KT 2H4EA 2ZOKB 5INCA 2B59A 3AREC 3GPEA 4GAFB 4EUPH 1MQKL 4FQ1L 2L7UA 1ZGLM 3WHXB 4NHUA 3V0AC 4C8XA 1UD4A 1IFHH 3E8UL 3U46A 2AAVA 3P11L 3P0VL 2HWZH 4D8PB 3HR5A 3O6MH 1ZA3A 1WRFA 2AKRA 3NSJA 5DC2A 3S96B 2P28B 4H8WH 4LIQH 4TM9A 1UKTA 5C0AB 4MJ4A 2ZSVB 1GZPA 3FQRA 3GMLB 1G6RL 5BUAA 3L3HA 2IG2H 1HSAB 2VLKD 2Z3FA 3BIAX 3MR9A 4PP2A 5CSZA 4XNZB 3S4SA 2XPZA 3LKSB 3HS0A 2H2PD 2E6QA 3WN5C 3HIZA 2ZG2A 4FLQA 1G87A 5E8OA 3ZDZE 3R06A 3EOAB 1DQQB 1WFJA 4DGVH 1TFPA 2QPFA 4LDLB 1MIEL 4DPRA 1R3HB 4MNGE 4DEWA 1YYLH 3D39D 1BJ1H 3LKQA 4NQEA 3WEXB 5C6TL 1CR9L 3NJLA 2VN7A 1Z0NA 2VZ3A 3HG4A 3LZLA 1CTMA 1E6JL 2IPKA 3F64A 3K6OA 5F7DA 3RAJL 2A38A 4YDKL 3E9TA 5J1AA 3QO0A 2OL3L 4YHZH 4EIZC 1TLMA 1IILE 4QRSA 3J8F7 2YAQA 5KYUB 1U95A 1UURA 2PWEA 3CFUA 4MXQD 3NG5A 2V2XA 2OR9L 3I6GB 3PV6A 2QPSA 1N59A 1FNEA 2QZQA 1IAMA 2W9DH 5CLXA 5SV4A 5FECA 1BYPA 1UFUA 1FI8C 2Q7YA 1ZGLA 3TGXA 3EGDA 4M93B 4PIBA 4QTHB 1EGJL 1MHPH 2FJFA 3C60A 1HILA 3FTXA 3T3PB 3L7EA 5DD6B 4TVUA 3GSUB 4JDZA 2DWSA 3BZDA 4Z3EA 5FDWA 3MBXL 4A1RA 1GYAA 2E7LC 4KOBA 4PVNA 4OGAC 4M4RB 2J21A 4PJ9A 2WVVB 2FT7A 4WWKA 3L9YA 1A3LL 5T1JA 1FIGH 2V6HA 4EI5B 2QADC 4JPQA 1EFQA 1X5HA 1DQKA 2V4LA 2WW8A 1OSYA 4BFIA 2DLFH 3QQNA 2Y7LA 4N0CD 1E9QB 1BQLL 3P1VA 5L2KE 1ZHNA 4G9DB 1S6NA 5FV2A 4PV8A 1FVEA 2PCFA 1ZEAL 4YNYB 3THML 3QARA 1ETZA 5HHXL 1WEJL 1ZT7A 3MRRB 2YMXH 5HYQA 5LGJB 5H4ZA 1D5XB 5DRNB 1HKFA 3RIFF 4ZQKB 4ODXB 3D0AA 3ABGA 5LDSA 4G9FE 2FIKA 1S9VB 3G5VA 1T4WA 1NWOA 1FZJB 2BNUA 1TDQA 1XSOA 2E74C 3T2NL 3QHZH 4CGUB 4N2EA 1E30A 1XTLA 4I9WE 4FI8A 4PRNB 2BSTA 4P49A 1NGZA 5T1LD 5CFAA 5F0JB 2KI6A 3OKEA 2LFGA 5DT1L 3A6OA 5FF6B 4N2IA 2WOYA 1B88A 4AQEB 2WBJA 2DYPB 2XKSA 3WCYA 2P8MB 3SKMB 1XMEB 4NZRL 1KFAH 4GKNB 3MX0B 1LJMA 3B9KD 1A1OA 5DD3H 3M17A 4NLAA 4Y5XA 2PTTB 4PRAB 2RFXB 2X70B 4K23L 4WV1B 5DMIL 5FK9B 5M95B 4AQAB 2DQCL 2EDBA 3EFOA 4OCYL 5JZ7D 2DV6A 4WUUD 1Q9KB 3PNWB 5AWNL 5IVXA 1BAGA 2E4TA 3KHQA 4Y16C 2E7DA 4OZFH 1YY9C 3F05A 2CZNA 1NOLA 4NQDB 1RUQH 4NT6B 2NYKA 1AIZA 1OAQL 2XTJD 2BY0A 5DVMA 5D5MB 2WBXA 1Y1UA 3OSVA 3B9VA 4KK9C 3PAZA 4HG4J 3MLUH 3CHPA 1VKXB 4I3GA 5IHHA 1U8QA 5AL0A 5E8PA 1DVFA 1REIA 1WZ1H 2J72A 4I5BA 3BVDB 4DT2A 5JDJA 1KZQA 1K4CA 1WUNT 5J8OA 2FHBA 2BIPA 2I32A 1G1CA 2CHXA 1UC6A 1MRFH 3HCVA 4DTGH 2JQMA 4G71B 3SE9H 2AV1A 1MCEA 4OUOA 4UIKL 4PSPA 5DUBA 4HPYH 4Z77B 1KLUB 4FE9A 5F3FA 5B8CB 5D1XC 2G0KA 3BMWA 1CFQA 4L9LC 5JUEL 4HZLA 2QVTA 5JXED 2IOMA 4OLXH 3WAJA 4PYHA 1T6VN 3IWUA 4AIXA 2NUTB 1NDMA 2JKJA 5DFVD 5E00B 3BH8A 5A7EA 5BOZG 4ES9A 2GCYA 3BGMA 4RGND 4CC4C 1H8OA 3DO4A 3KPLA 2F19L 4JFXA 1GOHA 2G4GA 5IBTL 4ODUA 4NCDA 1MCLA 3P02A 1E65A 2AK1H 2AITA 5IVZB 3WTYA 3VSUA 1HI6B 1HJCA 2RQ8A 2WLIB 2R9HD 1K3IA 2NY1B 5F6HI 4WI0A 2DN7A 1R3KB 4UDTB 2AANA 1PFOA 4F58H 4U1MA 3QUXD 2ZF9A 3NGBC 5HPMB 4HUNB 2J43A 3M7OA 4IKNA 4GRWH 5F44A 5K59F 5FKPB 4Z7VF 3KYMB 5AD0A 5E5UB 2CAKA 3IGUA 2W0KA 3WFCH 1T5WB 4XNQB 1S9XB 1NBVL 3EGSA 3I9IA 3QZNA 4Q2ZB 3T77A 1AHWB 1XHHA 3L3OB 1OAUL 4LSTH 4L1SA 5IBUG 2VLJE 4PG2A 1P5UC 4DW2H 1FC2D 5HTSA 4ZZKA 4Z7QE 3O6KL 5L8JB 8FABA 4OIIH 1Q9WB 3E38A 1JMXA 2IGFH 4RFNB 2VMJA 5EPMB 4ZX4A 4K5OA 3ZL2A 3WHE1 4M48L 5I8OL 1RZQA 3KW7A 1TO5A 4CGTA 5HJ3A 2JELL 1YO4A 3EUDA 5I1LB 5BV7H 5JQHC 4PVLA 4JRXB 4PW4A 2VSMB 1VZGA 3N43F 3HHMA 3N85L 4OZIB 2VLRB 2O1AA 3F7VB 2GJJA 1JV5B 1EAPB 2WIIB 4G3YH 4H0IA 4KXAA 1CDHA 2ZCLH 3ESNA 3H85A 1YMMA 1L7TH 1QBLH 1NAMA 4U1LA 5GPRA 3B1TA 1N0XH 1IEAA 4MCZA 4B9KC 1ZS2A 1GOGA 3C5JA 4N2LA 1PGRB 1I8IB 1PDKA 4R7NA 3RZCD 4TRPL 2JKTM 3ECVA 4DVBB 4MVBC 4KMLB 3BSZL 3MRHB 2XN9E 3ZMRA 1JZ4A 2DZEA 3QFDB 4KHXL 1LO3H 2ID5A 2K3HA 3SE6A 4JFYA 4HX1A 2BHFA 2C3VA 2P5EE 3HMWH 4Z7OB 2NUPA 3S4SG 3ELAT 2K9UA 3MA7A 4NNXB 2IAAC 4K3HA 3FQWB 4XO8A 4PJHF 2HT2D 3HC3H 2QVKA 3KWXA 4BD4A 1KB5B 4S0SD 1SYSA 4BKLB 4CC4A 3QORC 4HIQA 4Z7WA 4PJDE 3QXAA 4LARL 2XUWA 1SXZA 4JJOA 2VXSH 15C8H 4R83A 4XNUH 5DWUH 1HXKA 1OTSD 1EANA 2GBTA 1E28A 1B4RA 5ID1A 1KXVA 2RHEA 1GIGH 1X5YA 3BP6B 3KM1A 2HRGA 2CBMA 2D3VA 1OP9A 3ECWA 4E41A 1KEML 4GEIA 1A4AA 4IIQC 3T0ED 3MRGB 1I75A 3MRLA 4MA8L 2VJ8A 3MNVA 4QI3A 4UCFA 4F5CA 1SBBA 1SXBA 3EJCA 3MRJB 3ULVH 3V6FB 1M6OB 3IS1X 2YGVA 1DEDA 4GO6B 2VL4A 4Y1AB 3IB4A 3US0A 2ZSWB 2VW4A 4DETA 5I9QB 4GUCA 4XBEL 2QLVB 3D9AH 5EIVA 2EKJA 1NGPL 3DBXB 1UGKA 1AXTH 1CZ8H 1KGWA 1T6BX 1CU4L 4Z9KB 3RE0A 3VD3A 3EOTH 2H9GA 2IOIA 2PCPB 2X1PA 1JGDA 3FUEA 5TDNA 7PAZA 3OC5A 1YECH 5DHVA 3OSKA 1ACCA 1F6LL 1VEOA 1W0WA 5CCKH 1RI8A 3VGDA 2Z31B 2TSBA 4AV0A 5JHDB 3EO0A 2DQUH 3H2PA 4J7RA 4F37K 4KJPC 1OP3K 1HQRA 2LU5A 2XACC 4JFOA 3BRGC 4OD2A 1PZBA 3NFNA 4Q9QH 3CHXA 4HSQA 3F58H 4NM8H 1JV2A 3SD2A 3ARDB 2YAHA 3Q13A 3KS0J 3BQUB 3KGUA 2A2QT 2IIJA 3VMOA 4NBYB 4L4VE 1QKZL 4JZJB 2YSSA 5TPWH 1LE9B 3MOQA 3LZFH 1X3DA 1P4BL 2C7UA 3CQQA 3CVHH 1NSNL 1ACYL 4LNVA 3AM8C 5LBSL 2CR3A 2ADYA 4J2XA 1MFNA 1QQDA 1CDUA 2XA3A 4NC0B 1QZ1A 3TPUB 1HCYA 1SNRA 2FJHA 4UQBA 5BUPA 4TL5A 2VN3A 1GW6A 4NQVA 3PP3H 4JM4H 4LRNL 1HQ4A 3COOA 3A6BL 2VR9A 3D2TA 4ZS6C 3KCWA 1YEEL 4QF1A 4ZG1A 5BV7C 4P2RD 3TZVC 4PCTA 3GNML 3NH7L 3BKMH 1ASPA 2VLKE 4PP1C 2IWEA 3BE1H 1NUNB 1XB3A 4JFDA 4OJFL 4BDVA 1BZEA 2EUZA 1S7RB 4X4YA 4U1NB 4OLVH 4PUBH 1DCEA 3T04D 1IGIH 5B38B 3DUSB 3L5XL 2C9SA 4L3AA 2EE2A 4FFWC 4N9GA 4PLJD 5HHNB 4UT9A 5C08B 3D39E 2XG5B 2BNQA 3EBHA 4G43A 3Q1EA 1OIOA 1XIWB 4RDQF 5E08L 3Q9PA 1Q72L 1U3HC 4HAFA 3CVIL 3RVXC 2BP8A 4YQXH 4OFIA 2NMSA 1CDYA 2Y1AA 3UTQB 4HS8H 3KD4A 4K5MA 1L4IA 2H3KA 1ZLUK 1X6LA 3O6LL 3PDDA 1XL4A 4B5ZA 5TH2A 4J2QA 2EIZB 3FTYA 4J3OG 4KFMA 2NPLX 1IAIL 4FQCL 1W6LA 1AC6A 2SODB 1MHCA 3DVGA 3V9CA 5FB8B 4ZYKB 4BFOA 1TPXC 4EI6B 2C4FT 4M9OA 2YWZA 5IK3B 4ACTA 3QQ4A 2E7MA 3O0LA 3RWDA 2O5YH 1KCLA 4GRMB 3RB7A 5AG8A 3FH5A 4L5FH 1MFEH 4PLKD 3TS8A 2JCWA 3ZTEA 5EO1B 4NOBA 4LQ1A 4GI9A 5F89A 3T4AB 1TJXA 5EOQL 5A2BA 4E0RB 3D2UD 5D5MF 2V5MA 1M2OA 2XYCA 3LQMA 4X4KA 4QHUB 5KYXB 4XO3A 4U0RB 1EZUA 1CBJA 4JRLA 4OUUB 2CWRA 4Y2NA 5AOMA 4MLSA 1MJ8H 4WTQA 4J3SA 4F15B 3BRFA 1E6OH 5CEXA 1PAMA 4JGMA 3VNYA 3MV9A 4RIRA 2GAZA 1UACL 1KJMB 4PBWD 4YPGB 1HHGA 5FCUH 3ULVC 2K45A 1A3RL 2YAOA 4X9IA 1CXIA 3GK8L 4IEFB 3RFZC 3LIZA 1Q1JL 4PJ5D 5E95B 4HCFA 4KI5D 3M86A 4L4TD 4WGVB 2BY3A 3L4WA 5GGUB 4EN3B 4IW4C 4FNLH 4MA3A 4ZAKD 1O0VA 4BFGA 3O2WH 5I1AA 4H26B 1RUAL 1CL7I 3PWJB 3S5ZA 1AD9A 5E1IA 4BH8B 1ML0A 3L13A 3DHPA 1YEIL 5TE6H 5JOFB 4XN4A 4RGMC 4RX4D 1XGPB 2EO7A 4HUUB 2PYED 4AQ1B 1S7UA 2JE8A 2FR4B 1FZMA 3KXFA 1N12A 1JHTA 3APCA 1USQA 4OTXH 4Z0BH 2WO2B 5GIRB 5I74C 2FT8A 3VGAB 1U4FA 4RETB 4HF5L 1RZJH 4HA1A 2G3MA 3CLWA 5DZLA 4BZYA 7FABH 3OLDA 1G1OA 3QQDA 5DS8B 3VH8G 3FN3A 3EJQA 1N0LA 4NWUH 3NABH 4WUUE 4UQ3A 1ID5I 4CVXB 4TNVK 1OALA 5C3IA 4XP9L 4NOFA 5EF0A 1RCYA 5A16A 4G8AC 3UH8A 1RZIB 1DBBH 3II1A 3KG5A 2B9AA 3ZZ1A 5KVDH 1TKWB 2FEEL 2CM6A 4NNYB 3OKLA 4OZ4A 5J6HB 3QUYB 1EAOA 4K73A 1QSFA 4P3DA 4ZMWA 2PW2A 2XTJE 4G6MH 5IHUL 3RPIB 1YEDA 5CBAA 3VFRB 3PDGA 4L37A 4P5TC 4HMCA 3N1QC 4D94A 2YKKA 1EO5A 4EI0A 1K6QL 4BCXA 1LDSA 4XPTH 4FLOA 1MVUB 5ERWA 1MAKA 3MNWB 1GZQB 4M5SA 2ALWA 5SX5H 2PCYA 4FQJH 3SE3C 4WU7B 1B9ZA 5T3ZL 2YXMA 3IKKA 3FB5B 2FBOJ 1BDYA 4OF7A 4HLZG 4OZIF 3HN8A 3FU7B 3VFPB 4YDVB 4YHNB 4EKJA 2OXGA 1ZXQA 4OQTH 5B1AB 1SDYA 3NA9H 3DV4A 3S3CB 2HYMA 3RWJA 4I3SH 1GOFA 1MLBA 4EO5A 3WHE0 1I7RB 5ANMB 1GYUA 1K3ZA 4BV1A 1JGLH 4MMZB 1UHVA 5DC4B 4LVHB 1HHIA 2EXSA 3UTZA 4OLWL 2A73A 2XXCB 4GSUA 3FUNA 4HCRL 3LB6D 4LVNC 4RGNE 4U1HB 5T3XD 4MA1B 4DWHA 5GS0D 1UM4L 3RFZA 2N1KA 4JFWA 1TYRA 5HVGB 1JTOA 4JDEB 2XI9A 4PTUB 5SWZA 2Z8SA 2FYVA 2FATH 2G0LA 5AVVB 4U3SA 3QFGA 4NWTL 3QEHA 4J3UA 1CLOL 2ED8A 2OSLA 4UMSA 3AMKA 3FT0A 4XPHL 1NCOA 5CBEA 5JORA 1JPST 1ZS8B 3K6SB 5IB3B 3WKNA 3SDCD 1LDPL 3EYQC 3OAZH 3VI3B 3L3DA 4JVUA 3FNKA 4NZJA 3HS0B 1TNMA 3AXLA 2ICEC 2R0WH 5HPOA 3RWCA 4N5EC 1YQVL 5HGAB 3OZ9L 2BWQA 1XCTA 4PJFE 1SLVA 5ACZA 2ZX6A 4RBPH 1PJ9A 2CJUL 1ADWA 3I50H 1A64A 4HIPA 4I0PA 5C0BD 4WK0B 5DHXB 1JGIA 4B9GA 4KKLC 1X9QA 4G6JH 5EU6A 4Y1SA 5EO9B 4YDMA 3NJXA 3QO0B 1L6PA 4EJ1C 4PJEB 3KPRB 3POCA 1NCNA 2FWOB 2PR4L 5FA4B 3TC9A 1CWVA 3P9MB 2CO3A 1JRHH 1QEWB 4HPOL 4IRJA 2EIDA 2LLGA 2J44A 3WNOA 2W9LA 4K8RD 1IU1A 1KIUA 1T2QH 1U58A 1NC2A 5FCSH 5FM8A 3EGDB 3IBOA 4D0CB 3QWRA 2XOTA 3FBKA 1NBYA 3UYPA 1L5GA 1KEGL 3IE4A 4WWNA 1RZJC 4UNVA 3LEXB 4LLYB 3TA3D 1IC5L 4HJ1A 1FG2A 1TJHH 1OSEA 3DX6A 3VFTA 3RU8H 1E9OA 1AO7A 4I48B 4WWOA 1NCAH 2NQ3A 2PNDA 1R17A 3RA7H 2XZQH 1MIMH 4JNXA 5EORL 2VYRE 1QTPA 2DEYX 3O3AB 1AXSA 3EGXA 3LPOA 1AS8A 4FP8L 4O02A 5DQDL 2RCSH 4BSJA 2YQGA 5EU5A 3S37X 2AQRA 3AREB 5H37H 3VD7A 5KOMC 4MAYD 4QHLA 2R7EA 3FQUA 2I9LA 3F6IA 3I3DA 3SY6A 4OCNC 1KTLB 4WI5A 1CGSH 4WNSA 3L2MA 3B7UX 3UG5A 2I5YH 3QEQA 2HJFA 4A68A 4MNHA 3T0EE 4P48A 5PCYA 2H1XA 3OQRA 1NCDH 4JBSA 2B1AL 3OBAA 4DN3H 5D2LB 3K4DA 4PGBA 4HXAH 2Q76A 1OQXA 2HSIA 3FSWA 4KUCF 3FRUA 5E8DL 2OMWA 1A1MA 4UV7H 4W4OC 3GI8L 2ZJSL 4Q8BA 4YHLH 3T2LA 3PJLA 3WN5B 1H6UA 4ZFZA 3ERXA 3RLSA 3SE8H 4UT9L 4ANKA 2VDOL 2V5TA 4EDWH 5DD5H 4AYFA 4R4ND 3NJNA 3SJVD 4LOUC 4KRLB 4A2FA 5DS2A 4RWYH 5JOPD 1TYJA 4LAQH 1AHMA 3BPCB 1ZLSH 3RIFK 3PDOA 6FABH 4OD1L 3U9UB 3VFUA 1KFGA 1WZAA 2MWCA 4QWWC 5B1JC 2FD6H 3TF7C 5FGRA 1WAAF 4CKVX 1MG3C 3FB6B 3ISYA 4KHTL 4XXWC 3QYMA 1KGUA 3OR7B 3QDGA 2GPZA 3D5OF 4GUPB 2GBUA 2FSDA 3O8XC 3OMIB 4I2XE 2O6DA 4I0KA 5B1KA 2Q8AL 3MTRA 4QHNB 5HY9B 3EBAA 4UTCA 3KLHC 3TU6A 2AFNA 1AC0A 2CBPA 2PXYA 3GXUB 4HISA 5C0EB 1KIRB 1GXEA 4LCWA 2F18A 3BP7B 2ZAHA 3EJUA 3C5ZC 2BW5A 3GBMH 1N19A 3MCG1 4LLWB 4KXCA 1UD5A 1AZUA 1JK8B 2Z7YA 4H13C 2QADB 4D9QD 2PTVA 1T66C 3FT4A 4P2RE 1T4KB 1V7NH 1NBZB 3G5ZB 3MSPA 3FSVA 4DERA 3DTUB 3ISWA 1FUNA 3K3QA 5HYSB 3T6XA 1KTDB 3KYOB 3AWGA 2J8UB 4ZFQA 4GAGH 3VFOA 4LGRB 3BT0A 4L1DA 1INEL 4XI5C 4ZX5A 1FAIL 2X6CA 3FT9A 4HSAC 5ELIA 5KW9H 4MCYB 5DR5L 5CMAB 3KZ8A 4X8JA 5JIQA 3BWZA 3MUZ1 3SDDC 3NIDE 2EIKB 5FFLA 1L7IL 5KTEL 3B2DC 5E6IA 2Z8VC 4WW2C 3X3FH 4IYKA 2QR0A 1LO5B 3RL2A 3KDPB 5KAQG 2E8YA 4UM9D 4L3EA 2F58L 4GRLD 2CPCA 4A6YH 1OAKL 2FBRA 4X5QA 2OMTA 5HI3D 4BCZA 3REWA 2AQQA 3EJJX 3MV7A 4OIAA 4KVCH 3H7BB 3RJQB 1DL7L 4X4ZA 4IBTA 3V5KB 3D4GA 4PJCE 3KVDD 1EK3A 5IP4A 4I89A 2A9MH 1KXQA 5ADPH 4KAQL 4KMTH 1D7CA 4ZNEE 12E8H 4N85A 4CJ0A 8PAZA 3HVNA 3ORJA 4Y5VB 4LAJH 4JGJA 4Y16B 1PYWA 3GMNA 4EUPB 1J11A 3NK4A 5HYFA 4WLCA 4ORZC 5JXAL 1J12A 4GQ9L 3GLDA 1DVYA 1NAMB 2EDLA 1QFOA 1JDCA 1UZ6F 4P99A 2AABL 4GW1B 4A7SA 4CBZA 2K70A 2IMNA 1RIUL 2AK4D 3IMWA 3VSQA 2DI9A 1X5GA 1DANT 4PJ5E 1Q4NX 4KI5E 1Q9LA 1H5BC 5MENE 3H8NA 1BPLB 2BOCB 4UM8A 4JPIA 3VFNA 2FWUA 3A21A 2XSKA 3MREB 2DQTL 2YR3A 2ZKHH 1OM9A 3U6XS 5B39B 1VFUA 1RSFA 3FAXA 3V4PA 2VAAA 4HK0B 5D1XB 5IQMA 4X7TA 1P1ZB 4ANXA 4KPHH 4L9LB 2P42B 4PBDA 1FO0A 3AB0B 5AAMA 3WIHH 2FYYB 1S5IH 2PYEE 1R46A 4KK6C 1QHPA 4PWJA 3ZIMA 4XB3A 3C5SB 4ERSL 5CAYB 1KWKA 3PHOB 4MNGA 1LP9E 5ALCL 4OFYD 2FGWL 3GQFA 4XOCA 1MHEB 1RJZB 3STZA 1U33A 3BKCH 2H41A 5KSAD 4U4IA 4AENA 2F7OA 3KR3H 4WHTA 3TBSA 4U49A 1EAJA 3K4AA 1HX0A 4UV4L 3IJEB 1K8DB 3LN4B 4PG9B 1J0ZA 5I1GL 4X0NA 3N9GH 5DLML 4F9PC 4F2ME 4M62H 4YDIH 1XGZA 1TZAA 5MEPA 3L3KB 3Q3GB 4M6MH 2VDRL 4FQLH 5D7IB 2ZKMX 1OP4A 2WLNA 3NGBB 4LBEA 2ZKWA 1LQBC 3SKOB 1DN0B 3VI3F 1VCAA 1B0IA 3U9PL 1P7QB 2Q3ZA 2CGYA 5IJBC 3FTGA 1BFVL 4M5ZH 3U4EB 2B2XH 2QV2A 1J05B 3S3PA 3QXVA 1A6UL 3IAGC 3MRBB 1TVHB 2O6CA 4FQQA 1P5UB 3RTQC 2X87A 5LNGA 5CJXC 2P44B 2MNJB 3LAFA 4FCAA 3REVB 3Q05A 5G2NA 4PVBA 1U8JB 2BK8A 1CYWA 5JW4M 5DZJA 1TVBB 3Q06A 2R0KL 2NY0C 4EZMA 2BVUA 4QPEA 4EQ3A 5LGHL 3EDFA 4LLMB 2E6PA 4EVNB 4PJEF 3V0VB 3VI4E 4F33B 2BWDA 2H7WA 5JW4Q 2H6PA 1NGWA 2DDQH 2BNRA 3IDNA 4FJ6A 5BXFB 3BUYA 4R7LA 5J6GA 2Y6SC 4R90L 3QE5A 4R4FH 5EN2A 1BEXA 1IL1A 3NIGE 3QJTB 5TE4L 5FFOA 1KZYA 2JQZA 3STBA 4AE1A 3Q48A 3I02B 4OCXH 2DOCA 2MNUA 1WFOA 2JKSA 1IBZA 4OGQC 5ICXB 2OMZA 5DRWB 4G9FA 1T7XA 1SFHA 5T3XE 3CBKB 3TJHD 2Y07L 2ZPKL 1AS6A 2YPVA 2A1WL 2ZT9C 1IM3D 2GK0A 3BAIA 4ZMYA 1WAEA 3FW6A 3OF6D 5CS7A 5FOBA 4BE5A 1BF5A 4JFQB 2VDMH 4PJIA 2BSDA 1QQDB 5AL8A 2VSDA 2ATAA 3SCMD 1CFNB 3K8KA 3VWKC 1DQVA 1E40A 4A55A 4PV1C 3TCTA 4O02L 5IOPA 3SDYH 5F8RC 1L6ZA 3LS5H 4N8CL 4G7YH 4NUMA 2ICWI 2OFQA 4OZFB 2Y5EA 4XTRC 4BZ1A 4PFEA 3QORB 2GT9B