1QBML

Fab e8b antibody, x-ray structure at 2.37 angstroms resolution
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
214
structure length
214
Chain Sequence
DIQMTQSPASLSASVGETVTITCRASGNIHNYLAWYQQKQGKSPQLLVYNAKTLADGVPSRFSGSGSGTQYSLKINSLQPEDFGSYYCQHFWSTPWTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immunoglobulin
molecule keywords E8B ANTIBODY
publication title Structural basis for the binding of an anti-cytochrome c antibody to its antigen: crystal structures of FabE8-cytochrome c complex to 1.8 A resolution and FabE8 to 2.26 A resolution.
pubmed doi rcsb
total genus 51
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 1998-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1qbmL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1qbmL01
4PJIE 4XC1H 2FIRT 4OT1H 3K4ZA 3VRJB 1GOGA 3OB8A 4DVRL 4JO1H 3U0WH 3SGKC 4QHMA 2X6MA 4ZYKA 4TN9A 2XN9D 5SX4I 4I2XA 4I3GA 3NPZB 5MEPB 1CLZL 4PGCB 1JTPA 2N1KA 1EMTL 5F71A 5JW4R 3M1BB 4N0FB 2J4WL 4Y2DA 7FABL 1VGEH 3MLRL 1KCUL 3C5JA 2BY0A 1FNEA 3MV7D 1MHHA 1CK0H 3VE0A 2GT9A 2XZCH 5BVJB 4ZAKC 2CJUL 3QO1B 5IGXH 3GKWH 4MJ4A 4X7TA 2P42B 1QFWH 3RDTC 3BKJL 4ZFFA 1MEXH 5C92A 3DMMC 1VEOA 4ZFGH 5E2VL 2IQAA 2PO6C 4IRSB 4IBLT 1MCHA 4GLRH 3WBDA 1T2XA 2D2OA 5F9OL 3SKNA 5DFTA 1NSNH 3ARTA 4DGYH 4LRNH 3O6FA 5FYJD 5I76A 2E7CA 3QPXL 4HHAB 5MHSE 4NQEA 3SDXE 5DHYB 1I85C 5CD3A 2Z93B 2EDXA 2EZ0D 4LSVH 5I1IL 3SGDH 3QUZD 2I9LA 1BEYL 3HB3C 1NMCC 4NM4H 1MI5D 4JY6B 5DYOA 1A9EB 3JXAA 4ZO9A 1CZ8L 3T2PA 4XH2A 3SDAD 5IOPB 1JGEA 3T65A 3RA7L 4H1LG 3RTQC 3TBYB 1W2KT 3V4PH 4CN6A 4ORZC 2XWJA 1X5FA 2R1WA 5DFVD 4HMEA 1G9MC 2R69H 4NQSA 4XCFH 3RRQA 4EQ2A 2C7UA 2ZJSH 3P0VH 5LGHH 2LV4A 3C6LC 4JG1L 3PGFH 4OZFG 4F9LC 3W39A 4X4YB 3QXDA 2H26B 2AGJL 1TPXC 5SWQA 1RJZA 1QOKA 4I3RL 5DD0H 3S36L 4MQSB 5HHNB 2D7NA 3K1KC 4OTXL 4M43L 3AREB 5T3XL 3RWJA 3HE6B 5H8DA 4UQ2B 1BIIA 2FL5B 3T0AA 1F3DH 1CD1B 4HT1H 4L8DA 1I7RA 1DVFD 4P3DB 2FEEL 2GJ6D 3NCEB 3BP7A 3HCVB 5I18H 1BVLB 2KUTA 3QWRD 4BQ9A 1EXUB 1AO7A 3H3PL 2PTVA 1RQ5A 2QQKL 1S8DA 1VEPA 1HZHL 4JKKA 5A3ID 1H3XA 4TNVK 4PRAA 4PUBL 1CGUA 4K23L 4C57C 5TE7H 2C4FT 3QEQD 4WFGD 1ZA3A 2VH5H 1A6VL 5JXED 5DHXB 4F15B 2DM4A 3H42H 2G60L 5M94B 2OXGA 1IC7H 3R4DA 1MRCH 5I1GL 3T77A 3L3HB 1VCAA 4Y4FA 4ACPA 1VEMA 2AQ2A 1IM9A 3G5XB 2XZAH 1MCQA 1F8TL 4I0PC 1LO5B 3MGAA 3V6FB 3VG9B 4M6OL 4PGEA 1UZ6F 1UZ8B 2F19H 2CIIB 3DUUA 3W2DH 3WIFB 3BQUB 4HZAA 5FHAL 5FM4A 3AC0A 3I9GH 4PIRF 4YE4H 3HZVB 4K3GA 1KB5B 5D4QA 3RUGA 1T89A 5AD0B 1SJXA 1IT9L 3I3DA 1DEEB 1BFSA 3S37X 3VWJD 5T3XD 4CBPA 2VZ1A 2WBJC 5B39G 1TZHA 1KYOK 4EI5B 4IOFC 1H5BC 4X6CF 3HMWH 2ESVD 5D7LE 1CF8L 1FFQA 1P7KA 1KEGH 3WKML 4S1RL 1M05B 1CG9A 2DM2A 4GT7A 5FCUH 2XOTA 4G8GA 2FIKA 2JCCE 1E4XH 4JDTH 2F54E 1TVBB 3KPRD 3UAJC 1ZHKA 3QA3A 5J11C 5D6DA 4CDGC 4D8PB 1B0GB 3SGKA 3C60D 4L4VA 1BD2E 4PJDA 2DWDA 2P43B 1NAKH 5E03A 2EYRA 4JKPH 5FHBH 4BH8A 1A6AA 1SVCP 5DURB 3U4BH 4FP8H 4LLMA 4APQB 3H9SB 1JRHH 4K3JH 4G43B 2IMMA 4ZUTA 4N9OB 3OKEA 1BECA 2DQFA 1FVCB 2VISA 2VLLB 5E8DH 5GISH 3IKCB 2X4RA 4LHUD 3I6KA 1KPVB 5F96H 1PQZA 2ICWB 4PGBA 3U4EB 1VB9A 3DI2B 1Q94A 3DMMA 5IVXE 4JM2A 4WI5A 3U7YH 3KPTA 4UIMA 5EO0A 4YO0A 5HI3D 5L2KE 1IAMA 1JF6A 2V2TB 3KAAA 1Q9OA 1EV2E 1E4JA 1KCRL 5DDHB 1CLYH 1BP3B 5F44A 3IS0X 2D0FA 3V5KB 3EOTL 5TDPB 4OIAA 4W6XB 1PX3A 4IRJB 4P2CG 3REVB 4HGKC 1KLGA 1AGEA 4YDJA 1OAUL 1UWXK 2IFFH 4P4RA 4KJQD 3EDEA 1I9IH 3A0OA 4V1DA 3W0WD 1YPZF 3OXRA 5T1DH 4HWEL 4WO4D 3RVWD 3SY0A 1AJ7H 5SWSB 1A6WL 1L9NA 3BRGC 3QH3A 5HJ3A 1I9EA 1GZQB 5I1LB 4X98A 4MNGB 3V0VB 2R1XB 5J3HC 3BSZH 3S35H 2OZ4A 5A16B 2XXCB 2P5WA 1O7SA 3ARBC 4OD1L 1RZKH 1QNZL 1BZ7A 4XP5L 3RBSA 4NGHH 1S7UA 5F7UA 2OR9L 5HHVH 4OM0H 4JRXB 5TF1L 1X4ZA 4AL8L 3C6LA 3TA3A 2R8SH 1H8SA 3LKQB 2OL3L 1B4JH 2GW5A 1NDGB 3LQAL 5C86A 2VDNH 4MXWH 5BO1H 4YXLL 3MRCA 3B3IB 3QI9B 2CRYA 4WFHE 1OSZA 3TN0B 3IETB 1GAFL 2CDEB 1JIBA 3V95A 1RK0B 2W60A 3BH9B 4YUEL 1KGCE 5E08H 3D87B 5KSAD 5EOTB 4JCLA 2CO7B 3HFMH 3DBXA 4MJ6A 4G6MH 4MA3B 5IUSA 1AH1A 2UWEA 3HNVH 3LHPH 2QQNH 1T3FA 4YAQB 4B53A 3T1FB 2EDKA 4KKBC 1OTSD 4Y88A 3RVUD 1T04A 1A21A 3KPQB 3OKKA 1Q9KB 4PB0H 4Z0BL 2AJXL 2W65B 3FB5B 3V6ZA 2GFBA 3DUHA 2VRAA 5BS0D 2O5XL 4YQXL 2V5YA 4UOW1 1DBMH 3SPVB 4FNLL 4ODHH 1CGWA 2Y07L 2AI0H 1BAFL 2IADA 3LN9A 3VXSB 4LCWE 3MLWH 4JO2H 3RI5F 1CVRA 3OG6B 3I75B 2ZOKA 1UEMA 3FRPA 2EDEA 3QFJE 5E2UL 2HTKD 1BOGA 2FCBA 1JYXA 5JPMA 4I0PA 1ZHBB 1WWAX 1AGFB 3QIBD 3T04D 5E95B 5GS0C 1RZ7L 3ZL4H 3DV4A 1N3NB 4EUPA 4Z7UF 3DRTB 3ZE0F 2Z35A 4M48L 4NBYB 3U1SL 1F13A 4ZS6D 1HH6B 4DVRH 1PZ5A 3EYFA 2VABB 1KG0A 1HHJA 1S7TB 3UTTD 1T80A 3EYVB 5C6TH 1CLZH 1H5BA 2A1WL 2V2XA 4RFOH 1AHWC 1EMTH 1NFDF 1X5YA 3RWFB 1W0WB 4QTIL 2J4WH 2UZIL 7FABH 1I8IA 2EIDA 1MPAL 1ITBB 4QRRD 1JWMB 3QG6B 1W0VB 3MOBL 1U6AL 2CJUH 4NKIH 4GRWE 4U49A 5T1LA 5C0CB 3CUPB 3UJIH 3BKJH 2NY1B 1BJ8A 1XF3B 4U1LB 5I73B 4KZDL 2ZOLA 3B9KB 4JN1H 1GGIL 1QPPA 2W0FA 3MV8B 3LN5A 5K9KA 3SOBH 1BJMA 3QDJD 3WD5H 2VDQL 2ZCKL 3FFCB 3MRNB 3AS1A 3WHE1 2DYPA 4XAKE 3UP1A 3O6ML 2X09A 1TTFA 2ZCHH 5CINL 2E7LC 1G0YR 4HJGA 4POZD 3KXFD 3ZT7A 3EHBC 2ZNWA 1KIQB 5I1IH 1URLA 1U3HC 3D2UB 2H9GB 1KJVB 2DQUL 1I1AA 2OZ4H 1WFUA 3ROLB 3PGCA 3GJFH 1CZ8H 5IKCA 1F4WL 4MJ5B 3O2VL 3E6FB 3X11B 4MDIB 4MSWB 1P4BH 3RA7H 2D7TL 4P2RD 1LK2A 2GCYA 1Q38A 3TFKC 3WFCL 2H1PH 1K4DA 2ZUQC 5I1DB 4MD5A 4JG1H 3MJ6A 1V3LA 2AGJH 5D2LE 4R4BA 4RBPH 3TNMA 3S36H 4OJFL 5C0AD 4F7MA 5HVHB 4NCDA 4FQLH 4OTXH 4M43H 3OX8A 4NOBA 4O9HH 4AIOA 4IOIA 3ARBA 5AWNL 4M02A 1MCIA 3CXHJ 3GO1H 4OFIA 3TWCH 3BEVA 3KYNA 3V4UL 2I5YL 5CBAA 5D1XC 3GBNL 3FZUD 2R0KH 1A6PA 1D6EB 1LILA 2CKBB 5K59F 4P4KB 3D39B 1SJEB 2WAHA 1DBJL 2XWTA 5GS3A 1NGPL 1NMBH 4X6DF 1IQDB 1TVDA 1MFDL 2VDML 4CN1A 3H9HA 3OGCB 4P5MB 5E94B 2PCPA 3G5YA 1ZA6B 4MA8H 3FQUB 5EBGA 3L3JB 2K1MA 5HBBA 2ADIA 4R3SB 3PWLA 1MWAL 4WJ5A 1D5MB 2G60H 1Z3GL 5FV2A 1XF2B 4NN6B 3NZHH 4PJ7B 5DC4B 3MJ9A 5HGDA 3VJ6A 3VFWA 2V5SA 5D7IA 4EBQL 4HV8B 4KU1A 5EZOL 2QKIB 3OV6A 1AP2A 1MI5B 3B5HA 4JFXA 1CE6A 1HWGB 2AK4D 1S7QB 1E6JL 3D0VB 5EBMA 4JZJB 3PWPD 5FHAH 2FYYA 3BYYA 3DVIA 2EEDA 2ADJB 4PJAE 1JHTA 4OF6A 4LSSL 1IT9H 5EOCH 5C8JA 1HE7A 5EUOF 2EDFA 1D9KD 2EKSA 2MKWA 3ZDYF 3O2DA 4Y5YB 4C83B 1ODAA 1CT8B 1CF8H 3WKMH 5E8NA 5F6IB 4ODWA 5BJTA 4LHJB 3MCG1 1R6VA 2ADFH 3NIFF 3NIGE 1JNHA 3STBA 1UJ3A 1TQCB 2VKWA 4JDVA 1ZVHA 1B0WA 2J88L 3T4YA 1C08A 4P23A 4UDTA 4BKLB 3Q6GH 3CFJA 5AG9A 3ARDA 2GYSA 3AU1A 4IRSC 5FO8A 4KQ4L 1BF8A 3CVHB 4WTXA 1DVFB 4RAVB 2FEDC 3D18A 2ZUUA 5CJQL 3GMMA 3QG7H 3IKKA 4PG2C 2HJKA 1ZK9A 5ABDE 3JWDL 4N1CA 3OB0K 5DMGD 5FDYA 2KKQA 3EFFB 4HSQA 4PRHE 1E27B 2NY6D 4ZFZA 4AM0B 3EJYD 3GM8A 5FK9A 4PLKC 5IVZB 1YEEH 2QSVA 3KPPB 1CVSC 5EUKB 5DUBA 3IXTA 1SQ2N 4WUUD 3TP4A 5AZEH 1KCRH 1ZMYA 2WLZA 1ZTXL 3KDMB 1MJUL 4YHZL 3EOTH 4LAQH 3VFPB 4F37K 4UV7H 1ADQA 2P24A 5JA9A 5ACLA 4NIKB 4XVUC 1Q9WB 5F7MC 2IALA 4R26H 2QV2A 3VD5A 1OAUH 1ORQA 5SV3A 4HK3J 2VNCA 4U3XA 1P7HL 4HWEH 3LS4L 4PR5B 3PWVA 3TEUA 5KS9E 4M9OA 3BZDA 1A6WH 2MNUA 3BDBA 4YDVA 4LLVA 3MA7B 1EO5A 1ZT1B 4WW2B 5HYEA 5IW6A 4F7TA 3UPRB 3HE6C 1ONQA 2IBZY 3PABA 5C7XH 8FABB 4PJGA 1A7OL 4LEOA 1NL0L 4WU7B 1FG9C 4NQCB 5JOPE 1NCWH 4PJHA 1DBKL 4AL8H 1YEHL 5LBSH 3T4AA 2IC2A 3MLUL 3MRMB 2CR3A 1XZ0B 4XNYL 1HSBB 1YQVH 3HPJB 3PWNB 1V05A 3BGMB 1ZOXA 1K8IA 3KPRB 2BRRL 5I2IA 3QHZL 1D5XB 1IGYA 3MR9A 3B5GA 1PY9A 4J4PC 4YUEH 2Z91B 5DZNA 4PJXA 1GGBL 2BRQA 4ZSOA 5GRWA 1I75A 3DWTA 1RPQA 1V7NH 4XPBL 4KK6C 3B6SA 3QUYB 3VFOA 4XP1L 1IEBB 3FHQA 5D1XA 2OXHA 4FFYL 5KSVB 4F15C 4NJAH 4P2QA 1FV1B 3PHQB 2FR4A 2P8MA 4YWGL 2WQRA 3RKPA 3ARFB 3T2NL 4LEXL 3VD7A 2PYFB 1NBZA 4LU5H 4RFEA 2AJXH 5EZIL 4JHZA 3CX2A 3VG9C 1R3IH 1TJGL 3R8QA 2M2DA 3CK0L 3I3EA 1EEUA 4K7PX 3NAAL 2E7HA 4X4XB 5DRZA 3BQUC 3VXTB 3RVTC 1CDUA 2VLRB 5L2JB 1N26A 3DXAD 3KYMA 3O2DH 4J3SA 2FHFA 4GW5B 1T0MB 3PWJA 4EI5C 3B2VL 3FT2B 3AMLA 3W0WB 5IMLB 5GRXG 4LLDB 3M8OH 3O6KL 1WIPA 3CH1A 4WO4B 4M61B 3P9LA 1YEJL 3NTCH 4M48H 3HS0A 4U0RB 1NCDL 4WW1B 1WAAE 5DT1L 2BXZA 4GKOA 3PE9A 4U6HA 1FAIL 5MEPA 3EUUA 4EDXB 3IDMB 3QUXD 4JFOB 4PGCA 3OF6A 1TDQA 3MRDB 5BW7C 4QTIH 3M1BA 4N0FA 4RMSA 2UZIH 2ZWLT 1RULL 1MPAH 3ARGD 4JFFE 4X7EC 3BZ4B 2JELL 5INCB 4IDJL 2NTSP 3MOBH 4WEUD 5BVJA 2MMXA 1N5AB 2NW2B 4R7NB 1DE4B 2AK1H 3UYRL 3VW3L 3KLHC 4P2OD 3TNNB 1FAKT 4KZDH 3C08L 4Z95L 5I8EB 2R4SL 4IRSA 2DQTH 1ADQH 3AS0A 5FUCC 4HHAA 2VDQH 2ZCKH 4FZEH 4NRYA 3E0GA 5DHYA 3NCFB 2BNQB 1XIWA 2Z93A 5CINH 3MA9L 1A4JB 5I1EL 1QRNE 4YHIB 5FAAA 4IRJC 3TJEL 3HE7B 5BS0B 4PRPA 4YHNB 4HIIB 1S9YB 2A6JB 1OP9A 3N1PC 4JY6A 1A9EA 5IB4B 2EE2A 3CH8A 1QBMH 1D3CA 3CDGB 2X41A 3O2VH 5IOPA 3L5XH 4MJIE 4Z7QE 2ED9A 5FV1L 2D03L 3TBYA 3FQRB 5D7JD 2D7TH 4BZ1L 1B6DA 1PEZA 4UNUA 3W82A 1JFQL 3WFCH 2WM0A 1DJSA 4OLUL 4NZRL 1GHFL 1U0QA 2X4NB 1MF2H 3WUZA 4X4YA 1UB5B 2C3HA 2H26A 2OL3B 3SE3C 3SJVE 5JW3H 3VI3E 2PTTB 3D69B 3QISA 4F7EB 3IFNL 5AYQA 1U8IB 3QI9C 4OV5B 3N1GC 5DMKB 3TN0C 3TZVD 3AREA 4MA7H 2B4CL 3IB4A 4JFDE 5AUMA 3HE6A 1JPSL 3MXVL 4UQ2A 1F11B 2FL5A 5T1KD 5JR1H 4OZHB 5J13C 3MMEB 5BQ7B 2YHGA 1GJIA 3DO3A 1CD1A 1CFTB 1CLOL 2I5YH 4Z7WF 3I02A 1VFAB 3KLAB 4P3DA 2IQ9H 3HCVA 2BNRE 1UXSB 3BJLA 3KPSE 4R4FL 1BVLA 4KI5C 4PJ5E 1EXUA 5TH2B 5FYLE 3D1MC 1INQA 2VDMH 4P57B 3GHEL 4GG8B 1JZ2A 1KFAL 2Q1EA 3JV6B 4ODXB 1JI1A 3BP6B 1YC7A 4K3DL 1OSPL 4XMLL 3P4NB 3VU2A 2UYLB 1PKOA 2CMRH 3EDFA 3O9WC 4GUPB 4QYOA 4JQXC 1MWAH 1Z3GH 5DD6B 4H1LB 4Y0GA 4PG9B 3F7RA 5C08B 2NX5B 1NC2B 3L3HA 4YHLL 3G5XA 1S3KH 1LO5A 3V6FA 1NANI 5EZOH 1J0JA 1UZ8A 4OZFB 3JWNC 3E8UH 4S0TD 2CIIA 1E6JH 1QHOA 2IPKB 3NCMA 4WY7H 3WIFA 3BQUA 1NBQA 3RIFF 5BRZE 3HZVA 3ZLQC 4ZO7A 5AD0A 4L9LC 5DQJB 1DEEA 4YIQB 5C07A 4ENEC 4OZGF 3VD9A 4EI5A 4ZO6A 1Z0NA 2YK1L 3FO1B 2Y06H 3O6LH 4S0SD 4GRMB 4HKZB 1X4YA 1M05A 1BREA 3BN3B 3RX5A 1TVBA 3WMSA 3WS6A 3MJ8B 4D8PA 1BD2D 4N5UA 1B0GA 3DJ9A 2NY1C 1V3KA 1OP5K 4RMTA 4OKVB 3B9KC 3P4OB 3GBML 3DX6A 5EZJB 3HRZB 4KJWC 3PF2A 4LPCA 1QR1A 1MIEH 1NBVL 4APQA 3H9SA 5BOZG 5CJQH 1MUJB 4G43A 4QXGL 1A22B 3WIHA 1NGQH 5CD5C 1FVCA 3IKCA 4KI5F 1KPVA 3U4EA 3LDBB 3CSGA 4KRNA 4Q58C 1EGJA 5L2KD 5H37G 4HLZG 4U2YA 4OLXL 4LLWB 1VPOL 5ISZE 2J8UF 4G9FE 5DRWB 3K80A 3PIQB 4B7IA 4DKEL 2V2TA 1EPFA 5DDHA 3KYKL 1ZTXH 1MJUH 1KBGL 5B39B 4IJ3B 4AEHL 5TDPA 5BOPA 2XWBB 2ERJB 4IRJA 1JUFB 4GG6E 2XTJD 3BPCB 3REVA 1A1MB 1RHFA 3VDBA 3V7MA 2AK4B 2J5LB 3LS4H 3OAYK 3WO4B 5IHBA 3LN4B 4LCUA 4D0CB 5SWSA 5EIVA 3PWPB 4N8VG 1GZQA 5HVHC 3V0VA 4MNGA 5C09E 2R1XA 5I1LA 1OPGL 1J05B 5FYKL 5FYKU 2ICWI 2VXSL 2LQRA 5A16A 4PJ8D 5EN2B 3W11D 3KJ4B 3ZKXC 2GI7A 2DLFL 2NW3B 4G6AD 3K8MA 3MZTA 1A7PL 3IU4L 1EHNA 3MLUH 3NIDF 3LKQA 3SE3A 1FNSL 1NDGA 1OF2B 3OPZL 1DLFL 4WFHD 4X5XB 4P5KB 4XWOD 5E8PB 2BRRH 3B3IA 1PW3A 3QI9A 3EDDA 3QHZH 3TN0A 3IETA 1KGCD 3WJLA 2CDEA 5F7EL 4PLJD 1U36A 1IRAY 5TE6H 5CS7A 4AEFA 1RK0A 4NOFA 3N0PB 3BH9A 3L5IA 1GGBH 1JCKA 4ONHB 5EOTA 4XPBH 4ZD3L 5HSFA 3FHAA 3KJ6L 4M7LL 4MA3A 3QJFB 4HCRH 3CX5J 4LHQB 4C56E 3MXWL 4M62L 4YAQA 5T5FL 3T1FA 1NEZG 2BCKB 4YWGH 4GQ9L 2EIEA 1FH5H 4G42B 3TV3L 4NN6C 2EZ0C 3FAWA 3MLYL 1XF1A 2HT4D 4LEXH 3KPQA 1J88A 1Q9KA 4F7PB 2W65A 3FB5A 5EZIH 1LO3L 5C0GA 5C0IB 2Z9TA 3D48R 2NY6B 1KTDB 3IJYB 4Y5XA 1A7QH 4I3SL 4LCWD 3SPVA 2JJTC 5EU6B 3I6LE 4GXUN 1DANT 4YGVB 2R2BB 3VXSA 2PYEE 3SDAC 1C1EH 4JQXA 5FYKD 3QFJD 3UJTL 1YC8A 1CICD 3I75A 4IRZL 3ISWA 3DI3B 1P6FA 1J12A 1S9XA 4Z7NE 4ZODA 4Y5YC 5DF0A 4XPHH 1CGSH 5K9JL 5F6IC 5DA4A 4RGOH 3QCTL 1YEJH 1N3NA 3HAEH 3DRTA 3RZCD 2L7JA 1HH6A 1FAIH 3TBSB 2VABA 1S7TA 3WIHH 2R4RL 1DVFC 3RWFA 1W0WA 4UOW0 1MCSA 5KTEH 5GS2H 5JIHA 1A3LL 4JJHA 4LOUC 1XGQB 2HT3D 4XNQA 4YJZL 3U9UB 5GSRA 3F7VA 2JELH 4IDJH 4LIQH 1FORL 3QG6A 4D9LH 1EGJH 1W0VA 1HSAB 3V52L 3MRBB 1KULA 4JFEA 1UXWB 3UYRH 5C0CA 3CUPA 4AIZB 1XF3A 5A3IC 4U1LA 1GH7A 3C08H 1J8HE 1NMAH 2R4SH 3B9KA 4GH7B 1PSKH 1PG7L 1VACB 3MV8A 4N0CD 3UBXI 1E4XI 4FTVE 3QP3A 1T0NB 3LEVL 4XAKD 3O2WL 2A9ML 3L3KB 2HJLA 5JXEC 2A6KB 5EA0L 3FFCA 3MRNA 3AY4C 4OCYL 2VR9A 2OLDA 1EIBA 3MA9H 5I1EH 1QVOB 3C6SB 4EIGB 1ACYL 4ODUB 3TJEH 1KIQA 3OL2A 4PJEB 2H9GA 1WWWX 1JRHI 1KJVA 4Y1AD 3CFKB 3QCUH 3ROLA 4XMKL 2HYMA 3GKZA 4QKXB 4XPAL 1OAXL 3DSFL 2DMKA 2Y5TB 3GI8L 3E6FA 4KXZI 4WW2C 3O4LE 4MDIA 4MSWA 1EAPB 1Q0YL 3VWJC 4BZ1H 4Y4KB 4FABL 4QWWD 1JFQH 1M7XA 2DOCA 3AAZB 4PJBA 4OLUH 1GHFH 5I1DA 1N64L 3S3PA 2Y6SD 5TQ2L 4PJIB 2E6PA 1VSCA 2MKLC 1JN6B 2ARJQ 3GMOB 1AGCB 1QD0A 1XH3B 3CDFA 3QQ9D 3RI5K 1G9NC 3WHE0 1LD9B 2B4CH 5EOQL 3C60C 3MXVH 3PDGA 4UB0L 4N68A 3QUYC 4MB3A 4PJFF 1MCBA 2W1NA 1FIEA 1WLHA 2XV6B 3RL2A 4O58L 1D6EA 4OGYL 4R4FH 4ELKB 4J1UB 8CGTA 2VQ1B 3ARGB 4PRID 1WZLA 4EQ3A 2R9HC 1MCWM 3D39A 4P4KA 1SJEA 4OFVA 4H0HB 5E6ID 3ARFC 4G3YH 1IQDA 1WIOA 4P5MA 3OGCA 5E94A 2PN5A 2ZSWB 4P5TD 4PY8I 1ZA6A 4HFWB 1KFAH 3QDGB 4K3DH 1OAYL 3RY6C 1OSPH 4OI9A 4XMLH 3L3JA 5HI3C 3IFLH 1HCVA 4R3SA 4YDIL 2FSEB 5ENWB 1KT2B 1NFDE 4LP5A 3RHWF 4I18B 5JORB 1D5MA 1IFHL 2VYRE 4GXUM 4PJ7A 4F2MB 2HFGL 3L95B 4HV8A 3CDYA 4KJQC 1RJYB 1TITA 2QKIA 4LQFL 3DX9B 2VSDA 1X5AA 3QIUD 2VDPL 4Q0XL 4WO4C 1S7QA 2AEQL 3D0VA 1IAOA 2P44B 1CBVH 4JZJA 2MHAB 1LNUB 5D7JB 5HHMB 1CXLA 3GIZL 3I84A 4KKLD 4A2MA 4MQ7B 1DEDA 1FLRH 4CJ1A 2PETA 4Y5YA 4C83A 4KQ3H 3UTSE 2M26A 3BMVA 2EXYD 1I9JL 5SWZB 2CUHA 3S8WA 3G9AB 1AGBB 3VA2C 1Z9MA 4Q7DA 2EECA 5HDBF 5KSBE 5KG9B 5I0DA 1KENH 4QOKE 1MHPH 4BKLA 4QHLB 1Z0MA 5KSAC 3IXAA 3CVHA 4JANB 1DVFA 4RAVA 1G6RL 1T21B 1NBVH 4EDWL 2NY3B 4D0DB 3BP4B 4QXGH 3PDDA 2I9TB 1OTSC 2VXTL 2RBLA 3QNZA 1SM3H 3P2TA 5BV7L 5CILL 3EFFA 3HE7C 3MGTB 4Q74A 4C59B 1E27A 5ESQB 2L0DA 3QWOB 5J57B 1OAQH 4AM0A 4UT9H 5TF0A 4DQOH 5IVZA 5HYQB 3KPPA 3UTOA 2P48B 2C9AA 5EUKA 5EZLB 2GKIA 1QBAA 5JXEA 1MCOH 1XGTB 3ULSA 3KYKH 3H0TB 3KDMA 1RZJH 2BHZA 1BFVH 2HTKC 1FYTD 4MNQE 3VFPA 5K59E 1Q9WA 4R8WL 4JQIL 1L0QA 1A4KB 4X6DE 1BX2B 3GMNB 2QADB 4RX4A 4LLYB 4PR5A 5GRUH 1G6VK 3LQAC 4FMKA 2BERA 1M7IA 4L8SC 4OLVL 3MA7A 4ZS6C 2AJ3B 1ZT1A 4WW2A 5DA0B 2VXSH 5FYKH 2YOCA 4YXKL 3QCVL 3UPRA 1KJMB 2BHUA 4DJMA 1S7XB 3PUCA 1S7SB 5D7LB 1I7TB 1E4KC 1FHGA 1YN7B 4WU7A 4NQCA 1GXEA 2BK8A 1GZPB 1FVEB 1I8KB 12E8L 1A7PH 2BMKB 3NCJH 5FM5O 4QT5B 1FZOB 5C0RL 3MRMA 1P1ZB 3TT3L 2F54B 1XZ0A 3OPZH 1DLFH 3HPJA 1HSBA 1WFNA 3PWNA 3SKMB 4RZCB 3BGMA 2AQ1A 4KJPD 2CDFB 4OD2A 4CMHB 3VWKB 5HXMA 1SYSB 1YEKL 5ESAB 1D5XA 3I85A 1T7ZA 3L3OB 1BD2B 3BGFC 3HA0A 2NCMA 4KHXL 2Z91A 1DQJB 1BBDH 2CUMA 4W4OC 4ZD3H 1T6WA 4Y19A 3QUYA 1KYOJ 3P9MB 4M7LH 1IEBA 2Z31B 3D85B 3ZDYE 1P7QB 3LKPB 5DZOA 3MXWH 4M62H 5KSVA 4U6VL 5T5FH 1KCSL 1WGOA 1FV1A 3HNSL 5D1QB 2I24N 4GQ9H 3TV3H 2ILLA 2VWEE 3MLYH 4HXAH 1R3LB 3ARFA 3LMJL 4X6FB 4JFHE 4X7SL 5ADOH 2PYFA 5IVXB 2I27N 1LO3H 4U7MA 1PLGH 2R0LL 2FEEI 1YJDL 2OR8A 3ZKNC 5DJYB 1AGDB 2IPTL 4I3SH 2YSSB 5SV4A 1FO0L 1W8NA 1IC5H 3VXTA 2VLRA 5L2JA 5HGAB 4OCSH 3UJTH 4KUZL 1UM4L 4GW5A 2VC2L 2Q86B 1T0MA 5CWSA 5EBLB 2VL4A 3EZ8A 4OGZA 3FT2A 1T2JA 3TIEB 4J3VA 4NJ9L 3SKUD 1GGTA 4DKAA 1CL7L 3LZFL 4KKCC 1HOCB 4LLDA 5K9JH 5LKNA 4WO4A 3W9EB 3QCTH 4EEEA 3UYPA 1QFHA 2HJFB 4OCXH 2ZKHL 3ULUE 3V4VH 2F15A 2VR4A 1MJJB 5F7NC 3T0EE 3VFUB 1KIPB 3MQIA 3A6CL 5F7DB 5FECB 5CP3A 4EDXA 3IDMA 5DJAB 2R4RH 3L5WB 1KIUA 2X4OB 3FZUC 2J7LA 3MRDA 3MNWB 2IANB 2C3VB 4OZHF 5F88A 3MODL 4LNRB 1FZJB 1A3LH 1VFMA 1FL3B 3ALXA 1KV3A 3WL9B 3BZ4A 1X5ZA 5INCA 1FORH 3I2CH 1H9VA 3BRDA 1N5AA 2NW2A 3BAEL 1F4YH 5GGTA 1DE4A 5GRJL 4BQBA 2H2PD 2BSRB 3LDBC 1FPTL 2AV1B 5TGBB 4XCEA 3MV9D 2EDJA 4KTDH 2YUZA 3WHXB 5I8EA 1EO8L 1F6FB 5A40E 1PG7H 4YHOL 1Z5LB 5I6XC 4G8IB 4NPYB 3LEVH 3O3BB 1QP1A 2A9MH 3O2WH 5EA0H 3CZJA 4Q6IC 1UH4A 1RAMA 3BP5B 3DVFA 1CLCA 1QRND 1QACA 2BNQA 4FQ2H 5ITBL 3G08B 3VI4F 4IJ3C 4LPXA 1A4JA 1YA5A 1KCLA 3CCHB 3F58L 4YHIA 2ERJC 4M7KL 3NBNA 3HE7A 2EDWA 4YHNA 3O0RL 1S9YA 2A6JA 5D71L 4XVJL 4XMKH 2H3NB 5IB4A 4GW1B 4MJID 3CDGA 3DSFH 3GI8H 5GGSB 1X7QB 4PY7A 1UCTA 5HGGS 1CICB 3FQRA 5E9DE 2IH1B 1QSFE 1RV6X 1WC7B 3KJ4C 4FG6D 4LKCB 4GRLB 4R7DB 1H3VA 3WCYA 3SJVD 2Z8RA 2X4NA 3FTGB 1D5BB 1N64H 3VXPB 2B39A 1Q9LB 5TQ2H 1UB5A 1NCTA 5KOVC 2V2WB 4RMRA 1ZLVH 2PTTA 2QBWA 3O3DB 1L0XA 3D69A 3CSYB 3BH8B 4JFDD 3SEPA 4F7EA 1I1CA 1U8IA 4OV5A 4NO0D 3GB7B 5DMKA 3J7HA 3G5VB 5EOQH 3H8NA 2MPAL 1TZGH 5I8OH 5EORL 5GZOD 1F11A 1E4KA 4OZHA 5HYFA 3MMEA 1D5IL 1J7VR 5BQ7A 4UB0H 3C5ZB 3SDCA 4ZMAT 2BNRD 1EDQA 3KPSD 3EO9L 1VFAA 2P7TB 3KLAA 3H2WA 3PL6D 4PJ5D 4UBDC 4O58H 1UXSA 4OGYH 5FYLD 2UZXB 2DQHL 3EDJA 4P9HL 5B22A 3OKOB 4PLNC 5TH2A 2CRZA 3B2UD 1XF5B 1OGTB 4HJ0D 3H9ZA 4P57A 3X12A 4GG8A 1A7BA 1KXVC 4XPFL 2NY6C 5CZVL 1B2WL 5IROC 3JV6A 4ODXA 3K2MC 3BP6A 1OAYH 3IGAB 4W4OA 3MRJB 3VG0L 3P4NA 1VFOA 1YMMB 3QULB 2DI7A 4YDIH 4GUPA 4IOSD 1JPTL 1T83A 3BKML 5IM7B 5AZ2L 5DD6A 4H1LA 4PG9A 1KJ2B 2GUOB 5C08A 2NX5A 1NC2A 2X5PA 2J8OA 3FQTB 3E3QE 3WIIL 2CQVA 5HDOA 4LQFH 4YH6A 2LVCA 5BRZD 2AEQH 2IPKA 4XNXL 1QLRB 5CP3H 3PQYE 5E5RB 4BK5A 3IFPB 5BXFB 5DQJA 1JPST 4YIQA 5GGVL 2QTEA 3GIZH 4H20L 4L3CB 4LVHB 4KDVA 1XGUB 1CTNA 3IVKB 3FO1A 4GRMA 4HKZA 3N1QC 3TM6A 2A73A 5DWUL 2Q76B 5GGQL 3TBTB 2OJZL 1I9JH 1U2CA 3VFVB 1VADB 3HC0B 3JWOC 3I6GB 2DQGH 3ILQC 3HC4H 5HGHB 3JWDC 3MJ8A 4LF3B 2VITB 3RPIB 2CLRB 4U1MB 4HH9A 5HPOA 2BSTB 3BISA 4LMQE 4H88L 4X83A 2A74B 1TXKA 4G6FD 3HRZA 2GY7B 5A2LH 5DJ8A 2IBBA 1HHHB 2GJZB 4K8RL 4EDWH 5CUSL 1MUJA 2DWEB 4JY5H 5CHNB 3R1GL 2JIXD 1Z2KA 2VXTH 3VXUB 1QLEL 4KPHH 4HIXH 3FB8B 2VZ3A 5BV7H 5CILH 4Z7VB 3O8XD 5ISZD 3DRQB 3LEYH 2BSSB 4G9FD 5L7XL 3GSNB 4LLWA 4S11A 1RVFL 3UZQA 5DRWA 3PIQA 4FQXD 5KZCB 4OIIL 1V5JA 3WN5B 2VDKH 3GMPB 4HC1A 4O4YL 4ODSH 5DUML 4UINH 5B39A 3N50A 1ZEAH 2XWBA 1JUFA 2FB4L 2W9EL 3BPCA 5ANMA 1A1MA 3Q0HA 3PWUB 4YHYB 1M7DB 2AK4A 4LARH 3LN4A 5E2WL 5C09D 4D0CA 4MMXC 3PWPA 3SO3B 3LRSA 4OLVH 4AH2B 3VGGA 4MB4A 5BMFL 2YPVH 4HKJB 3B9EA 1T6VN 5EN2A 4JRYE 5SX5H 1EFXD 1KEML 4J12A 1MOEA 3SE8L 4HPOL 2NW3A 1JHLL 3QUXC 5HHOE 4OCRH 4NNYA 5L0QB 2DDQL 2WP3O 3TT3H 5DMJB 4K8RD 4XPGL 3RWGB 2NR6D 4QRPA 1OF2A 3S36X 3ARGC 4X5XA 3U30B 3U6RB 3RIFK 5E8PA 4D9RE 3BO8B 4FXKB 4OFYA 1YEKH 1LEGB 2VLKB 1JF5A 3LKSB 4WI7A 3OJDB 1IC4L 4FQQB 4KHXH 5DO2D 2C1PB 2KPNA 3IAGC 4CRPA 1KSRA 5FUZH 1NAMB 4C56D 3TPKA 3QJFA 5JXAL 1EVUA 2A83A 2ZUYA 1DBBL 1KCSH 4I18C 3WFBL 2BCKA 1AI1L 2GSGB 2ADGB 1RUPH 2AXGB 4JPKL 4G42A 5F3BB 4LSPH 1ZLWH 4PRHB 2MSPA 4X7SH 4HIEB 4F7PA 2R0LH 3X3FH 1YJDH 5C0IA 4LP4A 4AQOA 5CKGA 3WS3B 5A2IH 1HIML 2GTWB 3GSWB 1KTDA 3IJYA 3AROA 1HHIB 5K93A 1DBAL 1EJOH 4XCNB 4D94A 5EU6A 3UJJL 4YGVA 4QRUB 1UJTA 2R2BA 4PJEF 4N8VB 2BVQB 3TO2B 4H8WC 4JZNB 1KPUA 5D7JC 2IJ0C 4YFLF 2ID5A 5F7YC 5ESVB 3MLXH 1Q0XL 1FFPB 2FBJL 3FMGH 3RNQB 1B0RB 3ALPA 1CL7H 3LZFH 5KS9B 4YDKL 3NPSB 1YQ2A 4MA1B 5MEQB 4PJCE 4O00A 4ZPTB 4L4JA 3TJHD 2PXYB 4P9MH 4PJIF 2C26A 1VKXA 2J8UE 2E9BA 4NZJA 4PFEA 3BFOA 4OGAD 3SDYL 1JZ5A 1G6RB 2AEIT 3MTRA 1R5VB 1UWGL 1NCNA 1XGQA 4WRLA 4WGWB 2NY3C 1CE1H 3MNZB 4Y5VC 4E41B 3U9UA 1NEZB 4LGSB 4L9DA 1HSAA 5FOBB 3MRBA 1G7HB 1UXWA 2R15A 1ETZB 1JZ3A 1FNLA 5E56A 1J8HD 1HCFX 4AIZA 5CZXD 1FPTH 1W72L 2NPLX 1QKZL 4U0QB 3N9GH 2OP4L 4LASL 3Q5OA 1R24B 1VACA 3WV0A 3QEGH 4KK8D 4FQHB 1T0NA 3LPGA 2X70B 1QZ1A 3L3KA 5DJDB 1H3WM 3D25B 1IEHA 3SDXF 2VLJB 2YA2A 4J3OC 3KG5A 3MUGB 1SBSL 1INDL 3F58H 1QVOA 3C6SA 4M7KH 4R90L 5C0ND 4ODUA 1I7ZB 2H45A 3NFNB 4F58H 3O0RH 1ZS8A 3CFKA 4NFBA 4XVJH 3C2AL 1JZ6A 1T20B 2IGFL 2YRZA 3O4LD 1N0LA 3VXRA 2Y5TA 1T0PB 1EAPA 1GRWA 4WDIB 4Y4KA 1GL4B 1BQHG 1MHEB 3IRZA 3LPWA 3AAZA 1JZ8A 4RFNC 1GC1L 2DM3A 4YHML 1QQDB 4WFFE 5IF0B 1JN6A 4FXGA 4RGNE 2HFTA 3GMOA 1AGCA 4EN3D 4MYWB 4RMQA 1XH3A 4HWBL 4CMHC 1YECH 1QHPA 1CN4A 2QHRH 4M6AA 1JGDA 1LD9A 2AW2A 1IARB 5EORH 3MJGX 4KROD 2WWKO 1D5IH 3V6OE 3EO9H 4YFLI 3NMEA 4JREC 4JFFB 4UDUB 3ZHKA 4ELKA 4ZNCD 3PP3H 4J1UA 2VQ1A 3ARGA 4YBLB 3D6GA 3HI1B 4O2CB 1TZIB 1NGYA 2E27L 1A5FL 2A77L 3HZMB 2ZSWA 1YYLL 5CZVH 2QR0B 4HFWA 4I77L 1FL5B 3QDGA 1OAZL 1RURL 4G6KL 3DECA 4R2GB 1Y18B 5IBTL 2FSEA 5ENWA 1KT2A 3BKMH 1AY1L 1QRNB 5JORA 5AZ2H 3MLVL 4ZS7H 1HDMA 4YC2B 2G2RB 3HTLX 1G1CA 1MLCB 1YEGL 1KCVL 4EOWL 1FIGL 2DTML 3L95A 4AENB 1FVDB 1RJYA 4HG4K 3DX9A 4G80B 5CIPB 4P46B 2DQDL 4XNXH 3IDGB 4X7CC 1ZLUH 3RVVD 4ZUWB 2MHAA 4I48B 1LNUA 4MNHB 3IJSB 4QGTA 3RUGE 5GGVH 5D7JA 2FJFB 3FB7B 5DI8B 4GS7B 1IE5A 1UB6A 4JQVC 1Q8MA 1N5YL 4H20H 4G6AC 2BFVH 3UTSD 4MQ7A 1X5XA 5EU7E 3GSQB 1WCQA 2WNGA 3DGGB 5IT2L 2JJSC 2YD4A 5J06A 4OIBA 5E2TL 2OJZH 3TC9A 1RFDH 3OQ3B 5SWZA 1F02I 3VXME 4XWOC 2B8OT 2JCCF 4JFDB 4E42B 3CMOH 3QXWA 3BD4A 4QOKD 2FO4B 2YD6A 4PLJC 4Z76B 5KG9A 4M93B 4H88H 4BZ2L 3FKUS 4DCQB 3PXHA 3H3KA 3V0WL 4JANA 4JDZB 1I3RB 3TBVB 1T21A 1UFUA 2VDLH 4D0DA 3GZKA 3EJJX 3RJDA 1G7PA 1FSKC 1T22B 1ZWIB 3KPMB 1F6AB 1SEQL 3MGTA 1MY5A 3HR5A 5ESQA 1RK1B 3QWOA 3MLZL 2XFXB 2MCG1 5HYQA 3KR3L 1RVFH 4F9PC 5EZLA 4PJFE 4D3CH 1O0VA 4JO3H 4XP4L 4MNQD 1XGTA 1CICC 5E6YA 1SY6A 3H0TA 5DUMH 2VAAB 1ZT7B 1OD7A 5IG7B 3GRWL 4DGIL 1WV7T 1A4KA 4J23A 1BX2A 2FJGB 3R06A 3GMNA 3EIFA 3IDUA 4MLSA 3JUZA 3VXQB 1CIUA 5E2WH 2BVEA 2YMXL 4H26B 1EEYA 4K7FA 3RZCC 2D7PA 5D2NE 4OFPA 2AJ3A 4N8CH 5TFSL 3GJFK 1KJMA 4LVNC 1S7XA 3ZE2E 2HKFH 1KEMH 1S7SA 5D7LA 1I7TA 5I74B 4TSCL 1YN7A 3QEQE 5HYJB 4C58B 4HPOH 4Z6AT 3C5ZC 1GZPA 1FVEA 2AKRB 4BK4A 5C6WH 1IKNC 5JUEL 3EFDL 2BMKA 2DDQH 4QT5A 1FZOA 2N7BA 5CGYC 3ZDZE 4XPGH 2HT3C 2F54A 3ULUL 4XT1C 5EO9B 2H32H 4F80A 3SKMA 2IBZX 4V2BA 2CDFA 3LKNB 3VWKA 3RIAF 5C0BB 4RBPK 1HNFA 1UWEL 1MELA 1GIGL 4KJYB 5ESAA 1CS6A 3L3OA 1BD2A 3QFDB 7CGTA 1JTOA 1HHKB 1PGRB 4JO4L 1DQJA 1WTGT 4K9EC 3NABL 5DJXB 4N0CC 1NGWB 4R0LA 3P9MA 3PJSB 4UTAL 2Z31A 4LLAA 3D85A 2UWEE 1P7QA 3LKPA 1DBBH 4UV4H 5F21B 1WJ3A 4JFHD 1P9MC 2KDGA 5D1QA 2JIXB 3VGBA 4JPKH 1R3LA 4X6FA 4GSDL 5IVXA 2ED8A 1UM5L 1HIMH 5ISZB 5DJYA 1AGDA 3NCBB 4Z77B 5I17B 2YSSA 4S2SA 1EO7A 3TVMD 3MOAH 2DJ4A 1C7SA 4FQXB 1MH5B 4QXUL 5HGAA 1NC4B 4ZUSB 3NA9L 2Y25A 1B90A 1XCQB 2Q86A 2B1HL 2VAJA 4ODTL 1QTYT 2EDLA 2V9QA 5EBLA 1Q0XH 2VMFA 4AQ1B 2FBJH 1JGVH 4LVHC 1OCWL 2YD8A 3F7YB 4JKLA 1FC2D 3TIEA 4UIKL 4ZAKB 1F4XH 1R5WB 2Y6SC 4YDKH 3UZEA 1HOCA 3ULUD 3W9EA 3LRHA 3RDTB 5C09B 4BFEA 4IS6A 4ZOEA 1ZLSH 4L3ED 1DQQA 2OI9C 2HJFA 3BKYL 3QQ9C 4LCCB 3IDNB 1MJJA 5DD3L 1LWRA 3VFUA 2VQTA 3QXVA 1J0KA 2C1OA 4ONGH 4HUWB 5J89A 5F7DA 4L1DA 4JQVA 5FECA 5A43C 1P4IL 3STLB 4XWGL 3HI5H 3SDYH 4P3CL 1IBGH 5DJAA 3GI9H 3L5WA 4N0RA 3MNWA 2IANA 2C3VA 1P84K 1B4RA 4LNRA 1AKJD 1FZJA 3CLEL 4N5EC 1FL3A 3WL9A 4HF5H 1MIML 5F1OB 1NMCB 2F5AH 3GFUA 5E6IC 3QQNA 4X9GA 1OB1B 1NDMB 1L9MA 4KVNL 5HDQH 4GRWF 4ETYA 1IGMH 3GIVB 1AD0B 4P5TC 2BSRA 2AV1A 5TGBA 1QKZH 3WHXA 5C71A 5TQ0H 4X6CB 4HQQL 4S1SL 3RTQB 5IEKB 1SY6H 4C56B 1PD6A 5EIIB 4G8IA 4NPYA 3O3BA 3THML 4Q9CA 3BP5A 4C54A 1QSZA 3VMOA 3G08A 4NNXB 3CFEB 1SBSH 1INDH 3CCHA 3UBXG 1S5HA 3D9AL 1QFOA 4R90H 2LAAA 2P8LB 2OMNA 2PR4L 5IJVB 4YHYC 1T5XB 3MFFA 2PYEB 3QIUC 3MRRB 3BPOB 2PW2B 5HPMA 4OAWB 2H3NA 4GAYB 5IHLB 1T03L 1LEKB 4GW1A 1GGYA 3SO3C 1CFVL 5JTWA 5GGSA 1X7QA 3ET9F 4M9PA 2FRGP 3SE4C 1CICA 1UQSB 2OTWB 2IH1A 4M7ZB 1WC7A 1WBYA 4HJJL 4KKLC 2NY2D 3VFTB 4NRXB 4LKCA 1NLDL 5I0ZA 2YD7A 4GRLA 1Y0LB 3ILPB 1ES0B 4FZ8H 3DIFB 1GC1H 4R7DA 3TIDB 3GSVB 3FTGA 1PBYA 5ITFB 3MJ7B 1D5BA 5L0QC 3VXPA 4Y16D 1Q9LA 5TDOB 2V2WA 3BHBA 4L29B 4DN3L 5D2LF 3O3DA 4HLJA 1HINL 3U30C 3X17A 2NNAB 4CVZB 3CSYA 3BH8A 3GB7A 5DEFA 3G5VA 5CJOL 3CFBB 4BQ6A 4YDLB 4ESKA 4RWYL 3ARVA 4OCMC 1U93B 3MBED 5INDB 2MJWA 2J1KA 3B9AA 3HC3L 3C5ZA 2P7TA 1TJHH 1YPZB 4GAFB 4N9GB 3T2QA 1V7ML 2BVYA 3OKOA 2BY1A 3W9DB 3ZSTA 1XF5A 5I1AB 1OGTA 4HKXB 4CVUA 2A77H 4XC1L 1YYLH 4FTVB 4I77H 2X1QA 1LHZA 1OAZH 1HYSD 3IGAA 2WBJB 3MRJA 1WQVT 4G6KH 5GGRA 3PP4L 3QULA 1YMMA 2LTQB 1KJ3H 2E3VA 4PGDB 4TSAH 4FS0A 5IBTH 2XACC 2XA8L 3UTTE 1I1YB 3G6JF 4RISL 1KJ2A 4G8FB 4NQTA 4EOWH 2HMID 3MUHL 1FIGH 3SCMD 2DTMH 3BWAB 5J9PB 2HLFD 3NPSC 3F12B 4MA1C 5J11B 2X9XA 2RGSA 1QFWL 2DQDH 2OQJB 2A6DB 1INEL 3O4LB 3T3PF 1KNOA 1QLRA 5LVEA 5KVEH 4PJAF 4YLQT 2Q3ZA 2VB5A 3IFPA 5BXFA 4WCYH 1E6OL 3WXWL 1JMZA 4E9LA 4L3CA 1XGUA 2XQBH 2DL2A 4HKBB 3FT4B 1T7VA 3IVKA 4B50A 1QO3B 2Q76A 1CD0A 3VFVA 3KXFE 1VADA 3HC0A 4NM4L 4PJ9D 3I6GA 4JPIB 1FCGA 1OD9A 5HGHA 1V3MA 4XPTL 3NIGF 4NC0B 4LF3A 2VITA 4K3EH 3RPIA 1C5DB 1WFTA 3S6CA 2CLRA 4U1MA 1QLFB 5BV7C 5B3JF 2BSTA 2HVKB 5JOFB 1W72B 2A74A 3TO4A 3V4PL 3V0WH 4MD0B 4PLOB 5CMAA 1TVHB 5JOEA 2CXKA 1HHHA 4WNQB 1J1PH 3LKOB 2DWEA 2MQ3A 3P0VL 5LGHL 3FO9B 4Z7UB 1OHQA 2C4XA 5CHNA 1CXIA 3VXUA 4K2UH 3SDDB 1IGFL 2EH7H 4Z7VA 4X6BB 4XNMB 3DRQA 3ABZA 2BSSA 4WHTB 4LVOB 3GSNA 2BP3A 4JGMA 1NFDB 4RWHA 3EZJB 2YUXA 5IHUL 4HT1L 3WN5A 5BZDB 3GMPA 3WEXB 5DQDL 4XX1G 4XVTH 1RY7B 5LGKA 4OLYH 4J3TA 4LPUA 3OAUL 3HZYB 3PWUA 4NO5A 5L6YL 1M7DA 1JPFB 3B83A 4JG0L 3QUML 2YMXH 4F33B 3ZKMD 4CU6A 5IFJB 1KIRB 2LU7A 4AH2A 3SE4A 5TE7L 2VH5L 5J4MA 4TSCH 4KY1L 1DUZA 3H42L 4GBXD 4MWFB 3HPLB 5IMMB 1ED3B 4PJHE 3T0BA 5JUEH 1IC7L 3EFDH 1UCBL 4OQTL 2VDOH 4D9RD 3RWGA 4XXCA 2QQQA 3U6RA 4MGXA 4JY4B 5GS1B 3BO8A 2F19L 5FO9B 4FXKA 2N56A 5D72L 1LEGA 2VLKA 2H2PC 2DIBA 3LKSA 2IAMD 3OJDA 5E7BA 3CPLA 3I9GL 4FQQA 4HUKB 5F7WC 1HEZB 2C1PA 4PJXE 1NAMA 1OGAE 5JZ7D 4UTAH 4R2GC 4WWKD 5JW5B 2ZG1A 4HIHB 2XZZA 4JKWA 2GSGA 1KEGL 2ADGA 2P5EA 5F3BA 4NUGH 1IGIH 5FCUL 4MLIA 4PRHA 4X9HA 1X6NA 4GSDH 5EPMB 3GSUB 5JLZA 4HIEA 4JDTL 1HN1A 1UM5H 3WS3A 5IQ7L 2GTWA 3GSWA 5B38G 1FG2B 4P46C 1X4XA 4ZOAA 3C8KB 4QRUA 3V5HB 5HI4D 4DTGL 4N8VA 1NAKL 4HUUB 4QXUH 1P5VA 3RJQB 2BVQA 3TO2A 4JZNA 5FHBL 2UVFA 4MNQB 1CDYA 2HA1A 4NO2B 1AHWB 1K3IA 4TRPH 3K4DA 5ICZA 5ESVA 4K3JL 4X6DB 4FG6C 1FFPA 1IAII 4GKSB 1OCWH 3RNQA 1B0RA 3EO0B 3HKFA 4WEMB 4UIKH 2IF7A 5KS9A 5GISL 3O3AB 5F96L 3GM0A 2F53E 3MRKB 2Y7QB 4AJ0A 4MCYB 1E4WL 2A9NL 4ZPTA 2PXYA 2Z0BA 2JKXA 1A1NA 4KDTC 1WAAF 5I66B 3VDCA 5ACZB 3S97C 2D0HA 4M93C 3ZYIA 5GZOC 3G6AB 3FL7A 5IVNA 2GJJA 3OWEA 5KAQF 1PAMA 1CLYL 4XWGH 5K33A 4WUUE 1L6XA 4Y2DD 4LHUG 5ERWB 5IHZA 4NN7C 3PL6C 1R5VA 1DQMH 4NQVB 1JWUB 1X9QA 3CLEH 3GBLA 2K7PA 3QXTA 4OV6F 3MNZA 4E41A 5I9QC 5B8CA 1H15B 1U3HB 1X5IA 1I9IL 2YA0A 5F8QC 1LE9B 4O51B 5T1DL 3U0PB 4XC3H 5FOBA 3VFGH 4O5LH 1G7HA 2X4TA 3GSNH 1AJ7L 4KVNH 1ETZA 3QRGH 5EUOB 5GQBA 5I15L 3EJZD 3BSZL 3GSRB 5EBWB 3OKLA 2NY5C 4HQQH 4S1SH 3IYLW 2MQ0A 2Z8VC 2FD6H 1R24A 3UDWC 4FQHA 1NEUA 2X70A 4N0UE 5E99H 2XNAB 5DJDA 4DGVH 5HHVL 4OM0L 4L4TB 3D25A 3QRFM 2R8SL 2BX5A 2VLJA 3H9YA 5IK3B 5BO1L 3D9AH 4L8CB 2UUDK 1I7ZA 5FFLA 2AJSH 3NFNA 4PREB 4PRPE 3SGEH 2E6QA 2N4IA 1T20A 3JTSB 1CFVH 3HFML 1I9RH 1KN2H 1H0DA 3V5DA 3ARXA 4WDIA 2V5TA 4HS3B 3LHPL 1UACL 4HJJH 3Q5YA 2QQNL 2D7MA 1MHEA 5I74C 4A6YB 3SQOH 5CJXA 4CL7A 1NLDH 2AVGA 4NDMB 1QQDA 4Z0XB 1AR1D 4RGND 3MLSH 1TIUA 4DEPB 5IF0A 3N85H 4XMPL 4P9HC 4X5WB 3T0EB 1HINH 1DBML 3OKNB 2AI0L 1C16B 1FQ9C 2Q8AL 2CLZB 3MSPA 2NXYB 4JO2L 5HHPB 1CU4H 1HWHB 4KK5D 3RVXC 3DXAE 1YY9C 4F57H 5KN5B 2E9IA 4JFFA 1AKJB 4HD9A 4UDUA 3ZHDA 1AO7D 5CSBA 5EO1B 5F72S 3EOAB 3HI1A 1TZIA 4V2CB 3ZL4L 2WW8A 3S7GA 4DAGH 5FOJA 2GSIB 4ELMA 3HZMA 2YPLB 1PX4A 3B9DA 2QR0A 4UT6H 1WZMA 1FL5A 1YYML 4RRPG 3PP4H 5KANI 4POUB 3VGAC 1Y18A 1KTLB 4FQXC 2FGWH 5C6TL 2P46B 2X1OA 3TF7C 2XA8H 4OF5A 4RFOL 4LDOB 1ZVYA 3QIWB 1KTRL 4RISH 1A7RH 4PP2B 5IW3A 4ISVB 2G2RA 5DJCB 1IM9D 2MCPH 5F89B 1MLCA 2EDBA 1BQHB 4M8VA 4AENA 1FVDA 4NKIL 4G80A 3PDOB 5CIPA 1QSEB 3TPUB 3LSOB 4P46A 3UJIL 1EH9A 3IDGA 1INEH 4QRTA 4ZUWA 4JN1L 4LCCC 4OCNC 5E9DB 4I48A 1QSFB 3T0WA 4MNHA 3IJSA 1K6QL 2FJFA 3SOBL 3FB7A 1E6OH 3RU8H 5C07E 3WXWH 4QRSB 5DI8A 3WD5L 3ULVE 1S5IL 2FLBT 3CU1A 2YZ1A 3GSQA 4OKDA 2ZCHL 3S5LG 3BDXA 5JHDB 4YBHA 5M7QA 1TTUA 5IIEB 1AXTL 3DGGA 1EJ6A 4Y16B 2QSCL 4KH2A 3VXMD 4K8RC 4MQTB 2NR6C 2BDNH 2CK0L 3EDKA 4GMTH 4GJTB 1CDIA 2OZ4L 5CP7B 4YK4B 4XPTH 1DN0B 4HK0B 2FO4A 1A3RH 2E6JA 3GUTB 4L4VD 3QEUB 5DO2C 1G9ML 4DCQA 3UC0H 1P4BL 4XB8A 5CEZL 5F7FA 2VZUA 4JDZA 1OTTD 3OR7B 1I3RA 3TBVA 3F5WA 1OTUD 2H1PL 2M8XA 4FQ1L 3H9SE 4LCYA 3DO7B 3K1DA 3D3VA 1CTOA 3RX8A 1IGFH 1T22A 1ZWIA 3DMMD 4XBPB 1A7NL 1F6AA 1LO0L 4JM2D 4KKNA 1N4XH 5KSUB 4WI9A 4FQLL 1RK1A 1PG7X 3A6BL 4LIQE 4O9HL 3P73B 5C0DB 2PW1B 3BPOC 2XFXA 5I1HL 3UDWA 5B3NA 1KCKA 3GO1L 4U1KB 3TWCL 5E0QA 4NQUA 2AEPL 5IHUH 2MTPA 4EIZC 3Q3GB 5DQDH 5I30H 2R0KL 2VAAA 2D31A 1ZT7A 4M7ZC 2J8HA 5IG7A 2KQMA 1KN4L 1J1XH 5CZKA 1OAKH 4GG6F 4V1DD 3HB3D 3OAUH 4G9DB 4LLQB 2AQ3A 2FJGA 1I3UA 1NMBL 5L6YH 2AS5M 1BOYA 3PQYB 4JG0H 3QUMH 4LDLB 1GVIA 4MA8L 1U91B 4H26A 5SWSE 4IIQB 1EK3A 4NP4L 1MHCB 5CGMA 1ZGLP 4KGJA 4YDLC 5E8OB 4Y2OA 2DLIA 4KY1H 5HYJA 1FP5A 4GOSA 4JHAH 4OGAC 5CEZD 4ERSH 2FH6A 3TA3D 3QT2A 2AKRA 1UCBH 4OQTH 3NZHL 3X13B 5J12B 2XICA 4GXVH 5EO9A 5GJTL 2VDRH 3U36B 1M6OB 1TETH 1AXIB 5MP6L 1Q1JH 5BZWB 3LKNA 4AEEA 5C0BA 5D72H 4KJYA 4QHNB 2RCSH 3JVGC 1SBBA 4BA8A 4FHBD 4QGYA 3QFDA 1HHKA 2D7OA 1MLBB 5EOCL 2HN7A 4KRPD 1RUKH 5DJXA 1IAIM 1NGWA 4KK8C 3PJSA 2LTQC 5DEGA 5I19H 1S9KC 2YBRB 3CLFL 5C0JA 3UPAA 1U8NA 1CDCA 2JIXA 3RFZC 3X14B 4OZIF 3HMXA 5CIPH 2WLYA 2VR5A 5C9JB 5C0NC 1BFTA 2ADFL 25C8L 4FA8A 5IQ7H 3MRIA 5ISZA 4ZOCA 1VERA 4NZTL 4X99B 5I17A 4Z7WB 3S98A 2H2SD 4OFDA 3Q6GL 4DTGH 2JB6B 4XHQA 4FQXA 5F6HJ 1NC4A 2C3WA 1J0IA 4RCAA 2QSQA 1UH2A 1XCQA 3R0NA 1HQ4B 4XI5D 1MFAL 2KL6A 4I0PD 2IH3B 2WUCH 3QG7L 3D5OF 2K7QA 2FBOJ 3F7YA 1R3HA 2X4UA 5DQ9B 4Z7NF 4ZAKA 1R5WA 5IB3B 1JPGB 2W92A 4CAGA 3RDTA 1E4WH 2A9NH 4A2LA 3AXLA 1YY8B 4EN3C 2PO6A 3VFRB 4LCCA 4BUHA 3IDNA 3UTZB 4HUVB 4TPRL 4JRYB 1YEEL 1MFBL 3LPFA 3OMZA 4FQJH 4QF1B 5HHOB 2WBKA 4KROC 1IGTB 5AZEL 3STLA 1I85A 3T1WA 2FDBP 2ITDB 1JI2A 3HG1E 1RZ8B 4LAQL 5J8OA 4UV7L 4UI2A 4OLWL 4R26L 5KOMC 2XTJE 2ICWJ 3MRHA 2RR3A 4BQ8A 5T1LD 1BMGA 4MXVE 1OB1A 1NDMA 3SDDC 4JFEE 2IAMB 5I15H 3GIVA 4OZGB 3S4SA 1BVKA 5C3LD 3GNML 3WUWG 3B5TA 3K8KA 4X6CA 3RTQA 5IEKA 1ACZA 2EDNA 2VL5B 4LVOC 2VOTA 5DC0A 3V7AE 5C7XL 3RGVB 3MV8E 2VTFA 5EIIA 4HXBH 1NCWL 3K0WA 2DYPD 2WV3A 3DOSA 1XAUA 5LBSL 4F9LA 4M6ML 3QNXA 4NNXA 3RIAK 3CFEA 4YHKH 1YQVL 5MENA 5CBEB 5JQ6L 2P8LA 1TQBB 5IJVA 1I1AD 3MLTB 1U92A 1T5XA 5EU5B 1WK0A 3VXOB 2APBA 2PYEA 4DKFH 5C0FB 2FGZA 3MRRA 1NFKA 4PP1D 1JGLL 2X4SB 4OAWA 3EKCA 4GAYA 3RVVC 1LEKA 5J13B 3CXHK 1V7NL 1M71B 2EXWC 2PNDA 3AFLA 3WDJA 4NRZB 1UQSA 2OTWA 3MJ9L 5GGUB 3S34L 1FZMB 1UACH 1FLTX 3QAZB 3FOMB 4LK4A 4NJAL 5KW9L 3VD4A 3VFTA 4NRXA 1Y0LA 3ILPA 1ES0A 3TIDA 3DIFA 3CD4A 4PJBE 3GSVA 5ITFA 3MJ7A 4YR6B 3GSXB 4LU5L 4WI6A 5TDOA 4XMPH 4L29A 5DVKA 1R3IL 4LBEB 3PXJA 2J8UB 2NNAA 5GS1C 3G04B 4YGAB 5J3HD 4CVZA 2GK2A 3ARBD 5FUOH 4NSKB 3CFBA 4XZUB 2Q8AH 5F9AC 1OWRM 3O9WB 1U93A 4JHWH 5INDA 3O2DL 2BOBB 4XBGB 4Y2DB 2Z8SA 5FYKE 1FRGL 3T2OA 3HMXH 1MCCA 1YPZA 1N0XH 4M5ZL 3L5JA 1F6LL 4HWZB 4HUNB 1T1YB 5T1MB 3W9DA 3M8OL 3D39E 3RWHB 4Z9KB 2DS4A 3WXVL 5I1AA 3NTCL 3JVGA 3UBXB 3IDJB 3IU3B 1LO2L 3SKNB 2A2QT 4FTVA 4KTEL 4L9LB 1YYMH 4O02H 5I1CH 2EEAA 2WBJA 2Q7NA 2R29H 2FECL 4PGDA 4KKBD 5EG6C 1HH9B 5JIPA 4AG4L 5LG1A 4QNPF 4MAUH 1HILB 1I1YA 3FQWA 2BXYA 4MX7B 1N6QH 1XF4B 4G8FA 4PJ7E 2F5BL 2I9LB 3BWAA 1CGTA 2EH8L 5IBLD 2GK0B 1DTUA 3TYGH 5J9PA 1MJ8L 3F12A 3MRLB 2AK1L 4E0RB 3WNLA 2OQJA 3O4LA 2C4FU 1U8LA 5F70A 2DQTL 2JJUA 1K6QH 5F9WB 2E8YA 1ADQL 4OM1L 3VFSA 4U05A 2ZPKH 4FZEL 4OF8A 1S5IH 3BEWB 4HKBA 1G0DA 3FT4A 1AXTH 1QO3A 1QSVA 4OF7A 4RGNB 2QSCH 5FKAB 4UMGA 2RAMA 5JW4N 2CK0H 1JL8A 4JPIA 2NYYD 4O2EB 4P23D 1YUHB 1QBML 1C5DA 4Y1AE 5F93C 3OKDB 4RQQB 3LH2H 5KSBF 3ARDD 2DQJL 1X5KA 1G9MH 2HVKA 2ZUWA 3L5XL 5JOFA 3L6FB 5CEZH 3S9DB 2FO1A 4MD0A 1MRDL 4TVPE 2X9WA 4I4WB 4WNQA 4FQ1H 2AJYH 2VWEC 3LKOA 4OUUB 1MF2L 3FO9A 1KB9K 4Z7UA 2B5IB 1MCNA 2WWMD 5JW3L 4QRQB 3U7AA 3HAEG 5DVOA 4GQPH 3ZT6A 3SDDA 4ODVH 2O61B 1TLKA 1A7NH 1LO0H 1D6VH 3W81A 4X6BA 4XNMA 1KF9B 3A6BH 4MA7L 1FDLH 3RL1B 4WHTA 5I1HH 3TVMC 4H0IA 1Q72H 1NFDA 5HYIA 5JR1L 1BZ9B 2XN9B 4LPYA 5D5MF 1UENA 1QYGL 3ZKXB 5T3ZL 4RMVA 2X40A 3OSKA 2AEPH 1KLUB 5DGQA 5BZDA 5JPNB 4XVSH 2IQ9L 4UILL 5AAMA 3WEXA 1AIFB 2MQCA 4PY8J 2OTUB 3U7WL 1KN4H 3MV7B 5DK2B 5IB2B 1U8JB 3DUUB 4PRIE 2W0PA 4DEPC 4K94C 5J0BA 1JPFA 3ULUC 3MV01 2X9YA 3T0EC 4J3XA 2VE6B 1ND0B 3HLAB 5IFJA 2V7HB 3KNBB 4NP4H 1KIRA 3SBWC 1EUTA 2CMRL 3TFKD 3QWQB 2NXYC 4DN4H 3G6JE 2D4FA 4NQCE 4MWFA 3HPLA 5IMMA 1A14L 1ED3A 3REWB 2XY1A 3VXMB 2FIKB 4EUPH 5IQ9B 5HTSA 1S3KL 3QUZB 4PGZA 5EDXA 5GJTH 4HG4J 4BFIB 1CXFA 4MS8D 5MP6H 1DQLL 5GS1A 4RA3A 4JY4A 4HH8A 3E8UL 4PRNA 2XYCA 5FO9A 5DS8B 1GPOL 5D9SB 4WY7L 3T3PE 4M8QB 2V5MA 3EYUH 3SDAB 2DWDB 2EYRB 1HEZA 1OGAD 2X7LB 5D1XD 3EYSH 3CFDB 3RWIA 4Y19E 4XCCH 3PHOB 5DMYA 5D7SH 4P2QD 2AXJA 5T3ZD 1VGKA 2Y06L 3O6LL 4YBQC 3CLFH 5JW5A 3QIWC 4HIHA 1JYNA 3P0YL 1AFVL 3HUJF 5EPMA 5C3TA 3GSUA 5T5NF 2Y36L 25C8H 4YX2L 4NZTH 5B3JE 1FG2A 4PJFB 4NM8H 3C8KA 3V5HA 4HUUA 1A3QA 4P0DA 4FRWA 4NO2A 2FZ3B 1AHWA 2GJ6B 3SGJC 5HY9B 3ARWA 4RGMB 1MIEL 43C9A 1MFAH 2BSED 4X6DA 2NY2C 4GKSA 4JAMB 1AE6L 3EO0A 2F53D 3T3ME 1NGQL 4MAYD 4N90E 5DJZA 2APXA 4Y16C 3O3AA 4XCYB 2MFNA 3MRKA 1PY4A 2GEEA 2Y7QA 1OVZA 4X98B 4U7KA 5D2NB 2R2HB 1KELH 1F2XK 4YK4C 5B21A 3ULUF 4TPRH 1P4LB 2WANA 1MFBH 4OD3H 3ZTJH 1BZ7B 3QEQB 3GJFB 5ACZA 5I66A 1GGUA 2VUOA 5JW4M 3MBEC 4M1DH 2D9QB 5LJYH 3OF6D 3TA3B 4KKAD 1OW0C 4RA0C 4KUCD 2E7LA 3U48A 5ERWA 5HVGB 3CXDL 3MNVB 2EYTB 4NQVA 1JWUA 4OLWH 3CVIL 2XA3A 1FYTE 3PV6B 1S9VB 1HK6A 1H15A 1S7WB 1U3HA 1LE9A 4JN2B 4O51A 2LU3A 1ZT4B 3U0PA 1CXKA 2J6EA 4X8XA 5EUOA 2DB8A 3AMKA 2OMBA 3UZVB 2ZUTA 2XZQL 3GNMH 3LB6D 3GSRA 1MJ7H 5KVMC 1HYSC 5EBWA 4KRPB 3ETBF 3VWJB 2FEDD 5B38B 2UWEB 4ZFOL 2LE9A 1FFOB 4JFZL 4WI3A 1NLBL 1HKLL 2ESVB 2XNAA 4DWHA 4L4TA 3O41A 1XIWD 3DVNB 4M6MH 4OCWL 4I1NB 3L7FB 4XTRD 3SCMC 3UYOD 5JQ6H 4PRPD 3DV6B 1A64A 1JNNL 5DJ6B 4L8CA 5EIQA 2HLFC 4PREA 4X4ZA 2BOCB 4PLKD 1NH6A 2PTUA 5TE6L 1JGLH 4LDEB 3C60B 3OKYA 4L3AA 3JTSA 1DL7L 4NKDB 4IIQC 1UKSA 4TUOB 3U0TA 4HCRL 3S34H 3MJ9H 2MOVA 4HS3A 3K74B 4A6YA 5KW9H 1FH5L 4NDMA 4LHUB 4XHJC 3UTPE 3V6BR 5J12C 3W5NA 4NKMB 4X5WA 4U7SA 2AJUL 3T0EA 1AQDB 4CDHA 3DUSB 1S7VB 1A7QL 3ARED 3OKNA 4Z5RB 3SBWA 3ULVL 1LO4L 1C16A 2CLZA 4HPYL 1C1EL 5HHPA 4PTUB 3LAFA 4J8RB 5GS0H 1I8IB 1HYRC 4FFVD 1FRGH 1V8HA 5KN5A 1U95B 1AKJA 4M5ZH 4LSUL 4LSQH 5EO1A 4XPHL 1CGSL 3QDHA 3EOAA 2X42A 2BJMH 2R23A 4IDLA 1DQTA 4X0KB 3WXVH 4RGOL 5C6PB 5MI0B 1LO2H 2GSIA 1MREL 2YPLA 3VRJA 4JFQB 4KK6D 4KTEH 4NCC1 1L7TH 3WFHB 1BHGA 5HHQB 5K9OB 1E28B 5F97E 1KTLA 2QQLL 3FAXA 4MXQD 4GKNB 3WIHL 3WSQH 4AG4H 4M3KB 1P84J 3QIWA 5KTEL 2BVOB 4PP2A 4ISVA 5DJCA 2NX5E 3JV4B 1BQHA 2F5BH 3RAJH 5FGSA 3E6HB 4LIQL 4D9LL 1EGJL 2EH8H 2IEPA 3QO1A 1MJ8H 4R97B 3PDOA 3TPUA 1K4CB 1QSEA 3LSOA 1B9ZA 3RVTD 2A6IB 4AEIL 3ZYJA 3CSPA 3P11L 5KSAB 3RNKB 1NMAL 5E9DA 3MV9E 1PSKL 5C07D 1QSFA 3ULVD 4JLRB 1LK2B 4OM1H 4EI5D 2EDQA 4QRSA 1RIVL 4KK9C 1K4DB 1I7UB 4UQ3B 5IMOB 4GBXC 4NHUB 4PG2A 1NKRA 5JHDA 5IIEA 4Y16A 2J6EH 4RAUB 2HH0H 1UKTA 3DX8B 1EHXA 2O5ZL 2I25N 5CP7A 2WUBH 3QCUL 4U3HA 3IJHB 2IAMC 3GUTA 4I0KA 3QEUA 2W59A 1MCLA 2DQJH 1RUQL 3KYNB 1BM3H 2NQCA 4LSDA 3SHSA 5DURD 1JYWA 5DEZA 1MRDH 5JZ7C 4APQD 3H9SD 3RGVC 1DR9A 2JK5B 5D1ZD 5HDLA 3OR7A 2JF1A 4WENB 1U9KA 4QHUB 1YMHB 3DO7A 2XWTB 2VN7A 4XAWL 4Q9RL 3QIBB 2FATH 5GS2D 1FCCA 4QO1A 2NMSA 4G5ZL 2JJWA 2XQYG 5FF6B 3WJJC 4ZO8A 4XBPA 5L8KB 1TQBC 5HHNA 4L8SB 5KSUA 4CADB 5DUPL 1JNLH 1U3YA 5C0DA 2PW1A 3MUZ1 4NCC2 1RIUL 5HI4C 3UTTB 4U1KA 2FX8H 1QYGH 4A6YH 5T3ZH 4I13B 2ZSVB 4XP6L 4HGWB 3Q3GA 4UILH 3BI9X 3QUKB 4IRJD 3VFWB 3VJ6B 3QAZC 3U7WH 4U6YB 2RFXB 4IM8A 4JRWA 4QRRB 3LEXB 5ANME 4DK6A 2GTZB 4LLQA 3EOYG 4G3YL 3S5LB 4J3WA 3P4MB 4X8JB 5SWSD 3BGFB 4N8PA 3PQYA 4J4PA 5JQHC 5E1HB 2E7BA 1U91A 4XNZB 2IWGA 2E8ZA 3CDCA 4ZUVB 4IIQA 1CD8A 1D7FA 5IB5B 2EDTA 1MHCA 4X6EB 3IFLL 2WQ8A 1QBLL 1IILE 1WTLA 3QDJB 1U8MB 3BUTA 3JUYA 5E8OA 5DTFB 3SGEI 4DFIA 3ZE1E 3FB6B 1A14H 4Y2DC 3KXFB 4Y8DC 1RI8A 5E6ZA 1F42A 2EE3A 2G75B 4QRPE 3GK8H 3U36A 3V8CA 1M6OA 3QI9D 1DQLH 3VRLE 3L3DB 5DR5L 5BZWA 1GPOH 1LQSR 4QHNA 4UDTB 1CBVL 3EJZC 4DUXA 1KB5A 4OLEA 1EAJA 3RKDC 1MLBA 3MACL 3BW9B 3NFSH 4P2RB 4RAHA 3OJVC 5E1AB 1I3VA 2YBRA 1FLRL 1JGUH 3BVNB 4KQ3L 2LABA 4HAGA 3X14A 3P0YH 1AFVH 3PP3K 5F9DC 5C9JA 4RIRB 5C0AB 2Y36H 2O5YH 4DUWA 4FFZL 3C09B 4YX2H 3QHFL 4KAQH 4TULL 3VXSD 4Z7WA 1KENL 5DUBB 4PPTA 5EU6E 1MHPL 5ACMA 2JB6A 4ALAH 4LMQI 5F9WC 3F8UB 4MQXD 5BW7A 3BDYL 1HQ4A 4KI1A 2IALB 1DDHB 3EYQD 4YFEA 2IH3A 1ORQB 4KMQA 1AE6H 1HXMB 5J6GB 2F8VA 5DQ9A 1GGCH 2CO6B 4RGNC 2VLLA 2VO5A 5DD1H 3L5HA 5IB3A 1ZE3C 1JPGA 1SM3L 2ICWA 5GHWH 3UPCA 4IHOB 1G1YA 4PJCF 1YY8A 2Z92B 4ZDHB 4Q97A 3VFRA 1OAQL 3CZFB 3UTZA 4HUVA 4UT9L 4DQOL 4JRYA 3IDXH 4PS4H 4LCIL 4KZEH 5MERB 4QF1A 4YPGB 1ZLUK 5I6XB 4LEOB 3LQMA 3MGOB 3V6OC 1G7LB 4PJHB 5DXWA 5EFIB 3HG1D 5HHOA 3NCYP 1MCOL 4Q6IB 1IGTA 3GMRB 1QFWI 1RZJL 1RZKC 2ITDA 3V5KA 1BFVL 1RZ8A 1A02N 1IJ9A 3CXDH 3FN9A 3G5ZB 4GLRI 3CVIH 1K8IB 1NUFA 2VSCA 2B5IC 4JFED 2A38A 1F97A 4OBRA 3GDBA 5CLTA 5GRUL 4R96B 2HWZH 2XT1B 2IAMA 1XT5A 4OZGA 3DHJA 3B9KD 2XZQH 1OGAB 3QQ4B 3MV8D 2VQUA 2OBGA 3SGDI 1NANH 5JDSB 3B4NA 3RGVA 4XNUL 3FFCD 1D9KB 4JFZH 1L0YA 1WWBX 1NLBH 1HKLH 2FR4B 2DBJA 4JRXA 5C2UB 3NCJL 1MRFH 4OCWH 4RFEB 3VH8G 2VXVH 2KZ1B 4DW2H 5CBEA 3B8YA 1BGXL 1JNNH 4WUKH 4WWID 1N6VA 3MLTA 5EU5A 5C0FA 3Q5TA 2W91A 2X4SA 4XRCB 1DL7H 2AABL 1T89C 1BBDL 1IZJA 3VXRE 4NC1E 2EEBA 1M71A 2AJVL 5GGUA 1N6UA 1FZMA 5EU7C 3P0GB 1MWAB 3FOMA 4X7DC 1RUAL 2APWA 2F53B 4OZIE 2EIBA 4M3JA 4MAYB 4HWUA 1LP9E 4HXAL 1MCRA 4CU8A 4YR6A 3GSXA 5ADOL 5BVPL 4JPVH 1PLGL 5GJSH 3I50L 3HS0B 3QUZC 2AJUH 2B0SL 4LBEA 2J8UA 1KB5H 3G04A 5D6DC 1EEQA 1IM3B 3ULVH 4U6HB 1LO4H 1IC5L 1R5IB 2APFA 4NSKA 4WIQA 4XZUA 4HPYH 3BJ91 4WUUB 3O9WA 4OCSL 1LGVA 3WUWB 1WWCA 2BOBA 5D7KD 4XBGA 1U2HA 1OTTC 5DFVC 5JHLH 1OTUC 4IEFB 4LSUH 5CKAA 4P4KD 3D39D 1ZHBA 4HWZA 1EA9C 1AGFA 1T1YA 5T1MA 2BZDA 3WFDL 5F7KC 3RWHA 1H3UA 1IL1B 1NCAH 3UBXA 3IDJA 4JFPB 3IU3A 1K2DB 4JM2C 4OCXL 3V4VL 1MREH 1VFBB 3CVHL 4L9LA 4TVPL 3QDGE 4N0UB 5DRXB 3GSOB 2APVA 1VA9A 3CU7A 4NRYB 4N1EA 2QQLH 2WP3T 3EYVA 1HH9A 5KVDL 5KVFH 3PHSA 2OM5A 5E2JA 1XIWB 4HZLB 1HILA 4RGMC 1ORSB 4MX7A 1EX0A 1XF4A 4MJ2A 1J5OH 5KANG 4MDJB 4PRPB 2H8PB 1JWMA 1CIDA 3I2CL 3A67L 2GK0A 5KAQG 1OY3B 4U2ZA 1F4YL 3Q48A 1G7IB 3MRLA 3NCYS 1LK3L 4E0RA 2N7AA 1YEFL 4AEIH 5D2NC 3P11H 4KTDL 1ZANH 4KVCL 5DSCB 2VZOA 5CEYB 2CDGB 2EDOA 2WSKA 2ZNXA 3BT2H 3RUGF 1MCEA 3Q6FB 2D9CA 5DK3A 1RIVH 1IQWL 5HHME 1FBIH 3BEWA 5CFHA 3TA3C 4FQ2L 3PG2A 3O4OC 1VESA 5L8JB 2IMNA 3FO2B 2QEJA 5FKAA 5ILTH 5SWZE 4W68A 3D2UA 2O5ZH 5AUMB 2H41A 1J1OL 4O2EA 4HMDA 1YUHA 1YEIL 1ZV5A 1JYVA 2JE8A 3OKDA 2G5BB 4RQQA 3V6OA 3MUJA 4JFYB 4MJ5A 3DXAB 1RUQH 3X11A 3L6FA 3I02B 4KRPC 3FJTA 4POYA 4TVPD 4ZFOB 4QHKI 4WGVB 2X89A 4PJDF 4LOUD 2C3GA 4B41A 4I4WA 2OK0H 1EERB 4OUUA 1K9TA 3NGBB 1INQB 2H6PB 4XAWH 2FWOB 4Q9RH 1G9NL 5FO7B 3TCLB 3WNKA 1QRKA 2EC8A 4QRQA 4G5ZH 1NFIB 5LCVH 5I75B 2O61A 2BC4B 4NUJB 5CAYB 2ICES 5DUPH 4XP9L 3RL1A 4JM2F 2H2SC 1TZGL 5A2JH 5I8OL 1C5CL 3OAZK 1JJUA 4QYOB 1RIUH 1GOHA 1BZ9A 2XN9A 3M07A 2AP2A 3KS0J 1ULVA 3QUXB 3VGHA 4BSWB 1KLUA 4XP6H 5JPNA 3H7LA 4XI5C 1AIFA 2OTUA 5IB2A 5DK2A 3MV7A 4BZYA 4QXWA 2CKBA 3BKCH 1U8JA 4RX4D 2YD2A 2XRAH 1NGXB 5LGJB 4P2OB 4WHYG 4MCZB 3OZ9L 4CW1B 2I26N 2VE6A 1ND0A 3FQUA 2B2XH 4W81A 3HLAA 4Z78B 2V7HA 3KNBA 5C07B 1DUYB 1NCCL 3P3YA 3SDXB 1QBLH 1YN6B 1ITCA 4NQCD 4YXHH 4QNPE 3ZE2F 3PV7A 1XF2A 3REWA 1FGNL 2YUVA 3VXMA 5IQ9A 3VMNA 3ZDZF 3QUZA 4BFIA 5CJ8A 3ZDXE 3VXNB 5DR5H 1MI5A 3GMQB 2JJTA 5DS8A 3RVWC 5D9SA 3TESA 3HAEB 4ZTOL 4LPTA 3BZFB 5EU3B 3LV3B 4M8QA 5MI0C 3SDAA 2ADJA 3DX6B 3MCKB 4Y19D 3QUYD 1QR1B 3MACH 1U8PB 2X7LA 4NQDE 5H35B 4DVBB 3G6DH 5F3HB 3NZ8B 3CFDA 5D1ZB 4NKOB 3RP1A 1ZGLB 3FONB 3PHOA 1IVLA 2YKLH 4Y7MA 1TFHA 2UWEF 2OTPA 2R9HD 5DRNB 1CT8A 3ARFD 5GGTL 3KHQA 1KTKE 4KXZH 3AB0B 1S7RB 2V9TA 2DQGL 3HC4L 4WTZG 1I1AC 4FFZH 3TZVB 2DAVA 3QHFH 4R97C 2WWKT 4TULH 4PP1C 1CWVA 1QFWM 4PJFA 4JB9L 2VLRD 5T1KB 4KTYA 2FH8A 2FZ3A 2GJ6A 3HN3A 3BDYH 5HY9A 5J7CC 3INUH 4H5SB 4Y5VB 3QWRA 2R0ZH 4JY5L 4N90D 4JAMA 1AXSB 2X10A 4U6TA 3ZKSD 2EE6A 1DFBL 2GAZB 3SKJL 3RVUC 2X1PA 2V5RA 4KPHL 4HIXL 4LCUB 2DMCA 3BX7C 4XCYA 4CVXB 1DANU 5D2NA 2R2HA 1VDGA 3LEYL 1DQDL 3VDAA 3MUY1 1P4LA 1L6ZA 3JTTB 4LCIH 5D5ME 3QEQA 3GJFA 3BIBX 2R0WL 3AY4A 2VDKL 4CGTA 4ODSL 4UINL 2NTFB 4CU7A 4M6NL 1ZEAL 5B4MD 2BY3A 3MNVA 2EYTA 2IANE 2B20A 3PV6A 1EEZB 1UADC 4WI8A 1S9VA 1S7WA 3QIBC 4JN2A 1ZT4A 4LARL 3U46B 1Z6JT 1OT2A 2ATKB 4DZBB 2HFFB 5HHXH 1I4FB 3VWJA 4PV9B 2YPVL 5E5MB 3KHOA 5B38A 8FABA 4XNUH 4TQEH 1DSFL 3N06B 1FFOA 1FZKB 4RFNB 2CKBH 2BNQD 2ESVA 4OCRL 3OKMB 2YC1B 2JCCB 3DVNA 3EOBB 5GZND 3KYOB 4MD4B 5A2FA 3L7FA 5C0GB 1AC0A 3HE7D 1BGXH 4NZDA 4JZOB 3DV6A 3MO1B 3F6LA 3KPRA 4Y5XB 5DJ6A 5IBLC 3UO1L 3HI6L 2BOCA 1F3JB 3EAKA 1P2CB 2R39A 4MZ3A 5FYJH 3C60A 2NY0D 4XNZC 2AABH 5EWIL 4NKDA 3MREB 2V17L 2GQHA 2NLJB 2EO9A 2GITB 5FUZL 5JMRA 3IAQA 4TUOA 4JREB 2AJVH 1S9XB 4ODBD 1CD9B 3OJ2C 1RUAH 1ZHNB 5J6HB 5FA3B 3PHQA 3UTPD 1RUPL 3M17B 4LSPL 3HUJE 4Z7OE 4POZC 4LHUA 5BVPH 3DX7B 4ONFH 3UXFA 3X3FL 3I50H 3CIQA 4NKMA 5CCKL 2B0SH 1UJ3C 1AQDA 4OSUL 3DUSA 4IMKC 5CSZB 3V0AC 5L2KB 1S7VA 2NYYC 1YNTB 3RY6A 1EJOL 3K81A 4JR9L 4X4XA 4Z5RA 3B8SA 4P23C 2YD3A 3K7UA 3ARDC 3C87A 4BJLA 3HG1B 3SDCD 2COQA 5JIIA 3JZ7A 4PTUA 4KWUA 4J8RA 1QFUL 3MLXL 3MLRH 1KCUH 2VZVA 4XNQB 2XTJB 1U95A 1CGXA 3FMGL 5GSRB 3F7VB 2R56L 3W0WA 5IMLA 1X6LA 2WWMC 4JFEB 3ALWA 4EI6B 1MQ8A 3WFDH 2E9WA 4M61A 4X0KA 2HRPL 4P9ML 4HS6B 2YXMA 5E2VH 1KPRB 4WW1A 5F9OH 3C09C 3CVHH 4JFQA 4L3EE 5JO5B 3ZYZA 4PJ8B 3WFHA 4TVPH 4UT7L 3FRUB 1ROWA 3QPXH 5HHQA 5K9OA 2HJLB 1E28A 2CIKB 2ZZUT 1IMHC 1YMME 3V2AR 3LKRB 5KVDH 3NFPB 4GKNA 3EO1B 4JFOA 2D4DA 4JVUA 5EC2B 5C08D 1PG7W 2NX5D 1NC2D 3VA6A 2BVOA 5IP4A 3R0MA 1CE1L 3JV4A 5J1AB 1BEYH 1PVHA 3ZKND