4GJTB

Complex structure of nectin-4 bound to mv-h
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
114
structure length
114
Chain Sequence
b'GELETSDVVTVVLGQDAKLPCFYRGDSGEQVGQVAWARVDAGEGAQELALLHSKYGLHVSPAYEGRVEQPPPPRNPLDGSVLLRNAVQADEGEYECRVSTFPAGSFQARLRLRV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hemagglutinin glycoprotein
molecule tags Membrane protein/viral protein
source organism Measles virus
publication title Structure of measles virus hemagglutinin bound to its epithelial receptor nectin-4
pubmed doi rcsb
total genus 20
structure length 114
sequence length 114
chains with identical sequence C
ec nomenclature
pdb deposition date 2012-08-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4gjtB00
4NQVA 1F2QA 4UDUB 4E41E 3EDKA 2ATPB 4FP8H 2KDGA 3JUYA 5FK9A 1MRDH 1V3JA 1IAII 1NMCB 4I2XE 4KTDH 3RGVB 5C0DB 3ARGC 3U4EB 4EZMA 5I8KL 4JFDB 4A2LA 5HHXL 3RX7A 3FTGA 5KVGL 4F58H 1K8DA 2P24B 1BX2B 4UV7H 4ZXBD 3NN8B 4NO2A 4PB0L 4G8IA 5IP4A 4BZ1L 3H9HB 2WWKO 5J4MA 5HI3D 4DWHA 2IPTL 5SV3A 3QUZA 1KG0A 5DJ6B 1VKXB 3ZSTA 1U93B 5L9DL 3MUHL 2V2XB 2FCBA 1GPOH 5IFHL 1DANU 4MQTB 4KY1H 3IT8D 3RGVC 3HMWL 1LE9B 1WFUA 4GBXA 4FFWC 5A1AA 1KENL 4K9EL 2CGRH 5IEKA 4QGTA 1AXSA 4MNGA 5AEAA 2VLRD 4NQDE 2VXSL 3EGSA 5KSBB 4GKNB 3B2UC 3CVHL 1RURH 2E7LA 4Z0BH 4LDLB 1FFPA 1H3VA 5JXAH 4ZXBC 1KCSH 1OSZB 5ESAB 1LEIB 4ZFOL 1U36A 2X89D 4HXBH 4M93C 3SKNA 5DJCA 4YHZL 2WQRA 2YXFA 3E3QE 2PYED 3MFFB 1JHTB 3ARFB 4UIMB 5LVEA 2XTJB 3RFZC 2EKSB 3KPSE 5IW6A 4MXWL 5E9DA 1D5MB 2ZPKL 3PHQA 2OCFD 1XGUB 2IPTH 1MFDL 1BECA 1EA9C 5CWSA 2IPKB 3X12A 2Z93A 1I3RB 4X0KA 2XKUA 2WBJA 3Q48A 2NQCA 1JHKL 3DX6B 1MRDL 2R1WB 2BDNH 4UNVA 3FRPA 1P2CB 1MAML 4MXQD 1F4XH 3QCVL 4I5BA 5C0EB 3VI3E 1H3UA 1TTGA 3QDGB 3BH9A 5A16B 1VDGA 3NCYP 3P4OB 4JM4L 4OZIF 4H8WL 2DLFH 4AIZA 4Y5XB 4NM8L 1LO5A 1DDHB 1L9MA 3MUGB 2BNQA 1G7HB 3SDDD 1I9JH 1XIWD 1NL0H 4M7LL 2NR6D 3CUPA 4AG4H 1QBBA 2R9HC 4YIQB 1SBSH 1FNHA 4JDZB 3UP1A 2BSRA 3PJSB 5I1CH 4U1IB 3P73B 2XZCL 3QDJE 1QFHA 4G9FD 3EYUL 1KN4H 1C16B 3GEWB 4M62L 4CMMB 1FLRL 2Q87A 1X7QB 1EK3A 3T0ED 2HP4A 1FHGA 5CIPA 1CXHA 1UQSA 4LNRA 4PJAF 3ABZA 1BP3B 1CL7H 1LEKB 3AREA 4XPBL 5HGHB 4ENEC 2V2WA 2JIXB 2HRPH 5F9JA 3MV7E 1KCRH 1KJ2H 4RISL 1LP9F 4AMKL 5EWIH 2ORBL 4ZUSA 2GQHA 3L7FA 3QIUA 2BSED 3O45A 4K7PL 4P2RD 1WEJL 2GJZA 4P46D 3U2SA 1QSFE 5LJYH 4J3XA 3KNBA 4OQTL 3GMRB 3ARBA 3H8NA 3WNPA 4O02L 1RIVL 4QHKJ 5C8JA 5JOFA 1JWUB 1K8IA 4J4PC 5IB4A 1J1OH 4L5FH 3L3JB 4FQPA 1W72L 2CDFA 1IMHC 5IKCB 3HCVA 1IEBA 3CSBA 5DRXB 1WLHA 5GGVY 1AP2A 5DZNA 3DVNA 1TZGL 5IT2L 1KPRA 5GRXG 5C07E 3TBWA 4XH2A 1MAKA 1WWAX 4MNGE 5DK2A 5DRZA 4M62H 3VXRA 4YHIB 5JW5A 1V7NH 4OF6A 4DUVA 2NY4B 4NRYA 1FDLL 1IGCH 2L0DA 5J06A 3ROOB 2P5WD 5EPMA 1P6FA 3BYYA 3I02B 3IJSA 5K59E 5TH2A 4HAFA 3D39B 2AQ3A 4U6HB 5DLML 4JO4L 3G6AB 5F1IB 3RKPA 4W6WB 5HSFA 2NXZB 3GKWL 1U91B 4OV6F 1OP3K 1VACB 2D03H 2ORBH 2R9HD 2X4TB 2ITDB 5BZDB 4TNVF 4OF0A 2Y4SA 1PLGL 3UROR 2BSTA 1QFWM 3LB6D 5I1GH 3T1WA 4OFDA 4Z9KB 5F9JB 4JM2B 3ARDD 3PDGA 3G5ZA 5HYJB 3LQAL 5KOVC 2Q76B 1B2WL 3T0VA 3G6JA 4M8QA 5EA0L 2VLJD 4F80A 1M71A 4AH2A 5EU4B 2UUDH 4O2CB 1C5BH 5DR5H 5HGAB 3EKCA 3DX9A 3LH2H 4NO0B 3EJYC 3ZE1F 5I75C 5EO9B 3ARPA 2OTPA 4GKZB 2IQAB 3L95A 2E6QA 4UTBL 3OR6A 1NC2B 3C6SA 2G5BB 4LQ1A 3O81A 4PLKD 1TZHB 2PTTA 1INDH 2HYMA 4GFTB 4YDVA 2PUQT 1ND0A 5C6PB 5AWNL 4HKJB 5DUPH 3EO0A 4MSWB 1KJMA 5CJQH 1WAAE 3JWDC 4U3HA 2GI7A 2EECA 4RA3A 5EBMB 2VDRH 3FOMB 1JZ6A 3QWRA 4R7NA 3CCHA 2XPGB 4HK0A 1UG9A 1I3RA 3R8QA 2WBJB 1UA6L 2R1XA 4FQHB 3BD4A 1OCWH 3T2PA 2FL5A 3GMPA 4XT1C 3L5HA 4YBLB 3GKWH 1MCHA 2GJ6E 4UIMA 4J7RA 2BERA 4P46C 1FPTH 4UV7L 1PSKL 3VG9B 4JFXA 2DQCH 5C92A 4HWNA 4DVBB 2IAMB 1DR9A 4KJWC 4XNMB 3EFFA 4JFZL 2CR6A 2R0WL 4BSWA 3KYNA 5E56A 1FFPB 3BUTA 4GXUM 1UJ3A 3QG6B 1G7MA 3LQAH 5GRZA 2BCKB 3JVGC 1J8KA 4NUGL 2AJVH 1ITCA 1KPVB 4LBEA 2X42A 3QUXC 5DMGD 3UAJD 3OXSA 1LE9A 3P77A 3GBNH 1CICA 3ZKXB 4ETYA 1HHKB 2J4WL 2BNUB 3BGFB 4WWKA 1G7QA 2XI9A 3LVEA 2OSLB 5EOCJ 1FORH 3C5JA 3UTSA 2JB6B 4LEXH 2CMRH 3ZSSA 3UZVB 1CF8H 1RJLB 3F5WA 4EXPX 1K85A 3WXVL 3A6BL 1A0QH 4HUWA 2Z91B 3WE6B 5KS9A 2PW1A 5JXAL 3FB5B 4H8WC 1INDL 1IM9A 3BWUC 1GZPA 3QUYA 3GM8A 5FYKD 4U2ZA 3PABB 5T33L 4RX4D 3V2AR 3HPLB 1BFSA 3OF6A 4YDIH 4WHYG 3ULSB 5D72L 1XH3A 5C0DA 1A7QH 4DAGH 3UTTA 4LCWA 3INUL 2DLHA 2P49B 3CSGA 3T0AA 3FN0H 3G5VA 4MAYB 5LCVH 5HI4D 5BOPA 4DQOH 1FL6A 4XI5C 5F9AC 3BW9A 1YDPA 4QRPB 1J5OH 2BOBB 3MV01 3ZKMD 5LGKA 5I30L 1GGYA 1E6OH 3O6FB 1FV1A 2Q3ZA 3IRZA 5AYQA 2NY1C 2VZSA 1NDGB 4KUZL 1CLZH 4YPJA 3GIZL 3GBNL 4LQFL 2DJUA 3WIIH 1T03L 4DGYL 5CCKL 2PR4H 1I3VA 4NPYB 3D2UA 4P3CL 1JPSL 1WBXB 1DEEB 2W9DH 4F33A 3ULVF 4LLDA 2LABA 5JUEL 1F90H 1W8NA 5GS0D 1T1WB 1HYSC 2CDGA 4KH2A 3BH8A 5IT2H 1S7XB 4NFDA 1KYOJ 1TLKA 2F5BH 1R3HB 3THMH 3OSKA 5EC1B 3MA7B 3UJJH 1NFDB 1PKQE 4H25B 2VABB 4UDTA 3FOLB 1CG9B 5T3XH 4IMLB 1LO0L 4XNZB 4F9PA 3T3ME 4YDIL 5LWYL 3CVIH 1XGTA 3EYUH 3GSQB 5CGYC 1F58L 4FQXA 5DFVD 3WKML 3NTCL 1UZ8B 1FORL 3AS1A 3VGDA 4OKVB 1RJYB 3GMMB 3H42H 4MJIB 4YE4L 3M17A 5D9SA 3QDJB 4JN1L 1ZLWH 4LPUA 1F4HA 3HC0B 2Z31D 2EDYA 5D7SH 4WUUA 1OAYL 4LHUB 4N0UA 5FKPB 1I9IL 1RZJC 3SOBH 3BEVA 5GISL 3CMOH 4WU7B 2MSPA 3QQ4A 3GSNB 1MIEH 4NSKA 4BH7B 1F6FB 1JPSH 2W9DL 1RSFA 2UZIH 3TIEB 4LLQA 2YZ1A 2AJSH 1VEPA 3CFCH 3TT3H 1KEML 1I1AA 2EDWA 2JK5A 4PB9H 5I1IH 3EHBD 1IGMH 2VC2H 4OLEA 4LAQL 3QH3B 3FMGL 4JFEB 2EIZB 1T4KA 1M05B 1W0YT 3OV6A 4WO4B 5IHUH 4M61B 3EJJX 1DQLL 4YHNA 1EPFA 2Q86A 1H8SA 3TN0B 5GRJH 3RUGA 4LCCC 2DLFL 4M7ZB 3S5LG 5J89A 4PGEB 4ZAKA 2Q6WA 3MOBH 2XXMB 4G3YH 4IS6A 3UTSD 3PP3H 3FO2B 4JRXD 1KOAA 4P23D 2D7OA 1H3XA 4LPWA 5CSZB 5F71A 4M61A 2I5YH 4XX1E 3NCMA 4WY7H 3GSQA 1X6NA 5A40E 3LKQA 5BOZG 2JK5B 4RFEA 4LPYA 1CZ8H 4JFFA 3A0OA 5GGTH 3ZE0E 3BZFB 1V3LA 5GS3A 1AXIB 2GJ6D 2IBBA 1E4KC 2VZUA 3MA7A 5AZ2L 1FFOA 3I6LD 4B7LA 5FYLD 2MMXA 3CXHJ 4PGCB 4K9EC 5A2LH 3TN0A 4RGND 3ZKQD 2XFXB 3B9KD 3P40A 2VQUA 4LSRL 3K1KC 4TRPH 3S34L 5FDWA 4HGMA 1XCTA 5ERWB 4F33B 1MWAH 3HFMH 1C5BL 1CDHA 1NCWH 2HWZL 4JDVB 1I1YA 5DGRA 5EOCL 1MELA 3GJEB 3QDJA 5E08L 5EORL 1EO7A 3I75A 2EDKA 4OLYH 1TJIL 4PGDB 1ONQA 2D3VA 4NUGH 3H9SE 3MCLL 1S7TA 3JWOH 4ZS6C 2I60L 4NNPH 5CP3H 4OAWB 1RIVH 3QQ4B 3G5VB 4MAYA 3V6FB 4F3FA 3MV8D 4UIKH 5KSAA 1A4JA 2X4UA 2DJ4A 5DFTA 3MJ8A 3PWNA 1U8IB 1OTSC 2VLJE 4LCWB 4ZO8A 2AXGA 2GAZA 3QHFL 3UC0L 4NQED 2CXKA 4HJGA 3RTQA 4HUVA 4HWUA 4KDWA 1ZVHA 3RPIB 1HQRB 1EHAA 3WFDH 5JDSB 1ZHKA 3WEXB 3JV4A 4QOKE 4LVNB 1YNTA 1BQUA 1S7SA 1UA6H 2XT1B 5KS9B 4KU1A 4OCXL 4HZLB 1MQKH 1CG9A 1K3ZA 4KAQL 4RQQB 4X99A 4HX1B 2R4SL 3B3IA 4F57L 1QLFA 3E0GA 1D5BA 1EHLL 1JTTA 4WUUE 4YC2B 2NY0C 3ZYOA 4X9BA 1S7XA 1NEZG 4HQQH 5EBLB 1S7WA 2X7LB 5DS8B 2HKHL 3L3HA 4ISVB 5TE4L 4JZNB 3CFDB 1CLOH 5BXFA 2LU7A 5C9JB 2QJDA 1NBVH 1RV6X 2QKIB 3HRZB 1ZT4B 1II4E 2Y5EA 3QPQD 3F62A 4WV1C 5DTFA 1OAQL 1JF1A 4S10A 2BVPB 3WHXB 4POZD 1HKLL 5CJXC 1TQCC 5MERB 3QBTB 3QXTA 3ILPA 5D71H 4MA3A 2W0FA 2C4FU 3N1FC 5ADOL 4V1DB 4GW4A 3QULA 4N1HB 3C5JB 2YSSA 4WW1B 4HS3A 1MCWW 1I7ZB 5I8OL 1I1FA 5GS1A 5F72S 1IC5L 2NY2C 3DX7A 2YR3A 5B8CC 1QR1B 1L7TL 3CDCA 3IDJB 5HYEA 4JJ5A 1VPOL 2X2YA 2XPGA 2V5YA 4RAVA 4XZUB 2GT9A 1NGXA 4PJAE 2CRYA 3LRSA 2BCKA 3L5JA 4LCUB 1EHLH 3H42L 3RVUC 5MEPA 4OJFL 1I1FB 1Z9OA 4GAGH 4LKCB 4RCAA 2YA0A 4DVBA 1CQYA 3S4SG 3DV6B 5FO8A 5HHPB 3QDGE 1H15A 4XP4L 4U1KA 5GGSB 4PJCA 4L1HA 1FLTX 3MODH 3RDTB 4LLYB 5HD8C 1KPVA 4D0CA 2UYLB 5MHSE 1WK0A 5I18L 2VZTA 3JBG7 1B6UA 3MRPA 4O2EA 4KUZH 2B39A 5T3ZD 1AO7B 3O6KL 3SJVA 3KYOB 2WIIB 4AJ0A 1SHMA 1BEYH 3RWJA 4R97B 1TPXB 3T4YB 3RX8A 1FAIL 4LVEA 3S36L 4L29A 2MTPA 5FM4A 5IB5A 5DHVA 1OAXH 2DLGA 3HZMB 5DHYA 2EDQA 4U1LB 4O2FA 2XTJD 3MV8A 3ARDC 4L1DA 3QUXB 4ZPTA 4YDVB 4WEMB 1BIIB 4Q6IA 4ZPVB 4P2OB 1K9TA 2RAMA 3EFDH 2M1KA 4FQHA 3K4DA 1FZKA 2FX9L 4ZUUA 4Q7DA 1T6WA 3WMSA 5BRZD 2AXFB 3PWPD 3TO4C 3WXVH 2YD3A 3HR5A 1TJGL 4ODXA 3DGGB 3O2VL 3HRPA 1VPOH 4XWOD 5EN2A 3X14B 3MLSL 1PZ5A 4M6OH 1A6WL 1NC2A 5EZOL 3HC4H 3QEQD 4FQ1H 3BP7A 5HDBF 3HCVB 1MSPA 3ULUH 2D7PA 2XG5A 1FAIH 1NANH 4JR9L 4GBXD 5F6HJ 5MI0C 4U49A 1AR1D 3ARWA 2EEAA 4J4PD 1R24B 2YPKA 3H9SD 3FMGH 4EN3B 4H8WH 4MJ6B 1JGVH 1T5XA 2ZOKB 3EOAA 4QLRA 4KTDL 1F4AA 3MRLB 1UB6A 1AKJD 3ARYA 4U6HA 3JWOL 5ABDE 5I18H 1RVFL 1QLEL 4M6ML 1CTOA 4WFFE 1MFDH 5HYJA 2DKSA 1QLRB 3OR7A 4W68A 2DI8A 1QR4A 4QWWC 4RMRA 3EYQD 5D5MA 5CINH 1DLHA 5ESVA 5JPNB 1PZ5B 3P0YH 3RL2A 4XH2B 5GPRA 3SO3C 4YDJA 5ANME 1X4ZA 5F1KC 1AD0A 4X80H 1QBMH 4U1HA 1UCBL 4JPKL 3L3JA 5TH2B 1OP5K 3D25A 5MEQA 1DUZB 1DBKL 4XNYL 1UGNA 4JY6A 1JGDB 1RUML 3V5DA 2Q6WB 5MI0B 4JO4H 4ZAKB 3RVXD 4PGEA 3G5YB 4Y2DD 4PJFB 2ENYA 3SE9L 5F7NC 1GCFA 3QA3B 5C70A 5J9PA 3TYGH 1EVTC 2VLKB 2YPLE 2VRAA 1RUPL 5E8PA 3D0LB 5FYJH 4I0PA 2YUWA 5CS7A 4E5XB 2OMNA 5MEND 4N8CL 3TNMB 3TNNB 4K71B 4RGMB 3U9UA 4HG4J 5FYKL 4MX7B 3OTTA 3TA3A 5GQBA 1JNLH 4A2MA 1J05B 4UQ3B 1JYWA 4HMDA 2O5ZH 3D87B 1MI5A 3WFZA 1L6ZA 3QO1A 2VL5A 2Z31C 2GEEA 4KI5D 3AS0A 3IJHB 1L7IH 4QOKD 1S9WB 2J8UB 5CWSB 5DD0H 3MR9B 2ERJC 1BD2D 3K8MA 1RHHB 3CH1B 3D3VB 3EYFB 3AVEA 3K8LA 1V7NL 4I3RL 1MCNA 5IMMA 3FQXA 2NY6C 3ZMRA 1KTLA 1C5CH 1JTPA 2APVA 2FGWL 2LQRA 2AJYH 4TSAH 4U4BA 1CDIA 5E2WL 5E94A 5I2IA 1UXSB 4TTDD 5E8OA 3V4UH 1WICA 3GHBH 4EI6B 4KK9D 2E6JA 2BOCB 3CFIC 4KK8D 1WSST 2ZCLL 3SDAA 1NGXB 1JMXA 2R1WA 2YD9A 4V1DE 4MYWB 4GRLB 2QQLH 1ZANL 1U3JA 3HUJF 1SMAA 2Y06L 3CZJA 1XGUA 1OD9A 1T1WA 3ALXA 2KQNA 3LN9A 2NY7H 4LFHD 3PHOB 2X4OA 3C60D 2C1OA 3WLWD 3X3GL 1LD9B 2NX5B 5JNYB 5KVGH 1BOGA 2RFXA 4DFHA 2YC1A 5LQBL 3MRKA 4NNYB 5KBNC 4JZJB 3D1MC 5IEHB 1T89C 4GKSB 4KK9C 1R5IA 1HH9A 1JWSB 1QPXA 2VDNH 3GUTA 3U9PL 1BF8A 3V8CA 1AGFA 1IQWH 3BP6A 3RGVA 2EDOA 4HGWA 4F7TA 5K9JL 3C6LA 5IEKB 5IW6B 1U0QA 4FQCH 2DS4A 5IVOA 1S7QA 4MDJB 3F58H 1JWSA 4YLQT 5B4MD 2GTWB 1KB9K 3CX2A 1FE8L 4XVTL 5GZND 4EN3D 5A2KH 3IDMA 5D6CA 5I66B 4C55A 3DRQA 1A9BA 4WCYL 2V5RA 4MB5A 1MJUL 3MC0A 3TBVB 2C1OB 1DBAH 3MJ7B 2P5EA 2WANA 2VZ3A 4HKZB 4OZ4B 2IH3A 4HWBA 1I8KB 4NZRH 3LEXA 1YEEH 2YN3A 1QR1A 2MQ3A 2H2PD 4XRCA 3T0BA 3U4EA 3H7BA 1F13A 5TDNA 4PJIF 1N0XL 4HGWB 1U8LB 4YFLI 2VDNL 5HHOA 1N6UA 3PGFL 3VW3L 1WIOA 3SGEH 4PJEA 3U82B 1ZVSB 2NZIA 4CW1A 4XNMA 5ALBH 1JGVL 1ONQB 3P9WB 4WWKC 4E0RA 3H3PH 5HYSG 3X3GH 3RWHA 1OAXL 2ZCKH 1U8HB 4XP6H 3GB7A 1J1PL 3W0WB 2QBWA 3GMLB 3OKNA 3Q6GL 4MVBD 1MLCA 2F53A 3VXQB 5EOTB 3LPWA 5DZOA 2GTZA 5H2BB 3FCTA 1MCFA 1JHLL 2F54B 3QI9D 1K3IA 1U6AH 3BN9C 3KYMA 4NN7C 1FCCA 5CJ5A 3GMOB 2P43B 2A6KB 3IB4A 4N8VB 4GMTH 1A1OA 1N3NA 5T33H 4DTGL 3QFJE 2WUBH 4EOWH 5F6HI 1TJGH 2EKJA 3LKQB 4U6YB 2HH0L 1ND0B 4PGBB 4M1CC 2NXYD 5TQ0H 5IMLB 3MV9B 4I2XA 3GGWB 4ZNEA 1S9KC 2XZQH 3ECBA 3FQXB 2Y9RT 3V6OC 3ZTJH 4OCMC 3LMJL 1DBAL 5FYJE 3SJVD 4DZ8A 2HVKA 2NXZC 5J8OA 4Z76B 3D3VA 4WFGE 3SDAB 5HHQA 4NQSB 1AGDB 3FT4B 3HHRB 1W72B 4PB0H 5HYJD 4UNTA 4PGDA 3DMMD 1MVUB 4K7PY 4KVNL 4XBEL 2PXYC 3RQ3A 4PJXE 4PD4J 4LLWA 4NRXB 2P5ED 3L3GA 3TT3L 2XACC 4X6FA 5TF1L 4L4TD 1PSKH 4BUGA 5FFLA 3D0VA 5GGRA 1BLNA 2AEQH 3D85D 4PJEF 1MHCA 3JSSA 3VH8G 1G7IB 1OW0A 3QQ9D 3HAEH 5I8KH 1KIUA 3CH1A 1RHHA 1FO0H 1SQ2N 3DVGB 5LG1A 5T1KD 1CFQB 1E4WH 4KJQC 3VDCA 3ZE2F 1T1XA 4RMSA 2DYPD 5JLZA 4LHUA 3WJJC 4KVCL 3B9AA 4P3CH 1U91A 5H35B 5JHDB 1ZLVK 1LHZA 4EN3A 1QSFA 2EDXA 4MMXC 2VKWA 4IOIA 3X11A 1FL3B 3BP4A 4NYLB 2A6JA 3UYRL 5CP7A 4GRWB 3L6FA 1H5BA 3AC0A 4V2CB 5DRNA 3TBYA 4EVNB 3BOVA 2ITCB 1S3KH 4ZUVB 5C07D 5M95B 4X9IA 3UTPE 2H45A 4M7JL 4S0TD 1JNHA 3VXRD 3WJLA 4NNXB 5F7FA 4O58L 2W92A 5ISZD 5DRZB 4HIIB 4YDJB 1CVSC 1N59A 5TQ2H 5HPMA 1HILA 1CI5A 5K59F 3ZE2E 1DQQB 4G80B 4JRYA 4AENB 3FB8B 4NGHL 2HT4D 3DROB 4G7YL 3OAUL 3QI9A 2WV3A 4HF5H 1P1ZA 5IVXE 4F7EB 3EJZC 4XMPH 2NW2B 2ZUQC 4OF8A 2DICA 4UBDC 4OD1H 3VFUB 3CPLB 1L7IL 4ZUUB 4PJBE 1T4KB 2VDPL 4HKBB 4MLIA 5E2VL 4PJ9A 5HY9B 3BSZL 5CEZE 2BZDA 2C4XA 4RFOL 2ZUQB 3WUWG 3K8KA 1EUUA 5E9DE 2F74B 2KKQA 4XPHL 4Y5YA 4NQXB 4FNLL 3ZE0F 2G2RA 1GAFH 2OLDA 2R2EB 1PG7H 2QEJA 3MV8B 5I30H 3QIBB 1H8OA 5DI8A 3V4PL 2QHRL 4Y16A 1KC5L 4IRZH 4ZUWB 1BQSA 3SDCB 1JFQL 4DGYH 3LHPH 3ARBC 3QHZH 3HC3H 1E4XI 4N0UB 5FKPA 3VGBA 4FQIH 3LD8B 3RWJB 4WEUD 3CFKA 4JFEE 3QIWB 5GRVL 3ARSA 4WCYH 4R4ND 3BQUD 4G8GE 3G08A 1IZJA 3L3OA 3BN9D 3AAZB 4N5UA 4TVSa 4MA7L 4NKDA 1IILE 5L2JB 1U95A 5JPMA 3QO0B 4IHOA 3BVNB 3BZEA 5IBLD 1CDBA 4XXDB 5TDOB 2X10A 5DJ8B 1YEHH 2NNAB 1WZ1L 4AEIL 3QDMA 2YS4A 5EU7E 3O11B 3CK0L 3RDTC 2VDPH 1ZAGA 4DCQA 4MQ7B 3QEGH 5TJWK 1DQDH 1IGJB 1PG7W 1KCUH 4PJ8C 2FJFA 5IHZA 1KSRA 1XZ0B 5IV2A 3TJEH 4U2YA 2HLFC 3W9EB 1EAPB 1RUKL 3RZCC 1O0VA 4HIJB 4JFOB 2GKIA 2NTFA 3DX7B 2ADIB 1NC4B 1ZT7A 1IARB 3FB6A 1U8QA 2YD4A 2XA8H 3ULUC 4NBXB 1ES0A 3DSFL 3N1QC 4PTTA 1P5UA 1ZGLM 4P59L 2RCSH 2IQ9L 5GJTH 2BOBA 1R3JA 3K2UL 5C08E 2VXQH 2Y5TA 4W4OC 1TFHA 4LF3B 3OAYH 3ET9F 3ZDYE 1AH1A 3SKOB 1H15B 3M07A 5DD3L 1NGQH 4BFIA 5IHUL 4JVWA 1P4LB 2WNGA 1CGYA 4IDJH 3OKMA 3CIQA 1N5YL 5D70L 3VXUB 1ZT7B 3QWRD 2FGZA 4N0CC 2WBWB 1AO7A 5E6YA 3MRCB 3B6SA 1FSKB 3FOMA 4J6RL 5JOPD 4GJTB 4MJID 4M4PA 3LQZB 4OLWH 1JI2A 3GJFH 3JV6A 5E7FA 1KCKA 4P2QD 1TETH 3RIAF 2DQFA 2ZUUA 4HZLA 1QBLL 4PGJA 5JW4M 2H3NA 3P4NA 1KG0B 5KSAD 1FZMA 3VFSA 1MJ7L 4RGNE 5EA0H 3RVTD 3FQUA 3QO0A 4IHOB 3T0EE 3MOAL 5ESQB 4F2MB 1OGAB 1A9EB 2E27L 4MA8L 3DHMA 4DGVH 5C0AB 4G9FE 4NO0A 5J1TC 2MQCA 1URLA 1ODAA 4KRLB 3VXUA 2IMMA 1HINH 5I9QB 1GOHA 4QOKA 5ILTH 1FVEB 3JV5A 4ZTOH 4C56E 2DTSA 2VISB 4BH8A 4JZNA 4LPTA 3BP5A 3L1OH 5AZEL 5I8EB 4KV5E 3N06B 4OLVH 3U9PH 3VGFA 2ATPA 1SY6H 4OAWA 4LCCA 3QJFB 2FJHA 1WISA 3IJYA 3ULVD 1A7PH 3A6OA 2HFFB 3P0VH 1QACA 1M7DB 1XF5B 4TQEL 3U7WH 3LQMA 4PLOB 4F7PB 1DBML 3NABL 3C5ZA 3SGJC 4CL7A 4JQXC 3TVMD 1I9JL 3OKDA 3DPBA 4HIJA 4JFOA 1G0XA 1F11B 1JPGA 4JRXB 1ZSDB 1UM6H 3VFUA 3ZKNC 4KPHH 3C09C 3E1F1 1BQHB 5I1LA 3TF7C 1YEJH 4KKCC 3QCTL 3GSNL 4L4TB 4MSWA 1OAZL 3GSXA 3VGHA 3OKEB 4BQ9A 2F15A 4JKMA 1ZV5A 4B41A 2IAMD 5SWQA 4DGVL 2OL3A 4EEEA 3V6FA 4FQLL 4MXVE 1AQKH 3U0WH 1G6RB 2BJML 2GITA 3RVVC 5FOBB 4Z95H 5IK3A 4JB9L 3EYOB 1N0XH 1AGBB 2NXYC 2PW2B 1FG9C 4P4KB 5EIVA 3TBYB 1QBLH 3SE3C 1WIPA 1BWMA 3L3OB 1ORQB 2VMFA 4K94L 3KDMA 2QADD 5FDYA 3ZDZE 3P0VL 1CLOL 5EU4A 5J6HA 2OXHA 1P53A 3MJ8B 4JN2A 1IT9H 3KR3H 3DETD 2GJ6B 2E7MA 3SDCA 1EFXA 1FH5L 4N9GA 2ZUWA 4IRJD 2JIXD 4YXKL 1EFXD 1T7ZA 1CTNA 4PG2A 5CEXB 3PXJA 4ZTOL 4LSVH 3MCKB 2YPLA 1OM3L 5CINL 2X4SB 4NRXA 3QEHB 4LGRB 4OLVL 3DO7B 3RNKB 3HA0A 1T83A 1IC4H 2Z8WC 3QXDA 2VZVA 3HMWH 4HFUH 3WIHH 4RAUB 2H8PB 5C07B 4UOW0 1VACA 3U30B 5HY9A 5HXMA 4WTWA 4Y1AE 1D5IL 3PGCB 3G6AA 2G5RA 1MH5B 4ZOEA 2VDQL 4XTRC 3NAAH 3WS6A 1P7HL 4RMVA 3P73A 4H88L 1JZ8A 4OTXH 2BSSA 2I24N 2XKNB 4PJCE 3RZWA 1T1ZA 3ZKXC 5CEYA 1YECH 2PYFA 3JTTB 1NCCL 3GDBA 1LGVA 4LCWD 1X5XA 4RFEB 4WEBH 4OFYD 4WW2C 4CVUA 2DMKA 1L4IA 3O3DB 4PJ9D 5D2NC 5DRXA 2O26U 4GRMB 3V5HA 1I7TB 1GXEA 1YMMD 5DD1L 3VD5A 1AC6A 2APBA 3OGCB 1K6QL 1DL7L 1ULVA 5J56B 2YKLL 4JVPA 1IJ9A 4PR5B 3O6LL 3OAZH 3INUH 4JLRB 4KK6D 4YHPB 2ZSVB 3GSXB 2B7DT 1RUQH 2ZNWA 3I9GH 4HW6A 1S5HB 3CX5J 2AV7B 4L4VD 2F53B 2AEIT 3V6OE 5AG9A 5E99H 3VFRA 1MOEA 1D5IH 2BVOA 2LU4A 5C86A 2IJ0C 3REWA 1P4IL 5IIEB 4Y5XC 1EH9A 1HE7A 1SJEB 2DBJA 2SEBB 2X89A 3RWHB 3VRJB 1CGXA 3SKNB 2FB4L 1Y6KR 3BW9B 4KKNA 5E6ZA 3QJFA 2FJHB 5IWLC 4YAQA 4HJJL 5F88B 4NQSA 3BEVB 4HFUL 4KI5C 1AKJA 3ZL4H 2VISA 2EICA 1IGYA 4Q2ZB 2VLJA 4MWFA 4Y8DC 4YEFA 1MHEB 1W0VB 4HCRH 3HPLA 2C1PB 2BNQB 4MJIA 3IKCA 3D39D 1ZA6B 5C0RH 4BFEA 2IH3B 2DD8H 1OAUH 2CLRB 3PWLA 2NX5D 2YWYA 3SDAC 3VDAA 3BDXA 4QXWA 5EO0B 4X9FA 1Q72L 1TIUA 2CIKA 4M3JA 1EV2E 3I9GL 4XMPL 1KEMH 4LOUC 4ZXBB 3UTQA 1FV1B 3IDMB 2ICES 4KRNA 5D7SL 2FATL 1FVCA 3MLWL 2FLRT 2MCPH 2F5AL 3OXSB 4ZFOB 4F58L 3Q1SL 3DOSA 3DXAE 4BA8A 1KB5H 4LLUA 1U3HD 1PG7L 4KTYA 1WBXA 2EDDA 1IBGH 1G7MB 2FLBT 1EVUA 2V9RA 2CIIA 1MCKA 5E2TH 3D6GA 4P9HC 2CUIA 2NY2D 3PABA 3UO1L 3NFNB 1M7DA 4P2CG 2IG2L 2CQVA 3QEQA 3MRKB 7FABL 4YXHL 3BKMH 4NZTH 1HNFA 3GBLA 5HHOB 3ZHDA 5B3JE 1VA9A 4L3EA 5CGTA 2F8XC 2YZ8A 1F6LL 3FFDB 2X1QA 3WBDA 3LB6C 4QOKB 3GHBL 3PWPE 3DARA 4Q9BA 1DLFH 3DYOA 2OK0L 4G6AC 4BELD 3ZTJG 1OGAA 4Y19B 2VDML 4Y2DC 2BVTA 4G6ML 1YEKH 3MJ7A 4NC1E 2LVEA 3IS0X 4G9DA 5KSBE 4PV9A 4XAWH 3U7AA 5ALBL 4OFPA 4Z77A 1N8ZA 4FQCL 3VD4A 4YH6A 1TMCB 1INEL 1MIML 3O4LE 15C8L 1JK8B 3FTGB 1I8LC 4I3SL 1BOYA 3HLAA 4LSTL 3WFEH 2FIKB 3VRLE 5BS0A 5GRUH 5FUCC 3EZ8A 1YUHA 1NSNL 5IR1B 3MACH 3QWOB 3WLBB 4FZ8L 3W82A 3HNTH 4I0KA 4WVRA 1U8JB 4X6EA 8FABB 1GZQA 4PV8A 3S37X 1J10A 3ZE1E 1M71B 4AH2B 4UAOC 1GOFA 3Q3GA 5EBMA 5I75B 4IRSA 1HEZB 1EERB 1G9ML 2I60H 5DJ2B 5IBUB 4H1LA 5BV7H 1I9EA 2AV1A 3IVKB 1AHWC 2D0FA 5IOPA 4Y2OA 3U6RB 3WV0A 4NQXA 5I1CL 1MHHB 2PTTB 2VLKA 5KVDH 4OFKA 1QO3B 1CDYA 2DQEL 3C6SB 4WW2F 2ZCLH 1UKSA 4PJBB 3VFNB 4K7FB 3PF2A 1XZ0A 1JGDA 1F3DJ 1AJ7L 3NIFE 2YD7A 4WGVB 3SN6N 2R1YA 5D1QA 2LAGB 1A7RL 4I3SH 2EDFA 2D31B 1WZKA 1MCLA 3SKMA 3FB8A 1EGJL 1IT9L 3UPAA 2Q76A 4JDTH 1UH3A 1MHPL 4WHTA 1P84K 3MUJA 5I1AA 5DJ8A 2H1PL 4HD9A 3ULVH 4YXKH 1MY7A 5FEBA 1W0WA 2DI9A 2D7QA 4FZEH 4CVZB 2HT2D 2HAZA 4Q0XH 1MWAB 2FWOB 2MCG1 1XR9B 3SCMB 4IOIB 1S9WA 1Z6JT 1A5FL 2H26A 3U2SB 5JHDA 3SGEI 1OGTA 2OJEB 2JJSC 3T3PF 5GGSY 4DVRL 3IAPA 3FAWA 4I77L 3G6JB 4NQTA 1P9MA 5MEOA 3EDJA 1A6UL 3MRGB 4ZOAA 5ELIA 1QOKA 1JE6A 3TA3B 5KW9L 3BRFA 4GOSA 2H32A 1OB1A 4OZFB 4WNQA 1B90A 1FZOB 3R8BB 3U9UB 5DJYB 3SE9H 4DK6A 2G2RB 3B2VH 3SKJH 2OJZH 3PGDB 4X6FB 1MJUH 4I0PB 1Q9LB 1GGUA 1LO4L 4FQJH 5DK0B 3KLHC 2R2BB 3KXFB 1FGNH 4BZ2L 1AP2B 1KTDB 2ZNXA 1YC7A 4LFHG 2NY2B 3JV0A 4FG6D 1EGJH 1RY7B 1KJVA 4UAOB 1TNNA 4ZMAT 3C2AH 4HFWA 4HF5L 5J1SC 1N5AA 4NRYB 4S1RL 1PLGH 4LLMB 4ODVH 1KTRL 2EZ0D 4NO0D 4GRWH 4U6XA 1NCAL 2XWBA 3S88H 2AKRB 3MYZA 4GUPA 5EOCH 1SJHA 5AAMA 1G1CA 4C58B 3U36A 4PJDA 2R2BA 3IS1X 3MUGA 3KJ6H 4Y5VB 5E6IC 5EU5A 3HI1B 4U0QB 5CAYB 2IEPA 1DBJL 5GJSH 4FTVB 4JFPB 4LSUH 2WM0A 3DMMB 1FYTD 1QZ1A 2XRAH 3BH9B 3Q6FB 4U6YA 4HDIB 1PVHA 3S3PA 4WIQA 5JOFB 3EFDL 1HOCA 4WRLA 1GGBH 1MCJA 2F5BL 2QL1A 1IAMA 4MS8C 3DX6A 1ZTXL 4APQB 2W1NA 4HC1H 3WXWL 5JOPE 5JLZB 5DD5L 3SJVB 1R24A 3LKSB 2EH7L 4YR6A 5LWYH 2PTUA 2DYPB 5HHOD 5B38B 4U1IA 3CFEB 2VSDA 4FXKB 4XAKD 5E5UB 1EFQA 5BW7A 3BP7B 2GW5A 4PJ8D 4AIXA 1JK8A 1G7HA 2AJXH 3G6JE 2I07B 1VSCA 4MJ2A 4JN1H 4N1CA 3GI9H 2DQIL 1L0QA 4JZOB 1QFPA 2PN5A 1T0MB 5IQ9A 3OJMB 2VDLH 1CLYH 4CW1B 4F57H 1KEGL 3AREC 4YO0A 3K4AA 1JPFA 4G43B 3LRSB 2A73A 1UT9A 4Y19A 2GSGA 3V5KB 4XZUA 3B5TA 1EX0A 4F7CB 1UM4L 1RAMA 2AJUL 3BGMB 1BAFL 1ROWA 4Y4KD 3CDYA 1W72H 4XNZC 4PJXA 4TVPE 2F19L 5DJ6A 1VKXA 3JTSA 4L9DA 5E6ID 5FA4A 1CCZA 3STLA 2AV1B 3K3QA 4U1LA 5DC4B 5FO7A 4DEPB 5SX5K 5IB5B 3I6KB 3KLSA 5CILH 3IU3B 1I7UB 3SPVB 4Z7WB 4N8VA 3EDDA 3HAEG 1BX2A 1E4JA 5CZXD 5DC0A 2VLRB 2KZ1B 1ZLUH 3BZ4A 1U8JA 4Q9QH 3GRWL 1RZKC 2WP3O 3UAJC 3O8XD 4X4ZA 4LLUB 3PWPB 2EKSA 1AGFB 1QFUH 5JMOC 4HS6B 3TIDB 3GUTB 3IFLH 2WSKA 3HPJA 5JW4N 2J8OA 4X80L 2FD6L 5EZIL 2XY1A 4KKLC 3VW3H 4FTVD 1NGWB 4OV5A 2K1MA 2EDNA 5GGTL 3QJHA 5IVXA 3NN8A 4NO2B 1XEDA 5HHMB 4QNPE 5TDNB 1ZHKB 2F9BT 3VXPA 3C6LD 1K5NA 3UCRA 4Z0XB 5EU6A 2P48B 2P47B 3MRNA 4N5ED 1J5OL 2QADB 1KCUL 1TJIH 4FN0A 1Q9KA 5DC9B 2DTML 2KUTA 3LS4L 3O41B 1DVFD 2LFGA 3I6LE 2P8PA 1P6AB 1JPFB 2W0FB 4P4KC 4PTUA 1ADQH 4DKAA 5ISZE 4K8RD 4OZHF 2X4PA 1Z2KA 2DQGH 3LKNB 4N8VG 1XGPB 4OQ1A 2ADJB 3QDME 5IMKA 4UTAL 1BVLB 2JCCF 3B9KA 1D7FA 2YEZB 4DKEH 5HVFB 1Q38A 4NQDB 1XGYL 2YK1H 4LAJH 3CAFA 5L88L 3C2SA 3NCFB 4HEME 5HI5D 4X98B 3SQOL 4ZSOB 1D5BB 3T0DA 4XCCL 1HHIA 3MRJB 2GK2A 5EU3A 5L8LB 4CU6A 5HI4C 1A7NH 4ONGH 1QSVA 3MLSH 1BOGB 3OB8A 4KDTA 1SJEA 4RMUA 3KGRA 4F7MA 3DMMA 5ACLA 2UY6A 4U1NB 2Q7YB 4TTGA 1CR9H 3JV4B 1X5IA 4K3HA 5JORA 5IJKA 4OCNC 3VWJD 3MBXH 2BVEA 3C8HA 4WFHE 2GSIA 3AU1B 4PJDB 4L3ED 4EIGB 1DFBL 3D3VD 4KGLA 4PJFA 4J12A 3V5DB 1IQDB 5FM5O 1OVZA 3X3FL 5GIRB 1SYSB 1MCBA 4L4JA 3HZVA 3I3EA 3V0WH 4LSTH 1R3LA 4XVTH 1Q0XH 1I1AD 4JG1H 2JELL 3ZO0A 1QRND 4KPHL 3O3DA 5FCSH 1H3PH 1IC4L 1BJ8A 3NCBB 4JDVA 1S7VA 4XNQA 3ALWA 3VXME 5GGUB 1CFSB 1ZHLB 3DXAB 5KZCB 2V7NA 2H6PB 4UTBH 2BK8A 5FDWB 3TJHD 1MJJA 1Q94B 4ZAKD 4LHQB 2OBGA 5E2JA 3GSWA 3HZKB 1FE8H 3D39E 3GHEL 3IJHA 5HDQH 5KVFL 5C07A 3K46A 4Z5RA 3DUUB 4GAGL 3P9LB 4HDIA 2VLKE 2YPLB 1NKRA 4CVZA 5MP6H 4H0GA 3ZT5A 1I7TA 5DT1H 4EUPG 5C09E 1M6OB 5CSZA 5I1AB 5DMIH 2OP4H 3QZWA 5T3ZH 4KDTC 4E5XA 5C0CB 3O9WD 1P4BL 1RJZB 3V0WL 3NZHL 1SJHB 3RY6A 3TBSB 1ZS8B 1MWAL 5T1MB 5D7JC 1GVIA 1XR8B 4J3SA 4DN3H 1C7TA 1KC5H 3OGOE 4JDTL 3MJGX 3IFOA 1Y18A 4MNQD 5IF0A 1G9NC 1T7VA 2VE6A 4KI5E 4CNIB 4RFNB 1NMBH 5FGBC 3UJJL 1WWBX 5HHVH 3L1OL 4NO5B 5AZEH 4HUKB 2WUBL 4RAUA 4EOWL 1X5HA 5CD3B 3CC5B 4P2YA 2OL3B 4IOFD 2AW2A 3PHSA 3OQ3B 1RZ8A 2VAAA 4N9OB 5JPNA 3CLFL 3VXOB 1FQ9C 5IG7A 3TYFB 2C3GA 1XIWA 3WN5B 5C0JB 1IVLA 4AEHL 5I1LB 3N1MC 3ETBF 3RRQA 2CO6B 3VGGA 4P23B 4BH8B 5EIIB 3KYKH 1IKNA 4MNHB 4PV8B 4WUUB 2VDOL 5D1XB 1IAKB 3SKJL 1A22B 1YN7A 2OP4L 5T3ZL 5EG6C 3PQYE 1T5WB 2FEEI 1OP9A 1I7RA 3L3KA 3CVIL 1A6ZB 3OX8B 5ESQA 4KAQH 3QDMD 1ZVYA 2DD8L 3KVQA 4LLYA 5IROA 3PE9A 1U3HC 1NCBH 1A2YB 3UBXI 5KANI 1A6AA 1QFWH 4MHHG 5KS9E 1EEUA 4HC1A 3T1FB 3X14A 5LXGL 1AFVH 4U1MB 2OSLA 3W5MA 2Q8AH 4PJ7F 2FHFA 4LLVB 2VXUL 3UBXG 4ODWB 4R96B 3S3SA 3DUSB 4G9DB 1O5DT 3RIFK 3DBXB 1EZVY 3WYRA 5C3TA 3JWOC 3MQIA 4L9LB 3RA7H 2HJFB 1DBJH 5GJSL 2DIAA 2VLLB 3IDGA 2FBJH 3ARGD 3LKRA 2R0LL 3RY4A 1U8OB 3OKDB 4D9RE 2I9TA 1TQCB 1ZLSH 5K9KA 4IIQB 1X5KA 1CFNB 1DVFA 1D5XA 1XGQB 5IB1A 1S78C 3MRMB 3PL6B 5I1DB 4ZPVA 4FRWA 4TUJA 4JFXB 1C5DB 1YY8A 5C0GB 2YK1L 1KUMA 2XZCH 3FQWA 1Z0NA 5E8EA 3DETC 1FYHB 4MA3B 5F7DA 2NY1B 5EZLB 3IFLL 1RJCA 2UWEE 5DJ2A 2X9YA 2FL5B 1YJDC 3MRMA 4Y4HA 3SBWA 4G6FD 4D3CL 2BY1A 3ORJA 1DN0B 4P5KB 1QFWL 1XMWA 1G7PB 2FSEB 2WW8A 4H88H 3NZ8A 1BD2E 3W11C 3BIKB 4R26H 2J5LC 5IHZB 2Q8AL 1HHJA 5F8RC 4U1JA 5E2VH 2J8UE 3L3HB 1IM9B 5F9OL 3RDTA 4XHJC 3D69A 3MJ9L 3SBWC 1JRHH 3L3DB 1KLGA 3KJ4C 4CVXA 4DJMA 4NWUL 1QEWA 3BPNC 4HUUA 5DF0A 2VUOA 1T66D 4Q74A 5L0QC 5I1DA 1IZKA 4KK5D 1QA9B 2Q20A 3D2UD 3P77B 3WL9B 5K93A 4L8BA 3BVNA 1YYML 4HULB 3SHSA 2BRQA 4R90H 5D1ZC 3HB3D 1ZEAL 4YBQC 1G7PA 2FSEA 3NFSH 1FVDA 2HFGH 2FEDC 5TPWL 4K7PH 2VLJB 4RDQF 3CLEL 1B88A 4L3EB 3OBAA 2FECL 4P49A 3MJ6A 4OUUB 4S2SA 1BBDL 2FGWH 2IAMC 4JHAH 1HI6B 4U33A 4X4XA 3VE0A 1S7TB 5IESH 3O4OB 3L5XL 4ONOA 4X5LA 2A9NL 3M45A 3F7PC 5F1OB 3L3KB 3KPNB 3V6ZA 3FB6B 5KVDL 4Y16C 1G84A 3UDWC 1KN4L 4OF5A 2Y06H 4XAWL 2IANA 3CPLA 3REWB 1I3GL 3CCHB 1WAAF 3Q2CA 3ZDXF 3T04D 4KZDL 5D2LF 1WBYA 2DM4A 5E24E 4LASH 4UBDD 4M1DH 1VFUA 2CXGA 5JHLH 4JJHA 3GIVB 3S96A 4HS8H 2W59A 3VXOA 4XCYA 3IDYC 4RQQA 1FCGA 5GSRA 1RZ8B 2VAAB 1ZEAH 1UH2A 3QDMB 2W60B 4XP1H 3QG7L 5CBAA 2Z8SA 1L9NA 5BVJB 4XPAH 32C2B 3MMEB 3UJIH 2Z92B 4Y7MA 1C12B 3IDYB 2CJUL 3BKJH 1ZA6A 3OKLA 2VL4A 1QLEH 3FT2A 1IGTA 4LARL 2R4RL 2VE6B 3U0PA 1INEH 1MIMH 2F58L 2A6DB 3AAZA 3ARBB 1FL3A 2APTA 1ED3A 5D7IB 1EO8H 3DURA 5E5RB 2AERT 1T1ZB 3MCLH 1YPZA 1PJ9A 4P59H 2VAJA 1KTDA 1I4FA 4XMKL 3A6CH 4L4VA 3O45B 2ZG1A 4F3FB 4F9LA 1RU9L 4NHUA 3PV7A 4BJLA 3PGDA 1OTUD 4M5YH 4MJ4A 5DMKB 4WO4A 4XVUD 2EIZA 2R2EA 4NT6B 43CAA 1A6PA 3QHFH 4I9WD 3UC0H 1NBQA 4EVNA 1LVEA 3TV3L 1WCBB 2YD6A 4S1DD 3I75B 3BP4B 3TO4B 5EOQH 1MVUA 1YZZA 1FC2D 2DIJA 1R5WB 1P84J 1BMGA 1KTKE 5CEXA 5F1IA 2A9NH 5DJXA 3VXSB 5C0NC 2BVQA 4TPRL 3GSNA 3MRFA 2BY2A 2A1WH 1PD6A 1YY9C 2B1AL 5CEZH 4Z76A 4GRWE 2P5EE 1MCSA 2XYCA 2EH8H 3NMEA 5IB2B 3N85L 3V0VA 1IAIM 5T3ZE 1W0WB 3TVMB 5GSVB 5DDHA 5FYJU 4H26A 4D0BB 1FNEA 3QIBD 3EYQC 4KKBD 4OGXL 1FNSH 5F21B 3WNOA 5C0IB 4OFIA 2VLRE 5IGXL 4WFGD 3LSOA 5EU6E 3NFPA 3MROB 1JWUA 1K8IB 1AGDA 3FT4A 3TP4A 3LHPL 1P2CA 3WFEL 4XPAL 1HKLH 5EC1A 4PRBA 5C0BB 3B2VL 5EUOA 1HQ4A 2GK0B 4C56A 1TNMA 2YMXH 1LWRA 4ZNEE 5ITBL 3TZVD 4M43H 3ARGA 4LNVA 4X98A 2GTZB 5H2BA 1VGKA 4R2GC 2FNBA 1A6TB 5IOPB 1CFSA 4GSDL 2PYEB 4G6FB 3D0VB 5GGRB 3GJFA 5ISZB 3MFFA 3G6DH 3ES6B 5JIIA 5KG9A 2B1AH 4YQXH 2D4FA 5T1DL 4WI9A 2DI7A 4R3SB 1GSMA 1NEUA 3MCKA 2NY1D 5L7XL 1J8HB 3C8DA 8FABA 1C16A 1MCDA 5EULV 4CMMA 5J1AB 1JWMB 3VFMA 1EFXB 3PL6C 5HVGB 4WU7A 1NCUA 3GK8H 4XP5H 2KQMA 2LTQC 4BSJA 1NC4D 3PJSA 2B0SL 5J6HB 5T1KB 2FIKA 4LLAA 5KAQG 1U2HA 4TPRH 2AJUH 3UBXB 2J8HA 3V8OA 1GGBL 1RZGA 3WFCL 3U4AA 2ZCHL 4E0RB 5ID0B 3HZYA 3L5WB 5FAAA 3QFJA 4Y5XA 5F7KC 3SE4C 1U93A 1IBGL 1U58B 3P4OA 4RNRB 4F7MB 4M43L 5C9KA 2V5SA 2EYRB 1FZMB 1HDMA 3EYSH 2RGSA 3EYVB 4IMLA 4KFZC 3NPSB 4XWOC 1JPTL 4EI5B 5JW4R 4WUKL 2MPAL 1ETZA 5BS0D 3VA2C 1R3HA 1Z5LA 1HXMB 3GIZH 1GYAA 3F58L 4AM0B 3S4SA 1JMZA 1DBBL 5HYJE 5GGQH 3TZVB 1SBSL 4MNQA 4QXUH 1J7VR 4GRLC 4NC1C 3BP6B 1T89A 3MRQB 2C26A 1NCCH 5I19L 5KZCD 2BNRB 4R0LA 5K9OB 3B5GA 2W9EH 5I66A 1SVZA 2XTJC 3O6FA 3SPVA 4Y0GA 1V3KA 5JXEA 2GTWA 2UZXB 1PKQA 3SOBL 3MJ9H 5I15H 2CIIB 3FO1A 1OTTD 1H3WM 1LMKA 4WO4C 1SYVB 4PRIE 4MNQB 3C6LB 3EO9L 3O4LB 1AI1L 1RUQL 2XZZA 4TUOB 4Z7UB 1M7IB 1MFNA 2IAND 2VYRE 3AGVA 1XH3B 4OLXL 1D3CA 4KKBC 3TM6A 5EO1B 5FYJL 1HKFA 2XTLA 4Z7WA 4WUKH 1GZPB 4QRQA 3Q0HA 4JM2D 3IU3A 1KXVC 1HDMB 5C09B 1QP1A 3QCUH 4Z7QF 5CCKH 4NKOB 1KBGL 1JFQH 1PFCA 1NGWA 4J3OC 4YFEA 4RNRA 4CJ1A 4N8PA 3EJZD 2GHWB 1A7PL 3QXVA 3F8UB 2Q3AA 4M7LT 4TTDC 4RRPG 4PJCF 5I71B 3DHJA 5FIEA 3THML 4QGYA 3QXUA 35C8H 3W0WE 3MRDB 5DJ0A 1EMTH 3MRCA 1SM3H 4PS4L 1S7RB 4BQBA 4HWEL 3FHAA 3WO4C 4U6VH 5HGAA 1JI1A 2D7TH 1KCLA 4B0MM 1B9ZA 3TA3C 4GKSA 1NBYB 2FH6A 2YA1A 5F6IB 5JQ6L 5JIKA 2YUZA 3G5ZB 3C5SA 3F6IA 4QTHB 2XV6B 2NX5A 4PRAA 5HDOA 1JBJA 1QHOA 4D2NA 2X4OB 3JTSB 4H1LG 5JR1H 2BSTB 3MLZL 4UV4H 2VERN 5EU5B 3MNWB 1NFDF 4PTTB 2C3HA 3H9SA 4WW2A 5GS0H 2NY4C 4Y5VA 5F7MC 1DQDL 1LO2L 1RUPH 3BGMA 1QKZL 1D6VH 5SWZB 1HQ4B 1QBAA 1N64L 4AIOA 4KJPD 4PR5A 1FP5A 2VL5B 4HPYH 3H0TA 3STBA 3BKJL 1VGEL 4PYHA 3QUYC 3UZQA 4NN5B 1DEDA 1XF3A 2R0KL 3SY0B 3UO1H 1BF2A 2Z4QA 4PUBH 4BQ6A 1T22B 1F6AB 2OQJA 1OT2A 1JF6A 1IFHL 4GKOA 2VQ1B 3QWQB 2PYFB 3JTTA 4LCIH 3U36B 1H3PL 1OWWA 1NAMB 3BXNA 3ME0A 3O3UN 4Y16D 4YX2L 5DDHB 1IEBB 3FONB 1H3TA 3IXAA 5HVWA 1OLZA 5IKCA 1FAKT 3P2TA 5IB3A 4ZUVA 4MD5B 2IQAA 5IB2A 3BO8A 5ACZA 4NKDB 2IFFL 3IF1A 3DV4A 4HFWB 3KPSB 3VWJA 4NQEA 3RTQD 5DEFA 4Y4HD 2I5YL 5JW4Q 2X09A 3ROLA 5BJTB 5L2KA 1DFBH 3RZCA 1Q9LA 5FECB 1HHGA 4Y1AD 5GGVH 1MCEA 4V1DD 43CAB 4JFPA 5MP6L 5ECJE 3C5ZD 1J0YA 2JIXA 3PV6A 1F4YH 2HN7A 3TCLA 3L3IA 1UB6B 3MRLA 5C7XH 4NM4H 3DI2B 4M00A 4MQXC 1ZGLB 4Y4KB 1V3MA 2DKMA 3MLZH 4UV4L 1GHFL 1TPXC 3KLAA 4GAJH 4LSSL 1MWAA 4HAGA 4KUCD 5ICXB 4DZBA 2VXVH 4PJIB 4XPHH 3CFJA 1U3HB 3F12B 4B7IA 2P42B 1J1XH 5FOBA 4PJDF 4YIQA 2YD8A 3KLHD 3MGOA 4JY5H 3QR2A 1E28B 4IRZL 2O5YH 4O02H 3ECBB 1HCVA 1KPRB 3TPUA 5TE6H 5K9JH 4L8SC 5DUML 4KZEH 4QRRE 2BFVH 2H32B 4WNQB 4YWGL 5B3NA 4QRSA 4L4TA 4P23C 3S96B 4OJFH 3NCEB 3VCLA 4PBXA 1BFVH 2WMPA 3HR5B 4Z0BL 3TC9A 4MHHI 4U31A 1NLBL 4OSUH 5ALCH 3O2VH 4NN5C 3WDHA 2DQIH 3MLTB 4ODHL 3UZEA 2A6KA 2ZOKA 1T5XB 1AJ7H 5AUMA 1CF8L 2P5WE 2H26B 5I1KL 5L6YL 1J87A 4M93B 5GHWH 4FABH 5BRZB 3ULVE 4QRPE 3DX8B 2ZJSL 4D0CB 1S7UB 3BGFC 4NDMB 3WNNA 3KXFD 3OKNB 5I16A 4NQUA 1T7YA 1J0ZA 1HEZA 1NLDH 1UQSB 1TVBB 1N8ZB 2M2DA 2XWJA 1FVEA 1BM3L 1FNGA 5E6IB 2AXHA 5F1SA 4NKQB 1LDPL 2BVYA 1WQVT 1CLZL 3EO1A 4TSCL 3EGSB 5KSBA 4LCUA 1HNGA 1NJ9B 3CZFA 1KB5L 2VWEE 4V2BA 4JDZA 1KJ3L 4LSPH 3NIGF 1F90L 3FT3A 4P2QE 1BBJA 4GBXB 4RGMC 2PKDA 3T2NH 3U83A 3K1DA 3MV7D 4L3AA 4OCYH 4Y4FD 2Y6SD 3MV9A 4J3TA 4PJ9C 3U6RA 1E0OB 1UVQB 3VFVA 3MV9D 4X6CF 1G9NH 1N5YH 3P0GB 1JHLH 2O5YL 5HBBA 3MZGB 3D69B 1T2XA 5TE6L 5I9QC 3QEQE 5HYIA 3BIKA 4OUOA 3MRBA 5DJDB 1UCTA 1S7QB 3KYOA 4TNWK 2CRIA 4J2XA 2HH0H 6CGTA 4XPFL 2HG5A 3BAEH 1MFCH 2CKBA 3FZUD 1ACZA 1EEYB 1MLCB 3QULB 4YHLH 4K3GA 4HMEA 4APQC 5FHBH 1SYVA 1CU4L 2VH5H 3MGAA 2VIRA 5EBGA 4OF3A 3LN4B 4FABL 1NAMH 1FGNL 2GUOA 4BZ2H 2HTKD 4PJGF 5BRZE 5MERA 4EUPH 3GI8L 5HHPA 3RJDA 3HI6L 1CL7I 1L0XA 3VFVB 2ZKHL 3NACL 3SDDB 3CDFA 2E27H 2K7PA 5EH1A 4X4YB 1BFOB 5DTFB 4LKCA 3SE8L 4PV9B 4NKMA 4F37K 3QUML 1K6QH 5BMFH 3MOQA 1U8OA 1R6VA 4K2UH 1U8KA 4BK5A 2E7CA 3HAEA 3O2DA 5C9JA 5CZVL 2DQCL 4RGNB 1JVKA 4O51A 4X7SH 3BEWA 4R6UA 3K0WA 4NIKB 4GT7A 4X5XB 2NLJB 2Y07H 4MJ5B 3DYMA 4LCYA 3WIFA 4OI8A 5KSBF 4XB8A 5D5MF 3QP3A 3IDXH 1UCBH 4JPKH 4FMKA 2JJUA 3O11A 4HKZA 4OZ4A 4S1QH 3MOBL 4IRJA 1CXEA 2AEPL 3EYVA 3BE1L 4M6MH 3RTQC 1QYGH 2BX5A 4QHNA 3EOBB 1WAAA 3LEVL 1PAMA 2FX9H 4RIRB 2WWMD 1A8JH 1SMOA 3Q5OA 3KPMA 1M1SA 3FO0H 4KKCD 1CU4H 5CHNB 3VRJA 2D03L 4CU7A 4WI2A 4AL8L 1CK0H 5FGCB 3C08L 5ETUA 4RBPH 4NN6C 2FX7H 2AXGB 2AI0L 5EDXA 4D3CH 2XFXA 1YEHL 3O3AB 4JFED 5A3ID 3VCLB 2XA8L 1T2QH 4ZS7H 3KPPB 4EKXA 3B3IB 4L8DA 3MZTA 1MRCH 4X7EC 4YHZH 5D2LA 2QADC 5IWLA 4L3CB 2RFXB 4LP5A 3O6FD 2SEBA 5CKAA 3QFJD 3HNVH 3P4MB 4Z7OE 5LXGH 2HKFH 4Y4FB 2O5XH 4UU9A 1JZ5A 3UJIL 2CLRA 3IU4H 2HWZH 4M6AA 5D70H 2YRZA 1JNLL 2Y36H 4M1GL 1F2XK 4NOFA 4PGCA 4HJGB 1KN2H 3T65B 1CS6A 2GAZB 2PCPB 4PP1D 4AENA 1JHKH 1MREL 1MLBA 3TH2T 1RZIB 4I0CC 3E8UL 3EZJB 1UKTA 3EOTH 4NN6B 2H32H 2AJZA 1QFOA 4FXLA 35C8L 1WT5A 3IDXL 1TETL 3TO4D 2JJWA 4GG8B 4HPOL 4E41D 4AYFA 4R4BB 1FNEB 1MCOL 5B8CB 5D2NE 1NL0L 1LP9B 1XF4A 1TJHH 1S9XB 1X44A 5FCUL 2YHGA 2B4CL 4D9LL 4G7VL 1XCTB 4G6MH 1IAIH 3KPSA 4PRPE 4HIHA 3QG7H 4QRRD 2OK0H 4LKXB 4G5ZH 2H6PA 1MEXL 2D2OA 4U1SB 5GGUA 1ZHLA 3DXAA 2NYYD 2UVEA 4JPVH 5D8JL 5ICYA 3L3GB 5FOJA 1IL1B 4LSSH 1HWHB 4G42B 3MNZB 1CXIA 5JHLL 2FDBP 1GRWA 1MNUL 4QY8B 2D9CA 2PYEE 4L4TE 1NSNH 4PJHA 2C9AA 4N90E 1HHHA 2ICEA 1B0GB 3DUHA 3QRGH 4AMKH 1AIFA 5ADPH 5E8NB 3VH8A 4UOW1 1ZLVH 1I4FB 1T0PB 1HINL 2HKFL 3QXWA 3RU8L 4TOYL 4OZIA 3T65A 4KUCF 2BSSB 2PF6A 3DURB 3KPOB 4OGZA 5JZ7C 4JY6B 3WXWH 5IMOA 3VU2A 2X1OA 3EDEA 5I17B 1DUZA 3TLRA 1MCOH 4PGZA 5FYJD 3SJVE 2PW2A 1BPVA 3MNWA 4ZYKB 5C6WH 2DRUA 1CGUA 4OB5H 2WP3T 3IETB 5AAWA 1AD0B 1FNAA 4PJ7A 3C5ZB 3T0EC 1JUFB 3RL2B 1JGUL 2VWEC 4DAGL 3NCJH 4UTAH 4HSQA 4MAUH 4L8DB 4Z7VA 1ACYH 5CZXC 5AG8A 1AD9B 4U0RC 5C0AE 4BH7A 1MJ8L 3MLUL 4I13B 1NC2D 5KSUA 1J8HE 4KKAC 4DQOL 3GSNH 2ICCA 3E6FA 3D2UB 1U8NA 1F97A 2VXUH 3X3FH 2M8XA 4OIIH 3WHE1 5CGMA 4P5TD 2HMID 1HZHL 3KDMB 3WFBL 1I3UA 3KPRE 5DSCA 3QQ3A 5D9SB 4Y4KC 1OF2B 1FRGL 3S34H 2FBJL 1WC7B 5I1GL 4OM1H 5GGSA 4HIEA 4QHNB 4PTUB 5GRWA 5K33A 1BIHA 1TZIB 4OLYL 1IQWL 2JB6A 4JPWH 1H9VA 2RJMA 3BUYB 1RIUL 4LCYB 4XC3L 3MRNB 4I77H 2HA1A 3G6DL 1D9KD 5HYSA 3DGGA 4MJ5A 2ILLA 3VXPB 5MEPB 2HT4C 2CDGB 2CGRL 2AS5M 2FO4A 5DUMH 4F2MA 4KZEL 3PG2A 1O7SA 2HJLA 4JG0L 4YHOH 4RZCB 4APQD 3FO0L 4CADB 1J0IA 3T08A 4JJ5B 1U8KB 4I0PC 3V4VL 5GS1B 2E7BA 5TQ2L 2J88L 4OV5B 2Y72A 4OZFG 4UT9H 3DRQB 3BAEL 1UM6L 3I50L 4BFIB 4FFVD 4UINH 4LCWE 2DBLL 1KLGB 5FUOL 4CVXB 3HPJB 3LN4A 2VLMD 3C2AL 4RSVA 4CJ0A 2BVUA 1YEDB 2D0HA 1UWXH 1VFAB 4NWUH 3ILPB 5I1JL 4RDQG 2DWEB 5BZWA 3HC4L 3PXHA 3O6LH 5TGBA 4XMLH 3PWVA 3TZVA 1P9MC 1N26A 4U7MA 3RGVD 3WD5H 1U8QB 2J7LA 5BMFL 4WENB 1YQVL 4Z7UE 3HRZA 4FQXC 2E9BA 4UZGA 4ZTPL 5BCAA 3MRBB 5DJDA 1R5IB 3QFDA 3MRPB 4OBRA 3MYJA 5J12B 2FJFB 1SVCP 1DQLH 2FRGP 3WNKA 4JR9H 2YC1B 1LDPH 2JJTA 3LPFA 4K55A 4WDIA 3V4PH 3QZWG 3L7EA 3I6KA 5SWSB 3NGBC 3RBSA 3STLB 3WO3B 2A9ML 4IRSD 3CLFH 4QF1A 5JZ7D 3FZUC 4GXUN 1N7ML 3I2CH 4CN4A 5F9WB 2PETA 2BNUA 2UZIL 4DN3L 5FF6A 1LE5A 1TZHA 5DWUL 4X6CE 4WWID 4K3DL 2NY6D 4WI8A 4L8SA 1A6VL 3FT3B 1PBYA 3RHWK 2CPCA 3WO4B 3IDNB 1G9NL 5ID1A 4OZHB 3K4ZA 1G9MH 1IGJA 5EO9A 4PS4H 3VGAB 1HQRA 4S11A 2DKUA 3Q5TA 3EO1B 4LRNH 4EI6A 3RTQB 4DGIH 2JB5L 1YEIH 5EU6D 2ZOLB 2JCCB 3CVHA 4M5ZL 4QHMB 4KVCH 1F8TL 3PWNB 5TQ0L 4GW5A 3X17A 1A7OH 2XWJB 3JWDH 2FYYB 5F96L 2J8UF 3HG1B 4UQ2A 1YQVH 3S36X 3A6BH 4P2QB 2XWTB 4LF3A 4MB4A 4GAYA 1AR2A 1MCCA 1BZ9B 5DQJA 4HWZA 4FFVC 4BSVA 4HGKC 4YC2C 3QUMB 2R56H 5CD5D 1F4WL 1BD2B 4FXKA 4N90D 3TBTB 3OX8A 5C0ND 4CMHB 2X4TA 2F5AH 1I7RB 4POYA 5EZJB 2ADIA 2R1XB 3BESR 2XNAA 2DN7A 4N8CH 1MRFL 1UYWL 3GSRA 4HK0B 4APQA 4PFEA 4MNHA 2KZWA 5BXFB 3HS0A 4H0IA 3V52H 5D93C 2A83A 4JFHE 2F58H 3FAXA 4MQ7A 2HTLD 2YPLD 4QCIA 4F9LC 5JXED 2YBRA 2R23B 5E03A 5FV1L 3DVFA 1GC1C 1E6OL 4XVUC 3QUZD 3UDWA 1N59B 2BRRH 2G5BA 2XWBB 4GG6B 4GUPB 1QPPA 2ZUSA 5IFAL 3SDXE 4J6RH 1BZ7B 4I3RH 3GSVB 5L2JA 1KIQB 4CNIA 4QWWD 4X7TB 5C8JB 1N0LA 1A4KA 1WZ1H 5EPMB 3IFOB 4AT6B 3K80A 3BHBA 5HVHC 4Y5VC 1NAKH 4GXVH 1JPST 5F7EL 2Z31B 4PRHE 4Y4KA 2X1WL 3H2WA 1KJVB 4TUKH 4G7VH 1HK6A 3NCCB 4XBPA 3U79A 1YPZE 3L3IB 1T1XB 1EBPA 4I0PD 5E4EB 3VH8B 5D96B 3L7FB 3QIUB 2IWGA 3TBWB 2DM3A 2ICWB 1J8HD 2WINB 2QLVB 4M3KB 2DQJH 4XAKE 1MJ7H 4ELMA 4XTRD 4HT1L 2IC2A 1FZOA 5SWSD 5HHOE 4NC0B 1G9EA 1RK0B 3NTCH 4NHCL 3RWFB 3LV3B 5I73B 1FNLA 1ZANH 2R69L 3QIUC 4U05A 3IGAA 2DQHH 5IQ7H 4NYLA 1RUAH 4Z5RB 4OCXH 1QVOA 4GRWF 5DFWH 3O4OC 4ZS7L 4LVOC 2X4RA 3H7LA 4XBPB 4NM4L 4XPTH 4MJ6A 2R56L 4NSKB 4LSQL 4WFFD 3U48A 3VWJB 2VXQL 2NY5L 3FN3A 3NFSL 5I0ZA 4RFOH 1FYTE 1A3LL 2A6DA 2ARJQ 1G6VK 3BWAB 5TE4H 5KSVA 3JWNC 3O9WB 4HEPG 3IXAB 4JRYB 3AUVA 3D18B 4XCFL 3ARDB 3WHE0 4R4BA 4TNWF 5C6TH 3C60C 4KHTL 3RAJH 4XWGL 3W5NA 2EXWC 4RWHA 3ARVA 5IBTL 3C60B 1RZJL 3HZVB 5D93B 3GIVA 4J3VA 1YQ2A 2VUYA 3RNQB 1SYSA 3RWIB 1N3NB 4N1EA 5ENWB 4L8CB 1T20B 2GYSA 1XGYH 2OL3H 3FRUA 5L8KB 4C4KO 5D7JA 1ZMYA 4I9WE 4WUUD 3LZFH 3GGWA 3KPNA 5KANG 5C7XL 3MODL 2B2XL 1K4DA 1SY6A 3KS0J 3N9GL 4UU9B 4ZNCD 3B43A 2FX8L 4OIIL 3KPRB 2FZ3A 3HZMA 5DHYB 5KJRH 5HGHA 1I1AB 1AGCA 3OAZK 2H1PH 4ZO9A 4YJZL 4OUUA 1E4KA 2DQJL 4S2SB 1AFVL 2AJ3A 3D5OF 1GZQB 2Q7NA 4ZO6A 1OTUC 5T5NG 4R9HA 2WLYA 5MHSD 1FL6B 1UM5L 2R69H 4X6EB 2C3XA 2Z8VC 5IQ7L 5DURD 2OZ4A 1D6VL 2WUCH 1NUGA 4C56D 3VXQA 4P2RB 5E9DB 1FNFA 4HS8L 4IIQC 4NFBA 4LSVL 4IMKC 1YUHB 4QTIL 3WNMA 3KWWB 3QHTC 5DWUH 2CR3A 4NJ9L 3VFTA 3T2NL 4QO1A 5ADPL 1RU9H 1XGPA 1AHWA 1J1PH 3CNKA 1RIHH 5KS9F 1I8KA 1X5JA 2X4PB 3GMMA 5FF6B 3PWUB 2M26A 3MV9E 2WZPD 2P5EB 5E2UL 1I8IB 1LDSA 2VDQH 2CUHA 1B6DA 2GY5A 3FO9A 2H9GA 4KY1L 4QHUA 9CGTA 3H9HA 5CP3A 4M48H 1A9BB 2W9EL 2UV3A 5EU7C 2DQDL 4UT7L 3PDOB 2ZUVA 4M5ZH 3H7BB 4JKWA 4PJXF 2V5TA 3ZYIA 3QFDB 4EDXB 1TXKA 5EO1A 3K2MC 3MREA 5LGJA 2XY2A 3LOWA 1ZXQA 2WLZA 5ALCL 2NW3B 1ORSB 4FQ1L 4Z7UA 4JCLA 2VXTH 1A47A 4YXLL 1WT5C 4XC1H 4JKKA 3V79C 3LD8C 3GB7B 2YPVL 1JHTA 1S9YB 2NZ9D 3RUGE 1WIUA 1DQML 4OLUL 1MRFH 1UYWH 3LDBC 5CJ8A 5FHAL 3UTPD 2BVPA 4NNYA 5ESAA 3PL6A 4QRPA 1K8DB 2BNRA 1PY9A 3U1SH 5J13C 3BPCB 5K9OA 1KV3A 2A74A 4NO3A 3S9DB 4PG2C 4YDKL 2C7UB 3WFHB 1EEYA 2HJFA 2W07A 4XBEH 3S4SB 2VR9A 1CD1A 1MF2L 3MREB 5E1AB 3C9NA 2DQDH 2QSQA 3O3BA 1F00I 1JP5A 2EXWD 5IVXF 3SE3A 1KJ3H 3AFLA 3FO9B 2AGJH 1N4XH 3TBVA 1AY1L 1QYGL 1F58H 3WKMH 4FXGA 5E94B 5I2IB 3ARED 3CDGA 1YECL 4PJAA 4GS7B 3D9AH 1OF2A 1NPUA 2IALB 2IH1B 2WAHA 3UYRH 4JAMA 4EDWH 1AHWB 3W2DH 5IMMB 4HUVB 2EH7H 4OCWH 3NIDF 4Y19E 5T5FH 2B0SH 2Z35B 1T04A 1IEAA 1Q72H 1CDJA 4OZFH 3D85B 2A0LD 3I85A 4ZDHB 4NQDD 3VJ6B 1RURL 5C0JA 1T2QL 4F9PC 3CU7A 3VFMB 4LSRH 4TRPL 1J8HA 1I75A 4P4KD 3C5ZC 4M8QB 3T0EB 2H2PC 3DO3A 1MI5B 4PG9B 5CBEB 2NY5H 5L2KE 5EC2B 1R3IL 1NLDL 3GJFB 3KPRA 4ZOBA 4JFQA 1S78D 3RUGF 3OF6D 3CFEA 1JZ2A 2AV7A 5D1XD 2ARWA 2WK2A 5E8PB 2DYPA 2QHRH 3WIIL 4LCIL 3L5IA 4WHCA 5BRZA 5HHXH 2J8UA 4K94C 4K2UL 4WTXA 3GNML 5EUOB 1F3JA 4GRLA 1J88A 4KTEH 1FFOB 1GIGL 4WI4A 1TTFA 2X41A 1KULA 4JLRA 1F45A 4K8RL 2OR9L 3KPQB 3BZFA 2I27N 5FUZL 4M9OA 5T3XD 2FHBA 1CK0L 5E8NA 1ZLSL 2BOCA 1OLLA 4I3GA 5HHMD 3GMNB 3QRFM 4Z7OF 2RIKA 2VO5A 1WWWX 4U1HB 1DQJB 5IHLB 3D0LA 1AE6H 3DUUA 1Q9OB 3GRWH 1DLHB 4IS6B 1BJ1J 1IL1A 2I26N 4NQCD 2NCMA 2OZ4H 5AZ2H 3D18A 5KN5A 2XKNA 5IM7A 3TN0D 2VDMH 1GC1H 2YUVA 1JGEA 4JQVC 3MBEA 2GFBB 1NFDE 1RZ7H 1N5AB 1R3IH 4XNUH 3M1BB 2XQYK 4I48B 5IW1A 4WFHD 1MH5A 2BVQB 4XPTL 5H94A 1VFMA 3H3KA 2W91A 1NCWL 4CVWA 3OG4B 3DSNA 3BPOB 4PJIE 1P4BH 2KL6A 2YWZA 5J12C 3CXHK 4OGXH 1OAKL 4ONHA 1B4JH 3MSPA 3NACH 3QYCA 3RWFA 1J86A 1K4CB 1E6JL 2EIDA 3TNNA 4HLJA 3TNMA 1AI1H 3EOTL 5FECA 5JA9A 1QLRA 3OR7B 5FO9B 5INDA 5HYQB 2E9WA 1EJ6A 1CD9B 4QRRB 3S8WA 2FR4B 1UB5B 3IDUA 4JN2B 5DA4A 1YPZB 1NGQL 4HHAB 1UEMA 1HSAB 4P4RA 4J1UB 4W6XB 3NVQA 2J5LB 3MLPA 4ODXB 4LPVA 4P46A 3ZZ1A 3QCUL 1NEZA 4M7KL 4P4KA 3NA4A 4RAHA 1G6RA 1D6EB 2GITB 3DIFB 4KRPB 4M6NL 3VMPA 4ONGL 3DXAD 4JVUA 3RGHA 4JO2H 4L3CA 1R5VA 4GXVL 4Z7NE 3CSPA 2VABA 5IESL 3NCJL 4JHWH 4PBVC 2VLKD 1EHXA 3OJVC 5D8JH 4XC1L 3OKEA 5JHDE 3REVA 3MLUH 4LASL 3BKML 3O8XA 1DJSA 1UZ6E 5JHDD 3O3AA 2FH8A 4LL9A 3MRHA 3BT2L 1EXUB 5HGDB 2F8VA 4K7PX 1QSED 4PY8J 4YHKL 3SDYH 1VGEH 2CKBH 2IANB 3NH7H 3OXRA 1F11A 4FS0A 4OZGE 4MA8H 1NCBL 3X12B 4QRTA 1PEWA 2BHYA 4P2OA 1XFPA 3GMQA 1DE4B 3W39A 4FTVE 2ZCHH 1BIIA 4Q6IB 1MEXH 2BY0A 1AGEA 1XF5A 1FFNB 5FYKH 5EB9A 2HFFA 5DQJB 3IJYB 1HI6A 3VE0B 2MCPL 4QTHA 2NY3D 1IEHA 3VFPA 4LGPB 3BD5A 4N0FB 1SY6L 1RIHL 2FIRT 3BYTA 5HGBA 1HXYA 2V5MA 1X7QA 4YPGA 1D9KA 4DEPC 2E7HA 1QNZH 5J7CC 1CFBA 2Z8RA 2OTWB 1YEGH 1DBMH 3NABH 4QEGA 4GKNA 5C0AA 4Y19D 4X5XA 2EO1A 4NQCB 3F7VA 5BS0E 2UYLA 4PJHE 1MCIA 2JELH 3P11L 4MD0B 3QJHB 5IVXB 4L8BB 1UJ3C 3FQRA 2ADGB 3QSKB 4H0HB 2VKXA 4FQJL 4GMSH 3RBGA 3SDXA 1FFRA 3QCTH 1MCWM 4HS3B 4R4NC 2YSSB 4WW1A 3SDDA 1HHKA 5CSBA 2FEDD 6FABL 4HPOH 3L3DA 3LQZA 3DECA 3ARZA 5EOQL 3VXNA 2G75B 2QV2A 4LIQL 4WDIB 1TJHL 4QRQB 3TA3D 2GT9B 3ILQC 3T77A 4NQCE 1NCAH 1KYOK 4P5KA 3RY5A 4YZFE 3KYNB 3MLRH 5EFIB 3OKMB 1Q9WB 3BISA 2IAMA 3O4LA 1OCWL 4JE4B 2DWEA 3AM8C 2NPLX 1S7WB 1UM5H 1WFTA 2X7LA 3K74B 3MBXL 4N0FA 3CXDL 1Q0YH 2DQUL 4MD4A 3QUKA 4QRUB 1A7RH 4JEGB 2Y5TB 2CO7B 3QEQB 3HUJB 4YK4B 2RCSL 3O3EA 3W81A 2VN7A 2DLEA 2I9TB 3UJTL 2VDKL 4G6JH 4G6KH 5FB8B 3WIHL 3ULVL 5IV2B 2AEQL 4S0SD 3W9EA 2EXYD 3WEXA 3V5KA 1F3RB 4EBQH 4N0CD 2ZUXA 1N2RA 1IGFH 3O8XB 1OP5H 3DNKA 5HYSB 1QSEB 1KJMB 4OCWL 3EO0B 3WKNA 4DCQB 4KWUA 4MCYA 2FX7L 4ODWA 1FIEA 4PPTA 1XCQA 4WI5A 4U1MA 5L7XH 4W4OA 4QYOB 1FGVH 2BMKB 5KTEL 1A2YA 4YDLB 1A6WH 4YBLC 4RMWA 1D6EA 4HIEB 4G8IB 4TSBL 5F44A 1C08A 2J12B 3VRIA 2ED7A 3IKCB 5HHNA 3BFOA 4O4YH 5I1KH 5JXEC 3PWJB 4P57B 2HTLC 3DRTB 1DL7H 4G8GB 3MV7B 3QIWA 4S1DC 5D1XA 4JREB 1OL0A 1YN7B 4O2CA 1IGYB 3E6FB 4YPGB 2ARJB 3MLTA 2P1YA 4RWYL 3WD5L 5FO9A 3IXTB 1FRGH 3D48R 5KSUB 1MCQA 3TYFA 1INQA 3OWEA 3BMWA 1AD9A 2DQTH 1T0NA 5CFHA 2ED9A 4J3WA 3FB7A 1T1YB 4KI1A 4PJ7B 5LBSL 3IETA 1IKFL 4PJ9B 1JPTH 2HJKA 5IFAH 2OR7A 3I2CL 3X13A 3RL1B 4JPIB 1NEZB 4KV5F 4RA0C 1KIPA 2RHEA 3NPSC 1P1ZB 4LVHC 5IMOB 2VJXA 5DA0B 3QEUB 1GJIA 2IGFL 2OM5A 5IM7B 4PJ5D 3KPSD 5JW5B 2DAVA 1ZGLA 4TUKL 1ZS8A 3O2DH 4G8EB 4Y89A 3TCLB 2QSTA 3HN3A 4HIIA 4XX1G 4KHXH 2HLFD 4DGIL 4WHYH 4YUEH 5GGVL 5D6DC 2CDFB 3WSQH 2LV4A 2ITCA 3JWDL 1KB5A 3Q5YA 5A43C 1I8LA 1YNKL 2DF3A 3BKCH 4LLQB 1B2WH 3GJEA 3B8YA 4ODVL 3UPRB 5C08A 1DCLA 2XXCB 3HZKA 2F8OA 2ESVB 4JFYB 3MUY1 2NY3C 4NQEB 4LKXA 4I48A 4GAJL 2FWOA 2IADB 3LS5H 1IKFH 2EC9T 1S8DA 4Y2DA 2AABL 3U30C 2BNRE 2V7NB 5C1MB 1JGLH 5TE7L 1IRAY 2V2WB 3RVWC 3AREB 4POUB 1LEKA 5C6TL 3QEHA 5EIQA 4XVSL 4KJYB 1UKQA 3BPLB 5SX4I 4E41A 3GZKA 3HI5H 4GW1B 2EDJA 2G9HB 1F42A 3RKDD 4YXHH 2VR4A 1CFTB 4Q9CA 4F8TA 1B0WA 4BYHA 1JGEB 1QQDA 3FJTA 2BSRB 2QQKH 2COQA 4DZ8B 4OD3L 2HVKB 5E0QA 2Z0BA 3WDIA 2PCPA 4I18A 1OW0C 5JOEA 3VXRE 2NXYB 4CN1A 4YQXL 4NFCA 5HGGS 1KIRB 1DQJA 4ERSH 1DEEA 4HJ0C 4MGXA 1LNUA 3O2WH 4U1NA 1CR9L 3RY6C 1WTGT 2H41A 4TNVK 1NGZA 2HTKC 3QUYD 1DLFL 4KHXL 5IJVB 4P0DA 4PP2A 1HHIB 2CH8A 3MX0A 5ITFB 2DQHL 1UADC 1OGAD 4BKLB 4QXGL 4XPBH 3RI5F 3FKUS 2MFNA 3WLBA 4PUBL 1ZSDA 1YEFH 3MOAH 3Q6GH 1BVLA 5I71C 3MV8E 3AS2A 3MV7A 3WIHA 3W0WA 5I6XC 5E95B 2ADJA 1NDMB 1A3LH 4P57A 4G8GD 4TULH 1U6AL 4WJ5A 3LKNA 2J4WH 1RZFL 2P7TA 4KKAD 4XP9L 5E99L 4PRNB 3CDGB 2CDEB 4FXGB 1A02N 2DOCA 5DEGB 1ZVSA 1PQZA 2J88H 5FKAB 1RK1B 1U8LA 2EYSB 3QHZL 3PP4H 5HJ3A 2FB4H 3N9GH 3UTTB 4WWKB 4PLJD 5IJKC 3HI5L 4X8JA 3OKOA 3VFWA 5E9DD 4XVJL 5CEZL 1DTUA 3BH8B 4UMGA 2NXZD 2IALA 4P5TA 3LEXB 4K8RC 3FFDA 3ZL4L 4OGYL 4XGZB 4YHLL 1UFUA 4YNYA 3HR6A 2C7UA 3WFHA 2LVCA 2PW1B 3HAEB 4LK4A 5FB8A 4CAGA 3ZHKA 2X44D 2Q1EA 5IHBA 1QA9A 3QNXB 4R8WL 4OLUH 5BW7C 3HI6H 4ERSL 2JLLA 2B4CH 2P7TB 4D9LH 3H3PL 3B9VA 5B39B 4MDJA 1Q0YL 2DQUH 2IMNA 3QUKB 4HS6A 4QRUA 3TIDA 1CBVH 1M4KA 1FYTA 4LBEB 3RWCB 1TCRB 1BEYL 4HZAA 3CSYB 1IM3A 2BHZA 3O4LD 5H8DA 4ZFOA 5EORH 4XP1L 2A2QT 1E4WL 4G6JL 4G6KL 4GQ9L 2WBKA 3BPCA 4F15C 3HE6A 3F7QA 1LK2A 4R7NB 4GSDH 3PQYD 5E5MA 4IEFB 3PDOA 1EDQA 2I9LB 2DQGL 1RULH 5I74C 3FB5A 3EW3B 2G75A 5EUKA 4JFHD 5D1ZD 2KH2B 4FFZL 1RQ5A 4HUWB 5JNYA 5FO7B 3PHOA 3MA9L 1YNLH 3UTSB 1F3DH 5IW3A 1A7OL 1ZA3B 3QISA 3FL7A 4IIQA 1ORSA 2DL2A 1VADA 2WIMA 3W2DL 1BBJB 4WTZA 3AY4C 3OKOB 1BVKA 4EDXA 1FG2B 3TO2B 5FHAH 5DT1L 3HTLX 4Q2ZA 4AZ8A 1Z9LA 2APXA 2D9QB 2A6IA 4JANA 5INCB 1AKJB 3BX7C 3MNVA 5JQ6H 3PNWA 4I8DA 1YNKH 4XCNB 2UZYB 4E42A 1V7ML 1IC1A 4BSWB 1T21A 1CXKA 1I8IA 2AK1H 4IMKA 5C2BL 4RRPA 1DP0A 2E5EA 5D1XC 5D1ZB 2AJ3B 1XF2A 4RISH 2EYTA 4X4MA 4Y4HC 5EWIL 4ODUB 1IAOA 3HB3C 4FP8L 3ARDA 3WN5C 1B3JA 3L95B 5KVMC 2ITDA 2IADA 3U1SL 2BRRL 4YR6B 3RX5A 4PJ7E 4I4WA 1DBBH 5LBSH 3ISWA 2BNQE 5ITFA 2EC9U 3HG1E 4ZFZA 1ZTXH 1EXUA 5ENWA 4NJ9H 4XHJD 1SEQL 5CSGA 1J05A 4UQ3A 2PXYB 4QRSB 5MENB 3SDCC 1NCDL 5LGHH 2DM2A 3SGKC 1DSFL 5AD0B 3BIAX 5I8OH 5F7WC 3HNSL 2AXJA 2AGJL 3C09B 3CC5A 4QNPF 4HBQA 3DVNB 1JN6B 4KMTH 2AKRA 4LDEB 1JRHI 3G5YA 3GHEH 3MA9H 4X6DB 1UACH 2PO6D 3FQTB 1U3HA 3HUJE 3P30L 2AVGA 5I74B 2LU3A 4A6YH 2OR8A 4F7EA 4PRDA 3UTTD 3V4VH 2CRZA 4KGJA 5EBWB 1RD6A 4TSBH 4GW1A 4P4RB 1WBZA 3U46A 1U9KA 5F9WC 2FR4A 4PRPA 5FUOH 2APFA 1JN6A 4LQFH 3QXDB 4BUHA 2X4SA 4D9QD 1R0AH 2EE3A 2R0LH 4KXZH 3VXUE 5F89A 2DLIA 1EEQA 5J11B 1S8DB 3P9LA 4JFFD 1MAMH 3MLYH 1TVDA 3V7AG 1OOAA 1NMAL 4JZJC 1HIML 3SEPA 3VG0H 5C0CE 4PRPB 4U1GC 5K9QI 4Z8FL 3HE7B 4HKXB 1WBZB 4J4PA