2EVFA

Structure of a ndt80-dna complex (mse mutant ma6t)
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
303
structure length
290
Chain Sequence
VILTQLNEDGTTSNYFDKRKLKIAPRSTLQFKVGPPFELVRDYCPVVESHTGRTLDLRIIPRIDRGFDHIDEEWVGYKRNYFTLVSTFETANCDLDTFLKSSFDLLVGRLRVQYFAIKIKAKNDDDDTEINLVQHTAKRDKGPQFCPSVCPLVPSPLPKHQTIREASNVRNITKMKKYDSTFYLHRDHVNYEEYGVDSLLFSYPEDSIQKVARYERVQFASSISVKKPSQQNKHFSLHVILGAVVDPDGIPYDELALKNGSKGMFVYLQEMKTPPLIIRGRSPSNYASSQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*TP*GP*CP*GP*AP*CP*AP*CP*TP*AP*AP*AP*AP*C)-3'
publication title Principles of Protein-DNA Recognition Revealed in the Structural Analysis of Ndt80-MSE DNA Complexes.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Cell cycle/dna
total genus 86
structure length 290
sequence length 303
ec nomenclature
pdb deposition date 2005-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05224 NDT80_PhoG NDT80 / PhoG like DNA-binding family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1390 Mainly Beta Sandwich Immunoglobulin-like NDT80 DNA-binding domain 2evfA00
2EVFA 1MN4A 2EVIA 2EUVA 2EUXA 2EVJA 2EVGA 1MNNA 1M7UA 2ETWA 2EUZA 2EVHA 1M6UA 2EUWA
chains in the Genus database with same CATH superfamily
4OVUA 5IW6B 1F45A 1GA2A 1GW0A 1XAUA 3FU6A 5IB5A 2WLIB 2ZKWA 3WKNA 1OTSD 1X7QA 3OKNB 5D7KD 5GRZA 3ULUD 3IVKB 1DJXA 2DMHA 3SGJC 1HOEA 3T1FA 5ACZA 4XH2A 2C4XA 3QQDA 1V3KA 4LCCA 1F58L 2IAMA 1F1GA 4FHKA 4NWTL 4UT9H 3A4FA 5HI5C 3X13A 2EYTB 4G59C 1IFHH 3N40P 2J8UF 4FERA 3AZUA 3Q6GH 4XGZB 2NY0B 5EBGA 8FABA 4PGDB 2AQ1A 3JUZA 3OKLA 4G9FD 1JPSH 3D33A 4MS6A 4KTGA 5JDJA 1YN6A 4S1SL 1Z3RA 3MCG1 4IBWA 5LGHH 4JVPA 5AW8B 3AWEA 4ZYKA 1GC1H 4URKA 3AXIA 2GBAA 4NNPH 2ICEC 3B2UC 1GY2A 1E65A 3H3KA 5E5LA 3FK3A 3QJHB 1ASQA 2FEJA 2K4WA 1B0RA 3VNYA 5BNXD 5KJ4A 3BRGC 2OJEB 4G82A 3C60C 5GPRA 4A2DA 4Y0GA 1YNTA 2ZUYA 3OM3B 4KBPA 1KENH 4AH2A 3CZFA 3MLUL 4LLQA 4C4KT 1IUZA 3PJSA 1CDJA 1TZ8A 3O4LE 2J88L 2VXUH 3BEVB 3ZE1F 4H2AA 3ARBA 4F91B 2DLEA 2WV3A 3F01A 4WW2F 5EORH 4EIZC 2WXJA 1F42A 2CKBB 1JXJA 3SY0A 5FF6A 2F61A 5GS0H 3U1QA 4DVRH 2BVPB 4WTZA 4QHKJ 2C9QA 4XAKD 2YPVA 4BEIA 4AYBA 2F54E 1ADWA 5ID0B 3LY6A 3VX0A 4L4TB 4I88A 2BSSA 2XJKA 4OQTL 3VXUA 1FV1A 4OGAD 1IGTB 4H8WH 1ORSB 4FMKA 4RWYL 3HCVB 43C9B 3U46B 2EDEA 2UWEE 4JO3L 4P2RD 3PGFH 1NCGA 2FJGA 2PCFA 1UB5A 3O9WA 4LARL 3WXWH 4L8SC 1FL5B 4AQ1C 1U3JA 3P3SA 3U83A 3NFNA 3UZEA 2PXYC 4C4KO 2IH3A 3D39B 1C16A 4TQ8A 3VTMA 2ED8A 2E27L 1OEZW 4X8GA 4APQB 4B50A 1TLMA 2CO7A 2IH1B 1LNUA 4YSRA 5EU3B 5AOKA 4BCZA 4XXDA 5ITFB 2AERT 2HG0A 1L4IA 3FFCA 1CICB 1KG0A 4N6RA 3FOMB 5IIEB 1UADC 1WZ1L 2OULB 3LRSA 2XKUA 2WQWA 4O2EA 5EV7A 1HL5A 3IJHA 4S2SA 2O5ZL 2X2UA 5IJKA 1M9WA 3DIFB 3H2PA 4BZ1L 2J43A 1TR7A 5CBEA 1NA8A 3Q8AA 4EOWL 1E6OL 4JFTA 5J7CC 4EZLA 4NN5C 3S8FB 1X9LA 3D51A 1S9YB 2FGZA 1P4UA 2JJVA 4AGOA 5EC2A 1RIVL 4PG2C 3TL5A 4HIQA 4CMMA 4UTAA 5E6YA 5ITBH 1CLZH 4JKPH 5BJTA 1EPFA 3T2PA 1CE6B 1E9PA 5C7ZA 2P48B 1XGRB 4AGPA 4M5YH 5EZLB 2CMRH 4AIZA 4J1UB 3FAWA 3Q3GA 3RZCA 3MGTA 3GHBH 2FO8A 2Z93A 3QNZA 4NRXA 4XBMA 3GNML 4MA1C 1TTUA 1KV7A 3TURA 1J0JA 1WAAA 2VXSL 3KLAA 3OPZH 4J12A 4HSQA 3ZQXA 6CGTA 3PY9A 3P2TA 1DQTA 1KPUB 4I89A 1J0HA 2DQGH 5DJ6B 2YAEA 4P5TD 2VH5H 5LXVA 4OT1L 1E5YA 4PY7A 1WEJL 4I85A 1KOAA 4YOKA 3RY4A 3O6MH 1KN2L 1FI8C 1QBAA 1T5XA 4LEOB 5EFIA 2NY3C 1L0PA 4RAUA 3BAEH 2EEBA 2GY7B 3NP3A 1TTFA 3WO4B 4G5ZH 3FO1B 3RWGB 5C3LD 2R2HA 2MSPA 1M1XB 1JRHI 1RUML 3IMWA 1G43A 3E80A 4P5KB 1QABA 5AAWC 1M7DB 2NR6A 4MZ2A 4KWUA 2NY2C 1T6WA 4U1MA 2Z31D 4FTVD 4MLIA 4Y1AE 1CDBA 1CCZA 2PP8A 3CVDA 2AK1H 2I5YL 4RRPM 1QKZH 4ZW6A 2E74C 3V5KB 1ZHKB 2AV7A 1F6FB 3FZUD 4AKPA 5CP3A 3CDZA 2VIRA 5FKPA 5HVHC 3IGLA 3HZVA 3BUPA 4NO3A 1JNLL 1JDAA 1O9ZA 2XWEA 4NX0A 4OLUH 4JRXE 4MAUL 3C6LB 2NZ9C 4NPYB 2CUHA 5C0BD 4JJ5A 3U1SH 3SDXB 5F9DC 2VUKA 4IIZA 1MJUL 4S0HA 1KFGA 4XVSL 3V4VL 3FFOA 2EABA 2OCCB 2YD6A 3QEGH 4PJHB 1ZLUH 3C5ZA 3RJOA 1NCWL 5J13B 3WELA 3WAJA 4ODWA 1D9KB 4KTDL 3ZZQA 1HK6A 3SHSA 5FFGA 3PWUA 2DQDL 1URIA 4NJ9L 2NUPB 3T04D 4Z6AT 2I07A 5K93A 2R29A 4LLYB 3P73A 1AYOA 4OCSL 2H1XA 5ICXB 1A1NA 1R3LA 3I85A 1LMIA 3EOYG 4EKXA 5CEXA 5DMYA 4HJ0C 3LIUA 4RVBA 5C1MB 1QAWA 2IGFL 2B2XH 2XSKA 4M7ZC 1HQ4A 1WBZA 2YRZA 4IMLA 4WNJA 2YUZA 1HWWA 4N3UA 1A4BA 4MB5A 4GOSA 4D9RD 5CJOH 2FECI 1LTXA 1YECH 4UTBA 3STZB 4E41A 4J23A 3GJFB 4Y7OC 1XCQB 3PWVA 4WIQA 1E3XA 5ICZB 1JD7A 3JBG7 4WUKH 2X05A 4GW5A 3W2DL 3B9EA 4GUPA 3Q01A 3APFA 4N9GA 4KI1A 2EC9U 1RLWA 4BD4A 4YPGA 1KLGA 2VLLA 3ZKMD 2CE6A 1I31A 1P2CA 4JZJA 3G5VB 4JKKA 4OIIH 4ATTA 1DLHA 3V9CA 1W72H 3TIDB 5DMIL 4GS7C 4OM0H 3LEVH 4KKBD 1KJ2B 1AS7A 1HS6A 4ALAC 1S5HA 5IY5B 3CH8A 1JPTL 1IAOA 3QHFH 4HWZB 1ZHBA 1NC2D 2JXMB 2A9CA 5JA9A 1UH2A 3HG4A 5DUMH 2AEPH 5KSBA 3TVMD 5I17B 1MELA 3CFJB 1AC6A 3L3OC 2CIIB 3ES6A 3NFPA 4OZGA 3MR9A 1H0DA 2ZSVA 5DMJB 4OZIA 4CNIA 4OLVH 4R0LA 4F8TA 4ICXA 5B3SB 3DHPA 4X4ZA 3GTNA 5INDA 4PY8J 4XPAH 1LO3H 1HOCB 2C9AA 2YPVH 3E3QC 1LEKA 5T33H 3ZDXE 2IPKA 1MLBA 4M9PA 1WO2A 3B83A 2TSBA 5E94A 1ZE3H 1HYRC 3KG5A 5D7JA 3UJJL 3RJQB 2FX9H 5IREA 4LVEA 2YPLD 4MYPA 5JW4R 3ZSTA 1UA6L 3II2A 2J56A 1N59B 5AB1A 2YKLH 5DJDB 1O9VA 4NUGL 2DWXA 3BC9A 2FB4H 5MP6H 1CDYA 3ZX1A 5JTWA 3JWNE 2H45A 3BN9D 4HAKA 4QHMB 3GFUA 1XXDC 4WHTA 3ZTNL 1N2RA 4Y5YB 3GSXB 4XCCH 4V2BA 1M2VB 5F88B 3IEAA 2BVOB 5AB0A 1CT8B 1JGDA 5LNDA 4PGEB 4QXTB 2QHRH 1A64A 5MHSD 3RA7L 2PPAA 5FR3A 2B1AH 1TPXC 4ZSOB 1JZDC 2VDPL 1HE7A 1JNNL 5AWNL 2AJSH 3MJ9L 3MLTA 4HUMB 4DKDC 3ZKND 4P2OA 4PWHA 1JSYA 1INQA 3DA0A 3FQTB 5D2NE 5JHLL 3V0HA 4BCXA 3TNNB 1R0AH 2FEEL 2FO4A 4IRSB 1XGUA 2F54B 1DVFD 4FXKA 3TXAA 1IEHA 5K69A 1DZBA 5EU6A 3EH1A 5HGGS 3V9FA 2O72A 2P1YA 2JKNA 4ZO6A 4F15C 4P2AA 2YD8A 2UWEB 2CGRL 3LKSB 5SV4A 5EZIH 4AYFB 4OJFH 4UTAH 5IROA 5I0VA 2H1LM 4HQQH 4EMZA 3NGBC 1EAPB 3BVDB 3N43F 4R7DB 4PLOB 5KSAB 2OA9A 4UQCA 4GQQA 4HJ1A 1U8PA 4HMCA 5C0GA 3FT3B 3FB5A 1ACZA 3H3PL 4JFSA 4KUZH 3U6XS 3ALWA 5DEJA 3IDGA 4WKXA 2CWRA 1CGWA 3WJMA 3VQLA 4DGWC 4G6KH 3NEOA 1N18A 1CDUA 2J1YA 1NGPL 5C70A 1VKXB 5L88H 4P9HC 3ATAA 3PV6B 3UYOD 4CJ1A 5F9WC 2EDRA 3QDJA 3VQMA 3V52L 1SLUA 4O5LH 2B16A 1U3HD 4DN3L 4PBDA 1AIFB 2DWTA 4QRRE 1X7SA 4X98A 3A4AA 3ME0B 2X3BA 3ATFA 4O51A 3MA9L 4OF8A 1MEXL 4JANA 5F1IA 1B4TA 1DJGA 1GZHA 1P0SE 2SEBA 3IDJB 4Y5VC 2XQYK 1QBLL 1DN0B 4KTYA 4JMNA 4PLJD 1I85C 4HBCH 1OTTC 3A6OA 2VERN 4OCRL 3F12A 3KL5A 1DJWA 3GK8L 4Y2DD 2OSLA 5E0QA 2NW3A 4NP4L 3F00A 2EC8A 4YVUA 2VLJA 4MTMA 5D1ZB 2BNUA 5GGTL 3T2OA 4N8VG 3SPJA 2HLAA 2N0MA 3LNGA 2KLRA 4JCLA 3HMXL 2A4CA 4JLRA 4C58B 4JQVA 4ZXBB 1BXUA 1BEXA 1A1OA 1D5ZB 4R7NB 1SLWA 1UWGH 1F8TH 4R7VA 1W0WB 2HFEB 2ENQA 4FZ8L 5FGCE 3R1GH 2IPUK 5BPPA 5J1SC 1PLBA 1IQWL 4MJ5A 5IEHA 4QNPF 4PB0L 3TBTB 1H3PH 3HC0B 2W1NA 4ODUA 3C8KB 2GFBB 1PEZA 4BV1A 2V2XA 3MV7E 4P46C 1KGJA 2ZONA 3T6QC 3GMMA 1J5OH 5EBLB 1XZ0B 2X2YA 4O00A 1TQVA 4JN1H 4A1RA 4LKXA 4AE1A 5KSVB 2ADJB 2PPFA 5JXAH 1GMIA 4LCIH 4YHOH 3BSZH 1QBML 3GI9L 1S7SB 4OY9A 4PAZA 3IWUA 4OGYH 3EBIA 5EWIL 35C8L 4Y1AB 4HK0A 4F27A 3K71B 4X8JB 4PWGA 1GGIH 4PWKA 1LK2A 2AFNA 4NI6A 4ZMXA 4TVPL 3WBDA 2V33A 4NKOA 4DCQB 3K2UH 4I18B 3VCLB 4XNUH 4UTBH 5LBSA 3RILA 5MI0B 5AVSB 3TOPA 4BSVA 1QNIA 1N64L 4JRXB 1YN7A 1YZZA 4WSJA 1F4XL 3UL4A 3MV9D 3VWKC 1QUNB 3SOTA 1PIFA 1DJSA 2AXHA 3MLWH 3UP1A 5LNGA 4H8WC 2UZIL 2ERJC 5BW7C 2BSRB 4EQ2A 5EF1A 3PQYD 1OGSA 3CBKB 3Q5YA 3QRGH 3ZHLA 1PX8A 43CAB 4PFEA 2J1XA 2JK5A 1CF8L 3BKCL 5T1LA 1ZWIA 2CBMA 4O58L 4AYSA 1GCYA 4APXB 1TDQA 4BFJA 1J0ZA 2WWNA 4Z7UE 1H15A 3DDGA 4L1TA 4WHYG 1ZA3A 1OL0A 2VDNL 3HZMA 5E8OB 2NZ1A 1J8SA 3WLWC 1Z66A 4MMZA 2I26N 4FRWA 1FNGB 4OCXH 2PYEE 1G4MA 1EAOA 3Q06A 3NZUA 2VQTA 4JG1L 4MJIA 4LSVL 1BAWA 3FSVA 1VHPA 5FKAA 2VLRD 5JLZA 5IBTL 4OFDA 3VH8B 1UD4A 2P8MA 1U8MA 4CN1A 2IBZX 1ZJAA 1E5BA 3Q13A 1AS8A 4M61A 3PWJA 2WVTA 5KANG 1RERA 3DBXB 2FNWA 4OZHF 5AB9A 1SPDA 2XKSA 1N5AB 2IDCA 2FWOB 4AQ8C 2PWGA 1FSKC 5EC1B 4I3RL 3M7OA 2COVD 4BFIA 2X6BA 1BPVA 3I9GL 4ZNEE 5K39A 1I9IH 4RMUA 2V7NA 3DTUB 1E2ZA 4Y4HD 1S9WA 3EJZD 3RL2B 5ENWA 4NZFA 4DGIL 3BGMB 3EH2A 2H6UA 3SO3C 4FNSA 3VVVA 2JSFA 5J1AB 4YHNB 4H0HB 1M1SA 2HN7B 3FBQA 1LL1A 3HR6A 3C12A 3PJLA 4KFZC 3CFEB 3EHBB 1MW0A 2FSEA 3K4AA 3DIDA 1O5PA 4Y4FC 2MPVA 3MA7A 4LSSH 2GTQA 1E30A 3MRMB 4OI9A 4R90L 4YN3A 3NG5A 3X14A 4DKTA 3JTTB 4YDKH 1OV8A 4E0RA 4PJGF 1U91B 4IGBC 3RVWC 4H1LB 4G6ML 5E8NA 1IZJA 4TVPD 4ZMYA 3HLAA 3VFOA 2CZNA 1B2WL 3L9YA 4XNYL 5CXPA 4X9BA 4QJ5B 4NHCH 1J12A 4QLWA 1XF2B 3PDOA 4B0MM 3HG0A 1RMFH 4KTEH 4Y8AA 5EEUA 4PU2A 5HI4C 3ZDWA 4KMLB 3KEDA 4AEHH 3QNXA 3C2AL 3W81A 4NJAL 3SGDH 3S6CA 2D4DA 1CXFA 5HGAA 1EBAA 2IANB 4WUUB 5T3ZL 1KTCA 4OD1H 3WEBA 4DEWA 1XH2A 1T7YA 4ZFFA 1G7MB 3APNA 4AVIA 3T8MA 1ET8A 1MVYA 1X5YA 2QSCH 1DANU 2WQXA 5D2NB 1Q9LB 1M53A 2OK0L 1EEUA 1SJHA 3O0RL 4WV1A 4IRZL 3LH2L 3VGGA 3MRIA 2WKOF 4OD3L 3FSWA 4H0LC 2CCWA 4N1HB 3CDCA 1BLIA 4YLBA 1T1ZA 5DZAA 4OM1L 3VD4A 3SKNB 3ZMEA 4Y16A 5IK3A 4PGCA 5A3IC 1I8IB 5I1LA 2ZWSA 2P5EE 4MSWB 2DIEA 3WEOA 3EO0B 5HDBE 3GUTB 1X4YA 4HWUA 1Q38A 4HLEA 1ICTA 3NZ8A 3CGTA 4KKCC 5HHVH 3MOQA 4GW1A 3IPFA 2QSVA 5JIMA 4MNGA 5D7LB 3BRDA 4HKZB 1HEJC 5KYXA 3VXME 5IBUB 1FNSH 2ADGA 4BQ8A 3IYLW 1Z9LA 4M8UA 1DBJL 3CSPA 3I6KB 4UAOB 1G1KA 1UJ3B 4LLVA 4HPHA 4N8CH 4IKNA 4KI5C 4HXAL 5BMFL 1PD6A 4DN4L 3TA3D 1CGVA 1JTTA 3WHE0 1HDMB 4N2DA 3ARTA 2DKMA 4Y1SA 3LN9A 5AOJA 2UZXB 3NA9L 1BFOA 5C0RL 1PMYA 4QRRB 3W38A 1CXHA 1BYOA 2F7IA 5DDHB 4N8VB 5DQDH 5K9KA 5EO9A 1CYWA 2D3NA 2EE3A 1F4YH 5FCUL 4YR6B 3GXTA 4KUCF 3VFNA 1JGEB 3IJEB 4JHWL 5FW6A 2GPZA 5I1CH 2WXLA 3QO0B 3LQAL 4KDVA 3KL0A 3BZEB 1C8QA 5SWQA 2AABL 3D3VD 5BVPL 3RIAF 4HJ0D 2ZP9A 5DZOA 4JM2C 1TEGA 1T66C 5I73C 3FHEA 4U1IB 1J5DA 1D6EB 2GK2A 4UDTA 5F96H 3K0YA 5IEKB 5FHBL 5KTEH 2VISB 2EEFA 4DW2L 3OGCA 2ZOLA 3BWZA 2XFXA 3INUH 3SBQA 3SYOA 5LWYL 1HEZB 3K46A 1W15A 5FGCB 1KLUA 1NCTA 1VACB 3FO9A 4MQXD 4W9DC 4WCYH 5BVJA 5J6GA 3AB0B 3QARA 2GW5A 3LH9A 4MCNA 1ZE3C 1MAMH 5T3ZD 5E2UL 2X53A 3O6LH 1QNZH 1EAQA 3BP5A 3S5ZA 1OF2A 3NCXA 3MV7B 3UC2A 3G6AB 2OR7A 1E40A 4DO6A 4FYSA 5GQBA 1CLVA 2V17H 3BUYA 4TSCL 1U92B 1C7TA 1E8WA 5EZJB 5I6NA 1DCLA 2Q3AA 2CJTA 3EW3B 3BWUF 1BFTA 5JIQA 3GZPA 3LEYH 4P2YA 2H3NB 2X89A 3Q2WA 2YQGA 2DQJH 4ONFL 5IGXL 3SOBL 4FQCH 2D3LA 3RTQB 3ELQA 4JPKH 3T9WA 3AXHA 5LHDA 5IM7B 2BY0A 1EXUB 4LGPB 4NDMA 1OSZA 4J6RH 3SKUD 3G6DH 3IFLH 1J10A 1KDIA 1KPVB 5D7IF 3TV3H 3TEZA 4FX5A 2AJZB 5LNEA 1A7OH 2MOQA 5DF0A 5JXEC 2OMXA 3H54A 2IAAC 4FFZH 2V2TA 4MXVE 2EP6A 2FJFA 2P7TB 4QKTA 2AS5M 1UD5A 4HJSA 2HG5B 3ILQC 3Q6GL 1TETH 1FPTL 5C86A 5KZCD 4DZBB 1M7XA 2YAMA 3BSHA 5B4MD 4LOFA 1LO0H 4R4BB 1JPSL 1MCRA 5DXWA 4PG9A 4JPWL 3VFVA 1JVKA 1OT4A 4GSDL 3HI5H 5IESH 1A22B 4ADGA 4A2FA 3LKQB 5DHYB 3GZKA 5D70H 4MMYA 1NGQL 1PZ5A 1JWUB 1M7IA 1MRFH 1NICA 1XGZA 3QAZB 1GC1L 3MRHA 3DARA 1A7RL 1NCAH 1QUPA 4Z7UB 3S3CB 4KUCD 3QIWB 1JNHA 4EI5C 1BD2E 3IDMA 3HHSB 2PYEB 4QWWD 1HSAB 2DQUL 2W92A 1AGCB 3C5XA 5E0FA 3SSGA 1IM9D 3E6FB 3LKOB 1B4RA 3WS3A 1KENL 5GJSH 4BDVB 1QATA 5JQ6H 2J55A 5C07E 4H8VA 4JVUA 3DVIA 2HZHA 3CFCH 2QQLH 2VXUL 5D1QC 4WFFD 4Z7QE 2VZSA 4N0RA 3OJ2C 5D7HA 4UQ9A 5EORL 5I6MA 3T77B 5D6DA 3SBWC 2ZOTA 1O6VA 1CFMA 2BVEA 2A1WH 3D25A 4W9ZA 1U3YA 1SLXA 3HG2A 2X0UA 2QQNL 2NY4C 4FQIH 4CAGA 4LBAA 5GS0L 2LAAA 5JZ7C 1MXGA 3H56A 4G42A 4YXHH 1E4JA 4XVOA 1O7VA 5DD0L 4KPHH 3W11D 1ZVSA 5I0ZA 4HWBH 5B1KA 1I53A 4YAQA 4JGNA 4B9IA 3AXLA 1I1RA 1Z0NA 1XCXA 3VFGH 1OT2A 2WXOA 4ZX5A 3PGFL 1JNJA 5BQ7B 3ARWA 3X1BA 5JDSA 3LPWA 5ISZD 3WXWL 3BT2H 1AQDA 3L3JB 3ZW3A 3V4PA 1TO5A 1A7NH 2ENSA 2WTRB 3LIZH 5CFHA 1HHJB 2A77H 4LPUA 3WHXB 2BY2A 1BQHA 1C08A 1S7UB 2Y3NA 3IU3B 1UWEH 4L37A 5DJZA 4YDLB 4IOIB 2HX7A 1MVFA 1XAKA 4Z7NE 4OU3A 5HYEA 5C6PB 5JYLA 1TZHA 2EVFA 1FDLL 4JZNB 4OJCA 5KG9A 3RNKB 2AQ2A 4BFOA 1GYAA 1EK3A 1LP9A 1F3DJ 3SE3C 5AVUB 5F1SA 1XMEB 3MJ7B 4HUNB 4AUUA 3R4DA 2IBZY 2WNXA 1UYWH 3TO2A 4TUUA 3Q2LA 5IVZB 5E2VH 5JHDE 4EO5A 5DZPA 4JPVH 3L5XH 3QUXA 4ETYA 2C3VB 1FZOA 2C9VA 3ECBB 3IDIA 4XBGB 4WGVB 3MBEC 1CLZL 5E1AB 5ITBL 1Z0MA 2V9RA 4JW3A 4ELKB 4Y9CA 4B9CA 5B8CB 3DMMD 1WIPA 1P4LB 1I4FB 3MFFB 2X28A 4JFED 4XCYA 1TEFA 1MCPL 2GUYA 3K2MC 4KOCA 4ONHB 1LQBC 1G0YR 2UY7A 2BWQA 4ACPA 5FCSH 5DRNB 3RFZA 5DRXA 3TPKA 3OPZL 2R69H 1CFQA 2BH0A 4FQQB 4P4RB 4F33B 1N0LA 2MOGA 2P5EB 2VAAB 3T0DA 2DQGL 5HDBB 5DWPA 3MCKA 4HUWB 3EUDA 2VH5L 1FVCA 3L54A 4JFYB 5E5MA 4ZUTB 1E50A 3RY6A 3D12B 1DO6A 1MCDA 3O6ML 3DX8A 3E6HB 3VD3A 2F08A 1UD2A 1SXBA 2R56H 4KHTH 1ZGLM 1RPQA 3VXMB 5GS0D 3HE7B 3BAEL 5BZZA 3VFWB 1A8JH 3P3YA 1P7KB 2ZTBA 5A2BA 1ZXKA 5C0FB 2B5IB 2CO6B 4PD4J 3AROA 2FLRT 4GIAA 5CF3A 3CU7A 3QIBB 4PJXE 1QMUA 4AXWB 2KPNA 3VWKD 2VMJA 1JZ3A 5IKCB 1BXVA 1HEHC 2WNGA 3F58L 3QG7H 4FI7A 3EO1A 1W2KT 3FT4B 1UEYA 4EN3C 5IWLA 3ZDYE 3NCYS 4XMKH 2ALAA 2AK1L 1MY7A 1QWUA 1QKZL 4LL1A 5FYKU 5DZJA 4ISVB 1NFIB 3OVUB 1O9WA 3QUGA 3QSKB 1KTLB 5IB2B 1NIEA 3U79A 3PAUA 3FH5A 1IGJA 1N70A 1UB6A 2DTSA 3N41F 4ATWA 1XSOA 4H8HA 4DEUA 5KVEH 4OLUL 2R0ZL 5I75C 3ZLQC 3ZRSA 3TT3H 2VM4A 3U1SL 2RFXB 1KGYE 3HPLA 2BOLA 1JL8A 4GSUA 3GKWH 1MWAA 2IWEA 4LOEA 5D96B 1A6TB 1QFPA 3P02A 3QEGL 4L5FE 1BAFH 4NBXB 2EDDA 2FBRA 1F11A 2YC1B 4IHBA 1URLA 4UM9B 3VU2A 4JGMA 3VD5A 1CG9A 4IDLA 4JFFE 2LHAA 1Y6KR 3EJRA 1E27A 4XODA 4X6CA 3KLHD 3E1ZA 2AEQH 5EIIG 1YMMA 1DE4B 2BNRA 1JZFA 2WXNA 3ZHFA 4AW7A 2LGNA 5EB9A 1UXSA 2V9UA 3QEHA 4LAQH 5I19H 4N2HA 2ED6A 2B2XL 5I6XB 1SYSB 3MV8E 5C0CE 5BO1H 3KXFD 4A6YA 1SXCA 3FNKA 1UOVA 4RGMB 1YECL 4UT7H 4UI2A 4L3CA 1V3JA 2BC4A 3TZVC 4WUKL 3O8XC 4UOJA 5KVGE 2D7QA 4NNXB 4MAYA 1KGWA 4D0CA 3ARDB 5G4OA 4XOBA 3TBVB 2AKRA 5IFJA 3ROLB 2Q7AA 3CFMA 2VXVH 3HG1E 1PQZA 3OWRA 4L1BA 3PGCA 3FH8A 4OIIL 1TTGA 4Y4FD 4G8EB 3QQ3A 5C0BB 5AAMC 1YNTF 1R3JB 3MC0A 4OM0L 3B9KB 3DYPA 2D2CC 3S0PA 3ZPDA 4GI8A 5C0AD 4X5XB 1TJHH 2GSGA 3QHFL 1HJBC 2X2HA 4GQ9H 3QUZB 2IMNA 4K71B 5CJXC 3KPOB 1RAMA 3QQ9C 1QSFE 5DUML 4AV4A 2AEPL 2QGDA 4ADJA 1U4FA 3KS0J 3V7MA 1OP9A 4KJWC 3RHWF 4YK4B 2VAJA 4QRBA 3U9UB 1GAFL 4U3SB 4OLVL 1IZKA 2X12A 4BQ9A 1F6AB 4FQXD 5SWZA 3X12A 3BUIA 4PJBA 3LV3B 3NYKA 1LO3L 2YXVA 2YPVL 1JV5B 5J5EA 3TO4A 1A0QH 3MPCA 3VGAC 1FHNA 3G04B 3S7GA 2JCCA 4OZ4A 5IOPA 1EXHA 1XTLA 2GAZB 5DEZA 2FX9L 5E6ZA 2X9WA 4MVBC 1BOYA 1BD2B 2Q2EB 4U6HA 5I2IB 3WLBB 5E08H 4ACTA 4HEME 4UUJA 3MRGA 3VYOA 2YKLL 5LN4A 5T3XE 3WY2A 5MP6L 2FB4L 4IM8A 5F44A 1OCZB 4ZFZA 2WZPA 2MJWA 1Y18A 5CJ8A 3V4PH 3GBLA 4G3YL 3HS9A 2G2PA 1X3DA 3SCMB 4XCCL 4MJ6A 5C07B 4CW1A 1CFVH 3CLEH 4RMRA 4N8UA 2QHRL 4NCDA 4YSEA 4AENA 3MDJA 4Z7QB 5A3ID 2A73A 2B1AL 3BQUC 1FO0B 1H6UA 2C9XA 3CH1A 4MDJB 4QLRA 4BH8B 3VD1A 4OAWB 1NBVH 2AJSL 1G6RA 2OZ4A 5I1AA 3BW9B 2IAMD 4KKCD 2NQ3A 4GI6A 1QRNE 1G9MH 5CSGA 3BX7C 1ZHLB 2VOTA 4J2QA 3ARPA 5G5DA 5DEGA 3ERXA 5I1JH 1HJCA 2G2RB 3N50A 3R0MA 5EOCH 3S35H 4KI5D 5CLYA 3US1A 4CSPA 4Z8FH 4NQDE 2DQFB 2QPUA 5F97E 1JYNA 2UYLA 5EZIL 2E4FA 2ICWI 1IBHA 3DURB 3A5VA 4JY5L 2FHCA 5DLMH 4UTAL 5FLVA 4HQQL 4HV8A 3QDHA 2G4GA 2Z92B 4HGWA 4FNQA 1W0YT 1NEZG 3GJEA 3FAXA 4JRYA 4GKNB 1ETZA 3V0DA 3LMJH 4AITA 4R3SA 2F19H 4AWJC 5JW5B 1AHWA 4A63A 1EHLH 1P7BA 5IW6A 5LJYH 2QKSA 3IMUA 2WCPA 4KUZL 2WLIA 3TH3T 3EH5B 1WAAF 4Z7NB 1FVDA 4W1TA 4DOHE 3IVKA 5L88L 1T20A 3G7TA 2BCKB 2H3KA 3ZUCA 2N4IA 4WENB 4CC4A 5AYQA 4B3EA 3OAYH 1S8DA 3VXSE 2H0PA 4O5LL 2D73A 4C56E 4OZFG 1IQDB 5JPNB 1WS7A 1ZAGA 4GAYB 4XCFL 4HFWB 4CC0A 1WWBX 1L6XA 3NBNA 5LAXB 4XGZA 4WWPA 4FLHA 4RGNC 2OP4H 4PGDA 4O02B 5BCAA 2A4ZA 5JHDB 3OLGA 4MRCA 3ZTEA 5HSFA 3KAAA 2K7QA 5CUSL 1T0MB 3QR0A 5H4ZA 2ILLA 5DEFB 5EUOA 4PRIE 4AVKA 1BXXA 3REVB 1ES0B 4LFHD 3V95A 4LCYB 4XP5H 2GHWB 2Y3AA 3QJHA 4AQEA 1ZLVH 2MTPA 2VERA 2OJEA 3O9WD 2V8MA 1W80A 2X10A 2WK2A 3VI4E 1FYTE 1F13A 1MCCA 1UWGL 1F8TL 1VFAA 5EO0A 1Q8MA 4G71B 1PF3A 3R1GL 5CWSB 3HUJA 2HJFB 2C9PA 4CGUB 4FE9A 3DOHA 1HESA 5SX5H 2UUDH 4WI2A 3FFCD 2LABA 3RURA 1T6BX 3PCYA 2N0KA 2CKBA 1YO4A 2WMPB 4KROB 4IKJA 4WTXA 5ESQB 5HHOE 5ACMA 1J5OL 3E9UA 3KE0A 3V7AG 5TPWL 2BVPA 3BKMH 3ARZA 5KBLA 4JN1L 5DJAA 4WFGD 4ZPTA 5ID0A 3VRLE 4E68A 4PJXB 1OLLA 1YEGH 3OHXB 4L4TA 4V1DE 3WIHA 5JXAL 3ILQD 4LCIL 4YHOL 1I1AB 1AHMA 4B5EA 1ORSA 4OF0A 43C9A 3U46A 1ODUA 2E5EA 4N9OB 4OGYL 1BVOA 3ZDYB 4HAGA 1QHPA 2FLBT 3GXNA 2YARA 1TENA 1FL5A 3A4DA 2VKXA 4QYAA 4X83A 5AG9A 5C8JB 1R34A 3K2UL 4XNUL 4UTBL 2BP0B 5SX4I 1RJYA 2YSSB 4PSRA 4Y9FA 4N86A 5EIVA 1MCQA 2IH1A 4JUSA 3MODH 1MCHA 3IJ8A 4L8BB 5EU3A 5L2JA 1I1YB 4IEFB 3MLWL 4KXAA 5ITFA 2ESVB 4QT5A 1J8RA 2J5LC 5F6IB 1PYWB 4KKQA 5HJGA 1NFAA 3PS6A 4LRIC 5IIEA 3IPBA 3QRGL 3O2WH 2BIPA 2NY5H 5J9PB 4JFFB 1KBWA 4XBEL 3ARYA 4WJ5A 4LDOB 2LE9A 2VZUA 2WINB 3QPQD 3UBXI 1KWKA 3GSWB 5HD8D 2KZWA 1QLEB 1BDYA 4BA8A 3V8CA 3MTRA 3KPRE 4X2UA 5KSBF 4ZX3A 1MAJA 1JK8B 4GEIA 4OCXL 4K3HA 5JZ7D 3O45A 5T5NG 4HULB 5K9QI 2GC4C 2IO5A 4OZGF 4QTFA 4OZIF 1QWHA 2HTLD 2I32A 3MV8B 5C0CB 3SDCC 2OYMA 1TT6A 1CE6A 1XGRA 1TZIB 4I8DA 1EA9C 1IBGH 5AKRA 1YJDC 3K81A 5F8RC 3T3ME 2DM3A 2K9UA 2XXMB 4J1UA 4L9LB 2LU3A 3HAEH 5C09A 3R8QA 1CYGA 1K2DB 2G4EA 2QLYA 3CFUA 4M7JL 4TNGA 2Y5TB 1NDMB 4JE4B 4HD5A 3V5HB 1MCSA 3DK0A 3VX1A 5J89A 1SBSH 3HG1B 2UX6A 1KGIA 2APXA 3C8HA 1QVOB 2WXIA 3W0WD 4QRPD 2YJLA 4OFQA 2VR7A 4LCWE 2YD9A 1X5JA 3C60B 3MUJA 1H5BC 2WANA 2VCOA 5I30L 2ED9A 3VMOA 1AI1H 4LEOA 4XOCA 1QSFB 3KM1A 3I6GB 2D2OA 2DYRB 2N59A 4UT6A 3BD5A 3HN5A 1G6RH 1DVYA 4EIUA 5L8JB 2D4FA 5B38G 1NUDA 3FO1A 2ORBH 1QQDB 3RAJH 3RWGA 5ABAA 3GLDA 4AL8C 3QEQA 1JE6A 4LSSL 4JO2H 1O6SB 1M7DA 3VM5A 4M00A 4LAJH 1A2YB 2F8IA 3GBDA 1NBCA 2P4AB 1WT5A 5D1XC 3IGAB 4YDKL 5IW1B 3V5KA 4M29A 2C7UB 1J1OH 1A21A 1KBBA 1ZHKA 1ZGLP 5L4MA 2H2PC 4IRJA 3SBRA 3ZDZE 1AGFB 5AL0A 4B5ZA 3SKOA 3T6ZA 2R2EB 4NHCL 3GRGA 4U1KB 1IVLA 2EYRB 4X7SH 1RMFL 1XIWA 5EUKB 1KDJA 4KTEL 5C0DA 4F9PC 4L8SB 4AEHL 4AQ1B 3SPIA 3KYNA 1RZJC 2PXYB 4A66A 2VLMD 5FYKE 5HHXL 2PPDA 4W9HC 1G9NH 1RURH 4DP8X 4EJ1C 3FFDA 3WGUB 4XMPL 1JXFA 1S7QB 4JKWA 1F3RB 4G8GE 2O5XL 4WRLA 1D6VL 2NUPA 1EEZB 3D4YA 1QRNB 4LLYA 4WWKB 5DHXB 5ICXA 4GBXC 4NAMA 1AZVA 1IGIH 3MX0A 3TCLB 3CQQA 1ZS2A 3NJIA 2D31B 5IVXE 4XVJL 3H7BA 2KHAA 3KCPA 1QSVA 3WTWA 1SJVA 4H88H 4G1EA 2VUYA 4NN5B 1ZOXA 4NCC2 3STZA 3HS0C 2OV0A 1HCVA 1NKOA 3GJFA 1XCQA 2ZCKH 4JR9H 2A9MH 4UTCA 5D7JD 4ZS6D 4ECNA 5ICZA 1IB5A 2C9RA 4LEBA 3TBYB 5HHVL 3CHSA 2X87A 4YDVB 4F37F 4HK3J 2P8PB 1CL7I 4KDTC 2ROXA 1T7XA 2ROYA 2WOYA 2IQ9H 2LAGB 4DOHB 4N8CL 3AVEA 4KK6C 3B8YA 4MA1B 1KJ2A 2Y7MA 3B3IA 3IKCB 1OK0A 2MIZA 3VXSB 3GGWA 1NCHA 4C56B 2P45B 4AQOA 1B0IA 4HWZA 1CDGA 1IGMH 3N85H 2AQPA 3NQKA 3RZWA 5I17A 5E9AA 4HUUB 5ILTL 5DQDL 5LVEA 3ULVH 2CIIA 2W0PA 5TQ2H 2CKBH 4I9WE 4P2OD 1KYOJ 1SJEA 2KPWA 5I1GH 1OGAE 4ZTOH 3QYMA 1FFTB 2F74B 2M26A 2IDUA 1ZV9A 5HPOA 1HOCA 1TOXA 2FT6A 5LN8A 2XOTA 5BUPA 3B2DC 4I13B 2NY3B 2WYIA 3LEXB 1J8HD 3WIHH 5I1KH 4DUVA 4W81A 1OGPA 1E5CA 2OSWA 3MRPB 3IDUA 3OL2A 3G5WA 3TJPA 4QHNB 5LKNA 2PTTB 3BLPX 2QVIA 5F96L 1GKOA 1JOIA 5C3IA 1N59A 5DJDA 4QJ3B 5KTEL 1DLFH 3T6WA 5IQ9B 3VI4B 3AQXA 2NY2B 1FYTB 3RPIA 3DECA 2ZXQA 2NDGA 4ZI8A 4QHMA 4MA8H 5LBSL 5ERWB 2YAPA 4HG4K 3RKDC 3RVUC 4Y5YA 4I87A 3GSXA 4WCYL 1M2VA 2J1ZA 4FF9A 3IXAA 2BVOA 5F88A 1CT8A 2JKSA 3ZTJG 1MAML 4PGEA 3QUYC 1P5VB 1WC7B 3MROB 3O6LL 1LVEA 2ZXAA 2OJZH 4ZSOA 3WKMH 1ZJBA 4GAAA 1FFNB 3V6OA 4C59B 2B4CH 5F7EH 4GXVH 5HHOB 2IQAB 3QDJD 1ZKAA 3FQTA 4ODTH 2V17L 3EG9B 3TNNA 3KYOB 3P54A 2AAAA 2IDFA 2J57A 2XBDA 2F54A 3LEYL 2ADIB 4HS6B 4IRSA 1G7PB 2RBLA 2DQJL 3BXNB 3QQ9D 2EDYA 4AMKH 1L9TA 4B9FA 4FQCL 4JPKL 3TGXA 2B0SH 3RG1C 1DQDH 3ZGIA 4RH4A 1V3LA 3DTDA 1JBJA 1BMGA 4OKVA 5EOQH 3LKSA 5F9JB 3HC3H 4UOW1 3CTTA 5H94A 4AYFA 3G6DL 3VGDA 4YSQA 2JI1A 3EOTH 3U4EB 5AQ0A 3TV3L 4R7DA 1A7OL 5KSAA 4N0FB 4MZRA 4M7ZB 3UCQA 3EJPA 2VR8A 1G9MC 3MUUA 4FFZL 4A39A 5JMOC 1HL8A 5DFVD 2CDGB 3GSVB 4LSRH 3D08A 3IGUA 5C0EA 4KVNH 3VJ6B 1TETL 1B0GB 3SD2A 3W9EA 4K3DH 4IOFC 1LO0L 3OSVA 4PJEB 3JZ7A 4TQHA 5IESL 3HI5L 5C92A 3QBTB 3TJEH 2ZP8A 2W94A 4J2XA 4PRHB 5H2BA 1HZHL 2CRZA 5D70L 1MZYA 1MRFL 3NACH 1AIFA 2UXFA 4EVNB 1WAPA 2HTKC 1C5DB 1GZQB 1NCAL 2EUXA 2QHLA 2VWEC 1MVUB 3BQUD 4WHCA 3BKYL 2DI9A 1DN0A 1UCBL 3KPRB 4E9SA 3X1FA 3MGOA 3ZIMA 4Y4KC 4E5XG 3IRZA 1C7SA 2VDRB 3UG4A 3KPLA 2JI3A 5TGBB 3T8XA 2CBTA 3KYAA 4HIEB 3L3OB 3C09B 2JMRA 3L3HB 2XIIA 5D1ZA 3HMWH 5GJSL 5JQ6L 3T4AC 4ZX6A 4HIHB 1S9XA 1G7LB 3L7EB 1WIOA 3CFCL 4HAFA 4CVXA 2QQLL 3TEYA 1XF1A 2WWKT 1JZHA 2OYPA 1CFNB 5BUAA 4R7NA 1J9QA 2A1WL 3IB4A 3DDFA 1W0WA 4KC3B 2WKGA 3EGSB 5DC4B 4YXHL 3F6IA 4AC4A 4KPHL 4XMVA 4LCWB 3HC0A 1F00I 1XH1A 3OZ9H 3B37A 4HWBL 3T2LA 4AT6A 3C8KA 5AZEL 2A6IB 5E6SB 4UU9B 2R8SH 2BFVH 4CSSA 1BVKA 3DROA 4NGHH 1XZ0A 1XT5A 5FHAL 2O93L 4KJQC 1A25A 2NTFA 3P69A 3BT2L 4OF7A 4NYLB 2ZNXA 1CXEA 4P23C 4P48A 5KSVA 4LVHC 1A7NL 1BMZA 4UILL 1RP9A 3S37X 4P5SA 3LIZL 2YO3A 1HHIB 2PN5A 1A14L 2A77L 4JFHD 3VW3L 3FUIA 3ZJAA 3VYPA 3GIVB 3HIZA 1UWEL 4NM4H 1L9RA 1OK8A 2WWKO 3JWOH 4LESA 4Y1AA 3DX0A 5SWSE 2JJSC 3K71A 4MJID 4X8JA 4M4PA 2BK8A 2QKIC 4HJTA 1T0NB 3L4YA 3QEUB 5DSCB 1T04B 1U4EA 2DMBA 3ZDZB 3RU8H 4I18A 1NINA 2P24B 3VCLA 1MFAH 4DCQA 4F15B 2LLLA 2OMBA 1BZ9B 3GJFH 2GT9B 1E5AA 4DHLA 2QADB 1E9QB 2RA1A 4E9VA 5K5YA 1OCOB 1RULH 1QUNA 2HKAA 3VRIB 2B20A 2QVKA 5TJWK 3KH4A 3NGBB 4NN6C 3VD9A 2BSRA 5E2VL 1U8IA 5I28A 1SN0A 4JPVL 3L5XL 43CAA 3FO2B 5KVDL 3B1TA 2X88A 3TYFA 3UFIA 1KJ2H 2F7PA 2DQMA 4N0UA 3EUUA 1EJFA 4DP6X 2EDLA 2Z64C 1ZSHA 4AZUA 1FE8H 1KBVA 2B1HH 3GZQA 2C8NA 5E24E 3MVSA 1FNGA 3D09A 4L3ED 1TYJA 2NX5E 4YEFA 2EXWD 2BP5M 1JGLL 5DJ2A 3NCMA 4BSJA 1ED3A 2R69L 1HH9B 2W07A 1KBKA 1T0PB 2BNQD 4Q9RH 2H6PB 5DC9B 4Y5VB 1TQCC 3D18B 1S9KC 3C6SB 3NJFA 2IWKA 1K8IB 2NY5C 2NZIA 3F7QA 3FQ4A 2AZAA 3DTXB 3K5RA 3D8MA 3WIFB 1NBYB 4CVZA 1KLFA 1QD0A 2R0LH 4HJIA 4G1MB 2R56L 5KS9B 3BZFA 1NL0H 4U7MA 2FWOA 4Y19E 5EC1A 4XHJC 1R3HB 3CX2A 1OD7A 2A3TA 3QYNA 2C4FT 1PW3A 1JDCA 4B9PA 3QI9B 2A6JB 4Q2ZB 4YSCA 5DHMC 4NQXB 4A67A 2E75C 3RL2A 4AEIH 3BGMA 4G6AD 1YA5A 2ATKA 5ELIA 4QDGA 4XMKL 4JMXA 2VDQB 2HN7A 3BIKB 4HKBB 3RWHB 3GSNB 1U8NB 1LK3H 2J44A 2YUXA 1UHVA 2QBWA 4AM0Q 4D9QD 3NDYE 2QFPA 2OMUB 2LR4A 3R06B 1DBMH 2DWDB 4P46B 3MRMA 2EE0A 4TYUA 5DURB 3R7RA 4DP1X 2ITFA 3S3PA 4ZTEA 3CN1A 1MCBA 5GGVY 1HHHA 1WJ3A 5DJYB 1FZJB 2GK0B 3SE4C 4H1LA 2BDNH 4Y16D 3JT0A 3RUGE 5LUMA 3OKKB 2DYPB 2ALWA 1BAFL 4LFHG 3II1A 4GI9A 4XXCA 1RI8A 4NNYB 1XF2A 2AC0A 3AG1B 4FS0A 4WNSA 5JHAA 2W60A 3IMVA 1V3MA 4S11A 3TN0C 1UFGA 3U0TB 3AM8C 1EV2E 2AEQL 4G7RB 1J1PH 1Q9OB 2JJTC 3FQNA 2FQGA 3B3BA 2ZYIA 3IE4A 2IANA 4WUUA 5DI8A 4PJ9B 3HZYB 1AOHA 4LAQL 1AZNA 1G7MA 3A0OA 5TDPB 5B3JE 5I19L 4WFHE 2I85A 3HRZC 1W8NA 5E8DH 1AGDB 3H3BC 1UKQA 4GKOA 4HA1A 1A6ZB 4XX1G 5IHWA 4CSTA 1E2WA 2H2SC 5BO1L 2EIBA 1Q9LA 2AQ3A 5D2NA 2QVTA 3OXSA 4QF1B 4UZSA 1J5IA 2ERJB 4UT7L 4J3OC 1O7SA 4S1QL 4I0PA 2ZUQC 1G7QA 5E7BA 1QSED 1EO5A 1NDTA 4G8IA 2AANA 3HE6C 3SKNA 3CMOH 2H1PH 4P9MH 3P0VH 2VXVL 2ZJSH 3FU8A 4W9CC 5D72H 2NLJB 3AGVA 3M1BB 4MSWA 4R83A 3GUTA 3RTLA 3QPKA 2P26A 4BRVA 2KZ1B 2AXWA 4DAGH 2AK4B 2BVYA 3QT2A 3O3BB 4ABUA 3PL6A 5D1XD 5DO8A 2GG1A 5C3TA 1EEYB 5IT2L 2OTPA 5IJBC 5D7LA 1U93A 1TJHL 2YGQA 5FM8A 4GQ9L 1FL6B 5DD5H 2XZZA 3TFKC 3FCSB 1HZKA 4QHLB 3FHQA 4LSPH 3UJIH 2ICWB 3QFGA 1UJ3A 4JRLA 4X6DE 1HNFA 1GCFA 4FFVC 1V5JA 3LN5B 5C0NC 5LQBL 1CD0A 4X9FA 2VM3A 4NQCB 2XQYG 3NIDE 4KRPD 2DOCA 3W9DB 2UZXA 4Q6IA 1DQQB 1FSKB 3QJQB 2ARJB 1FG2A 4KX9A 5L2KE 1FC2D 4K73A 5DDHA 4N8VA 1U8LB 2HP4A 3JUYA 4FULA 2RIKA 1JGEA 3IJEA 2MKLC 2OCJA 5E08L 1NBQA 4TSAH 4NO5B 3QO0A 1YEIH 3RWDA 3UTSB 3WUWB 3BZEA 4XN4A 3SO3B 3BHBB 4BJLA 3V4PL 3D69B 4GBXD 4L1LA 1IV8A 1IC4H 4U1HB 1YEKL 3NQIA 2FL5B 3QCVL 5HJ3A 1CFVL 2ZYHA 1D6EA 3CLEL 2B7DT 2YN5A 2FEDD 2HRHA 2W9LA 4FL4C 3ZXAC 3UG5A 3ULVC 2VISA 2I7OA 2A9NH 3D2UB 1SVZA 4YDIH 5GGQH 4MD5B 5I24A 4LASH 4IGBB 4NPJA 4Z3FA 5DD1L 2YUVA 5L9DH 1KCRL 1LP9F 3OB0K 5FV2A 4HOMA 4JEGB 3US0A 1KBGH 3P3TA 5AW9B 5I1JL 1JZIA 2J8UE 1P4IH 3IJ7A 4N5UA 3QZWG 2N3JA 3MRCB 4JKMA 5BZDA 1H3VA 3ZR5A 3MV7A 3AG2B 4HJGB 4B3VA 1AZZC 4PWJA 2ZUSA 2J2ZA 3S35L 1KTBA 1GY1A 3ISRA 3KPMB 3OZKA 4KK6D 2XTJC 5TH2A 3MLXL 2F5AH 2O6EA 1SMOA 3CHPA 4KXDA 5DLML 2AJ3B 1OTUC 3L4UA 2H3NA 2GUOB 2YD3A 4Y8DC 3NA4A 2DPKA 3S97C 3LMJL 3SO5A 3NJXA 5E5RB 2F19L 3RTQA 2BIOA 4IHOA 3T3PF 3KNBA 5IM7A 1AD9B 2XA8H 5DZLA 1E4XI 4Z95L 4APQC 4W9LC 5IB3B 4IBYA 4HHAA 5DGQA 3KGSA 1YEEH 4I7ZC 4XCNA 1HKLH 3QJVB 3UH8A 3BJ91 1CICC 4YHKH 4AMXA 1KPVA 4WFED 2GJ6E 4TTDD 2P43B 3OZLA 3CLFH 4QHUB 4RAVB 1F3DH 2EILB 4DQAA 3L95B 3QWNA 4U4BA 2GEQA 4YO0A 1IE4A 5ESVB 3OAUH 5FW7A 2HG5A 1PLGH 4NZRL 3ZE1E 2WTOA 3CBRA 4Q0XH 4Y5XA 2OP4L 4K94H 4R4BA 3I74A 2QPFA 3MRQB 4FJ6A 5GGRB 4G6JL 2WP3T 3TBSB 4ZMNA 1X5XA 3RKDD 3RVUD 3FB6B 3LKQA 5DHYA 1MQKH 2IWFA 3QC5X 4AIOA 2ISDA 3EDDA 3QUYD 1L9QA 2H0EA 4Z7UA 1NJ9B 1XTMA 3L9RA 3H9ZA 4XP5L 3MRRB 3EJUA 4FXGA 4BXVA 4GG6E 3OKYA 3AU1B 4F93B 2DWEA 5DUBB 5FXCH 5EULV 3HHSA 1Y7VA 2NX5B 4G80A 4FTVE 2GQHA 3PFQA 4KQ3H 4ONGH 5T5FA 5DS8B 3WFCH 1K72A 3DUHA 4W9GC 4L29A 3RI5K 1AGCA 1ZTMA 3HVDA 1AG6A 1R6VA 3E6FA 3WJJA 1HXMB 2J1WA 3B5TA 3ARGC 4BDVA 5KUMA 5CP7B 2MCMA 3E0GA 3UBXB 5J0BA 5J1TC 4JO1H 1QPPA 3WTTA 4PTUB 3WE6A 3CSBA 4GEJA 1HL9A 4JFPB 4L8DB 4ZG1A 4Z0BH 4KZCA 4GAFB 5DCCA 4YXKH 4H1LH 1WP6A 4NERA 4XI5D 4EDWL 1MWAL 3T77A 5I74C 5L8LB 2QL1A 5EEXA 2FBOJ 1USZA 2XWDA 3FTGB 4JM2B 4RA0C 2WP3O 3GBNH 3GUFA 4WNQA 5I73B 3WO4C 1XSKA 3KWUA 3JWNH 3VFPA 4XPGH 4JFDE 3ARRA 4ZNEA 2WOBA 3NTCL 1YEGL 4GRMB 4X6CF 1CURA 1TKWB 3G08A 1IAKB 1NCNA 5I8EB 2Z7WA 3V6FB 4W9JC 1RK1B 5DK2B 4Q4IA 3NSFA 4IOFD 4Z7VE 3FU7B 1R17A 3Q5OA 4NZTH 3L48A 4LQFH 1SDYA 2B14A 3ECUA 3QUXD 4G43A 4PVNA 1IO4C 1EFXD 4NN7C 4JDEB 3VMNA 4OSUH 3L3JA 4A6YL 2H41A 1MXDA 2CHDA 2WTRA 5GGVH 1NANI 4KJYB 3X3FL 3C6LC 4HU2A 3WHXA 2CQVA 4Y88A 2XBTA 1QP1A 1KCLA 2R27A 3CX5J 3IU3A 1S7UA 3LQZA 4J4PC 3H9HB 3DO7B 4IOIA 4PI0A 2XKNB 3FTUA 3MODL 1OPOA 1FFOB 2H47C 4QOKD 3WNOA 5AYTA 3S8WA 5T8IA 3RUGB 1OOWA 2F53E 2Z91B 3H42H 2VLKD 1NIDA 5J13C 3VB8A 4RWHA 5L4JA 2Q0ZX 4AJWA 4JZNA 2VSMB 3RNKA 2WO4A 1D9KC 1IAIH 2X4RB 3O2WL 1TCMA 4L4JA 4U1JA 1TQBC 2LFEA 2NY5L 1XL6A 1N6UA 3BWAB 2FBJH 1VENA 2JI2A 1PG7X 2W65B 4LU5H 2NSXA 2FWUA 1X5FA 1WFMA 3POCA 2L3BA 1RZQA 4OB5H 5GRVL 3RDJA 3P4NA 4GRLC 1TTAA 3DVNA 1OCWL 1T4WA 2ZKYA 3K6IA 3JWOC 3BQVA 1BQSA 4DESA 3TT1H 1XVSA 3QXVA 1FZMB 3ECBA 4XBGA 5CZVH 4QY8B 5IMKA 4WAFA 1IGYB 2EDWA 4PJBF 1AZRA 5INCB 3F7VB 1IBGL 1P4LA 1FGVH 1KEGH 2PETA 3MFFA 1Y6NR 3ZE0E 4AV0A 1PAZA 2R2BB 5FGRA 2JCCF 1OOAA 4ONHA 2C1PB 5AOIA 5DRNA 2EO9A 2ITDB 4KJQD 4MJJA 2ZOOA 4JFXB 4UIMB 2WYHA 4CGTA 4I1RA 2GTZA 4FQQA 4P4RA 1BP3B 3AUVA 5CHNB 4F33A 1RUAH 2VAAA 3CBJB 2JVUA 1Q72H 3GBEA 3FO0H 1ZLSL 4EI5B 1ZIBA 4LIQE 3L5WB 4FLOA 4HUWA 4BFBD 1LE9B 4JFYA 5AVXB 4ZUTA 4HMEA 1PKQE 2IALB 4WI3A 2Z65C 4WGKA 3W5NA 1MCOH 4PI2A 4S1RL 3E6HA 1UQSB 2WBKA 1AI1L 4YSSA 3VXMA 2XJLA 4OH2A 5CJ5A 3EXJA 3VFWA 1P7KA 1S3RA 4X6DB 1G6RL 5C0FA 2JKRM 2BOCA 15C8H 5D1QB 4F20A 3IAGC 3QIBA 4YX2H 1G1CA 1ZLDA 4AXWA 2ORBL 3RAJL 5KW9H 5IKCA 1H3WM 5JPMC 32C2B 4JO2L 2QEJA 5B7MA 2CG9X 4NRZB 3LKNB 2NY4B 4LNRA 3FT4A 5J11C 5L2KB 3AY2A 3UYRH 2DICA 1LO2H 2NY7H 4AZ8A 3FTSA 3G5XB 5IHUH 3S98A 1L0QA 1AXSA 3SQOH 4ISVA 3V5DA 1KNOB 1NFIA 4KK5C 4N26A 3VXRE 2ZPKH 1KTLA 4K23H 3JXAA 5IB2A 1R47A 1KIUB 2XN0A 3VGBA 4TMPA 3VO0A 4FN0A 2DV6A 1KT2A 3HG5A 1HWGB 4X7SL 3FUEA 3VD2A 2RFXA 2NXYC 3B9VA 3SGKC 4ENEC 1GZPB 1NIFA 4TUOB 3RX5A 2BW4A 4XE5B 1A6TA 1AY1H 2CALA 1ESOA 2PMZA 5HGHB 4P5TA 2YC1A 3T1WA 1G9NL 1RURL 2CLRB 4MFHA 5HTSA 4K8RC 3IETA 4MCYA 4R26L 2WM0A 2Y23A 3D6GA 4YBQC 2DKUA 5IG7A 2KLSA 3ORJA 5GSRB 2VW4A 1NGXB 1HXKA 1NKGA 2J8UB 4ZO8A 1IGIL 4KFMA 1A8ZA 4NHUB 7TAAA 1A7PH 1MJJB 5SWZD 3PABB 4FFWD 3ATDA 4YFLI 3AY4A 4D0BA 4PWFA 5CINH 4H88L 1RJLB 4UM8B 2UVEA 3HI6H 3GWJA 3K4DA 5FUCC 2Z31A 4HCRH 3B9DA 5EUOF 4FNUA 1M57B 2ZCKL 3HB3D 2A9ML 1KTKE 3LXCA 3QIUC 1YNLH 3MNMA 1HC1A 3QZOA 5DHVB 5FIEA 1U6AL 3UGEA 2XV3A 4GT0A 3JZYA 3MBEB 5FM5O 3ARDA 1QR1B 1FJ1B 1FN4B 4X99B 5A2AA 3TBVA 4UOZA 3W39B 3EJYD 3ROLA 5T5FH 4BUGA 1P5UC 2Z1KA 3CSFA 1AP2B 4G7VH 4G8EA 2IQ9L 2WZPD 3K0WA 3JVGC 5C0BA 1D5BB 2GJ6B 2IV9A 3AW5A 1T83A 5IP4A 4K5PA 1HCZA 3KCWA 3HUJF 3ARFC 1B88A 1NCBH 3N85L 2A7BA 3KPOA 5DTFB 4U3HA 4ZRGA 1EERB 3ZE1B 3UTTD 1HCYA 5TQ2L 2CKBL 2X4QB 3U9UA 4U3SA 1OALA 3BWSA 5H37H 3AQYA 1TVHA 4R84A 5HHME 1F6AA 2Y7QA 1OIOA 2C9UA 1Z9OA 3AABA 2HT2C 4YHIB 2X1QA 2MMXA 2GY5A 2O6FA 1JV5A 3ZGHA 3BGFB 4I1NB 5EF0A 4L5FL 3SN6N 4NZUL 3G04A 3WIHL 2W0KA 4BE5A 1Z3GL 5I15L 2GAZA 3MBXH 3VXPA 4GG6B 1CBVH 2CJUL 1PZAA 1BD2A 4PW3A 3H85A 5CZKA 4Z7OE 5I2IA 2IBBA 4ZXBC 4KXCA 2XTSA 5F7NC 2Y24A 1DLFL 4ZO9A 5JR1H 3HG3A 4R4FH 3EYVB 4EN3B 4JRYD 1UURA 1I7RB 1I8LA 4FKKA 4J3TA 4E9TA 3ZZSA 2WWOA 4MA8L 3CDGA 4G7YH 4PJDB 3SCMA 4KVPA 1G4RA 3R18A 5C07A 3NFSL 1QFWI 1OKEA 3TC9A 2CUMA 1WITA 5I71C 1JMXA 1R33A 5ADOL 5I75B 3JV5A 3WKML 5L0QC 1FO0A 4N2OA 4BH8A 2CM5A 5B1BB 4OAWA 5AZ2H 1KZYA 3TBWB 3WJLA 2B4CL 1EHXA 5E4EC 3LKRB 5F7EL 4GXVL 1KCSH 2WKLA 3P9MB 3BW9A 1FL3B 1JRHH 4P04A 4U0QB 2F1AA 3LB6D 4PEEA 1VB9A 4JFDB 1P1ZB 3IBOA 3GSOB 2X4SA 1KXTB 2NY0D 1UXWB 3N91A 3TFKD 1XQ4A 3L3IB 4J8RB 2B0SL 1XBDA 4Z7VB 1DQDL 5JW4N 3FTXA 5EOQL 2DQFA 2HLEB 3KWWB 2HRLA 2IV8A 2XVBA 3HC3L 5C0ND 4IOSA 4XPBH 4A7TA 1CB4A 2OL3B 1RKRA 2YRPA 2Q2LA 3DURA 3EOTL 1Z9PA 3F84A 3OG6B 1KTJA 2Z92A 2VZTA 3G5YA 3LTVA 2JIXB 1AQMA 3CXDH 2VLRE 5D5ME 1BOGA 5JOPD 5AW6B 5ABDE 5JW5A 4A2HA 1KTDA 3IMTA 4LSRL 4HGKC 5CLTA 3HKFA 2GB2A 4AQZA 2WGXA 1J7VR 3KPQB 1AH1A 1WUNT 3ATEA 1WICA 4K3DL 3TZVB 6PAZA 4ADIA 2F53B 1SDDA 3O8XB 3TU6A 1HI6A 5TTRA 3TJEL 1M3JA 4XMWA 1IQDA 3NACL 5JPNA 4GAYA 5I8CA 4HSAC 3P11H 5CILL 3NJJA 4N0CC 3ULVD 3U82B 1SGKA 5LAXA 1W9XA 1EJOH 1LHZA 1S7WB 4F58H 4F5CE 2E6PA 4WEBL 5EG6C 4Z78A 1E3ZA 1WFOA 3DC0A 4UT6L 1MRDL 1FCGA 3NABL 4DQOH 1SXAA 1CFTB 2IPTH 3L1EA 2YMTA 3OKDA 4M7LH 1T0MA 3L4TA 3LRKA 3ABGA 4G6FB 5DEFA 2QLVB 4L4TD 2D3VA 3LPPA 4ZOEA 4WEEA 3MXVL 4X5WB 3REVA 4Q97A 3HMWL 4PJAE 4LCYA 3FUJA 1EDHA 3ZE0B 4HUKB 1QI5A 4QRSB 4KK9C 1BX2B 3JYBA 5KVFH 4M5TA 4F7MB 3QDME 3VGAB 1OTUD 3A47A 3JWDL 1D5MB 1YAIA 3FRUB 1S7XA 4A68A 3D39D 1FAKT 1ZDSA 2HJFA 2YA0A 2Y7SA 4APQD 3QXUA 1PKQB 3OZ9L 1PZBA 4TKWA 1LD9B 1XGQA 3NPSB 1K3IA 1CICD 3MKKA 5C0IB 3GSRB 5ESQA 3L2LA 2R8SL 2BFVL 3LNFA 5I0WA 1NFDB 2HVBA 4NGHL 4ZFOB 3FL7A 3BAKA 4WEMB 3GIZH 2X40A 2AI0H 4Q52A 1YVLA 2E7LA 3B56A 4XB7A 4XNMA 3GXUB 3P3UA 4YHPB 3OHXA 4F24A 3SYQA 1KPRB 4CRPA 2Y2TA 1NUNB 1PEWA 1TTBA 2WQUA 5HHPA 1JHKH 5EHFA 4NM4L 5E1GA 3UGXA 4F7PB 2Y06L 3ZYJA 4GAGH 2EDHA 4Y2DA 5KJRH 5EIQA 3BVXA 4NUQA 3MNDA 1L6ZA 4X42A 1F56A 1RCYA 3VXRB 2WIMA 4EDXB 5C8JA 1XWVA 1BYNA 3N1GC 4BK5A 2OW7A 1MFAL 2VMFA 2FHFA 1WFJA 4KQ0A 1LXMA 3TWCH 4NUMA 5BRPA 1IAIM 1PAMA 2P28B 1F41A 1MAKA 1RULL 3FN0H 1J05B 2B8OT 4L8BA 4X0NA 4IEFA 5DRZA 3RGVC 2L7EA 3O3EB 3TJHC 4OZHE 1XCTA 2ESVA 4Z76A 1PYWA 1A4JB 3QE5A 3S4SG 4LCUA 1CDHA 4HU8A 1UT1A 4UF7C 5C9KA 5J9PA 4JFFA 1KJ2L 3UXFA 2WLLB 1M05A 5JA8B 2KH2B 4HOWA 2WINA 2CPCA 3FB8B 3MJ9A 3V4LA 4FZEH 1DL7H 1IVTA 4ZZFA 3SGJA 1FE8L 2B1HL 3WOVA 4AVHA 2HCZX 3VE0B 4YSUA 1A4KA 2AJYL 1AQKH 4OIBA 1JK8A 3B43A 2EIEA 4YIQB 3VXQB 4EZKA 3GYRA 4KJPD 2WIIA 3BH8B 3PWLB 1PZUB 3MV8A 5JIHA 4BZYA 5C0CA 5TK2A 4DEPB 4Q9RL 4RGNB 4NC0B 1ZCRA 3TNMB 3UTOA 1DBKH 1K4DB 1K2DA 2CRYA 5C7XL 4DVBB 1ZGLA 5EU4B 3UTZB 3D3VE 2Y5TA 2IMMA 5AZUA 1HINH 1NDMA 4K5NA 4PJGE 1XD0A 3V5HA 4QXVA 2ICEA 4PYHA 1NL0L 2I69A 2XHNA 3HG1A 5D4IA 1LEGB 1WBXA 3C6LD 1AHKA 1QVOA 2JKTM 3BD3A 3SJVD 3MV9A 4K4KA 4CADB 2OTUB 3QNFA 4YE4H 3DVFA 4J4PD 2ITCA 1OPGH 3CXHK 1ZA6B 2CSPA 3C60A 2YD7A 2P8LB 4GAJH 4AEIL 5BRZB 1BZ7A 2ZF9A 2B59A 2BSTA 3PQYA 1YEDA 3EYSL 4DKEH 2GTWA 3I6GA 2I60H 4LKCA 5CEYA 5T3ZE 4U7KA 3MNZA 3WAKA 3QFDA 4NQUA 1M6UA 3S5LG 1D9KD 4CMHC 5MEQB 4RX4A 1CZ8H 5HHMB 5E2TH 1F4WH 1QQDA 5GGUA 3CZKA 1JGUH 1DBML 4QO1B 5BOZG 3WKYA 5TDNB 4GRLD 1Q1JL 1DO5A 1A2YA 1A3LH 2D7NA 2OPCA 5FX3A 4OLWH 2OXHB 2X7LB 4NB7A 4JKLA 3VQ2C 1TU2B 3WFHB 2C7UA 3VDAA 4NO0B 2VL4A 2BDNL 2UWEF 3OF6D 4Z7OB 5DT1H 3KPSE 4Y2OB 2F8XC 3F85A 3QULA 4HEMA 1AGFA 1GGCH 2EQDA 2VC2B 3CHOA 3OGOE 2K8MA 4HUVB 4MNQB 4U1KA 2EYRA 5C2BH 3O6FB 4MA3A 2ZYSA 1JD9A 5EUKA 2EDBA 4U1LB 2VN4A 1JHTA 4L8SA 4NQEB 2W5PA 2HWZH 4YWGL 4AQ1A 3VTTA 1KULA 5E6IB 3T0EE 1XF4B 2AEWA 3CV5A 2YD1A 2PXYA 3ASNB 2CBQA 4PJ7E 1BQHG 3X1EA 3V0AC 5E8DL 1Z6JT 1KGUA 4N2FA 1J9SA 3HC2A 2AJUL 4NRYB 1EEZA 5E03A 3V79C 1SXSA 3MRLB 4OGXH 4JGUA 2J5LB 2VXTH 3P30H 1P6AB 2BY3A 3OWEA 2Q76B 1JPGB 3IDXL 4GW4B 4O02H 5DJ8B 5IFAH 2X1OA 4TQPA 4DPBX 1E9OB 2P5WE 3C87A 2H1PL 3I50H 4PMFA 5CGTA 5LG6A 3P0VL 2VWEE 4ZAKB 2ZJSL 5D72L 4K2UL 2VW7A 3O2DH 1OSPH 4K9EH 1A3RH 4DAGL 4A7SA 1F97A 4PG2A 5HYIA 5IQMA 5D5MB 1YCSA 4YDVA 4ODBD 4DO4A 1OAZH 1SFDA 2P8PA 3SDCB 4JL2A 3T2NH 4KY2A 5DD5L 5DD3L 4KK5D 2Z4TA 2OZNA 2NTSP 3N1PC 4QCIB 4LSPL 5IJCC 2V5YA 4HXBH 4XP4H 3QJSB 5DHEA 4QUOA 5L4IA 1N0XH 1SYVB 3VXSA 4ENED 1PDKB 1KEMH 4C56A 4MXQC 3V0VB 3BP6A 3WMSA 3O4LD 3IJSB 5DS2A 2FJHB 5CMAB 3AG4B 4HUUA 5C9JB 3QIWC 3RQ3A 1PCXA 3G5ZB 4HT1H 3BLBA 5DS1A 5F0MB 1H5BB 3I75B 4HOXA 5A6MA 3RPKA 4H5SA 5KOMC 1A5FH 4A7QA 5L7XL 3B2VL 1YEIL 3NUKA 5D93B 4IRSD 3L7FB 2F54D 4HJJH 4TNFA 4YBQD 3SDAC 5HYQA 1ZS8B 3LEXA 1B6DA 1B4JL 1IC4L 1HHKA 4PJAB 1JF1B 3OG4B 3N1FC 4NFCA 2R1XA 5I1EH 1MHHB 4QPEA 3VI3E 1RV6X 5TD4A 4W9KC 3DOSB 4LEEA 2FZ3A 3GRWA 5AAWA 3UZQB 5IQ9A 2K9FB 4P59H 2DH3A 3VI4A 3QDMB 1FYTA 4O2FA 2JE8A 3GZOA 4I5BB 5D7IE 5KSAD 1D7CA 1BZEA 2HH0H 5GGQL 4LASL 3KLLA 3DVGA 5L9DL 4I3SH 1KBGL 5FYJL 1P4IL 2FO1A 1WC7A 3I3EA 2ZOKA 4IKLA 5F7UA 1OAYH 2L4OA 3DBSA 1S6NA 2G30A 5B39B 4L5FH 3LXUX 5IZ7A 5HHOA 1TJXA 1WFIA 2BWDA 2IQAA 2MPAH 1GTNA 2O5YH 5HDLA 3Q2VA 1H3TA 3GMLA 3KYOA 1Z9MA 2F5AL 4J3UA 4NM8H 4GINA 4RGOL 1PG7H 4HS6A 1ZPUA 3KYKH 1LJMA 1GSMA 1G7PA 4OCMC 5GISH 3RVTC 1KXQA 1TZGH 4FD0A 2XDHA 1QLEH 4YDLC 2L8AA 1JIBA 2XA8L 2JKJA 4KKLD 4JFEE 3UADA 1T5WB 2DM2A 2A2QT 3IS1X 1YEEL 2HT2D 2NNCA 1HKLL 2Q6WA 1OWRM 6PCYA 2E9WA 2R51A 4YHKL 3S4SB 2OM5A 2E8YA 1DBAH 4RQQA 5F7YC 3ILDA 5D1ZD 1ZT1B 4J7RA 4N0FA 3QXTA 4PWIA 3EYFB 3UGUA 5A2FA 4WWNA 4X8CA 3PRZA 2CDGA 5LO7A 4WEUD 2H32B 4OJYA 5KVGH 5GS2H 4ZXBD 2FJSA 3OAUL 4Q89A 3IF1B 2HX9A 4S1DD 3VJ6A 3LX9A 4ZTPL 1B0GA 4S10A 3HS0B 4JREC 4YSPA 4OZHB 4Q0XL 2MOVA 4Z3IA 4LRNH 4TXVB 4K94L 1K3ZA 1F5WA 4PJEA 4NXKA 3FOLA 1U8OA 1A6AB 4FFTA 3CSYB 4PRHA 4IIQB 1MQKL 4AEEA 1JCVA 1NLBH 3HBZA 4NQSB 1MLCB 1P1VA 2OW6A 1U33A 3KJ4C 5B8CC 1C5DA 1GZQA 2W0FB 1MVUA 4B53A 3Q1EA 2R9HD 1V7NH 3MREB 1PPIA 2CIKB 1O7DE 4X5QA 3O4OB 4IRZA 3RNQA 4KQ3L 4ONGL 5CSZA 3WFCL 5DC0A 4LLMB 3F7YA 3O3DA 5TGBA 1RZGA 3BZ5A 4HIEA 3L3OA 3L3HA 4DPAX 1UATA 4HH9B 4JO1L 3SPCA 1ZT7B 1YC7A 2ADFL 4HIHA 4DK6A 1SLVA 1G7LA 3L7EA 1OANA 1WGVA 3E8UH 4Y1AD 1IC5L 2HUEA 4PJCA 3ALXA 4Z0BL 5E00B 3RGBA 1AR1C 1JF5A 1PZDA 4PJGB 3BAYA 1CFNA 1NAKH 4X80L 1DZ0A 3HAEG 2WW8A 2PW1A 3HNSH 5BRQA 3HE7C 3K8MA 2DDQH 3GBNL 1T5KA 5T3XH 3BYTA 3EGSA 1HQRA 1YMHB 2B5IC 3MZTA 4JRXD 3D85B 4BFEA 1XGTB 4WQOA 2BSDA 5CO1A 4NKQB 4XTRD 4X5RA 2VTFA 3OXRB 5KOVC 5I8OL 1TVBB 3UBHA 1AGEB 2A6IA 4XO8A 2R0KH 1WISA 4DERA 1USQA 3MYJB 4MDIB 4WGWB 3H9SE 4GUQA 1INEH 1JK9B 2OR8A 1MUJB 2UZPA 1QA9B 1QR4A 3VTAA 1GHFH 3CXFA 1Q9WB 1U8HB 1UM4H 2C3XA 4GNKB 1FA4A 4NYLA 4N0CD 1U2YA 1ZXQA 1HHIA 3BAXA 4HP5A 1REIA 2VZVA 2G60H 2Q87A 2PO6B 3NDZE 5I5IA 4MA7H 4X4MA 1W6LA 4ODVH 4FG2A 4BWWA 1JGVH 4AOFA 4PCSA 4PRBB 1UZ8A 2KKQA 3ARVA 2HPOA 2RHEA 2N01B 5D96C 1IM9A 7FABL 1T0NA 3O2VL 3QISA 3SYCA 3QEUA 4K3EH 3H42L 1T04A 3KPSB 4GMTL 5EOTB 1LEIB 3RVVC 1ODAA 2OYLA 1BZ9A 1IAIL 2VO5A 4ORZC 2FBJL 5I6KA 4MJ4A 3EAKA 4LU5L 3VRIA 4KK9D 4LT7A 2Y6TE 3ZR6A 5C08E 2XA3A 1JERA 1R1CA 3T0EB 2CKNA 3RIFF 3J27A 2Y1VA 1A3ZA 3GXPA 4FDWA 5I6XC 4PRPB 4PJ7B 3FO2A 3A6BH 3TT1L 3GINA 1F1DA 5DK0B 1P7HL 4RGMC 1WVZA 2D0GA 1D5RA 3VFMB 2FNBA 2X4NA 3NEEA 1KEGL 5TE7H 5CCKH 5GRUH 3IE9A 4K7PL 3DUUB 1KZQA 3QZPA 3EHBD 4JG5A 2P5WB 1VJSA 1K6QH 2X4OB 3WEMA 3CFKB 4AQAA 1RUAL 1NFKA 2H6PA 1Q72L 4Y5VA 3FO0L 4B41A 4E42B 3AMLA 3D18A 3HFFA 3B9KC 1I85A 2EDMA 5DD6B 3F6JA 4Y4KB 1KXVC 4OFYA 3WIFA 1NBYA 1JN6B 3QNYB 4ANWA 1I8UA 1MCOL 3QUZC 1S78C 4G1MA 4JRFA 2WZAA 1LE5A 3WSQL 5KS9A 1HYSD 4UT9A 5E6RB 2EKSB 3AJ7A 1L7TH 5DZNA 3JV4A 4TS6A 4YK4C 4CDHA 1SXZA 4FQLH 5ICYB 1MJ8L 2WQRA 1F18A 4N5ED 3MRBB 5BZWB 4OVVA 3SDYH 5GZNC 15C8L 4U1NA 2ZWZA 4TRPH 2A6JA 4Q2ZA 5KW9L 4OFIA 3D0AA 4NQXA 1SHXA 4PM1A 4PVMA 1OP5H 3TJHD 3FW6A 2IAND 4WUUD 4JY6B 1N6QH 2A74C 2JB6A 3U0PB 1LO2L 2G5UA 2NY7L 3F6LA 4N3TA 4FLSA 5IHUL 1WWAX 2ZCLL 3B34A 2ZX7A 4HKBA 3RWHA 4TTGA 5E9DB 3GSNA 2VR6A 1IC0A 4RFOH 1YUHB 1VDGA 1KJMB 2VMCA 2ZPKL 4ODXA 4K23L 2OMUA 1ITCA 1DSFH 4KMTL 2DWDA 4P46A 4ABVA 2OMZB 2DB8A 3U4BH 5AW4B 4MAYC 2XTJE 2V0AA 5E7FA 3U2JA 1T80A 5L4FA 2K6ZA 2HVJB 3NH7H 5KBMA 3ULSB 2QVMA 5J56B 1RUQH 2LU7A 3BKJL 2ZCHH 5JORB 4AKOA 3VI3B 4P23B 4D0DB 2HT4D 2CXGA 3HBQA 1P7QB 1DN2A 3MLZH 3B2PA 1MFNA 4HOZA 1LWHA 3UZVB 2BY1A 5D7IB 4N6QA 1YG9A 3U0TA 2QKIB 2VM9A 5D7LD 2XRAL 3QCTH 4JB9L 4EQ3A 1MFDH 3W5MA 3L6FB 1QW8A 4LHUB 1J1XH 3BIBX 2YGPA 4MZIA 5I5JA 3A6CH 2XBZA 3FQUB 5TDPA 1F6LL 3EO9H 4QD2E 3GMOB 1A7PL 1AGDA 1DUZB 1CQKA 3SQBB 3VWKA 1I1CA 3ZL4H 1YYCA 4PTTA 3Q9QA 5CINL 3O3AA 4NN6B 4QF1A 3HI6L 5BW7A 1NAMB 4QRRD 1RHHB 4OD2B 4W6XB 4FGMA 3U7WL 2CGYA 1YNLL 1U8CB 4Z7UF 3VXUE 2MCPH 3B1UA 3ARUA 1ND0B 3CFBB 4ALAH 4RFNC 5T5FL 2WXGA 2NLJA 2F15A 5CN3A 2VDRH 3EBGA 1M71B 3OKOB 5AEAA 1CS6A 4JHZA 2AK4A 3GDBA 3O3BA 3PPEA 3M45A 1GYVA 1VFBB 2PYFA 1EEYA 4OV6F 4LLUB 2X9XA 3BDYL 3DETD 3OJDA 4ZPVB 1NCBL 1FL6A 1Z7JA 5F0JB 1FIGH 1NGYB 1L9PA 2QV2A 4OI8A 1TQCB 1UXMA 1VEMA 2XN2A 1DFBH 1QWNA 3FBKA 5GHWL 3FCSA 3T4YB 4NT6B 4QHLA 5CR8A 2ICWA 2IGTA 2RGSA 3LN5A 4YFDB 2EEXA 4P2CG 3LN4B 1JWMB 4NQCA 2D03H 1M6OB 4P3WA 3CWGA 2O61B 2G75B 4U0RC 3W9DA 1FNEB 2DW5A 5AW0B 5AW5B 2K0RA 4AQ8A 4F57H 4LE8A 3VD0A 2ARJA 2XETA 4FABH 3W56A 1QRKA 3SDDC 4QEGA 4UV4H 3E1F1 1U8LA 3MV7D 3LRLA 4UB0H 3KXFA 1CBVL 3QFJE 3NZHH 3KZ8A 4QRQA 5HI3D 1KB5B 4M6OH 3PIQA 4NO5A 3QWOA 3GBMH 3VG0L 3UTSA 3WUWA 5KWYC 3QUMB 1SEQL 4R4FL 3D69A 4FAAB 3TF7C 5T1DH 3RTQD 2XNAB 3W82A 3FRPB 4G7YL 1NMCC 2XWRA 2FIRT 5LBGA 2RH0A 2FUTA 2YWZA 4KNUA 4Y4FA 5DO2C 2WJ5A 4N85A 1H9VA 5T1KB 2WXHA 2XLLA 5FA4A 3FQRB 3D05A 6TAAA 1SEBA 2APBA 5AZ2L 5B3NA 3X1GA 1KCSL 4MD5A 4IGBA 2RR3A 1JRHL 2EINB 4XMUA 1G94A 3KW8A 4YSTA 4NEHB 2BMKB 1EZSA 4RETB 4YUEH 4KZ0A 1MG2C 1D5IH 1I1AC 3NMEA 3W37A 2JQZA 4R96B 2KDYA 1OAXH 3QB7C 4HIIB 4HJGA 3TA4D 3TN0B 1N7MH 5FYKH 3KPMA 3H9SB 4R7LA 3OKEB 4JPIA 4P5RA 4XPBL 3VFTB 1M56B 3F3HA 4L9DA 4YE0A 2AJ3A 5I9QB 4WVRA 3W1ZA 2GUOA 5I0DA 5K9OB 5GGRY 2FATH 3CMGA 1WA0X 4P9HH 2NXZC 3QIWD 3N2JA 1BYPA 5J6HB 2Q8AH 2DQCL 4BFFA 4KQ4H 2PYED 4AY0A 1MPAH 4I4WA 2VJ0A 1FNFA 3BEWB 3PXHA 5CBAB 2ZOUA 3GPSA 3K6DA 5A2CA 2WSDA 5IMLB 3KW7A 4XN9A 2ICES 4E9YA 1QASA 4CL7A 1MIMH 1PFOA 2MH4A 1T1XB 3HE6B 4RAVA 4YGVB 5B1JC 5HDBF 3L95A 3SKJH 2CBOA 2R1YA 3ZK0A 4BKLB 4XC1H 5ESVA 3P11L 5GRJH 1LO4H 3IN0A 1W8OA 5A16A 3D07A 1E4HA 1DQLL 4C8XA 1KJ3H 5C08B 3K6SA 3ZTCC 1QI3A 5DVKA 5JIDA 1EJOL 3NPZB 4F58L 1RIUH 1AGBB 5IVOA 4IW4C 1GYCA 3GRBA 3TBSA 2ZIDA 4LPYA 3TX4A 4P3DB 1UWFA 4DQOL 2FECL 3FB6A 2BLFA 2IPTL 3T71A 4M7LL 1G7HA 2QZQA 2XG5B 4L9LC 2G5BB 2Y5QA 4JAMA 3RWCB 3WEXA 3P4OB 5ADPL 4ANKA 2XI9A 1RHFA 4TOYH 3AU1A 2BS71 5DUBA 4XBPB 3UPRB 3KMDA 2VDQH 1SRDA 2B3IA 1ANUA 5DS8A 1DEDA 1Y1UA 3NIGE 5KVFL 3GSNH 4PV1C 4NLAA 5TE6H 1IL1B 1Q94B 1X9UA 5GXBB 3EFFB 3PXJA 2Y36H 4GRWF 4IU3A 5IUCA 5E8EB 1NC4B 3LSOB 2VMDA 5KBDA 2IXQA 2ZUTA 5DLLA 3UJTH 2R4RH 1FNHA 2X1XR 3OAZK 3VWJB 3N41B 4F80A 2WQ8A 2G3MA 2ENYA 4PTUA 4E41E 4BGDA 3VFUB 4JFPA 3DX6B 4L8DA 5JMRA 1RZFL 2HVKB 1W72A 2HXAA 3ZTJH 5C97A 3FTGA 3QZNA 2X2IA 4Y89A 4JM2A 1N6VA 5HYFA 3GIZL 5AVVB 1X7QB 3QJFA 1PU0A 1RJZA 1ZEAH 4FL4B 5AALA 5ACZB 4XH2B 3D4CA 3QQDB 4LCCB 4PGBB 5I8EA 2VSKB 2WLNA 3LZFH 1VERA 2VYRE 3QVAA 3UTPE 4N2EA 3V6FA 1RK1A 1RUKL 1KJVA 2NY1C 3MFGB 3B2XA 5D71L 5DK2A 1I3VA 2WN2A 3FU7A 5CR1A 1JHKL 3BAJA 4P4KC 5CD5D 4ELMA 2W91A 3LZOA 3MLVH 5KJRL 5DUPH 4JDEA 5G55A 4XP6L 2G2NA 3LS5H 1YN6B 2DWSA 5EOCJ 3DGCR 1S7VA 3K72B 4DP5X 2XTJB 2EAEA 2UZYB 3H9HA 3TWCL 2UVFA 4ZMPA 1TNNA 2C1OB 5F7AA 3MJGX 1MCWW 4YBHA 5FUCE 3UERA 3ZSSA 2Z91A 2P5ED 2XZCH 4KK8D 4BUQA 3INOA 2X4RA 2Q8BH 3B7TA 4N1EA 2W65A 5DFAA 1BBJB 4AH2B 4WWKC 3CZFB 3GKZA 4PB9H 3ABZA 1DL7L 4MXVF 4LLQB 1G87A 3PJSB 3VXMD 3WY4A 1JUFB 3MLPA 5JXEA 1KN4H 3HE7D 4X7TB 2EH7H 5FYLH 1AQKL 1U41A 3ARBB 5CFAA 2O4EA 1YPZA 1FZMA 2ZCZA 1KB9K 3QIBD 3SY0B 3SODB 1X5HA 1JFHA 4QY8A 3RB7A 1IGYA 2AXJA 1NH6A 5INCA 4YHYB 3F7VA 4NAJA 3K4ZA 4L2YA 3EOBB 1DBKL 2R2BA 3ILPB 1N26A 5EU6E 4Q74A 2C1PA 3VXUB 1HINL 4PW9A 2ITDA 1J9CT 2FCBA 4YZFF 1C12A 2A9AA 4JFXA 1NWPA 4O4YL 1MFCL 2K6YA 2NYYD 4KO9A 2J6WA 3RP1A 3VXOB 4X7FC 1JPST 3DX7B 3HLKA 2PCFB 4PJIE 4EI5A 1AJ7H 3KL3A 3L5WA 1LE9A 4YE4L 3TCTA 1HIMH 3STBA 5I8KH 4EE2A 1KIQB 4RIRB 2XQYA 3JQOB 1W91A 2IH3B 1XD1A 2XVKA 4GAJL 1UQSA 4XOEA 1C16B 1LM8V 3ARGB 3TP4A 2CO7B 4DKEL 2VQ1A 2I60L 1FO0L 4UM9D 3EJSA 4X6DA 1DBBH 4N2NA 9CGTA 5D1QA 4OQ1A 1B3JA 1CZ8L 1JV2B 1YNKH 2YZ8A 1DUYB 4GKZA 3LRSB 1JGUL 4WTQA 1NQBA 5I74B 3SBWA 2HJLA 3WDIA 2JELH 4ABQA 3E9TA 3QORC 4O2EB 4S2SB 1A3LL 5K33A 4OLWL 4AV5A 1GRWA 4GYBA 5AAPA 1FQ9C 1T7WA 2AGJH 4IMKC 5LGYA 4FA6A 1ASPA 5BZXA 3QFJB 1KNOA 1WE5A 5DT1L 4UIKH 3OB8A 2R2CA 4HCFA 5A6LA 1GGCL 1EO7A 5EC2B 1PLCA 3OX8B 2E4TA 1KIUA 5C2BL 3Q5TA 4F8LA 1E9PB 2VLJE 3ARDD 3WN5C 3PWNA 4TUOA 4NN7B 5IQNA 4AIZB 2HWZL 3MNWB 4L1SA 3MLRL 2W8CA 1DQIA 3Q3GB 1BXAA 3MGTB 4ZDHB 3K1DA 3QZWA 2XTLA 2Z93B 4JPQA 3W0WA 3SJVB 3UC0H 1T89C 5TQ0H 4QRPA 3BVWA 4W93A 4Z7NF 5FDWA 3B9KD 3RBSA 3S36H 4OGXL 3MRDA 2VXTL 1R5VA 3QUZD 2RTTA 4KO5A 4XR8C 1AZBA 4GSQA 1S9VB 2WQVA 4GQRA 4Z5RB 2HAZA 2OSXA 2MWCA 4JFZH 1TQBB 3SE3A 4N2MA 4O02L 1FFQA 3LHPH 5IFAL 25C8L 5GZND 3PABA 3ETSA 1KELH 3I50L 2DM4A 3VM7A 3FUDA 3BSZA 4OJAA 4RAUB 1A66A 3PNRB 2Z7ZA 4JCMA 3ZQ9A 4GRLB 3ZTDC 5K9JH 5SX4H 3TFBA