2EVFA

Structure of a ndt80-dna complex (mse mutant ma6t)
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
303
structure length
290
Chain Sequence
b'VILTQLNEDGTTSNYFDKRKLKIAPRSTLQFKVGPPFELVRDYCPVVESHTGRTLDLRIIPRIDRGFDHIDEEWVGYKRNYFTLVSTFETANCDLDTFLKSSFDLLVGRLRVQYFAIKIKAKNDDDDTEINLVQHTAKRDKGPQFCPSVCPLVPSPLPKHQTIREASNVRNITKMKKYDSTFYLHRDHVNYEEYGVDSLLFSYPEDSIQKVARYERVQFASSISVKKPSQQNKHFSLHVILGAVVDPDGIPYDELALKNGSKGMFVYLQEMKTPPLIIRGRSPSNYASSQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*TP*GP*CP*GP*AP*CP*AP*CP*TP*AP*AP*AP*AP*C)-3'
molecule tags Cell cycle/dna
source organism Saccharomyces cerevisiae
publication title Principles of Protein-DNA Recognition Revealed in the Structural Analysis of Ndt80-MSE DNA Complexes.
pubmed doi rcsb
total genus 86
structure length 290
sequence length 303
ec nomenclature
pdb deposition date 2005-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05224 NDT80_PhoG NDT80 / PhoG like DNA-binding family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1390 Mainly Beta Sandwich Immunoglobulin-like NDT80 DNA-binding domain 2evfA00
2EVIA 2EVJA 2EUWA 1M6UA 2EVGA 2EVHA 1MNNA 2EUVA 2EVFA 1M7UA 2EUZA 1MN4A 2EUXA 2ETWA
chains in the Genus database with same CATH superfamily
4YFLF 3BKCH 3QCTH 1XH2A 4NO5B 3Q6GH 5LLIC 3MC0A 4FQJL 1KDJA 4WI6A 2F8VA 5EMYA 3PAUA 3MFGB 1M9SA 1E5UI 3V2AR 1BVLB 2NY4D 3ARUA 4HXAH 4GT0A 2BIOA 2ZUQC 2N1KA 1T66D 2VC2L 3ZLQC 2IG2H 4K0OA 4JQIA 4KZ0A 4BELD 3T1FA 1IC7L 3IDXL 3B9AA 3UP6A 4BJLA 2XY2A 5JA9A 1QZNA 5H35A 3IE4A 3LDBC 3GSNB 3UP1A 3B2VH 1TOXA 1EH9A 4HZAA 1INEL 5ADPL 2IPTL 5K93A 1ONQB 2EDBA 3JVGC 4KY1L 1ACCA 1B3JA 1I8UA 4UTCA 1M05B 4ODVH 2X4OB 3B83A 3Q43A 2A3TA 4TNEA 3SD5A 1AACA 2D2OA 2OS7A 3MXWL 5AFAA 2A73A 3DO7A 2HT2D 3CN3A 5L88L 3QG7H 4K3JH 4I1RA 3DO7B 1BZ9B 1P7QB 2K1MA 1YAZA 2QSCH 3Q8CA 5JLZA 2CPCA 1QSED 2YPLE 4MZIA 4WTZG 5GGVL 5DD3L 3DO3A 4ZS6D 5JHLA 3MQIA 1ASQA 4I2XB 3RIKA 3ZDXE 2IALA 4JDZB 4N0UB 3RUGF 1IZKA 3G6AA 3PGFL 3MUGB 3JWDH 4EQ2A 4LKCA 1ZHNB 5E8NA 4NI3A 3QZOA 5C08B 3TV3L 1GOFA 2TSBA 1IC0A 5KSBA 3S8GB 4PJBE 3U0PA 4HCRA 1KYOK 3O0LA 5D7KD 2WZPA 3RVVC 4PP2B 3CPUA 3I75A 3O3BB 2E4TA 5EZOH 2C3VB 1KXVC 4FZ8L 1WQVT 5HPOA 3EYOB 4PJCB 3MBEA 1IM3A 3O6ML 2YWZA 4BEIA 3G6JB 1QWHA 4L1DA 1JZEA 5DHYB 3CSYA 2AJUL 2QPUA 4FS0A 3B5HA 4IIQA 3QO1B 4YQXL 4XO4A 1MIEL 1TTRA 3H0TB 3NJNA 4IHOB 3REVA 4K5OA 3DIFB 4HJGA 3X1EA 2PO6B 1WEJH 3Q6FB 2A1WH 2ERJC 3KHQA 4ZZFA 4OLWL 3CFEA 4FXGA 2EDQA 5HJGA 3T0EB 3ZKND 1H5BC 2YAQA 4I3GA 2BCMA 4TQEL 5CAYB 2YRPA 3WU1A 4PSPA 4S0HA 2Z93A 1GGYA 2VR9A 2XTJD 3CBRA 3ALWA 5DZLA 1KN2H 5SWZE 1AO7D 1B4JH 3LZOA 5FEBA 5J57B 3FH5A 5MEPA 2VE6B 4JN2A 1IZJA 4PTTB 1FVCA 2XRAL 2EDDA 4D8PA 1XB3A 4QOKB 1UD5A 3RFZB 1FVDB 1HHKA 2ALWA 3UABA 3DWTA 4OW6A 3MYJB 1JHLL 2YGNA 3GHBL 2P5WE 4F57H 3FQUA 1KB5H 4XPGH 3V0FA 5F7YC 1NOFA 1TLKA 5IW1B 1JVLA 1NMAL 4AYMC 4UNTA 4PJ7B 1E4WH 1TZIB 3CZFB 1YMMD 3FCGA 3QEGL 4H8WL 3L5XH 4JM2A 3SPCA 2BCKB 1LP9E 4OZFB 1FPTH 5IJKC 2AEOA 3WUZA 2A9MH 3FOMB 2XWZA 1X5KA 2AKRA 4Q4IA 1N2RA 2CHWA 1UA7A 2VITA 3A6BH 4LHUG 3ARTA 3GJFH 4JDEA 4U1NB 2VABA 1GGIL 4APQA 4IIQC 1CB4A 1JI1A 4K3EL 3IFPB 4L5FE 3AFLA 3BPOB 3WGUB 4RMTA 2V9RA 2FECI 4UOW1 3GKWH 5J89A 3SKNB 1PY9A 2UXVA 2BOBA 2FJGA 4RX4D 5AVSB 2F7QA 1AXSA 2HG0A 4HBCH 5F7NC 1PZBA 5F3BB 1HEZB 4BCXA 2OJEA 8CGTA 4L5FH 4YL4A 1IE4A 2RAMA 1BAWA 3W0WB 1J8SA 4LSPH 2YK1L 1Y1DA 2JB5H 4K8RL 4QTFA 3X12B 1FFPA 3KPOB 1U8CB 3QQXA 2XZCH 2EIBA 1KGCE 3TASA 1MJJA 5IHZA 1F6AB 3FT2B 2BXZA 3C9NB 2QADD 4YSSA 3VXSE 5DMKB 1T1WB 2WLIB 5IQOA 4CW1A 4C57C 1PLGH 2CIKB 2OXGA 3PRZA 4QHUA 4RGNB 1J10A 2X3CA 1IAMA 5IVZB 2O5XL 4YHLH 3P73A 4PJ5E 4JFQB 3BZEB 3MLXL 5F9OL 4Q6IA 5DJZA 4EDWL 3VU1A 5E8NB 1ACYL 1I8LA 2FDBP 4KQ3H 2C7UB 4LSUL 3AY4C 2WINB 3O9WA 4OSUL 1GYAA 1BZ7A 4NRZA 1NQBA 2DS4A 2F5AH 2OKMA 2W60A 2X2IA 1Z5LA 4OF8A 2I7OA 2MWCA 3BWAA 1GY2A 5GIRA 5IB4A 1B2WL 1U8JB 2CWRA 1MCBA 3AREC 4GSXA 4ONFL 4POUB 5D1QA 5A2AA 3MVSA 4YGVA 3DNKA 1OM3L 1KLUA 4AEIH 4UTAL 1G7IB 3L7EA 3UPRA 1WFNA 1SY6A 2IDSA 2X6UA 3HPLB 1CF1A 4LSUH 4RWHA 1YNLL 4XP5L 5IHLB 5KYUB 1QFOA 2LABA 3IF1A 4DFIA 4M8UA 3JWNG 4M6NL 5C0AD 2HLEB 1OT4A 1XR9B 3BMWA 3GO1H 3NRFA 1HHJB 1I1YB 4FG6C 2Y9RT 1OCRB 4FXKB 4N9GB 4Q0XL 5FW7A 3O4LA 4Y4HD 7TAAA 3H4HA 2VDRB 5C0BA 1M3IA 1KJMA 1U4FA 1C16B 2ZF8A 4HWBA 3SGKA 5K9OB 2GT9A 2Y2WA 3F00A 3ISYA 4NPYB 4WNJA 4IBYA 4Y16D 2OMWB 3CDCA 5B38G 3T0DA 5FHAL 3IGFA 2ZCKL 2B5IB 1XVSA 3MYZA 4WEBL 3FQWA 4MAUL 5AW8B 5ILTL 1GC1L 5FCSH 1SVBA 1FLTX 2FIKA 3ULSA 2VR8A 3IN2A 3QC6X 4HUMB 3WFEH 4CRPA 2B4CC 2VXUL 5TH2A 4U1SB 1M1XA 5LCVA 2QQQA 3VE0B 3ZBMA 3IXTA 4PRPE 1ES0A 3GJFB 4ENEC 5D2LE 3FU8A 2E46A 2ZP9A 3QUXC 4BH8B 2E75C 4QWWD 4QY8A 3RGVA 4JNXA 3DK0A 1MZYA 2PO6D 4P05A 3JV4B 2KQNA 5HY9A 2H1LM 3EOTH 4WENB 3ZE0E 4BRVA 1QW9A 4C56B 5F44A 5AYQA 1AXTH 4JZJA 1Z9PA 4JFEB 1R47A 1OWRM 4G9FE 1A7BA 1U58A 4QRRA 1WZKA 4AW7A 3MOQA 4D0BA 5I1AA 2WCSA 4JHBA 4NZTH 3FAXA 4XHJD 5DHDA 1UOLA 2AS5M 2DQTL 3N40P 1ZLWK 3PAVA 5IW3A 1HNFA 5C0GB 3MLYL 4Y1AB 5FOBB 1EO8L 43CAB 2E3VA 4OD2B 1CDHA 1EAOA 1NGPL 1E3ZA 3B1TA 1TTUA 3RILA 4W9ZA 4H88H 4IBUA 4PGJA 3GNML 3VXOA 2B59B 3DX1A 1JNJA 1KGYE 1CIDA 3TIEA 4IDLA 3QUML 4WWOA 2H0JA 1E8XA 3W82A 4XNZB 3CCHA 6FABH 2IV8A 4E41B 4KFZC 1L9OA 4MNQD 3BMVA 3LKSA 3FSAA 4C4KT 4FL4B 4MAYA 4F57L 5EO9A 3TNNB 1KZQA 4UM9A 5LXGH 3MLUL 3WMSA 3L95A 1ZIBA 4B0MM 4O9HH 4UOW0 5CINH 3MRBB 3S34L 3A23A 2ZUTA 1KEGH 1R33A 3PHQB 1UKQA 1PZDA 2B7DT 4KDTC 2IC2A 2I32A 2QHLA 2Q7NA 3QCVL 1J8HE 4JPIB 3DURA 5DJ2B 1CIUA 1IBZA 1WZ1H 4APQD 2A5UA 3SDXA 3G6DH 1I9JH 3DPBB 3KAAA 4LIQL 3E38A 5L7XH 4FOMA 5L0QC 5CEXA 2KERA 3C6LD 1CDCA 1YLBB 2WLZA 3LEYL 5E4IA 3BRDA 4JFEA 5FA3B 3RWGB 1OM3H 3MLZL 2YD4A 3D33A 5E6ZA 5PAZA 3CE1A 3JV4A 3GRWL 3UEQA 4DVRL 4DOHB 3HNVL 1OO2A 4MXWL 3BDYH 4GMTL 3PHOA 3CFIC 4Y2DC 3HE6A 3DUUB 3MJ8B 5JORB 1PCXA 4JGMA 4FQPA 5LBGA 4DW2H 4E9WA 2IG2L 1HWGB 2UWEF 3Q9PA 5CLWA 4UT7L 2NOYA 4JM4H 4QLRA 5CU9A 1MCJA 2EH7L 4W9CC 4DVBA 4MCZB 1DVFA 2D4FA 1AGCA 2P8PA 3JWNE 3FQYA 2G4GA 4G8FA 1T03L 1MQKH 3QAQA 1PY4A 4QD2E 4QXVA 2G30A 1BIHA 1LQSR 1SOQA 4AENB 4PJHA 2ZSVA 3X13A 4B3VA 1BXAA 2BP3A 2X1QA 4MMXC 5FUZH 2OQJA 5IMKB 2A9NL 2EDRA 2X0UA 4APXB 2V33A 1XCTB 4NO0B 4NOBA 1S7TB 2CLVB 2AJ3B 1DBMH 2A6IA 1CDJA 3OAUH 4H8WC 4BFIB 5E6YA 5HPMA 3US1A 1OP9A 3M1BB 5CLZA 2A74C 2FNBA 5BS0D 4NDMA 4ETQB 3KLHC 5JXED 1JZHA 4MKMA 3FOLA 5F9JA 1INQA 3L48A 3ZYJA 2DLIA 3IMRA 1OE3A 3DYMA 2GKIA 4P2QE 3FQ4A 2NYYC 1D5MB 4P2AA 2A38A 5KVEH 2WXMA 3VJ6A 1JF1B 3TCXA 2UXTA 3FCTA 4G7VH 1GAFH 1B2WH 1ZTXE 5DJ8B 2OMWA 5C7ZA 2Q9OA 3NK4A 5LAPA 1MLCA 4UZSA 4F33A 1QW8A 3W57A 3SZKC 2C7UA 2XNAB 5DMIH 2ZZUT 4G70B 4ZTEA 5I1KH 3MU3A 1EAQA 1BIIA 3NCJL 1AO7B 1UXWA 2Q3ZA 3CLEL 2X09A 1DZ0A 3IPEA 3PAYA 4XPFL 4Z18A 2R1WB 3KR3H 4MAUH 5GS0C 3LQAH 3OKLA 4A2FA 3WLBB 2VXTL 5EEXA 1WEJL 2YS4A 2K9UA 4OCWH 1R1CA 1XGYH 2GSMB 1VPOH 1W8EA 4LASL 1BP3B 2HJKA 1HHIB 3CG8A 2GJ6D 1J1XH 3FU5A 4EN2A 3QT2A 2VQTA 1FORH 4BA0A 3K4DA 1AHMA 3TO2B 4G3YH 4HFWA 5A7EA 3V5HA 5T5NF 4GUQA 1NGWA 4KKPA 3UTZA 5EO1A 3WNIA 2B4CL 4NZDA 2R69A 4L2LA 4RDQG 1KFAH 3GGWB 3BDXA 3ZDXB 3OKOA 5I16B 1C9SA 4HS8L 2Z31A 2Q2EB 4IIZA 3WTWA 1GW6A 2WJ7A 1K3IA 2KLTA 4Q6KA 4KZDL 1NSNL 1L7TH 3BKYL 3STLB 1YEHH 2PCXA 2Z34A 5DMKA 4P46C 2XACC 3N85H 3BGFC 2V5YA 1X9UA 4X8GA 1A9BA 3QBTB 1TCMA 2IDCA 2W0LA 5TE7L 2F8IA 1MJUH 5JMOC 1U8NB 2BS8A 3QEUB 2OZ4L 3JV5A 4IGBC 2F61A 2VERA 3W0WA 2MNWA 3MV7B 3SPHA 1MFAH 3I2CH 4O2CA 3UJIL 3L5JA 3CSFA 1F1AA 4LNRB 2P43B 2VMJA 3G5WA 4RMSA 4TTDD 1ZSDA 4JG1H 1IFGA 1BJ1J 3FCSB 3ZTCC 1KLFB 3P4OB 3PQYB 5DYOB 4F3FB 4CBZA 1QKZH 2JK5A 5I0ZA 3SYAA 1P1ZB 3RVTC 2GW5A 5D7JD 5EUKA 1I4FB 3LNIA 4ZOBA 2AQ3A 3WUWA 4Y88A 1I7TB 2BNQE 5F7BA 3OLEA 5DD0H 4N0FB 2CDFA 4K9EC 2XU9A 3FPYA 1KPVA 3O3AB 3O6FB 3Q6FA 4OD3H 5FC9A 4JKWA 1ZLWH 3RB7A 4MJIB 4PRPA 1LDPH 4L29A 1HKLL 5PCYA 3NZSA 3MGOB 5K5YA 4F58L 5E95B 2GCYA 3HI5H 3PWPD 4XNAA 2Y6SD 2UVEA 2IWKA 4H2AA 3W11D 4N2OA 1E4WL 5MEPB 1PBYA 3IYLW 2EC8A 2X6CA 4FHKA 4HUWB 2HH0L 4JL2A 3IGLA 1A65A 4PRAA 4JKNA 1YNTA 5TF1L 1Q0EA 2YLHA 4GEJA 1MFDH 1G43A 1N18A 3L2NA 1QTYT 3B2PA 1IEAA 2KDYA 2NX5A 2G9HA 1MUJA 1NBYA 4UQAA 1D5BA 4L8DA 3FFCD 5JTWA 5D72H 4LL9A 4HKZB 5KSBB 3B2UD 4Q9QH 3R18A 5I28A 4MGXA 4DUWA 1TNNA 3L8QA 5D55A 1W0WA 3C6LB 3CMOL 2R0ZL 3I6KB 2H1XA 5CIPA 3WO4B 4Z7UA 1HIML 1HCVA 3ETBF 2R4SL 5FKPA 4KO9A 4XBEH 3MNWA 4PU2A 4XVJL 1ZSHA 4P23D 4XOBA 3Q06A 1MLBA 5D5ME 2IGFH 1OVZA 5JOFA 2AEQL 2LV4A 2WC7A 2XPZA 3ARRA 3PL6A 3QG6B 5IVXB 2CO6A 1IX2A 2DW5A 2QR0A 3IDMA 2WXRA 2F1BA 4U1HB 5C08A 2R15A 3CK0L 2WXQA 4S1SH 1DVYA 1AP2B 4PFEA 1E2VA 1Z5HA 2IGFL 5I1JH 2DICA 1AE6H 2X6BA 1QI4A 1XZ0A 2WO4A 5KBMA 4NJAL 2OMUA 3PXLA 1NKGA 2DQGH 4XXDA 2EUWA 3DX7B 1S7XA 5IOKA 3BUIA 1O6SA 4GQ9H 1BVLA 1OZUA 2NQDA 5HJ3B 3S98A 2JSFA 4AUYA 3TN0B 1W72A 2VERN 4PJIA 1Q72L 1P53A 1PNDA 2E74C 1HAUA 1KIRA 4KKZA 2DJSA 1RZJC 3GLAA 1DBKH 2F54B 2APWA 3Q44A 1ETZA 5LBSH 1YNTF 2FX8L 3EDEA 1WPCA 4NWUH 5G5DB 2V2TA 2NR6D 4UU9B 3GO1L 4Q0XH 2DTML 1RV6X 3KH4A 3WMQA 2QSCL 3DHUA 1S5HA 2JVUA 4HV8A 3KVPA 1TMQA 5KWYC 1B3IA 3NSDA 1FBIL 3HS0B 2B14A 2ZKHL 5ICYB 2GHZA 4QRTA 1UEMA 2OXHB 4IRZL 1VRSA 3SD2A 3FC8A 5GS0H 2VISA 1XCQA 3KNBB 5E8DL 2GTZB 3QUZD 4XZUA 4TS6A 4R6UA 2X2HA 1B88A 3BIKB 3ECQA 1QATA 5CGYC 3UIYA 4AQAB 2IH1A 3CFMA 5MP6H 4PJ5D 1KXTA 1XEUA 1V3JA 2EILB 5D5MB 1HCZA 1EDYA 1J8RA 5C0IB 5SWSE 4NQDD 5LNGA 4L8SB 4I3RH 2OPCA 5BQ7A 1XMWA 2B2XL 4MA8L 3NPSB 1D9KA 4N2DA 5E8DH 2GIXA 5J6HB 1OV8A 1MCLA 1W6LA 3DJ9A 1JD9A 4E42A 4XCYB 1SVZA 3WJJC 4AYFB 4OIBA 4HCRL 1AS6A 4A7TA 4JGNA 4CILA 3MV11 1HL8A 3GMMB 3P30L 1BV8A 1GXEA 3VFUB 5CSZB 1MFDL 4NQED 1P1ZA 2YRZA 1O7SA 4ZG1A 3QJFB 4C4KO 1FZOB 3C09C 1NFIB 2IDFA 2QLYA 3E1F1 1B4LA 2I24N 4PGCB 2VDKB 4HISA 5I76A 4TMPA 2X4SB 4IMLA 3MRFA 4NO2B 4YXKL 2EACA 4RGNE 3OGOE 3Q1SL 4ENED 1R3LB 1F18A 3BC9A 4WY7H 4I9WE 3UYRL 1H5BA 3IE9A 4YDIH 5INCB 4ZZKA 1PYWA 5KZCD 1K8DA 5M7QA 4J7RA 2ZOKB 3HG1A 5KBPA 4Y5XB 2E6QA 3K2UL 4FNRA 1GGBL 3SE8H 4FTVB 3R4RA 3KM1A 1CR9H 4F8NA 5CD3B 4LHQB 3UTSD 4XI5D 4ZTPH 1J1OH 3NMEA 5KVMC 1XSOA 3KPMB 2R59A 4IS6A 3C60A 2B1AL 3VA2C 3WE1A 3H6AA 5D6DC 2BP0A 2I69A 2NY3B 4P5TD 4V1DB 4QJ3B 4XNXH 5ANMB 4UT6A 3ZE2E 3OKOB 4R90H 1GHFH 2OTUA 3O6FC 5I8EA 3D87B 1JDDA 1BF2A 3A0OA 3DX8B 3AGVA 4U6VL 4XP1H 4B9GA 3P4LA 1TVBA 5AVTB 4E9LA 2XXMB 2Y5QA 2VZTA 1NGWB 2FRGP 2CR3A 4G1MB 1JNLH 2Y1YA 2XN9B 1I3UA 4HIEB 2RR3A 3CDFA 3W11C 3OXSB 4NQVA 1OTTD 2X87A 2O5XH 4KMQA 2R4RH 4IU2A 3WIFA 2XKNB 4HWZB 2UYLB 3WMPA 1W8OA 2R0ZH 1G0YR 3DO4A 4OV6F 1HZKA 3OB0H 5EWIL 4L1SA 3ULUF 5LCVH 2ZUWA 3HNVH 4MXWH 4R2GC 1FNSH 3TIDA 4G6FD 3WENA 3HE7B 5I66A 4G7VL 4U31A 5BOJA 5I75C 4ONGL 4B9FA 4ONHB 2CIIA 5TD4A 3ZU8A 3QXDA 4GKNB 4X9BA 5BXFB 4OLUH 2VJ8A 3KVDD 1UOWA 4YAQB 1FBIH 3RUGB 5KBKA 3FU3A 4NQCB 2G2PA 3L9RB 1RFDH 1NBVH 1OSYA 2XXCB 4H13C 2BK8A 1DSFL 4UI2A 5IIEB 2YD2A 3FT1A 1P5UC 3P69A 4W9LC 2P80A 1G6VK 3GT6A 3E6FB 5C7XH 1D5MA 3UPAA 4JFXB 5GS1A 1I85A 2JFCA 1I4FA 3MUHL 3NCBB 3AMKA 3PU7A 4NKIH 4GAGL 4PRID 5FUZL 2XCMC 4E9RA 5AUMA 1LYQA 3K8KA 5E5LA 5FF6A 2EP6A 4Q6IC 3C5JA 3PGFH 1MXGA 4GRLD 1MHEB 3MRIA 5BZWB 4LCUA 2AXFB 2W0FB 1FHGA 3OKKA 4R4FL 1FJ1B 2ZSVB 3US0A 4CVZA 4DP0X 4M93C 4HWBH 3MV7A 4OLEA 1VADA 5D1QC 5ICZA 2GC4C 1N70A 1R46A 4S0TD 2GG1A 1EZSA 1GMIA 4OGYH 1N7ML 4MCZA 3MO1A 5GQBA 3T6QC 1CG9B 1EFQA 1I7RA 4PR5B 4X9IA 1Z1WA 4RGOH 4YO0A 4HLZH 3M07A 2DI8A 2D9QB 4RESB 3IJYB 2NMSA 4FNTA 4GRWH 2HX8A 1F4XL 2F74B 3IMTA 3HI1B 3KR3L 1P5VB 4NHUA 2WXOA 4BFEA 1BZDA 1OTUD 4EKJA 2DKUA 3EGSA 3WFCL 3SGKC 3CDYA 3ZZSA 2QKIB 4HS3B 4QRAA 1A9EB 1S7WA 4BKTC 1EHLH 4MMZC 2ZCHL 4WHYG 3QPXL 4PIBA 4PJ5A 3OR7B 4AOFA 4FYRA 4OT1H 3ZL2A 4RQQB 5HGHB 1FN4A 3ARDC 3DPBA 3VI3E 1D7CA 2OMBA 1U9KA 2I5YL 3CC1A 2KPNA 4X6BB 3GJEA 2VW4A 4P49A 2EUVA 5F3HB 3MJ6A 4M7LL 2QMKA 3L45A 4JFDA 4DP5X 1BW8A 4ZUVB 1KXVA 1UACL 4DETA 4MB5A 3DHPA 3V6ZA 2Z9TA 3E1ZA 1DJXA 2OMZB 1XGRB 3KCPA 4TV3A 4Q9RL 3RNQB 5EU5A 3MRJA 4G7YL 5AWNL 1MREH 1XR8B 4Z7WE 4L3CA 1BEYH 1G7MB 1XIWB 3C8HA 4PS7A 3AQYA 3I50L 5AD0A 3L3DB 4OF7A 5CJXA 4HEME 3F04A 2J5LC 2M2DA 2PTTA 1H6FA 2J3SA 1MH5A 5EBMA 1BREA 5EU7E 4JFOB 5CJQL 4ZXBD 3HZ3A 5L0QB 1AGEA 1NWPA 1PU0A 4F20A 3W1ZA 3KXFB 2DH2A 4ZOAA 3EDDA 4ZPTA 3LKOA 2LHAA 3DDGA 1E9PB 2BY2A 4KKAD 4MX7A 1QOKA 5I74C 5AAWC 1RK0A 5LAXA 1WISA 1L0XA 2OYMA 4EUPA 4FQHA 3VGGA 3ZDYB 5E4EB 5ICXA 2P49B 4NWTL 1HNYA 4C56A 4Y2OB 2J5LB 1T1ZB 1QQDA 3MLRL 1RZFL 2R0WL 4BINA 1I9JL 3T6VA 4KU1A 3KXFD 5BRZB 4PTUA 4IBVA 4X80L 1QPXA 1ET5A 1N19A 4OCYH 4A2GA 1F4AA 2AEPH 4WFHD 1XSIA 4LVHC 2JF1A 5F6HI 5DZPA 2MFNA 3WSQL 1DDHA 1UZ6F 1RZKC 2RFXA 3T3PE 2LTQC 3DVNB 1H0DB 1H3PL 1SOKA 3F62A 4W1TA 5HHVH 4ALAC 2CDEA 1L3NA 5IM7A 3IS0X 3D06A 1O9WA 2IH9A 5C07D 4XPFH 3B9KA 4WDIB 4GKZA 5I26A 3H54A 4PB9H 3IK2A 3JWOC 1ZXQA 4BDVB 4Y2OA 4IMKA 4M7LH 2NX5D 1KBPA 4HWEL 4R97C 4KKCC 2H1PH 1FG2A 2OR8A 1OAJA 2DKSA 3TFKD 1P69B 2J8UB 3F7PC 1PDKB 4Q74A 1XF1A 2F9BT 4KPHH 4NB7A 2EKSB 3KPLA 1A3ZA 3CFNA 2BH0A 3NCYP 3VFMB 4C56E 2DQIH 4CKQA 1OP3H 3SGJC 4M9OA 3K6OA 3D0VB 3MBXH 3QZMA 4JY5H 4UV7H 1G9ML 2QKIC 3WY3A 4HWEH 1DO5A 1DVFC 3AC0A 4IDJH 1QRND 5E8PA 2J20A 5CP7B 2VAAA 3G7TA 2WXFA 1S78D 4PWHA 5LWYH 1Q1JL 4MSWB 1FNFA 1UT2A 4PJFB 3KPQA 4WEBH 3QIBC 2FBRA 3TC9A 3MRRA 2ZXDA 4J8RA 3VXQA 1UXMA 1ACXA 2XV3A 1CC3A 3ILQD 3K0WA 3LXUX 5T1DL 5I5IA 4NNYB 4Z7NB 4NKIL 5K1NA 4L4VA 2C9XA 3QDGE 3VH8B 3AAZA 3TIEB 2FLMA 2V8LA 1RAMA 3QZPA 1G7QA 1SBBA 4HD9A 2K45A 5AVWB 2F7RA 4U1GC 3PP4H 3FFCA 3LIZH 3M45A 5EUOA 4U6YB 1M7DA 1F4YH 1OKEA 3A21A 3QJQB 4M9PA 3V4PB 1SRDA 4WGKA 2B3RA 3LRSA 2EJ1A 4FZ8H 1T0OA 1T7YA 1KT2B 4MNHA 4WEUD 3GXMA 1FYTD 3IJHB 1WBZA 4F2FA 1LEKB 2VN6A 5SX5H 1KIPA 3L4YA 4P2OA 5I0YA 3BUYA 4I0CC 2BHUA 1VEOA 1T80A 2AF2A 2NSQA 5EEVA 4ZMTA 3QZNA 1GMEA 5DCCA 1SEBA 4HJ0D 5DGQA 1OAXL 3VWJD 1A5FH 1WFIA 3FQ1A 4CVZB 5IB5A 1HXYB 4GXUN 4WW2A 3BXNA 2VLKE 1ZLSL 3QIUD 1WZAA 4QUOA 1VAHA 2NZ9C 5ESAB 6PCYA 5I18H 1EJFA 1SN5A 2RH0A 5GRVL 2UXFA 4FYSA 1J5HA 4R4NC 5FYJD 3P9LB 2WP3T 2QVKA 4KKLD 1OPOA 4G6KL 4JO1H 4H44C 5J4MA 2H32B 5E8OB 4QHNB 1I7ZA 1TYRA 4NM4H 2IAAC 1IE5A 4XMKH 3NDYE 4XMLL 5BRZE 1MAKA 5SWQB 4JREC 4U6HA 3RKDC 1LNUB 1NANI 3VD1A 3T77A 4PJ7A 4F7PA 3MLUH 5DZ9A 3SDXF 3UTSA 3X1BA 4NPYA 3MPCA 1CDUA 1UD3A 2KZWA 3MJ7A 5L9DL 1ADQL 2WXGA 1XF2A 3KPPB 3UG4A 1UYWH 4FQ2L 1XF4A 4JG0L 4LPYA 4HIPA 4MB3A 3IDNA 3O45B 1FFOB 2F19H 4AVIA 1EJ6A 1YYMH 1SYVA 3IVKA 2ROYA 1E8ZA 4UQ2A 1S7UA 3QUYC 3MRKB 1EEUA 3GMNB 5J6GB 3HZKB 1B0IA 4NCDA 2Z8WC 1ZVYA 4K5LA 1TEYA 4CC1A 4IRSB 1A7QH 3O6FD 2XUWA 4LQFH 4P9MH 4GKOA 3B2DC 4WJKB 3T0EA 2H3NB 3IXAA 1KGXA 3FFDB 3U4BL 1SN2A 2VDQL 4ZQKB 1T7VA 4LP4A 4NQCA 4BHUI 4LMQI 5C3TA 1R0AH 4KMTH 3IGKA 4TLSA 3TF4A 1U3YA 2X42A 5IB2B 4XXCA 4UTAH 1AS8A 3SGEH 3ARFC 4QRUA 1R3HA 5DC0A 4ERSH 2XDHA 4FD0A 3K6DA 5FYJL 4HJIA 2ZX8A 3TCLA 4QAMB 1DVTA 3FSWA 2DQJL 4PJ7E 4DTGH 1BHGA 1F6AA 4ZK8A 4CNIA 3LX9A 1J1PL 1NOAA 4HWZA 4ISVB 2X70A 5B8CB 5I18L 4RFEB 4KNUA 3MLRH 4WI5A 3ZXAC 2X4RA 3H53A 2EIZB 1DVFD 3FB6B 4NJ9H 1BLNB 3CZNA 1T5XB 2NXYB 4RGMB 5JXAH 2BIMA 1HX0A 32C2B 1L9RA 1VENA 2VLKA 3DSFH 4BK8A 1IGFH 4F27A 1PW3A 4KPHL 4DKEH 3JTBA 1ZTMA 1Q1PA 4KKCD 4A04A 1Q9WB 1EAPB 1NFIA 2YUWA 5EH1A 2A73B 2F1EA 3NJHA 1YDPA 1X6NA 4WU7B 4Y2NA 4Z7QB 2H41A 5CSZA 5CD3A 4P4KB 1KC5H 3ZZ1A 3ECBB 1GA2A 2LR4A 2BCKA 4OZFA 4RMUA 5FW6A 4HYTB 3F7KA 4LL4A 1OGSA 1YMHA 3Q6GL 2AK4D 3VH8G 3TPUB 1OWWA 1ZKAA 1IC5L 2WLYA 2C4FT 4K55A 4NENB 1UWXK 4HZLB 3T2NH 3VNZA 4M8VA 2WYZA 4YSAA 3B3BA 2YJQA 1EEYB 5LWYL 4XB3A 4MVBC 1XL6A 2EABA 2XG5A 1KB5L 4UT9A 3CVHL 1T2QL 2OMTB 3WIIH 4NHCH 2BWDA 3B5TA 2G5BA 3TJHD 3B8YA 2RA1A 4ZO7A 3UYPA 3HE6D 3LH8A 4PBDA 2XVBA 5ISZA 1JPST 1KGUA 1NFDF 5IWLA 4GAYA 4XBPA 4Y4KB 3HPJA 2GQHA 1KTRL 5L6YL 4LP5A 4ZOEA 1NCBL 4AGPA 1G7HB 2BVYA 1QTSA 1G7HA 1LJMA 5T5FA 3NQIA 4H0IA 3T5WA 2XWBA 1RIUL 4L8SA 1MI5D 2FR4A 1YAIA 2ED7A 1E0OB 3G5VA 8FABB 2BS71 1CZ8L 2E7MA 2OL3B 1RUKL 4A7GA 4OGQC 2CO7B 4G1EA 2QBWA 1KCBA 2VW6A 2WZ5A 4QRPB 4PJ9A 4QRRD 1QFUH 4OF6A 4S0SD 3TZVA 2MMXA 4U0QB 4H8VA 3O3BA 4HHWA 3KEDA 1CBVH 3GZPA 2VH5H 4ZDHA 1PZ5A 4OI8A 3FZUC 1F4WH 1H9VA 1Q9LB 4TSBL 5DO2C 2P48B 4TQPA 1RMFL 1UD2A 2HKFL 3OJMB 3TPUA 3HRZB 1I8KB 1DCLA 4J3VA 2VM3A 3NUKA 1FGNL 4UU9A 4J8RB 3VXQB 3Q9QA 4KH9A 4GSDL 4N2IA 1MXDA 6FABL 1HESA 4I2XA 3A6CH 5FYJU 1F58H 4PCYA 5GZOC 3TEYA 5JHLH 1AGFB 2DMKA 3IJEA 3MJWA 2QPSA 1I1AC 4C83B 2W07B 3V6FA 4PRIE 3KWXA 5TF0A 4E0RA 1OP5H 1QPPA 5SX5K 1FNLA 5TDOB 3SQBB 4ZNCD 3KGUA 4FC3E 1GZPA 1PJWA 3V10A 4DN3H 4Z7UB 3EXJA 3KWWA 4BV1A 2VUYA 4LKXB 3S8FB 3I6KA 1YY9C 2QT6A 3QNYA 3HBQA 3VCLA 4L0YA 1NEZA 1ZT1B 4WV1C 1AP2A 3NFSH 4Z8FL 2IO5A 3DI2B 2E76C 3MACH 4UYQA 2IPUG 3ECUA 4Y9GA 3HUJF 5FM4A 3QIWB 1LEIA 4IGBA 5GRJH 1AIZA 4UANA 2HVBA 4BRJA 1RPUA 1QNIA 3P9MA 1UGNA 4XP9H 1JVKA 3S36H 1CWVA 3TZVC 4PJDE 3GSVA 1NMCB 1J8HA 2P8MA 5HI3D 1MLBB 3PWUB 2EIEA 3EF7A 3QEHB 4LIQH 5IB3B 3O2DH 2VDLL 3K3QA 3AUWB 5JHAA 1U8PA 2XV6B 1UEYA 4LDCA 5AAMA 3K6SA 2BZDA 1L0QA 1UD6A 1RJCA 5C0CE 3C8KB 4DO4A 4L8CB 1EHKB 3FQTA 3L3IB 1Z0MA 1RJYB 3MNZA 4QRPD 3V6BR 5DD5H 4W9GC 4GS7C 2DWEA 3HNTL 5AB0A 2IH3B 1NPNA 5GZOA 1JTOA 5A40E 1YEIH 4XP4H 5IEHA 1NMBH 1JMXA 4R90L 3G04B 1BGXL 2H9GB 5C9KA 3LSOA 2Y69B 2ZG2A 1WE5A 5GS2H 2NTSP 3WFDH 4OU3A 3TJEH 3MJ9H 3TYFB 3MTXA 4HLZG 1AVAA 5DD3H 3MTRA 3FMGH 3VI3A 4WRLA 1RIHH 1G9HA 3O4LD 4Y4HA 3ME0B 3GZOA 1NICA 5D1XB 4DKEL 1ULVA 4PEEA 5TPWL 5I1EL 3FT0A 1E9OB 5AAPA 3VU2A 2R69L 4ZO6A 2GUOA 4FFVC 1ZE3H 5C09A 4LCIH 5DK2A 2HKHH 5I0XA 3UMTA 2Q0ZX 2GB2A 2BERA 3B9DA 1MOEA 2WBKA 2BPBA 3LEVH 2RALA 5E1AA 1VZIA 3WNOA 5IV2A 4U3CA 1E4KC 2G60L 2VDML 3BQUA 2ARWA 3QEUA 1XR8A 4ELMA 3UC2A 1U8NA 3AQXA 4G7QB 5BMFH 2BVPA 5E23A 4XB8A 3UTQB 5F1NB 4FKEA 5JO5B 3QYMA 2FGZA 4O58L 2H32A 1JNLL 1DN0A 1AKJD 1M7UA 3MCLL 2IFGA 5DUBA 3HMWH 5A7BA 1DLFH 2CO1A 3RPKA 1QRNE 5A6MA 1Q38A 4JFYB 4MCYA 4WO4C 1AQKL 4AI7A 5IFHH 1LL1A 4IRZH 4LASH 4O2CB 3CVHA 3ARGC 4JO3L 4NSKB 3TLRA 4LARL 1SXCA 3AU0A 3CPLB 2FATL 2HRPL 1QSFA 3O41B 4Y9CA 1YMME 4PWKA 3V5HB 4NQXB 4OCRH 1LEGA 4G42A 5D93C 1HI6A 2RCSH 1S7WB 4PY8I 5T1LA 3VXUD 4AJ0A 4ZFGH 2XIDA 4FULA 4MQ7A 1FL3A 3CFJB 3EJSA 4GUPA 4ATWA 1XGPA 3L3HA 3PDOB 4TLUA 4WQOA 4A6YB 3S4SA 4RX4A 4U6YA 3LH2H 4XZ4A 1EXGA 2OMXA 2FZ3A 2AGJH 2R0LL 5DD0L 5F1NA 4BZ1H 4XX5A 2Y7MA 1NCNA 3TEXA 2WQWA 1HJBC 3PAZA 4QJ5B 1MAJA 3M17B 1AFVL 1ADQH 5I73C 3O41A 4MRCA 4YK4C 1UVQB 1KB5A 1UUSA 3P3YA 4PVMA 4UT9L 5DHVA 3D3VD 4TSBH 4ZODA 4XP9L 3S36L 3TFBA 4GG6B 4F8LA 1SEQH 1JPEA 3WNKA 3CVBA 1ETJA 4KI1A 2NQ3A 4MCYB 1UJTA 3MRIB 4GO9A 4R7DA 1IB5A 2HJKB 4EEEA 3DJSA 3SCMA 2YD6A 3W56A 1S9VB 2R2EA 4POZD 5GGTA 5JA8B 3FDWA 4ETQA 2MCPH 1W16A 3M1BA 3OC8A 3BSZH 2WXPA 3ATAA 5DF0A 1OD9A 1NPJA 4KGJA 1FIGL 5AKSA 4YVNA 1X5MA 3X14B 3QUMA 1WZMA 3JV0A 3VRJB 4A7SA 3ARDA 3VD5A 1G5GA 2E9GA 4OM0L 4AENA 1MLCB 5IIEA 3GEWB 3WN5A 5EPMA 5L2KE 4Y5XC 1EX0A 2AP2A 4JO4L 1JNHA 3TBYB 3M17A 4XC1H 3FQXB 4AIOA 2CGRL 2Z35B 4G8AC 4X9HA 3IN0A 1RZ8A 1CF8H 3FB5B 3ZDWA 1A1NA 2K8QA 3H4FA 3WIHL 1AXIB 3O6KH 2BSDA 2BRQA 1MSPA 2D7NA 4Y16C 5F0PB 1WO2A 3APNA 5IG7B 2CSPA 2XPGA 3RWFA 1RJZB 4NO0A 5EC2A 5C8JB 4APXA 4NI6A 2A6DA 3R06A 1Z3GL 4Z7OE 4HOWA 2VDRH 3ROLA 1Q0XH 4GKLA 4WTWA 4DEWA 3RIFK 3S8WA 2Z8RA 4PG9B 4G42B 5T1LB 2NY1D 5GGSA 4HIEA 5TE6L 3QYNA 3LH2L 1X9RA 2WO3B 1L9MA 5JNYB 5DEZA 1DEEB 3VCLB 4YC2C 1ADQA 5LXVA 1OP4A 4RMWA 2YHGA 4K4KA 2WV3A 3KS0H 2VXQL 5BS0B 5EU3B 3I3EA 3K6SB 1XGUA 5D96C 5DJYA 3FJTA 5IBTH 1UOVA 2VSMB 5FYJE 5JQHC 3HE6B 4HC1H 3ML9A 3S6CA 4D0CA 1A6ZA 3BKML 2BJML 1RULL 3ETTA 4YHZH 3ZSTA 1YYCA 4GXVL 5IVXF 2UUDH 3EYVB 4X8CA 4GEIA 3VA6A 1FZKA 2G3NA 3D85B 3FB8A 4QXWA 3RWGA 3WYRA 5ID0A 5EEZA 2YPKA 2ZOKA 2YXVA 1GGUA 2WMPB 3VI4E 5E08H 5AD0B 1G6RA 5K1VA 3BEVB 3QNYB 4PJCE 2WUCL 1CDGA 1IEBA 4FHJA 2L0DA 5IW6A 4Y4FA 2WLJA 3PP3H 4TTDC 4HHAA 4JE4B 1QFWL 3U46B 1GZPB 3UEZA 4Y16B 4G82A 2VIRB 1WA2X 4ZOCA 3ATDA 1CLCA 3QIUA 4ZAKC 5H4ZA 2I27N 3OLDA 4QRPA 4JCMA 1U8QB 5D7IF 5JW3L 3VM5A 2ORBH 3GSQB 1N8OE 5AOMA 4X5WB 1QD0A 3VRLF 3AW5A 4NN5B 1WHOA 2CAKA 2CJTA 5IREA 3O3UN 5I19L 3HR6A 1QEXA 1Y6KR 3POCA 4P2OD 3QJRB 5IFAL 3MRMB 3TO4D 1IGYB 1PG7W 2CRZA 1FYTA 1WF5A 1CICD 2R2BB 3V9EA 5KJRH 3C5ZB 4YDVA 1NL0H 2UZIL 3D8MA 3ZHFA 3T8MA 5F8RC 2MCG1 3OKNA 2VRQA 2JJSA 1S3KL 4G9FD 5T1KB 3B43A 2WVSA 3VXOB 1P5UA 1SXAA 3C8KA 1CGUA 1TJIL 1BJ1H 1J0HA 1L9PA 1QMUA 2IH1B 4Y89A 3GBDA 2J7LA 4OKVA 3BZFB 2VMEA 2JJWA 2MQ3A 3D4GA 3FB7B 3ESVF 3KNBA 4HS6B 1WT5A 4L4VD 3PHSA 4WHDA 4KKBC 2ZKWA 3VG0H 3MO1B 4F9LA 1WUZA 4ZUTA 1OGAE 2WSPA 3D25A 4KXDA 3RTQD 4JX0A 3VDBA 5J11B 3X3GL 3H7BA 1BD2E 1A6VH 2OSYA 4JZNB 1RZIA 3QQ4A 4WI3A 4C55A 5K9OA 4PWEA 3RZWA 2L7UA 1FNGA 1G7LB 3BP4B 2EYRB 4LCUB 1FO0B 4WFFD 2X88A 2BSSB 2HPOA 4DPCX 1T7XA 4NUJA 5ETUA 4TUKH 1KTJA 4P4KD 2NSXA 3HE7D 5FF6B 3GBNL 3V4UL 1WIOA 2FWSA 4AZUA 3I2CL 1QFWM 1L9QA 2I9LB 3WLWC 3WS6C 5DQDH 1TJXA 3WFHB 5IESL 4PRHB 4X6CA 3FO2B 3MLTA 4P5MA 4MA7H 3ZJAA 4CU7A 4F7EB 5D7IB 4E9YA 2OMUB 2RQEA 4PJ9D 4MJID 1QASA 1CFTA 2Q20A 1MFCH 1NAMH 1MWAB 2YUVA 2R9HC 2OMNA 3N9GH 1EO8H 1I8KA 1OSZB 2H6UA 5DVNA 1JXFA 3M86A 3VFNA 1YMMA 2EEXA 2P9RA 4HZ1A 1LD9A 4EZJA 1VGKA 3CLFL 3SOBH 3V0WH 1DVQA 1F8TL 5DZNA 5TQ2H 3VWKB 4AQOA 2XYBA 4B9PA 3L4XA 1LE9B 4K8RH 3TIDB 3ISRA 3PJNA 4AIZB 4XMPL 3S3PA 5EN2A 1A4CA 3QDGA 5CJ5A 3RIAK 4HT1H 4B41A 4MYWB 5JOFB 1Z66A 5C07B 1IU1A 2RBLA 3OKDB 5ISZD 3SKJH 1YEKH 1AQMA 4HGWA 1KCSL 3AACA 4XAWL 5FKPB 4Q89A 4BSVB 2HVKB 4QTHA 3LNEA 2YBGA 3AY2A 3BPLB 5FO2A 4FXLA 3WE6A 5H8DA 2UZXA 3AG4B 1IQDA 2WSKA 5EBLA 5IBLC 4XPAH 5CMAA 4LLUA 4ZQKA 2X4RB 1B0WA 4MB4A 4Y19D 5I8EB 2BOBB 2J1WA 5EU4B 1E3XA 1Y1UA 5CJXC 5KUKA 4P3DA 3VI3F 1PLGL 1FC1A 4PJ6A 4MQTB 5DK0A 3IFPA 2A77L 2G5BB 4P2RD 1YNTB 4UINL 1BVZA 3PWPB 2GJ6E 5D70H 4XNMB 3GINA 2VXQA 4L1HA 4LAJH 3EBAA 1MJJB 5IHZB 1LE9A 5H2BB 2YSSB 3VYNA 2LTQB 3MUJA 1S8DA 3O45A 1KY7A 3HE6C 3WTVA 2ZUVA 1BXXA 4G6JH 3MBED 3HZMB 4BQCA 5DQDL 4M48H 3GI9L 4UQCA 4QHMA 2FO4B 2VLKD 2A9BA 1ZGLM 5HBBA 3GXDA 2D3VA 4FQIL 4K9JA 3GSWA 1TKWB 1D7FA 1ZT7B 5GRUH 4LSTL 1T5WB 3SKMB 1J1XL 2IOIA 3QDGD 4YDKL 1FO0H 1K5NB 5SWQA 4FA7B 1PTZA 1NGPH 3QQNA 1UWGH 2LAAA 2MPVA 4MRBA 4AKQA 4PD4K 1Y7VA 5T1DH 3P3RA 2VXVL 3KPRB 3PQYA 3ULUL 4HKJB 3II3A 4PCSA 3WKMH 3O6LL 2VR4A 5E9DD 3PGDA 4FXGB 4YEFA 3T8XA 4H8PA 4IOSD 5D7EA 3QDMD 2FO4A 3MLVL 4KV5E 2NUTA 4WUUB 5CWSA 4JO5A 3MRGA 3R7RA 3H7BB 3A24A 4AEEA 1I8LC 3FB6A 3CVIL 1RUPH 1KG0A 4JKPL 5C0IA 3W38A 3DJZA 1FVCB 2KYIA 1BJMA 2ZP8A 3B2VL 3K8LA 4YHYC 4HS6A 5L8JB 2IBZY 2A7BA 3QO0A 1LK2B 4FQ1H 1CFQA 5DLLA 2V9UA 4OLZL 3MBEB 3KPSA 5IKCA 2YA0A 1NINA 3WAJA 3F7RA 3RVXC 2DLTA 3UZEA 3FS9A 1HYSD 2Y7QA 3GMQB 3PUCA 1I3RB 3PP3K 2MCPL 3GNMH 1EMTH 5CMAB 3D4YA 1GTNA 4UV7L 2VLRD 3IDGA 4JHZA 2OI9B 5DD6A 1TZGH 4PJ8C 4MXQC 1K5WA 4GW5B 3QJXA 4HWUA 2ADGB 4FLQA 5EZLB 4AW4A 2VKWA 4CN1A 2YD0A 3K81A 1ZLEA 2VMCA 1W9XA 4KJYB 4DCQA 4MD5A 1RIUH 2DQFB 2ZUQB 3SE4C 3STBA 1QYGL 1Z3RA 3LYRA 4X4YA 3LKNA 3W9DB 4XNBA 1EJ8A 5HVFB 2K0RA 3KPNB 4GMSL 4YSPA 1JZ4A 3P54A 2COVD 1A6AA 4J2QA 5E2UL 5TFSH 4ZW3A 3PGCA 1PKQB 3GXIA 3O2VL 1MAML 4OGXH 1HJCA 2EYRA 1ZTXL 3RGVC 5H35B 4OZGA 1N0LA 1NTDA 4ODWA 4UF7C 1NUFA 3QUYD 1DFXA 4RIRB 3VXRE 1MFNA 3R4DA 1JZIA 4GKZB 3SN6N 3FUKA 3KYNA 4LPVA 3AXLB 4K5PA 3C8DA 1UD8A 3PWNB 3VWJA 1Z32X 2DYSB 2H4EA 1VIWA 4P5MB 2X53A 4JDVA 4NZUL 2CDEB 4PRHA 3QG6A 1K4CA 1N68A 2EDTA 4JQXC 4X6CB 1ZHBA 5TQ0L 1MI5B 3L1OH 3L16A 4DGVH 4Y4FD 5F1SA 4LAQL 2Q6WB 1WCQA 1MREL 4NX0A 3OAYK 3VWKC 3D0AA 2H2SD 1AD9B 1OF2A 2B5IC 4LLWB 5HDRA 3RTLA 2FE0A 2C3WA 1G7PB 2E7BA 4OV5A 2ZCLH 4KOBA 3RKDD 1W0WB 2ICCA 3DXAD 2KQMA 4M93B 4UBDD 2FD6H 2HYMA 3KYMA 3CH1B 4PJHB 4MJ5A 3UBFA 4HKZA 1I1AD 4NP4H 4WWKD 5F9OH 1MFEL 2VL5B 4G71B 2WO2B 3SE4A 4JDTH 3W39B 2CBPA 2OYKA 4KRNA 3ULUH 2ESVD 3I74A 3UYRH 2WQRA 1MF2H 1N3NA 4KTEL 2DQEL 1S7SA 2CBOA 1O7VA 5DLML 1XIWD 2A77H 2AK4B 4GI8A 5DZAA 3GXTA 4OVUA 2PP9A 3SPIA 1INDH 2F0CA 1Q94B 4FI8A 4NM8L 4UTAA 1PD1A 4N1EA 4AVHA 4PY8J 3QK0A 1BQLL 1VFBA 3ZKMC 3GSUA 1EHAA 5KSVA 1R3KA 4P04A 3ET9F 1OAZH 4YR6A 2APTA 5TFSL 4W9KC 1OAKH 5LBSA 4U6XA 5D2NB 1V5JA 2O6CA 2ZAIA 1GC1C 3G6JE 3QDMA 5AAMC 3D39A 1BG1A 4UIMA 4WAFA 4AV5A 2PUQT 1UFUA 4YDMA 2OZ4A 1BVNP 4ORGB 2FEDC 2UXGA 3LRLA 4TUOA 3WY2A 2JCWA 3NG5A 3SCMB 4TRPH 1SNRA 3D0VA 1NCDL 4YWGH 4Z3IA 3HVDA 4FQCH 4K3HA 5KSAB 4V2CB 4CVUA 5EBMB 5KW9L 1EDQA 4BZ2H 1JPGB 4PRHE 5TDNA 4QAWA 3BEVA 2WYIA 4M1DL 1JZ2A 4OLXL 1GOHA 5J7CC 2YD8A 3K72B 2CXGA 1J0KA 5B38B 5GS0D 1BQHB 4LCIL 1IBGH 1FCCA 3TL5A 1CFVL 2BOCB 1DANT 4O4YH 3QUZA 3ESMA 4XVUD 1U93B 3P02A 5H4YA 2NUPB 4RLDA 4XVUC 1V55B 2VCOA 3SCMD 5GSVA 5IM7B 2BSRA 3TF7C 1KN4H 4X4ME 1LLAA 2CE6A 5C97A 1BZEA 1BQ5A 3QWRA 2H0EA 2FQEA 3ULVE 1XXDC 3L3HB 4AEIL 4ZUWA 2FECL 5DJYB 3DROB 5EU3A 1F5WA 4PJIF 1AMXA 1UM5L 5HXMA 4F24A 5FFOA 1RERA 2X1OA 4P2RA 4JGJA 1H6UA 3RDTA 3LB6D 1J0ZA 3ZL4L 3ZYZA 5CD5C 1VADB 3OR7A 4FNQA 4BXVA 5MEOA 4Z7VF 3LPFA 4NSKA 4N0YH 3TGXA 5KS9E 2EINB 4XCCL 1A9EA 4PJDF 4ZMXA 2QPFA 2F74A 3BI9X 5IBLD 1GGCH 1NCTA 2BXYA 4NN7B 3VXSD 3VXUA 1G9NC 1S7VB 2JKWA 3UG3A 2ITCA 1F4HA 5JO5A 1ZHBB 4ZQTA 5M95B 2HFEA 2OK0H 4YBLB 1AY1H 1HZLA 2NW3A 3OQ3B 3FQWB 4NOFA 1JNHB 4Q4EA 5C08D 1WAAF 3JT0A 3P0GB 5CSBA 3L5IA 4IRSD 2NZ1A 1ZEAH 3PWJB 4KKBD 4OBRA 4RIRA 4E9VA 4GG6A 3MCLH 2VMFA 5E1AB 5IV2B 1PZ3A 3F7LA 1F02I 3RGBA 5DHVB 3NVQA 1HIMH 7PCYA 4CADB 4LVOC 3RY5A 3VQMA 3EJTA 3MRJB 1JFHA 1ZLVK 2QKSA 4JR9L 4TSAL 4P5KA 5MP6L 4UT6H 3IGUA 2EH8H 2L3BA 3WJJA 3FOLB 3VXUB 4NIYE 1BA9A 2VDNL 3IF1B 2ZPKH 3SDAB 1ND0B 2ZUSA 1UCBH 3EG9A 4U1KB 1S5IL 2MKLC 2NR6C 3N5AA 4KJYA 4DCQB 4DH2A 2VLJE 4W93A 4DK6A 2A9ML 2OR9L 3HBZA 3L5XL 2OQJB 5C0CD 5DRXB 2DQUL 1RXLA 5INDB 2CHZA 2W60B 5AKTA 4DHLA 5AYTA 4MA3A 4JAMA 2HWZL 1JD7A 2OCJA 1OAQH 2FHBA 1XSJA 4E36A 1AGCB 1TETL 3D2TA 4HWNA 1X7QB 2BIQA 2LOEA 1A9VA 3NSFA 4HPHA 3UAJA 4GY4A 5I66B 3MV7D 3U6RA 4BKSC 4FYTA 1UJ3C 2R27A 5JW5A 1ZA3A 3P0VH 4X50A 3W9EB 1H9DA 4OQ1A 1CFMA 4L23A 3QR0A 1RL1A 3HNTH 4PLNC 1MCCA 4RA3A 2H8PA 1C7TA 2HT4D 2N7SA 1BAFL 2HJLB 3HKZA 3PS6A 5I1DB 4EBQH 4KNQA 4RZCB 4F7TA 2OW6A 1NFDE 3UTTE 1GGBH 5D7JC 4Y5XA 4HCGA 1FFNA 2DIEA 4YFLI 4UTBH 4BBWA 5I6OA 2BNUA 1AG6A 4PRIA 2O26U 2YEQA 2FH8A 1ZDSA 3MRGB 1TUPA 4YDNA 4WUUA 5CWSB 3E80A 4XB7A 2YBRB 5HGAA 2B1HH 3SJVB 2VDRL 2V6HA 1ED3A 4ZD3H 2B0SH 1BWWA 1SLVA 4LLAA 2BFGA 4UAOC 3WIIL 4HG4K 5LGHL 4FMKA 4L18A 3LRKA 4JPKH 5D96B 1FGVH 4EDXB 4TQHA 2WBJB 2ZICA 4GRWB 4HWBL 3NFSL 4IGBD 4Z8FH 3QPKA 1DCEA 3H9SB 1CLVA 5C0AE 5JR1H 1N2RB 3PREA 4PJXB 2VM4A 4YDJB 5E8EB 1MHHA 5GISH 5K1JA 1K5NA 2X4TB 3GZKA 1J9TA 4GW4B 4L9LB 4ODHH 5I15L 3E6FA 2QPEB 2PETA 2ZPKL 2W9LA 4E41A 1G6RH 5E6SB 1E67A 4EI6B 4TLKA 3T65A 5I74B 1CFSA 1JL8A 1RUKH 1WZLA 3DTXB 4M43L 4MS8C 2ZUYA 4XP6L 1IM9A 2X4SA 2B59A 3DUSB 2IMNA 1F90L 3NFNB 2Y2TA 4P4RA 4G59C 2PLTA 5L2JB 1U8PB 1RUAL 2K78A 2DLFH 5IB3A 4NYLA 3NA9H 2FATH 2HRPH 4KY2A 5I1GH 4QO1A 1KN4L 3GM8A 4C4UA 4TVPH 1MRFH 5JYMA 4P23B 5H37G 4JCWA 4MJ4A 3PJLA 4QCIB 3BAWA 5BOZG 3C60D 4E9QA 2HA1A 4KY1H 2NY5H 4QTIH 2H2SC 3VRLE 5FX3A 1SJHB 5DJDB 1DUYB 3P2TA 4JZJB 1LO0H 4Y4FC 1DL7L 1DFBL 1CGSH 4LLUB 1IMHC 3Q2WA 5E7FA 1I7UA 3N41F 4KC3B 4FABL 2EH8L 3MV8B 3HMXL 1KN2L 3LDBB 5G5DA 3GM0A 3WE6B 4F7KA 4JRLA 4ZXBC 3ARED 4P5SA 5D7LE 1EXUA 2ZYIA 3ZN6A 5HGDB 1FAKT 1ITBB 1FDLH 4BZ1L 4HUUB 5FGCE 4JREB 4ZX5A 3SDDA 2IQ9L 1DL7H 2HFTA 4LPCA 1MI5A 5DURB 2DM3A 4ECNA 3B9EA 5AVRB 3GRWH 3PWNA 1U42A 4PRNB 1B0GB 1TZ8A 3O3DB 1G9NL 4RMRA 4YK4B 5HYJE 1I9IL 5KUMA 3WJMA 1JG9A 2IBBA 4D9LH 5SX4I 3CQPA 1S5HB 3OX8B 5AW9B 5IVNA 2Z92A 3MUGA 2MHAA 1PYWB 4X98A 4XAKD 3MLPA 2HRLA 2Z92B 1YMHB 3MMEB 1F4WL 3OJ2C 1Q9LA 4U1HA 4NKOB 4BWWA 1JHTB 1A6AB 3MRFB 4NO2A 1MJ8L 5TE7H 1YEJH 3UTTB 3KPRD 1M4KA 2ICWA 3L4WA 3R19A 3QIWD 2Y3NA 3ARDD 3PL6B 2GTWA 3UADA 5LDSA 2E7LC 3N40F 4OCSH 4WSGA 3ZIYA 2GEQA 1OT2A 2P42B 2F19L 4C83A 3DX7A 4HXBH 3OL2A 3MHZA 2J56A 3WHXB 1WJ3A 4UOQA 3QZLA 4V11A 3SYOA 4OKDA 1THAA 2FEDD 1U6AH 2R51A 1MW2A 4G83A 4WNQA 3LD8C 3GKZA 1AZCA 1HQ4A 2D3JA 2XICA 2YPVL 3O11A 4HCFA 5BVJA 1U8MB 2Y7QB 1D9KC 3GMQA 3UH8A 4RFEA 4HOMA 5IMOB 4L4TA 7FABL 3P40A 4KKRA 2NY5L 4QTIL 3REWB 3BP7A 4LSSL 4PHZA 4NQEE 5TPWH 4QO1B 2OMTA 3T0EE 5DHEA 1X4YA 3WXWH 5CN1A 4QKTA 3MNWB 2OX5B 35C8L 1IT9L 4N6QA 5HDQL 4B3EA 4PBVC 1BWMA 3C6LA 4XHQA 3KYAA 3U9WA 1TQCB 2CRIA 3MV8A 3QWNA 1HSAA 5AAWA 2ZWLT 1L5GA 4M43H 3GYRA 1JCKA 1I7UB 4I9WD 5AB9A 1G9MH 2ENQA 4JMNA 4A7VA 4YDVB 3N6YA 3V4VH 4GP5B 1R3IL 3BO8A 3BPNB 1OAKL 3FUDA 3FTXA 1YEDA 1U92B 3HE7C 3RZCC 4NXSA 4N8VG 2NY1B 2FX9L 3WUWB 5DVOA 2E7LA 4TNGA 4JPWL 1GPOH 1PIGA 2G0LA 4Y5VC 1M42A 1AAJA 4HKJA 4NP4L 4NCC2 3OJVC 4OFVA 4APQB 2BSTA 5C0FA 4X0NA 4X6FB 4AE0A 3MXVH 2B3IA 3RB5A 3CDZA 2BHZA 1K6QH 2ICWI 5HJ3A 2K4WA 4ZO8A 4NQCD 4YXHH 3PL6D 2GCYB 3C60C 4Y2DB 1TZIA 2JB6B 1OCWH 1FRGL 4X4KA 3HVNA 5D8JL 1OK8A 1UH3A 4GQZA 5H94A 3VXPB 4AYBA 1L7TL 3BKYH 4ACTA 1OGPA 1NUGA 3O3AA 3O6FA 2Y7SA 4PRIB 1JPSL 4GAJH 2EIMB 1LK3H 5J3HD 4OJFL 5DRNB 1SMAA 4JFFB 5A3ID 2QR0B 2YMTA 3D2UB 5K9KA 2XZAH 2JK5B 2WWMD 3CZSA 4KV5F 3WN6A 5SWZD 4DP7X 2WKGA 3QUKB 3RWHB 1Z0NA 5DK0B 3WNMA 4S1QL 1Q9OB 4FG0A 1UQSA 2X4NB 3EOAA 3SPJA 4AXWA 2CO2A 4KDWA 2Y22A 4LNRA 2BC4B 1MVYA 2IXQB 1E6OH 3CFBB 4P5TC 1VEMA 2PO6A 4G6FB 4M6OL 1DEEA 2NNRA 3BFWA 4RRPG 3BUYB 3V55A 1UZ6E 5DVMA 1RUAH 2X4PA 2X2YA 1JYWA 5BNXD 3HLKA 4NRYB 2WLLA 1OSEA 3CNKA 3MZGB 4HIQA 4JBSA 1PL3A 4ANUA 1OW0C 2WQSA 4L48A 4BKLA 3HJEA 4GLRI 2BHFA 4CC4C 1NC2B 2C34A 4NWUL 1L6PA 2LVEA 3EYQC 4Z0XB 1F11B 3HCVA 3DRQB 1YC7A 5B3JE 1IBGL 2EXWC 4AL8C 2EXSA 1I85C 1ND0A 1R3IH 4W4OA 2HP4A 4PRAB 5I8OL 3T9WA 3M7FB 1T7ZA 2AZAA 3ILEA 1CE1H 4D9QD 4Y7OC 3OM3B 3FUHA 2RD0A 4UQ2B 4TULL 3FB5A 1NBCA 3FTZA 5D2NE 1WAAA 3AAZB 3KM2A 4KRPC 3HRZC 5F21B 3DYOA 2GIMA 1UACH 1VDGA 1G7JB 3HW7A 2C26A 4I7ZC 3O2WL 4FI6A 1QNZH 2DL2A 4L29B 2D7PA 4JAMB 3ZRSA 2TRYA 3O2DL 1YPZA 5EOTA 3PABA 4HULB 3FFDA 2CR0A 1R4XA 2FBJL 1BG9A 4N0FA 2WQUA 4N20A 5B3SB 3LZNA 2HTKC 1KTLA 3OC5A 2JJSC 1O7DE 1HSBB 1UJ3B 3GMNA 1UD4A 3ENEA 4JRFA 3HZVA 3NIFE 4IJTA 1TENA 4OGAD 1ZLSH 3MLWH 3TJEL 3ZGHA 1QHOA 5CR8A 1E4HA 3NIDF 3DX3A 3IDYB 3IWVA 3BFOA 1AHWA 4FLRA 4Z7QE 3C08H 1NGYA 4Y4KC 4U0RB 3GSNH 4Y1TA 5AVQB 4Y1AE 3EJYC 2Z31D 1IIIA 4UWQB 2BSBA 5F97E 3JXAA 4GINA 1NCIA 4ADJA 1JZ7A 4ZUTB 2PKDA 4FKHA 1MVUB 4YHPB 3WNNA 4YVUA 4M61B 4PJEB 5CUSH 4DNLA 3MNMA 1O75A 2R0WH 1TU2B 2RFXB 5FYLL 3BPCB 2WNXA 3UO8B 1XCXA 2JXMA 5AW6B 2RMNA 4JFVA 3VXMB 3DPDA 1M3JA 1MCFA 5E2JA 2CZNA 1CXFA 5IJVA 3CFUA 3BP6A 1M7IA 2Q87A 2EQDA 4H25A 2A9NH 1NCJA 3CTTA 3GGWA 2DN7A 2IDUA 2NNCA 1G4MA 1CJYA 2WOBA 3LZFL 5HHNB 2OP4H 1QSFB 3AGWA 3A4FA 3FT4A 1TYEB 2FIRT 4KUZL 3C87A 3SBPA 1CQYA 3OWEA 4HEMA 3IJHA 4BZ2L 1KCRL 4JFYA 1KDIA 2X3AA 4OIIH 1KEML 2DM4A 1A4JA 2ZX9A 2XA8H 4F37F 1H8LA 3D39B 2E8YA 3IJ8A 2AQRA 1LILA 2CDGB 4ODVL 2XN9E 3UTQA 1MHPH 1IAKB 4AL8L 2BVPB 2P28B 1ERNA 1SFHA 2ZOOA 1IEBB 3H9SD 3G08B 5DFVC 2XETA 4TVPL 5F1KC 4NHCL 4JRYD 3APFA 5FGCB 5TDNB 3LQAL 3OG6B 3CVHH 3CXDL 2X9XA 5DMJB 2GPZA 3OKYA 4MDIB 3U0TB 4D0DB 4CL7A 4PD4J 2X10A 3O6LH 3ATFA 4QRQB 2X1PA 4QT5A 3U4KA 5EF0A 4H0HB 2QGCA 1LDPL 4NDMB 2CLZA 1A3RL 5DR5L 2ZOWA 1GCFA 1YG9A 3GD1C 3BLKA 3FFCE 5EUOE 4ZSOA 5E1HB 2OYLA 2D4DA 4HMEA 3CFDB 4GW1A 1ECZA 5EZPA 5EZIH 4JVUA 1KJ2A 5FWRA 5JXEC 3QCUL 4UQ3B 2DWSA 2JTDA 2ODIA 5BV7L 1IKNA 3N1QC 5CZVH 3BPOC 3DOHA 3PP4L 5ICXB 2ZWSA 3O8XD 3V0VB 4JW3A 4LHUA 2HG5B 2PWDA 1GGTA 2BWQA 1IM3D 1JSYA 3EGSB 2H3XC 3SQOH 4YS4A 4S1QH 3V8CA 3MCKA 4XMVA 4WHYH 1FE8L 2ZJSL 3LKOB 1F00I 3GJFA 5E6ID 2ITFA 5FO9B 1Q0YL 4ZO9A 5AW4B 3SGJA 5ESQB 1E30A 5I1LB 2VXUH 1PG7H 4UQBA 1DE4A 4LGRB 4AX3A 2AMUA 5HGBB 3J27A 3PIQA 5I6MA 3BGAA 4LVNB 4AYSA 1IIKA 5FDYA 3JUYA 3QIWA 1LEIB 3LN4B 3BGMA 5C09E 1QR4A 3GDBA 1X5LA 1UM6L 1NFDA 3QIBA 1DBBH 3F85A 1AHWB 4M1GL 1T1XB 2A6KA 3VRIA 5DC2A 3WNJA 1QBAA 5C0BB 3DARA 4Q9RH 3QUMB 1VF5C 5CU5A 4AL8H 4OV5B 2ZXGA 3EGDA 1BVKB 1IKFH 1XGRA 5FB8B 4HGMA 5J11C 4XMKL 1ZS8A 3FU9A 4L8SC 5B7FA 2XVLA 3MV01 2Z31C 3MA9L 4X4YB 2C9AA 3GDCA 3RWCB 3NTCL 1XCWA 1QNZL 5CS7A 5CKGA 3RDTC 3ULSB 1RY7B 1BMZA 4B9ZA 3WTYA 1KXHA 4MLSA 4QHKJ 2YD1A 4X5RA 2DB8A 3ZX1A 1MH5B 2BNRD 4ONFH 4OF5A 4JY4B 2OMVA 3NFPB 5DRZB 3BD3A 5CCJA 4JPQA 4U3HA 4PJEE 4LQFL 4P9ML 1GYUA 2CBQA 5FAAA 2KC0A 4F9PA 4ODWB 5I71B 3JTTB 1A3RH 2XG4A 5A16A 1J9CT 1TJGH 1UCBL 2J1YA 3IU4L 1G7MA 1XIWA 2ZXEB 1NBQA 1BFVL 4EJ1C 4X0KB 4I13B 4I0KA 5DI8B 4HS3A 4YE4L 5L4IA 2K3HA 4WWNA 2R1YA 5IESH 3BD5A 3RGHA 3RX8A 4JPVL 5E00A 1XB8A 2ZOUA 3TBCA 5E9DB 1NBVL 1E8YA 1V10A 1W2KT 2FL5A 2J44A 4NRXB 5E5MB 5AW1B 4Q58C 4ICWA 4FJYA 2VXSH 4GG8A 1GPOL 2CCWA 3S4SB 5FYJH 2R83A 1WD8A 1OIOA 2WLMA 3QJVB 4JVPA 2XKNA 1JOIA 3EFDH 4XODA 4X6BA 3ARWA 5GIRB 1RJLB 2A4CA 4LBEB 2WLLB 3T6ZA 4LRIA 5ADPH 2QV4A 3FUFA 3IFOA 3ZQXA 3OVUB 1CLYL 3NIFB 1CDBA 1D3CA 3PXHA 3B6SA 4PGBA 1K85A 4JUSA 3PWVB 4K3JL 4EDWH 2AXWA 3GF8A 1EEZA 1FZMB 5JPNB 3E6HA 3RURA 4KUZH 4PG2C 2KI6A 4LSQL 4EN3B 4X6CF 5FECA 1J1PH 1H3PH 1H3WM 2ZD0A 5C0BD 1CXHA 4NZRL 1EZVY 4ODXA 3OHMB 3DVIA 3VE0A 3VVVA 5IMMB 1FRGH 3AB0B 3LZFH 3QUYA 5T5FL 2DM2A 3QS3A 3EJJX 2UZPA 4OGYL 3ZZQA 1VFMA 4KH2A 4JM2B 3KPOA 5AB2A 5KVFH 2YPLB 2CO3A 1TKWA 2X12A 4JKKA 5I73B 5K33A 2I26N 5GSRA 2AQSA 5BVPH 5C0DB 4XPTL 1YNLH 3U36A 5CO1A 3V0IA 2ZXCA 1BX2B 1NGYB 2D7MA 4X5LA 4IMLB 1BD2B 2WKLA 1E6OL 1UA6H 1TO4A 4K7FA 2PWHA 3IPFA 3O9WD 5J8OA 3QUMH 2G9KA 2IV9A 2O72A 4DN4H 2WNKA 4YDIL 5AUMB 2E7DA 1SUJA 2FSDA 2VABB 4IRJA 5G4NA 5C0FB 4YQXH 4QPEA 1OXYA 3O81A 3E3QE 1QFWH 3EYSL 4U1IA 1QRNA 5C7XL 1BSIA 3IDJB 4QRPE 2EEDA 4IHBA 2WWOA 5EU4A 3INUL 5E4EC 3C2AL 1SMDA 1R19A 5AG9A 3BWUC 4PB0L 2NT1A 3RFRA 4DAGH 3OB8A 3GI8L 5BQ7B 2YPVA 4YHKH 1IQDB 4OFYA 4X9GA 5CP3H 1ORQA 5DJCA 3UAEA 5ACZA 4FMFA 4Q6IB 5F88B 5JOPE 3AWEA 4ZX3A 2D3LA 1SVCP 5HDOA 4CNIB 3L3OB 1MNUH 4KKNA 3G6JA 4A67A 4ZFFB 1N10A 5DDHB 2FJHA 4M8QA 3DVGB 1J8HB 1EUTA 2NT0A 1WIUA 3B9KD 5T33L 3QFJB 1SUHA 1KPUB 3E9TA 3K8MA 3L9BA 1T7WA 1KYDA 2Y7LA 2QZQA 3MODH 2G0KA 2QFPA 3HS0A 4IJ3C 4L3EA 2Z8VC 5HHPB 1MFMA 1T20B 2FBOJ 1ML0A 3AADB 1IGIH 4FE9A 4WNQB 3PUUA 3IFNL 4WO4A 3EDFA 4F2MB 3D6GA 4Y9BA 3Q8FA 4NQSA 1R3LA 1N8ZA 3BZ5A 3N41B 3V5KA 3KDMB 4BSWB 1TXKA 1UZ8A 3GK8H 4IRJC 4PJAE 3TCTA 1FGNH 3C5ZD 1LGVA 1BQKA 4N0CD 3HHSA 3GLZA 4IRSA 3KEHA 5BVPL 2GBVA 3RX9A 1NCCL 5TDOA 3SQBA 3TP4A 2DIAA 3NESA 1QEWB 2DTMH 3F6LA 4ZFOL 2WXJA 1SBSH 3KYOB 1CDIA 5I8KL 2XKUA 5EO0A 3L4CA 3IJEB 1JPFA 4U2YA 2WYHA 2CXKA 4HUCA 3IDNB 4XC1L 2CHDA 5ABAA 1RPQA 1MY7A 1E4XH 1U2HA 3TJPA 1NGXA 1NDMA 3LHPH 4L05A 3T3PF 4ZXBA 5HJDA 4G5ZH 2DDQH 1MEXL 1W91A 4OQTA 4LRNL 1ANUA 4QYOB 1MCOL 3UTSB 4RDQF 4S11A 3UJTL 4KXCA 2BVUA 4FP8L 5DHMC 2GI7A 4I1PA 5A43C 1EAJA 2NY7H 5KTEL 5I2IB 3WFHA 5MEND 4AYGA 2WIMA 1FQ9C 4Z78B 1XTLA 4XZUB 2YRLA 3D85D 5BS0E 1ORSB 3QDJA 3UZVB 4Y19A 3GC3A 2VW7A 3GHEL 5ETUB 5CIPB 4R0LA 4PBWD 3RWEA 4PJ9C 4C8XA 3VB8A 3T2QA 1CVSC 1JV5A 1BQLH 3EYUL 3CFEB 3CDGB 1FNGB 3O3EB 1E5AA 1ZHKB 4U05A 3KBFA 4OCWL 5KVGH 1JCVA 1D2OA 2CHNA 4J6RL 3F7VA 3MXVL 3QXWA 4HIHA 1IBYA 3MOAL 1L5GB 1JFQH 3HNSL 3HPJB 2XKSA 3D25B 1MUJB 1NBYB 4M62H 3UGEA 5D5MA 4EBQL 4OTXH 2BRRL 3BAEH 2E9WA 4R0LB 2VDPB 4P23A 4HFUL 2OMYB 4FMVA 1U95B 2ADFL 1CU4L 3UZVA 2V5MA 1WV7T 1R9FA 2GTZA 3DECA 4BK5A 3RY4A 4OSUH 5DD5L 2XN2A 2F7OA 1QSEE 4X5XB 4PJCA 1RZ7L 4HJTA 4OLYH 5EU6E 2J71A 4M62L 4U1MA 4XOAA 4Y9EA 1IM9B 1BLIA 4YZFE 5GGTL 5ID1B 2H47C 4MJIA 4HX1B 4HIHB 4OCRL 4JPKL 1VHPA 4HLEA 3Q5TA 4OLZH 5E0QA 1D7BA 5FDWA 3V5DB 1NEUA 3MRCB 4YOKA 4PV1C 3G5ZB 3RWEB 3DHMA 3U0WH 1OCCB 2IAMC 1HL9A 4QXUH 4XNXL 4PJBF 5F7LB 1INEH 2W8CA 2X9WA 4OD1L 4JS7A 4EZMA 4Z78A 3FSOA 5IVXA 1SXBA 2VWEC 5KJRL 3OLIA 1I53A 5C0RL 2PYFB 2N1TE 2AJVH 2APVA 2ZOLB 4XXDB 5E0FA 2E5EA 2X4OA 3RX7A 5SWSD 2HTLC 3GSRA 4KXZI 5KN5B 1JHTA 2DQJH 2ITEA 2DWXA 2UVFA 2VDLB 4XC3L 1Q0YH 4XP6H 2FVNA 3V5KB 5JHDB 1PDKA 5FGRA 3ZKXC 4CU8A 3RZCA 4TM9A 3DX2A 3U7YH 1YECH 1T5XA 3HS9A 4HAKA 4Y5VA 5D7JA 4DN4L 4FJZA 4P23C 1TTAA 3U25A 3F12A 2GVYA 4QEGA 1FZJB 1AR2A 2LFGA 5DJXB 4RISL 3N43B 4IKLA 5LGKA 2RCSL 3WFCH 4Z7WA 5HYIA 2HFGL 1OB0A 1GSKA 4P2CG 4PLKC 5GS1C 3NAAH 3UBHA 4D0CB 3UOAB 4KXBA 4HUWA 3EJRA 3NOIA 4L4VE 2X1WL 3KH3A 3ZE1F 2VSDA 4PJIE 1R3HB 5DMGD 2QTEA 5FA4B 1QLEB 3BLBA 4OAWB 4ZD3L 2Z35A 4K8RC 5CSGA 4RISH 1HH9B 3RA7L 1ORQB 3MKGA 1DBKL 1QFUL 3D18A 2OTWA 4DGWC 1I3VA 4FKKA 1GZQB 3UTZB 3UX9B 4ODSL 2Y1AA 1PX4A 1DJWA 2QADB 4GB9A 4Z7VB 4LLVB 4WFFE 1U8LB 1RZKL 2WBJC 5GISL 3VGAC 4KJQC 4Q97A 4AZ8A 1NCAL 3KPRE 3F64A 4OLWH 2I07B 1S2EA 3WXVH 4A6YH 4NKDA 4CJ1A 1QUNA 3GBEA 3BRFA 3HFML 3VFGL 3ZDXF 5ITBH 1UKSA 3D2UD 5CLTA 4NFDA 1QLRA 4OM1L 1JZFA 5IQ7L 4DQOH 2F5BL 3MRPA 3RYMA 3NQKA 1N7MH 1U2CA 1TETH 1TQBC 4G6KH 2GJ6B 4KX8A 2YA1A 1R6VA 4B6ZA 3F7YB 3II1A 3LEXB 5F1OB 4N22A 3NA9L 3CZJA 4LP8A 3MV9D 1FP5A 1M7XA 4URTB 4LU5H 4BQBA 3QCVH 4JHUA 4LOFA 2V0AA 2H26B 3O2WH 1EGJL 1KJVB 4MCMA 1TDQA 1RQ5A 3ULUC 2JQMA 2LU7A 2F1AA 3ZK0A 2CUHA 4JFDB 4QGTA 1DUZB 1KPRA 1JPTL 3Q48A 2K6WA 3QNXB 1HQRA 4K94L 3OKMB 4OM0H 4YSTA 5E9NA 2NY6B 4OZGE 4MBOA 4XCFH 5LO7A 4KI5D 1Y18B 3TN0C 1JWUB 5EU6D 3JWOH 5FWQA 4KUCF 1Z7JA 4NQEA 2VDLH 2W38A 3QI9B 4PJAB 5C0DA 1CK0H 2KMWA 4PAZA 4TSCH 3IMBA 4XAKE 2MH4A 4WUKH 2HN7B 1YYLL 5KVGL 4Y19E 3CFKA 3VVWA 1RH8A 2N3JA 4KZEL 3QDHA 1A9BB 5I30L 3R1GH 1TQBB 3QVAA 3EJZD 4KGLA 3SKOA 2FZ3B 3NJXA 2XXGA 3OV6A 4IOSA 3GMPB 1FNSL 2BVQB 4ZTOH 5FIEA 1OE1A 3SDXE 4OLXH 4LEBA 5E9DA 3WFBL 2EVGA 4AT6A 1H3XA 5FFLA 4RFNB 1XGPB 4A6YA 1EEZB 1FZMA 1I7RB 3OKEB 2JIXA 4NGHH 3PWLA 2X2UA 2BOCA 4UQDA 4X7TA 2YFNA 4WW1A 2AAVA 3HAEG 3AREB 4HSAC 5DYFA 2R0KH 2AQPA 3U4EB 3RDJA 4N2LA 1FH2A 1AZUA 1LQBC 3WFBH 4Z3HA 1HT6A 2Y07L 2J1ZA 5DRZA 2ZCLL 2WTRB 3WN5C 4KO5A 1DQKA 4I89A 4ATTA 2AXFA 3F01A 1SQ2N 5FLVA 4BZYA 4N2EA 4PW3A 3RY6C 2LW3A 3PYCA 4WWKB 3GI8H 1ZJAA 4DJMA 1INQB 1KELL 3WO4C 4PIRF 2XQYA 2X5PA 3FU6A 3TWYA 1HL4A 4G9DA 5JW4N 1CYXA 3D05A 5JZ7D 5KS9B 1F6FB 1EV2E 1C12B 1LTXA 4QRSA 3N3EA 1X6LA 4P5KB 1QHPA 4YPJA 5FCUH 2XNAA 5CKAA 1R3KB 4X8XA 1F41A 1DLFL 5E99H 1ADWA 2AEPL 4BDVA 5T1JA 4G8FB 3FCTB 1O6VA 1ZD6A 5FYKU 4AKPA 2ADIA 3ZKSD 1LO4L 1NDTA 3HE7A 2O30A 2V2XA 5HHOA 2XWCA 5C0GA 1K4DB 4F15B 3WKQA 1PQZA 1EZVX 1QFHA 2F8XC 4KAQL 3GPEA 4OFYD 3CU1A 5DFVD 1BVKA 3AT8A 2ODHA 1VKXB 1TPXC 4XWOD 2WXKA 1U3ZA 1EFXD 3TS8A 1JHKH 4Y8DC 4QRRB 1T1XA 2A6KB 5IMKA 4IM8A 5K9QG 3AM8A 2NPLX 1E9QB 4GAFB 3OPZL 1E9QA 3NCEB 3GRBA 5HY9B 1GR7A 3KYMB 1U3HD 1DQJB 4LB8A 5CEXB 2GJZA 4YGAB 4P2RB 4FQHB 1PG7L 3ARYA 3SO5A 3ROOA 2A99A 3RNKA 1NA8A 3QNZA 5FYLD 1JGLL 3LRGA 3SJVD 1KYAA 3WFZA 2P8MB 1MAMH 4U1SA 3BRGC 1G0DA 2VN3A 1KGWA 3PHQA 4Y4KD 2XN0A 5CN2A 3H8NA 3SQOL 3V0EA 4LCCB 4PS4H 5CCHE 1KCKA 4YIQA 1IL1A 4KHTH 4Z5RB 2GEEA 5E9DE 4LHUB 3TEUA 2R29H 2QHRL 3K4AA 4EE2A 2P5PA 5AB1A 2H45A 1BQHA 1HOCB 3QZWG 4NNPH 3U30C 3QHTC 1PSKL 1WH0A 3UC0H 3LIZL 4PHXA 1IJ9A 4OF0A 1A6WH 2B39A 4U33A 4KJQD 4WI2A 5EU5B 3O4LB 3NP4A 4LKXA 3DURB 4LEOA 2YA2A 4NUGH 3JUZA 4XN5A 1EBPA 1JE6A 2CDGA 3GXFA 5BW7C 5B4MC 2DBJA 1KIUB 2GBAA 3P1VA 4YSUA 3TZVB 1PZCA 3RTQA 3GSNL 1W0YT 3UIZA 3PV6B 4D8OA 3MRBA 5TTRA 5HD8D 2V2WB 4D9QE 4J3SA 4X80H 4UBDC 3SO3B 4WFEE 1G5AA 4GW5A 2FQDA 3HIZA 1FN4B 1XQ4A 4G6MH 1DJIA 1YQVH 5DVLA 4NQUA 1JERA 1SJEA 4F92B 2WINA 4F9LC 4D3CH 3WTSA 3L3KB 3QH3B 2Y1VA 1MWAH 2MPAH 5GRXG 2QPDB 3DXAB 1WTGT 3EKCA 3S34H 4LGSB 4RWYL 3BZEA 1IAKA 4FAAB 4FFYH 3TWCL 5CJOH 1BECA 5DFWH 1ZK9A 3ESPA 3BSZA 3SKJL 3KJ6L 3UJJH 1GRWA 3MRDA 1T89C 4P06A 3TO4A 3BUDA 5C6WH 4WK0B 4WI0A 2VDKL 1UM6H 4D94A 1J5IA 1F1GA 5L4FA 1N3NB 5TJWK 3KW7A 1USQA 3FTGB 4MJHA 3T4AA 4YO0B 2OL3A 3EZ8A 2IBGA 1DQIA 4DKDC 5CF3A 2PN5A 1XIWC 2JI3A 1ZDQA 3FFOA 4N9OB 1NLDL 2IANA 4HV8B 3GMRA 5FHBL 3VFSA 1GYVA 4XVSH 1OTSC 2NW2A 5TGBB 4IBSA 1NBZB 1KGCD 1G7PA 1URZA 4OCNC 3UYPB 5GGSY 4FQIH 2JB5L 4X4XA 3UC0L 2E4FA 3V0GA 4BZ1A 4ABWA 3FK3A 4X8JA 1CT8B 2IMMA 5JPNC 1G1CA 2W94A 2XG5B 4YH6A 4GRMB 4MMXB 2GJJA 4AH2B 1GC1H 2OI9C 3IS1X 1KV3A 3FBQA 1KYFA 3QARA 4NFCA 3OXRB 4RDBA 2VLKB 1T1YB 3DTDA 4J1UB 4O4YL 5J1AA 3TYGH 3ZDYF 4DF9A 1PEZA 2PXYD 3PABB 2FB4H 3BUTA 3I6LE 1RLBA 1ZHLB 4JRXB 3V4PL 4YDLC 3EH5B 1K8IB 4N87A 1F3DH 1T89A 2NDGA 3P11L 5IJCC 1SDDB 5CZKA 4ZUUA 2MKWA 2AXHA 1BDYA 3NH7H 4EOWH 2HLFC 2FX7L 1EK3A 1A7PL 1RUMH 2J12B 5EC1B 1H3VA 3VGHA 4G5AA 5DWUH 1KCVL 3VI4F 2YGVA 2G60H 2VDMH 3BQVA 1NCBH 1KTLB 3FT2A 3J2PA 1XF5A 1JGIA 5DEJA 3VD0A 1F86A 1ETA1 5B22A 3V7AG 2DWDA 3GXPA 3HBPA 3KDMA 5I1GL 1Z5LB 2JKJA 2UZIH 3H9SE 4NT6B 4Y2LA 5C0AB 4BGDA 2XIBA 4LQ1A 1TVBB 4XNQA 3REVB 5D4HA 5HDBF 5I1CL 4LHJB 4QIRA 1MFUA 1OAYL 1DJZA 1HEZA 4WEMB 5HYEA 2CJUL 3U82B 4JJOA 3ZYOA 3ZSSA 2DEXX 3IXAB 5DWPA 4BFJA 1Z9OA 4PJGE 5JUEL 2QSQA 2R23A 3SJVE 3VACA 4OUUA 4I5BB 5CEYA 3VGFA 4XH2B 1P6WA 4K3GA 4TNWF 2YAFA 3HZKA 3BIBX 3QFDB 4P59L 4YXKH 5DDHA 3QDGB 3SIKA 3C9NA 4XN2A 3DRQA 3N42B 3ZDZF 1YQ2A 3T71A 3U1PA 4YJZL 5D1ZC 1EVUA 5LN8A 1U8CA 1X3DA 4UT6L 2YEZA 1J12A 4ELKB 4JR9H 3MGOA 4TSAH 4U4IA 4Y5VB 1NFAA 3IT8D 4HF5H 4PMEA 4RBPH 3S37H 3UTTD 2QV2A 3NTCH 1NJ9A 3EO1B 3FQUB 4XVTL 4NNXB 4DZ8A 4TUKL 3LNFA 3KL3A 3DTUB 1BJ8A 3ABZA 5F72S 2OJZH 3T77B 1SHXA 1VEPA 2QSTA 4AXWB 1CGYA 5I9QC 3KPTA 4ZUSA 4PS4L 1E8WA 3FN9A 2BVOA 1VESA 4PJCF 3LQAC 4MKTA 4PGCA 4GMSH 4W9DC 3CXFA 3HLAA 2CQVA 3LIZA 5EIQA 2WZPD 2G3XA 1F0LA 3P3SA 4OJEH 4GUOA 3E2HC 3BSGA 1N59A 2CK2A 4LXFA 1DDTA 3B7UX 1ZSDB 1NM4A 5M94B 2VWEE 1K8IA 4WW2B 4LPUA 1WRFA 1TJMA 4DZ8B 3UZEC 4LOEA 5C09D 4GIPD 2X38A 5IQLA 4P9HH 4MJ6B 1GGIH 2I60H 2BY0A 2ZX6A 1JZ5A 2K3TA 2W59A 5DUPL 1JMZA 2XQ0A 1PF3A 5JW4Q 4YN3A 4AMKH 2WWKO 3RFZA 1F3DJ 1QSFD 1CI5A 5GHWH 1I1FA 4X5XA 1IAIH 4GRMA 4MMXA 2ENPA 4FQ2H 5DC4B 3HUJE 4A2MA 2VLJA 1DHKA 1YQVL 2R39A 1E6JL 1U95A 3GRGA 1VGEH 2ZQKA 2VDKH 4C47A 5E1GA 1AKPA 2I5YH 5FYLH 4M6ML 4OI7A 2EEAA 4PJHF 4ZW8A 3VW3H 1AKJA 1QLFA 3BT0A 5ICYA 2GSIA 1YNKH 3FUNA 1UCTA 1HQ4B 3O11B 5BVJB 3BVWA 3C5ZA 1QZ1A 1VCAA 5EWIH 4EUPG 2VZ3A 2E0PA 4PYHA