4GJTB

Complex structure of nectin-4 bound to mv-h
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
114
structure length
114
Chain Sequence
GELETSDVVTVVLGQDAKLPCFYRGDSGEQVGQVAWARVDAGEGAQELALLHSKYGLHVSPAYEGRVEQPPPPRNPLDGSVLLRNAVQADEGEYECRVSTFPAGSFQARLRLRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein/viral protein
molecule keywords Hemagglutinin glycoprotein
publication title Structure of measles virus hemagglutinin bound to its epithelial receptor nectin-4
pubmed doi rcsb
source organism Measles virus
total genus 20
structure length 114
sequence length 114
chains with identical sequence C
ec nomenclature
pdb deposition date 2012-08-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4gjtB00
1YNKL 4KROD 4E41E 4P5TB 5H2BB 4S11A 1MJ8H 4GLRH 2VL5A 5T1LA 1YC8A 2NLJB 5DHVA 4P23A 5C0NC 5DRZB 2DQGH 1JNNH 4P2QD 5E6YA 1YNLL 1X5KA 1YUHA 2MKLC 4ZXBD 5DDHA 3D3VE 4D9LL 2P42B 3P77B 1IL1A 4XP1L 3NTCL 4WJ5A 3SJVB 3RVUD 2VLME 3ARBC 1NEUA 5ISZA 3VFRB 1U92A 2GTZA 2BVPB 4DEPB 1C5CH 1WFUA 5FO9B 2VO5A 3QPXH 1EJOL 5JZ7D 5C07D 3JBG7 4Y5XC 3WD5H 3UZEA 5KS9F 3FJTA 1DBJL 4E41B 4Z7OF 4AEHH 1DUYA 4HD9A 4Y5YA 3UPRB 1CL7H 4HH9B 5C8JA 3SDCC 1MFEH 5JW4N 3B4NA 1RVFH 2B0SL 1C5BH 5I76B 1NSNH 2HH0H 2VXVH 4PUBH 1KLUB 2IMNA 4H20L 3SE9H 1LEIA 3OWEA 3D3VB 4M62L 4P2OB 2ESVD 2YN5A 5B4MD 5GS1C 2X7LB 1ZGLM 4Q0XL 2X4QB 4OT1H 3W5NA 4OGAD 2K7PA 2R4SH 1FN4A 2AXFA 3D85D 3GI9H 3NCBB 2JTDA 1XCTB 1B4RA 1I3UA 1HZHH 4I3RL 5DD6A 4TULH 3TYFA 5E4EB 1YEGL 2HJKA 4O02H 5KVEL 3QDGD 2FSEA 1G9MH 4JN1L 5L8LB 4V2CB 1GZQB 2GKIA 2VUOA 3FO0H 3OG4B 4QRRE 1OARL 4ODTL 1NFDF 1DN0A 2BSSA 3QFJD 3FN9A 4K7FA 3V4VH 2I9TA 4XBPA 4OLUH 3MUGB 3U82B 1ZMYA 3U0WL 3VGAB 1J1OL 4JO2H 3FQRB 2NYYD 4HDIA 3SKUD 5HPOA 1V05A 4RMUA 3KPOA 5CD5C 5KZCB 3GSOA 5AUMB 5KS9E 1QFOA 4Z7OE 5EORL 2VJXA 5FYLL 1FZKA 1VGKB 4F58H 3GKWL 1W0VA 5I73B 1ODAA 3WLWC 3MREB 1SY6H 1AJ7H 1EGJH 4QRRB 2GTWB 5IW1B 1JWSB 3CSYA 2UVFA 3I9GH 4XXDA 1ETZA 2AJUL 3F62A 1A0QH 2PYFB 3BPNC 1RZ7H 4TPRL 3BN3B 4L4TE 3MJGX 1ZA3A 3VRJB 2CRIA 1CE1H 2DKMA 4HIEB 4C4KT 5IW6B 1MIML 4MA7H 1NBYA 2NY6C 2LAGB 4R97C 3EKCA 2XOTA 4WCYL 3FFCA 4Y1AD 3SPVB 1A6AB 5CEYB 5FYLE 4JAMA 4OV5A 1P6FA 1U91B 4YHPB 1IC5H 3PWLB 5KS9B 1X5IA 2EO9A 1IGFL 3GSQB 1HQ4A 2IFGA 2Y1VA 3F12A 1A4JB 5EUOA 1PGRB 1KIRA 5F88B 5J6HB 1HK6A 4BFBD 3E3QC 4Y4FB 4Y16A 1EMTH 2QQLH 4K3JL 4JFZH 1JK8A 4FZEH 3ULUL 1FZJB 1YEIL 4CJ1A 1Q8MA 3B2UD 2P5WE 4S1SL 4CVXB 2X4TA 2G75A 1NFIA 3WFEH 3OF6D 4L4TB 2PYED 2RBLA 3LQZA 4Y4HB 1UM5H 4IDJH 4LHUB 1T04B 2A9NL 4I1NB 4R4FH 4PD4J 4KVCL 4LCCB 3OKEA 5E08H 3V6OA 1A64A 1EVTC 4CVZB 4HLZH 1RZKL 3ARGC 4JGUA 4KK6C 3QCUH 3SO3B 3T0ED 1Q94A 3CMOH 5IIEA 3ULUE 3SCMB 5A16A 3TEUA 2BVOA 1TVHB 5H35B 5DSCA 1B6DA 3RWGA 1HHKB 4ONFH 3QCTL 1NC4A 2P5WB 4UTAL 4FFVD 3V6FA 3JTSA 1IT9H 2V5SA 1YNTA 5JA8B 3GIZH 4L9LC 2EDLA 1W72L 2VLJD 1OTUD 2K3TA 1YC7A 3QNYB 5EBWA 1AGEA 5LBSH 1BLNB 5TPWH 3QO0B 4NQTA 1QP1A 5A2FA 1N0LA 4X9HA 2Q7YA 4L8SA 4DN4H 1H15B 3HI5H 4HZAA 3CFEB 2XY2A 5EPMB 4IIQB 5GS0H 4HF5H 2BVTA 3H9YA 4JRXD 5IW3A 4X0KA 1HYSD 3D2UB 4BSVA 2P43B 1S7XB 1JPGB 3O3DA 4AMKL 1IGYA 3F7YA 5KG9B 2HT4D 5DK0B 2DM4A 2BHUA 2P45B 5AYUH 3ZL4L 4B7IA 4S2SA 3GJFH 4Z7VF 4FQXD 4X6BA 4MX7A 1WT5C 2G2RA 3O4LE 3QHTC 4JVWA 5I1DB 3RVXC 1ZGLB 3SKOB 3U7WL 3FL7A 3FOLB 3I50H 1FE8L 2Q86A 3OB0H 4CN1A 4BFIB 2CLRB 1J0IA 5E6IA 3RWEA 1MHCB 2MCPH 4AL8H 1IKFL 5EFIA 3V79C 1BD2E 2F5BL 4JFHD 1FNSH 3QXWA 3OAUL 2ZSWB 4OZIF 2WM0A 4UT7L 4MJ4A 2EDRA 5IHUH 4NQUA 1I9IL 1TLKA 5TDPA 1QLEH 1ADQL 2NY5H 5IG7A 1EVUA 1DCLA 1DQLH 3FQUA 4AENB 1MRCH 1W72B 2WV3A 3BKYH 3O4LB 4WTWA 3HMXH 5E8NA 1MFAL 4RQQA 4N9GB 1U3ZA 3AFLA 1I7RB 4UT6L 4CU7A 2HVKA 2AJVL 3WNNA 5K9QI 2NY1D 3REVB 1CR9H 1A1OA 4QHUB 1H8NA 3U2SB 3QUML 4QRUB 3L7EA 1BD2B 5JOEA 3C6LD 1G7LA 1I8IA 2DTSA 2GCYA 2PW1B 5MI0B 2CUHA 1CK0L 5ADPL 5HHQB 4U6YB 4YHIB 3ET9F 5AZ2L 4EI5B 1ZHKB 4HKBB 3HZKA 3TWCH 4OUUB 3MNZA 5E99H 2HWZH 4A6YB 4Z7WA 4Q6YA 4WEBL 3MJ7A 3ZT6A 5I2IB 1CDGA 1A6WH 4X4MA 4P23C 4HIJA 1HN1A 2NXZD 4PJ9A 2B8OT 3K8KA 5GSRB 3TJEL 4K71C 5DRWB 3EW3B 4WNQB 5BS0E 1FZMA 3O0RH 1KG0A 4YHML 5I1AA 3VXRA 5FV2A 1UWGL 2ZKHH 4W4OA 3MV7D 3M17B 3I3EA 3HI1B 1WBZA 4OZIE 2Z31A 3ARFD 1VB9A 2B2XH 4LIQE 4PBVC 3QIUB 1WZ1H 2MTPA 2MMXA 4HBCH 3MXVH 3DX8A 4Z8FH 4XVTL 3LPFA 3T2PA 3DRTA 4F3FB 1INDL 3QHZH 5BVPL 4KK8D 4EI6B 4YR6A 1Z9LA 4Y5YC 4QOKD 2Y5TB 1GC1H 5LCVL 4HX1B 5BS0B 1QHPA 1U3HD 1JV5B 4UIKL 3QUMB 5A1AA 2VDMH 3IU4H 3MGTA 3MV9E 1CICB 3JV5A 4GW1A 1D3CA 2PUQT 2BOBA 3DI3B 3WFBH 4NNPL 2A6KB 1A7PL 1KTDB 1LK2A 5KSVB 5BXFA 2A83A 1YJDL 1CBVL 4HFUL 3PWJB 4Q7DA 2AEQL 2ZOLA 2HT3C 2ZSVB 3BIKA 5CMAA 5DD5H 2EDEA 4KHTH 3UYRH 4FQPA 5FDWB 3LHPL 3P9LA 3WKMH 4HXAL 5HHXH 2AV7A 3TCLB 1BJ1H 4Y19A 3FO1B 1EFQA 1MREH 1EHNA 1GGCH 3X11A 1WF5A 3CFIC 2E5EA 5KVDL 1D5MA 2ICEB 3F7QA 4X5WB 2DDQH 4O51B 1KJMA 4MSWB 4XNQB 3O9WB 1VEMA 2C1PB 1NMCC 1D9KB 3MMEA 3MV9B 5FYKL 4PGEB 2D9CA 5CBEA 2OTWB 1NCDL 1PYWA 3VI4F 4GAYA 3GMNA 2NTFB 3QXVA 3U48A 1NAML 1AXTH 3N85H 4LCYA 5E2UH 2VLKB 2YA2A 4CDHA 3GZKA 1ZVSA 3GMPA 1BM3L 3WE6B 1NDGB 3U4BH 4YHKH 4FFYL 5IKCA 4G80B 5ICYA 5DR5H 5GGUA 3LEYL 4JFOB 3QXAA 2XA8L 4RWYH 2Q6WA 2VH5L 1I8KB 5FYKE 4HKJB 2YPKB 3NPSC 4UDUB 4AM0B 3WIIL 1OWWA 1A7RL 1NEZG 1ONQA 4L4VD 2V5MA 4PRHE 5IFAL 1ZS8B 3NA9L 5GS3A 5GRJL 3BKJL 4QNPF 2CMRH 2YR3A 4WW2A 5A40E 4JQXA 3GBMH 3P0VL 3STZA 1IGCL 3D25B 4H0IA 1BX2A 2BFVL 3HZVB 1U3YA 2YS4A 3QPQC 1LQSR 4WU7A 1OB1A 2EDKA 2QHLA 4KKAD 1IQDA 4HCRA 4YXHL 1EZVY 3DUUB 4LNRA 1HEZB 1O7VA 4ZFOL 3HS0A 1FBIH 3CDYA 4BUHA 4PRPB 3V4PL 4LSSH 2WQRA 4NFDA 4Y16C 1AI1H 1MJUH 5IB1B 4FXGA 3E6HA 3K7UA 3QEQA 4OLXH 5HD8C 3SE4A 4OCYH 3QZWG 2ZUXA 4MDIA 4OF8A 4LLYB 4PRHB 4PLJD 1KFAH 5C9KA 1XGUA 4LPUA 2E7LA 3OAYK 3VH8B 2R1YB 2WUCH 3OKMB 2NY4B 2GJ6E 1SY6A 3VI4E 3MROB 4CL7A 2IH3B 1EGJA 1NAMB 3DGCR 4JKWA 1CQYA 5KJRL 1IE5A 4FQQA 4KJYA 3IS0X 2DD8L 5K9OA 1FG2B 3QDMA 1IKNA 4PJ8A 3V6OC 5E7BA 2E9WA 2VIRB 3CLEL 4G6ML 3BGAA 3SEPA 2F5AL 4NOBA 4ESKA 4QEGA 5T5NF 1MI5D 4PV9B 4J7RA 1PLGH 1XH3A 5FKPB 1UXWB 5EIQA 3VWJC 4LVEA 1Y0LB 3WXVL 3BZ4A 2KDGA 2RGSA 3ES6A 2MJWA 3SDXA 4U1JB 4FRWA 3HPJA 2X70B 3IFOA 1XGYH 4QNPE 2VXUH 2AVGA 1MVUB 5H94B 5HJ3B 3FB8B 3WEXA 1KYOJ 4HS8H 5TE7L 5I1EL 1VFMA 4LSPL 4RFOH 5ETUA 5ACLA 4ZFOB 4KKNA 2BSRA 5CBAA 2CK0L 2LAAA 4L8SC 1NKOA 1ZTXL 3L3KB 5GQBA 1FFNA 2APBA 2IMMA 5J12C 1EFXB 4WI9A 3PXHA 5SWSE 4HWZB 4DZ8B 1BF2A 5CZXD 3VG9C 3BP6A 4PREA 5C0BA 3NIFE 2Z92A 2DQTH 4OLWL 4ODXA 3P4NB 1JGDB 1MCWW 4FXKA 1JRHL 2VRAA 3PE9A 1YEKL 2J7LA 5I1KH 1FVDB 3T3ME 5ANMA 5C7XH 3BPCA 4XNMA 4KI1A 4HK3J 5IB5A 4NO0D 2IADA 3EFFA 5C3TA 2HFFA 5E6IC 3PV6B 5C0CD 1FO0B 5MEND 4MQ7A 4WI5A 1BQUA 3MOAL 1SJVA 4EIZC 4ELKA 4PGDA 1TVDA 4JG1H 2HKFL 3EJZC 4JFPB 4NP4H 4NYLB 4JG0L 1FH5H 1KJ3H 4YBQC 3QIBD 3TA3D 5IOPB 5SWSB 2AEPH 3WMSA 3OKNB 3QFDB 4KDTC 4P9HC 5HGHB 1QRNA 4MJ6B 5J6GB 2GHWB 1S7WA 4HIXL 2JE8A 1GOFA 4YAQA 3RWDA 3U4AA 1I7TA 1QNZH 1AY1L 3EYOB 2UWEF 4R7NA 3Q3GA 4Y2DB 5LWYL 2PXYD 4JHAH 3GJFA 4LPTA 1T89A 1U8NB 3GO1H 3PGDB 2Z93B 1VENA 3RKDC 3TO4A 1ZVHA 4GKOA 3C2AL 4OKVB 3KXFE 1NMBH 5KN5A 4HJJH 4K23L 3X14B 2R23B 4PJEE 1E4WH 2CIKB 3TZVB 1BAFH 4PRIE 4HPOL 4NQSB 1NBZB 2H32B 3RWHB 3MRNA 4PJDA 5C0ND 2YSSB 1D5XA 3GIVA 3RU8L 1SYSB 4OGYL 2VAJA 1N4XL 1BZ7A 1G7JA 1EBPA 3REWA 3IXTB 3NFSL 3THMH 4I3SH 4MCZA 3S35H 1FDLL 4OUOA 4W4OC 2P46B 3A6BL 4EVNA 4DGYH 3HMXA 3EYQC 3DX9B 4ETQA 5DRXA 5E5MB 1TJHL 2Z31C 4DKEH 2Z8SA 4LLVB 4IMKA 4ETYA 3KXFB 5EOTB 4PG9B 3OKKA 2DLFH 1P7KA 5JDSA 2R8SH 2JB6A 4RRPG 5TE6L 1MY5A 4PJEB 4ZAKB 4PRIB 2RCSH 4J8RA 1OTSD 1RD6A 5ESAA 3ZKNC 5F7WC 1IM9D 1S7RA 5F89B 1GGUA 2DQEH 1S9WB 1E4JA 1P2CB 5C6PB 4WUUE 4XC3L 3N06B 3GMOB 5TE4L 4DKAA 5C0IB 4KZDH 1XF5B 5C09A 1DBAL 1Q9WA 1Z5LA 4W6XB 3BYTA 4A2LA 4F7PB 1HHIB 1FHGA 4YWGH 4X7DC 4YC2C 3PL6A 4PYHA 2BZDA 3DV4B 3PHQA 3LKNB 1T1ZA 2AJXL 3RDTB 1ORSA 3ZSTA 2R4RH 1MHEB 4MAUH 3GSUA 1ZT1A 4AQ1B 3Q5OA 4XCFH 1MVFA 1FFOB 3A67H 1XR8B 5CJXA 2JIXB 1XF3A 5T1DL 4GQPH 4H26A 4CJ0A 4AIZA 4MAYB 2ADFH 3LEVH 3IDXH 4RGNE 1OGAE 1T22B 4DOHE 4YHLH 2C1OB 3FT3B 4OJFH 1GVIA 1QPPA 4Y5VA 1D7FA 2VKWA 1ES0B 4WUUB 1NCWL 2ZG2A 3JTTB 1WSST 1MELA 4UQ3B 5FM5M 4LSRL 3TN0A 2A73A 3WFHA 1EH9A 1MFCL 4OD2B 1LHZA 3PQYE 1WFOA 3I6LE 2D7TH 1F3DH 5I1LB 4ZFZA 4ZUWB 4JFDA 4L29A 5DLML 5FIEA 4FABL 2F19H 1U3JA 2GY5A 1X5ZA 1ZLSL 5CD5D 4U1KA 1V3LA 4M8VA 4ODSL 4UOW0 5IM7B 4GXUN 1RZ8A 4YXLH 4UAOC 4KI5E 4R90H 3PJSA 2R2HA 4FQ1H 4GSDL 5IEKB 4YFEA 4RGNB 1OGAB 3LV3A 4DOHB 3WLWD 1KCUL 1SHMA 1UVQB 5D1XB 1LE5A 3LN5A 1L9MA 2ITDB 3ALWA 2E8ZA 2M2DA 4O4YH 4U1GC 5ECJE 1HH9A 2CXKA 1G9MC 3PQYB 4WW2C 2YMXL 4JQXC 3HNSH 3QRFM 4Z5RA 5DC9B 4I8DA 4LHQB 4MB3A 4BELD 1KV3A 3KPRD 3OAZH 2EYSA 1VCAA 1BBJA 2NZIA 4FN0A 5I71B 1NCAL 25C8H 4APQA 2JCCF 3DROA 2B5IB 4LARH 4RAVA 1JGLH 2BOCB 5I74C 1ZXQA 3SE4C 4DVRL 1HWGB 1JTTA 3I02A 5IEHB 2XKNB 2E7LC 5EOCH 3LAFA 2OX5A 2H26A 3DXAA 5C6TH 2J4WH 1IEBB 1F58H 2OL3H 4XWOC 1TPXB 2YUVA 2YEZA 2DWEB 4LU5H 1DN2A 4LBEA 1OM3H 1IKNC 3BIBX 4PJ8C 3T77A 3PHOA 3BUYA 5E8EB 2J8HA 4HPYH 4XP6H 4LP5A 2ARJA 3ARGD 4FQ2L 4KK6D 3MRBB 1H3PH 2E9BA 3H0TB 4JO1H 1AIFA 5CP7B 2HRPL 1T7ZA 4HIHB 1NUNB 4X7TB 3I75B 4IOFD 5CS7A 3UTOA 2ZZUT 4W68A 1K4CB 4UTBH 3VFTB 2IANE 5DJDB 2V2XA 5C0AD 2BNRA 2ZJSL 3CGTA 2P24B 1VKXB 1T2QL 1U8OB 5FGBA 5E8PA 5ID0A 3B5TA 4Z76B 2IH1B 1C08A 5KSAA 1MRFL 1D6EB 1QVOA 4XPFL 3ARWA 3MRGB 3HR5A 2DQIL 4WO4A 1YECH 2VDQL 1X7QB 2EYTB 3KS0H 2OR9H 1RI8A 1NGYB 3NFNB 3HLAB 4DN3L 2BRRH 3QHFH 2LVCA 2HA1A 1PKOA 4MWFB 3SDAB 4H1LB 4WY7L 3GSNH 2VE6B 2WBJA 5J89A 3K4ZA 2NR6C 1MY7A 3IF1B 3BD5A 1RZIA 1T20A 2IANB 3K46A 1RUQL 2P8LB 2W0KA 5HDQL 1QSZA 3MXWH 4TVPE 3VXUD 1YEEH 1EEYB 3MLZH 4JO3L 4EBQH 3O8XD 3V0WH 3GMRB 1YYML 4TNWK 3FRUA 5IFHH 1CT8A 1HQRA 1NCNA 4Z7VA 3TPKA 4J3VA 3VXSE 3BAEL 1INEL 1I3RB 1CLZH 5I9QC 2EDFA 4G9FD 4G8GD 4ODWA 1OF2A 2CRZA 8FABB 2NX5B 3KYMA 3KG5A 3QUXA 1F4WL 1VADB 4GXVH 4HXBH 4OQTL 4G5ZL 3BRGC 5D93C 1HSAA 5HGDA 3W9DA 5D5MA 1Q0XL 4X4YA 5GS0C 4WFHD 1EHLL 4O9HH 3P11H 2DBJA 2OZ4H 4J6RL 2BXYA 3O2VH 2FZ3B 3DIFB 3RPIA 1DQJA 3SDYL 1PG7W 3D39E 1AKJB 4JDVB 3X3FL 3VXNB 3OMZA 3IVKB 3ZT5A 5IVXA 1T89C 3ULVF 1JUFA 1EUTA 5D7JB 3T2QA 3VXSB 4DWHA 4I77L 4ONGH 3TO4C 2R2EB 2NW3B 3CFDA 3K2MC 3S37H 3ZKXC 3U7YH 1FIEA 5EU3B 4NO2B 4J1UA 2DQJL 2UVEA 4U31A 4YE4L 5D72H 3IFLL 5JMOC 1DQML 3L3OB 2MFNA 2X1OA 1ZA6A 1NJ9B 2DMKA 1KCVH 1Y18B 5T1LD 4TTDC 2CO7B 4JKPL 1RK1A 2NY5C 4M6OL 1M1SA 2D7PA 4MD5B 3HMWL 4F57H 3D39B 1MWAB 2V6HA 4F9PA 4EDXA 2ZCKH 4HWNA 5DUBA 2R15A 4R3SB 4YLQT 2P8PB 3A6OA 2Z91B 4N8CH 5B39G 1KTLA 1QLRB 3QDAA 5F3BA 3LS5L 5ISZD 4IMKC 3PV7A 3LIZH 2HFGL 1LE9A 1J8HE 1OT2A 3DECA 1TNMA 4NN6C 4YGVA 4IRSB 5EZIL 5DA4A 2E6PA 1TCRA 3LDBB 2WLYA 4LEXH 2WINA 4NRZB 5D2LF 2Q8AH 4Z0XB 1KENL 3RIAF 2VB5A 1LO2L 1QBML 4WEUD 3P4MA 4KWUA 4EOWL 1I3GL 2FL5B 1E27A 2DKSA 1S5HA 3FO9B 3UPCA 1U8IB 3A6CL 1BFVL 1OAXH 3U46B 5FCUH 4LF3B 3ULVE 3RVWD 1T1YB 4HAGA 3D69B 1UZ6F 4IOIA 3KVQA 1HILB 4PJGE 3K4AA 3PL6C 1X6LA 2AV1B 2J1KA 2IFFL 3GEWB 1DEDA 4HT1L 2BJML 5DJCA 4ZDHB 1AR1C 4P2QE 4HZLB 5FA3A 1J8HB 5D96B 2AJZB 4JDZB 2HT3D 1HOCB 4XX1E 5LG1A 5CJXC 3GHEL 3ZZ1A 1UQSA 3BW9A 2H6PB 2J6EL 1N5AB 3HI6L 4MD4B 5IR1A 3DX6A 4FQLL 1VACB 4Y5VC 3KYNA 1QD0A 1CGSH 4S1RL 1GGIH 3MCLH 1KLGB 3JV0A 4NM8L 3TN0C 3BQUA 1QFWI 3OR6A 2KZWA 1QR1A 2JB5H 5GGRA 3JV6B 3PABB 5FECA 5C07E 4XZUB 3E2HB 2P8MB 1GC1C 3BP7B 3GNML 4KROB 5I8EB 3WCYA 4UINH 2W0FA 4PJGB 4WFGD 1FCGA 4KHXH 1A6UH 4WGVB 5J56B 1S5IL 2H1PL 4WW1A 4OCSH 3HAEG 4F7EA 5DTFB 4HG4J 4P2QB 1RUPH 4FQCL 5FA4B 1K6QL 4GMTL 5E8OB 1FGVL 3WSQH 3DX7B 1HDMA 1G7PB 2GFBB 4PGBA 2PO6A 2R29L 3O6KL 2ESVE 3D18A 3BGMA 2ICWB 4DUVA 1U8PA 3DSNA 2C4FT 3DVGB 1T5WB 4KGJA 4YHOH 4S1QH 3TO2B 1IEAB 3IDYC 4HKXB 3IJYA 3I2CH 2WWMC 5DK2B 4ZTOH 5HDBE 1XR9A 2FLRT 5C07B 1UZ6E 1SEBA 2MQ3A 3FHQA 4GBXA 2Q20A 3QDGE 1EAJA 5CAYB 4LLQA 3QPQD 3FFCD 3MACH 2R0WH 4PY7A 3NN8A 3OPZH 4F33B 5F7MC 3ZE1F 1Q9KA 3QFJE 2B1HL 4PJ7A 2BSTB 1RSFA 2J5LC 3W0WE 2ESVB 5GSVA 3VFGL 4APQC 1CFVL 5CSZA 5FYJH 1U93A 3KJ6H 1MCEA 1QUNA 4Y16D 3MO1B 3EOYG 1I8MA 1KPRB 3SGEH 1LP9F 5GJTH 2XXCB 4KTEL 3VWKA 2JELL 4M8QB 5HD8D 4NM4H 2ZUVA 3D85B 2Z4QB 3CPLA 2E27L 2VAAA 4GG6A 2GITA 1QHOA 4C54A 4TSBH 4NKMA 2EIZA 4ERSL 4MA3B 1PZ5B 1YQ2A 4C58B 3QDGB 3VRLF 2YUXA 3HNTH 3FB7B 1QFWM 4D8PA 4P3CH 2NY0C 1AXIB 2X42A 4CKVX 5GRVK 2HAZA 3IXAB 2O5XL 3QFJB 1A6VL 1P7QD 3MA7A 2YRZA 4LCUA 4KZEH 3W0WB 4M7LL 1DJSA 3RPKA 2YD3A 3MRDB 5E5RB 3G6DH 5CEZH 4MA1B 4Y8AA 1VPOH 3WLBB 5KSBE 4P46B 4TSCH 4Y1AE 3S36H 3QT2A 4KPHH 3BWAA 3FQTA 5D1QA 1U8JA 5FGBC 1CD9B 4Q2ZA 1YY8A 5KSAC 4U4BA 3EZ8A 3NCJL 2OLDA 1D5IL 1OGTA 5JNYB 5F97E 3FFDB 2VABB 2OL3A 4HUUB 3WXWH 4GQ9L 4NGHL 5DJ8B 3ZE1E 5JW5B 2VNCA 2V2TA 4MCYA 4WO4C 5IQ9A 5IESL 2DBLH 2OQJB 1TZGH 4LVOB 2PYEE 3QULB 2DWDB 4GAGH 2Y36H 4U0RC 4YXKL 3W81A 2MQCA 1MEXL 35C8H 3X3GH 3BKML 5LKNA 3EOTL 4QRQB 1IBGH 3C5SA 3MLVH 5KSBB 2WBJC 1QLFB 1R24A 1OL0A 2NMSA 3JV4A 4RDQG 4Y1AB 5ITFB 4QXTB 3B2VH 5FKAA 2DQDL 1ZLVH 3T0EE 2X4OB 5IJVA 3PWVB 4G6JH 1AD0B 2FYYB 4QTHB 3VRLE 1XF4A 4KXZI 2AJYL 2FJGB 3VFMB 5LXGH 1BECA 1OP3H 3TYGL 4YJZL 5CILH 3QXTA 5E6ID 4K7PY 5ENWA 1G6RB 2ERJC 4NO5B 4PJAF 3R4DA 3L1OH 2FGWH 4UZGA 5FB8B 32C2B 2PYEB 1WLHA 4YDLB 3RY4A 1RZFL 3F7VA 3IJHA 4OZGA 5HI5C 1AC0A 4YBQD 2ADIB 3QUXC 4N1CA 1FV1B 2DJUA 2OSLB 2VLJE 5DYOB 3OTTA 4Y7MA 3INUH 1WTGT 1G9NL 1WCBB 1NUGA 5J11C 1G1CA 1SJEA 4YO0A 3T0EB 4YK4B 1YNKH 1YY9C 5JO5A 3QI9A 2B4CL 3GSNA 5SX4H 2FBJL 4JRXE 4X8JA 3PDOA 5GGTH 1AGBB 1I8LC 3LD8B 4XCYB 2N7AA 1EIBA 5SV4A 4U6VH 1NMAL 1YNLH 4ISVB 2EH7L 5KAQF 4JFXA 1JI1A 1M05A 5IF0A 4D9LH 1QFWL 2UWEA 4XP1H 3SDDA 2HLFD 5EZJB 4ZFFB 4FFWC 1T83C 1FNEA 2MNUA 4MB5A 4CGTA 2VLJB 3BEVB 2X09A 5T3ZD 3IFPA 2E7CA 4JFHE 1DBJH 3DO7B 3VFVB 1KJ2L 1R3JA 4PJ9D 4PS4H 4JRXB 5BZWA 2IJ0C 4GMSL 2R2BA 5GIRA 2B0SH 4M03A 4X6EB 3ZKMC 2FO4B 3QO1A 4F9PC 3PWNB 2OZ4A 4PJAE 3RZWA 1NUFA 2V5YA 1X5HA 1HWHB 3SOBL 4OF3A 2FIKA 1CD0A 1IAIL 4O2CA 2Z31D 3OQ3B 4G42A 4H5SB 4ODUA 2ADGA 3U9PL 3IRZA 3QWOB 3CXHK 5FF6B 3NMEA 1FVCB 1BIIB 3T0XA 3ZKND 1KCLA 5F3HB 2BNUB 1V3MA 4PJCE 1T66C 5KVEH 4JJHA 2A77L 3MLSL 1YN6B 5IMKA 5IB3B 5HYIA 3W2DL 3MRCB 4JN1H 1H5BC 5DI8A 5ID1B 5LVEA 3QDJA 1DLHA 3DMMB 3X12B 1OARH 1DR9A 5CKGA 3DOSA 3GSWB 5EH1A 4PJAB 1SVCP 2LU7A 3K2UH 5GJSL 1NANI 3L95A 2V7HB 4WI4A 3UO1L 2AABH 3QDHA 1FJ1B 3U0WH 1EXUB 1J1OH 1C12A 3VFOB 3EYFB 5F6IB 4QRSB 1B0WA 1Q0YH 3O3AB 5F1NA 2X4PA 2NY1B 3PWPD 1JN6A 3UCRA 1O0VA 1T0MA 2ZUSA 2VR9A 1F4AA 5IGXL 4XP5L 4B53A 1I1AA 3P4LA 5L7XL 4PJCB 5EORH 2VXQL 3V5DA 3GKWH 1N6QL 1QA9A 3C5ZB 2L4OA 3BQUC 5FM4A 3WHXB 2FO1A 1KGCE 3L3GB 3V7AG 4RWHA 2OM5A 4OLZL 4M5ZL 3ARDA 3ZLQC 5ITBL 3MJ8A 1MFNA 3UJTH 5CFHA 5I1CL 1F6AB 1B0RB 3EFDH 2ED7A 4QOKE 2PCPA 4YHZH 2ICWJ 3T8XB 2NXZB 3BGFB 2HFEA 5D7SH 4L8BB 4GRLA 3MGAA 4WCYH 1PW3A 2L0DA 3QP3A 4JM2A 1H3VA 2PO6C 4NHUA 4JFFD 4GRWF 1IGFH 3VXPA 5ERWB 3S96A 4OZFG 4ZUSA 4NFBA 3P0YL 4MNQA 1A21A 4PP1C 3CVHL 4HQQL 1U0QA 4K3JH 4HV8A 5C70A 1P5VA 3BP4B 1YEIH 3PP3K 3BZFA 4CVUA 3V0AC 2B20A 3FKUS 4AEFA 4S1SH 3BOVA 3H9HA 4GBXC 1P84K 1OP5K 4PJBB 5BOZG 1SMAA 5FOJA 5GRZA 2FX9L 1G7HB 3ARED 4QOKB 5CGYD 5FM8A 4P99A 2HTLC 1ZSDB 1U2HA 2W65A 5F1IB 1QSEA 2OBGA 4U6XA 1U3HB 2A9NH 5L0QB 1IJ9A 3ZMRA 4BSWA 4KVCH 4JREC 3MA9L 4I4WA 1J8KA 4WTZG 1IEHA 5MERB 4ZPVB 3GMQB 4G8FA 1AD9B 3B9AA 4HMCA 4ZUTB 4BK4A 3D87B 2HJFB 3QQ3A 3QEQD 3VWKC 5TH2A 1QQDA 4GS7B 2ZPKL 4NOFA 4NZUL 4RISL 4KTDL 1S78C 4WV1B 5C2BL 1IAOB 2DL2A 3GSVB 1R3LB 1NAKL 4WDIB 4WI6A 5DZNA 1GCFA 1U95A 1DDHB 2GT9A 5DWUL 2VISA 3NVQA 4PJFB 3CU7A 3QDMD 4PJ8D 1A3LL 2G5BB 3LH2L 1K9TA 2OI9B 3MLTB 2R1WB 1LMKA 3GI8H 4N8VA 4Z0BL 2BX5A 4M02A 3HFMH 2YD7A 2QR0B 3ZYIA 1OPGH 4KY1L 4X6DF 2X1XR 3CVHB 2C7UA 1TTUA 5IJKA 2Q8BL 2FJHA 2V17L 2BERA 5F72S 5EU6B 4BYHA 5F7HA 2M8XA 3OXRA 5EC2A 3CU1A 3BHBB 3FB5B 4U1HA 5D1QC 3BE1L 1JGEB 1S9XB 3MBXL 1L0YA 3UYPA 1OTTD 3ZL4H 4UOW1 1ZHNA 3VMNA 3CFJA 3V7MA 3UPAA 1XGRB 2XZAH 3PIQA 4R7DB 3D0VA 4NJ9L 3U7WH 1XIWA 4R9HA 1K3ZA 1FE8H 4R96A 5EU7E 3UP1A 4BUGA 2E6JA 4LASL 5DUML 1J1PL 1IKFH 3CLFL 2HVJB 2F5BH 1TQCB 2HN7A 5E9DA 5JOPD 5DK3A 3GJEB 5CWSA 5B38A 3R06A 1DL7L 4K94L 1M7DB 4Z18A 3MRQB 1G84A 4UT7H 4U3XA 2ZUTA 5E2WH 2NR6D 5C0BD 1I9IH 4OSUL 1B2WL 1U2CA 4U1IB 1ADQH 2WNGA 3QQ4A 3UTPE 2GK0A 2CR3A 4ENEC 1MI5E 4RFNC 1OAKL 3OSKA 5EOQL 4ZTPL 43CAA 4H88L 1JP5A 5A3IC 4DCQA 3L3DB 3OX8B 3E8UL 1MFAH 4GOSA 4UV7H 4UT6H 5F9WB 4K3DL 4XPGL 2VDOL 3BH8B 4GRMA 1N2RA 5D1ZA 1DVFB 3RGVD 3SQOL 3QUMH 1OT1A 3G6JF 1YEDA 4X6DE 4F7CB 4HC1H 4MLIA 3RL2B 3RVTD 1CK0H 5ADPH 4LHUG 2CJUL 3U4EA 1TTFA 1QRND 5J1AB 1YPZF 1Z3GH 4P57B 3MFFB 1T6WA 5GS0D 1RIHL 1TETL 3P73B 3QI9C 3CC5B 1MI5B 2ED8A 2UY7A 3EO1A 3R0MA 2XPGA 5F7DA 1KNOB 4YFLI 2R0ZL 1SEQL 3TJEH 4YHMH 2ZUWA 3N1GC 2Q3AA 4R0LA 1HHGB 2N7BA 2W9DH 1KC5H 4L9DA 3TO4D 4DVBB 4F9LA 4X6DB 3SDDC 1A6ZA 3DUSB 4NSKA 1LD9B 3HCVB 3UPRA 4LSDA 2AK4E 3D6GA 1HI6B 5LAXA 5I76A 3QWQB 4BQBA 1CWVA 1U58A 5C0CE 5INDA 4XHQA 4JY4A 1KLUA 3UTZA 1DUZA 2YHGA 1KIQA 4G8EB 3MODL 4P5KB 4Z77A 1INDH 5BVPH 4ZUUA 4TTDD 2FX8L 3AS1A 4ZXBA 1C7TA 5LCVH 4PJ5A 2HLAB 1X5LA 2CKBH 3DHMA 3MC0A 5EO9B 1IAMA 1DEEA 2UZIL 3NZHL 5JIIA 2VXTL 4UIKH 1XCTA 3MBEB 1YA5A 3OAYH 2YPLE 5GGTA 1YEJL 3G6JE 4JPVL 4R2GC 3KPNA 2Z35B 3E1F1 1HXMA 2XKSA 2VDLL 1UYWL 2N1KA 4XVJL 3T3PE 2AK4B 1AFVL 4NO0B 1AGCA 4ZFGL 1YJDH 1CBVH 1YPZE 1NH6A 4HFUH 2AEQH 4QT5B 5C0CB 3C5JA 5DHYB 4H0HB 3NCEB 2D31B 4WHDA 1X6NA 3O3EB 5KVDH 3QIBB 4NN5B 5D2LA 3ALXA 5DC4B 2NY2C 1A1NA 3QJFB 5HHMD 1VSCA 5JPMB 5AUMA 3QZWB 3PL6D 2YPLB 1BBDL 4QCIA 3MRFB 1NCDH 5D9SA 3Q6GL 1PDKA 4OLVH 4YDKL 1M6OA 2DTML 3OGCB 4M7ZB 4K2UL 1YMHA 1NAMH 4PY8I 5IW1A 1T21A 1YPZB 1VEPA 3NA4A 2XNAB 2PYFA 2FX7L 1BM3H 1I1AC 1RJZB 3VRJA 1BVKA 4GRWH 1FSKB 4FFYH 3LEYH 4YNYA 2E9JA 2EC8A 1KPVB 3FN3A 2XA8H 1J0YA 3TN0D 2H41A 2VH5H 1J0KA 1I4FA 4ELMF 3ARDC 3WIIH 1A7RH 5I19H 5ICXA 5AG8A 4KJWC 2Y5EA 5IFAH 3NA9H 2MCG1 5GRJH 2PTVA 2VSDA 1MCIA 4X7SL 3GSQA 3RX8A 3IDGA 3HG1A 3QXUA 1CE6A 1GOGA 5J6HA 5HHNB 3LVEA 2ZUUA 2EDNA 3MZGB 4GRLC 4HK0A 4JY6A 3VE0B 5IQ7L 5BQ7B 4JM2C 3BH9B 4D9RD 4LLUB 2WAHA 4OLYL 4YXHH 3OB8A 3RUGF 5BRZE 5FHAL 2XQYK 4MMXC 5JUEH 4Y4HA 4ZSOA 3S5LA 1MUJA 2IPTL 2J8UA 3ARBB 4XVSL 3QUKB 1LDSA 2V5RA 3TVMA 4S1DC 1DBBH 3QEGL 4LCCA 4PJIA 4OTXL 4IMLB 4CVZA 3KPSA 4Y5XB 3ESVF 4P2RA 4PR5B 4LLWA 4OLEA 3JZ7A 1IM9B 1UJ3A 4MDJA 3CUPA 2ILLA 3SCMA 3MV8D 1VFBB 4WHTB 3SDCB 5KJRH 2XN9A 5ALBL 1JHLH 2DD8H 2W0PA 1KF9B 4TNWF 4KVNL 4RAUA 1RUML 1DQQA 2KQNA 4UUJA 1MLBA 3KYAA 4LRNL 4S10A 3DBXB 3JVGA 4HJGB 1JYNA 3CLEH 5BRZB 4G6MH 2VOTA 2F5AH 4APQD 2O5YL 1CLOL 3T08A 1NFKA 3VXQA 3WXVH 4M5YL 1HKLL 4ELME 3QNYA 1KB5H 1EPFA 1F11B 3K3QA 1D5BA 5I1IL 4FA8A 1LP9A 1CN4A 3F58H 4BQ9A 4CDGC 4CMMB 4RGMB 3SY0A 5I8OH 4JN2A 2VDPL 2R69L 4P59H 2NY0D 4LSPH 3HUJF 3ZTJG 5GRUL 5KVFL 1T3FB 2VDRL 3JWDH 4OCXL 2FGZA 4V1DE 4XNXL 4HUWB 4I5BA 1JIBA 1LO0L 1PQZA 1H8OA 1Z0NA 1ZTXH 4M6AA 4QHLB 5IJKC 1OSZA 1OOAA 2E7HA 1CDJA 1NLDH 1QO3A 4W6WB 2W0LA 3KPRE 1NGWA 1R3HB 3V95A 4ELMB 2CLRA 3C60A 1L0QA 3PNWA 4QF1B 2BNRD 2ZCHL 4NPYB 5HHPB 3SGDH 1JRHH 2VDKL 1DZBA 2AXJA 1DP0A 3IDIB 3E3QE 4KV5F 4X5XB 1WGOA 5ESVB 5F7LB 2F54B 3QCVL 2XFXB 4X99A 2ZUQC 5FO7B 2DYPB 3G08B 3NCCB 4WO4D 1SMOA 5E94A 3IAQA 3BPNB 4FP8L 1FFQA 1U6AH 5FUOL 2NXYB 4V1DB 3L5XL 4C56A 2VXSL 4AENA 3MOAH 4A2MA 1W72A 3MRMA 5DVLA 2HKFH 1JGVH 2NY6B 4JG0H 1PVHA 5KW9L 2WBJD 5TF1H 5EBGA 3KLHC 1IGTA 2EKSA 3KPRB 1RFDL 3HC3L 2XXMB 4NZJA 3FN0H 3WO4C 4G6FB 3HE7A 1BD2A 3LKRB 4HIXH 3Q6FA 1GHFH 2LU4A 4NO3B 2PW1A 4U6YA 1RZGB 2Y25A 2PTTB 5HGAB 3QB7C 4HKBA 4HUXB 2NW2B 4UU9A 5LWYH 4AIXA 5CP3H 5C0AE 1ED3A 3KLAB 3AXLB 4HKZA 4K8RL 2VR4A 3VH8G 4IRJB 5HI5D 1HH6B 2R2CA 3QUXD 3C2AH 5F9OL 4NC2B 2OYPA 1WIPA 4XBGB 4X4ZA 4K23H 2Y06L 3ARGB 4OZ4A 3MLWL 2H9GB 2YPVL 1G7QB 2X4NA 1YY9D 4HPOH 1JJUA 3RY5A 3M17A 1A02N 5CIPB 1I7ZB 2X89A 1J05A 5C0EA 4F37F 3IGAA 1KULA 1RK0A 1R5VB 1CG9B 1ADQA 1IAKB 3TBYA 4WUKL 5GGSA 1N4XH 4KMLB 4RCAA 1JNHA 4R0LC 4QHKI 3DETC 3NFSH 4EUPB 5C0AB 2FBOJ 1FDLH 3A6BH 4F9LC 3S34H 4ZD3L 2WMPA 4FFWD 4P3DA 4L9LB 1TJHH 3VXMD 3BD4A 5E95B 3U36B 1JV5A 3QUMA 1IGIH 5FK9B 1TVBB 5TE6H 2BHZA 4HC1A 2OR8A 2LU3A 5DVNA 4OFYD 4NQVB 3WKNA 1CFTA 2D3VA 5DGQA 1CD1B 1Y6NR 3CFBA 5JHDA 4XPTH 5TGBB 4ZXBC 1LDPH 1E4XI 1HYRC 1CFBA 2UZXB 1OAUL 1QRKA 1JGUL 4OI9A 1T0NA 3VXOB 3GMLB 4XC3H 3ZKMD 3B9DA 5TE4H 3MV7A 4LLMB 1FL5A 1DBAH 4LCIH 3RVUC 4WFHE 1AQDB 4I2XA 1JNLH 1FIGH 3SN6N 3TBTB 3UC0L 1M71A 1SQ2N 5E2TL 4U1MB 5JZ7C 2CQVA 2E7BA 2AJXH 2BVQB 2OXHA 1RULL 4X5WA 3UTTA 3WDIA 3WIFA 4AH2A 1U8LB 3EAKA 1RJYB 2ZG3A 5TDNB 5T1DH 5K9QG 2CDGB 1D5ZA 3DTXA 1EEZA 4UQ2A 1MFDL 2EDWA 1NGXB 3NFPB 3O6ML 4MD0B 3BMWA 3SBWA 1NCWH 2KPNA 4NQDA 2I5YL 4LSRH 2VLKA 1X5JA 1XF1A 3TT1H 4JGMA 1NCBH 4FMFA 1MFCH 1U8KB 4OGAC 3T1FB 2P7TA 2CKBA 4N8PA 4G80A 3WN5A 5IROC 1LEGB 3S98A 1K3IA 4N0RA 1T0PB 2HTKC 5DLMH 1AGFB 1KJVB 4UDUA 3MGOA 3ETBF 5C0FA 5F96L 4D9QE 2FR4A 1RQ5A 1S9VB 1ZLSH 4BQ8A 1CTNA 3STLB 1YEHH 2OJEB 5HVHC 5DS8B 3HRZB 3MRPA 5T5NG 1EDQA 1KCUH 3AU1B 3BQUD 3U30C 2Y7QB 2NY3C 4NZTL 4NKIL 1FNLA 2DI7A 4LQ1A 4NQXB 5JW3L 5HYFA 4NQEA 1HEZA 4KDVA 2AI0H 1P4BH 2PKDA 2VL5B 5T1LB 5D8JL 2YMXH 4P23B 2QEJA 3H8NA 3FRPA 5DVMA 4F7MA 1YDPB 4PRPA 1XMWA 2VQ1A 4K71B 1YYLL 5DFTA 4ZQKA 3KNBA 1YUHB 5JXAL 5SX5H 3VFPB 2B39A 2I25N 3RI5K 2FD6L 2ZCLL 1AC6A 1JF1A 3C8KA 1S7VA 4JCMA 2PO6D 2DN7A 1IL1B 1F5WA 2DIAA 4L3EA 5L8JB 4WJ5B 5HPMB 4TQEL 4Y4HC 1DSFL 2IH3A 1NAMA 3L7FA 5E0QA 4L4VA 2MPAL 1E28A 1U92B 2GTZB 3QRGL 5TFSL 3TVMC 4LCCC 4KMTL 5TQ2L 2FWOA 2X1PA 4GBXD 4NNXB 2I24N 4ZOBA 2VDNH 4WENB 5EZLB 1UJ3C 5EUOF 4Y5YB 4LSVH 5I16B 1Y6MR 2HTLD 3DV6B 4Y88A 4RSVA 5I15L 1BPVA 2VC2H 1LEIB 3JVGC 4X6FA 1K4DA 1HCVA 4FQ2H 1ZT4A 2X70A 7FABL 1F00I 4WFGE 3IYLW 4QYOA 5DD3L 1ZWIB 4L8CB 3D0LB 2HRPH 4LFHG 1FN4B 1J0ZA 1MAML 2AXFB 2WP3O 3VWKD 5DEGB 3TNMB 4ZFOA 2YD4A 4GW5A 3MV01 1MLCA 3Q48A 3UDWA 5MHSD 5DD6B 1S78D 2ZJSH 3QNZA 2X4RA 1T2QH 4I0CC 2FSEB 1EFXA 1N6UA 2NY7H 4JHWL 4PJXA 5L6YL 4UOJA 4ZOAA 5I1JH 5T5FL 5HDLA 1DN0B 4NZDA 1UXSB 3WFDL 1HIML 2I9TB 1KTKE 4MGXA 3HR6A 4JKLA 4JZOA 2VDQH 1J0HA 1TZIA 4DN3H 1X5AA 4HDIB 1N5YH 1WIOA 4NQCA 4DKFL 2J12B 3FFCE 3WL9A 5SWZA 3HZYA 1M4KA 5IFJB 3AVEA 4WY7H 3KPOB 3C60C 3GSOB 5D1QD 1X3DA 4ZS6D 1MHPL 5A2IH 1FZKB 4LSQL 1N8ZA 2OXGA 1W0VB 1CXKA 3O11A 3PF2A 4NYLA 4NT6A 4CNIA 3WNOA 1KB5A 5HYSA 4JO3H 2FHBA 5SWSA 4RNRA 3NPSB 4XXDB 4G7YL 3OKNA 1ETZB 4LMQE 4AT6A 5HGHA 1YYMH 3MZTA 1CL7I 1E4XL 1SYVB 3AS2A 4F8QA 3MJ6A 5EA0L 3VGEA 1ZA3B 2YD2A 5DEFA 1HYSC 2H2PC 3BAEH 2PETA 1INEH 1NBQA 5I66A 1L4IA 2BNQA 1NL0L 4JQIL 3CZFA 4MQSB 2W60A 2D0GA 5B39B 5JIHA 3SO5A 3V6OE 5J9PA 3FFCB 1F4WH 4N0FB 3LSOA 4OQTH 4G5ZH 5LGHL 2AKRA 1SJXA 2QKIA 2IGFL 1Q0XH 1T80A 1AQKH 3HE7C 5IBTL 1HQ4B 4RA3A 3ZE0F 3F12B 1FGNL 4LAJH 1EHLH 3UJIH 1KIRB 4XPHH 5HDOA 5IK3A 4Y16B 3T4AA 1BQHB 2FEDC 4OKVA 1JK8B 2QADD 2UYLA 2BVUA 5ALCL 1CDYA 3BYYA 3SDYH 1FVEA 4OIIL 3X3FH 1S7UA 5TDOA 2G75B 2CIKA 2CUMA 1NFIB 4NQSA 5FO8B 1NBZA 1XGQA 4I77H 1BWWA 5CSBA 4K3HA 3FQWB 3HTLX 3V8OA 2K1MA 4P2CG 1FNFA 3CH8A 4QHMA 2CKNA 1LWRA 2DQJH 5FHBL 2BCKA 3IFLH 4PPTA 3UAJC 1DQMH 1MCSA 4LDLB 3ZDZF 2AQ2A 1UWEL 3QI9D 1Q94B 5IIEB 1JZ8A 3OAZK 2PW2A 4PP2A 4JKPH 5E5MA 1BJ8A 5A16B 2PXYA 3VWJB 4DGVL 3U1SL 4M6OH 4PB9L 4LLVA 5SWQA 5DSCB 1FLRH 3IKCA 3RWGB 3HMWH 1NGPL 3OR7A 1NC4B 5HVGB 1RIVL 4Z7WF 4PJEA 4ZAKA 3V6FB 4P9HL 4YX2L 3JTSB 1IZJA 3SDDD 1C16B 3DRQA 3LB6D 5F89A 5D2NA 5IWLA 4O2EA 3RP1A 1H3XA 3LS5H 5CP3A 3GMOA 1N3NA 5EBWB 1AGEB 2HFGH 3HC4L 2LABA 4Z7NE 5EZIH 5K93A 1JHKL 4V2BA 1OCWH 2Q7YB 4L8SB 1JPFA 5J12B 1YZZA 1I3GH 3RDTA 4M93C 2EC9U 3KJ4C 4JFEA 3O3DB 3A6CH 1BFVH 1IGYB 1MHEA 2X4SA 3F7YB 3LOWA 4H1LG 4B0MM 3CXDL 1FFOA 1XR8A 3BSZL 2DQFA 1RMFL 3B8YA 5T3ZL 4PY8J 4S2SB 4R2GD 1LO5A 4M48L 2G2RB 3T0DA 3ARZA 4X9BA 2D9QB 4RMTA 3MLXL 2IFFH 4RBPK 3FT3A 2VSCA 5DRNA 4UQ3A 2Q86B 3TIDA 3B9VA 5D7LA 3RWEB 2MQ0A 5EFIB 3ZDZE 3EO9L 3AC0A 3GHEH 1CXEA 4RGOL 4O5LL 3W11C 4DTGH 3STBA 2J6EH 3HI6H 5DO2C 4BZ1H 4NJAH 3QDJD 4UDTB 4S1RH 4TUJA 5T3ZE 5EUKA 3S88L 4NM8H 4P4KA 5IG7B 4Z7WE 1PSKL 3FO2A 1WITA 4N0UE 3FQUB 3GNMH 4X4ME 3LPWA 2APXA 3WN5C 2H1PH 3S3JA 3CX2A 5E8NB 4RQQB 3W9EA 3EBAA 2BP3A 2HVKB 3VXRE 3HC0B 4GMTH 3R1GL 1FGVH 4EDWH 3L7EB 1AP2A 4NNYA 1MJ8L 3EDKA 1I1AD 1ZGLP 1G7LB 1I8IB 2R29H 2R39A 2GCYB 3GSXA 4Q9RH 1YJDC 4NKDB 4BZYA 4QWWC 1A9EB 5JW4M 1MNUL 3WBDA 4KUZL 3MOBL 3HZKB 5TJWK 3OL2A 3MNZB 3ARDD 4XAWH 1B88A 4Z7WB 5IHBA 2EDYA 3MJ7B 5T3XD 4N0UB 3P9MA 4ODHL 1CDHA 3BZEA 5DURD 5IMMA 1FZMB 1KG0B 4GRLD 4Y89A 1DBML 4FQIH 5IB4A 2XWTB 1MRDL 4JM2D 4KQ4H 3VXRB 4IOSD 3K4DA 4OCRL 2NY4C 4WW2F 1KB9J 2CUIA 1QR4A 3RVVD 1WBZB 1MFEL 4QRTA 4DJMA 2Z31B 4MNQD 2CSPA 1C5BL 5F9JA 2QQKL 1BZ9A 1NSNL 1RHHA 2HH0L 2YBRA 4UV4L 2W9EL 4S1DD 3IAGC 3RUGA 1CVRA 2JELH 5BW7C 3DVIA 4WI7A 4U6HA 1R3KA 2C5DC 2FHFA 3MRBA 1GSMA 4Y19E 3ZHLA 3H0TA 5CJQL 4YR6B 4E0RA 3CIQA 4ERSH 2YA0A 2R4SL 1JTOA 1QSED 4KKAC 3MRKA 1Z9SA 4JPIA 4WFFE 3GI9L 1I1FB 4X7TA 3I75A 5KOMC 2RAMA 3T0VA 1QTYT 4MHHI 3MGTB 4GW1B 1HHHA 1UM6L 4TSAL 1MPAL 4NRYA 1O7SA 2O5XH 4O02L 1A6VH 2BOBB 2M1KA 5IMOA 2DJSA 5F70A 2Z8VC 1LK2B 3G5XA 4DGIH 1G9ML 5JOFA 2IH1A 5BXFB 2A83B 3FO0L 2X05A 4PLJC 1V5JA 2ZOLB 2H2SC 3AB0B 2J88H 2X6MA 5CMAB 3Q5YA 3P9LB 1BOYA 3C8HA 2AV7B 3KLSA 3QIWD 1WZLA 3QH3A 4Y19B 3GFUA 4N0YH 1X7QA 1K85A 2O26U 4HS3A 4UNTA 3NFNA 3QQ9D 1D5MB 1QBBA 1F4XH 1CD8A 3NCJH 5HYQA 1A6PA 5E00B 4FMKA 4KK9D 5I8KH 4FFZH 5B3JE 3MMEB 4GQ9H 4NGHH 5CBEB 5FM5O 1GRWA 4M43L 5IESH 1PYWB 4GAYB 3GMNB 3HB3D 1KOAA 1MEXH 3HUJA 5F7NC 5MEPB 4MQXC 3RZCD 3FT4A 4NN7C 4JZNA 5FYJD 1ZVSB 3GMPB 1R0AH 4U49A 2GSIB 4U1LA 1CE1L 4UAOB 2AJSH 4XX1G 3VFSA 2ATPA 5IKCB 5ICYB 5DMGC 5GGUB 4XMKH 1QSVA 1GL4B 1F2QA 2AJYH 2NX5A 3QEQE 3H3KA 1XIWD 4ZG1A 3VGBA 1ONQB 1X5GA 1IC5L 4X98A 4U1GB 2QSTA 1OD7A 5E9DD 4WW2B 2ICES 2D2OA 2FATL 2VTFA 5JORB 5CZXC 1RZFH 4HGWA 1BX2B 3QDME 4PD4K 2FZ3A 3DIFA 3JWDC 1OB1B 3DUHA 3KLHD 1QG3A 2A6DA 3K0WA 1Z9OA 5CEZD 4GO6B 4LNRB 3WFEL 4LK4A 2I27N 3ECBA 3O2DL 3O8XA 4IDJL 4I0PD 3VXSA 1LK3L 3BPLB 3EGSA 4XNUL 2B4CH 4IJ3C 1VESA 2JF1A 4JZJA 4FXGB 5EU3A 5E08L 3E6HB 3QEQB 2HKHH 1I9EA 4MDIB 5GS2D 4OFKA 5I18L 3SDXE 15C8H 3U0TA 1XGUB 5D1ZD 4G9FA 1RY7B 4G8GA 4DAGL 5L2JA 3LN4A 4GW4A 4R8WH 2R1XA 2W92A 1XGTA 4LEOA 4FQQB 4KJYB 5K9KA 5K9OB 3QDMB 1LO4L 4JFYA 2WIMA 5BO1H 2VLLA 5DMKA 2P8PA 2RJMA 5JXEA 1IFHL 4NBZB 2ZNWA 1IT9L 3LQAL 3C2SA 2VR5A 3SJVD 1XH3B 2PXYC 4OQTA 1KJ2H 5KANI 2WANA 4GKNA 5F7EL 4NCC2 4HHAA 1HINL 5C0BE 3PP3H 2VITA 5TPWL 3ES6B 3SDXB 2VLRA 3IFOB 4JLRA 5EZOH 5ANME 4DQOL 3SOBH 6FABL 5I6XC 4BZ2L 4PJDF 1U8MA 4HF5L 5D2NC 5GS0L 3WUZA 3WEXB 1IAIH 2FCBA 5IWLC 2FL5A 5DJAA 5ETUB 3MCKA 3GSRA 3U46A 5JR1L 2BSRB 5JA9A 5CBAB 2X44D 1G1YA 1T1YA 4F2MA 5C0RH 1FFNB 2AV1A 2E8YA 1KEGH 4PJ5D 4Y4KA 5HGBA 2A77H 3MLSH 1M7XA 3RDTC 1GJIA 3W2DH 4HZLA 1QRNE 1MSPA 4OZFB 4PREB 4JDZA 5C0BB 5DD1L 2Z92B 4FQHA 1HOCA 3TNNA 1S7TB 3VDBA 3ZO0A 4ODXB 3R8BB 5IB2A 4FXKB 4ZS7L 5AYQA 5ANMB 5GJSH 3BPCB 1AXSA 3UO1H 4XNMB 1BEYH 5IB5B 2IADB 3EFFB 1QLEL 2CD0A 2HFFB 4AY0A 1OTSC 3TH3T 3JV6A 1DQLL 2O93L 3U7AA 1A6TA 1MRCL 4ELKB 1I9RH 4PGDB 5IGXH 4XP5H 5I9QB 4P4RA 5L7XH 2EIEA 2VXQH 1IC4L 1N6QH 2Z8WC 5K9JH 5DTFA 3GBLA 4C55A 4P4KC 1KLFA 1QRNB 3S9DB 5D93B 2OJZH 1UENA 1CR9L 4X9GA 5K33A 5T1MA 5L2KA 1S7WB 1FC1A 4M5ZH 5EO1A 4JANA 2AJ3B 5DZOA 1W0WB 3RWDB 4JJ5A 1I7TB 4UMGA 3B9EA 1T5WA 2HTKD 3C09C 1KIPA 4R7NB 1ZLVK 3TO2A 1G0YR 1IEAA 3Q3GB 3ZKSD 5E99L 2HWZL 2W91A 3GJFB 5E03A 3VFNA 4OI7A 1EO8L 1DFBL 1PBYA 1Z0MA 4EIGB 1OP3K 1A6WL 3GBNL 2DB8A 3TO4B 3ZKXB 2NNAA 1Q9LB 1VFAA 4F15C 4G6AC 3Q1SH 5KN5B 3S4SA 2NY3D 3CVHH 3NPZB 4HCRH 3VDAA 2J6EA 2BSTA 1RJLA 3MRNB 3D48R 3HG1D 3P2TA 1KXQE 3EOAA 1D5XB 5DMIL 3GIVB 2FX9H 2IQAA 1BVZA 2V5TA 1BZ7B 2R0KH 4HBCL 3REWB 3MXVL 4M8QA 5C09E 3QUZA 4MCZB 4CU6A 3QHZL 4KXZH 5HHME 1U8HA 3MA9H 3H9SA 1BF8A 1NUDA 4ETQB 3U79A 7CGTA 3DSFL 4Y4HD 5DRXB 4UB0H 4MA3A 4ZYKA 4LLDA 3TVMD 3OKKB 2VDML 1P7KB 3P30L 5JDSB 2JB6B 4N5UA 2OTPA 5HTSA 1CXLA 3IU4L 4NN6B 4UILH 3T0WA 4Z78B 5FYLD 4JQVA 3KPSD 3MOQA 2Y07L 3IXAA 4P2RD 1P4IL 4J8RB 4NZUH 4H8WL 4LDOB 5C2BH 1MCFA 3KYOA 3MRDA 1NAKH 3SCMD 5B21A 1OAQL 2XN9D 5DWUH 4G43A 3WLBA 4WI8A 4NWUL 1A3LH 4P46A 2VZOA 3UYRL 5C09B 2FRGP 1Q9WB 1Z5LB 4U0QB 3IDMB 4IBLT 2LTQC 1FYTA 4PJHF 4Z0BH 4QGTA 5DJ2A 3H3PH 5GZOC 4HLJA 4JFDE 2DI8A 3PHQB 3L3HA 1NFDE 2QQNL 1ORSB 2DDQL 4KRPC 3O6FA 2Q8BH 3V9FA 2GAZB 3OBAA 2V17H 1ZT1B 4KK5D 3IDNA 1HXYA 4D9RE 1BVLA 1XF3B 1P69B 5L88L 4H26B 4AIZB 5LQBL 1KN4H 3MBXH 3LRSA 3FHAA 3ULUD 3DLQR 3GK8H 4Y5VB 3D2UD 5INCA 5E2UL 1P7QA 4RIRA 3JXAA 1QLFA 4LAQH 1E6OL 3WFHB 3KPMA 1QACA 3G5YB 2WWKO 4YHKL 4HH8A 5KAQG 5DUMH 1J1PH 3PWVA 4NRXA 3CLFH 4ZFZB 2FYYA 4JFDB 4IOFC 4L29B 4LKCA 4UIMA 1NFDB 3VFMA 3A0OA 1DL7H 4MNHA 5ICZA 4QXWA 3C60D 3ESUF 3QEUA 4U1KB 5A43C 4LOUC 1RZ8B 3IDUA 4OKDA 4OCWL 4ZUVB 2CMRL 3PJSB 2R2HB 4N5ED 3DGGA 3H9ZA 4UNVA 3KPLA 1PFCA 3WIHL 5EOQH 4ZTPH 1ACYL 1LE5B 2ADIA 3LN5B 3HE6A 3I85A 3IDYB 2GY7B 1GYAA 3E8UH 3GUTA 4K3DH 3DXAE 1HH9B 4J4PA 4O2FA 1PG7H 2OTUA 4C56D 1BIHA 3K74B 2H2PD 4W6YB 2YOCA 3SQOH 3NAAH 1AI1L 4NWTL 1MJUL 1XF2A 5IHZA 3ZT7A 4JPKH 1YQVL 4OCYL 3RL1A 4RX4A 4A6YL 4YZFF 1ZHBA 5J7CC 3P0GB 4KKCC 2J5LB 2WUCL 3HE7D 1BD2D 3WUWG 3WS3A 1RIHH 3O8XC 1TETH 3ILPA 1ZT7A 4APQB 3DROB 2F58H 4KU1A 4RAVB 4K7PH 4WWKA 5BVJA 5EZJA 4Z7UF 5DQ9B 5DT1L 2FEDD 2XICA 4JZJC 1JYVA 2IPUG 4PB0L 2R0ZH 1SEQH 1VFOA 3MRRA 3I02B 5D5MF 1D6VL 2BNRE 4MJIA 1A9BA 2H26B 3DXAB 4LCWA 4N90D 4FHBD 1SVZA 5DJZA 4Z7QF 4LBEB 3T77B 4M1DL 5J06A 3LKSA 3BUYB 3UBXG 1F3JA 2NY0B 3UAJD 5IVXF 4ONOA 3QBTB 1XGYL 5JXEC 2VXUL 3TBWA 1AIFB 2X89D 3TFKC 4XNZC 2FX8H 5CHNA 5LGJA 2VMFA 1TITA 4HS8L 2JK5A 3BEWB 1EA9C 1UKSA 3ARXA 2KH2B 3F5WA 1BIIA 2O61B 3PDDA 4RMVA 1I7UA 2LFGA 5MEOA 4L1HA 1YEJH 5E8PB 4JPVH 2V9QA 4Q97A 4RAHA 3QG6B 4BA8A 5KSAB 4LIQL 1YN6A 1QVOB 4GKSA 2VDLH 2F53A 4XVJH 3MNWA 1AFVH 3F6IA 5H37G 3DMMA 4ZFGH 4Z7VE 1WTLA 3RI5F 5ESQB 4YZFE 5F44A 3HR5B 1R5WB 1YEFL 1CICD 4WO4B 5I1KL 1RHFA 2YC1B 4HW6A 5CEXA 5JHDD 3G5ZA 4U0RB 3QUYB 5C7XL 3GGWA 5I8CB 4Y4KC 3VJ6B 1FJ1A 1LILA 4ODVH 4QRSA 2WBJB 5DD0H 3K80A 5KVGL 5KTEH 5D5ME 1RZIB 1T20B 3FZUD 3PP4H 1KJ2A 5FOBA 1SBBA 1BBDH 4X6CA 1FH5L 1UKTA 3Q6GH 4YDKH 3C5ZA 2AEPL 2DTMH 4Q74A 3L5IA 3UTTD 1UADC 1SJHA 1CT8B 1HQRB 5DZLA 3L3GA 5IVXE 5C0DB 4Z7VB 5I0DA 3GM8A 2K9UA 2QHRH 2ERJB 3TBSB 3TT3L 3W39A 2AXGA 1MAKA 3OG6B 4XGZA 2JJUA 3W11D 2FX7H 5DFVC 1QNZL 4X80L 5EC1A 3MLRH 1A8JH 1Q1JH 3QA3A 4ODWB 5DO2D 3T4YA 1GGBH 1FP5A 1X4XA 3KYMB 3RVWC 4NQDD 2VLKD 5HGDB 2VZSA 5D5MB 4X4YB 5J11B 1PJ9A 3EYVA 1QSFA 4OZIB 4UT9L 4YHYC 1E6JL 1UACH 3U6RA 4YDJA 3KPQA 5GZNC 3L3IA 2QLVB 1GZPA 1NMBL 3RPIB 1DQJB 2D4FA 4NZRL 1F6LL 3PWPA 2HMIC 1RPQA 4M61A 3RA7L 1NCCL 5CGTA 3BXNA 2NPLX 1BAFL 5IVXB 1U41A 1JUFB 2EDDA 3L5WA 2XA3A 3M8OL 5FEBA 1UKQA 4OLYH 4CMHC 1T1WA 3CFDB 4PJBA 3S35X 4JHBA 5FHAH 3G6AB 3C08H 3BO8B 4QWWD 2HJLA 4XP9L 3UJJL 3RWIA 4J1UB 1ZSDA 2XY1A 2XTLA 4XVSH 1ND0B 3LKOA 5HXMA 1FCCA 4Q58C 2K7QA 4I3SL 3S35L 1ZA6B 4OTXH 4NQED 2CIIA 4HWEL 2APVA 5I30L 3V0VA 1RK1B 3SE8L 3SHSA 3JWOH 4PRPD 4DK3A 4ZUTA 4D0BA 2P5EA 2Y4SA 4G8IA 4EKXA 4HWBH 3MPCA 3FMGL 2R8SL 5FYKD 3CSBA 4EDXB 3QUZC 2QJDA 4JFFA 1OQXA 1DANU 2BC4A 4JPWL 4K9EL 4KVNH 4PRHD 5DUBB 4LRNH 4L3ED 1XZ0A 5I17A 2NY4D 1DLFL 2DQEL 4CRPA 1R3LA 1KTLB 2FJFA 5F3BB 4NC1C 3S3SA 1P53A 4PJFA 1JNJA 1Q72H 2QSCL 3GM0A 4KZDL 1CLOH 2CXGA 1LE9B 3H6JA 4PTTA 2GSGA 3I84A 3KWWA 3GRWL 1H3WM 4YGVB 1HKLH 4JQVC 4YIQA 1TCRB 1MCOL 4PJ7F 2WINB 4LSUL 3AREA 4YWGL 2UUDH 2Y23A 4P5MA 1Y6KR 3BVNB 3CVHA 1E27B 1S5HB 1H5BB 2R4RL 5C0GB 2I26N 4MAUL 5B8CA 1I9JL 4XPAH 4XCFL 2A1WL 5EU6A 2VDPH 1OHQA 2R69H 1RUKL 9CGTA 4GG6F 4MVBC 4IOIB 1A7OH 4N1HB 1WC7A 4GXUM 2ADFL 2VDRH 4OCXH 3I3DA 1S9XA 4XNXH 4XT1C 3IDJA 2AK1H 3PDGA 4NHCL 1LO0H 4OJFL 2YXFA 3VFUA 1MCBA 4E5XA 4MJ2A 3O6FC 5CUSH 1RZJL 3UEZA 4CN6A 1LEKA 1N0XL 5FA3B 5AAWA 3ARUA 2H2SD 1XT5A 3EIFA 3OV6A 1RU9L 2VN7A 1ZLWH 3DYOA 1WZKA 1K2DA 3BW9B 5CKAA 3NABL 5IR1B 1ZKAA 3V4UH 1NLBH 5BMFL 1WISA 3DX6B 4ZNCD 1EFXD 1RJCA 2V2WB 3KYNB 4C4KO 1QFUH 2G60L 1M7DA 1MF2L 3MRQA 3BQUB 3OR6B 1R3IL 5E4IA 4MYWB 2C3VA 1FO0L 5GGRB 1QR1B 5F71A 1SM3H 5FECB 3QCVH 4U2ZA 5KVMC 3S6CA 4XH2A 1HCFX 5FYJU 1CGVA 4FP8H 4R90L 2FNBA 2W0FB 4FQ1L 1IGJA 3L5XH 5AD0A 4WW1B 2VXSH 1FAIH 4NQCD 4MQXD 5D70H 5SWZD 2Q1EA 5BV7L 3L3DA 3OX8A 4P3WA 4DW2H 5M7QA 4O4YL 2GJ6B 4PJ7E 3HC3H 2CO6B 4JDTH 4YDIL 1HDMB 4XMLH 1BJ1J 4PGBB 4LQFH 3D18B 3BGMB 3FAXA 3ARTA 1U8PB 5DMGD 4UNUA 4D0CB 5GRYA 4ZPTB 3HNSL 5JW4Q 4RZCB 3B8SA 3HE6C 5SWSD 3FTGA 1INQB 3IJYB 2ZUYA 5HY9B 1UC6A 1XR9B 5J1AA 4GG6E 4J4PC 5MHSE 4GBXB 5DQJA 1F8TL 2BNQD 4K8RH 4LLQB 5AAMA 3PGFL 3LS4L 4TYUA 1LNUA 5F9OH 4PY7B 3NN8B 5J1SC 1Q9KB 4JREB 3CFKB 2Y06H 1JF6A 3MLWH 5GSVB 1XCQB 2YPVH 3QEHB 5CSZB 1U93B 2VKXA 3LRGA 2BMKA 4OZGF 4WWKC 4CW1A 5AWNH 4LU5L 3D9AH 1OM3L 1X4ZA 4LL9A 3VWKB 2R56L 4HPYL 4WUKH 4PLKC 3CPLB 3RGVA 1II4E 4GG6B 4JO1L 4NKMB 2EIZB 1WWAX 4HMDA 5BV7B 1JZ3A 4OCLC 3OZ9L 4ZD3H 3MLPA 3NH7L 4D8PB 3ROOA 2D4DA 2GIYA 3ELAT 1AGDA 1NEZA 1C8PA 1AH1A 4NCDA 2Z35A 1IGML 2F74A 1J7VR 1OAUH 4QTIL 5GXBB 1XGPB 4QT5A 1YECL 3BWAB 1FNGB 2DLHA 2HLFC 3FQTB 2B4CC 5D1QB 4ZAKD 5A2JH 2OR9L 2QTEA 1U8JB 4G6KH 5DHYA 4F7TA 2ZG1A 1VGEL 1YY8B 1LO3L 4OAWA 3UC0H 2SEBA 1OGTB 4ONHA 4LGRB 2OL3B 1RULH 2V2TB 4MCYB 2CPCA 5IQ9B 4PJ9C 2EIDA 3QZWA 4OZGE 3X17A 1OLZA 3MLZL 4EBQL 2X2YA 2BDNL 1P4LB 3C5SB 3Q5TA 4FTVA 4WWID 3V0WL 1S9YA 3RDTD 4JFED 4TUKH 2VWEC 1R24B 3JV4B 1GAFL 1O5DT 5FKAB 1A7BA 2I5YH 2NZ9C 3O3UN 2JIXD 4BFEA 5IJVB 3SGEI 2XNAA 1CLZL 4YUEH 4MAYD 4JR9H 3VU2A 1RJZA 3OGOE 4RFNB 3H7LA 1XF4B 2PR4L 1WFTA 1BOGB 3C5ZC 4DZBA 3NCFB 1KEMH 2XYCA 5IP4A 5D7LD 5E7FA 2EE9A 5IVZA 5ENWB 3MJ9L 5F96H 1BFOB 2VQTA 5CJ8A 4OM0L 4O9HL 2UWEE 3F7VB 3IJHB 4OZGB 3NIDF 4XRCA 1MH5A 5F8RC 3SKMA 5BCAA 2DQHL 1F6FB 5HHNA 4J3WA 1IARB 2O5ZL 4P4KD 4XAKD 1IQWL 3IETB 4NKIH 3BH9A 1SJEB 4YO0B 3ULSB 1PAMA 1EO5A 5JO5B 5JW3H 3QI9B 2W9LA 3GSNB 1DQDL 4KDWA 3U7YL 4X8JB 3PDOB 3PWUA 2N56A 5DJYA 1G9EA 5D72L 1JYWA 1JPSL 4PV8B 3BUTA 3OKYA 3ROLA 5JXAH 4JFXB 1M05B 5IF0B 2FD6H 2ZCLH 2QQQA 4G7VL 3RWCA 3MQIA 1KCVL 1UA6H 2UWEB 2ITCA 4PR5A 3SDDB 4EUPG 4TQEH 1K8IA 1QZ1A 3R0NA 1DSFH 1B4JH 3B5HA 3V6BR 4G6AD 1FNEB 4Y0GA 1YN7A 1PEWA 3RWJA 2MPAH 3QRGH 5TFSH 3IFPB 5EBMA 2ORBL 2D7OA 3FQNA 3IKKA 1H3UA 1HSBB 4JM2F 4KMTH 5TQ2H 3NCMA 4URTB 1ZEAL 2MKWA 1SBSL 3CX5K 3VMOA 1R3JB 1UM4L 5BZWB 5C92A 3LIZL 4RMQA 2R2BB 5GIRB 3VCLA 4LVNC 3QO1B 5I15H 1REIA 4GS7C 5DJ6A 4KTYA 3FONB 4OZHA 4UBDD 3CH1A 2R9HC 2F8OA 1FZOB 2FIKB 4Q6IA 4O2CB 3RWFA 5J1TC 3P9WB 5DD3H 4Q9QL 2X4UB 4G42B 4LGSB 5CZVL 1OAXL 2ADGB 1MAMH 3EO0A 4EN3A 3CDCA 3AREC 1CIDA 5CGYC 3MV8A 3TC9A 5C0JA 1BQSA 1IRAY 4Y8DC 3G5VB 5HYEA 5CSGA 5DI8B 2Q76A 5B8CC 1DLHB 1CXFA 2ICWI 2YD5A 2R0LL 4JHWH 5L6YH 2NY2B 3UTQB 3V5HB 5T5FH 1L7TH 3VFWA 4ZO6A 1KN2L 1EV2E 1GIGL 1HIMH 3MRLB 4HGMA 1N6VA 3T2NL 3L95B 3BN9C 5GZOD 4HWBA 5HHPA 2BY1A 2I07A 1KIUA 4L1DA 4HG4K 1GGIL 2ZWLT 3MCLL 4KRPD 5HHOA 4PJHA 4DKFH 4PYGA 5F1NB 2X4PB 1X4YA 2F54A 2JB5L 5FO7A 3O6LH 1JN6B 3G08A 3KPTA 3NOIA 2GQHA 2QSVA 4V1DA 4XMPH 4LSQH 1T5XB 4OCSL 3V5DB 5MEQB 1QA9B 5HVWA 4MNQE 1F97A 2P4AB 3TBVA 2HG5B 5L9DL 1P6AB 3WSQL 4G7YH 3ARDB 3H7BB 4FG6C 2P47B 4PRNA 3MJ8B 5C6WH 5EA0H 4WGWB 1J5OL 3IFNH 4RRPA 4XC1L 1CTOA 2PCPB 2CDEA 4PG2A 4YHNA 4NO3A 3TIEA 1QSEE 4TUOB 4RBPH 4S1QL 5DURB 1NL0H 4GKZA 4JQIH 5GRXG 1RZGA 2PTTA 3I2CL 4MZ3A 5EIVA 1OTTC 4JM2B 4LOUD 1CU4H 4NHUB 5GGQH 2IGFH 1TZHA 3HAEH 5IBTH 3S96B 1WAAA 4TVPL 1FGNH 4ZUSB 3LKPB 4IRJA 2NX5D 4MNQB 1FFRA 3MACL 5ALCH 3BZFB 1WCQA 2JCCE 4OIIH 3WNMA 1A7QH 3V6ZA 3H9HB 3O45A 3GHBL 1FL6A 3OKLB 3KJ6L 1ZHLA 3DYMA 4CN4A 2W65B 5C08A 5JMRA 1QSEB 3I6GA 2FH6A 3VD3A 1IAKA 4U6XB 3BT2L 1WFNA 1AKJD 3OKOA 4KKBD 4E42B 5D7JD 4KKCD 4M6ML 4L3AA 2NTSP 4OQ1A 3VXSD 1WICA 1B90A 4G8FB 5JIPA 1UWEH 4XBEH 3WJJA 3IJSA 5DJ0A 5SX5K 4MJ5B 3B5GA 1T4KA 3QQ3B 1TQBC 1TCMA 1N59A 5TH2B 1MWAL 4PB9H 1ITBB 1QQDB 3RGVC 3U36A 3FQXA 1NGPH 2A74A 4MB4A 2JCCB 3BDBA 4Z95L 1RIVH 4Z7UA 5D6CA 1A3QA 3CDGB 3RVTC 1U95B 1Z2KA 2GT9B 2VISB 2XWJA 4KJQC 3VXOA 4N8VB 1TDQA 3L6FA 1UWXK 4KPHL 5DQDL 3LEXB 3HC4H 2CLZA 5JXED 1EK3A 3B6SA 1JHKH 5E9DE 3TFKD 1S9KC 4PRBA 5DF0A 2C7UB 3MUY1 4OB5L 2FJHB 1A5FL 3BWUC 5EC2B 2AP2A 1FORH 5CEZE 4U1HB 2VLRD 2DBLL 3CXDH 3BSZH 5DUPL 1RJYA 5C1MB 1XAUA 4JY5L 1ZHNB 3VXMA 4ACPA 2EEBA 2JJVA 3CFJB 5HHVH 1IBGL 3MLVL 3MLXH 3PIQB 3NFPA 2CH8A 1L6XA 3D0VB 2CDFA 1FFPA 2YXMA 3MRJA 4OFYA 4RMSA 2ZUQB 3B2VL 4R96B 2A6JA 4KRLB 1T1XB 3MYJB 3T65A 3TV3H 2DL9A 1U8KA 4CADA 1KPUA 5E9DB 2AGJL 4XXCA 5CWSB 4Y4KD 1BZQK 5B38B 3R06B 3FOMA 3WYRA 5C9JA 1AGFA 4XHJC 5IBUB 3KYKL 3ULVL 3BI9X 3S88H 3QQ4B 1MAJA 3OKDB 3UXFA 1H0DB 3WO4B 3BP5A 1WQVT 3LZFL 5F7KC 1BGXL 4NKOA 4M1GL 43CAB 4GG8B 3GMMA 2IAMA 2DM7A 5IV2B 3DPBA 5JIKA 1JFQL 2OMBA 2Y7QA 1MIEH 1GGYA 2IG2H 1BQHG 1UZ8A 3V52L 1U8QA 4GRMB 1JI2A 1N2RB 1K5NB 3KS0J 1UEYA 4P49A 5DVOA 3R1GH 5EO0A 4NQXA 4K3GA 4JFQA 5T3XH 1YEDB 1DTUA 5DHXB 5DJXA 5DFVD 4HFWB 5GGTL 1YDPA 2VQUA 3U4EB 1NC2B 1MNUH 4BH8A 4BM7A 4U6VL 1X9QA 3OXSA 1G7MA 4KUZH 4W81A 3MOBH 5L2KD 3DWTA 3VFPA 1M7IA 4N9OB 4P2YA 2ZOKA 5I1GH 2HFTA 5HPMA 2FH8A 3EO1B 5F7DB 2XPGB 5GZND 4PJ5E 2KUTA 4TRPL 4ODHH 5MP6L 2HMID 5FUZL 1DBMH 1PKQA 3QWRA 3RNKA 3C9NA 5K59F 1MRDH 2KKQA 4LKXB 4R0LB 5D4QA 4NNXA 1V7NL 4OCRH 1A6ZB 3BJLA 5EZLA 4NSKB 2ADJA 4PS4L 5F6HI 4POUB 5I16A 3X13A 3DV6A 3DURA 2QQKH 5LAXB 1GPOL 4UV4H 1U58B 2W9EH 5INDB 3UTZB 4JY4B 1Q9OA 5FYKU 1DUZB 1KIQB 3LCYA 4Z77B 3C6SA 4ZUUB 4U1SB 5CJQH 1ZWIA 1A14L 2J8UF 4ZXBB 4L8CA 1W2KT 4PJ5B 3D0LA 4OF7A 5KOVC 1I1CA 4WHYG 5D2LE 3MLYH 1DEEB 5DEGA 3SGJA 2VZUA 4PJIF 3QUZD 2YK1L 3O81A 3TNMA 1NDMA 1CCZA 3H9SD 1UM6H 4TSAH 1MPAH 3KPNB 3RTQA 4Q6IC 1HXMB 4M7KL 2DAVA 4HAFA 1FPTL 3FAWA 4RGMC 3D5OF 4PRAA 1AGCB 5JQHC 3QXDA 1YMMA 2G9HA 4EN3C 3M1BA 2BVEA 4ORZC 1UXSA 3K2UL 3W0WD 3C5JB 4MXQC 4M7JL 4LRIA 2AABL 2C3HA 4JRYA 4U1NA 5CINL 1Q0YL 1OAYL 4P46D 4M1CC 5D2LB 4AK1A 1KT2B 1A1NB 5IFJA 3NBNA 5K59E 1FYTD 3AAZA 3JWOC 4MVBD 3HNVH 3EDEA 1X5FA 4QXGL 1T2JA 4QCIB 3HG1E 2PNDA 4JGJA 4M43H 5D9SB 4HEME 1M6OB 3VDCA 3ULUF 4H25A 3DVNA 3O6FD 1DE4B 3I6KA 4WIQA 1B0GB 4ORGA 5EU5A 1YMHB 1T21B 3K8LA 4QGYA 1SYVA 2A0LD 4QXUH 3UJTL 1JWMB 2RHEA 2NXYC 1ORQB 1ZANL 4AIOA 3EFDL 1BVKB 4ZSOE 5HVHB 4YHZL 2J8UE 1WBYA 4YNYB 5D7SL 5CJ5A 4XTRD 3U30B 5B39A 5E8DH 3QAZC 2NY3B 3NACL 4OGXH 4PJIE 1I4FB 3HN3A 4N0FA 3MRHA 1G6RL 3KPSE 5ICXB 4P2RE 3MNVA 1UCTA 3RIAK 2YRLA 3IDGB 3HG1B 4FOMA 4PG2C 1CE6B 2FATH 2WIIA 3QJHB 2EDOA 2XN9E 3MR9A 4YPGB 3BIAX 4HK0B 4JY6B 3WHE0 1BQHA 2AERT 4TVSa 2X9YA 1KBGH 5GS2H 1JMXA 3UBXI 5DXWA 4HGKC 3PHSA 3GB7A 1OAZL 1G7IB 5FO8A 3S5LB 4ZSOB 3O2DH 4OV6F 1MUJB 1LK3H 4IRJC 4NDMA 2J8UB 3LKQA 12E8H 4XNUH 3B9KA 4X7FC 1F90H 3FQWA 3HE6D 3TVMB 4WI2A 1S8DA 1B6UA 1WEJH 4HUVA 3O2WL 4PJIB 4J4PD 4I13B 5I18H 3KPSB 1RUAL 5AZEL 4P2RB 5F8QC 4OZFH 4DAGH 4LLWB 1LP9E 2EH8L 1UJ3B 4MDJB 3CUPB 4O58L 3H42L 2XN9B 5GPRA 3VWJA 2V7NA 4MXWL 3RBSA 1LO4H 4RX4D 2P1YA 4RAUB 1DQQB 4UUJB 1MLBB 3JUZA 1UCBH 5BJTA 4OBRA 3ABZA 3RNQA 2H45A 2I9LB 4F8TA 1IFHH 3WJJC 4YDVB 3LQAH 4WWKD 3TPUA 1OQOA 2EE2A 1C16A 4FQJL 3SKNA 1QYGL 3VXQB 3B3IB 3GI8L 4K3EL 4PLKD 5F7EH 5T1KA 1UB6A 4MJID 1HINH 3HAEA 5DA0B 4LCWD 3HFML 1QPXA 5EWIL 4C83A 1D5BB 3G9VA 1OPGL 3S97C 2W59A 4PBWD 1LP9B 4DQOH 6FABH 4N0CD 4QLRA 3UTSA 4BZ2H 4TOYL 4OFVA 2LVEA 1IM3A 4D0DB 2RFXA 3SY0B 3MCG1 4JN2B 2RR3A 4QRPA 1FRGL 4X83A 4FZ8L 3V5KA 5JR1H 2D7NA 4K8RC 4C56E 4I5BB 1MJJB 3KR3L 1UH3A 3QQNA 1EAPA 4RFEA 1PQZB 3LN9A 4XVUC 1AHWB 2EZ0D 2XZAL 2BY2A 1FNAA 1ZAGA 1OSZB 3BESR 3LQMA 1QO3B 1NGWB 1WBXA 3KDMA 3C60B 3PNWB 4R4BB 3EYUL 3NTCH 5DD1H 2FB4L 5E1HB 1MHHA 4ZS7H 2EC9T 3FCTA 1F3RB 5JPNA 4J23A 1I1RA 2EXWC 4IS6A 2P48B 1CFSB 5D7IA 2ED9A 2F53D 4XCEA 3MUJA 1EJOH 4UDTA 5E2WL 1C5DA 1T03L 3CNKA 3DMMD 4X99B 3ARRA 4IEFB 4KDTA 5E94B 1UG9A 4N90E 4HS6B 1L0XA 4C56B 1NGZA 2VL4A 5EIIA 4XXCC 1CLYL 3MRMB 4XP4L 2YD1A 1MCPL 4M6NL 1IC4H 4H20H 4PTUA 4UV7L 1IGTB 2EKSB 4PLOB 5F7FA 4M62H 2NZ9D 3HC0A 4FQXB 4NUJA 4IHOB 2IPKB 4AG4L 1F13A 5GGVY 3HE7B 4Q0XH 3Q6FB 4X4XA 4HC1L 2IQ9L 3E6FA 4NKDA 2IAMC 3C5ZD 3N9GL 5DEZA 1R5IA 1A9EA 5CD3A 1Z3GL 4I3RH 5IMLB 4UU9B 43C9A 4EXPX 1YEGH 3ARYA 3WDHA 1ED3B 3CCHA 1CVSC 1EO8H 1DFBH 4N0UA 3TH2T 4HKZB 3GBNH 1MCCA 2IBZY 3M07A 4PFEA 4ODTH 3FB6A 2L7JA 1JPTL 4Q9BA 1I1YA 1ACZA 5AG9A 2XWTA 5E1AA 4OZ4B 1QSFD 2X4NB 2BVYA 3KLDA 2XV6B 2W9DL 1KC5L 4I9WD 5JHDE 1J05B 5C0EB 3IGAB 3FT2A 4NBXB 5HYJA 3O41A 4DUXA 2MWCA 1RK0B 5JLZA 5DMIH 3BPOB 3TBYB 5EU4B 5GGSB 4XI5C 1I3VA 5TQ0L 3MV7E 3SGDI 1JNHB 1JRHI 1KGCD 3C6LB 4HK3N 5GISL 5FYLH 3L3JA 4I2XE 4MA8L 5JW4R 1CFQA 4I18A 2IWGA 3P4OA 2OK0L 1TXKA 3DSFH 1S7SB 4G9DA 2WLZA 4P3DB 4OD1L 2CKBL 4L8DA 3UTTE 2AJUH 1I1FA 1JWUA 3P30H 4M00A 4TPRH 1KXVC 4MMZC 4HIIB 3PGCA 4ZNEA 1B9ZA 3IU3B 5C71A 1MIMH 2Y07H 1CFTB 1CXIA 4XCNA 1P4IH 5CLWA 4HUMB 4H8WH 3CFBB 5JHDB 4K55A 4U7MA 2P5ED 2YA1A 1OAQH 1T0NB 4M93B 4R4NC 4NQDE 3KJ4B 4HLZG 4NWUH 3SGJC 3MV7B 2VLKE 1UB5B 1FL5B 3MUZ1 1A1MA 4I2XB 3ARFB 2R9HD 3RTQC 1A4KA 1M71B 1EEUA 1JBJA 4QHNA 3ULUH 1UT9A 2QQNH 4D3CL 1NQBA 3UTTB 3CJJA 3WIFB 4JEGB 5E00A 4AH2B 2EDXA 4C59B 5L88H 4POZC 3U0PA 4LRIC 5LQBH 4OLVL 1D5ZB 3DTXB 2GW5A 1EEZB 3WUWB 4UQ2B 1J11A 5MEPA 1RZKH 2IEPA 1X5XA 5EU6D 3DYPA 4NQDB 3QNXA 4B41A 1E6OH 2ENYA 2MHAA 3K1DA 4NQEE 2GSIA 2DF3A 5HBBA 3BN9D 2P7TB 2CKBB 3WN5B