5KS9A

Bel502-dq8-glia-alpha1 complex
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
182
structure length
182
Chain Sequence
DIVADHVASYGVNLYQSYGPSGQYSHEFDGDEEFYVDLERKETVWQLPLFRRFRRFDPQFALTNIAVLKHNLNIVIKRSNSTAATNEVPEVTVFSKSPVTLGQPNTLICLVDNIFPPVVNITWLSNGHSVTEGVSETSFLSKSDHSFFKISYLTFLPSADEIYDCKVEHWGLDEPLLKHWEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class II histocompatibility antigen, DQ alpha 1 chain
publication title Diverse T Cell Receptor Gene Usage in HLA-DQ8-Associated Celiac Disease Converges into a Consensus Binding Solution.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 39
structure length 182
sequence length 182
chains with identical sequence C
ec nomenclature
pdb deposition date 2016-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00993 MHC_II_alpha Class II histocompatibility antigen, alpha domain
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5ks9A02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 5ks9A01
2HRPH 3BHBA 3VFUB 3ROLA 1KPVB 3ZE0F 5F70A 2VR5A 5SWQA 1Q9WB 2Q86A 1NC4A 4F8QA 2HTLC 4RFEA 3P9MA 1EH9A 4PJAE 3D87B 4UT7H 2DYPB 2OLDA 3D69B 2Z8SA 3JV6B 4GRLD 4GFTB 3VXPB 5K9OA 3VXUD 3DVGA 5TE6H 4EXKA 4HXBL 4KXZI 3OQ3B 1I3UA 1YNLH 3D85B 1MLCA 2ITDA 5AG9A 4E0RB 1N64L 4X6BA 4M1DH 4NN5C 3OF6D 1NEZB 4K7PL 4Z6AT 4QT5B 2V7HB 4XCYB 4PJDA 4R4NC 3MREB 3D0LB 5H8DA 3RX7A 4K3JH 1C1EH 1MHHA 3R06B 4YDKL 4WCYH 4JRYE 4G6ML 2O61A 5GGTH 5T1LB 4ORZC 3MRRA 1NBZA 2E9JA 5CGMA 4JO1H 3SY0B 4ODVL 3IDYC 3MRKA 3O45B 1YEFH 3MLYL 2HG5A 3D0VA 1TXKA 1Z9SA 4L8SC 1N4XH 4NFDA 1JPFA 3CFCL 3GMRA 4LVNC 2XWTA 4S0SD 4U7SA 1OVZA 3MXWH 5TDPA 4NQVA 4ZYKA 1QFPA 5E1HB 5KVFL 2XPGB 1DUYA 1IT9H 3KLAA 1FC1A 3L5WA 3CC5B 5DUML 4HAFA 4QRRE 1RK1B 1RVFH 5D8JL 1MH5A 3T09A 3HA0A 4NZRL 2VQUA 3UPAA 4HEME 4Y19B 5GSVA 2YEZA 2MMXA 2X4RB 3U1SL 4YPGB 1G9NL 4HT1H 3ES6B 1FFNB 5C0AA 1DE4A 5HHOA 4D0BA 4X7DC 2WBJA 4GBXD 5HI4C 4PGEA 3O4LD 3T0EC 4JKKA 1Y0LB 5F6IB 4GG8A 4WY7H 4CKVX 1DBBL 2AEWA 1P6FA 4JREB 3OB0K 3MLTA 1IGTB 2ZUTA 5CCKH 1V3MA 1FIEA 4XCCL 1JGDA 5GXBB 3LKPB 4UV7L 3H3PL 1FGVL 3OGCA 4RFNB 4AEHH 1QEWA 4TOYH 3NFPA 5JHDD 3NZHL 4L3CB 4YHKH 1QR1B 4L4TB 1KIQB 2X4PA 2GITA 5GRWA 1H15B 2QTEA 1SYVB 3HMWH 4IRJA 4GKOA 4U6XA 5J11B 4XVJH 1ZT1B 2NW2B 4Y4HB 3UO1L 1SJEB 4OCWH 3GUTB 2H32A 3QQ4A 1G6RA 2B4CL 1QKZH 2NLJB 3FZUC 5GRUH 3TN0B 3BE1H 4UTAH 1K4DB 1OTUC 2ZCLH 1JRHI 1NAMB 4NHUB 3TWCH 4KI5D 1NC2D 4O2EB 1S7QB 4PJXF 4OZIF 4PJ8A 2X9YA 4LEXL 5D7IA 3CLFL 3P0YL 2VKWA 1W8NA 1ONQB 3Q3GA 2EH8H 5I30L 4RMQA 1S7TB 4LHUD 1SJHB 4WRLA 3NH7H 4L9LA 4YDLC 4WENB 3CFBB 1L6ZA 4JN1H 5BW7C 4JDVA 4Z7UA 5CBAA 3MRHA 4MJIA 4LSPH 5GGSB 4ZAKA 5JO5A 4GMSL 2G75B 2D9CA 2CH8A 2Z9TA 5EU7C 2XKNB 3ZTNL 1NJ9B 2JJTC 2ARWA 4R9HA 3THMH 3FO0L 1OAUH 2AI0H 3KXFA 2I25N 3BSZH 4NKMB 1SMOA 3AY4A 1XGUB 4LCWB 5D71L 2GIYA 2ZSVB 5EBLA 3D1MC 1YDPB 5EZJA 1JWUA 3R4DA 2A2QT 2P5WD 4XPHL 4JFQB 4Y4FA 5GRVL 3HZYA 4HLZG 4H26B 4OLUL 3CVHL 3BKCH 4HFWA 2P8LB 4P2RB 3BKYH 4KQ4H 3WJJC 1EEZB 3VFVA 3V6ZB 4PJGE 5F7NC 3PWJB 1D5IL 1AGDB 1BIIA 3G5YA 2JELL 5D7LA 4UBDC 1KB5A 3LS4L 5EPMB 1I7UB 4CAGA 4P48A 3QR2A 4KUZH 3L3OA 1ZLVH 4LCCA 5ENWA 3DWTA 2CGRH 2NYYC 4O02H 1IEBB 2FO4B 3AREA 4XPGL 4CU7A 3LN4B 2Y23A 2R2BA 3MROB 2MJWA 4G6AC 3ZHLA 3L5XL 4NBZB 4CU6A 4KVNL 5BMFH 3JV4A 5CSBA 3PIQA 3SE3C 5KS9E 1IGJA 1BD2D 3PHOA 2E8ZA 1GSMA 1GGBH 3U0PA 3BIBX 4QRTB 1JNNH 4KXZH 1YNKL 1ZHNB 1U8JA 4RGMB 5D6CA 1YPZA 4DKFH 3FB7B 3STBA 4YWGH 5MP6H 5IOPA 1UM4H 3FFCB 3CFKB 3BN3B 3QIUA 3QZWG 4ODTH 3JWDH 3MUHL 1MFBL 2E5EA 3PQYB 3ILPA 3WMSA 4TQEH 1XAUA 5D2LE 1KJMA 5BXFA 4G8EA 4D94A 5SWSE 4JM2D 3MV9D 3GKWH 1WC7B 1RU9L 3P4NB 1FL5B 4XVTL 2LAGB 2ZPKH 3RFZC 3V5DA 2NY1B 3DRTB 4MNHB 3TC9A 3TVMD 1QLRB 2EDEA 3WS3B 4WEBL 2HLFD 2F74A 3FQRB 4MA8L 4XPBH 4NWTH 4P9HH 2I9TA 4YNYA 1XF1A 2R0ZL 2C26A 1P1ZB 1AO7D 4KZEH 3QZWB 1RMFL 4LVOC 2HFFA 3KPPB 2OYPA 3PHQB 3BISA 4LQFH 3W5NA 2YC1B 2JCCE 2X4NA 4MCZA 5FDWA 4GAYA 3RI5F 5GGRA 2BFVH 2OTUB 5AYQA 1TJIL 3G5ZA 2GEEA 5IHZA 2PXYD 35C8H 3RWCA 2IH1B 1RULL 5L88H 5TPWH 3QDJE 2WLYA 1TTUA 1ZGLP 4GQPH 1G7IA 1KBGL 3HRZB 3Q6GL 4OT1H 2Y07H 5EZIL 2IWGA 3FOLB 1L0YA 2QADB 4RGND 1CGXA 5GJSL 2A6KB 3BVNA 3WXWH 1HE7A 1JK8B 3S3JA 4LAQL 4NGHL 4XP6L 5CEYB 3L3IA 3FQXB 4YDJA 1I4FB 3EUUA 3QDMB 4OLWL 5T3ZL 1NSNL 2ADFL 2OTWA 3WIHL 4LF3A 1R3LB 4Z7WB 1JPST 5IFAH 5F7EL 3NTCL 5DQDL 5C0BA 3HI1B 3FB5A 2CLZA 3QDAA 4K3DL 1FPTH 4I77H 3I9GL 3KYNB 3TNNA 3MJ9A 4QCIA 3SN6N 1OB1B 2DI9A 5IBUG 3SO5A 1UKQA 3HZVB 4OGAC 3WFEL 5JDJA 1J05A 3C6SA 2X4UA 4MCYB 5D96C 5IB2A 4KKBD 5EWIL 3RWDA 3BPOB 1JRHH 2FJGB 4PJDE 4RA0C 1CLOH 1HQ4A 4ALAL 4OQTH 2V2TB 5EBMB 4OGZA 2M1KA 2OTPA 3S34L 2XA8L 1DQML 3H0TB 3IDNB 3WIIH 1RZ7H 1IGIH 5HYQB 2BHZA 5GZOD 2H26A 3L3HA 4KROC 5CINL 5IBUB 4NJ9H 1I7ZA 5CGYC 1OLZA 5FO7B 2FLBT 1KJ3H 1U8PA 3QUML 1WSST 2C9AA 4G7VH 3PG2A 4LDOB 4NT6B 4N68A 4LFHG 1QLEH 1PYWA 2BSSB 3CUPA 5I1IH 2VLKE 2BC4B 3MLPA 2EDBA 5IG7A 1I75A 4UT6L 1LNUA 4OKDA 3K80A 4ZD3L 3L5JA 4LLUB 5HVWA 1AD0B 1SBSH 5FGBA 1N64H 3P0GB 3QUYB 4K7PH 1RIHL 5EORH 4HJJL 1IZKA 4IMLA 1N2RA 5INCA 4CN6A 3I2CL 5HYSA 4XAWL 3O6ML 2JJSA 3DSFL 3BWUC 1F42A 4PJHF 3O2VL 1SEBB 4Y4KD 1QQDB 4L8DA 4IOFD 4X6EB 5J56B 4ODVH 3NFSL 4PRAB 4JPWH 1MHCB 2AV7B 2Y7QA 1PEWA 3CFIC 1BVLA 1X5LA 1MRDH 1KJ2H 3TYFA 2JIXA 4ZFZB 3LN5B 3SKOB 2YD9A 3O2WL 3MO1A 4X83A 3G5XA 4HSQA 1JZ7A 1V3JA 4LLAA 2YN5A 5DUMH 1RI8A 3QG7L 3I75A 3EYVB 4FG6C 2MFNA 2AXGB 3P11L 3BKMH 2PCPB 3LKNA 4X5LA 5LCVL 1AXSA 2SEBB 2JK5B 5F7YC 1EHLL 3O8XB 4L29B 1ADQL 1SY6A 3GSNL 3EYFB 2AKRA 1MRCL 3G6AA 4XVSH 5E5MA 4PRBA 1FBIL 2YMXH 3P4MB 4TUKL 2NY6D 5D7IE 3Q1SH 4G8IB 3ZL4H 3HUJB 1EO8L 4NKOB 2D7QA 3P2TA 1JMZA 4Z95L 3QEQD 4FQPA 4PR5B 2FIKA 1IQDB 3UPRA 1A02N 4HX1B 2Z91A 1DQJB 1FG2A 2PNDA 1T83A 4L8BB 3GGWA 12E8L 1UACH 2LTQC 1J1OH 4I0KA 2UZXB 2AABL 1ZANL 4BJLA 1EVTC 4JJ5B 1KLUB 3ALPA 4IOIA 5DJ6A 4Z0XB 3CXHK 5HHPB 3IJSA 1EHAA 3PGFL 3QXAB 1MLBB 1A2YB 1MWAA 4DZBA 2GYSA 2W65A 3BWAA 1FRGL 4HG4J 3O3DA 4QHNA 4PRNA 3CGTA 1Z9OA 4P2QE 3QO0A 4Z78A 3GBNH 3RL1A 1K3ZA 1MIMH 3RTQB 4ZTOH 4E5XB 4KHTL 1CICB 1I3RB 4PRHA 3P4LA 4F7TB 4Y2DB 2AEQH 1P4LB 4J4PD 5IB4B 5DD0L 3WSQL 2IGFH 2XWBB 2R1WB 3E2HC 4YO0A 3VWJB 3AXLA 3UTPE 4IRSC 1RJCA 5C09A 2GJZA 3CLFH 3MV7E 3P0YH 4KGJA 5I9QC 4M00A 3KAAA 4LRIA 5HYFA 4XCNB 1QBLH 1UZ8A 1NGWA 4S1DC 4LIQE 1DZBA 3TNMB 3DV6A 2IBBA 3MUGB 3NACL 3I3DA 1PQZA 2AK4E 1PZUB 1B3JA 4HWZB 4X99B 4JFOA 2XRAL 3FONB 1YPZE 3IT8D 3QHZL 1WFOA 3QQ3A 2MQ3A 5D71H 2JJVA 5JIHA 3RDTB 5I75C 2FZ3A 1G7LB 4GQ9H 4I4WA 2K3TA 2C4FU 3DUHA 5I8OL 5K9KA 5EB9A 3CVHH 4M61A 5A2LH 2C3GA 2DQIL 2PYFA 1CQYA 4HUKB 3TYGL 2B7DT 3VA6A 4PJ7B 3TBVB 1T3FB 1RSFA 5F1SA 1B0WA 1JWSA 4P5KB 4A2MA 4YHZL 5ALBL 4OGYL 4OFDA 4NQUA 3CLEL 1CXHA 3LS4H 1HKFA 3F6IA 2R23B 1T2XA 1XH3B 1WBZA 3KWWA 2CLVA 2YXFA 5KSAD 1MJ8H 2YUZA 1AR1C 2Y06L 4E42B 4HV8B 3QEHA 1CTOA 1KCLA 4TUOA 5MEQB 1IKFL 5B38A 4HIIA 3EYSL 4KVNH 1WT5C 1D6VL 1QP1A 5MERA 3IDIA 3ZKSD 4PPTA 1JP5A 3ULVD 1C16B 3R1GL 1L9MA 2J8UA 1U8NA 4NN6B 1PG7L 1E6JH 4HIXH 3Q0HA 4I8DA 2WIMA 2WBJC 4XXCA 3EOTL 4D0CB 5B4MC 2VQTA 3MLSL 3QDGA 4MQSB 1RZKC 5DJYB 3MLZL 2QQQA 3JTSB 3D39B 3WIHA 3DUSA 4JFDE 2DKUA 4AT6A 1CN4A 1S78C 3IVKA 4F7PB 3RVXC 4M93B 4K55A 3BH8A 5DVNA 4ZXBA 5C70A 1RU9H 4XVTH 1D9KB 2GTWB 1QRND 3RHWK 4J23A 1AY1H 5F7DB 4YGAB 4WEBH 3CJJA 2OJZL 5CP3H 5C0BE 4IRJC 2V7NB 1YEEL 1NGYB 5C0ND 2UYLB 3UTOA 4G7YL 3VD9A 3X3GL 4HUVA 5IT2H 2R0ZH 3WHXB 4FQXB 2Q87A 2VAAB 4XVUC 1BQLH 2X41A 1KNOA 3TBSA 3N1GC 5JXEC 4JFFA 2QQKL 3U2SA 1NCCL 4PBWD 5DD6A 3DJ9A 2VZ1A 2HT2C 5BV7L 1GGCL 4X9GA 4Z7VA 1FO0H 1Q9KA 2CMRL 1RULH 2ITCB 4Y5VC 3U0WH 1XCTA 5K59E 4LOUD 3SHSA 3SJVB 3T65B 5ITBH 3IDGB 3SE8H 5FYJU 2DL9A 2GSGB 4HUUB 3U7WL 5CHNA 5CZVH 4JLRA 1NCUA 4NYLA 3VWKD 5IW6A 4L9LC 4NQXA 2ARJB 2VLJB 3FT2B 3B9KD 4G6JL 3DX8A 3U6RB 4K8RL 5BS0A 32C2B 2X4OA 4ZAKC 3SDXE 3MV9E 1IBGH 3ARFA 4WIQA 4L4VD 4P4KD 3O6FD 3DUUB 4HS8L 5F7EH 1PX4A 1YJDL 1XR8A 2GUOB 4RA3A 3G6JE 2FATL 2B2XL 4HDIB 3N9GL 5B39G 3WFCH 4FXKB 2QEJA 4K3DH 3AY4C 1T4KA 1DBML 4LVHB 4WI8A 5LBSL 5L2KD 3GI9L 4Y4FC 5ITFA 3K46A 4AL8H 3TH2T 2J6EA 2PF6A 1NKOA 3DPBA 4PJFF 4MD4A 3V8CA 3B5TA 2BX5A 2WINB 5C07A 1DBKH 1QYGH 5IJVA 4OM0H 4WGWB 4M62H 1UQSA 2XTJB 2VZUA 3CDGA 4R2GC 5FOBA 1QR4A 3SDAB 5B39B 3QUZB 4OB5L 3AREC 2ORBH 3PJSA 4RGNE 4UTBL 1QSFA 4JHWH 3VGEA 4PJCA 4F57H 5DUPL 3OXRB 5I17A 5DSCB 3DRQB 3MLUH 1S5IL 1YMMA 5DGRA 2APBA 3MRCB 1NMAL 4JY5H 4JO3H 5CUSH 2F5AL 3PDOB 5J57B 1QLFB 1YEDB 4S2SB 5I18H 5KOVC 4OD3H 2NY7L 2W60B 2XFXB 4AH2A 5LAXA 2HWZH 3P77B 4OD2B 4QRPB 4RX4A 4MJ6B 1OGTB 3F65A 4FQIH 3ZDYE 4FZEH 5E8EA 2X1OA 1FZOB 4P46D 5GSRB 2ZKHH 3I2CH 1QVOA 1LE9A 4PP2B 1CFSA 3DSFH 1JUFB 2PW1A 4X4XA 3SDDB 1NAML 2K1MA 2VXUL 1FNGB 3C60A 5F89A 1EZVX 1YY8B 3ULVH 3CSGA 4XX1E 3EFFB 4H88L 3IDXH 1OGAB 2BSTB 1UM5L 4XGZB 4PRDB 5E4EC 4HFUL 5GGVY 5LGJB 2QQLH 3RGVB 3O81A 1UJTA 3O2WH 3E8UL 1H8NA 1RHFA 1A7NH 1WWAX 5KS9F 2A74B 3PL6D 2FYYA 2XACC 1Z3GL 2GJ6B 4ERSL 3LKOA 5K9JL 4EDXB 3REVA 3MXVH 4XBGB 1TCMA 3HPLA 2E27L 1D5MA 4B0MM 3G08A 2YPKB 3IXAA 1C8PA 4PJBE 1HH6A 3A0OA 5DC4B 1ADQH 2BNUB 4HWEL 1UWEL 5IMLB 5D2LF 5I1EH 4JQXC 1ZVSB 4WW1B 1ZA6A 5B8CA 1YNTA 5HDOA 3P40A 5HYJB 4QTHA 2DYPD 4LSQH 4XMKH 3MRFB 2I26N 1T22B 1KULA 1JNLH 1C5CH 2DM2A 4PG9A 1WFNA 3NIFF 5ADPL 1U8IA 3D85D 5E2VL 2IANA 4MAYB 2FX9L 1VGKA 1X5ZA 3QAZB 3OHXA 4P23C 1CU4L 1E28B 1XEDA 4KC3B 3IETB 4K8RD 3VE0B 1EDQA 5CD5D 1I8MB 4UT9H 3V6OA 1CVSC 4ORGB 2M2DA 4JZNA 4YHOL 3T3MF 2VDKH 4P3WA 4KKCC 5DEFA 4CMMB 5T1LD 4MS8D 3K4ZA 2OK0H 1CFQB 1EFXA 3ZLQC 1TZIB 5C08B 2BCKB 1JYWA 4JR9H 1XGQA 4F15B 5D5MA 3MODL 5DHXB 4PJEB 4WU7A 5DYOB 1NMBH 3LV3A 3ZSSA 1HN1A 4KKLD 5J4MA 1XCQA 1YY9C 2R15A 1DUZB 4DAGH 2GSIA 4MX7B 5FHBL 4V1DA 1P7QA 2FX8L 3NOIA 3RNKA 4IM8A 5MI0B 3MRIA 1JCKA 3PP4H 4NQDB 1U2CA 1QO3A 3UZVB 1G9NC 4N1EA 1DQLH 1UB5B 2FHCA 4N0UE 2M26A 2QHRL 4Y19D 4EN3A 3T77B 2FBOJ 5F3BA 5IMOA 5DHYA 1A6ZA 3H9YA 4ZUWB 2J8UE 4PLNC 2NY4C 5HTSA 3LEXA 4RRPA 2OJEB 1T2QH 1OAXH 1CXKA 2IPKB 1S3KH 3MSPA 2OL3B 2E7CA 4AQ1B 4QY8A 4EXPX 3EYOA 4ZTPL 1MQKL 2V5RA 5GJTL 4IEFB 5IEHB 5T3ZE 4U1IB 3PUCA 4L4TD 2JJSC 2YSSA 4FQCL 3B9AA 3DROB 3GK8L 1CGSL 3IF1A 5GIRA 5D1ZB 1FIGL 3UAJC 2JJUA 1GVIA 1X6NA 3UDWA 1A7RH 4YHZH 4K7FA 1D5XA 3GMLB 3PWPA 4BZ2H 1WLHA 2AXHA 4WDIA 3OR6A 1VEPA 1G6VK 4MA1C 2B4CC 3IRZA 3RWGA 4Y4HD 2F53B 5EUOA 4HWNA 4NUJA 3L3KB 1BZ9B 3C09B 3LPFA 4POZC 3TN0D 2EDLA 1U6AL 4NZUL 3QNZA 5EUKA 5FYJL 4QHKJ 1IKFH 4XNQA 3WLBB 3R0NA 5SWZA 4NNYA 1D6VH 4R3SA 3TM6A 2H9GB 1U58B 3REWB 4MDIB 3RUGA 2CRIA 4I3GA 4CW1B 4N9GB 3M07A 4AMKH 1GPOL 3F7RA 5H37H 2WP3T 1AIFB 1K5NB 2D3VA 4Z7VE 3VRJA 4Q58C 3MV8B 3SDCC 3NZ8B 5CD3A 4N0CC 3WUWA 5I8KL 2JB6B 4Y8DC 4OIIH 1I1RA 3B4NA 3MFGB 3CZFA 1S7RB 4PRIB 2HKHH 1NUGA 3ULUF 1MIEL 2Z4QA 3SDYH 3MJ7B 3GIVB 4N8PA 3HAEG 4XCFL 3S4SA 5GGTA 3KLHC 3BP4B 2DB8A 5F8RC 1T83C 2P1YA 4ETQB 2ZUXA 3C6LA 4K3HA 5L7XL 4YJZL 5C2BL 4G80B 4HQQL 4H25B 4LCWD 1LO3H 1X7QB 1KCUL 43C9B 2OJZH 4KMQA 1KXVC 3V2AR 1E6OL 3MRBB 5IVXA 4CDHA 3UTSB 4JANA 5F9DC 1EAJA 2G2RB 1U3HA 3RVUC 3LPWA 4P2RD 1YEIL 2D7TL 3L6FA 5DUBB 5FO9B 1DLHB 2IMNA 4OFVA 2MQ0A 1XFPA 3OR7A 1BEYL 3HAEB 1NCCH 2H8PA 4YGVA 4JFPB 1TNNA 4KH2A 4YHNB 1EMTH 3CDYA 5I19L 4Y88A 5C9JA 5D1QA 3MRQA 2HJLA 3HZKB 2XZZA 5IMMB 5D7IF 5B3JF 3ARBC 5J12C 1P9MC 4LRIC 5D7JA 1AGEB 4YK4B 5B3NA 5C8JB 1FVCA 4FFYH 3ZDZE 1RY7B 2EXWD 4J12A 4Z77A 4K8RH 3T04D 4Z7UF 1J12A 3UBXG 4QHKI 2J88H 3AMKA 3WLWD 4KJWD 4M7LH 2VDRL 2AEIT 2KQNA 4R97C 3FFCD 4I18C 3D18A 1YMME 4JFEE 4U1KB 1F6AB 1LO2H 3EO9L 2FATH 4JZJA 1DBMH 4PRPA 2BVEA 4RGOH 2DWEA 4HPOL 5IHUL 2CDGB 1EBPA 2AJVL 3CH8A 4Z7OE 2G60H 5EA0H 1MCDA 3F7YB 5AWNL 5TFSL 2NY1D 1KENH 3JTTA 3MA9H 4NSKA 4YR6A 2I07A 4OJFH 4UV4L 3SGJA 5C9KA 3P73A 2R1YA 1FE8L 3VU2A 3N85L 3BIKA 1MCOL 4AM0B 3UBXB 1WAAA 1MCBA 3DYPA 1F3JA 4J1UB 3PWNA 4JPKL 2G9HA 1C5DA 4NOFA 1XGPA 3QFDA 1HXMA 4WI4A 3LH2H 4TVPL 1F45A 3STLB 1H3GA 4XNUL 4QOKA 1WWCA 2OSLA 3U30B 1J0ZA 4WWKB 1J9CT 1EXUA 1MFAH 3MACH 5IROC 4DVBB 3MOAL 5DUPH 3MRLA 1KT2A 1E4KA 1KFAL 4Q0XH 4X7SL 2FGWL 3BGFC 1R5IB 3WFHA 4DQOH 2A9ML 4L4VE 1H3PL 2FJFB 3TCLA 4DOHB 2F5AH 4N0YL 3AGVA 2QADD 4GS7C 4YFDB 5F9OL 2BNRB 1XGTA 3B2UD 2ED7A 3DVFA 2D7MA 4OZGB 2A6IA 2QSCL 1IC5L 2B1HL 5IK3B 1O0VA 4ZFOB 5E0QA 1LO0H 1QFUL 4G8GD 2ATKA 2VIRA 4KRNA 5IVZB 3RPIA 5JPNB 5EN2B 2ESVA 3QDMD 1N8ZA 1JV5A 1JHKL 5GHWL 2UUDH 1BPVA 1NEUA 3QPXH 2W91A 3AB0B 3GJFK 4YAQB 4KGLA 1A7PL 5KG9A 1RFDH 1BOGB 4Y5YA 1T04B 1NAMH 5ACZB 3EO0A 2VXUH 1QRKA 2PYEB 4CVZA 5BJTA 4HC1L 1MI5E 5F9JA 3T4YB 3VXUA 1ZSDB 4NN5B 1J8HB 4PJ5B 5GRJL 1IEAA 5KVGH 3OF6A 4K3EL 5DA4A 4FQJL 2FECI 4MJ2A 3AAZB 3S7GA 2ADJB 2UV3A 2MCPL 4ERSH 3HRPA 4K2UL 5A16B 3EW3B 2D31B 2ICWA 4ODWB 2P24B 1V8HA 4QXUH 4BKLA 4OZHA 1G9MC 1NCDL 4F7MA 5GS1A 5EU5B 4JPVH 4XPTH 2Q20A 3OX8B 4HWEH 1UWEH 2DLTA 1VCAA 3MBEA 2OQJA 4YFEA 5F97E 4U1GB 1YEJL 2J12B 1LMKA 2AJZA 4NJAL 5BVJA 4YHMH 4WUUB 5BOZG 5KAQF 1T80A 3VXNB 1T7WA 2Y36L 3ZE1E 3ARFC 3JWNC 1DL7L 3KPRE 4YH6A 4FMFA 3QXVA 5ADPH 1QNZL 1A6UL 4KQ3L 4D9RE 4PS4H 2EZ0D 2FX9H 3QUYD 4D8PA 5F7WC 2MWCA 2G5BB 5DRZA 4KRLB 3UTTB 4JG1L 3CH1A 4ZQKA 3T0EB 2MHAB 1HILA 5GGRY 2DS4A 2OX5A 4GBXA 4NC2B 3H9SE 4FQ2L 3KPQB 4XHJC 1A1NB 4BFBD 4LFHD 1AJ7L 1DDHB 2A73A 3B5GA 4HLZH 3GFUA 2V6HA 1Q0XL 3EJYC 4JFYA 3KHQA 3QUXD 1K2DB 1ZXQA 3EDEA 1U8KB 1FGNH 5JHDA 3HR5A 1JBJA 4EI6A 2VDML 4JFXB 1DFBH 2BRQA 4GXVL 3VI4F 3ZDXE 3T1WA 3OAZH 2EKJA 3N1FC 3RIFK 3QEUA 1HDMB 1D5ZA 3VW3L 4LLQA 1CFVL 5JQ6L 3WN5A 2QHRH 1FAIL 3VRIA 3OV6A 3QCVH 3O8XD 4APQA 3KPLA 4YBQD 5D9SA 3KPNB 3HE7B 1NGPH 3BZDA 5C86A 1JJUA 3F58L 4XB8A 4QGTA 3C9NB 3RWIA 2IPTH 1NC2A 1G9EA 3KPOB 1MQKH 4E41B 4TNVF 1VACA 4K94H 3OKLA 3F7QA 1AFVH 1PKQA 5C71A 1K8IB 1BVKA 4YDLB 1TCRA 4OQTA 2D7PA 4LHUA 4P0DA 4X6FA 1A14L 1KEMH 3UYPA 3EO1B 2NX5E 2YRLA 5J1TC 4NC0B 3QHFL 4PLJC 5BO1L 5J1AB 3VFPA 25C8L 3QA3A 3PGCB 1DSFL 1FVDB 2ZOKA 5ID1A 4K07A 3U9UB 5LKNA 4I3SL 4M5YH 1REIA 4NNXB 2HJKB 4NO2B 3MRDB 5FKAB 4C57C 2IALA 3ARWA 2P5WA 4GRWB 4X6CA 3RTQD 3NPZB 1CICD 4WW2A 4Y2DD 2BVYA 5HXMA 2FEEL 3PP3K 1DN0B 3H9HA 3SGKA 2DOCA 4LLMA 2H2SD 1T5XA 3VWJD 1GPOH 1BJMA 1JF5A 1JE6A 1CDBA 2Q3ZA 2BOBB 5I8KH 3HE6B 2R2HA 1NMCC 1ORSB 1TVBB 4CVXB 1B4RA 1YUHB 1MFCL 2OR9H 3FRPG 5B8CC 2ZOLA 1MIEH 1UJ3A 4LMQE 5ESVB 2ADIA 4XCFH 1AXTH 4X5XA 5L6YL 1OWWA 3FL7A 3RKDD 4UINL 2EDKA 3MNZB 4PJAB 2JLLA 3EHBD 1UA6L 4JHAL 4WHTB 1VFMA 3BJLA 3LD8C 3O3UN 1U3YA 1OOAA 5C2BH 2H3NA 3LQAC 3MYJA 5EC1A 2ZCHL 4ELKA 2NY0D 1BD2A 3RDTD 1T1ZB 1KJ2A 4KJPC 1I8IA 2ILLA 1PBYA 4WHCA 2F15A 2Z0BA 5GZNC 4U1NA 5GPRA 4HZLB 1OSZA 2GK0A 5SV4A 3ZE2E 4FABH 4RZCB 4PTUB 3NGBC 4JRYB 1FZKA 2OMBA 3KR3H 2HVJA 3IGAB 2IEPA 1JZ6A 4JM2A 1ZLSL 1ZE3C 1IGCL 4D0DA 3RZCC 4P2CG 5JIKA 5IB1A 4UAOC 4MA7L 2X89D 4JAMA 5F1NB 1VESA 3RBGA 1OPGH 2C7UA 1ZT4B 4QOKE 4MJ4A 4PBVC 2RCSL 3BP6B 4LVOB 1MCKA 3T2NH 5ICXA 4QRRB 3JZ7A 2DMKA 2A6DB 4FN0A 4TRPL 4EN3C 2ZNXA 1P2CB 1SEQL 3DI2B 3BIAX 1OTTD 2DQUH 2HT4D 2I60L 2DQTL 4JVUA 1JPTL 2PXYA 3D39D 4LBEA 3PF2A 2CO6B 1NFDE 1TJGH 2FJHB 3BPNC 4JN2A 4OZFG 1RUAL 2N7BA 4IJ3B 5EU6A 5CEZD 2CLRB 2EYSA 4AIOA 5I66B 5JA9A 5KJRL 3TJHC 1D9KD 1TVHA 1YQ2A 5AWNH 2AS5M 3UYRL 5DK2B 1CDUA 3F12B 3KYKL 2DBJA 5DJXA 2UWEE 5I1CL 3CD4A 5CJOL 4MVBC 3ECBB 3PDDA 2CKBB 2J4WH 3QG6B 4M6ML 4FQXD 1G84A 4R4FH 3W9DB 5CJBA 4O4YH 3IDJB 4OZFB 1IAOA 3MBXL 2Z92A 5CEXB 2P8PB 1EO5A 3VFWB 1NCWL 4AEIL 4PGBB 1HHKB 3DX6B 1VKXB 4OTXL 1KFAH 4YXLL 5D96B 3ZT5A 1FFOB 1EEYA 4Q6IA 5BZWB 3ZYOA 4A6YL 3SJVD 2J8UF 7FABL 1WBXB 2C5DC 1CF8L 5DR5L 4ONGL 2O5YL 2N1KA 3WEXB 3KDMB 3BQUB 3A6CH 4R26L 1MCPH 4XZUA 3X3FL 1Z9MA 1JGVL 4HGWB 1FZMB 2YPVH 15C8H 5T1MB 1DQQA 1GOFA 2B1HH 2VLJD 1A1MB 3WNOA 3GMNA 3O6LH 5CBEB 1YN7A 3DGGA 5DD5L 3S8WA 2W59A 1YJDC 2R0WL 4O2FA 3K4DA 3WFDL 1JPGB 1KGCD 2X1QA 1HSBB 4KRMB 1QSZA 3MOQA 1ZGLB 4QXTB 2IBZX 2AJUL 1RJZA 2EDTA 2BNQE 1FH5L 2Q6WA 5JLZA 1FCCA 3BUYA 3LRHA 5CJQH 1P4BH 3FJTA 1W0WB 5TH2A 1Q94B 4KTYA 1U3HC 2PR4H 2NY2C 1U92B 2VDPL 1KXTB 1UC6A 5DQJA 4NC1E 4YZFE 5DT1H 5I1LB 4OFIA 4MAUL 4LCYA 1FNSL 3AS1A 3LKRB 4WVRA 5EOQH 2Y6SC 5GRYA 4PJGB 3SE9L 4BSWA 5FB8B 4Z9KB 2XTJD 4QHUB 1TJHH 1MCWM 3MLRH 5I0DA 4Z7VF 4NQCE 4DEPC 3SDAD 3IJHB 3QUZD 1CT8B 1LK2B 4F7CA 3ABZA 4XMPH 4M48L 1MFDL 1NCDH 1RJYB 3HMXL 3KPMA 2CUHA 2X10A 3HPJA 5IKCB 5FYJE 5FM5M 3OAYK 4G8GE 4OM1H 5D7JC 3QPQD 1INDL 4H8WH 3TA3B 1BX2B 1YEGH 4LSUH 2FWOA 1G7HA 1EJOL 1INQB 4PB0H 1BREA 2AGJH 4NJAH 1GCFA 3UP1A 5J6HA 4RAUB 4ZPTB 2A1WL 3IS0X 1A9BB 4OFYD 1D3CA 1ORQA 4LLVB 5CP3A 4XMLL 1FN4B 4FXGB 1IMHC 1HHGB 3DV4A 4JZJC 5HGBA 3TLRA 1RD6A 1I1AA 1GOHA 1MHEA 4KHXL 3HC0B 3FOMB 5D2LB 1IGFL 3LVEA 5F88A 2GY7B 5SWSB 3LRSA 4FQ2H 1S9YA 4AG4H 5H35B 1U8HA 2FEDC 4K9EH 3KVQA 5DLML 3SGJC 1WK0A 3SDDD 1RPQA 5C0CB 3SKNA 5D7SH 1TZHA 5CWSB 4RWYL 1VEMA 2GTZB 3FN0L 5IW3A 3QEQA 3B43A 5IFJB 1OGAD 2LTQB 4JG0H 3OB0H 1T0MA 5DO2D 4OZ4A 3H2WA 3TIEB 4LU5L 3RGVD 4OLXH 3CAFA 3STZA 4NRZA 5LXGH 3OKMB 1KOAA 2XI9A 4PJCF 2GJ6D 3S36X 4X4ZA 1DANT 5GRVK 2JCCB 1E4KC 4GW4A 1RZ8B 2FLRT 4P57A 3VW3H 1CL7I 3ARYA 1CFVH 4N8CL 4DTGL 4KK9C 5CEZH 4U1LB 2X40A 4Q6YA 3GNMH 4X8JA 1VFOA 5KBNC 5DD1H 4NZTH 3V52H 3QDJB 5E6ZA 1I9RL 3GBML 4ONFL 3QWRD 1K8DB 4PLKC 2CRYA 2NXZC 3CFDB 1OSPL 5JUEL 4NP4L 3L1OL 1W8OA 5HYJD 4BSVB 3HR6A 5DRWA 2YZ8A 3GJFB 4WUKH 3VXRA 3BHBB 5I9QB 2NPLX 3V5HA 4RNRB 2X9XA 3Q5OA 2DQJH 5DQ9A 1ZKAA 1JF6A 1WICA 2Z93B 3Q6FB 4M43L 3O3EA 2R1XA 2DI8A 1Q9OB 3GM0A 3UXFA 1VFBB 4Y5YC 5BO1H 4I2XE 1N7MH 1DEEA 1R3KA 2P4AB 2KZ1B 4OFPA 2Z8VC 5EO0B 2EICA 1MLCB 1V7NL 2ITDB 4OD1L 4X6BB 3GSOB 2HH0L 4WTXA 3OKOA 4GUPB 2FD6L 1LP9A 1NUNB 1XGRA 5C08D 1AGBB 1N59B 1ZWIB 5I2IA 5I75B 1KCSH 3HS0B 3IXTB 3MCLH 4PJ9D 1IRAY 3ARDA 3IJYB 1X4ZA 4PJDB 5HHQA 1OD7A 1V05A 5JW4M 2O61B 4OSUL 3CXHJ 4CL7A 2RFXA 4TVPE 3AROA 4DKEL 1NBZB 2CIIB 3GSQB 1W72A 2CD0A 4WU5A 2NY3B 3V0VA 5DJ2B 3MTRA 1LDSA 5I1HL 4MSWA 1I9IL 2P7TA 4NQDD 4KV5F 3LB6C 2R0LH 1TITA 2YK1L 3MBEC 1MFCH 2XWTB 1YECH 1A5FL 2UY6A 3EYQD 3OZ9L 3VRLF 4NQVB 3L9RA 2D7NA 5KSAA 3QJHB 3ZKND 1M7DA 1TIUA 2E9BA 5FYLD 1I7TB 3C5SA 5AZ2H 2DKSA 1IQWL 3PWVB 1F4WL 3L5WB 2VXTH 1S7UA 3KYOA 5CILL 5DRXB 1MY5A 2VLKB 4HKZA 1CR9L 3H6JA 3QXWA 4MJ5B 1G7QB 5F96H 2VERN 4P5TD 4IDJL 5EIIB 4D0BB 4NC1C 2WBJB 3MGTA 1BQUA 4ELMA 4GG8B 5ILTH 3DIFA 3SKJL 4W4NA 2X2YA 4AQOA 1UWXK 5H94B 1EEQA 5EU6E 1N5YL 1A0QL 5D1ZD 1AHWA 4C4KO 2NZ9C 3I6KB 2HVKA 4IIQA 2VSCA 2MTPA 5DVMA 1A6AA 4MNQB 5DMYA 3C2SA 4F9LC 3FB8A 2E8YA 1QEWB 1MCNA 4LSSH 5D5MF 3UJTL 1IGCH 1PAMA 2A83A 2F53D 4XP5L 2X4PB 5JORA 1Z6JT 5M94B 1QRNA 4YHYC 1P84K 4OLYH 1KYOK 3V0WH 3VCLB 4F2MB 3B83A 2CO7B 1C08A 1UB6B 4DFIA 4GMTL 3EZJB 1OQXA 3IU3B 1HHIA 5KVDL 2RCSH 1OCWL 4HKXA 5DI8A 3U36B 4LDLB 5DJ0A 3T0XA 4HF5L 2H32B 4HJ0D 3MV8D 1XF3A 4HXAH 4APQC 3S88H 3U46A 4PY8J 3V6FB 1KG0B 2ID5A 3LEYL 5IQ7L 1DLFH 3BZ4B 4Y5VB 2DQTH 3ILQD 4YDIL 4FQLL 5B21A 2DDQH 2CDFB 2C4XA 4X6DA 5D7IB 4AZ8A 3HG1E 5KSBA 4OLZL 4BK5A 4KJYB 1WJ3A 3S5LA 4RMTA 1HQRA 4N1HB 3GSUA 5TE4L 3AS0A 4HPYH 1ND0B 1AGCA 3VWKA 1LE5A 3NFNB 3OKYA 5J3HD 3B9KA 3WKNA 1MOEA 1CWVA 3UTSD 4OGXH 4F7EB 1DEDA 2CR6A 1OQOA 1T20B 1A1OA 3O6KL 4P4KA 3S37X 1OP5K 3VG0L 2X4TA 3O6FA 3T8XA 2AEPL 2ZUUA 5EUOF 4Y4FB 1CL7H 5L2KA 3QCTL 5HGDB 4AEIH 5IGXL 4DZ8A 1UCBH 4P2QB 4HFWB 1PY9A 1XF4B 1KC5H 5CS7A 3DURB 3RUGF 3VFVB 3BDBA 3KYMB 3SGKC 2NXYB 4OUUA 1CFTB 2LV4A 2YD2A 4XXDA 3VFOA 3ZKMC 4FTVA 1N5AB 1M7XA 3S96B 3GSXB 3MV7B 2IQAA 4G9FA 4WEUD 4NNPH 1BF8A 3CFEA 4LPCA 2R2BB 3HI5H 3IFNH 3QNYB 2X7LB 2YD8A 3MR9A 3JV4B 4GW5B 2O5ZL 1HSAA 4NOBA 2AK4B 2H45A 5AUMA 3LZFH 5JW3L 2VLLA 5EC2A 3VXTA 1YPZB 2C3HA 5E2UL 4XRCA 3H42L 2H1PL 4NO0B 4PY8I 5IVXF 3GSRA 5D93C 4CADB 3LS5L 5IOPB 3OJDB 2DLFL 4EVNB 4HCRA 5T5NF 1KTLA 1VADA 3NAAL 2XZAL 2VDPH 1E4JA 3IDUA 4PB9H 3VXOA 3MZTA 2MKWA 1RZFH 5LWYL 4I0PA 4OLVH 4KVCH 4NCC2 1NPUA 3WE6A 4HK3J 2R29L 4JM2C 4P46A 4N5ED 3TBTA 2CJUL 2YUWA 1H3XA 4DVRH 3QJFA 5FYLH 4JFHE 1A64A 5DJ8B 4BM7A 1MCFA 2ADGB 5L2JA 5JOPE 3GSVB 4PY7B 2ZG1A 5E2JA 4WWKD 3P0VL 2A9NL 4LCIL 4YNYB 3KG5A 2OL3H 1F8TH 5E4EB 2XOTA 1JPSH 2X09A 5HY9B 1T66D 4LKXB 5TGBA 5KAQG 4MCZB 1KGCE 5FDWB 1Q0YL 4GAYB 4HH9A 5D2NA 2BNRD 5C0JA 3UJIL 3PL6A 1MCEA 3OKDB 5IJKA 1F00I 1JWMA 4KWUA 1J0JA 1IGYB 1R3JA 4LLWA 3H3BC 4UQ3A 3VD7A 4GRMA 4JFZL 1O7VA 4IRZH 1CIDA 1NDMA 3GM8A 3NIGE 3TV3H 4WNQA 4JFDB 2X1WL 4KHXH 2V5TA 1R3HA 3VFUA 3MRMB 3Q5YA 2VXQH 3QUKB 1KPVA 5DEGB 3OWEA 5I1KH 3VXRE 1W0VB 4WFHD 1GGIH 1Q9WA 1IL1A 3U4EB 4YDJB 2X1PA 3SCMB 1WAAF 2PYED 2DYPA 3D69A 1AE6H 3LEVH 3JV6A 3T3PF 4OI7A 2CIKA 2DLGA 5JIPA 2XICA 5D72H 1S7VB 2NCMA 5DDHB 1J8HD 5DHVH 4PJ5D 3D85A 4JO4H 4E0RA 5DRNB 4P23B 3NIDE 5MHSD 4R96A 1SM3L 3T08A 4R4ND 1U3JA 2GQHA 3FT3B 1WTLA 4QT5A 4U05A 2V7HA 4XCYA 2EE3A 3LN9A 3IFOA 4RDQF 3R06A 4PUBH 4DTGH 3CXDL 1L7TL 1MJ7L 3IYLW 5T1LA 2VUYA 1I9RH 2DD8H 1EGJA 3UC0L 3SY0A 1TETL 1CE6B 1AKJB 2ZCKH 3N1QC 5JUEH 4NP4H 3X17A 1VGEL 4U1MB 4EUPG 1CFBA 4WUUD 2FX7H 2H26B 2DQCL 3L3HB 4H20H 1NCAL 3U4AA 3ZE0E 1SVCP 4YHLH 5GZOC 1DBAL 4JVPA 1ZT7B 3RWJA 3SDXB 3MV9B 4HKJB 1RK1A 2PO6C 3HAEH 3UJJL 3S36H 3TJEH 1VA9A 4M43H 3G6JB 3CUPB 4Y19A 4CNIB 4OV6F 5DWUL 1TQBB 3UTTD 2X4RA 4YPGA 4AJ0A 5HI4D 3ES6A 1FFNA 3T0ED 5I8CB 2HYMA 5D7KD 1RZJH 4NCDA 3QIWA 4OBRA 5CMAB 4X9FA 4ZSOE 5IHBA 1Y0LA 5ADOH 1J87A 1JGUH 5E6IA 5BCAA 1AO7B 3L7EB 1OWRM 2FR4B 1IARB 1JGLH 4EUPB 5C0EA 4ELME 4WWID 1QSEE 3M1BA 1QZ1A 5DMJB 1KJVB 1QA9A 5F9WC 3BJ91 2D4FA 2VE6B 1M6OA 1UKTA 3F5WA 3FT4B 5I6XB 1E4WH 1KCVL 1NLBH 1ZHKB 4L3CA 1QR1A 4L4TA 4HW6A 1KIQA 5L9DH 1KEGL 1H15A 1SYVA 3OPZL 4L8DB 1F58H 1DBJH 1KLGB 4OZHF 3QQ9D 4U6YB 4IOFC 4RGNB 1B0RB 1KN2L 4PD4K 4KMTH 4X7EC 4MA1B 1I9IH 1CK0L 1PSKL 3TYFB 4HUMB 3OZ9H 2NW2A 4Y4HA 4X4YB 2V17H 4NKQB 3FZUD 4M02A 1SJEA 4QRQB 3T1FB 4EBQL 1PLGH 2XG4A 3GUTA 2NLJA 3TN0A 1IQWH 1OTUD 1F4WH 1ZLUK 1JI1A 1U8MA 1HEZA 3VJ6B 3MRNB 3HE7D 5CILH 4XC3H 1K4DA 5TE7L 1LEKB 1CG9B 4XX1G 1ITCA 1KTKE 1BQHG 4O2EA 1S7QA 4X80H 3SDCB 3C08H 1I1AC 3VGAC 1VEOA 4NQEE 2OZ4L 4MMZC 4E41D 5KW9H 2YHGA 3BKJH 2AKRB 5DMGC 1ONQA 2BDNL 5ESAA 5D70L 1S7TA 3MUJA 1SJHA 4X6DE 4P59L 3CFBA 5GGQL 2NY6C 3MGOB 4W6WB 2W0PA 4D2NA 2FIKB 2XZCL 1F3DJ 5GGSA 1KCRL 2G75A 1FG2B 3I3EA 3MLVH 3GGWB 1TMCB 3UJTH 2XKNA 1K3IA 4NM8H 4ZNEE 4JQVC 1I85A 2I24N 1N0XL 2EYTB 4GAGH 3CVHB 1BQHB 3B3IB 4LCWA 2IAMA 4J3TA 2ZSVA 2VDQL 3ARXA 2RHEA 1Z2KA 2QLVB 3K0WA 4IOIB 4JFQA 4M4RA 5LG1A 1ZAGA 3LKSA 1BM3L 1HNFA 3ARGB 4H26A 5BRZE 5I1JL 2NY5C 1J0IA 2P8LA 1OCWH 3WKMH 1RAMA 4P2RA 4M1GH 1Q1JL 4N0FB 1EEZA 3LPGA 4QHNB 1VPOL 4PRNB 2WIIB 3V6ZA 2DAVA 4J8RB 4QRSB 2F54A 3PWJA 2Q8AL 3RL1B 4F8TA 5GGVL 1AGDA 3HE6D 2XY2A 5EPMA 4PJBB 4PJXE 4OZIE 5IQ7H 1NLDH 2P48B 2QQNL 2NYYD 4LSRL 3LOWA 2DQFB 3X12B 1EJ6A 1IEBA 3HFML 2FO4A 3WHE1 2ICCA 4G6AD 3AXLB 3LN4A 4KI5F 2RQ8A 5GS0L 3ARBB 4G9FE 4TSBL 5I73C 4AENB 3BP5B 1I3GH 5TE4H 1NGWB 2LU4A 3NCBB 3NCJH 2D9QB 5FA4B 2YKLL 2DKMA 3C87A 4QRTA 1AP2B 5HPOA 1ZHNA 3QB7C 4R97B 1IAII 4I18B 3O6KH 2R8SL 4LVEA 3WXVH 2Q8BL 2IQ9L 3FFCA 4M9OA 3CFKA 4JFOB 2P5EE 4PP1C 2VR9A 4JRYD 1IILE 2DM3A 3PQYA 1YYLH 4LLDB 1F4YL 4YBLC 3ARDC 4X6CF 4UILL 4EDWL 4NQTA 5FEBA 3QFJE 4Y1AE 4WW2F 3P4NA 1WC7A 4XTRD 4ZFGL 3ZO0A 1TNMA 1QLRA 2VDOH 2WLZA 4MQXC 3DO7B 4HK0B 1KXQE 2E3VA 1MFEH 3D25B 2CKNA 4RWHA 3BD3A 3FQRA 4PREB 1LD9B 1MRFH 1J1PL 3BD5A 4HMEA 4Y8AA 4AY0A 2GCYB 4QRRD 4RIRB 1NFIB 3S37H 2P49B 4C55A 3KPPA 3PHQA 4TUOB 5HI5C 4N0UB 2YC1A 4HIIB 3OKEB 1S7XB 1OARH 2OTUA 1CBVL 2WUBL 2RR3A 3BGFB 3JUZA 3VFRB 4GJTB 2X42A 2IH1A 1A7BA 4DN3L 2J8UB 4WO4C 4G3YH 4JCMA 1ZK9A 1MAJA 1RURL 1M05B 3HRZA 4M7KL 1A8JH 1QG3A 5ALCL 3FOLA 43CAB 5J13C 1JHLH 1PJ9A 3QRGH 1OAKH 1FDLL 1WZ1L 2VITB 4H1LG 4H5SB 2EEBA 1A7QH 4L9DA 1AHWC 5E2TL 2AXFA 2MPAH 5LWYH 1AGFB 3HI6L 5CEYA 3IVKB 2AQ1A 5TDOB 1OAZH 3FQXA 1FHGA 1I4FA 3QDMA 5C0IB 3LKQB 1FYTE 3L3JB 3W0WA 4JM2F 3AU1B 4JB9L 4Z7WA 5CJXA 1YMHB 4HS3A 1A3LL 3BW9B 3HI1A 1IFHH 1RIVH 4XC1L 1OHQA 3KYNA 3P0VH 4LGPB 1OB1A 4LCIH 3TT1L 3HZVA 1MSPA 1EAPB 1HYRC 2VYRE 4LCUB 3MLWL 4MCYA 1ZLVK 4H1LB 2FSEB 4LEOB 1YEKH 2C3WA 2R9HC 1Q0YH 3MFFB 2V2TA 2BJMH 4KDWA 1Q9KB 2AERT 3V4PL 2WBKA 1ZS8B 1JGEB 3H0TA 3S35X 4POUB 3IDNA 5HVHB 4JFZH 4LOUC 3FN3A 3QUMB 3ZYJA 4KROD 5HYQA 3OKNA 1KTDB 4NDMB 5FUCC 4MDJB 4R8WL 4JM4H 5JMRA 1HYSC 1NBVH 3BD4A 1P53A 4G5ZH 5E08L 5FO7A 3EFDH 2R2CA 5CP7B 4P9ML 3WDIA 4GRWH 4NT6A 4TSCL 3D6GA 3KGRA 3JV0A 5ACMA 4J3VA 2M8XA 2BSSA 3ARFB 4Z5RA 3FQNB 4NRXB 1Y18B 4U1SB 4LAJH 5SX4I 4BH8B 5TQ0L 4LLUA 1HNGA 3PV6B 3QWQB 2P45B 1F90H 4L3EE 1GJIA 3L7FA 3O2DH 3MQIA 4YXHL 3S35L 1RHHA 1HXYB 1MHPH 2YD6A 4KAQH 1R3IH 3R0MA 3CXDH 5DZNA 4V2CB 3RWFB 1L7TH 1MJ7H 1RUQL 3KPSE 1SEBA 2AJXL 1G7PB 1QQDA 3QNXB 4X6EA 2Z31C 4LARH 4PRAA 3G9AB 1IC4L 1MHCA 2AV7A 1OAQH 3IB4A 3TA3D 1A3RH 5EG6C 5AG8A 5FUOH 3QDHA 2A0LC 3EKCA 5TF1L 4ZFZA 5EZOH 3SKOA 3SEPA 4NIKB 3ULUL 3WS6A 1MCQA 4YUEH 3VFTA 5GISL 2IPUK 4U6HB 4WFHE 4HBCL 3EYVA 5E8PB 4BZYA 3GSNB 5JZ7C 4JFEB 1IAIH 2AXGA 3ME0A 4M1CC 2BRRL 2PCPA 2CPCA 2JK5A 2SEBA 2YOCA 5C92A 4L29A 3TH3T 4L4JA 3TFKC 5HDBF 3EYFA 3NCYP 1X4XA 4X7FC 2IMMA 4OV5B 5LAXB 3KHOA 2VL5B 1VERA 3P4MA 5I15L 4G8IA 3HUJA 1LILA 4I0PC 4NKOA 3ARQA 4PR5A 1IQDA 5ISZD 1DQTA 4PJHE 4P46C 1QVOB 1G6RL 1F3DH 1INEH 1JIBA 4L8BA 1EERB 5HSFA 4OF6A 1N6UA 4UU9B 2GHWB 1KEGH 4LLYB 4JJ5A 3ARPA 5F89B 1KLUA 1N3NB 1KN2H 4Z0XA 1CK0H 1PSKH 5HHXL 4C56E 5HHPA 1N6QL 3V5KA 2DLIA 3QXAA 1A2YA 1MREL 3QDJD 3A6OA 2FYYB 3H8NA 4OCSL 3GHBH 2Q7YB 1HHJA 4L4VB 3RTQA 3VFNA 4E5XA 1EUTA 1EV2E 4W68A 1I3RA 2EIDA 4F7TA 3MC0A 4S1QL 4F58L 2F54E 2Y25A 4Y2DA 1ES0B 5IB4A 2ZG3A 4MD0B 2CKBH 2XWBA 4IRSD 1X5IA 1K4CB 5D7KE 3VWJA 3IU4H 1FJ1B 1X5KA 2XZQL 4S1DD 4XCNA 1ZA6B 4OZFH 5B8CB 4DGYH 4UB0L 5E8NB 3FB6A 2ZZUT 5EZLB 4GH7B 3QEGH 1UYWL 4EOWL 3TNMA 1Q72H 3MUGA 1T7XA 3LD8B 1EFQA 2WBWB 2EO1A 4JGJA 1ZLWK 2AJYH 4HWZA 1MI5B 4OCRL 1KB5L 4XB7A 5EFIA 3ESUF 3FONA 3OHXB 5AZEL 3ARZA 5IW1B 4GLRI 3FO2B 4FP8H 4HUWA 3BAEH 3H9ZA 1G7LA 8CGTA 4UNTA 5I1GL 1BM3H 2EIEA 4DN4H 4O5LL 4XBEL 4G6KH 1OM3L 4KRPC 1OP3K 4C83A 3NGBB 4PJ7A 1CD9B 1Z0MA 2D2OA 2X4SA 2MCG1 2O5XL 4P5KA 1J0HA 3PDGA 4Y89A 1U3ZA 4TPRL 3ALXA 2NMSA 3NIGF 1RUMH 2R23A 3RZCB 4FRWA 4LSRH 4AYFA 1XCQB 2GAZB 2DLHA 4WJ5B 1A6TB 1XH3A 4UAOB 5KVMC 3O41B 4XNZC 1ZTXL 4E42A 2IG2H 4HV8A 3T0VA 4GSDL 4J6RL 4NUGH 2X89A 4Z0BH 2VLKD 5MENE 3U9PL 5FO8B 5KSVA 2Y5TB 3QULB 3KPRB 1P5VA 3CK0H 1C16A 1MNUH 4EI5B 5SX4H 4EN3B 4X98A 2YPLE 5EU7E 5JHLL 5JW5B 1U8QA 5D4QA 4C59B 1KELL 5HHNB 2WBJD 1MJJB 4F9PA 5JIIA 1B90A 2CK0L 4JDTL 2OBGA 3QIWC 4D0CA 3WFBH 1J88A 1FC2D 2V2WB 2IQ9H 5E6IC 5F6IC 5C6TL 3BPNB 1BBDH 5DJYA 3JTSA 2A77H 3D39A 3H9SB 1LP9F 1S78D 4OCLC 2R4RH 3RVXD 2EC9U 1W2KT 2NNAB 1OF2B 1F4YH 3CDFA 3HNSL 3QH3A 3OJVC 2L4OA 4XP9H 4F7PA 4QWWC 2EDHA 1A4JB 1DANU 3QI9C 4RFNC 1BFVL 3VXSE 1D9KA 4MNGE 2FL5B 2DIAA 1G1YA 5F7DA 2W9DL 4TNWK 2QSTA 3W0WE 4D3CH 1D5XB 5DFVC 2DQGH 5KSUB 1S5HB 1QFWI 1NGYA 4QO1A 2UYLA 4B5EA 3MLXH 2IC2A 4S1RH 5JR1H 3EYUH 3WCYA 1JI2A 5JXED 2GW5A 4FQXA 4BH7B 2VAAA 5BV7B 5J11C 1Y6NR 5LVEA 5EUKB 1LDPH 3HNTH 2HT2D 3WL9B 5DJDB 2ATPB 2IFFL 5T5FH 1XT5A 4C58B 5C1MB 5I8EB 4KZDL 4NRYB 2F5BL 5E8DL 4XPAL 4CMHC 5DJAA 5E4IA 1KN4L 1J1XL 5IF0A 1BLNB 2ITCA 2QL1A 1RZIB 5GGUB 3ULVF 3SJVA 5CD3B 4M7KH 3I02B 3CFJB 2GSGA 3QXDB 4HUUA 4ELMF 5GS3A 5J0BA 3CZFB 3IKCB 2VLRE 3MJ9L 2GFBB 3PABB 4P5MB 1FDLH 3P9WB 3RA7L 2VLJA 5F3HA 3UCRA 3FT2A 1XMWA 5E5UB 3TIDA 4S10A 5E03A 4XCEB 2JKXA 4Z7NF 3NPSC 2CUMA 3HI6H 2NX5B 1FL6B 2XQYK 3E6FA 4JB9H 3DUUA 3OB8A 1A3LH 1MCCA 2GUOA 4UDTA 4AIXA 4RMSA 3ZYZA 1I85C 2AQ3A 4HDIA 4FXKA 1L0QA 2IAMC 4R0LC 1HIML 4Y4FD 5IM7B 4JANB 5A3IC 3HNVL 4YX2L 1ZHBB 4XWGL 4P2QD 1PD6A 4CUCA 4QYOB 1QPPA 1X5HA 3GJFH 2W0KA 4XP1H 3MLWH 5FKPB 1MAMH 2NXYD 4LASL 3MV11 2MKLC 5D7LD 1QHOA 4FFWD 1TPXB 1MCWW 1GHFL 2EDWA 3C8DA 3UTPD 2OP4L 3ZKQD 4R2GD 3MV7D 1I1FA 3O4OB 1YZZA 1RUPH 5B39A 1YYMH 3QUZA 3BMWA 2Y72A 3GMPA 4M8VA 4X6DF 5E95B 1PZ5B 2I5YL 4GO6B 5KSBF 3GO1H 4EJ1C 5D7JB 4IMKA 3OXRA 1PX3A 2AK4D 5DSCA 2GT9B 3VXME 3J7HA 1E4XI 4UDUB 3DRQA 1TLKA 3WDHA 5IVNA 4NO0D 1RZGA 3MRCA 5F9AC 3PDOA 3LQZA 1S9XB 3RNQB 1QLFA 1YEDA 1T1XA 4KJWC 5IBTH 4OFYA 1V5JA 2W60A 4GLRH 1XF2A 3OAUH 2BHUA 5T1DH 4DUWA 4OF3A 3VMPA 3T0DA 3BGAA 4ZOBA 4OD2A 3TT3H 1PVHA 3FKUS 4QRPA 4NKIH 1WTGT 4TULH 5K33A 3TEUA 4MJ6A 4S1SH 2YN3A 3RAJH 3S35H 5I1AA 3IAGC 1FZOA 4U6VL 5IP4A 5JPMB 4PJFE 4RDQG 4LRNL 5GSRA 4O58L 4NSKB 2L7JA 2VDLL 1NL0L 1JUFA 1T1WB 4JRXA 1FSKC 5L8LB 4OCXL 3LMJL 1YY8A 1C5DB 3EFFA 1S9VB 2HT3C 1YEHH 3TF7C 1CLYL 3KJ4C 1OGAA 3C2AL 2BSTA 3I6GB 4XGZA 4PRDA 3CCHB 1SY6L 3FFDB 5LGJA 4K94C 5ICYB 3NCYS 3MX0A 2OSLB 3I50L 3QQNA 4P2OB 3RGVA 1D5BB 1R24A 3WHE0 5HHVL 4NHCH 1RZKH 2A74A 4O2CB 3MRLB 1KT2B 1SQ2N 2GJ6A 4ZOEA 5GISH 1RUKL 4M6OH 2Q7NA 1KIRB 3NN8B 5DMIH 1TZGL 2BRRH 1UKSA 3TCLB 2YPKA 4JFDD 1C5BH 1NFDB 2BNUA 5IESL 5IIEA 5L0QB 2NXZB 5DJZB 5IMLA 1CD1B 4OF0A 3JUYA 1ZVSA 1S7SB 1I9JL 3N06B 4WW1A 2WP3O 3MNVB 3CX5J 4XNXL 5HYJA 1P4IL 5FUZH 1BJ1J 3SCMD 1KCKA 2UWEB 1MWAL 1I7RB 2VLME 3ET9F 3VFGH 4D9QE 1RQ5A 3FMGL 1MEXL 5A1AA 3MRFA 3DXAE 1R0AH 2VXVH 5C0BD 1JYNA 2H32H 4NFCA 5CJXC 2XQBH 3GRWH 1U95A 1ACYH 1QFWH 2EE2A 4P23D 4MAYA 2QSQA 1N26A 1E28A 4CVZB 5BJTB 4F80A 5F9JB 3IETA 1EHNA 1T2JA 4KKCD 4ORGA 3D3VE 5CIPA 4ONHA 2W0FA 4R4BB 4CMMA 1DQDH 1MREH 1CFQA 4Z8FL 1TZIA 5C08A 2BCKA 1NAKL 1AKJD 5DYOA 4PJEA 1EBAA 1YY9D 3CU1A 1TTFA 1BFOB 3RKPA 1DUZA 3L3GB 5C0GB 3GI8L 5ANMA 4CRPA 4L5FL 1X6LA 3WJLA 2D0GA 1FNHA 4DUXA 3UMTA 3IKKA 3RU8L 3MBEB 3X11B 3PP3H 4OBSA 1UB5A 4M7ZC 6FABL 2AJZB 1KV3A 4NQSB 1A6VH 1J5OL 1B4JH 1UYWH 3T77A 5AD0A 3NIFE 2EC8A 2R69H 4PGCB 5ISZE 2BNQB 4NN7B 1FLRH 5ERWB 4RMUA 3VD4A 2OJEA 2IPUG 4D8PB 1D6EB 4I3RL 1B2WH 3E3QC 2IPKA 2VH5H 2OL3A 2YD5A 3T3ME 3RZWA 1QUNA 2CXGA 5I1GH 5IEHA 1I8KB 5IB5A 4U1IA 3WNKA 4LIQH 4NQCB 3UAJD 1HKLL 3WD5L 4GW1B 2O5XH 2AJSL 3RWHB 1HK6A 4OF8A 3VGFA 3GMLA 2HFGL 2LAAA 1WEJH 3HR5B 3BP7B 2F53A 5FM5O 4G8GB 4KY1H 4POZD 3L3KA 4HWBA 1XGYH 3TO4B 4UIKL 2F19L 2GI7A 5FHAL 1E4XH 2B1AH 4WI7A 5DVKA 2BY0A 2H9GA 3G6DH 5BVPH 4MDIA 4Y5XA 4CW1A 4N9GA 2YBRB 4XBPB 5JHLH 3SDCD 2Q76A 3DVNB 4N0CD 1AIFA 1K5NA 4MB5A 3MV8A 3NZ8A 5MEOA 4YQXH 2JB6A 4LP4A 3DYMA 3HLAA 3GZKA 4JQIL 5EBGA 2VDNH 4PRIA 2VRAA 3RWIB 3RWEB 4B41A 4LSTH 2FBJL 3MJ7A 3GIVA 4DGIL 3KLHD 2HKFH 3GMMB 3OKLB 1BAFL 3W2DL 4DGVL 3F7PC 4IOSD 4ETQA 1BFVH 2YA0A 4P4RB 3TZVC 4JO2H 4G80A 4NFBA 5TQ2L 1X7QA 43C9A 3GSWB 1JN6B 3QA3B 3UTSA 4XPFL 2JB5L 3RVUD 3ARGD 3K7UA 2X70A 1G9ML 4ZS7L 4P3CL 5A2KH 1T1YB 3KJ6L 3D5OF 4U4BA 5DUBA 5FO9A 5D1XC 3T2PA 5J06A 3HAEA 1RK0A 1P84J 4JFPA 3RTQC 2VR4A 1SMAA 4NWUL 2F5BH 2VXSL 4HXBH 4YHNA 4BFIA 3AM8A 5GS0C 2WMPA 1KN4H 2ZJSL 5C0AE 3NBNA 4LHQB 1UWGL 5HHOE 2DBLL 2FH8A 3HZKA 3ARBD 5IMMA 3ZMRA 3A6BL 3FAWA 2R2HB 3ULUE 3BT2L 2D0FA 3DMMC 3T0AA 4YDKH 2ZOLB 4G6MH 1AGEA 3RA7H 4PGDB 5C8JA 2J6EL 5AYUL 2VJXA 4D9LL 1UZ6F 3NA9L 3QCUL 2VN4A 5HDLA 1NCBL 2V9QA 1Q9LB 4LSVL 3WFZA 3MLYH 3QUXB 4I2XB 3RKDC 1ZEAL 2H3NB 4U1KA 1F6AA 3CFCH 1RV6X 3ZT6A 5KVFH 5AAMA 3HNVH 1F4AA 1CLZL 1LO5B 2CDGA 1FFPB 4QRPE 4X8XA 5D8JH 3F7YA 3V4UL 4NZRH 3U1SH 4AM0A 1G9NH 3UBXA 4ODUB 4MMXC 5DK0B 2HVJB 4WV1B 2C3XA 4P3DB 4J1UA 5JW4N 1B0GB 2VMFA 3L5HA 4JRXE 4M8QA 2IH3B 1DBBH 3MJ6A 2MSPA 2X1XR 5B3JE 5J9PA 3STLA 2OXHA 2FH6A 3TBWB 2FB4L 4F37F 1FV1B 2FHBA 3JWOL 4RBPK 4XCCH 4WWKA 4UV7H 5GGSY 4K9EC 3LIZL 3VG9C 3H3PH 1FGVH 2XG5A 1A6WL 4EUPH 1UM6L 4PV8B 5EO9B 4Z7UE 2FCBA 3NZHH 4MJIE 5E2WL 5ICXB 4ZPVB 1JYXA 4QTIL 3RL2B 1R5IA 4Y16B 3RP1A 3RX8A 5EOCL 3U0TB 4KTEL 2DJSA 2FJFA 4NN6C 4MGXA 3DVIA 1JHTB 5T33L 5J89A 1P7KB 4F9PC 1CGWA 1EZVY 2BNRA 3KXFE 3OAYH 3U79A 3BEVB 3WNLA 1UVQB 3QDGD 3RJDA 4OZGA 5T3ZD 3LDBB 4LBEB 4ZFOA 2X4QB 3UO1H 1AD9B 3HCVB 1G1CA 2VQ1B 3DARA 4MA3B 5EU6B 1MF2L 2B4CH 5JPNA 5EN2A 5BZDB 3HC3L 1BJ1H 4M93C 3W9EA 3SO3B 3BZEB 4FQHB 1HZHL 2J3SA 4O58H 1X5GA 2HN7B 4I1NB 4ODHL 5D7LE 2BY1A 4YAQA 2XY1A 1NL0H 3G9VA 2XN9A 4LEXH 1M7IB 1T04A 5I30H 3OXSB 2PYEA 2APTA 4JKPL 3GIZL 2Z35A 5T3XL 2XQYG 1P5UA 3T4YA 1CLYH 4ZDHA 4FQXC 2PTUA 1ZSDA 3B9VA 2CK2A 2WWKT 3UTZB 1SY6H 1J8HA 1X4YA 4PJ5A 3GEWB 4X9HA 1A7OL 4DW2L 2C1OB 4WFFE 4GMSH 5E9DA 3CSYB 1NGQL 4HWUA 2L7UA 1GGTA 5DXWA 3AAZA 2ADJA 2BVOB 3ZTNH 1NBQA 5C6WH 2W1NA 5A16A 1RUKH 3FO0H 3DECA 1GC1C 2D31A 2VZSA 4ODWA 2P24A 2NY0B 3RI5K 4BZ1L 2E7MA 4XPHH 3MV01 4YEFA 3LQAL 1XR9B 4KJQC 1T03L 4OLUH 3HG1B 3OMZA 4ZUSA 1GAFL 5ANME 1PG7X 4OCMC 1D5IH 4O2FB 3ARFD 4WUUA 2JELH 4GKZB 4J3UA 4PJIB 3N1MC 3VXNA 2VISB 1F11B 3FMGH 4X7TB 3O0RL 2B0SL 2PO6B 1B9ZA 4Z7WF 5CZXC 4U2YA 1HINL 3TO2B 3PWUB 1L7IL 4RFOL 4XPGH 1AC6A 2EIZB 3PGDB 5JLZB 2X9WA 2G5BA 4LVHC 3DX7B 3UTTA 3L5XH 1PGRB 3DX9B 3ZTJG 2MHAA 1ZVYA 4XHJD 2ZUYA 3KPQA 1AR2A 3EDDA 1A1NA 1DDHA 3EJYD 5F9WB 4Z8FH 1YNKH 1WZLA 5M7QA 4TSAL 5FCSH 2XTJC 2BK8A 1CDYA 1K2DA 4HS6A 3H7BB 1DVFA 1U8KA 1MFBH 3ULUC 5DVLA 2DTML 4OF5A 4OCYL 2VZVA 1KB9J 4KTDL 4TVSa 3KPMB 3VH8G 2RIKA 4JKLA 1HH9B 3BPLB 5C7XL 3CMOL 1HDMA 4IMKC 3UZQA 4J3WA 4MQ7A 4OLEA 1YMMD 3O9WA 4JFED 3VFSB 4M7JL 6FABH 5CLWA 4F3FB 3X13B 3C8HA 5E00A 3IFPB 3O11B 1JL8A 1WWBX 1U9KA 4MA8H 4GAJL 3F6LA 4R90L 3KPNA 3HE7A 3CVIL 1JZ2A 4ZNCD 1RMFH 3DV4B 5KN5B 1XIWA 4I3RH 4R7NA 1I1AB 3C9NA 3VGAB 1I3VA 3VH8B 3KPOA 2HRPL 4E41A 1CDCA 1UH4A 3VXQB 1TJIH 1K8IA 3DI3B 2KKQA 2EO9A 3R8QA 4KU1A 1KBGH 3TP4A 3Q6GH 5FAAA 5BW7A 5EZIH 3EO1A 4PJ8C 2AJSH 4IS6B 4UT7L 4WI6A 1EA9C 5J1AA 1Q8MA 5E7BA 2PTTB 5GJSH 4WI3A 2HFGH 3VI4E 1CDGA 2UZIL 5TE6L 1UWXH 3QO1B 4B7LA 5CSZB 3U9UA 5DMKB 4LAQH 4NGHH 4M1DL 4NNXA 2HJKA 5DO2C 1JNHB 4LSDA 1FZJB 3MRDA 4XP6H 5FKAA 3RY5A 5F7UA 4UIKH 5C0RL 3FO1B 4OLWH 5T3ZH 1NSNH 2ADFH 4J3OC 3WIHH 1OT1A 4JGUA 4K3JL 3NTCH 1C1EL 5DQDH 3ARTA 5IQ9B 4WCYL 3AS2A 5GGTL 3WJJA 1DN0A 1GXEA 1PY4A 3I9GH 4JO1L 1YEFL 3K8KA 4G9DB 2BOBA 3WFEH 3HE6A 5FECB 1ORSA 3O2DA 4CVXA 3I85A 4JQIH 1YUHA 4N5UA 2RB8A 1BF2A 2EDFA 1CD0A 5EWIH 1WIOA 3HUJF 4ALAH 5IMKB 4UUJB 4MHHG 3VXRB 4DGIH 5ESVA 3RRQA 4LP5A 3FCTB 1IT9L 4H1LH 1A3QA 3S34H 1RVFL 3MNZA 1KPRA 4PJAA 3N1PC 4LCCC 3GMOB 2XA8H 3W2DH 1DQMH 2IAND 1MI5D 3W39B 4ENED 4F37K 2APVA 4MAYC 3SKMB 5KANG 3O3BB 1Y6MR 4HT1L 5HJ3B 3DYOA 5CINH 1T1ZA 4W70A 1UXWA 5GZND 5C2UB 5I1DB 1G9MH 2ERJB 3QUMH 2HTKC 1EFXD 4KK5C 2LQRA 5I2IB 4RZCA 1Z0NA 5CCKL 4PTUA 5HHMD 4JRYA 4YBLB 5HHQB 4ONOA 2DMCA 3UZEA 4UT6H 2EECA 4AEHL 3IGAA 4F15C 3BOVA 4TOYL 4ZD3H 3RZCD 4MXWL 3QIUC 4YHKL 2C1PA 1H5BA 3HMWL 2UVFA 1RIHH 4WU5B 4HJJH 2OMNA 2C3VA 5F1NA 3WJLC 4NPYB 3U7YL 5MI0C 2P7TB 1ZT4A 3LCYA 1EVUA 4XAWH 3KPRD 1WVZA 2Y1VA 3O6MH 1E27B 2BVQB 3BP6A 4EI5D 3IS1X 3L9RB 4OIAA 4EN3D 3O2VH 5IEKB 2A6DA 4OCWL 3VDBA 4D9RD 3QCUH 4YHPB 1QKZL 5GRUL 3K4AA 2V5SA 4WFGE 5KVEL 1P2CA 3NFSH 3BE1L 1S7UB 4UTAL 1U93A 1VHPA 4HKZB 2W07A 1U8LA 4WO4B 4ZSOB 4DOHE 1H3UA 3H9SD 5FF6B 2YWZA 1FFQA 5KTEL 1CLCA 2FJHA 4U3CA 1O7SA 4OZGE 2CLRA 5JXAL 3TJHD 3ZYIA 5I66A 1KIPB 1QSEB 3QG7H 3NH7L 5DK2A 3F12A 3V4UH 3P11H 1I1YA 5L8JB 3P30L 1BZ7B 4MVBD 4PJ7F 5LCVH 1G0DA 4LSPL 3ULSB 4PRHE 4LKCB 1EHLH 1A6AB 4I48B 3CMGA 4GKNB 3ECBA 2VABB 3GSNH 2CKBA 3QG6A 4CJ0A 5EU4A 5E1AB 1MRCH 3KNBB 3THML 2LU3A 2AQ2A 4F33B 2XN9E 1OAUL 2AI0L 1FBIH 3W9DA 4TUKH 3BSZL 5C09E 2HMIC 1EO8H 1Y6KR 1CZ8L 3IDJA 1C08B 1KUMA 4Z95H 4A6YB 5CEXA 1FL3B 2P8PA 4DCQB 3VFWA 1R6VA 3W5MA 3S5LG 4QNPE 1BFTA 3K8LA 1HHKA 3DX6A 4PGBA 1HHIB 5E6YA 5L8KB 1VKXA 3BKCL 12E8H 3G5VB 4KQ4L 5FYKE 5BZWA 2AABH 3QXUA 4Y5XC 1QD0A 1R5WA 5E9DE 1ZANH 2QSVA 5EDXA 1WBXA 1XF3B 3PHSA 1ZHLB 1GZQA 4HJ0C 4UQ2B 3U46B 4IHOA 3D2UB 3KDMA 3BQUA 3PGFH 4KUZL 3MJ8B 4NQEB 3NA4A 2NR6D 2WWMC 1FZMA 3MMEA 5T1MA 3BDYL 3HHRB 4O02L 1FRGH 1A1MA 2N56A 3VA2C 5D6DA 5DTFB 5CBEA 4MXQC 4X6DB 3QIBB 3DLQR 3FN9A 2NX5D 4PJ9B 4X9IA 3S5LB 3HC3H 3GSUB 4KHTH 4N9OB 1HSBA 4EIGB 2YA2A 4X0KB 4ODHH 5DD0H 1ZGLA 3WSQH 3CPLA 4QXTA 2D4DA 4RAVB 3MA7B 1C12B 2WW8A 5J3HC 4DKFL 4QXWA 4YWGL 3B6SB 5DURB 5MP6L 3ALWA 1W0WA 3GIZH 4RSVA 2EDJA 3JWDL 2LU7A 3C5ZA 1U92A 5BRZB 5JNYB 5I1LA 2Y6SD 4TQEL 3LKRA 3NACH 4LMQI 4PJGA 5FB8A 4QHUA 3GKWL 4ZUTB 2ENSA 5HGGS 2ZPKL 4XWOC 5ELIA 4KKAC 3AM8C 2XIDA 5FGBC 2IADA 2EDYA 2XRAH 3IJHA 4PJXB 3QHZH 1CT8A 1LK2A 4OUUB 5E5RB 1JZ4A 4OZIB 3VFOB 4P5TB 4BZ1H 2Z31B 5ICZB 1RJYA 4MD5B 3LQAH 4P99A 3QDGE 4XPBL 4NWTL 4P9HL 4X5WB 5D7JD 5I8OH 2OCFD 4G9FB 2DQIH 4HIEB 3DHMA 3TA3A 4CGTA 3TYGH 1LK3L 3TPUB 1INQA 2CUIA 2UVEA 4LQFL 5ID0A 4GG6A 4NO5B 1JZ8A 5ALBH 4OGYH 2IBGA 4RAUA 4ZPTA 3UX9B 3CLEH 4ISVB 2RBLA 4R7DB 1A9BA 2DJ4A 3I6LE 3O0RH 4U49A 4EEEA 3QHTC 4LLVA 5TPWL 1FN4A 4FXGA 4OT1L 2Y06H 2P5EB 3H7LA 4ZS6D 5EBWB 3C8KB 4C4KT 5DA0B 3EYSH 3HC0A 3FOMA 3DTXB 4JFFE 1YC8A 3HZMA 1BBJA 3MJGX 1BWWA 2FEDD 5SWSA 2XV6B 3FTGB 3R1GH 3QFJB 4JZOB 4Y1AB 3VXOB 4BFGA 5H35A 5A2JH 1PG7W 4NO3B 4I0PB 2AV1B 1S7WB 3EDKA 5C0CA 2FNBA 5DHVB 1PG7H 6CGTA 5CWSA 1S9WB 2GTZA 4YIQB 3K2UL 3EOTH 3TBTB 5IFAL 4DWHA 1SBBA 5IFJA 2BERA 4HUNB 3MLSH 5FXCH 3RVVC 4QOKD 3MLZH 3TIEA 4P2OD 1ODAA 1FPTL 4I77L 2A38A 1IKNA 3HB3C 3L95B 2IFGA 4GOSA 5GRXG 1G7JB 1IM9B 1SYSB 2JCCA 5BS0E 1RZ8A 4KK9D 2WSKA 3T2QA 4HBQA 4GT7A 5TGBB 4DUVA 1JRHL 4U1LA 5C6PB 1CLOL 1U42A 3IRPX 4OQTL 4UNVA 2DM7A 3QDJA 4PLKD 1YEEH 4XAKE 1J0YA 2H2PD 2NXZD 3S6CA 4G7YH 1K8DA 3X3GH 3CFDA 1R3JB 3CVIH 4GRMB 1LHZA 5BQ7B 2QQKH 4BSVA 5HPMB 1IGIL 1T21B 3GJFA 2JE8A 1ZLUH 1X5YA 4NJ9L 2LFGA 5BV7H 1R3HB 1GGCH 3VFMB 1KJ3L 3MRGB 4RNRA 3AB0C 1GRWA 2CMRH 4ESKA 1FYTB 4G7VL 5C07E 3INUL 2Z93A 3Q6FA 1IL1B 1QLEL 4I5BA 5LGHL 3BZFB 1Q9OA 5I1IL 3U7WH 1VFBA 4JPIB 4I9WE 1CXLA 2CIKB 2UZIH 1JTPA 2EKSA 4QXGL 1SBSL 5EO0A 1EPFA 1QSFE 2ICWI 2VWEC 4PJCE 4G6JH 3ARVA 3GSOA 5HVGB 4RCAA 4R96B 4WFEE 4GUPA 5EORL 1AGBA 1N59A 1ZWIA 5C0RH 3HS0A 3IXTA 3IJYA 1L0XA 4X4MA 1A4KB 3IFOB 3BRGC 4HS8H 1YJDH 2QJDA 4NZDA 2B2XH 4KRPB 3N9GH 5LBSH 4WGVB 3GI9H 2CIIA 4L8CB 4TUJB 3U82B 3GSQA 3EOAB 4GKSB 4MWFB 4K71C 1X44A 4O00A 5DJ2A 3LB6D 4JPWL 5C0DB 3MBED 5DS8B 1MUJB 1MRDL 1IAKA 1KJ2L 4JKMA 1F97A 4XNZB 4U1GC 5E8OA 3QJHA 2BNQD 1I7TA 5HGHB 3PWVA 3RWJB 3E0GA 1WT5A 2WK2A 4U1HA 5DRXA 2VLKA 4MJ5A 2KDGA 4OB5H 5EOTB 1G7QA 3BKML 3OKKB 4Z76B 4UTBH 4WI5A 5EIIA 2BY3A 4L3EB 4U6TA 5FCUL 3QIWB 5JOEA 3GMQB 5E6IB 4XVSL 5J6GB 2YMXL 1V3KA 4NQCD 1S5IH 2NZ9D 5H94A 3MNWB 3Q1SL 3ZL4L 5C0EB 1NMAH 3M1BB 3I6KA 1QA9B 1EUUA 3KPSB 3EJJX 1M6OB 2P8MB 4MNQA 4XNYL 3F5WB 4XXCC 2NY7H 3QI9B 5MEPA 1UACL 4PJEF 2K7PA 5FYJD 1J1OL 4MXWH 5T3XE 1DVFC 1VSCA 1CGTA 1LVEA 3TO4D 4KV5E 3VCLA 4PGJA 4F2MA 1EK3A 1T0NB 1UB6A 3QQ9C 3U7YH 3VRLE 1BJ8A 4ZXBC 1VB9A 3IU3A 4HHAB 4M9PA 1MVUB 4JCLA 2HFEB 4LGRB 4MXVF 2YD7A 3O9WC 5JXEA 1NGXB 4Q97A 3U36A 2AJ3B 4OAWA 4APQD 2DN7A 1QACA 2ED9A 1G7MA 3GBNL 3CSBA 5KVEH 3GRWA 1MIML 1U8MB 4QEGA 1HEZB 3LQMA 3V6FA 2IANE 1U36A 4ZTOL 4GRLA 4H88H 1KG0A 1NGZB 1JF1B 4CMHB 3HE7C 1H3VA 2AEQL 1UM5H 3B5HA 3BZ4A 4HFUH 4Y5VA 2JF1A 2IGFL 4Q9CA 3S9DB 1H0DB 3WO4C 3CDCA 1XIWC 4HUXB 4Q9RL 2CDFA 2OI9C 2VUOA 3E8UH 3V6OE 5KTEH 5JTWA 3ZZ1A 1BQSA 2H6PB 1Z3GH 5JXAH 1I9EA 5ESAB 4KJYA 5K9JH 1QBLL 1NKRA 2QKIB 1ND0A 4PJHB 5HHME 1BECA 4KPHL 2R2EB 1FNEB 3P30H 1T5WB 2E27H 3NFNA 5D5ME 3IDYB 5DC9B 3NPSB 5HI3C 1QBBA 4M03A 4F7EA 3SQOL 4L8SB 1T20A 3GJEB 1CXFA 4QRUB 1WCBA 5HYIA 5HGAB 4LVNB 4V1DE 4KDVA 3BRDA 2NW3B 3LSOB 3RGHA 4C56B 2IAMB 2UZYB 4R0LB 3WV0A 1CZ8H 4GQ9L 3LKSB 5HGDA 1QTYT 1U91B 4P2QA 1XF4A 5E2VH 3DURA 2IBZY 5FV1L 4PTTB 4HKBB 1OT2A 3KYMA 5ABDE 2F54B 3ZKMD 1CU4H 1CFTA 5FDYA 2X5PA 4BQCA 2IJ0C 3OJMB 4BUGA 3K3QA 4KMLB 4PV9A 1N5AA 3HE6C 2EE6A 3O4LA 3S96A 4YHOH 3GSXA 3MV7A 3UYOD 3BDYH 1MJ8L 1NDGB 1WBYB 1NFKA 1IVLA 1Z5LB 3QNYA 1AI1L 1IM3B 2X7LA 3C5JA 4WTZG 3MODH 4O51B 2LVEA 4GG6E 4GW5A 4ZMAT 5EO1B 4FQ1L 2AK4A 4WTWA 3PWPE 4YFLF 3DBXB 4B53A 5FHBH 2FX8H 3P9LB 1E6JL 4HIXL 3TGXA 4NO0A 1CS6A 3PNWB 5EUOE 3FQWB 4CADA 1HCFX 3K8MA 5C0FB 3OJDA 4EVNA 3QWOB 5T1KB 2ICEB 3EJZD 1IAIM 3NCCB 2YD1A 5SWZE 4DK3A 3MRPB 5JOFB 2XNAB 4TVPD 1VDGA 3OG6B 3RUGE 3SE4A 1ED3B 5I74C 3EGSA 2CDEB 3JWOC 5C0CE 5I71C 1H5BC 4XTRC 1AY1L 1MVFA 4UMGA 5DJ8A 3EOBB 2ADGA 1FSKB 3GSVA 4PY7A 1CXEA 2EYRB 2V2XB 2VC2L 4ZTPH 3ISWA 5GJTH 5KZCB 2HFTA 2BVPB 5IT2L 1T7ZA 3KJ4B 1WFUA 5DJCB 1J7VR 3UEZA 1BQLL 4FQCH 5MENB 2XKSA 3GK8H 4Y16D 1CGSH 1LK3H 5HY9A 1ZMYA 1X5JA 1FIGH 4LKXA 3WNNA 3C60C 2YPLB 2OR8A 4TTDC 3BEWA 5JQHC 3OKDA 1FO0L 3U0WL 5FK9B 5IVXE 1R5VA 1IGYA 2ARJQ 5ITBL 3SE8L 5EU6D 1JZ3A 2D0HA 1U6AH 4NZUH 4IJ3C 5CZVL 3G04B 5FYJH 2J2ZA 4JFDA 3MRMA 2PTVA 4JQXA 3QUKA 4WEMB 5DEGA 5GQBA 4LGSB 4NM4L 2AXFB 1W0VA 3VXSB 4MNGB 4FQQB 2NY5L 3U4EA 1IBGL 2DM4A 5F1KC 3SCMA 4M5ZL 3W0WB 3QXTA 3K2UH 4HS3B 2GY5A 3ESVF 1S7VA 4LNRA 5DDHA 3WFCL 5DRNA 4P23A 4JHZA 2B5IC 4JY4B 3MPCA 1OAYL 4AL8L 4XH2B 3FT3A 4UIMB 5FGRA 2R39A 3OSKA 5L7XH 1QBML 5E94B 1JTOA 4HQQH 3ROOB 4HMCA 1KCUH 4X4ME 1DBKL 1QYGL 1E6OH 4OM0L 5IVOA 2LABA 4G42B 4M62L 3BQUC 3HG1D 3V6OC 1CE6A 4PRPE 4OZGF 1AKJA 1YEIH 2D7TH 3BXNA 2WQ8A 5F1IB 2VLRB 5D6DC 2ORBL 4HD9A 1XF5B 2BZDA 4U1MA 1BEYH 3OKNB 3RHWF 4JHWL 1ZGLM 4F57L 4JDZB 2I9LB 2DL2A 2PO6D 1ZT7A 2BVTA 3SDXA 3MV9A 4HKJA 5I19H 1KIUA 4M7ZB 3MLUL 1WAAE 3INUH 1H3TA 3TVMA 2BOCB 3MRJB 4U7MA 3T3PE 4B50A 5LGHH 4KK6C 3G6JA 4JY5L 4YDVB 4JO3L 5CUSL 4CNIA 4Z5RB 1T0PB 1LQSR 3CSPA 5I18L 5I8CA 4OD3L 2QR0B 5CMAA 1W72L 1UXSA 4QXGH 2HWZL 1AO7A 3L7EA 3C5ZC 4QNPF 2FR4A 3DGCR 3L7FB 2YWYA 4FQIL 4EUPA 4FZEL 5ESQA 4TN9A 1RHHB 2EDXA 4NBXB 1KJVA 2VDRH 1A9EA 2VE6A 1ZLWH 2ZKHL 3FT4A 5INDB 3EO9H 1ZHKA 1K6QL 4HIHA 5ETUA 4MNQE 4YHIB 3ZSTA 4G8FA 5HD8C 1KACB 1U8OB 1KLGA 3W11D 4HPOH 4U6YA 3ULVL 5IHUH 1B0RA 1YN6B 2OS7A 2AJVH 2ZSWB 1NBYB 5CGTA 3IDXL 1HHHB 2YA1A 2JJWA 5TFSH 4CN4A 2A6JB 1OP3H 1KLFA 2ESVE 3TA3C 2QQLL 4UV4H 1FE8H 1XZ0B 4X4YA 5FOJA 3N85H 1MCOH 3VXMB 3UDWC 1A7NL 1WIPA 4QRQA 3T1FA 1FVEB 3VFTB 3VJ6A 4JPKH 3MRNA 3VI3E 3MXVL 1M71B