3GFUA

Faee-faeg chaperone-major pilin complex of f4 ac 5/95 fimbriae
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
211
structure length
211
Chain Sequence
SLAVDQTRYIFRGDKDALTITVTNNDKERTFGGQAWVDNIVEKDTRPTFVVTPSFFKVKPNGQQTLRIIMASDHLPKDKESVYWLNLQDIPPALEGSGIAVALRTKLKLFYRPKALLEGRKGAEEGISLQSRPDGRTMLVNTTPYIFAIGSLLDGNGKKIATDNGTTQKLLMFMPGDEVQVKGNVVKVDSLNDYGELQTWTINKKKPAAPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion
molecule keywords Chaperone protein faeE
publication title Structural and thermodynamic characterization of pre- and postpolymerization states in the F4 fimbrial subunit FaeG
pubmed doi rcsb
source organism Escherichia coli
total genus 39
structure length 211
sequence length 211
chains with identical sequence C
ec nomenclature
pdb deposition date 2009-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00345 PapD_N Pili and flagellar-assembly chaperone, PapD N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3gfuA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3gfuA02
3FO0L 2A9ML 4R4FH 3S3SA 3WEXB 5EBMA 2DQFB 4J3VA 1P4LB 2GY7B 2BOCB 4KUCF 5IMOA 3DBXB 3L7EB 3SDCD 3GJFB 5BRZB 1PY9A 5HYJB 1T83A 1TQCB 3UTSE 4WDIB 2ADJA 1ZT1A 2UZXB 4DW2L 3U6RA 4S2SB 5GZOD 4OM0H 5DQDL 5J89A 3MRGA 3PP4L 4U1HB 3HZMA 1OAQL 4O9HL 3NFSL 3VI4E 4TRPL 2NXZB 3WSQL 3KPMB 4DVRH 4XVTL 3ULUD 3UP1A 1QR1B 4N0UE 1MCIA 3UJJH 3MLZH 4UB0H 3LQZB 1ZT7A 2V2TB 3GMLB 4NOBA 4O02L 2R4RH 1JGDB 4JDZA 1U6AH 2R4SL 3BZ4A 1FGNL 1R3KA 2HLAA 3MCLH 5IJVB 4HHAA 1MCDA 2IPKA 1AHWB 2Z9TA 5D4QA 4R7NA 3IDMA 1JF6A 3VGBA 4EXPX 5EC1B 4R0LB 1FZKB 2IH3A 2R0ZH 4OZGA 1ONQB 2JIXD 3RPKA 4NQDD 4JLRA 4F3FA 1K8DB 1ITCA 4M5ZH 4EJ1C 4HV8B 1IAIM 4PJCF 3VFGH 4XGZB 5HHOD 3Q6GL 1KTDB 3N85H 1NLBL 2F8OA 1V8HA 1S3KH 2WBKA 3TEUA 2R29H 4L3CA 2W9DL 2DQJL 5IVXF 3PGCB 4Z7UE 1IC7H 4OGYL 3V52L 4Q0XL 2J6EH 1SJEB 4DOHB 1I3RB 3MRMB 3VWJA 5EZOH 4YFEA 3GNMH 4MCZB 4NQCE 3NZ8A 3PXHA 3GMMA 1B6DA 2K1MA 4NYLB 3DUUB 2HKHL 4MD0A 4DGYL 4P5KB 1JGVH 5C0CB 4H8WH 3O8XD 3DJ9A 5L2KE 4M6OL 3EKCA 2C26A 2FX7L 1HHJA 2BVPA 3KPQA 3L7FB 2QADC 3SKUD 4PGCB 4LCIH 4XP9H 5CEYB 5T1LD 3OAYH 2KUTA 5C0GB 3VMPA 1RHHB 3BRGC 3FB7B 4Y16B 2EE6A 3VXRB 3C2AL 3Q48A 4UNUA 1LD9B 1W0VA 2HMID 2CDGA 3MLRH 5K93A 1JPST 3IU3A 1J1OL 1VPOL 2QLVB 4BUHA 3DARA 3ARXA 4XRCB 2YN5A 4JZOB 5TPWH 1QLEL 2GCYB 2FLRT 4ZUWB 3TA3D 5TH2A 1E27A 2I5YL 4HD9A 5I6XC 5MHSE 3THML 1H3GA 1UC6A 3S37X 4MNGB 2VLJB 3H9SE 2OP4L 3SCMB 3IDJA 4IJ3C 4OFYD 1EHNA 3HE7C 3D48R 4ACPA 3RHWF 4P46B 3HZYA 5DJ6B 4CNIB 3U7YH 4KI5E 3UPRA 1MPAL 1XH3A 3DV4B 5I0DA 4GS7C 3QB7C 2A6KB 3PIQA 4V1DA 3V0VB 3CVHB 2HJLB 3B2VL 3BO8B 1WBXA 5GZND 4HSQA 3VGEA 5AZEL 1IGCL 3D2UA 5A16A 4LLVA 4E0RB 6FABH 4NBZB 3F7YA 3IU4L 1UXSB 1KFAH 4G8GE 5GS3A 3S35H 3U4BH 4KK8D 1RK0A 4UIKH 5D96B 5BV7H 1KXTB 3OB0H 1J5OL 5ITFA 3BZEA 3LZFH 3WIFB 1XIWC 1HI6B 3OXSB 3OB8A 3JV0A 3SDAD 5L88H 1V7NH 5AZ2L 3W11D 4S1RH 5DVKA 4Q74A 4FFYL 2DQFA 1QSED 1EVUA 3H0TB 5CD5D 3QIUD 4IS6B 2BOCA 3IYLW 1OQXA 2HJFA 5D6DA 3DBXA 1KENL 4OGAC 4PB9L 5HYJA 1WLHA 4N5EC 1T80A 4WDIA 5KSVB 4H5SB 3QDGE 3GGWB 3WE6B 1T03L 2ZNWA 1RJZB 4OZHF 1BQSA 4S2SA 4EN3D 1JUFB 4ERSL 5EORH 2NY0C 3U0PB 2Y5TA 3QXTA 1FHGA 4YHZH 5LCVL 4OUOA 2CPCA 5IVZB 1N26A 4U49A 3KJ4B 3B9AA 3KPMA 5E24E 4GBXB 4JDVB 1QFWM 2OM5A 5T1KD 4X6BB 3X14B 3SEPA 3LQZA 4ELME 2VZVA 4PV9A 1IGMH 1BEYL 2FHBA 1IC5L 2V2TA 3GMLA 5C07E 2H3NB 1J9CT 1JGDA 2GKIA 3CX5J 2DB8A 4FMFA 4PJIE 1MCCA 1T1WA 4LSTL 1AHWA 1WC7B 3MYZA 2MCPL 2YZ8A 4YEFA 1LO3H 5EC1A 4FZEH 4R0LA 1HCVA 1TCRB 1YNTA 4QO1A 5GGVH 3TP4A 2AEWA 3VD4A 5H94A 4PJBF 4XGZA 5KSBE 4PJ5E 1ZGLM 3KYKH 1CDCA 1KBGL 4XVSL 1KTDA 1CBVH 2HH0L 1CICC 1V05A 1OTSC 4K3DH 2R9HD 3BT2L 3PGCA 4RSVA 1SJEA 3SDCB 1I3RA 3MRMA 3WV0A 2VDPL 3MLWL 3VGGA 1CK0H 1L9NA 1RV6X 4HIXH 4IHOB 4LDEB 3WFCL 3MLYL 4MCZA 4S1SH 3SGDH 3TNNB 3TYFB 1O7SA 2ADFH 4KKNA 3RJQB 3DUUA 4M9PA 4JKLA 2DYPD 1UB6B 3U4AA 5C0CA 4GO6B 5TF1L 4DAGL 3EBAA 5JPMB 4EBQH 1Z5LA 2BJMH 2YA0A 3L7FA 2AS5M 4QWWC 4PGCA 1OWWA 2YRLA 1BM3H 5CEYA 3BD3A 5GIRA 3BRFA 2UY7A 4B41A 1GGIH 3RUGF 5C0GA 5HI4D 4C55A 3FB7A 4Y16A 1KGCD 4CKVX 5I73C 1IGFL 1LD9A 4HBCL 3CLEL 2HN7B 3K2UL 1XF4B 5FYLL 4TULL 4FQ2L 4XRCA 3MBXL 4K7FB 5DJDB 4KXZH 4JZOA 4LAJH 3E8UH 4OBSA 3PWPE 4XHQA 3V0AC 2P45B 1MY5A 3W2DL 2BY3A 2GCYA 3N9GL 5HD8D 4PJXE 4ZUWA 2ZZUT 5IFAH 2JIXB 5FHAL 4N0YH 1QFUL 4NQDB 3KVQA 5ACLA 2NZIA 1FN4A 12E8L 1DVFD 4YWGH 5MP6L 2LAGB 2JELL 4GG6E 3GMNA 1DBKL 4XB7A 2NNAB 1MFAL 4NWTH 3QXVA 1NSNH 4YXLL 5DYOA 3UZEA 4NKOB 4WWID 4WW2B 3MRPB 1YJDL 1AGFB 1DBMH 3JWNC 1N5YL 3FQNA 2VISB 1P7HL 3S8WA 3V79C 5TE6L 5DJ6A 5LGKA 4CNIA 3VXUB 1VGEH 2C3GA 3L3IB 3QNZB 3HCVB 3DV4A 2QQLH 1X5JA 3O8XB 2A6KA 5I18H 1NCAH 3PABB 1G7JB 3CVHA 2HJLA 5CEZH 2P44B 5KVEL 3LB6C 3BO8A 3QUMB 5I19L 5HHXL 3UTQB 3GK8L 3EYUL 4NZJA 1CR9L 3AM8A 1SJHB 5DFTA 3DSFH 3CK0L 3W0WA 2UVEA 4OCRL 3ARDA 4RMTA 1EO8H 4NDMB 3HB3C 4AMKL 3GMQA 5CINH 3RIAF 1MNUL 3MJ9L 1KPUB 2H45A 4JG1H 3U7AA 3WIFA 1O5DT 1LK3H 3FTGA 1I1YB 5F7WC 5IGXL 1BLNB 4PJAE 4ODXB 1NAMH 1I9RH 4KJQC 1A7NH 1WK0A 4LCYB 3KPSE 3TA3B 3CFKB 2FJHB 4F7CB 1FZMB 1VKXB 1ZLWH 4XCYB 3NCFB 2FSEB 2VE6B 3DRTB 4PV8A 1TTGA 5I1CL 2V9QA 2X4TA 3G5XA 4H5SA 5D1XA 4MSWB 3GGWA 3WE6A 1RJZA 5C0DB 3FZUC 1B4JH 5GJSH 3WFEH 2O61B 3Q2CA 3LMJH 2FJGA 3HNSL 3TV3L 1KUMA 5CUSH 1R0AL 5IVZA 2CLZB 3QCUL 3HMXA 4GBXA 4JDVA 4JFOA 1BQUA 4MNHB 3MMEB 3HR6A 1DN2A 2ESVD 1OLZA 3BH8A 4X6BA 3X14A 4DEPB 4JO2L 4FZ8L 3NGBB 5EOQL 4RCAA 4C56D 5EPMB 3RWFB 2BHYA 3ARFB 4FA8A 2X4UB 5CJXC 4JZJC 1E4WL 5KJRL 4YDIL 3RKDC 1WC7A 2FH8A 1FSKB 2RGSA 4LKCB 4PJ9C 1FAKT 2OX5A 5DWUH 4F8QA 4IIQB 3QG6B 4KUZH 3STBA 1CXHA 4BQBA 4HUVB 5B4MC 5LXGH 5ILTL 3WNNA 4WI7A 1UCTA 1T5WA 4MYWB 2QADD 3RVWC 4RGMC 4FQCL 4MAUL 1JGEA 5TE7H 3RKPA 2RJMA 1QSEB 1MJ7H 1KELL 1TJGL 3MSPA 2AEQH 3W5NA 3WIIL 4XAKD 5HPMB 4FP8L 3PQYD 4IHOA 3G04A 4NNXB 1E0OB 3TNNA 3BYTA 1LMKA 3OXRB 4EN3B 3L1OL 1FNAA 1RK1B 4KRMB 4LSSH 3O6FB 4H0IA 4JFEE 4YZFE 5JPMA 3U0WL 2QHRH 2FWOA 2XTJC 3GJFH 3ZMRA 2WW8A 5T1KB 2OR9H 2D7MA 2BNRD 1UWXH 2DD8L 3RDTC 3IDYB 4PRID 5BXFB 1OTTC 4LSPL 2ENSA 4RAUB 5HVGB 3RAJH 5JXAH 2PCPB 1MIML 3NBNA 3BDXA 5J57B 5LGHL 4WVRA 3VH8A 4N8PA 4CVWA 1XF4A 5F9OH 3Q1SH 3KAAA 3HE7D 1PZUB 1IEBA 3A67L 3QQ3B 4IRZL 5J6GB 4K7FA 1FCCA 5DJDA 4HLJA 5FHBH 3HTLX 1F2QA 4AT6B 4R26H 4ODTH 2AGJL 4JY5H 2EDXA 4L8SB 1RIHL 5SWZD 1IMHC 2C4XA 4L4TD 2W9EH 4OD1H 5DUPH 1RIUH 1G1CA 4P0DA 2X10A 1UWEH 1MCOH 2QJDA 4NGHH 2X40A 1WFOA 4NKOA 4WW2A 4JKMA 4DGIL 2DLFH 3INUH 5T33H 1UT9A 2OTWB 4M6AA 5DUBB 4WGVB 3VXUA 1INDL 4Y4KC 3QNZA 3HCVA 4MXVF 3PWNB 2DYPB 1XIWD 3WKML 5TJWK 3O8XA 4XMKL 1EJOL 1G7JA 1FNEB 5ITBL 3S96B 3QUMA 4JDTL 3UTQA 3BH9B 4XPTH 1NDMB 5CGTA 4AQ1B 1SJHA 4ZYKB 4DCQB 5B39G 1VEPA 4OGAD 4LAQH 5DZNA 4UUJB 4N5ED 4UOJA 4NDMA 5INCB 1SBSL 2XQYG 4X4ZA 4Y5VC 3SDXA 3WFDL 1I1YA 2OK0L 2NY0D 4OTXL 1CXIA 1BLNA 3GI8H 4FQ1H 1UYWH 3HS0B 4M1CC 4WHTA 3WNKA 4Z7UF 2ZJSH 1M6OB 5EA0H 5HVFB 4LCYA 2WQ8A 3DX8B 2AEPH 5GRJL 3CFKA 3HZVB 1MHCA 1BFVL 1RIVL 1FZMA 4F7CA 1QVOB 1VKXA 1NBVH 1EXUB 1I8IB 1DVFB 5D2LE 4XCYA 1UA6L 3T1WA 2FSEA 1I9IH 1SQ2N 3DRTA 3NACH 1OF2B 5C86A 4X80H 5LQBH 4N5UA 3KLHD 5E7BA 2Q7YB 1VB9A 4MSWA 4OFYA 4JM4L 1P7QD 4FTVD 4PRBB 4G6KL 4AEHL 2AV1B 5DVMA 3MLXL 1F5WA 3FFCE 3PE9A 3B3IB 5J9PA 3FAWA 4WHYG 3BKMH 4FQHB 2C1PB 2PYEA 4B0MM 5EPMA 3RWFA 3ARFA 4QGTA 4JPIB 5D72H 2VXSH 1HE7A 2IG2H 2HFTA 4K7PL 1BJ1H 1CICD 1OTSD 4QRSB 4PRNB 2CIIB 2MKWA 3G5ZB 4LKCA 1RZIA 4J6RH 1E4KA 4OF3A 3TO2B 1QR4A 5JHLH 4HPOH 3QG6A 3BP4A 3REVA 2BHUA 4Z6AT 1MREL 3T3PE 4HUVA 1UGNA 1UM6L 3OKOB 2Q8BH 5HVWA 4QWWD 3QEGH 4R9HA 1JI1A 3GO1L 2IH1B 2IFFL 1XF1A 1IAIH 4KI5F 1SJVA 2A73B 2XKUA 2XA8L 2HKFH 5E00B 3UTTE 1F58H 1UM5H 5HPMA 3DVFA 5C92A 1NGPL 4NZDA 4EDWL 2X4OB 2VUYA 4NNXA 3WLWC 4YBQC 5IT2L 5KAQF 3OXRA 2V7NA 2EIZB 3FB6B 1RK1A 4PJCB 3O6FA 3DURB 2GJZB 2YUZA 1OP3K 1ZLUH 3WDJA 5IVXB 1JZ8A 2ILLA 3CX2A 5HHQB 5HDOA 4NBYB 4YXKL 4M6MH 3S36X 2ESVB 1AD9B 1R24B 4Y5YC 5BXFA 4OIBA 4UDUA 4RAUA 3SKMA 4J3WA 1A7PL 2F58L 1YEIH 1T89A 1AQKL 3EYSH 1OAXH 2KZ1B 1U8OB 2FCBA 2X1QA 5LGJA 5J6GA 3QQ3A 4WFFD 3O2WH 2NX5A 4PJ7A 5H2BB 5JW4Q 5F96L 1I3GL 3UC0H 1EBAA 1MF2L 1MJ8H 3D1MC 4AT6A 1C5DA 4BZYA 3MRFB 4OLUL 4LVOC 1F11A 4YQXH 2E7LC 3V4PH 1CIDA 1N64H 3C8HA 5FOBA 4ZXBC 3HFML 2YRZA 1NL0L 1FE8H 1WZKA 2QADB 3LB6D 4OCXH 4KZDH 4AL8L 1Z0NA 1RU9L 1JF5A 4MNQD 2KH2B 4BZ1H 4G9DB 3E2HC 3ZTNL 1NANI 4ELMF 2OTWA 3TJHC 1DANU 3GZKA 1I1RA 3PWNA 2XACC 2BNQE 5T3ZE 4E9LA 3V4UH 2H41A 4BSWB 4PJIF 2FO4B 4X9BA 4F57H 5EUKB 1FNEA 1FIEA 3D87B 2CK0H 3S96A 1ACYH 2DIJA 1E4XL 3L5JA 4KJQD 3HRPA 1A7OL 3BH9A 1JNNH 3IFNL 3JXAA 1NDMA 1WWBX 1CD1A 2BNRB 1FVDB 4PRIB 5I6XB 3CH1A 1MAKA 4DCQA 1KXVC 5I1AA 3WS6C 4O4YL 1G7IA 5C1MB 1FNHA 4UUJA 2VXVH 5BS0E 4KTEH 4IJ3B 3ULUH 3HE7B 3QEQD 3CZFB 3ZKXC 3FZUD 2A6IB 15C8L 5KSBF 4NKMA 5EULV 4XBEL 5B3JE 5I74C 3E6FB 3GMOB 3G9AB 3HS0A 1MHHA 2V5MA 1UH4A 1EMTH 1MCRA 2M2DA 2D03H 4P49A 1QPXA 1M6OA 3K46A 4BFIB 3AY4C 1OAYH 3DX8A 2YD5A 5SWZB 3F58H 3HZVA 5KS9A 4GS7B 1LQSR 3KG5A 4L4TB 3QDJE 1QVOA 1RUPL 1I8IA 1DVFA 2Z31C 3BQUA 5T5NF 2F8XC 1CL7I 1OF2A 2EH8L 3EIFA 4H1LH 5E2VH 1WT5A 4WO4D 4C54A 1U42A 5D71H 1ZV5A 1LDSA 3VXMD 4MZ2A 4JEGB 3MOBH 3RKDD 3R1GL 5DJCB 2VTFA 4KTDH 4PRBA 5E9DE 3V6OC 1NLDL 3BAEH 2EH7H 4NT6B 1X5LA 4IRSD 4PJ9D 1D5MB 2AV1A 3S97C 1D5BB 5A2IH 2D2OA 2D0HA 4FQQB 1I7RB 4U1IB 4YR6B 3B3IA 1MRCH 2DBLH 5HGGS 4FQHA 4QY8A 1LNUB 4OZHB 5B4MD 4P9HL 4NCDA 4JPIA 4PB0H 3RVWD 1T1ZB 4JY4B 2AXFB 3IDNB 4PYGA 2FIRT 2X1OA 4PJXF 3QQ9C 4PRNA 2CIIA 3G5ZA 4Z8FH 5LWYL 2MQ3A 3UCRA 1JYVA 3EO1B 1I3VA 4Y19B 3TO2A 4GG6F 1OP5H 2C9AA 3IS1X 3TVMC 4MMXC 1A1NA 1G9NL 2NY0B 4FABH 5BVPL 3DNKA 1X44A 4X7DC 1GZPA 5L8JB 1AXIB 3WMSA 4IDJL 4JZNA 3L5XH 3QG7H 4KDWA 3OF6D 3OKOA 2XTJD 2FX9H 3OKMB 1DZBA 5CP7B 5EUOE 2IH1A 1W0WB 4TOYH 1BQLL 3PL6C 4JN2B 1A6WH 2BSED 1JGUH 1OTTD 2A73A 5E00A 3RDTD 4Z7NF 3V0WL 2H9GB 3SPVB 2CLRB 3Q6FA 1P7QB 3FB6A 2EIZA 4OIAA 3CH8A 4PJCA 2ZCKL 4CADB 4L8BB 1JPGB 4K23H 3DURA 3MA9L 1KV3A 2GJZA 3R8QA 5IVXA 1Q8MA 4R8WL 4ONGH 3LOWA 5HHQA 3QQ4B 3X13B 4X5XB 3ZKMC 2ESVA 2W59A 3VGHA 1MJJA 1JRHI 1U3HC 4ODVH 3C6SB 4BFBD 1F3JB 1N6UA 5KOMC 5DHXB 5CZXC 4OD3H 1S5IL 3L95A 4ZFZB 3HZKB 1LDPH 3MXVL 4PJAF 4P9HC 4UZGA 3B5TA 2GTWB 1P2CB 4V2BA 3RVTD 1YEFL 2PR4L 1CICB 1U8OA 7FABH 3MLUL 1GIGL 5H2BA 1DSFH 2R23B 5C0FB 3NH7L 1S78C 3MRFA 3OSKA 1YNKH 5DMKA 3RUGB 7CGTA 1IZKA 4Y4KD 4PJEB 4WTXA 3QUYC 1KCUH 4K3GA 2ZUXA 1G9NC 1U0QA 5EO9B 2ZCLH 1H0DB 1JBJA 3OKLB 4YXHH 3ZE1E 1A4JB 3HNTL 1U8NB 4G9DA 2XV6B 3SDYH 3MBEA 3O6MH 5CHNB 5I73B 5F88B 2XWJB 4MDIB 4P59H 4XPFH 3BEVB 3LHPH 5ANME 3ARSA 1WZMA 4BSWA 2FO4A 5EUKA 4M1CD 1LGVA 2JCCE 3W5MA 3VJ6A 3HAEB 5CCKL 4PJDB 4QRQB 3T2OA 2AK4E 2FHCA 2BNRA 4XCEB 1FVDA 4P2OA 4PRIA 3QCTH 3FQWB 1EAPB 1IFHH 5DO2C 3WO3B 5F1IB 3HE7A 3CZFA 2A6IA 3NTCH 1VEMA 3E6FA 3GMOA 3N1MC 5JHDD 1GHFL 4KHTH 4F9LC 3UTOA 1EEYB 5SWZA 4HIEB 5DLML 4LSRH 5GHWH 5J56B 4K3HA 3OJDA 1HWHB 5GRUL 1I1FB 2LV4A 1F3DH 2FZ3A 1B0WA 4ZNEE 2UZIH 5JW4M 3DUHA 2AJXL 2FGWH 4LRIC 4YHKL 1T6VN 4GXVL 4XNQB 3U30B 2VSDA 1T6WA 1INEL 4KTYA 5DJCA 3ROLB 3BZFB 2FX8H 1MAML 1ZVYA 1ZLVK 5ICZB 1MELA 1D5BA 2WP3O 1RZJH 2NLJB 4YHML 2D7PA 1NCTA 5EIQA 1I7RA 4U1IA 1KCRL 4YR6A 4JRYE 1YEKH 1I4FA 3D39D 4OZHA 3UEZA 4O2FB 4OCWH 3GMRB 1HXYA 4LQFL 4JY4A 2AXFA 1BOGB 4BZ2L 3BX7C 3HC4H 4HH9B 5J11C 3LEYL 1TXKA 3RX8A 4U7SA 5CILL 4DUVA 4MA8H 1F13A 1A6PA 1QHPA 3KR3L 2FR4A 2P5WE 25C8L 3IAQA 3EO1A 4RIRA 3WLWD 4I9WE 4Y19A 4YBQD 4LHUD 1K5NB 1TDQA 3CVIL 2YPLA 2IGFH 2IFGA 3KPTA 4Y0GA 2I9TB 1BVKB 4U3CA 3P77B 4I2XB 5KW9L 1A47A 1T0PB 3FONB 3IDIB 3OKMA 4KJPC 5CP7A 1RVFL 2BZDA 2COQA 3OQ3B 1W0WA 2J1KA 3SKOB 1F4WH 1ZHLB 3QBTB 4JN2A 2KPNA 1CDGA 5ELIA 3GIVA 4OLZL 2H9GA 4TNVK 1OGTB 3SPVA 1NAKL 2CLRA 4LVHC 1XGYL 4JZJB 2DQHL 2VLKD 1WIPA 3OWEA 2E6QA 1EGJH 2EDEA 4JJHA 3VXMB 3WFBH 3EGSB 2F53A 2Y7QA 4POUB 4X9FA 4PJBA 4CADA 2AJSL 4L8BA 1JPGA 4I0PC 1XMWA 5J1AA 4PJ9B 4YGAB 3ARGC 5CSBA 3H9YA 4ZSOB 2A38A 3QQ4A 3X13A 4X5XA 5CWSB 1NMAL 4ZXBD 1I8KA 1OTUC 3FFDA 1EERB 4EDXB 1W72L 3NFPB 5DD3L 1F3JA 1NBQA 4WTZG 1YNLH 3RWEB 4ZFZA 3D3VD 4RGMB 3HZKA 1M1SA 3SDDD 4MLIA 2XN9E 2BVUA 2CKBH 5DK0A 3AS0A 3KXFD 1CICA 5D2NE 1N5AA 1DEEB 1Y6NR 3VXNB 4WGWB 2R23A 5C0FA 1OPGL 3KPLB 3RUGA 3TJHD 4LLWB 4HEPG 2EDNA 3TZVC 3UBXB 4UV7L 5F1NA 4M48H 1MLCB 2B2XH 4JO1H 5CLTA 5IQ7L 5EO9A 4KRNA 2XTJB 1FQ9C 1PSKL 1T66C 4GAFB 2CKNA 3OKLA 2BDNL 3BP6B 4NQEE 1A4JA 4MVBC 4XWGL 5I76A 3O3AA 3RDTB 5IK3B 1K6QL 4BSJA 1F6LL 1U8NA 3DVGB 1OY3B 4P2RE 5F88A 3UTSB 1T1YB 2XWJA 3HNVL 3BEVA 2Q87A 2AQ1A 2P7TA 4IDLA 1KCSH 5IFHH 3S7GA 1U3YA 4FFWC 3VXSD 3QI9C 1YY8B 2ORBL 3HAEA 1TZHA 4ZS7H 4M5YH 3WXWH 4PJDA 4QRQA 2GUOA 3O9WC 5K9JH 2F9BT 4XCEA 1EO5A 3EFFB 3FQWA 2Z31D 4ZNCD 1F4AA 4N1HB 4M4PA 1CL7L 1KJ2H 4N0FB 3P9MB 2GK2A 5F1IA 4HS8L 1HOCB 1MFDL 1S7WB 1NH6A 3HC3H 4OFIA 1BBJB 5EWIL 4WV1A 4GMTH 1NDGB 1FP5A 4GKOA 3F5WB 1IM9D 4PR5A 4Y4KB 1EEYA 1MFEL 2DF3A 4HIEA 1AR2A 3BESR 3L3HB 3ISWA 1I1FA 4LIQH 1M4KA 5BQ7B 2IWGA 3M8OL 4KV5E 4K8RL 2DIAA 4B53A 1UZ6F 4XNQA 5DRXB 1MCKA 5K9OB 3DVIA 3LN9A 3WJLC 3ROLA 3OKYA 3BZFA 5F7YC 4F37F 1K3IA 4LLDA 4NQCB 5ICZA 1QNZH 5FB8B 3CMOH 4XP5L 4Y5VB 2XKNA 3TVMD 5HHMD 3AMKA 3EOAA 4TSBL 2J8UE 1G0XA 4K2UL 5LBSL 2DLIA 4PRPE 4O2FA 3GMRA 5ACMA 2ID5A 4ZAKC 1UM4L 2EXWC 1J0ZA 5FYJH 4TSAH 1OD7A 5C9JB 1WJ3A 2H6PB 4X5WA 3PL6D 4NHUB 2EE3A 1NJ9B 1HHIA 2C4FU 3ARTA 3TLRA 1VFBB 1YMMD 2OQJA 1GYAA 3MR9B 3LV3B 1QRNE 4HLZH 4JCMA 2P49B 5EOCH 4P2YA 4P3CL 4QRPA 3Q3GB 3P77A 4I3RH 4I2XA 1CGWA 4UMGA 1V7MH 4LL9A 4DUXA 2VQ1A 5JHDB 4FXLA 3FONA 1Z9OA 3IDIA 3AAZB 3QYCA 3ZKMD 3UJTH 3SKOA 1JRHL 2DQIH 1U3HD 1ZHLA 2QSVA 4KY1H 3CXHJ 2L7JA 1HNFA 5CJQH 4F9PC 1YY9C 3OZ9H 4GRWH 1HDMB 2EDOA 4Y88A 5SWSE 3H9SB 4BA8A 5C0EB 3VXMA 4M1GL 5ACZB 5CBEB 1ZA6B 4N0CC 4QCIB 4YPGB 1EDQA 1LO4H 4YAQB 5HJ3B 1ZTXL 1J8HD 2DQEH 4O58L 2CGRL 3JV5A 1KIUA 4QKXB 4ZSOA 3QUYD 1HHHA 5CWSA 3O2VH 4JFPB 1AY1H 3MJ9A 5DD6B 4RNRA 3Q0HA 4EDXA 3PWUB 3RZCB 5I1JL 4JFDE 3SE3C 1IGIH 2XXCB 4WWKC 5CS7A 1ZT4A 4MXWH 3RWEA 1KOAA 1G6RH 3LQAL 3NCYP 3AREC 4G42B 4G8FA 3SBWC 1JPSL 3I6LE 3H42L 1AR1C 3D9AH 3BHBA 1DEEA 4G8GB 1A3RH 5IMLB 2UYLB 3HRZB 3KPLA 3SQOL 2QHLA 4TUOB 4QRRE 4LHUB 4LLWA 4DQOH 4L4VE 1MLCA 4MAYB 1U92B 4HK0B 1ADQH 2KL6A 3BP6A 3GSNH 4IRJC 3MRBA 4Y5YB 3RDTA 1CDYA 1OARL 1OW0C 4UQ2B 2JJTC 5DO2D 3C9NB 3UTSA 1J18A 1T1YA 3MUHL 1U2CA 3QDGB 2EICA 2J2ZA 2YPVH 3OG6B 5IBTH 3MROB 5HY9B 1A7RL 4WI8A 4G6JL 5BMFL 1U41A 1KN4H 4Y2OA 3P9LB 3C60C 3NAAH 1HILB 4HCRL 4LVOB 4N0UA 4HUXB 4PIRF 3RA7H 4ELMB 4GJTB 1MEXH 3EFFA 5IROC 1A5FH 2R2BA 4Z7QF 1YEGH 2XWTB 4XXCA 3MFGB 2GT9B 5I8KH 1QSFE 4KROC 5H37H 3D3VB 4JVUA 1HKFA 3OKKA 2R69L 3U0TB 4K94H 3KXFB 1HOCA 4HGWA 1S7WA 2R1XB 2V5SA 3E2HB 4L3ED 1BBJA 2ZUWA 5EUOF 5AG9A 1DUYB 1OGAD 3X3FH 3QT2A 4NM8L 4PFEA 1NDGA 5F44A 1UKTA 3F5WA 4JPWH 4Y4KA 2AJUL 2R0LL 1XFPA 4JR9H 3TIEB 1N6QL 3MRKB 4LEOA 4EIZC 1FDLL 1N4XL 2WQRA 5FGCE 5BQ7A 5JA9A 2P8MB 3CLFH 2UY6A 5KSBB 4PJ5B 3B43A 1GOHA 4JFYA 3WIHL 3H3PL 1MRFH 3KYMA 5DRXA 1CLYL 2CIKB 4Z7UA 1XCQA 4L29B 3OAUL 5K9OA 5TE4H 1KTLB 2CRMA 3HUJF 1ZWIA 5DD1L 4ZQKA 4QHLB 4NQCA 5JXEC 2X70B 4WU7A 5FB8A 2UWEE 3ELAT 4Y5VA 4Z0BL 4NC2B 4X6DE 3F12B 2VLRD 5I74B 1MJUH 4KJYA 2X9XA 4J3SA 3VXSB 4XAWL 3PHQB 5TFSH 3DYMA 3I50H 3L5IA 1J87A 3DGGB 5C9JA 2H6PA 5EU7C 5E70A 4YE4L 2D9QB 1B2WL 4NHUA 1OQOA 2Z31B 4JQIL 1GGBH 4U2YA 3T2NL 1RMFL 3N1PC 4G7VH 4S1QH 4XC1L 3ARPA 2PW2A 1P69B 3MR9A 2A9NH 3LV3A 1M71B 3QHFL 3TH2T 4HFWB 1QKZL 1EFXD 2FBOJ 4PP1C 1M7IB 3PV6B 4LRNL 3U1SL 1GC1L 4AQOA 2ZWLT 1GPOH 4I0PD 1MCEA 1OWRM 1LWRA 4FS0A 1IM9B 3ARGD 4KVCL 4D9LL 1NCWH 2D7TL 5IB2B 1JZ5A 2B1HL 2W92A 3AAZA 1BF2A 5KOVC 5EZIH 3KNBA 1OTUD 1I9EA 3IDXH 1R3HB 2FJFB 3BKCL 4GG6B 1N0XH 1M7DA 2HT2C 1DJSA 4NO0A 1TTFA 2Z93A 3H9SA 2JCCF 3DRQB 5C0EA 1D5XB 1AP2B 3C2SA 5K9KB 5CBEA 1ZA6A 4EKXA 1HKLH 4QCIA 3S36H 5FM8A 1JWMB 4R4FL 3BW9A 4YAQA 5HJ3A 3WCYA 5CSZA 3MTRA 4KKCC 4UBDC 3TVMB 4ELKB 3H2WA 1IBGH 3B2UC 3LD8C 4GAGH 4JFPA 3TZVD 5DD6A 5GGVY 3K7UA 1WTLA 3PWUA 4N0RA 3RZCA 4O5LH 4OI9A 2JLLA 4OM0L 3NABH 4G42A 3N1FC 4MVBD 4DFHA 2DRUA 2NY2C 3PL6B 2ICWI 4DVRL 5E2WL 5HYSB 4G8GA 5IMLA 4OQTH 2Q7NA 3MLZL 4UB0L 2X4QA 3FN3A 4LHUA 3DETD 4AM0A 2R4RL 1DQJA 1U6AL 5ISZD 3ZZ1A 4AY0A 4FFWD 2ED7A 4MAYA 2VB5A 3QI9D 1AQDB 3I85A 4U7KA 3GRWH 4LF3B 3KPSB 1U92A 1GC1C 4HK0A 4AEFA 5C08E 4OSUH 1SHMA 2NQCA 2W0PA 3O9WD 3T0DA 4Y5YA 1U3HB 4AIOA 2WNGA 1G7QB 1NCUA 2R0ZL 3VRLE 5I75C 4UQ2A 1RUQH 3T0VA 4G7YH 3C5ZA 3QDGA 2NXYC 2XG5A 4M5ZL 5E8DH 3BP5B 4I3SH 5IHUH 2AXGB 5I16A 1UCBH 1OP3H 5HDBE 4J2XA 2NR6C 3RIFK 5BRZE 2R29L 1J8HB 1FGVL 1IC7L 1U95A 5IHZB 3QUYB 4P5MB 5EZOL 4ELMA 3FJTA 4HK3N 2XWTA 2GT9A 4YHYC 5FA4B 3DIFA 1OCWH 3D3VA 1JGVL 4H8WL 3U0TA 3GB7B 4PJIA 1JE6A 3KXFA 4LCIL 1BZ7A 1JHTB 1QLRB 1EA9C 1DUYA 2P5ED 3M45A 2C7UB 1FH5H 1L0YA 4OBRA 2UUDH 2YK1H 4Y4FC 1C1EH 2CDFB 2WIIA 4TNWK 1VENA 4P4RB 3BRDA 5KSBA 4PJ5A 5JORB 2EXWD 3U9PH 4GRMA 2CIKA 4ZD3H 3IAPA 4L29A 1MVUB 3WS6A 1KTLA 4RMUA 2W07A 3V7AG 4QHLA 3G5VA 4XX1G 3U36A 3OTTA 2OL3B 4PG9A 4OGXH 4JFEB 2C5DC 43CAA 3F12A 4ESKA 2XXMB 5JQHC 4DOHE 3NCJH 3HMWL 4WFHD 3UYRH 5J0BA 4EUPH 2B0SL 4P3WA 2ZUUA 1PLGL 1EIBA 4JG0H 5E95B 3U7YL 5C0CE 2HJKA 2DKMA 2PTVA 2JE8A 5I1KL 1YY9D 1AH1A 1Q1JH 3GSUB 1M71A 1W8OA 2AERT 1ERNA 4H8WC 4GKSB 5DSCB 4HFWA 3EO0A 4N0CD 1QTYT 2F54E 1VHPA 4D9QE 1OGAB 1M7IA 1DLFL 3PV6A 6FABL 3VXRE 3VFSB 4PJXA 4KZEH 1KFAL 4U6XB 3S35L 4F7PB 3U4BL 3NN8A 1KEMH 4BH7B 3BP7B 1MI5D 4UIKL 5BV7L 2Q1EA 3UPAA 3LS4H 1R3HA 4GG6A 1EJ6A 3VMOA 1V3JA 2G5RA 2OI9C 4G6FD 4NC1C 4OM1H 4OD2B 4ALAH 3ARED 5L88L 1V7NL 4TPRH 5ESQB 3GSXB 3MLVH 5J11B 1D5XA 1AP2A 4S1RL 5K9KA 4H1LG 1JWMA 5HVHC 1MVFA 2ARJB 4B7LA 2DI9A 4LBEA 5IOPA 4MNGE 2XZCH 2VLJE 4XC3L 3TVMA 5I1EL 2DTSA 4ODHH 2VLRB 5ALCH 3RVVC 1NCNA 2HWZH 1JJUA 1DBJH 5EORL 1FV1B 3RNQB 3PJSB 5I1LA 1X4XA 4YHZL 4FQIH 2V5RA 4IRJD 1RZKH 3PL6A 1WVZA 4G43B 5DC4B 4LVHB 4MXQC 4DZ8A 3GIZL 4CAGA 3LKSB 3EJJX 3OR6B 4KV5F 3NCBB 5DJ2A 1YC7A 2J3SA 4I0PB 1FFOA 4OLWH 3ES6B 1AQDA 3C60D 3KPSA 2YS4A 5I1IH 4O51B 3NA9H 2APFA 4CN1A 1G7QA 4G5ZH 3BXNB 1UZ8B 5GGVL 1UQSB 3MRCA 3L3GA 2GI7A 3BP5A 5J12C 3KYKL 4HW6A 1CBVL 4YK4B 5JIHA 4CVZB 4K3DL 4X6CB 5IHZA 3QUYA 4P5MA 4EQ3A 5KVMC 1CK0L 3N1GC 2E7MA 5FA4A 3JWOH 3GB7A 5DI8B 5D7KE 1C12B 4EBQL 3CFBB 3TBSB 4PLNC 1MWAH 1YECH 4GUPA 1YZZA 3KPNB 1FNFA 2C7UA 5JXED 3ARVA 1EEZB 1C8PA 3F6LA 5CJ8A 3B9EA 5FCSH 1HH9B 2CDFA 3QI9B 4P4RA 1PG7X 5F7EH 1JI2A 4OV5B 3NPSC 3REWB 3E8UL 2HG5B 2GHWB 3O9WB 3V7AE 1HZHL 4XX1E 5EBWB 1MVUA 5IFAL 4N0YL 3MRRB 1W72B 3OPZH 4GLRH 1EH9A 4HX1A 4AIZB 5D6CB 4YWGL 3HR5B 1T7VA 5EBLB 2AABH 1BD2D 4JFEA 4NWTL 4PP1D 3EDKA 1NSNL 1R3LB 4OZFB 1DBML 1DBBH 4KJWC 5DVNA 1KIQA 4HC1H 1JVKA 4LOUC 1CGUA 5DK3A 3OJ2C 1I85A 2JK5B 5AWNH 1T3FB 4XI5C 4LP4A 2QQLL 1AKJD 4KK5D 2HT2D 5I18L 3ULUE 1NCAL 1RZGB 1OSPH 3GSUA 3PUCA 3RWCB 4D94A 5CEZL 3FO9B 2Z8RA 3FO2A 3WDIA 3VFWA 1OGAA 2P5EB 3GJEA 5KVDH 2NY7H 2CXGA 3ESVF 1CIUA 5IW6B 3DSFL 5DD0H 4KKCD 4JRWA 5JZ7D 1EO8L 3BP7A 3B2UD 1X6NA 5E6IA 5CINL 4U6HB 3AVEA 3M17B 2H32B 1LK3L 2GW5A 4U6VL 1HHGB 5SX4H 4OD2A 4ZAKB 5T3XD 2JJSA 4YJZL 5ESQA 3VFUB 4E5XA 3GSXA 1I9RL 4NQDE 2NY2D 3MLSH 4HDIB 1A7NL 3STLA 3CFIC 1RURL 2W0FB 3HPJB 1JK8B 4GH7B 4N1CA 4HG4K 4ONHB 5IQ9B 5MEQA 1RUAH 3MNWB 2NMSA 4WENB 3WNPA 5HHOE 1JWUB 4EVNB 5GQBA 3M07A 1JYWA 1P4IH 3IKKA 3JV4B 1VFAA 4APQA 4A6YH 1B4JL 5GJSL 3WFEL 3QRGH 4UAOC 3LMJL 1FV1A 3RNQA 1QZ1A 3PJSA 4LARL 5CUSL 3SGKA 5L9DH 1IARB 3CXHK 4G43A 3EW3B 1FO0H 4DZBB 5E99H 1J1XH 4ISVB 3QIBA 5L6YL 1A3LH 2IALB 5BS0B 3T2PA 4I9WD 3B4NA 3LKSA 4KGLA 4M43H 4M1DL 3OR6A 2DQUH 2R1YB 1FNSH 3RY6C 1WAAE 3H3KA 4PJ8C 2NR6D 3MOAH 2A83A 4I0PA 4LLQB 3HI5H 3ES6A 2ZOKA 3U2SB 1TLKA 3RFZC 4O51A 3VW3H 5KBNC 1JNHA 1MI5B 2E27H 1LEIB 5DWUL 2UWEF 2I24N 3VWKC 4WWKB 3SKNB 1A6TA 2DM2A 3BXNA 4G6FB 4X6DF 3FRPA 1UZ8A 2VDLH 2ZUYA 4RMQA 4KUZL 3ZDZE 1H9VA 5LXGL 3VFTB 3ZYIA 4UI2A 4NQSB 3TBWB 4HFUH 5E9DB 5TE7L 1F6FB 1MJ7L 1R6VA 1A3QA 2R0WH 2GSIB 3LS5H 4I5BA 4K3EH 4KI1A 4KH2A 2FHFA 2AEQL 5DK2B 3RJDA 5FA3B 4CVZA 3FFCA 4F7TA 5DGRA 4RBPK 4X6CA 3GSVB 8CGTA 1JHKL 5JO5B 3VD3A 2DM7A 5EU6D 4FXGB 5GJTH 4GW5B 2DJUA 2D7OA 4X98A 5DFVD 5EOTA 3ZKNC 2Z0BA 4LSSL 1CDHA 1WWAX 5DI8A 4NNPH 4IRJB 4XT1C 3VD9A 1PX4A 2I07B 1C12A 3CFBA 3TBSA 1J7VR 3QDHA 2APTA 2OR9L 5EU3B 4JQVA 1IGJA 4P99A 1G84A 2JF1A 5D7LD 2WUCH 1EEZA 3W39A 3F7QA 3JV6B 1T20B 5DHYB 3RAJL 5JXAL 5FECB 4G80B 1YEEH 5F9OL 3Q1SL 5I1DB 2VXUL 3C60B 2XICA 4OV5A 4XNZC 5GS0H 5FHBL 3REWA 1BAFH 3P9WB 2HG5A 3OB0K 4R26L 2FBJH 2IPTH 4JY5L 2P42B 2WBJC 5EBWA 4KROB 3MRRA 4OLYH 1W72A 4X6FB 2WINB 2O26U 5FO8B 3L6FB 2W9EL 4OD1L 5DUPL 3HR5A 1RIUL 4QHNB 1QSEE 1A4KB 1S7RA 1UWEL 2NCMA 2AJ3A 1MCOL 1VSCA 3NCMA 3C8DA 3E1F1 4MA3B 4MA7H 1R3LA 4I1NB 5EC2A 4HKBA 3VD7A 3QHZH 1BECA 2G2RA 3TO4C 1ORQB 2D4DA 3HUJB 4LCCB 1BJMA 3TT1L 1WFTA 3INUL 5T33L 2A77L 2CSPA 1FAIH 2L0DA 5JW4N 2JK5A 3MCKB 4FNLH 3T0AA 1T3FA 1S9YA 2DI7A 3MRLB 3RWCA 1Y0LB 5F9DC 3GSOB 1BWWA 3CSBA 3QWRD 4NWUL 3T65B 2VLLB 4XPTL 1V3LA 1C08B 2P5EA 1WFUA 3O45B 3VE0A 3VRLF 4CL7A 5GS2H 3LPWA 5JR1H 2P24B 3EO9L 3MNZA 5I17A 2BY1A 3RVVD 3BGAA 3MUY1 3M17A 5HDBF 1HHGA 3GI8L 4Q9QH 2V17H 4FQ1L 4M7KH 4P48A 4ZAKA 1UYWL 4MDJB 3VFUA 4CDGC 1CFVH 2ZJSL 5J06A 2AEPL 5IQ9A 3HPJA 1JK8A 4ONHA 3MNWA 1O0VA 1NBVL 4MXQD 1N8ZB 1JWUA 2Y4SA 2VDRH 1BD2B 1I9IL 3NACL 3PDOB 4RISH 1RQ5A 1IKNC 5A3IC 4X80L 5LQBL 5E2UH 4P2CG 2E7CA 3DV6B 4M7ZB 5A1AA 5DEZA 2SEBB 5B39A 2XA3A 2ZG2A 2IQAB 3MV01 3LKNB 4QXGH 5DHVH 2XY1A 4QOKD 4DZBA 2GSGA 3HG1D 1AKJB 4K7PX 3ZL4H 4F9PA 4ISVA 3ETBF 2IALA 3BKML 5BS0A 3LPGA 3K3QA 4RZCB 1CFTB 3G6DL 2BRQA 4PS4H 4HEME 1UWGH 4HPYH 5D72L 1P84K 5M95B 1KGCE 2VXSL 2IG2L 3AS1A 4U31A 4LLQA 3BJLA 2G60H 2K9UA 3WHXB 2BVEA 3U2SA 3P0GB 4P9MH 1I3UA 1WZ1H 4ETQA 3LKRB 4YNYB 4NQXA 3LD8B 4GOSA 1MI5A 3QDJA 4OFDA 4WUKH 4AK1A 2VXQH 4XH2B 3GBLA 3T4AA 3ZHLA 3DX9B 5JHLL 3MUJA 4WWKA 3SKNA 3FN0L 4QT5B 4MD5B 4NPYB 2JKXA 5E2TH 2FYYB 2PKDA 4B50A 3NIFE 3SBWA 4RX4D 4QHKJ 3TBTB 3VFTA 2NY2B 4JM2C 3MNVB 3QEGL 3TBWA 1EAJA 4HXAH 3W81A 5E9DA 2KBGA 4XPBH 3P0VL 1ZOXA 3FT2B 5DK2A 4JPVL 5FA3A 4P4KC 2HKFL 4WEBH 1F58L 3GSVA 3RI5F 3A6OA 5JO5A 4FXGA 4GW5A 4F58L 2LU4A 4UTAH 4U0RC 4IOIB 3B9KC 5ESAB 5ID0B 1Q72H 1YPZF 2R15A 3CU1A 4IRJA 3C5JA 2I07A 2O5XH 5JDJA 1FIGH 3B6SB 2EEAA 5GS1C 1CT8B 5I75B 4ZUSB 2DL9A 1OW0A 4M6ML 4U2ZA 2BCKA 5EU3A 1FZOB 3E6HB 1H3TA 2W38A 3LN4B 1F3DJ 2NXYB 4OLVL 3JV6A 1QA9B 2LQRA 5DHYA 1D6VL 5FECA 4G80A 4HWZA 1YEIL 5DJAA 2VIRB 3EYSL 1OAXL 5I1DA 4C4KO 3TPUA 1RSFA 3C60A 4ODWB 3VFPB 3O2WL 4KJWD 5EUOA 1N7ML 1QO3B 3UC0L 1MJ8L 5E94B 5C0NC 1KCVH 4LOUD 1H5BC 4OJFL 2XIDA 1C5BH 3TCXA 4YHYB 4XI5D 4X6FA 4QRUA 1N0LA 4P5TC 3K80A 2MWCA 2PO6C 5FO8A 3L6FA 5FEBA 4JKPH 4QHNA 3QUKB 1FE8L 1A4KA 3V5KB 4ZODA 4KZDL 2APVA 4MA3A 4JGJA 2E9WA 3IJHB 4GG8A 3ZDYE 1WISA 1ZLWK 4AEEA 2FATH 3FT3A 4BZ1L 1PZ5B 1ORQA 3ECBB 3HUJA 4LCCA 1I7UB 4Y4FB 5EU6B 2NY5H 4MA1C 3MCKA 1BFTA 5KN5B 3L9RB 3NCEB 5IVXE 3R0MA 4Z95L 4F57L 3MRLA 3QO1A 3GSOA 1PEWA 5D2NB 2ESVE 3O0RH 3ARWA 4KMLB 3T0BA 1ACYL 3QXAA 4N68A 4XP6H 4IMKC 4WCYH 1JNNL 3T65A 4C56E 1BZ9B 2FDBP 1C08A 2I27N 2VOTA 1H8SA 5D7LB 3O45A 3OKEB 3H7LA 2P24A 1BIIA 4JKKA 4LIQE 4HMDA 1NBYB 3DI3B 4KTEL 3ULUL 5JUEH 2VR4A 3PDGA 4DW2H 5FKAB 4MDJA 1Q9WB 4V2CB 4J1UA 5DQDH 4HCRA 1I8LA 1EMTL 3PP4H 3RWJA 5EU5B 3S5LB 2D03L 1CFSB 1J05A 2QBWA 5GGRY 3TJEH 4TRPH 3QPXH 4QXTB 5E4EC 3WSQH 1BHGA 1XR8B 3AMLA 4P2RB 2H26B 5ANMA 1CWVA 1MOEA 3D69B 4WY7H 4LPCA 1BD2A 4EQ2A 4JRXD 4PY8I 3EAKA 3O2DH 3RWGB 4JFFD 5CEZD 5E2VL 3RTQB 3KWWB 4XAKE 2JCCA 3DV6A 4PJ8D 1SEBB 1FGNH 3PQYE 2SEBA 4XBGB 2OXHA 4ZUTA 2IQAA 1YEJH 1DL7H 5CGMA 5E8OB 3BAEL 1UKQA 1TIUA 4NN6B 4P2QD 3VWKD 1AKJA 4JANA 1F4YH 1MRCL 2Y5EA 4OZFH 2DBLL 3L3JB 5DZLA 4RZCA 3WIHA 3MLTA 4PRIE 4PB0L 1N6VA 3CDYA 1UWXK 4HK3J 1G9MH 4GRLC 4ZO8A 5FK9B 3WHXA 1NLBH 4M9OA 1VADA 4KRPC 3WLBA 2IBZY 3LKRA 4OGYH 4Q0XH 1JZ3A 3RQ3A 1B0RB 4XH2A 5ICXA 4ZNEA 3DX9A 2BFVH 2QKIB 4GRWE 4QT5A 3ZKND 4NPYA 3GBNH 4X4XA 2FYYA 2DKUA 3TC9A 5SWZE 3T4YB 3TBTA 3L5XL 3P11H 3QG7L 3T1FA 1DQMH 1P9MC 4L4TE 4JCLA 4IMLB 2RFXB 4YPJA 4JVPA 3FT2A 4TOYL 1A6WL 3QUXC 1JGUL 2H32H 1X5XA 4GMSL 2XTLA 4PY8J 3JSSA 3ULUF 3HI6H 4OLEA 2WMPA 5DVLA 4PRPB 4IOIA 1A1MB 1NKRA 5ID0A 1GVIA 1A9EA 3VGAB 4HS6B 4D9RD 1J1OH 1VPOH 2GK0B 4XNXH 4MB4A 5DA0B 4K23L 2VH5L 3PWJA 3VRJA 4R4NC 2MTPA 4BSVB 1QLEH 4QOKB 1CT8A 2B7DT 4ONGL 3EYVB 4ZUSA 5BV7B 2P5WA 3C09C 3HG1B 4BH8B 3DYPA 1FZOA 8FABA 3LN4A 4NHCH 1QRNB 3R06B 4NO2B 1QA9A 2A1WH 4OD3L 5JW4R 1LDPL 5J12B 3PGDA 1C5CH 2VIRA 2YWYA 5CLWA 7FABL 3P4OB 5GGUB 1DSFL 3TN0C 1KF9B 4PRHD 3TO4D 1QO3A 5E94A 2B20A 1NCDH 1A0QH 3SQBA 3U9UA 1KCUL 1G9EA 3WUWB 3GKWL 3N0PB 4NKQB 3OJVC 2FB4H 1FZJB 5HGAA 2BSRA 4NOFA 2DICA 3MV11 1P6FA 2ICES 3QUKA 3V5KA 2ZCLL 5GGQH 3LQMA 5FUZL 3TT3H 4YXHL 4JFQA 4XVUC 1NCBH 3WUZA 2J7LA 4D0DB 3Q5YA 2VDKL 1PZ5A 3D5OF 3O6ML 4M93C 3SDYL 4Y4FA 5EU6A 4FTVE 4P59L 4XPFL 4JFDB 4YH6A 5KN5A 3L9RA 5AYUH 1WAAF 1DR9A 3NPSB 1FG2B 1F8TL 4Q2ZB 2M1KA 5H35B 5D2NA 4HF5H 4W6WB 3VU2A 4YLQT 5JQ6L 1BZ9A 3WL9B 3IFPB 1TPXC 1XEDA 3QCTL 3OKEA 2CH8A 1IFHL 3BDYH 1I1AC 4F7EB 4W4NA 2ZUVA 4L5FH 4RDQG 1T0MA 2H2PD 5A3ID 3ZDZF 4PG2A 4WTWA 1Z3GH 3NTCL 4NQEA 1UG9A 3IF1B 5FKAA 4PJEE 1NGZB 1S9VB 1T2QH 5EU5A 4KHTL 1NFIB 2VNCA 1BPVA 4W70A 1X9QA 4LSRL 1XR8A 4P2RA 5DMIL 5GHWL 1MCJA 3BSZH 3UBXG 1IAKB 3D69A 2UZIL 5MERA 1HINH 4J3OC 4YO0B 3T8XA 1BEYH 1IC5H 1KSRA 4M8VA 2V7HB 2B5IC 5FV2A 5IW3A 3RTQA 3KWWA 2FECI 3LIZH 3JTSA 4XBGA 3SHSA 4J23A 1JGLH 2PTUA 5E8OA 1ZVSB 2FX8L 4LPTA 3A0OA 4WNQB 1X5FA 1FPTH 4DKFH 3LEXB 3MV7D 4CU7A 3VDCA 5GGSB 4PJDE 1YEKL 3L3JA 5B8CC 4DVBA 1YQ2A 4OIIH 2X05A 4OCWL 2EDQA 3QWRA 4JM2D 1BVLB 3QRFM 3P2TA 5C0BD 4MA8L 1EEQA 4P4KD 1YYLH 2L4OA 4X4MA 3SOBH 1CXLA 2BVOB 4FQJH 2QR0A 4WFFE 3MLWH 5SX5K 4Q9CA 5F7DA 1L0QA 3B9KD 1ZHNA 4UAOB 4YDVB 1PBYA 3QFDB 4P57B 3T4YA 2DQCH 4Z7WE 5GPRA 5D7JC 2R2EB 4DAGH 3VFVB 4G6MH 4GW4B 5JIIA 4OFKA 2B4CH 1F4WL 2UWEB 1IEHA 1NC4B 2JJWA 4JRXB 4MNQE 4X6DB 4H25A 5FYJU 4JFFB 4PJ8B 4N9GB 4PRPA 4HBCH 3WFBL 2VDMH 1A1MA 3GI9H 2N7AA 2LTQC 5IMKB 4HS6A 3W82A 3K1DA 4X7SL 3WBDA 2GK0A 5C0ND 2IMMA 1ZLSH 4RWYH 2MQ0A 4QGYA 3OJMB 4LSQH 3K4ZA 3DHMA 3VWKB 32C2B 3QA3A 3EYVA 4X7TB 3WNLA 1RZJC 1ED3B 3VDBA 4P5TD 5CMAB 1QRNA 3ROOB 3MGOB 3R06A 1PG7H 2HYMA 4ZTOH 1LK2A 2R9HC 1J1PL 1NAMB 3EOYG 4MX7B 4I48B 5I8OH 4R97C 5IR1B 2RQ8A 2PXYC 4M7JH 1MFAH 1NEZB 1S7SB 4NRYB 4PYHA 3P4OA 1KJMA 1H3PL 2CR6A 3RGVC 4FQXA 2QSTA 3JVGC 1AD0B 1YJDH 3QEQE 1N5YH 3DLQR 5FF6B 3LY6A 4I2XE 1ROWA 5TE6H 2ZKHH 1OAUL 3D25B 3LSOB 5SWSA 1FZJA 2B2XL 4RX4A 3WO4C 4Q6YA 1B90A 4JO1L 4MJID 2IAND 1ORSB 1BQHB 3WN5A 3BWAB 3ZTJH 1TVDA 1JL8A 1CF8L 3KYOB 1KEGL 1EBPA 4WTZA 4RRPG 4ZFOL 3RL1A 2D0GA 5T3XH 3VXME 3O6KL 1G1YA 4JFDA 3O4LD 4OCRH 2XFXB 1P5VA 1Q9OB 2Y07L 1KCSL 5IFHL 5MEND 4XNZB 1FG2A 1RAMA 4Q2ZA 5IV2B 5IFJB 4P23C 2VABB 4KK6C 4PGJA 4M5YL 3WXWL 4U1MB 2WBJB 4S1DC 1IAOB 2DN7A 5K9JL 3IFPA 3VMNA 5D7SH 1KYOK 1UACH 2NTFB 5KAQG 4F7EA 4QTIH 3ALPA 3MREB 1I9JH 4L4VA 4PLKC 1KJ2L 5GXBB 3MV8D 5I1CH 3ARBC 1AJ7H 1WGOA 3HC3L 2YR3A 5C08B 3TO4B 1GAFH 2ATPB 1NGZA 1S9VA 4GMTL 4F8TA 4YDKH 4X4YB 3TV3H 1NFIA 3WFHB 5E8EB 5GISH 4RAHA 4HUUB 4LHUG 4GAYB 1AXTH 1PKOA 2IEPA 2XTJE 2B8OT 2Y23A 4LIQL 1IAKA 3ALXA 1KIRB 4YO0A 3CFCH 5EOQH 3FMGH 5JIKA 5C0IB 2V7HA 4Z76B 4GRLD 1DUZB 2P8PB 1YEDB 2W91A 4YDIH 4KRPD 2X4RB 4YIQA 1QUNA 4DKEH 2NY1B 3KPOB 2EDFA 1IC1A 4WNQA 1QNZL 4HKJB 4Z5RB 3LEXA 1QSFA 2GIYA 2ITDA 5DDHB 4BQCA 4DFIA 4LU5H 5BZWB 1N3NB 1ZA3B 1D7FA 1LO2H 4ZFGH 5ILTH 5J1SC 4JHAH 1BVLA 4TSAL 4MXVE 5D8JH 1J11A 3QUXD 1KELH 3UBXI 3WIIH 2I25N 4DN4H 2XZZA 1WCBB 3O3BB 5EOCL 2X44D 4N8CL 4U1LB 1CXEA 4YDVA 1RJYB 4I3RL 3QFDA 3ZDYF 3L3OB 4P57A 4HJGB 1V7ML 3FB8B 2R2EA 1IEAA 4R4ND 3VFVA 4GW4A 1LEKA 4NCC1 4TUJB 1F6AB 3UJTL 3MC0A 2DQIL 1U2HA 2UWEA 3P40A 2X9WA 4KY1L 2MFNA 5J4MA 4OQ1A 1NC4A 5CJQL 1BGXH 5ALBH 4JRXA 4X6DA 4LSPH 3OZ9L 2GJ6D 4JFFA 1KB5B 4HIHB 1YN6B 4PJHE 1LILA 4N9GA 2OSLB 1U8KB 2J5LC 2BK8A 3TN0D 4Z7OE 3CXDH 1A6AA 2BERA 2RCSL 1KJ3L 1QBBA 1PQZB 1LO4L 4RA3A 2DQEL 3MV7B 3VWKA 4X7TA 2BY2A 5T5NG 3O2VL 4J8RA 1AY1L 1ED3A 2APBA 5CMAA 4Z18A 1IGIL 5ERWB 1HYRC 4MXWL 4C83A 5DRZB 3VXQA 4HGKC 1CGVA 2F54B 1G6RL 3AU1B 4MX7A 4NRXB 4NRZB 1YPZB 2FEDC 3IDGB 4I48A 4XVUD 1S9WB 2ICWA 3MGTB 2BXZA 4L9DA 3D9AL 1S7SA 3RWDB 4NRYA 4P4KB 2YA1A 3BKYH 1A3RL 1GSMA 5I71C 3QNXB 3G6JB 4LK4A 3BFOA 3ZHKA 5FF6A 1P7KA 5EIVA 4BQ8A 1UJ3C 3N50A 4U0RB 4DQOL 3TWCH 3D25A 3LSOA 1A6UL 1BBDH 1FRGH 5JHDE 2ADIB 4N1EA 1TITA 2O5ZH 2FL5B 3CFDA 2C1OB 4PTTA 3QUZA 3V4VH 5GS1B 1ADQL 1BQHA 5EH1A 3BWAA 3GSNL 2OS7A 3CFJA 4JDTH 4RBPH 2IAMA 3KYOA 5JOPD 3F7VB 1I1AD 3MUGA 3V9FA 2FH6A 2XFXA 4ZO9A 1Q9OA 3ZKQD 4Y2DC 1SBSH 4CMHC 2EEBA 5ICYB 4XZUB 1A14H 3MZGB 2IQ9L 5IFJA 3NAAL 1H5BB 2VABA 4U1MA 2WBJA 4U3HA 3D39E 3RA7L 3AXLB 4P5TB 3KDMB 1MEXL 1A5FL 2PO6B 1QQDA 1YEGL 3QJFB 4UDTB 5FGBC 5GRJH 5TDOB 2NTFA 5C7XH 5I8KL 4GRWF 1AGBB 2RHEA 1FC1A 4K94L 2FECL 2Q86A 5C08A 1H3WM 4URTB 2YD6A 2ATPA 4JM4H 5HYSG 3X3FL 1KG0B 4NUGH 4MA1B 4AENA 4JPWL 4U1SB 5F7FA 4OCLC 1SVCP 3WFHA 4GAYA 1IQDA 1EUTA 3MLXH 4JR9L 4MS8C 5FYKU 3WEXA 3TBYB 2BSTB 1P4LA 1YDPB 1KIRA 3BIBX 3CDGB 3CLFL 4MJIB 5C09D 2D0FA 1MRDH 5C0IA 3GM8A 3L7EA 3GJFA 2YXFA 5BRZA 4Z76A 4G8EB 4OV6F 5F7MC 3WFZA 5E8PB 2C4FT 3IFOB 2P8PA 2VLKE 4K7PH 4LPYA 3MZTA 4NC0B 4EOWH 1T7YA 3O4LB 4U1HA 4HKJA 4Z5RA 5KZCD 4E41D 5C2BH 2HFFB 4MHHG 4DK3A 5J1TC 4UU9B 5DDHA 1MJUL 2AJZB 4JREB 4XCNB 1QR1A 1TNNA 5BZWA 1T83C 2KDGA 1N3NA 3BUTA 3MODH 1U8LB 2ZCHH 5D7JD 5TFSL 1ZA3A 1KIPB 2IBBA 3QULB 4GT7A 4I77L 4N8VB 2CMRH 1B6UA 5E4EB 3EDFA 3QFJE 3BZDA 3D3VE 3DROB 3KLHC 2ITCB 1SEQH 4WI5A 2IFFH 1HNGA 1GGBL 5IJVA 3S34H 3KXFE 4G7VL 4S1QL 2XA8H 4OCYH 4KWUA 1WCBA 3O3BA 3I9GH 3PHOB 2R2CA 1NGPH 2A9NL 3MV8B 3V2AR 4K94C 5D93C 1FZKA 4U1LA 1RJYA 1ONQA 3BPOC 5CAYB 4CW1B 1GPOL 3DVNB 4W6YB 5EIIB 1K8DA 1D5IH 2VDNH 4LDOB 5J3HC 3S88H 3BN3B 5CIPH 3QPQC 3RX5A 4TUJA 3SE8H 1F6AA 4HV8A 5EZIL 3FQRB 4YXKH 3LRHA 4CDHA 3IDXL 1N0XL 1FYTD 3EUUA 4WI9A 2MSPA 2PXYD 2OSLA 1CVSC 1U8KA 5DUMH 1AQKH 3S36L 4KRPB 1S7UB 3RGVD 1XGPB 4NYLA 5HXMA 1PQZA 4P5KA 1ZS8B 4WHDA 3VXSE 1WTGT 1IBGL 1GGTA 4GAGL 5JW3H 3VWJC 5D5ME 5ERWA 5DRZA 1QBML 5IHBA 2F54A 3AU1A 1RHHA 4NRZA 1YPZA 3NABL 3IDGA 3I3EA 4PJEF 2VC2H 5DJYB 3VXRA 3MGTA 3BJ91 1RU9H 3QUXB 3RWDA 3WXVH 4P4KA 3BGMB 4X83A 1XF2B 1X5GA 1H8OA 4OQTL 4XMPH 4OF5A 1XGUB 3ZTNH 3V6OE 1CE1L 4NM4H 4H1LB 5EFIB 4HAGA 2Y06H 2ADIA 5DRNB 3VCLB 2FL5A 1L6XA 2C1OA 3GRWL 4MJ6B 4P23D 4KK6D 1XGQB 4OSUL 5C2UB 3C09B 4S1DD 2OBGA 5DMGC 4GQPH 4KKAC 4MNGA 5HHOB 4ZO7A 1FL6B 2VLJA 3IFNH 5E6ZA 3F7VA 3SCMA 1RUQL 4NCC2 1JCKA 3FQUB 1YUHB 3L5WB 4PJDF 4U6TA 2F15A 2DTML 4PLKD 4P46A 3ARBD 5E8DL 5IHUL 3R8BB 2P1YA 4DUWA 1UCBL 2M8XA 3TN0B 4PREB 4CN4A 4PRDB 3K74B 4XZUA 5CZVH 4Z7NE 2BC4B 5HHME 3FRUB 4UTBH 1H5BA 3NIGE 3V0VA 4J4PD 1U8PB 2ZSVB 1JZ7A 1E6JL 3K4DA 3AXLA 1L7IH 4LPUA 3P73B 2PO6A 3MXWH 3QJFA 4UDTA 5T1LB 5TDOA 4E0RA 4MCYB 1OCWL 1RUPH 2Y36H 2XPGB 1AGBA 1UXSA 4H88H 1RULL 1PJ9A 3TGXA 3UTPD 4Z7WF 2JB6B 3DECA 2BX5A 2EKJA 3HC0B 1KLFA 1YMME 4M93B 1AGEB 1X6LA 1UXWB 4XNMB 5J7CC 1HI6A 3OXSA 3TYGH 4U1SA 1FH5L 3FAXA 2VO5A 4MB3A 2YK1L 1K85A 4R4BB 1E4XI 4TUKH 1RZ7H 1C1EL 2F19H 3TBYA 3H0TA 4OB5L 1YDPA 3CDGA 1B0GB 3ZYJA 4IS6A 1KCKA 3U9PL 2XI9A 3EDEA 4X9GA 4G8EA 4DGVL 1TPXB 5D1ZD 3TIDB 5KSVA 3FHQA 3IFOA 1I1AB 1JUFA 1AGDB 3ARQA 4X6EB 3FRPG 3U0PA 2EECA 1AC6A 4MJ5B 5T1DL 1J8HE 5D6DC 5AYQA 3SO3B 4UU9A 4Z9KB 2AJZA 1JTPA 2EDTA 1WQVT 5BVPH 3NCJL 3UYRL 4AZ8A 1KIPA 3QULA 4N8VA 4PP2B 4IDJH 2H3NA 2GY5A 1TJIH 3MRQB 4XCCL 2IMNA 3DROA 3D0LB 1JHLH 1K3ZA 2LU7A 4WO4C 2NXZC 1R5VB 2N1KA 1BQLH 2QSQA 4NZTL 4OZIB 1Q1JL 3PHOA 3V0WH 2B5IB 4X99B 1MCNA 1PKQB 1X5AA 4IRSC 4MQXD 3KPPB 4ZUVB 2W1NA 1H3VA 1TCRA 5E4IA 4CW1A 3DVNA 3SDAB 1AE6H 4KZEL 1KEML 1MHEB 4MHHI 3LS4L 3CSPA 5B8CB 3QIUB 1FVEB 1KPRB 2W9LA 4OI8A 4OM1L 5C09B 2HVKB 2CQVA 1CDJA 3SDCA 2FEDD 3MLVL 3DXAD 5FYJD 3TYFA 1S7UA 4D2NA 4RDQF 5EU4B 2VN4A 1UB6A 2XZCL 5CKAA 1F42A 5KZCB 4E41B 1ZS8A 1M05B 5CJOH 3QWQB 1T2JA 1J0HA 4ODHL 3K8MA 5ALCL 2PTTB 1KN2H 5IF0B 2HWZL 5LJYH 2EYSB 1JZ2A 4OZFG 1DBJL 3MA7B 4XCFL 5CD3B 5F9WB 2ADGB 2MHAB 4FQIL 3PHSA 5GSRB 3EYQC 1RZKL 3DHJA 5IB4B 1XF2A 1FFNB 2HN7A 5DT1H 2AKRB 4L3EE 3KYNB 1OGAE 3QEUB 4H1LA 3KS0H 3CPLB 2LTQB 4Y2DD 3OKNB 5IVNA 2JIXA 5DRNA 5KTEH 1GXEA 3VCLA 4NQDA 4M3JA 3QIWC 5TQ0H 4OLWL 1HXMB 4MJ6A 1XGQA 5I1IL 3NA9L 2NNAA 1T04B 1BREA 1HQRB 2BXYA 5DEFB 3RVTC 5HHOA 2EC8A 4G5ZL 1FYTB 4QRTB 3GSQB 3MRPA 1AGFA 3IETB 3QJHB 1YUHA 4R97B 2CRIA 2VISA 1DQLH 2F74B 3TN0A 3RGVB 3L3IA 3H6JA 2O5YH 5GGRB 2BC4A 4YHOH 3FRUA 2VLRE 4LCWD 4F7MB 3PABA 4B5EA 1U8PA 2ZSVA 4TVSa 1KB5H 4NN7C 4Q6IC 3P73A 3AS2A 1ZEAH 4MS8D 4KQ4H 1IL1B 4YHLL 5T1LA 3WO4B 4NIKB 4MCYA 4IM8A 4ODBD 1WAAA 2XPGA 1CZ8L 3JWOL 5DMYA 2M26A 2JB6A 5B3NA 5L0QC 2RB8A 3HC0A 4QXUH 2WM0A 4GXVH 5D1QC 1RZKC 1AGEA 4YGVB 1KPUA 1UXWA 4JFZH 2VSCA 4XNMA 1QEWB 2QTEA 1NKOA 3I02B 4ODXA 3AM8C 5MEOB 3RX7A 4CRPA 4HUWB 4R4BA 4JGUA 1Y6KR 4PBXA 3TA3A 2Q6WB 3ARDC 4PJHF 1KCRH 4NFCA 2FJHA 1K4CB 4P23B 5F7EL 5FUCC 3EJZC 4ONFH 4Z7OF 4I3GA 1EZVX 1AC0A 2VE6A 1N2RB 2FD6L 2WZPD 2VDOH 3TIDA 1HSBB 3BPLC 1I1AA 5C0DA 1SM3H 3HA0A 2XZAH 3OPZL 5CILH 1AGDA 1RI8A 2O61A 3KR3H 2DBJA 4KPHL 1IT9L 2AABL 2CLZA 4MJ5A 3LH2H 2CKBB 3CVIH 4LGSB 4X6CE 3MYJB 2WV3A 4MNHA 2D31B 3MMEA 1VESA 1DTUA 2HTLC 5D1XC 1DBBL 5DJZB 4PY7B 5J3HD 4PP2A 3QPQD 4HC1L 2HFEB 3MRQA 2X4UA 2I60H 5DGQA 2KQNA 3X12B 1QRKA 3GHEL 5AWNL 3KJ4C 3F7PC 2OYPA 4JE4B 3U82B 2DLTA 3EDDA 4XP4L 3JWOC 4ZUVA 3KPPA 2CK2A 1I1CA 4IIQA 3TESA 5KVDL 4ZFOB 4XMLL 2BVQB 5ISZE 5E08H 1JF1B 2JJUA 4OZ4B 4Q58C 3SDAA 5DD0L 4LEXH 1IQWL 1BX2B 2G5BB 3VWJD 2XQBL 1QSEA 3CFEB 5B8CA 3QIUA 1RUMH 1FVEA 3ULVC 3VG0H 2HVKA 4K3JH 5DD3H 3SGJA 3MACH 4RGND 4TVPD 4UT9H 5C6TL 2OR7A 4KMTL 3MLSL 4QLRA 5IESL 4LPVA 4EN3A 5EU4A 3G08B 4U0QB 1RUAL 3MJGX 4TSCH 3VI3E 4E41A 5DVOA 1UZ6E 1NANH 1KJ2B 4WI4A 1LE5B 4R7DB 5T1KA 2PTTA 4LSVH 1UH2A 5IF0A 1NGWB 2EYSA 1XR9B 4A6YL 2CXKA 4C58B 5CD3A 3QRGL 1JTOA 4C56B 2VMFA 2ADGA 2MHAA 2PCPA 5DMGD 4KKAD 3QDMD 5L9DL 1FFNA 1FO0L 5IB1B 1MY7A 5E99L 5SX5H 4F80A 3D85D 1A3LL 2AKRA 5T5FL 4M43L 3LCYA 4KFZC 1MLBB 5EN2B 4OAWB 2DQUL 2P5EE 1XAUA 2J5LB 1FNSL 4L8SA 4BK4A 3MOAL 1RZ8B 1HXMA 4KDTC 1EHLH 2UUDK 1MCFA 1OL0A 4XP1H 3VW3L 1WSST 1BZQK 1T04A 1HQRA 3SDDC 5DEFA 1RJCA 3EOBB 3GDBA 1B88A 4QRTA 2VDLL 3GSQA 3IETA 2A74B 3OX8B 2JB5H 4ZTPH 1MCSA 3PQYB 3DXAB 4J3UA 5DUBA 5T3ZH 2F74A 4HFUL 4HWBH 4V1DD 5I71B 3RBSA 3JVGA 5GGRA 4PJGF 2DYPA 2R0WL 4K3EL 4F7MA 4JQXA 3O4OC 1UJ3B 3DPBA 4WW2C 1II4E 4OCSH 3BIKB 5KVFL 3MRJB 4WFHE 4ZPVB 5GJTL 1A1OB 2VRAA 1IL1A 5BJTB 4OKVB 1F4XH 2Q20A 1H15B 4ZYKA 4NNPL 4EXKA 3PP3H 5INCA 3DSNA 2FIKB 2QQNH 2VXTH 4YGVA 1SMOA 3OKDB 5L7XH 1BFSA 1RJLB 1QEWA 4EI6B 3I02A 1U8HB 2WUCL 4JB9L 5MEOA 3CAFA 4GRWB 2HA1A 4OF0A 4Y2DB 1YEEL 4CMHB 4Z0XB 3MUZ1 4OLXL 2EIEA 2DMCA 2Q6WA 5HYJD 4LQ1A 4IEFB 1K4CA 4P23A 1MI5E 3BPNC 3P30H 4K2UH 5LBSH 1EXUA 5GS0L 1BAFL 5FYKD 1KT2B 4FFZH 1N2RA 2IPTL 2AJVL 4PLJC 3R4DA 2KKQA 2WUBH 1HSBA 2Q7YA 2NXZD 3ZTJG 4OLYL 5GRZA 4BKLB 1VFOA 4W68A 4WHYH 5D5MF 3VFMB 5DC0A 1G6RB 1NUNB 4GAJH 5MI0C 1EPFA 2CKBA 4ZPTB 3A6CH 3T0EC 1GOGA 3MCG1 4P3CH 3BISA 3MYJA 4A2LA 2D31A 1XIWB 3QHZL 3MRNB 1QFWH 2DJ4A 4LCWB 5I1HL 5DJZA 2C1PA 2DQTH 3GSRB 4TNVF 3SE4C 4UILH 1BFOB 2HFEA 5F3HB 5HI3C 1C16B 4C59B 3TFKD 3AROA 5DZOA 3X12A 2G9HB 5HSFA 4FNLL 1T7ZA 1JRHH 5FM5O 1MCLA 4QRSA 1A7QH 3V6ZB 1Q0XL 4D8PB 2CRZA 4DEPC 5ADOH 3CDFA 4S10A 3GSNB 1ZANL 3BKJH 3ZO0A 4Z7QE 4X7FC 5JW5B 4ZFOA 2BVQA 1JF1A 4E42B 4Y1AE 3FN9A 4I8DA 3MJ6A 2AI0L 1BX2A 2G5BA 1IKFH 4J7RA 1ZT1B 1R3JB 1OM3H 4L9LC 4Q9QL 2V17L 3U6RB 4M7KL 1MFBH 1JMZA 2D7QA 5GS0C 3EYQD 3LQAH 1CFVL 2X4OA 4H20H 3NIGF 1S9XB 2ICCA 4FTVB 4JVWA 4K9EC 4KU1A 1OAKH 2VDRL 3QISA 1KJ2A 3G5YB 1ZT7B 5CFHA 2DJSA 4R7DA 4RISL 5D93B 5E2JA 1WF5A 5E2UL 3BPOB 1ZXQA 3HUJE 1NGWA 1AD9A 3QIWD 1R24A 1XR9A 3EFDH 5GGTH 4HHAB 4C56A 4DKDC 4QXGL 4HQQH 2OL3L 3IDMB 1FORH 2GTZB 3PG2A 5IB1A 3ZL4L 35C8H 3B5HA 4Q9RH 4OZGB 4FHBD 4G9FD 2YN3A 3MV9D 5F7UA 1U3JA 1MLBA 5EN2A 4JLRB 1XGRB 1UWGL 4HPYL 3S37H 3FOMB 2G60L 4KHXL 1T89C 4GW1B 4L3CB 4P9ML 5EDXA 2BP3A 1WZ1L 4WUKL 1WBYB 2VXQL 3EOBA 1K8IB 4H26B 1SBBA 5EU7E 2DKSA 5E2TL 2A74A 4NO5B 3OX8A 5BO1H 4MD0B 1TTUA 2EO1A 3PQYA 1NGQL 2R69H 4M7LH 4HXBH 5JNYB 5D1QD 3S5LG 4HXAL 4HMEA 4XPBL 1OP9A 3O6LH 1TZGH 1BD2E 1DFBL 1E28B 4NZUH 4MB5A 4WEBL 1UJ3A 3QSKB 3BIKA 3MRJA 4ZPVA 2VDQH 3ARRA 3W0WD 1A1OA 2D3VA 3ARDD 2R0LH 5GSVB 5BJTA 4UTAL 1JP5A 1W0VB 4HAFA 2CDGB 1N6QH 3K8LA 3EJZD 1FDLH 1N4XH 1CLCA 3LAFA 5LG1A 5I66B 1FIGL 3QDMB 3WIHH 3JUZA 5SWQB 2FIKA 3D85B 1RJLA 4NJ9H 4EI6A 2ENYA 1U8HA 1WWWX 2YKLH 2C3WA 5TQ2H 3WDHA 1FCGA 4LASH 4Z0XA 4BFIA 5CJ5A 4Z7WB 2OZ4H 4L4TA 2EXYC 2HTLD 5D1XD 1GH7A 4XNYH 1KCVL 3X3GL 4X0KB 3HZYB 5T3XE 1C5BL 4MNQB 4UINH 3QDAA 2F5BH 1Y18B 3E3QE 3VFMA 2K7QA 4JKPL 3T2NH 1G6RA 4NT6A 3PIQB 1D5MA 1WEJH 3BQUC 4V1DB 3I75B 1WBXB 4FQQA 4PD4J 1XIWA 2FATL 3NFNB 4LCWA 4LRNH 3U1SH 3GSRA 1LNUA 1QYGH 5F3BB 4L8DB 1BFOA 3U79A 2D7TH 5F3HA 4HWEL 1C16A 3VGFA 1T1ZA 2NY5L 3MRIB 1AI1L 4ODSH 2J88H 3IDNA 1MCPH 2CLVB 3ULVD 5GRVK 1UJTA 4QXWA 3V6ZA 1VCAA 2X9YA 1ADQA 1NBZB 3GSNA 4MQTB 4XP6L 1EVTC 4WCYL 3QEQB 1ZHBB 5JW5A 3ET9F 2JJVA 4E42A 4FQLH 2HJFB 2QSCH 3Q5TA 3QH3B 1JFQH 1T22B 1A8JH 5JUEL 1R3JA 5LKNA 1NUFA 3QXUA 1CLOL 2Y5TB 3TJEL 1NFDE 4WO4B 4UNTA 3QPXL 1S9XA 1P7QA 4PTUB 4FTVA 5E2WH 3MFFB 3WUWG 4WY7L 4FOMA 4PV9B 4IRSB 3G5YA 1YEHH 1GJIA 2X42A 3O2DL 2Q76B 4NFBA 5JDSB 2R2HB 3VA2C 2QEJA 1YQVH 4NZRH 5EU6E 3C6SA 1YEJL 2WWKO 1DL7L 1UEYA 4FFVC 1T1WB 1HEZB 3QFJD 5DD5H 3FQXB 3V6FB 2GTWA 1P2CA 4XPHH 1MCWW 2GTZA 2P4AB 4H0HB 2NY5C 1F4YL 4BELD 2DQGL 3O3UN 3U7WH 2Y6SC 1YNTB 2A6DB 1XGRA 4JHBA 5D7LE 3CSYB 4PJEA 5H94B 3FOMA 1XF5B 1G9ML 2WWMD 5TDNB 4GW1A 2WSKA 1FGVH 1H0DA 1WBYA 5I1GL 2OR8A 1K8IA 4H26A 2BFVL 4OFVA 1D3CA 4GXUM 3VXUD 3GBNL 4NO5A 4X6CF 2AK1L 3NZHH 4EUPB 3C87A 5CHNA 1UH3A 3P11L 4MDIA 5JNYA 1DQML 2AQ2A 2EZ0C 3DETC 4I13B 1Z5LB 4G6AC 1E28A 4WW1B 4AJ0A 5GIRB 3RBGA 1W8NA 1KTRL 3A6BH 3HI6L 3MBEC 2LABA 5DJ8B 5GSVA 4L3AA 3QIWB 5H8DA 3KLSA 3BE1H 1SVZA 2ATKB 4I18C 3DYOA 1EAPA 4XNXL 5I66A 5ETUB 4NC1E 3QDMA 4PLJD 1FFRA 1A9BB 5SWQA 1D6EB 3WYRA 2VUOA 1PAMA 1U8JB 5EG6C 3D85A 5FM5M 3WNOA 4G9FB 3MV9B 4NHCL 3BD5A 1FN4B 3SKJH 4P2OC 2A1WL 2N7BA 1NMBL 3GMNB 3T0ED 1C5CL 1DQQB 4X4ME 4OF7A 4Z7WA 1FFPB 5B38B 1G9MC 1HK6A 5DYOB 3SJVD 3HMWH 3T77B 1I7ZB 4NN7B 2B0SH 1L9MA 4Q6IB 3FQNB 5HI3D 3VI3F 1PLGH 4X0KA 3HKFA 4MMZC 1OD9A 2YBRB 1NCDL 1A0QL 4MNQA 4PJFE 2MPAH 4LLYB 1AO7D 1Y18A 2CRYA 1PEZA 2FB4L 5FO7B 1O7VA 3ZE0E 4PJHB 1ZGLP 2YHGA 5I1KH 5L0QB 3KJ6H 5D1QB 3PDDA 5GGQL 2PYED 3I75A 2NLJA 3TT3L 2HFGL 1NCBL 3ARFD 1CYGA 3PV7A 4RFOH 4OT1H 2V5YA 2OXGA 5AAMA 3M1BB 1BVZA 3NFNA 5FIEA 5BOZG 4OQTA 1DLFH 3SO5A 1JNLL 3U46B 5F3BA 4L8DA 3ZKSD 3P0YH 3W0WB 3ARDB 3MRIA 4MQSB 4KQ3H 1BOGA 2EYRB 4M4RA 4EZMA 4HH9A 4M7LT 5HYQB 3GMQB 2CLVA 5AYUL 4QOKE 5KANI 5KG9B 1G7PB 3GRWA 5E5RB 3FTGB 3HG1E 4HG4J 5GS0D 1NBZA 4HF5L 3BPLB 2VKWA 2UV3A 1K5NA 3QEQA 2I9TA 1ZHBA 1TJHL 1BVKA 2BHZA 3LRGA 3BDYL 4MQ7B 4L5FL 1X5IA 4XC3H 3EYFB 5I1EH 3TNMB 4PV8B 1T4KB 3QH3A 2X4TB 1T22A 4HKZB 3G5XB 1Z3GL 5D1XB 1NEZG 2OMNA 4WFED 3K81A 4Z7VF 3I84A 5HYIA 3O6FD 1OGTA 1T2QL 2FJGB 2YD8A 5CJXA 2EO9A 4JZJA 1FL3B 2VWEE 5F6IC 5IMMB 4XVJH 4WO4A 2WWKT 3DWTA 4PTUA 3JTTB 4JFOB 3EGSA 3MFFA 5M7QA 2CD0A 2N4IA 3BSZL 3KHQA 3BH8B 1J10A 1HINL 2APXA 3GIZH 4IRSA 4PJ9A 2DMKA 3DGCR 5HDLA 1Q0YH 2R8SH 2Q76A 2MNUA 5JDSA 2R2HA 3V8OA 1BQHG 4U4BA 1MWAB 3LIZL 2YWZA 3NFPA 1JGLL 3D39B 3ILPB 5HHVH 2QQKL 1HEZA 1KXQE 5GS2D 2NX5D 3FQXA 3V6FA 1FPTL 2ZOLB 4DKFL 5KSAC 1J0KA 4LKXB 1R5WB 3VXNA 4X7EC 3RIFF 2A6DA 4OIIL 3LPFA 4XPAH 3VRIB 1D9KC 3CSYA 5BCAA 1T5WB 1X4ZA 3O11B 1XF5A 1JGEB 5TDNA 3UBXA 1SY6H 3IVKB 5FUOH 1CTNA 1IC4H 1Z2KA 1YYLL 1ZK9A 1CFNB 3SOBL 3OF6A 2HLFC 4FQJL 1PX3A 5I9QC 1P4BH 4BUGA 5F6HI 2HTKC 3FO1B 3G04B 5IK3A 3DVGA 4EUPA 2DQCL 4LHJB 1RZFL 3V6BR 4G6ML 3JBG7 2VLKB 2B4CL 2FWOB 1G6VK 4WW1A 4AEIL 4TNWF 1CQYA 1YY8A 2DIBA 2VZ1A 3LRSB 5DJ8A 1RY7B 1VGKB 2IBZX 2NYYC 4ZXBB 3QIWA 2NW2B 1JPFB 2VDML 3GI9L 3VH8B 1A2YB 2X1XR 3WKNA 4ZMAT 2EXYD 2ATKA 1IEBB 5C0AE 5ETUA 3QFJB 4I0KA 4PJGB 1ZLSL 3SDDB 2BRRH 4RWYL 4N0FA 1A9BA 3P9MA 4LSQL 4XPGH 1D6EA 1HZHH 3UJIL 1U8JA 3RVUC 4G9FA 3MV9A 4ZS6C 1PG7L 2YSSB 4ZTOL 4HS3B 3BQUD 2Z4QB 3C8KB 5I8OL 1GGUA 1DQQA 4JO4H 4M7JL 3B5GA 1FFPA 5B38A 3L3HA 3OMZA 3SGDI 3O4OB 2AEIT 3T77A 1I7ZA 1U8QB 1A02N 4Q6IA 2DL2A 4NQUA 3FKUS 5I30H 2DDQH 5F6HJ 4WV1C 4HT1L 2YBRA 4YFLI 1ULVA 3SE9H 2ZKHL 4LLYA 4KUCD 5FO7A 4XNUH 3BDBA 4A6YB 4PJHA 3P3YA 1LO0H 5D1QA 3CU7A 4FRWA 4LNVA 4R2GC 3F8UB 3ZKXB 4JRXE 4JFHD 1FO0B 2XY2A 3M1BA 2B4CC 4UNVA 4JFFE 5CEZE 3U30C 1ODAA 4TVPH 5T3XL 3U46A 4KXZI 5D5MB 1Z9SA 4WRLA 1JTTA 5C3LD 1ZSDB 3UAJC 2AXJA 2EYRA 3BPNB 5HYQA 4P2QE 2NY4C 3SDXB 5KG9A 1G7PA 1NJ9A 3QZWB 4U6VH 1CGTA 2FGZA 1VFBA 3F7RA 5F70A 3RHWK 4WHTB 2AJYH 4K7PY 1A6ZB 4NKDB 1RURH 3KLDA 2V2XB 3N06B 5D7SL 3Q3GA 4ZFFB 1UACL 1QLFB 1MHCB 3V5HB 4FN0A 4MQ7A 4J12A 4NN5C 4QTIL 5MI0B 5JHDA 1I9JL 4OUUB 2IPUK 2HAZA 3T0EB 2DI8A 2IADB 3EYFA 3MJ7B 2Y9RT 3TNMA 3PNWB 5ABDE 1T4KA 1AJ7L 4LVEA 4HKZA 4RRPA 4MJ4A 3SJVB 1GAFL 1UADC 2YRPA 4FFVD 4FXKB 4KK5C 1GL4B 4WIQA 1HDMA 4YDKL 5ADPH 1YJDC 1F90L 1FL3A 5J8OA 3UYOD 4LARH 3ZSSA 5IMMA 5GISL 1AO7B 1AXTL 3JTTA 5ACZA 4WFGD 2Y6SD 4YPGA 5F71A 1P84J 5J9PB 3QO0B 5L6YH 4RWHA 2PYEB 3CFCL 4M1DH 3FMGL 1X3DA 5HHMB 5JZ7C 3V8CA 1MWAA 4BQ9A 2V2WB 3T0XA 2A6JB 1FG9C 3JUYA 1TMCB 3D39A 4YBLC 3ILPA 2Z8SA 4DKEL 1TENA 3RL2B 4D9RE 2ZOLA 4D3CH