5KS9A

Bel502-dq8-glia-alpha1 complex
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
182
structure length
182
Chain Sequence
DIVADHVASYGVNLYQSYGPSGQYSHEFDGDEEFYVDLERKETVWQLPLFRRFRRFDPQFALTNIAVLKHNLNIVIKRSNSTAATNEVPEVTVFSKSPVTLGQPNTLICLVDNIFPPVVNITWLSNGHSVTEGVSETSFLSKSDHSFFKISYLTFLPSADEIYDCKVEHWGLDEPLLKHWEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords HLA class II histocompatibility antigen, DQ alpha 1 chain
publication title Diverse T Cell Receptor Gene Usage in HLA-DQ8-Associated Celiac Disease Converges into a Consensus Binding Solution.
pubmed doi rcsb
source organism Homo sapiens
total genus 39
structure length 182
sequence length 182
chains with identical sequence C
ec nomenclature
pdb deposition date 2016-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00993 MHC_II_alpha Class II histocompatibility antigen, alpha domain
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5ks9A02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 5ks9A01
5CILL 2D0HA 4LVNC 3F65A 1AFVH 4URTB 5SWZA 1L0YA 5FYKH 4P9ML 3B2UD 5TE7L 1NSNH 3DGCR 4F3FA 4IRJC 4GG8B 4RMWA 4KROD 2OQJA 4WUUA 4Y4HD 4DVBB 5IB1B 4QHNB 1HK6A 1CFSB 1E4WL 1UADC 5ANMA 4ELMF 5DRXB 4P5TD 1UB6B 1IGJB 4YXHL 3WNPA 5ISZB 2MOVA 2XZZA 4X9GA 4CU8A 4Z8FH 3M45A 4QHMA 4ZUUA 3CUPA 3FMGH 3GMRA 1VENA 4HWZA 5AYQA 4RIRB 1QLRA 5D2NA 5DEFA 3SOBL 1JNNH 4FQLH 2LE9A 3VFVB 4ENEC 5CWSB 3RVUC 3Q2CA 3T0EA 3MJ7A 2NY2C 1DQMH 5MP6L 1L0QA 4G9FB 1FO0H 3DO3A 4GLRH 2MCG1 3F6LA 4NQXA 4L8BA 2DQDL 3IKKA 2XG4A 4OQTL 2ITCA 1JTOA 5AUMA 3BDYH 5I1JH 4UI2A 3KPOA 4YHOL 2X1QA 5AYUL 3VGAB 3ZDXF 1QA9B 3AVEA 3J8F7 2PW1A 3N50A 5CSZA 5J13B 4NO3A 4ESKA 5FO9A 2QQKH 2YD8A 3LIZL 1QRND 4X7SH 4F3FB 5FUOL 2EH7L 4WUUB 1JHKH 2JIXD 4TVPD 3VH8G 1AY1H 3G6JE 3VFGH 4LEOA 4QRPB 5ANMB 3GKWL 4J3XA 4LASH 5JHDE 2DQTL 3P11L 2FL5B 4K3JH 4QHMB 4ZUUB 2A9NH 1RIUL 1J1PH 3GMRB 4B53A 3C6LD 1NFKA 4NDMB 3U7YH 3CVHA 3RBGA 5I75B 4CU7A 3I2CH 3MX0A 3T0EB 3RWHA 4YUEL 3ZYZA 1FP5A 4M62H 4L8BB 1S7QA 2DLHA 1G9EA 1NCCL 3D5OF 1R3HA 2ITCB 3NZHH 4F7TB 1ZSDA 3MRNB 4QLRA 1PLGH 2J4WH 1CS6A 1OP3K 5J4MA 2YN3A 1FNGB 3N1MC 2A2QT 5CSZB 3O3BA 4NQCD 3GMNA 1RURL 3MA7A 3QQ4A 2YK1L 1LO0H 4PJDB 5EU5B 1PY4A 4YHKL 4IRJA 4F7CA 4LEOB 2YSSA 5C0BD 4NHCL 2VZOA 5IKCA 1Q1JH 1UM6H 5EC2A 3SQOL 3GHBH 1RUKH 2CGRH 1XGTA 3CX2A 3FL7A 3CVHB 4B41A 1DLHA 3FQRA 4JKWA 4P23D 4APQA 4OFKA 5ILTH 3V8OA 3NOIA 3RWHB 2XFXA 1EHLL 1S7QB 3IJHA 1U9KA 2PETA 2R0ZH 3QEGH 3TNMA 2A6JA 1ZOXA 3CFKA 3TN0A 2X4SA 8CGTA 1WBYA 1ZSDB 3RDTA 2G9HA 4W4NA 4JANA 3QCTL 2CIKA 3HKFA 3KGRA 5DJ8A 5DQ9A 2R4SH 1YECL 4RFNB 3WUWA 3JXAA 3O3BB 2VLJE 5D1QA 4EN3D 4PGZA 1GGTA 1RPQA 4JKMA 3MA7B 1ZEAL 3QQ4B 3LDBC 3U7AA 4S1SL 4F58H 2HTKC 2P44B 4FNLL 1MFNA 5C0AE 3MACL 4U31A 3GO1H 1FFNA 1Q9LB 1NBYB 1S7SA 3X12A 5I8OL 1K4CA 3DOSA 3B2VL 1U8IA 3D18A 3FCTA 5EC2B 4MJ5A 1INEL 3D2UA 3RWDA 1DVFC 1XGTB 3NA9H 5F7EL 4K7PX 1WUNT 2QQNH 4JVPA 4APQB 4D0CB 4EI5B 3RIFF 5LVEA 1XZ0A 5EOQL 3VGGA 4HWNA 1V3MA 4WI2A 3IJHB 4M4RA 3WFDL 3TNMB 3FT2B 3TN0B 2X4SB 5J1TC 3CCHA 2G9HB 3DXAA 5EFIA 5IHZA 1H3PL 3KPPA 3F7YB 5DQ9B 3V0WH 5DQJB 2EE9A 3UJIL 3O3DA 1YEEL 4OF5A 5D1QB 1LDSA 4XRCA 4LGRB 3M8OL 4NNPH 2PF6A 3PHSA 3WDIA 5KSAA 3GBNL 4NP4L 2BSTA 3GK8L 5CIPA 1TJIL 1S7SB 4JDTH 3VXMD 2C4FU 1Z0MA 4LNRB 4P46D 1TVHA 3VJ6B 5I6XC 4MJ5B 3D2UB 2IBZX 3F12B 3BH8A 4WW2C 4ODXA 1RUAL 3C08L 1SQ2N 3ZSTA 5IVXB 5DJCA 3EYFB 2FLRT 3IJYA 1WC7B 5HDBE 1I3UA 1A6UH 5ADPH 1ZVHA 2B0SH 1V7NH 1CTNA 1UEYA 1RIHL 4KKLC 4M5ZH 5GGSY 4UB0H 3CCHB 4N0YH 3DXAB 4Q97A 1I1AC 1OTTD 5EFIB 3PJSB 3KPPB 5DEGA 5JQ6H 1JZ4A 1BX2A 3O3DB 3U9UA 4KK8C 4FOMA 3IU4H 4WO4C 5I8KL 1ZLUK 3VXSD 3JVGC 3TYGH 4F9LC 3T0WA 4X0KB 4XRCB 1NCDL 4Y88A 4X8JB 1QG3A 1S7RA 4LLQB 2ZJSH 5GSRA 3I6LE 2LU7A 5KSAB 2BC4B 1G1CA 3FFCE 4YHML 3IXTA 2UYLA 2BSTB 4POZC 2LAAA 4QRRA 1TZHA 1NL0L 3DX7B 4R2GD 3MOAL 4O02H 5C0GA 5KAQG 3UXFA 1TVHB 2X5PA 1N6QH 5IFAL 2F54E 2X9WA 2VDRH 4PLNC 5DMKA 4D0BA 5DJCB 4NQTA 1JNHB 3F8UB 5L7XL 4ZO6A 3BPNB 4QNPF 1JF6A 6FABL 2Z91A 3W39A 4O2FB 1NMBH 3ZE1E 4EDWL 4BYHA 4Z7VF 3ULUE 5DLMH 3HLAA 3MYJA 2NY1B 5DEGB 4N8PA 1L7TH 4R7NB 1UWXK 4JHZA 2MJWA 2BSSA 2IGFL 3RWJA 1MREL 4PJFA 2CJUL 4ZS6D 3KXFB 4M02A 3T2QA 1DANT 1H5BA 1NBVL 5GSRB 3RAJH 1P4BH 3EKCA 4WU5B 3DV6A 1DTUA 1YN6A 2UYLB 3D85B 6CGTA 3UTOA 1U3HC 3FQUA 3MJ9A 1TZHB 3UTSA 3MRMB 2X41A 3HI6L 3DO7A 3I6KA 2EEAA 1UQSB 3TV3H 1D5MA 3WKNA 3S4SG 2VH5H 1HXYA 2ZZUT 4XMLL 4LHJB 3LKSB 3O9WD 3ECBA 4WWKA 5DMKB 3MGTB 4D0BB 3X13A 3RL1A 4WW2A 3BPLB 1HINL 4PRPA 1GAFL 5FOBB 2D4FA 1CVRA 3VCLA 3QUML 3CK0L 4G8GE 5C7XH 5D1XD 4ZS7H 5ISZE 1CLOL 4PRAA 4J2XA 3O11B 1JWMA 1OHQA 3MYJB 4LLVB 4JRXD 1ZKAA 3UJJH 2BSSB 5EU6B 4CMMA 2B2XH 4NQEA 5JQHC 5ENWA 4WO4A 4G9FE 4F9LA 1H5BB 5FYLL 1NLBL 1SYVA 1J5OH 2FD6H 1BZQK 5T5FH 3DV6B 5FGCE 3RWEA 4KRMB 1YN6B 4OIAA 4PV8A 3FQUB 3WXVH 3DO7B 3U0PA 4U6VL 4JM2A 3EO1B 3I02B 1D5MB 1HXYB 5CZXC 3MRCB 3D69A 1MFBL 2C1OB 4LSDA 3VXQB 5KSBA 3RVVC 2EEBA 3TJHC 3BYYA 4PJGB 3X13B 4J3WA 3RL1B 3PUCA 5EORL 2FEEL 1WAAA 1ZANH 4PRPB 5IJKC 4ZXBD 2PR4H 2FECI 4UV7L 2V5RA 3S88L 2OK0H 4R26H 4PRAB 4S0TD 2Y36H 1JWMB 1WVZA 2A1WH 2F9BT 3QDGD 2W91A 4JFZH 5DD5L 1LNUA 5IG7B 3G08B 4CMMB 4KVCH 4AENA 5ERWB 3L6FA 3L3GB 3C5JB 2F5BL 4KJPD 2XTJD 5DYOA 4U1GB 5AZEH 5DJ0B 1VFAB 1NJ9B 3L5HA 3RWEB 1OAYL 5I0DA 4PV8B 4RMSA 2CK2A 3QRGH 4PJEE 2NXYC 4OCNC 3QPQC 1U3HA 3PWLA 3IFLL 4NPYB 2ZUQB 2ARWA 3L3OA 2XWJA 2VQTA 3RPKA 4LK4A 2E6PA 4FP8L 2WP3T 3KLSA 3T1WA 5F9WB 5CJ5A 3SCMB 4Z0XA 1DQDL 4OZFA 3QDMA 2DWEB 3S97C 1MCJA 5C0CE 2ZPKH 3O6FC 1BIIB 1ONQA 3ZTNL 3EO0A 3OXRA 4L3ED 1E27A 1YEKL 5FUCE 4TUKL 5BO1H 3IB4A 1LNUB 5AG8A 4M6NH 3EYSL 3PHQB 4UNVA 1RIVH 2YC1A 4FN0A 3DSFL 3DVFA 4OZHF 1R5WB 3KVQA 1A3RL 3E1F1 2Z92B 4PJ8A 5F9OH 1AR2A 5AD0A 4N0CD 2YD5A 5GZOD 3L7EA 2VAAB 4PJAA 4M7LL 5C0RL 4JPVH 2F53E 1VCAA 4OF3A 4XCCL 2Q3AA 3THMH 4X6EB 4IRZH 4UIKH 3L3OB 4PRIA 2WUBH 4YDJA 2XWJB 1MIML 1TQCC 2VOTA 5D7JA 3RWFA 1VB9A 1NKOA 3CSBA 5HYQA 4Y19A 1DEEB 5KS9B 4Z0XB 4FQCH 1KPUA 4YC2B 4PYGA 5C0EA 4OZFB 1TJGH 5IJKA 2RBLA 3DUUA 3CFDA 4XH2A 5CHNA 2PO6C 3NFSL 3EO0B 2V7HA 3OXRB 2PYEE 2HP4A 4XP5L 1WIPA 4M6ML 2QADB 5GGUA 3AU1A 4WCYL 2WIIA 5EZIL 1I8MA 3ARDA 1F3DJ 1HHHB 2X89A 2YC1B 5GRJH 1A7NL 1CGUA 5JPNA 1F4YH 2DMBA 4PJ8B 1LO4L 3HAEH 1JK8B 1EV2E 1HIML 4XP6L 3K46A 4F7PB 4D0DA 5IB2A 4JRYE 3BZEA 1UWGL 3L7EB 1CU4H 2AV1B 2YWZA 4PJAB 4EI6A 2A9MH 1KB5L 3QCUL 4AL8H 4AK1A 3JSSA 1C7TA 4PRIB 4YDJB 3CDCA 1CE6A 2IANA 5D7JB 4HBCH 5DURB 5BS0A 1N0XH 4GBXB 5L88H 3O2DH 4Y19B 4WI4A 5EOTA 4JY6A 1IGFL 1KPUB 2WUCL 4Q74A 7CGTA 1QNZH 1YMHB 2AK4E 3IRPX 4M6OL 1FDLL 3DUUB 3CFDB 3Q1SH 4OD3L 4K94H 2V7HB 3NFNA 1JRHL 2ICEA 4OZGE 5FYKU 1EFQA 3O6FA 4DTGL 3SN6N 3PDDA 1IRAY 2P5WA 3D0LB 3MRQB 1GOHA 4KKBC 4OBRA 1I8MB 1U3ZA 4DGVH 3SY0B 4U6TA 2X4OB 5JPNB 1QSEA 1QPXA 3D1MC 3D3VE 1G9NH 4FS0A 5DR5H 1NGPH 5IB2B 5EH1A 3BZEB 3MCKB 4G5ZH 4PRBA 3ILQC 4FQQA 4DN3L 1MQKH 3Q6GH 1MQ8A 3NGBC 4EUPG 3M17A 3L5IA 2E27H 3MLSL 3O4LD 4G6AC 5E8EA 2ITDA 3H6JA 1CFTA 1AFVL 3FO9A 2DLIA 5J3HD 5FYKL 2FGZA 3B3IA 1J0YA 1NSNL 2ICES 4KMTH 3QJFA 4ZUWA 1PQZA 4L4JA 1G0DA 2V2XA 3MJGX 4FQ2H 3B2UC 3NFNB 4HQQL 1ZHKA 4XWOD 3FMGL 4KROC 4MGXA 3MOQA 3PHOA 4PLKC 4YWGH 4JKLA 4IRSD 1JNNL 4JDZB 4FQLL 3LB6D 1L4IA 3QZWG 4P5TC 1JV5A 4K71C 1DQML 1KEMH 1FO0L 2MNUA 2LFGA 1QSEB 1MLBA 3PV6B 1A9EA 2J1KA 3QFDA 4HUMB 2O5XH 4KDTC 3V6OC 5F3BB 4Q2ZB 1RVFH 4FQQB 2NTFB 5I1JL 4AH2A 1DJSA 2QKIA 3TBYA 4GKZB 1MCRA 4HLZG 2ZCLH 5M94B 3M17B 5D8JH 3PABB 1Z5LB 2ITDB 1CFTB 3G6AA 3FO9B 2CLRB 2QQKL 4TTDD 4QOKD 4P2QD 2ILLA 3B3IB 1J8HA 3K1KC 4X7SL 4HV8B 1JHKL 4MHHI 1N8ZA 4ZUWB 1AY1L 3P0YH 1EIBA 3KS0H 3NIGF 3VFGL 1NUGA 2UZYB 4H0GA 2H6PB 4DN4H 3RNKA 4LASL 1LILA 4Z7WF 5L2KD 3ULVH 1WCQA 3SGJA 4K3JL 4WDIB 1ZHKB 4B50A 2FO4A 2A9NL 3OHXB 1J1PL 2A83A 2HN7A 3BN9C 3V4VH 3U7YL 1AD0A 3I2CL 5BRZA 3ILPB 1JV5B 4ORGB 4NO5A 5HHXH 4YGAB 3IDYB 3K2MC 4M62L 1MLBB 3QFDB 4O9HH 2VE6B 2JCCF 3C6LC 4YPJA 3NZHL 4UNUA 5ALBH 3TP4A 4UUJA 1PLGL 2J4WL 3SKMA 5JW5A 2ZSVA 2QKIB 4HF5H 3TBYB 2P45B 3VH8A 4C56E 3FN3A 4GRWE 3MCLL 1MI5D 2NLJB 4NQSA 3L3IB 3G6AB 1UM5H 3ROLA 1O7SA 3LY6A 2CMRH 5F1NA 1J8HB 4LU5H 1LO0L 4MA8H 5IIEA 2VRAA 2CUIA 2IPKB 3SKOA 3RNKB 4XMKH 1Q1JL 2AJSH 4MAUH 1CR9L 2R39A 2B4CC 1UM6L 2XN9B 2FO4B 5FYJD 3GHBL 1RUKL 2CGRL 3T77B 2A83B 2WLYA 4UOW1 2HN7B 1D5BA 2Q7NA 1EO8H 3FZUD 1A7PH 5D5MF 5TQ0H 5ILTL 5BRZB 4Y4HA 4PJGE 3VD7A 1OAQH 3RZCD 4HUKB 1G7JA 1BFTA 2DAVA 2R0ZL 3QEGL 4JY5H 4MYWB 2AXJA 3LD8B 2WQRA 1I85A 4P23C 4UUJB 5JW5B 2ZSVB 4KDTA 3VH8B 4HWEH 3MA9H 2R4SL 3EHBD 4OGXL 4YBHA 3FQNA 4LPUA 2J8UB 1QUNA 1MRDH 3MLZH 4F58L 4Q9BA 5E6ID 5IIEB 1YNTA 4GQ9H 5EO1A 5K9JH 3WJJC 3H7LA 2ADJB 4MVBD 1A14H 4NUJA 2GJJA 4S1DD 1CTOA 3SKOB 2DBLH 2Z31A 4KTDH 2F8OA 2FHCA 2X05A 4K07A 3LPFA 5HHOB 1GGIH 1D5BB 5LGJA 1N6UA 2QQNL 1I4FA 2JIXA 5EO0A 1YDPA 5FOJA 3CD4A 1S7VA 5ESVA 3VXPB 5CJBA 2P42B 3G5YB 4RBPK 3BEVA 3C6LA 5FK9A 5BMFH 4JFFE 3DMMA 4NZDA 4DZBB 1QOKA 4RMRA 4JZNB 1ADQH 1PYWB 1OT1A 4FMFA 4JZOB 2V5MA 1R6VA 5CGYD 4M1DH 3I50H 3FQNB 1MCEA 1IC1A 4NNPL 5HYJD 3ET9F 4F9PA 1YNTB 5E00B 4LDLB 5EO1B 4E42A 2JJSC 4NUJB 2ZKHH 5EUOF 4FQIH 4WY7H 4JDTL 1P7QD 2Z31B 2AKRA 4NQCA 2AK1H 4ERSH 1U8JB 3GJEB 2EDYA 1Y0LB 2R0WH 3MLPA 5LGJB 3IGAA 1Q9WA 1T6WA 1I4FB 1MELA 1KGCE 5DA0B 2VUOA 5A40E 1I1YA 5BW7A 4P46C 5KS9E 1A6UL 5C0BA 4R9HA 5ADPL 2B0SL 1V7NL 3ZZ1A 2KBGA 4WHYH 3CDYA 4M5ZL 1AHWA 4UB0L 4N0YL 3GMOA 5FK9B 3OAUH 5IESH 1IAIM 3DMMB 4QWWD 1DLFH 5JQ6L 3U4EA 2NY3B 1KTDA 2BVYA 3R0MA 2XACC 5T3ZD 2XXCB 4FQXB 4K94C 3TYGL 3MUJA 1DBAH 5F8RC 4PJHB 2ZJSL 1OTTC 2AABH 4YFEA 2XPGA 4LSUH 4XCFH 4BFIA 3WJJA 1A22B 1F3JA 1BHGA 2AKRB 4O02L 4EN3A 1S5IH 1UXSB 4KRPD 4MZ2A 5IOPB 2NNAA 4KGJA 1U2HA 3O3AA 1N6QL 1BFVH 3WO4B 4GW4A 1Q9WB 4LHUD 2JE8A 1F4HA 1QR1A 3JV4A 4JE4B 3H0TB 1I1YB 4J23A 1CD8A 1MWAH 1NDMA 3R4DA 3DYPA 3OKEA 1TJHH 1AHWB 3U79A 1NMBL 2Z9TA 2E7LC 3GMOB 4JCLA 4EIZC 5DLML 1KJ2H 3BEWB 3TCXA 4L4VB 1L7TL 1JGVH 3U4EB 4Y1AD 1P6FA 1MSPA 1OSZA 3QUYD 4K7PY 3FHAA 4C59B 1DP0A 3QWQB 3RAJL 5FKPA 1P4BL 3CLFL 4R8WL 5MEND 4N0RA 1F3JB 3AFLA 4M3KB 1FRGH 2NY0C 4K3EH 3F62A 1M05B 4EN3B 3VXRD 4R4BA 3TV3L 3U36A 3VD5A 2VH5L 4G6MH 4HFUH 2NNAB 1B3JA 4HK0B 4PRDA 1RJZA 2AXGA 1X4YA 3FRPG 1QR1B 3JV4B 5MHSD 3LH2L 1NCWL 5C0DA 5KBNC 3DETC 1QFWM 4DEPC 4CRPA 4HT1H 1NDMB 2PTVA 1YNLH 3OKEB 1YEGH 1CDJA 4P46A 5JOPE 1A6TB 2EDTA 3O9WC 4ZS7L 4U1SB 5IT2H 3HC4H 3UJJL 2IBZY 4M1GH 4TNWK 3SE9L 1XF3B 2UVEA 3QIUC 3ULVC 1OSZB 2B2XL 1I7TA 2AAVA 4JVUA 4CBPA 5D1XC 2E9BA 3LN4B 4ZFGL 3S4SA 5H8DA 1X5XA 4TNVK 2I25N 1KG0B 3OGCA 1H3GA 5LJYH 2FD6L 4LHUG 5BV7B 4X6DE 1HNFA 4PJ9B 4IM8A 4GG6B 3AROA 1TETH 4MX7B 3WXVL 4ZOBA 2VL4A 4DFIA 3VXSA 1NLDH 5H94B 3U36B 4JO1H 3LQMA 4PB9H 1AO7D 4EQ2A 3OKKB 3T2NH 1KIQB 3SJVD 3PWVA 4HX1B 2UY6A 3CSPA 1KNOA 2OR8A 5C0DB 1ZANL 4FTVD 4PREB 4FQ1H 1BZ7A 4R6UA 4G6JH 4X9FA 2IF7A 1CXEA 1FNSH 3Q5YA 2PR4L 3GGWA 4MSWB 5JDSA 1NGQH 1DSFH 5K9OB 5IVNA 5KSVA 4R26L 2OK0L 3V5DA 5LXGL 2Y36L 2Z8VC 3C6SA 2A1WL 4LLYA 2AJVH 2E7LA 4JFZL 1K9TA 4P99A 4GS7C 2GKIA 1KLUB 3ARQA 4ZXBC 2EEDA 5MERA 1IJ9A 3B83A 4KVCL 4KK5D 5J9PA 1X5GA 1Q94A 1W72A 3S4SB 5F7KC 3KYMA 4LKXA 5B4MC 5DUBB 1KPRB 5AZEL 3OGCB 1ZLWH 3SEPA 4ZNEA 3T3PE 1FLRH 4RAVA 3QRGL 2BHUA 3VXSB 4Z7OE 4KJPC 5DI8A 2XTJC 2ID5A 4GXVH 4HKBA 1Y6NR 5DK2A 1J0ZA 5INCA 1OL0A 4DGYH 4KU1A 1KNOB 1TTFA 3QRFM 5T1KB 4HLJA 4QRSA 5IQ9B 3HZKA 1HKLH 1LE5B 4LCWB 2ZPKL 1BP3B 3BRFA 4PJIE 2DQJH 5E9DE 5KSVB 4MD0A 4I8DA 3KPSE 1ORSA 3C6SB 5E4IA 4LLYB 1R5VA 3LEVH 4QXGH 5C6TH 5MERB 2X4RB 5HI5C 4M6NL 4TVSa 1RIVL 4K3GA 5DRWA 2VSCA 1W72B 2X6MA 3WNLA 1BMGA 3EOAA 2Q20A 3H3BC 3KYMB 4LKXB 3JWOH 2FEDD 2DMCA 3BZ4B 3ARFC 4PBVC 4UT9H 2R1YA 4RAVB 1U8LA 4ZAKB 4JRXA 4JPVL 1BAFH 4HC1A 2XZQH 2Y5TA 5DI8B 1RULH 3TO2A 3D39E 3THML 5A3ID 4IRZL 3D48R 4UIKL 3JWDH 5GZOC 2WUBL 1NDGA 2J8UE 5DK2B 5INCB 4OAWA 2R2BB 4Q6IB 3ULUH 1RZFH 2N4IA 1G9MH 3BUTA 1INQA 1YJDH 4FQCL 2BOCB 3J7HA 1XGUB 1TJGL 4H88H 4W4OA 4N90D 1A1OA 4PG9B 1FVDA 1A0QH 4MD0B 2AQ1A 2YHGA 4C4KO 2ZG3A 1ES0A 5JW4R 4QRQB 3IDUA 4XNZC 3OXSB 4N68A 4PBWD 3KPTA 5GRJL 1CDUA 3E3QE 3ZE2F 4ZXBA 1F4YL 4WI3A 3PL6C 5CKAA 2DI8A 3EOAB 1LGVA 4OF6A 1JPST 5C0FB 3QULB 1E4KC 1CU4L 1FZOA 2YA0A 3HE7A 3QDGA 1U8LB 2IQ9H 2YBRA 1LEGA 3HG1D 2FBOJ 2Y5TB 2A9ML 1CK0H 1ETZB 5GS0D 3MV9E 5GRVL 4AL8L 5GGVY 4TULH 4X5WA 3QCVH 1VDGA 1CLYH 2UWEF 1NDGB 4HBCL 1PKQE 2XWTA 1N0XL 1N59B 1U8NB 5L88L 2YPLA 4ODTH 3O2DL 1INQB 5IBLD 3N85H 3QUZA 4P5KA 2FB4H 2VITA 4BZYA 1OAXL 2D4DA 4K94L 2WNGA 2YOCA 1FVEA 5F9JB 5TDOB 5GS2D 3EJZC 4JN1H 4DGVL 5CS7A 4L4TB 5LG1A 3CAFA 5JHLH 1JZ7A 2P49B 2DLGA 5DR5L 2VXSL 1H3WM 4ZD3H 4L3EA 4G5ZL 1KB9J 4HIHA 3MRDB 3KYOB 3HE7B 4N8CH 3QDGB 4S1QH 4F2MA 1DEDA 1MQKL 3AM8A 3Q6GL 4OCRH 5AEAA 4YXKH 4CMHB 2OBGA 4R3SB 2E27L 5IP4A 3PV7A 1QSVA 1TMCB 4X5WB 5C3LD 4Q9QH 1QSFE 2XTLA 3ARBC 2MTPA 2YPLB 4Y4KD 4KMTL 2HT4D 3QUZB 3IS0X 4P5KB 2NCMA 1E6OH 5F7LB 1QFUH 4FQ2L 4AIXA 4NNYB 3OAZH 5J11B 5DGRA 1CDHA 2ESVE 1G7HB 1YEHH 1KULA 4LCCC 1CG9B 5JW4N 4EUPA 5TH2A 5HVWA 1UGNA 1KEML 2NQCA 5JR1H 4XWOC 2I26N 2XWBA 2RGSA 3ARTA 2I24N 2O5XL 2J6EA 4IRSC 2EIBA 1RVFL 5J56B 3LB6C 4QT5A 4X6BB 4F2MB 1E4KA 4JKPH 3VG9C 4L4VE 4BSJA 2ZCLL 2QL1A 4OF0A 3SDXB 1PX4A 2MKWA 1XT5A 5D8JL 4Z7VA 4KJQC 3JV6A 1MCCA 1I3GH 4O58H 4KI5F 2X4PA 4CN4A 3VFSA 1D6VH 1QQDA 2C9AA 4R0LC 2MQ3A 1RD6A 2DIBA 3MRKA 3OKDA 8FABB 4JREB 3P0YL 4X7TB 2YUWA 5D2LF 1UJ3C 1UEMA 3QZWA 3MOBH 4HS3A 4DN4L 3ULVL 5DC4B 3EYOB 3RI5K 5DHVH 4PJBF 3S98A 1IBGH 3PIQB 4W68A 1P7KA 4EUPB 2RIKA 4JY4A 4R7DA 4RWYH 5HHXL 5TH2B 4POUB 2R2CA 4ORZC 1EGJH 4O9HL 3WN5C 1BBJA 5I76B 3L5WA 5ALBL 3C5ZD 4YK4B 4QT5B 3MLWH 2IH3A 4HF5L 4I0PC 4KXZI 3I3EA 4L8DB 3AREC 5HHMB 3HC3H 4Z7VB 4AQ1B 3JV6B 1UM5L 2X4PB 3FO0H 2CMRL 4GKNA 5TE6H 3QFJE 5F7HA 4Q9RH 3TWCH 1U8PB 1QQDB 3VFSB 4LU5L 4KJYA 5CCKH 4MA8L 1B4JH 1F2QA 2BNRE 3CSYA 4CL7A 3L3KA 1F8TH 2CO7B 4DGIH 3C87A 4GG6E 1G6VK 2DWDA 3QZWB 4HS3B 3ALXA 3LKNB 4PTTB 3O4LA 4XMKL 2AJSL 4MAUL 3HMXA 5EZOH 1SHMA 1YC8A 5FUZL 2FYYB 3FRUA 3VI4E 1KT2A 1EO8L 3SO3B 1KPVA 1S8DA 1A7PL 5D7LE 5TQ0L 2Y4SA 4LCCA 4JY4B 4R7DB 1MHEA 1OAQL 1T66D 1RZGA 4UMGA 2FHFA 4JY5L 4MJID 3VDAA 1XH3A 5FM5O 4OCSH 3NA4A 3DRQA 4YIQA 3FZUC 1YPZE 3VGHA 4TRPH 2IH3B 4R97C 1T0PB 3MA9L 3BH9B 2ARJB 4IRSA 3RZCC 4DZ8B 3G6JF 1QO3A 1WV7T 2Y6SD 4LLDA 3SGEI 2NR6D 4K3HA 3T04D 1MRDL 3KR3H 1GHFH 4KJYB 4GQ9L 2N7BA 5EZLA 1MJ7H 5K9JL 2FEEI 3L3KB 1T04A 3ZDYE 1A14L 4R0LA 4QEGA 3UDWC 3GMLB 5F6HI 1UJ3A 3JWOC 5CZKA 4QOKA 5E6IC 2HH0H 3KLHD 1T7WA 1ZHNA 1GGIL 1KT2B 1YEFH 2YD9A 5DD0H 3RGVD 5DMJB 4S1DC 1KPVB 1S8DB 4ALAH 1V8HA 1UACH 4NBZB 2HWZH 3QIWB 4MNQE 4PD4K 4N9OB 5I1LB 2DM4A 2H32B 2DBJA 1XH3B 4YHZL 2YD2A 3QIBD 4LCWE 5LKNA 3DRQB 3WN5A 2EE6A 3ARGD 1UZ8A 3TYFA 1YJDC 5BMFL 4LKCA 1K8DA 4PGJA 2IEPA 1AGFB 2G60H 4R96A 3UTPD 3KPNB 1KXTB 4M1DL 3RJQB 3I50L 2XQYK 1YC7A 2WBJD 4Y5XA 4NO0B 1KV3A 3E0GA 2DS4A 3PP3K 4OZHA 5D9SB 5EUKA 3K80A 5CGYC 1T04B 3L3JB 3QQ9C 3MJ8A 2ZKHL 3DI3B 1OPGH 4FQIL 4WY7L 5SWZE 5BQ7A 4JFEE 5IEKB 3OKMA 4R90H 2AK1L 3QI9D 4ERSL 4ELKA 4JB9L 4RFEA 3S3JA 2R0WL 3SDCD 3BI9X 3MV8E 3ROOB 4KTYA 1MRCH 3QHZH 2D7TH 3UTQA 4HIJB 4U0RB 2CDEA 2BY0A 1OOAA 4P3CH 3MLVH 1H8NA 4LLWB 3DX9B 3LAFA 4JHBA 5D2NE 1NAMA 1J87A 1UZ8B 3OAUL 3TYFB 4HMDA 5IESL 3GHEH 4W70A 1K8DB 5DD1H 1DLFL 3BSZH 1CBVH 2EDEA 3P4MB 1ITCA 2HKHH 4RRPG 4R96B 2J5LB 1QBBA 4RGNE 3HS0A 3BDBA 2LV4A 1U8OA 1DBAL 2IAMD 4Y5XB 1YMME 5I71C 3ZT5A 2AABL 4OZHB 3ZKSD 1ZGLB 3FFDA 4HFWA 4LSUL 1QACA 5FA4B 3HB3D 5GGTH 4XCFL 4KI5D 2Z93A 4F57H 3MJ8B 2LTQB 3UROR 3OKMB 1S5IL 5T3XD 1WZMA 2VQUA 4I2XA 3TT1H 1I7UB 4U7SA 1BFVL 4H1LH 2OZ4H 5K9QG 1OB1A 5E6IA 3QEQD 5D96C 1JPTH 3UTQB 2HLFD 1N5AB 1S9WA 3GSNH 5HGDB 3QWRD 2DM7A 3BXNA 1G7IB 1TJHL 3SDAD 5ITFA 1NAMB 5DHXB 5F1OB 1NMCB 1KJ2L 4KC3B 3D9AH 4DJMA 1JGVL 3MLUH 4X6CF 2I9LB 3ZKXB 1KN4H 1JGUH 5E5UB 3HS0B 1U8OB 1ZHLB 3BIKA 5TGBA 5ICXB 1FZKA 3S35H 1DN0B 3S37H 3NIFF 4XPBL 3FFDB 4NRYB 5EZJA 1FO0B 4G7YH 4HFWB 4I18C 1FHGA 3ALPA 1XF5A 3QUYC 2Z93B 4OCWH 3ARRA 1JPFA 2ZUUA 1FRGL 4K3EL 1A1NA 4Z7UF 4HG4J 2MHAB 2EE3A 2W0FA 4DKEH 5F3HA 4G6ML 2Q86A 4HFUL 4I2XB 2OLDA 5HYJA 4FFVD 1P84K 2M8XA 5DFWH 4M48H 2AVGA 3GIVA 4QXTB 4DVRH 3G9VA 3MNZA 4HT1L 4UQ2B 5F1IA 3MUHL 4NGHH 5K93A 1YEGL 2OI9C 5ITFB 3TVMD 1BOGB 2A6DA 2Q7YA 1J05B 3OL2A 4UOJA 3HC4L 5HHPA 4M1GL 4F33B 4X99A 4E5XA 4PY7A 2PXYD 1MF2L 2BVPB 1HILB 2CDFB 1WEJH 2W9DL 5SWSB 5TGBB 1FZKB 3KPQB 3SPVB 4G6KH 3S3PA 3U0TA 5IV2A 2IQAA 1W8NA 3FRPA 4BSVA 1TETL 1XF5B 5HHQA 1FGVH 4D9LH 2VDOL 4ETQA 4PG2A 4HCRA 1A1NB 4K7FA 5IBTL 1N64H 1NLDL 3V2AR 4G3YH 1EEUA 1ULVA 4JO1L 2DLFH 4PB9L 5HDQH 2YRLA 5HYJB 3T2NL 1RJLB 2RHEA 3Q5TA 2ED7A 1XAUA 3GIVB 3FO2B 3VFOA 5F88A 2ADFH 4HIXL 4XTRD 3MNZB 3L95A 2P8MB 4FQ1L 4GLRI 5F1IB 4KI1A 4BZ2L 1FNSL 2HG5A 3T1FA 5FYLE 1AGCB 1UB5A 1NGQL 3IDIA 1DSFL 1EMTH 4LPWA 3LV3A 2VL5B 4LHUA 2AJVL 3C5SA 4Z7WA 1YY8B 3BW9A 4X99B 4E5XB 3EYVB 4PY7B 1DBBH 2JELH 3C60D 3ZKQD 2IPTH 2AP2A 3RU8H 4LGSB 1AD9A 1X9QA 3B9KA 4WI6A 5I8EB 5C0JA 4CVUA 2IQAB 1WWAX 4BSVB 4OLYH 1FLRL 4Y1AA 1U8KA 4I18A 2B7DT 3MNVB 4O5LL 4XP4H 3QUYA 2APTA 4UTBH 1JWSA 3PWJA 4FRWA 2XY2A 3DX8B 4GXVL 4IOFD 5EU3B 2DJUA 5C71A 5E8PB 1NC4D 4MAYC 4DGYL 1YA5A 5DFVC 3UTTB 1JN6A 3VFOB 1HKLL 3VXRA 1HSBA 3T1FB 4NQVA 5F7DB 1N2RA 2DQJL 2JJVA 3LV3B 2X4UA 4LHUB 3C5SB 3LEVL 4Z7WB 4QXGL 5C6TL 4HD9A 3BW9B 3A6CH 1BREA 4NT6B 4JFXA 4OF7A 4P59H 3TPUA 2HRLA 3D6GA 1AD9B 5D5MA 3B9KB 4ONGH 3JWOL 4OV5A 5C9JA 5ID0A 3DSNA 4UT9L 5JXEA 1AQDB 4OFVA 4Y1AB 1IAII 3FN9A 1BF2A 1CI5A 2N56A 4RA0C 4P0DA 4XVSH 3HE6A 1BAFL 3VWJC 4OD1H 2XZQL 1TLKA 5EBWB 1YYLH 4KHXH 3QYCA 1RULL 3RVXD 3PWJB 1FZJA 3GZKA 3JWDL 2FEDC 1CQYA 2X70A 5MEQB 4F7EA 3ULUL 1RZFL 5DDHA 4QRRE 1G9ML 5E7BA 2J8HA 2PW2A 3DARA 1YJDL 5T1LD 4L29B 1TCRA 5A3IC 3BP4A 4FQJH 3KLAB 3VXRB 1HSBB 4PTUA 4XCNA 4NQVB 4KVNH 2ZSWB 1A0QL 5KW9H 4X83A 3UCRA 1SJEA 4B7IA 4G8FB 2BDNL 3QJHA 4FTVA 4J4PA 3I9GH 2A73A 2VXTH 5F6HJ 3I6GA 1PW3A 4ZQKA 2QQLH 1J1OH 3VFPA 5C9JB 3MUZ1 4C57C 5ID0B 2M1KA 2IQ9L 5GQBA 4GRMB 3HE6B 4PJDF 4PJFE 3AS1A 3VGDA 3RWCA 1CK0L 3TIEA 4NQUA 4ODVH 4ZO8A 3KJ4B 4TULL 1FZJB 1CLYL 1FBIH 1FVCB 3K8KA 2FJHB 4P48A 5DDHB 3RHWK 1C8PA 4ODTL 2PW2B 1DE4A 3ES6B 5GS0C 3BO8B 3RX5A 3N85L 4TQEH 1UH3A 2FH8A 4G43B 2DL9A 4MXWH 4PRHB 2FB4L 4WEMB 4JO2H 4PTUB 5IMMB 5ACZB 3VXNB 1W0WB 4PJ7B 2HVJA 4W6XB 5IBLC 5EUOA 4QXUH 1SJEB 5FB8B 1YUHA 4NFDA 4JN1L 3QJHB 1U42A 4NN6B 2G75B 4HEPG 2A73B 1DQJA 3RY6C 4LPVA 5BVJA 3I6GB 2Q87A 4YZFE 4ZQKB 1QLEH 3VFPB 3MROA 3H9SD 1Q9OA 2NXZD 3WE6A 1EVUA 4N8CL 4V1DD 2EXYD 1QBLH 2E3VA 5MEPA 3BGMB 4OCRL 4YXKL 5IW1A 3HCVA 4RFOH 4ZFOA 3RWCB 5IUSA 3OB0K 3AMLA 3X14A 3C2SA 4XPHH 2GTZA 5IB4A 5I9QC 2E9JA 4UDTA 2OL3H 3O41B 3T8XB 1E6OL 1QFUL 4ZUVA 3BD3A 2BMKA 2UUDH 1TVBA 2YD6A 4Y4KC 5LAXA 1YUHB 1YEHL 5LBSH 1PY9A 1DQJB 1NFDB 4YHIA 5BVJB 1AIFA 5FYKE 5JR1L 3STLA 4FG6C 3PQYE 2JKXA 1Q9OB 4CAGA 4JKPL 5IW1B 1JWUA 4U6YA 5DJZA 4PFEA 4LSQH 4ZFOB 1J1XH 1EUUA 2Q3ZA 1HI6B 1I3GL 3X14B 4O58L 4HWBH 2OJEA 4I5BB 5IB4B 3AB0B 1D6VL 2QR0A 2CRZA 4LEXH 3K4DA 3SGDI 2P7TA 3MRJB 4UDTB 4BA8A 4OTXH 3HG1A 3HRZA 3HZMB 2ZP0T 3F5WB 2W9EH 4OI7A 3GIZH 1W8OA 5ISZD 3MOBL 5IVXF 3HI5L 1BD2B 5D93C 4ZUVB 1YEIH 1FG2A 2BMKB 2QLVB 1M4KA 5I1HH 1XGYH 2W0LA 4JQVA 5LAXB 5GIRA 5BXFB 4Z76A 1IBGL 1NBQA 1A5FH 4I13B 3QEHA 2EZ0D 4G9FD 2VLRB 1X3DA 3CMOH 4JO3L 4YHIB 4JEGB 4P5MB 4PJXA 1AIFB 4N5UA 4JFQB 4MA1C 1EGJL 2OS7A 3RY6A 3UYRH 3VW3H 3BRDA 2BK8A 2AJXH 1CE1H 5HYSG 1KCSH 3DVNB 3V0AC 3MLWL 3K2UH 2NZIA 1JGDB 1V3KA 2VB5A 4KQ4H 4LDEB 1PKOA 3HC3L 3VFTB 4NOBA 3FO0L 5TE6L 4Q9RL 3TWCL 2QR0B 4I48A 5SWSE 4PY8I 5CCKL 2P7TB 3LRGA 1B4JL 4IOIB 3HRZB 4QRPD 4WFEE 1F8TL 5I1IL 2FNBA 4PYHA 3ZKND 1JZ6A 1P1ZB 5DMIL 1MCPH 1FG2B 5J0BA 4UNTA 1K8IA 4RX4A 3MRBB 2BY3A 1T5XA 4Z76B 3N1FC 2K9UA 3BT2H 2R1WA 4X5LA 1A7OH 1S7TB 3OR7A 4I0CC 4PJXB 1FNEB 2WQ8A 5HBBA 3JUYA 1BQHB 2JJTA 3QAZB 3U9PH 4OCSL 3ZLQC 2CKBH 2VUYA 1FNAA 4NC0B 5JOFB 1BVKA 4TRPL 2OSLA 3B43A 3FN0H 1T66C 2VXUH 1RZJH 1S9VB 2IWGA 1NH6A 4PP2A 4QO1A 4F8TA 5MI0B 4RA3A 1JYVA 3FB8A 3DNKA 3UP1A 2CK0H 2OX5A 5CJQH 1OP5H 3WLWC 4J3OC 4YBLC 4KDVA 2DDQH 3KYKH 4HJGA 1RJYA 1GHFL 5B39G 4U1LA 4YGVA 1IGTB 4OGAD 1RZ8A 1MJ7L 2D7NA 4BFBD 3SDDB 3QXDA 3BUYA 2GT9A 4J3SA 5E4EB 3TEUA 2Y6SC 2R2HB 4YHNA 4XBEH 2Q6WB 3GJFA 2NR6C 3QA3A 2IANE 3GRWH 4HGMA 1UKTA 5BS0E 4NC2B 3TF7C 2HH0L 3U4AA 2PYFA 4HMEA 3PWPB 5DD0L 1YEFL 3UBXG 4OFYD 2R1WB 1BEYH 5DJYA 4ALAL 1K2DA 3OR7B 1HKFA 1UACL 2HWZL 1CVSC 3R0NA 4Z7NE 4GRWF 3P73A 5DZNA 3P4NB 1P2CA 4U1IA 4YE4H 3KLHC 3RGVC 3FQXA 4MJ4A 2P5WE 1D9KD 3PGDA 5GS1C 1A02N 4NRZA 1EEZB 4RAUA 1AQKL 3V7AE 3L3DA 3SKJH 2G60L 1V5JA 1NGZB 1Q72H 4MCZA 4PP2B 3W0WA 3FB8B 1JUFA 5FKAB 5J6GA 2AS5M 1S7UA 4HPYH 4ZSOA 3PDGA 1QRKA 3C5ZA 3K74B 1F4XH 3BUYB 2GT9B 3HAEB 3P9LA 5CINH 5I1AA 1G6RH 4PJGF 1OPGL 3WJLC 1OVZA 3QA3B 4R90L 3ZSSA 4U2YA 1T83C 4LF3A 1RI8A 2EYSA 3FJTA 3VMOA 1U8QA 4APQD 4EI5D 3RIAF 3VFRB 2D9QB 1K2DB 4KMLB 1MRCL 3QHZL 2D7TL 4WJ5A 4WFGE 3V8CA 1CGYA 1JGLL 3P73B 3QI9C 4LCYB 4JRYD 2V7NA 3OJDA 1P2CB 4P3CL 3MLVL 2G5BB 4YX2H 3ZHDA 3C8KB 3PGDB 3GHEL 5DD1L 4NRZB 4JHWH 1CBVL 15C8H 2HKHL 3L3DB 1X7QA 4KPHH 5D1QD 1CN4A 4MCZB 3W0WB 2CLVB 4K2UH 1JUFB 1UWXH 1MCIA 1JF5A 4MJIA 4WTXA 1S7UB 4ZSOB 3CZFA 5EBLA 2L4OA 3C5ZB 2AK4D 3NH7L 1BF8A 4QTHA 4XWGH 4QXWA 5GGTL 5I1AB 4F57L 3F7VA 4JFDA 1QBMH 2IAMC 3BFOA 2CIIB 1DQTA 2VZSA 4LF3B 3TT1L 2EYSB 1UCTA 5FUOH 1U8QB 4QRUA 2BX5A 2OZ4L 3TH4T 3HB3C 1TIUA 4WENB 5DTFA 1JPTL 1KIPB 4WJ5B 3D3VD 3LPGA 2UWEA 3GSNL 1HEZB 2V7NB 1IAKB 2L7UA 4PRHE 1RUML 1HDMB 3DXAD 3QDJA 3NTCH 2HLFC 4PJ7E 3RGVA 2DOCA 3D9AL 4XNQB 3RA7H 1PDKA 3MLUL 4YUEH 1EAPA 1X7QB 5GS1A 1UENA 1KN4L 1JGUL 3MFFB 3O8XD 4FFWD 2VN7A 2Y23A 4IIQC 4MJIB 3QIBA 5KSAD 5K9KA 3C09C 3CZFB 5EBLB 3S35L 3S37L 3ARGA 3KHQA 4G7YL 5J89A 2YEZA 3RKPA 4Y5YA 4OCWL 3F7VB 4JFDB 3WLBB 4LBEA 5KS9F 4D9QD 1NUNB 1FFQA 4E41B 2X9YA 5ICZA 4DKEL 4CGTA 3WJLA 2WBJA 4FZEH 3HR5A 3BGFC 1GJIA 2APBA 3FB7A 1FYTA 4OT1H 4M48L 3CFCH 3T0AA 1QEWB 2UWEB 3MRLA 4ZTPH 3OAYH 4DVRL 2I5YH 3VFUA 4NGHL 2KZ1B 4RDQF 1QKZH 1W0VA 3QDJB 4FFVC 3U30B 3HPLA 2DI9A 2O61A 3SDCA 2FBJH 5EWIH 3T4YB 5HI4C 4PGCB 4XBGA 1EAPB 3EYUH 5I1GH 5LGHH 2H41A 1LQSR 3VFMA 4YLQT 3HR6A 2FLBT 3KXFD 3TVMC 5E8OA 1EEYA 3NABH 1NFDE 2AEIT 3QIBB 3ZO0A 3FO1A 4TNWF 5JIPA 3ARGB 3D85D 3V6OE 4G6KL 2JK5B 4WVRA 3GM8A 2YEZB 4Z7QE 4AEFA 2PXYC 1FGVL 4Y5YB 4D9LL 4EXPX 3ARVA 2V9RA 1TPXC 4TNVF 3VXUB 4LBEB 1CQKA 1GXEA 4KKCD 1N64L 5ICZB 2F5AH 4G3YL 3E2HC 2DLFL 3HR5B 3EOTH 4LVHB 5HDQL 1GL4B 3FB7B 1FYTB 4LSSH 4IS6A 5LQBH 4OCYH 3MRLB 2ADFL 1NUDA 1SY6H 4CADB 1T20A 3LVEA 1QRNE 2FIKA 3LKQA 2GY7B 4N9GA 3LRHA 2C3GA 1BD2E 4UTAH 1EMTL 4C56D 2J8OA 3OR6A 2O61B 4TVPE 3SDCB 5D2LA 5KVGH 4AIZA 4XBGB 5EU6D 4P57A 4OB5H 1I8IB 2FX7H 1DBBL 1X44A 2JELL 5DEZA 3QWRA 1EEYB 5E8OB 1RZ7H 5L8KB 3TBSB 2IPTL 1TQBC 5CEXB 3RU8L 3SDAA 3FO1B 3EJJX 2V2WB 5DVOA 3QQ3A 4OLYL 3DROB 3C60C 1DN2A 4OLZH 4XP4L 1OTUC 3T0XA 2DYPB 4UTBL 2B5IC 2EC9U 3SE4C 3TZVC 1KENH 4HJJH 1UYWH 4IJ3C 2V5TA 4Z5RA 1RZJC 5BVPH 2IH1A 5K9QI 2EKJA 4IOFC 3LKQB 1UVQB 1ERNA 1BLNA 1F3DH 5KN5B 2BRQA 4G80A 4OLVH 4G42A 4PY8J 3SGKC 4ZUTA 1DL7H 5KZCB 4L9LA 4AIZB 2AV7A 5HY9A 4P57B 2XA8H 3RQ3A 3A6CL 2X7LA 2XNAB 5C0BE 1NGYA 4P59L 4X7DC 4JZJC 4AM0A 3UO1H 3CX5J 3SDAB 3ARFB 1DDHA 4ONGL 1V3JA 3QQ3B 3DIFA 5EBGA 4PLOB 5IGXH 3T2OA 4XVSL 4OD1L 4HW6A 1YYLL 2PXYA 4KHXL 1PJ9A 4H8WH 5J6HB 2XZAH 1FFPA 4GUPA 4NN7C 5IFJA 4MLSA 4ZODA 3IXAA 3G6JA 3CVHH 4UBDD 4WV1C 4J3TA 3SCMD 4JGMA 5F1KC 5JHDA 3MOAH 4KQ3H 4YDLB 5CLWA 3RVXC 2O26U 1CZ8H 2ZNXA 5B3NA 3DI2B 3BIAX 4JFFD 1H0DA 3KAAA 3OB8A 4HS6B 4G42B 4ZUTB 5KW9L 3T3PF 1QP1A 5L7XH 5E08H 3PWPE 2R56H 2X7LB 4KFZC 3I9GL 1NGYB 2VXTL 1VGKA 2GHWB 4OIIH 2NY4B 2BVUA 2QQLL 5IW6A 2IC2A 3CH1A 1S9XB 1U6AH 1WFUA 3MV11 3DIFB 2HT2D 1I8LC 2ED8A 1MCDA 3LKRA 1X5IA 2D9CA 4MNGA 1ACZA 1G7MB 1MREH 5HYFA 5D6DC 3WFZA 2WWMC 4H20H 4ODVL 1NBVH 1IQDA 4GUPB 3QXTA 4PJIF 1FBIL 1S7WA 1G0YR 3O4OC 5I30H 3SE4A 4DW2L 5EC1A 2E7HA 5M95B 1PX3A 5JHDB 4TQEL 1A6WL 2JB6A 4MXWL 2NPLX 1AXSA 4JO2L 1A6AA 1H0DB 2F74A 4XMLH 2HYMA 5B8CC 3LRSA 2WBWB 2WINA 1CFBA 4UU9A 5GISH 1NC4A 3IRZA 4QXUL 2YZ1A 1AKJB 1IKNA 4K8RD 3OKLA 4PJ8D 3IU3B 3VXME 1VGKB 4P4RB 4BH7A 4N5ED 1T7XA 2IG2H 3MLRH 1QLEL 1I9IH 4KDWA 4ELME 2J8UF 4OZ4B 4L1DA 1MWAB 2IJ0C 2VLJA 1QBLL 3LKRB 3SKUD 2D31B 4M7ZB 3GB7A 4FA8A 3C9NA 4HAGA 4JVWA 4NZUH 2QHRH 4PRID 1KJ2B 4X4MA 5I74B 3BX7C 1CWVA 3MLYH 4XPHL 5D7JD 2NXZC 3WEXB 1A64A 2FO1A 4GBXD 2EXYC 4Y19D 2W92A 5DMGD 5E6YA 4WV1A 2JB6B 3TT3H 2OL3L 2D2OA 1IEAB 1WCBA 5BZDA 3IVKA 1ZS8A 2GJZA 4GRLB 1A6AB 4JFOA 2F74B 2W0PA 3LRSB 1C12B 1NC4B 2F15A 2FSEA 2X89D 3B9DA 4M00A 2GK0A 5KTEH 1UM4H 5LBSL 5IWLA 1OQXA 5D72L 5T1LA 2UVFA 2YRPA 4BH7B 5CFHA 4MD5A 3KWWA 4QHUA 1SMAA 4RZCA 1JPGA 2VLJB 5CIPH 1UH2A 3X17A 1TXKA 5MEOB 2H9GA 3C9NB 1KYOJ 1J1XL 4NCDA 3O3EA 5HVFB 5A16A 4NWTH 3RVTD 4YR6A 5C09E 4ZNEE 3GBML 3O45B 5C0AB 4HWBL 4X6CA 5GRVK 4PBXA 4JN2B 1IM9D 3HZYA 4HEME 1CDIA 1NFIB 4ODUB 4LMQE 3GUTB 2FATH 3ARWA 2VLLB 5DJAB 3UPAA 4OTXL 4RDQG 2BJMH 2W9EL 1ODAA 5JOPD 3GIZL 3IFLH 1WCBB 3S96A 1ZS8B 3IDJB 4CN6A 1YEIL 4JFOB 3DHJA 5F7YC 5I1HL 4E41E 2HRPH 4XI5C 4NYLA 5B8CA 1A5FL 4Z7UA 2V9TA 1U91A 43C9A 2F8XC 3H3KA 3UYRL 4RNRA 3TNNA 2X2YA 3KWWB 3CXHJ 3JTSA 3RWIA 1DBMH 3NCFB 3LEXA 2AJXL 1OW0A 1CE1L 4H26A 1KCSL 1F4WH 4PJHF 4RZCB 2EZ0C 3AREB 1AE6H 3K2UL 3D0VB 4KQ4L 4MWFA 3K81A 3ULVE 3MRRB 3O3EB 3LHPL 2DJSA 1LP9E 5A16B 3UZVB 4YR6B 2Q76A 4R4FH 1MCFA 3FFCA 4Q9CA 2KQNA 2AEWA 3HZYB 2Q8AH 3VGAC 1E4XI 2CRYA 4JRXE 4MLIA 3MBEA 4EBQL 4V1DA 1JI1A 5J13C 3MV7E 5GGSA 1K3IA 5TQ2H 3UTZB 2DIAA 3S96B 1MCPL 4PJCE 1SJHA 2BXYA 2IALA 2ATPB 4NO2A 5LWYH 4UV4H 1JP5A 1XR8A 3BT2L 1A7OL 3BVNA 3ZKNC 1U91B 1MCNA 43C9B 3REWA 1FC1A 1E28A 1B9ZA 4XP5H 1JZ8A 3TNNB 5K59F 5I75C 3H9ZA 3JTSB 4H25B 3CJJA 3RWIB 2EKSA 2CKBL 3LEXB 3U9PL 4H26B 5J12B 3T0EC 3VG0H 3MJ9H 1A7NH 4TUOB 4YAQA 1RZJL 2VDNH 1CLZH 2CK0L 4HMCA 2Q76B 2F58H 5CJQL 3FFCB 1UWGH 2DDQL 3B6SA 3KYKL 3BKCH 2VDKH 4UDUB 1FL6B 2NMSA 3KPRB 5BCAA 3MBEB 4HUUB 1IKFH 5GGSB 4CDGC 1ZHBB 1AGEA 3NCBB 2PTTB 1I7ZB 4XBEL 5CD5D 3NPSB 2F54B 2XN9D 2XTJE 3UEZA 5DHYA 2AXFA 3MUY1 1LDPH 2IALB 4NO2B 1BJ1J 4GG8A 2EDDA 3UJTH 5HYSB 2WUCH 3KS0J 1KFAH 2Z8SA 5BRZD 4OZIB 4DVBA 3BVNB 5IB1A 1CFSA 4G8GA 3REWB 4M6OH 3S35X 5CJXA 3S37X 4Y5VA 1UB6A 5ISZA 3G5VB 1FE8H 1JRHH 3WFBH 2Z8WC 4YE4L 1MFAH 3BD4A 4U7MA 2EDFA 2HFFB 1JTTA 3QO0B 5KAQF 2ORBH 3A0OA 5B39A 1FG9C 2C3VA 3ABZA 3D39D 3RWGA 3VFVA 2EDOA 3SKJL 2FJGA 4G9FA 4GG6F 1Q72L 4OI8A 1NCUA 5TF1H 4L3EE 4Y89A 2X4TB 3B6SB 4RFNC 2WAHA 4HPYL 3ZTJG 4KUZH 5JIHA 3UBXA 4M4PA 1F4XL 4S2SA 2BXZA 1QA9A 3BRGC 5CINL 5DUPH 5F7WC 1G6RL 4MNHA 3REVB 2APXA 4GXUN 1XF4A 5DHYB 2AXFB 1HHGA 2V5SA 4AQOA 5HHOD 1CYGA 1YPZF 1UCBH 1FCCA 1Q0YH 1UKSA 4M8QB 5IF0B 3V6BR 1UG9A 4G8GB 3BDXA 4QRPA 4Y5VB 3D25B 2FL5A 4HQQH 3V79C 4YX2L 1ZLVH 3V6ZB 4APQC 4D2NA 4EI5C 3BYTA 3JBG7 4NDMA 1X5AA 5B39B 2C3VB 3RWGB 4JHWL 1F00I 2X1XR 15C8L 2FJGB 3ZDYF 4KPHL 1LK3H 5B38G 3TN0C 5HPMA 3RDTC 4K2UL 3GMPB 5FGCB 4EJ1C 4F7TA 4M8VA 4NIKB 3MRNA 4NM4H 4PJEA 3QXUA 2B39A 4QNPE 3UBXB 1Y18B 1FNGA 4I9WD 5D1QC 4XWGL 1A1MA 4S2SB 2A38A 4OZFH 2Z31D 3VWKB 4MNHB 4NUGH 1QBML 4HIIB 3FHQA 1XF4B 1EXUA 3H2WA 1HHGB 4QYOB 5DJ6A 3TCLA 5JXAH 2YUXA 4WHTA 3UPCA 1RSFA 4PJDA 5EU5A 2F19H 1EAJA 5DD3H 5DRZB 1TZIB 5C0CA 4PLJD 1HHKB 4U1NA 2AQ2A 1R3KB 4FXKB 3UYOD 3RPIB 3S5LG 3DMMD 1MUJA 5HD8D 3NTCL 2ICWA 2NY3D 1UZ6E 5SX4I 4D3CH 3RA7L 1R5IB 4OFYA 5A2IH 1ZA3A 3C8HA 4FQXD 1KJVB 4BH8A 4WFHD 5HPMB 4AT6B 1KIRB 3ELAT 2QSCH 4WW1B 4PJEB 4NZJA 1D9KA 3O6LL 2H45A 5AZ2H 2R8SH 2GAZA 1A1MB 4R4ND 3MCLH 4FFWC 5FV1L 1X5LA 2WK2A 4BFGA 3G5ZA 2MCPH 5EA0L 2ESVD 3EJYD 5KSAC 1EXUB 4NC1C 5DJ6B 3TCLB 2ZUYA 4KKAD 4WHTB 2XT1B 4FZEL 1OGAE 5T1MA 1D5XA 4OT1L 2DQHH 1Q9LA 1PVHA 5C0CB 1NAKH 3CFCL 1NBYA 5EDXA 4ZTPL 2W65B 4U1NB 2VSDA 3UBXI 4FMKA 2PYEA 5H37H 2I5YL 1CR9H 4X4XA 2P4AB 2MFNA 1NEZG 3L9RB 1SEQH 1QKZL 1GRWA 1MUJB 4HDIB 4L4VD 1I1CA 2CKNA 2AW2A 5LCVH 3GSOA 2ICWB 4RWHA 5C6WH 4D0CA 4EI5A 2FBJL 1CT8B 5EWIL 2ARJQ 5TFSH 1ZA3B 3BPNC 3GMQB 5I1GL 3EYUL 4BH8B 5LGHL 5T5NF 5DHVB 1CD0A 1L9MA 5CEZH 1KJ3H 4JRYA 3BJ91 4AEHH 3FT2A 3X3FH 3EDKA 3NABL 2NY1C 1MH5A 5DVNA 2F53B 5DK0B 4ODSH 1MLCA 1D9KB 2E7MA 1MCOL 4U05A 3F7YA 2GAZB 5DQJA 4WGVB 1C5CH 3WNMA 4J8RB 3G5ZB 4GSDH 4OGXH 2X9XA 5DS8A 1LD9A 4QRTA 2F5AL 3EOTL 5JA9A 3RVWD 4LSSL 1D5XB 5T1MB 2AK4A 4OKDA 1MCKA 5LQBL 1IL1B 1I9JL 4OCYL 4KKCC 3MSPA 2PYEB 1SY6L 4LNRA 4X4XB 3VJ6A 5ACMA 4P2QE 5I73B 5M7QA 4BZ1L 5C86A 3F12A 4PV9A 4UTAL 3GSOB 3BPLC 4E0RA 4IBLT 5KVGL 5IVXA 1YY9D 3EYFA 2XXMB 1FN4A 1WC7A 3VDCA 3D3VA 4OB5L 2FX7L 4IDJH 3QFJD 5L2KE 4JRYB 3IJSA 4Q0XH 1RZ7L 3R06A 1MH5B 4ZMAT 1R3LB 3PWNA 3LQZA 1KACB 1MLCB 1QPPA 4PJ9D 3PJSA 4PB0H 5ID1A 4OIBA 2CRMA 2ICWI 4OLZL 2NW3B 1H5BC 3EZ8A 3ISWA 1TDQA 3O8XA 4X0KA 5DS8B 2DTSA 4X8JA 2OCFD 4LLQA 1LD9B 4QRTB 3Q3GB 1KENL 3K1DA 5D7LD 4HJJL 1UYWL 2BC4A 1A4JA 2AK4B 3N1QC 4X4ZA 5ICYA 5BVPL 1OD9A 3DX7A 3TIDB 5E5MA 1MI5E 4OZGB 3OJ2C 4DKFH 4NFCA 1SBBA 4FZ8H 4WWKC 4PV9B 3MXWL 1GOFA 4OLVL 2CXGA 3CMGA 5IEHA 5CKGA 4E0RB 4O2EB 2FX9H 1DL7L 4PP1C 4U1HA 1FN4B 1JNHA 1EZVX 1J0HA 2XA8L 3D3VB 3NCMA 3ZT7A 1T7YA 3IJSB 3EZJB 3VFNA 4O2FA 3SDXF 3R06B 3UO1L 2APVA 1T4KB 3LQZB 3PWNB 3FOMA 1WISA 4HGWA 43CAB 1IVLA 4R7NA 5FECB 5ID1B 3FT4A 1JHTA 4GO6B 4MB4A 5IGXL 5A1AA 3O8XB 4U1GC 1CFVH 3KXFA 1UH4A 4H8WL 2XZAL 4WU5A 3EOBA 3CVHL 3TO4B 1A4JB 1F13A 3D85A 5T1KD 4NHUB 5ICYB 4LSPH 4JM2C 1NKRA 3MRMA 4JGJA 5E5MB 2EYRB 2A6IA 3KPRE 4KQ3L 1UQSA 4Y4FA 4LCWD 1DUZA 4CN1A 5F7MC 1CZ8L 4UBDC 4P4KB 5A43C 5D6CA 4POYA 5F9WC 5IEHB 3LKSA 3SCMC 3FONB 3MGTA 3EFFB 3MNWB 4U1HB 3P77A 2D0FA 2YS4A 2P8PA 3HMWH 5FOBA 2EDWA 4QCIB 5E08L 1CF8H 2R56L 1IGMH 3HRPA 1BIHA 1LEKA 1CIDA 4OZIE 1M7DA 2FGWH 4OIIL 3VFNB 4U6XA 1S7XB 2XQYG 3O11A 3FOMB 5KOVC 3IDXL 4HGWB 4C56A 1U6AL 3ZMRA 4MA7H 1ZK9A 4LLVA 4ZAKD 5IMLA 1HH6A 1ZLWK 1S78C 3FT4B 1JHTB 5EU6A 4HKZA 4YHPA 1JYNA 1D6EB 1A7RH 2X1PA 4H20L 1HOCA 4XNXH 5D70H 3GSXB 4X7FC 1SMOA 3CLFH 3T0BA 2HT2C 3EOBB 5I30L 4R8WH 5FF6B 2YD4A 2A6IB 4Y4FB 4LRNH 4NOFA 3EO1A 1DUZB 1AI1L 3I02A 4MDJB 3W11D 3OQ3B 1FV1A 3MRCA 2C1OA 5D6CB 3VXQA 4YC2C 4PJGA 5GISL 3RFZC 1T2JA 3P77B 3LH2H 1NCWH 4RGND 2P8PB 3QXWA 1LEKB 1TFHA 1BQSA 1M7DB 1ZT4B 5CBAA 3WBDA 3UZQA 4JG1H 4LVOB 4U6XB 3MZTA 2QADC 2VTFA 2IG2L 3MLRL 4OFIA 3KYAA 1I9IL 5F96H 5GRUH 4C56B 3CU7A 3W5MA 5IMLB 1MIEL 1HH6B 3GSNB 4GRWB 5DZLA 5ETUB 5IG7A 3G08A 2W60B 3SE9H 3UZEA 4N0FB 4PJ8C 4HKZB 4YHPB 5ERWA 4N5EC 4EKXA 3L3GA 4KK6C 1DANU 3C5JA 4NZUL 2QHRL 2VISB 1HOCB 4ZFGH 2BVQB 3HA0A 3G9AB 3MLYL 5DJ0A 3VFWA 1VFAA 1J10A 1Z0NA 1NJ9A 1FLTX 3T3ME 4TVPH 3P40A 3L3HA 4MJ6B 4OSUH 2VWEC 1HWGB 5E1HB 5CJ8A 3TT3L 2CQVA 3QPXH 4NPYA 3QH3B 5D7JC 1FV1B 2GIYA 5E70A 2M2DA 2HJFB 5C2UB 1WTLA 3IAGC 1DCLA 5FM8A 5KTEL 3SCMA 3VMPA 1UM4L 1I9RH 4L4TD 2PTUA 2DWEA 3EO9H 5CBAB 1BIIA 3BJLA 4N1CA 3F7QA 4JFFA 1CFQA 5I1KH 3ARDC 5LXGH 1H15B 3SHSA 3GSVB 3FOLA 3HE7D 4U0QB 1NBZB 3QHTC 1AR1C 4Z95H 1OF2A 3PHQA 1AJ7H 1ACYH 1R5WA 2Z92A 2E9IA 4NWTL 4U4BA 5F97E 2WMPA 3VFWB 2B4CH 2YUZA 3BAEH 2GUOB 2VAAA 2YPLD 3L3HB 2FATL 2JCCE 2R2EA 1EFXA 3QUZD 5T33L 5L0QC 1FIGH 2I27N 2BJML 5HI3D 3RVTC 2VKXA 5I8CB 3OX8B 4X6EA 1IM3B 4WTWA 1EO5A 1OTSC 5T5NG 2BZDA 2XA3A 2HRPL 5I18H 5MENE 4ENED 1P6AB 1DEEA 5KS9A 3GKZA 5HVGB 3FB5B 2EDKA 1WSST 1VERA 4JFFB 1CFQB 3FOLB 2QHLA 1DBML 1F4WL 4WHCA 2BNQB 1HHHA 5MHSE 1AE6L 1OF2B 1RUQH 2FECL 5EBMA 5DJ2B 1O0VA 2WIMA 1FH5H 4OFPA 3PGFH 1JHLL 1HHJB 3TH3T 1JK8A 4LCIH 5D5ME 4F7PA 1PG7W 1XIWA 4R4FL 3EBAA 1A4KB 2BVOA 2AV1A 2GYSA 3PDOA 5CUSH 2Q8AL 2R2EB 1EFXB 5E8NA 3NCYS 4RMTA 4WEUD 5FYLD 5TQ2L 5SX5H 1CIUA 2HT3D 1QVOB 2FWOB 4HH8A 1Z3GH 4XPTH 3IYLW 1FORH 4J6RH 5C0NC 5LWYL 4GBXA 1CICB 4UV4L 5IROC 4UQ3B 2FJFB 2XZCH 3OAZK 4NNXA 3T65A 4TOYL 1FPTL 1YMHA 1JJUA 1HQ4A 3WCYA 4W6YB 4B5EA 1VFOA 1AO7E 4UIMB 5J57B 3S6CA 5CGTA 1OAKH 3SJVE 5BV7H 3D0LA 3MRQA 3VG0L 3SY0A 3MJ9L 3IDYC 5EBMB 4D9RD 5HHMD 4FTVE 2X4OA 5E5RB 4O2CA 2PUQT 2VDNL 5FA3A 1CLZL 3WMSA 1NPUA 3BPOC 4KGLA 1XIWB 3LQAH 2F58L 2BVOB 1ITBB 5EO9A 3MCKA 3PDOB 3BKCL 2VDKL 2DF3A 5HVHB 4K55A 1XCQB 5E8NB 1IKFL 2Z35A 3SE8L 3PG2A 3DVGA 3OWEA 4N8VB 3MUGA 1M7XA 3OKNB 4X9BA 4JR9H 4TN9A 2L0DA 1BJ8A 4F15B 1LDPL 2KL6A 1IM9A 3UJTL 3T65B 4NNXB 3AY4C 1J86A 1KFAL 3QNYB 4KZEH 2ICWJ 3ALWA 1HQ4B 5CD5C 3SGJC 4BUGA 3A67H 5DJDA 4LNVA 1BOYA 1OAXH 4ZOCA 3MREB 1FE8L 3WFBL 1F90H 4H5SB 5D7IE 1MFAL 1MPAH 1X5HA 3CFEB 5EUOE 1V3LA 3ORJA 2ORBL 3QG7L 4JDZA 2K3TA 4LLUA 4O2CB 1F58H 5DO2D 1AXIB 2ED9A 3WIHA 5FA3B 3LD8C 1WIOA 3PV6A 4LIQL 1J0JA 2VXSH 2VDQH 5TF1L 2HTKD 5DRNB 1FC2D 2HFTA 5EO9B 2YRZA 5F3BA 4Q2ZA 2NTFA 4KUZL 4GKZA 4NJAH 4DUWA 2Z35B 4XAKD 3RBSA 3DVGB 3ARSA 3MUGB 5DUPL 1FJ1A 3PABA 1Z5LA 1DVFD 5E95B 4P2OB 2CLRA 5EU4B 2EDNA 3N1PC 1BVZA 1IM9B 4HV8A 1UCBL 1Q0YL 2ZCHH 2YXMA 2GITA 3QIWD 5IROA 5KJRH 2VERN 4HPOH 1M1SA 2H6PA 5DJDB 1JPSH 3BWAA 4Z9KB 3QNXA 3VXTB 3DURB 3MRIA 4WDIA 3OHXA 1JNJA 4ZUSB 5FDWB 1KCUH 4YEFA 3P30H 4M7KH 4Y4HC 2CD0A 4JFHE 1NGWB 4LLUB 3ILPA 1YN7B 4ORGA 5F9DC 1LK3L 3KPMA 3V5KA 1I85C 2C26A 2VE6A 4N90E 3CFJB 1BFSA 4NO0D 1ZTXH 4X6DB 4JPKH 1VFUA 2NY6B 3CLEH 4NM4L 1HH9A 1ZWIA 4RQQA 1RHHA 1U8MA 1MY5A 2W1NA 2NLJA 1FJ1B 3L3IA 4NUGL 4UT6H 4GJTB 4WIQA 3BPCB 5JXAL 2ZOKB 3U2SB 2F19L 5KSUA 4A6YA 5E0QA 2GITB 3QNZB 5DD3L 1WJ3A 2Z31C 3TFKD 4QKXB 1PFCA 2LU4A 2IPKA 4PJIA 3NCJH 3AY4A 5E9DA 5B38A 3BWAB 4Z77B 3QNXB 4NBYB 3KPSA 3MRIB 2XN9A 1N7MH 4LOUD 5E2TH 1TITA 1I1AD 3T77A 4G8EA 2OL3B 4PLJC 1CXFA 4D3CL 1RK1A 2APFA 3EFDH 4HC1H 3DUSA 3KPMB 5E7FA 3V5KB 3PP4H 2OR9H 1WFNA 2QSCL 3DMMC 4PR5B 3GI9H 5HD8C 1SVZA 2NY3C 3TPKA 1HH9B 3U0WH 3W9EB 1ZWIB 4RQQB 5IFHH 1RHHB 4FQXC 3BIBX 5AZ2L 1LHZA 2R8SL 1U8MB 3D39A 5IJVA 2MCPL 2J8UA 4F9PC 4U1KA 1N6VA 3FTGA 2VXQH 1VKXA 3UX9B 1TZGH 4M61B 2GCYA 2DQUH 4JCMA 5KSUB 5HGBB 4R4NC 1NEUA 1ZGLM 4A6YB 2ADJA 2DQHL 1NAKL 4PJIB 2C1PA 3LS5H 5E9DB 3EJYC 5B38B 5HGHB 2GSIA 3WHE1 3KPSB 3WO4C 4PJ5E 1SEQL 3Q5OA 4YFLI 5FUZH 4G8EB 4LDOB 3VRJB 5HHOA 4EXKA 5LCVL 1JBJA 5BW7C 1RK1B 5TFSL 3IKCB 4CVXB 2VXVL 1T0MA 1EEQA 2VAJA 3DUSB 2BSRB 3VXPA 2R23B 1AHWC 3TA3B 3ZE0E 5CEZL 1KJ3L 4AEHL 1IEBB 3X3FL 2P5EE 1DFBH 1REIA 2AJYL 3G5YA 5E56A 3VDBA 5B3JE 1T0NA 4ODSL 4DZBA 4JZNA 4O00A 3ZYOA 4WNQA 1FSKB 1PYWA 1N3NB 3BKJL 3D39B 4B7LA 4P2CG 4XNMB 3MV9A 4JZOA 1TPXB 1C5CL 4G9DB 3FAXA 1QZ1A 2GY5A 4GSDL 4HKJB 4HK3J 4NZTH 3W9DA 1VEMA 5IJVB 5A2FA 3B9EA 4F80A 4U1KB 1NEZA 4KXZH 3FTGB 4YHLH 1VKXB 4DUVA 3S5LB 3VXOA 2GCYB 3L5XH 5E00A 4RMVA 2P8LA 2HJKA 4PJ7F 1SJXA 1U3YA 4EN3C 4D94A 2C1PB 1MAMH 3MV01 2GSIB 1U8JA 1JNLL 3GJEA 1LO5A 1XF1A 4RGOH 3RVWC 3CVIH 2NZ9D 1Y0LA 1WF5A 1BQUA 3P9WB 5TE4H 1JZ5A 1T0MB 4IDJL 4YHZH 5SWSD 2YA2A 4Q0XL 5TPWH 3VD9A 4WFED 1T0NB 4NKDB 3SO5A 2ZG1A 4WNQB 4LARH 4PB0L 2X4NB 3MV9B 5SV3A 2BNQE 4FQXA 4LCUA 1QSFA 3W9DB 5CZXD 2CKBB 4YDKH 1PKQB 1XGPB 2EIZB 2XG5A 2Y06H 1IC7H 1NEZB 4PJHA 5BV7C 4YO0A 4PJ9C 3VXOB 1GIGH 2P8LB 4UILH 2HJKB 4JPWH 5JIIA 2FH6A 4EUPH 3IAPA 5HJ3A 2DIJA 4PPTA 3LQAC 4DKFL 4PS4H 1LO5B 1IAOA 1UXSA 4FZ8L 2ESVA 4JB9H 5IOPA 2V5YA 2J6EH 1NFDF 4HJ0D 4OCMC 2FX9L 4L8SA 3W2DH 5JA8B 2R9HD 3LCYA 3H0TA 1FQ9C 2ICCA 3LMJH 4H0HB 4PGDA 2EICA 3BQUA 2EDJA 2N7AA 2ADIB 2FR4B 5JORB 5DT1H 2QV2A 1VHPA 1P5VA 1T03H 3BEWA 2W38A 4FFZH 4L4VA 3QPQD 4JFYB 4LCUB 5IB5B 1QSFB 1CFVL 3STZB 3ZT6A 1ZV5A 4XT1C 4YO0B 1KCVL 2WZPD 3UTTD 4LSPL 5J8OA 4OQTA 1CXIA 4HLZH 3CDGB 5HJ3B 1T1WB 5DSCA 3ME0A 3PNWB 1M05A 1IAOB 2ESVB 1FFOB 4YFDB 1PZ5B 4HK0A 3UC0H 5L8LB 3MXVL 2R1XA 4L8SB 1VADA 4R2GC 2X4QA 3BKYH 5FO8B 3HMWL 1CF8L 1IGML 4PGDB 3BQUB 1IZKA 3IS1X 2FGWL 2E8YA 4P49A 1F02I 4XP1H 1A6TA 3B9KD 1KC5H 4U1SA 4JO4H 4QGTA 4MA7L 3F58H 5HPOA 4YBQD 3H9YA 4AMKH 5D1ZB 1XF3A 4LPXA 1SBSH 1EBAA 4U3XA 3QFJA 1KTRL 1A7RL 2J88H 3HMXH 3LN4A 4LFHD 4XNXL 5D70L 3QG6B 1KG0A 4EQ3A 4XPBH 4ZAKC 3R8BB 4PJ9A 4GG6A 5H37G 4MX7A 1WZ1H 4ZS6C 5DSCB 2PO6D 3M1BB 4LRNL 5H94A 4Q6IC 1CL7I 2ZG2A 3OKKA 1NC2A 1KIQA 4PJXF 2R1XB 3S9DB 5D7LA 4HX1A 1VADB 2X4QB 4P2RE 4W81A 4PREA 3W11C 1Z9SA 4MSWA 3WD5H 4JG1L 1YPZA 1EHXA 5K9OA 4V2CB 2HFGH 4OLUH 1MHHA 4NN5C 2OMNA 5F96L 5GRUL 5JXED 5CGMA 1KLUA 3HE6D 3K7UA 2FIRT 3ESVF 4ODHH 3GSUA 4JQXA 1MF2H 4G8IA 3QFJB 2W9DH 5C08E 3CGTA 1EZVY 4MZ3A 3HUJB 5DUBA 1A7QH 1KPRA 2BNRB 3W82A 3V7AG 1H9VA 3QO1A 4TVPL 3MBXH 4OSUL 2D3VA 3QUXA 2VDOH 2YWYA 2RFXB 4AYFA 4PRHD 1EO7A 3O81A 5IBTH 4OD2B 1QLFA 5CP3A 2VO5A 3QPXL 2EYTB 2DQIH 1DBJH 1NC2B 4KKBD 5C70A 1T3FA 5D7LB 1I3VA 2BERA 3NPZB 1Q8MA 4F7MA 5T1KA 3CC5B 4DFHA 4J4PD 5IQ9A 1KJMB 1I9RL 4HIXH 4MXVE 4W4OC 4AY0A 1XEDA 1NMAL 2KZWA 4BZ2H 3IFOA 1FYHB 1LE5A 2N1KA 3EO9L 4WI9A 4U7KA 4LCWA 1G7QA 5IB3B 4LFHG 1YPZB 1MHHB 5I1KL 4Y8AA 5D2LE 1HHIB 4LQ1A 3QEQE 4JQIH 4I1NB 4QHKI 2GJ6B 2X4RA 3MRFA 4Z95L 1I1FA 1Q0XH 4PJBE 3GSUB 1AJ7L 4J12A 5F6IB 4H0IA 4G8IB 1ACYL 5IR1B 1CGSH 4N0UB 4EEEA 3RUGB 1QHPA 1VFBA 3HE7C 2B4CL 4JAMA 3BAEL 4IHOA 4X9IA 3QO1B 3BZ4A 4AEIH 4CMHC 3PGCA 1H3XA 5KG9B 4ZAKA 3BHBB 3QUXB 5GRXG 3RTQA 4JFEA 4O5LH 1FIGL 3SE3A 1QLFB 1JI2A 4M93B 5D7KE 1P9MA 3MV8A 5FYJH 2C5DC 4PLKD 1NAMH 1T3FB 2BHZA 1JYWA 4Q6IA 2R2BA 2BCKB 3QUZC 4MNQB 3DYOA 4F7MB 5I18L 3TBTB 1OD7A 5HI3C 2BOCA 5DC0A 1XGUA 3IFOB 2IBBA 1KELL 5TJWK 1KOAA 1M6OA 1G7QB 5DQDL 5J11C 5ESQB 1AP2B 3MR9B 1IMHC 4PG9A 4TPRL 1KIUA 5JTWA 4KV5F 4QRQA 4Z18A 3OXSA 3MRFB 3IFNH 2DTML 1RUQL 1I1FB 4ZPTA 3U4BL 4Y16B 2BSED 3BOVA 1FH5L 1YMMA 3PGFL 4DOHE 4WI7A 2YZ8A 3BD5A 5DFTA 4LCIL 1VFBB 1ZT7B 2ERJB 2HLAB 4XC3H 5GS3A 5C0FA 3QULA 4JAMB 3AM8C 4NM8H 4IHOB 5HDOA 2DN7A 5CUSL 5CBEB 3PGCB 3V52L 5E2VH 3RTQB 5SWZB 4JFEB 1ETZA 1BD2D 4N0CC 2OQJB 2WV3A 3B5HA 3MV8B 1T89C 1Z3GL 4J3VA 4ZDHA 3BN9D 4XPTL 1QSZA 3ZL4H 4L3CA 1FORL 4JREC 4J6RL 3N06B 1N59A 1U8NA 2DI7A 2UUDK 2XZCL 1S5HA 5ESAA 2VLRD 4NJ9H 5F21B 3CUPB 2V2TA 2HT3C 3WIIH 4HWZB 1SEBA 1M6OB 3H42H 5C07E 5JMOC 5GGRY 1QLRB 5D2NB 4Y2DA 5DEFB 4YH6A 4HZLA 3LN5A 3MJ7B 1OAKL 1YYMH 2DLTA 5BV7L 5F9JA 5TDOA 4NQXB 2BDNH 2EXWD 3W5NA 4DWHA 4RGNB 4ZPTB 2HJLA 4RISH 2GK2A 4L4TA 5AUMB 1YMMB 4TUJA 4HBQA 1GCFA 1GPOH 3JV5A 3KPOB 3LQAL 4YK4C 5JNYA 2HFEA 3FQWA 2DM2A 1H8OA 3MRDA 3KYOA 3IF1A 2PW1B 4W6WB 5F93C 4NO3B 4MNGE 1QFHA 5FO9B 3NVQA 4R3SA 1OARH 3LKOA 3WO3B 3EW3B 4ZDHB 1FNFA 4JR9L 1IAIH 3MJ6A 4L3CB 5D7SH 1S5HB 1U2CA 5ESAB 2ADGA 4KZEL 2V2TB 3OF6D 1KXQE 5EOCJ 1SEBB 2BVTA 4KRNA 4LSRH 3A67L 4Y2DB 2A74A 2NX5E 3QBTB 3ULVF 1KLGA 2IMMA 4MMXC 3DV4A 2A6KA 1LP9F 3HNSH 4HZLB 2QBWA 1F90L 1NUFA 3LN5B 4NNYA 3SO3C 2BP3A 3RP1A 3UYPA 1Y6MR 1MPAL 1RJCA 3DYMA 3T0VA 1G7HA 3MLTA 5FHAH 1A6ZA 1R3HB 2OYPA 1CG9A 5E2WH 2HJLB 5T3ZH 1F58L 4HCRH 3WFCH 4TUJB 2VDQL 5JNYB 1WZLA 2HFEB 4PJCF 3FQWB 5HTSA 3IF1B 4X6BA 5DO2C 3SDDD 3QUMA 4BQCA 4NJAL 1LO2H 3GMNB 3SDXA 4LVNB 3LKOB 4X4ME 4RX4D 4X7CC 4IRJB 4F7CB 2NW2A 3PWPD 1T89A 2YSSB 5IKCB 8FABA 3G5XA 2ADGB 1NANH 2C4FT 2ZCHL 3TBVA 4XX1E 4X7TA 5KJRL 4HPOL 2VKWA 2GW5A 5J3HC 5J1SC 3S7GA 1W72L 2A74B 1JPSL 1DLHB 1KLGB 2BVEA 3DV4B 2A6KB 1ND0A 3EYOA 3FQRB 9CGTA 1P4IH 2DQGH 2XFXB 1KCUL 1JGEA 3MLTB 3P30L 2VYRE 4M7KL 3QIWC 1A6ZB 3PIQA 2A6JB 2NY2B 3WFEH 3CFKB 1WBYB 3RDTB 3CXDH 4JANB 2CIKB 2DRUA 5DJ8B 1ZTXL 3WUWB 5I76A 1PSKL 2W0KA 4JPKL 2QSQA 2YPKA 3CLEL 5H35A 2H26A 1OP5K 3QUMB 4MB3A 1CLCA 1QFWH 4L8DA 4M7JH 3PF2A 4OM0L 5J06A 4NSKA 4BK4A 4UT6L 1BQHG 4X6CE 1FFNB 1A9BA 2NW2B 3VU2A 1GZPA 1U8PA 2RJMA 3X12B 1K4CB 1U8IB 3G5XB 3D18B 3FCTB 3TBVB 3RWDB 4GAYA 2E9WA 2D7OA 3NIFE 3HI5H 3LKNA 1O5DT 3NCJL 4PTTA 4TTDC 1ND0B 1FNHA 1N7ML 5E2TL 1XZ0B 2AEPL 3L1OH 2FYYA 1JGEB 3KJ6H 4HULB 4Z7UE 3TFKC 2Q1EA 4U0RC 2DKUA 2KDGA 5HXMA 3EFDL 4HC1L 4U3HA 4YHYC 3W0WD 1ZGLP 1N5YH 1K4DA 4JO3H 4QF1A 3PP4L 4LOUC 4G7VH 4L8CA 2OJZH 2OR9L 5IHZB 3GI9L 4KZDH 3STBA 1MCLA 2YPKB 2KPNA 3U0WL 5H35B 2H26B 4HZAA 3AAZA 2J5LC 4YDIH 5IFHL 3HTLX 3HNVH 3BH9A 2ARJA 4DZ8A 4OLXH 4IMLA 4LP5A 4NSKB 4Y5XC 3WS3A 2EDRA 1A9BB 1GZPB 5CIPB 2VXQL 3H9SE 4GAJH 1TZGL 2EDBA 3HUJE 1JVKA 2DQUL 4V1DE 4DK6A 2VC2H 4LHQB 2LTQC 1CXLA 1IAMA 2AGJH 5I1IH 3N9GH 4GAYB 3RX7A 1EDQA 3LS5L 3BH8B 3KYNA 5DMIH 3GMLA 4ODXB 5FHBH 2AJ3A 2CR6A 1DVFA 3SGDH 4XXDA 1R24A 4ZOEA 3IJYB 4ZPVA 5KOMC 1OWRM 3HAEG 3QIWA 4GMSH 1K4DB 4QF1B 5C09D 4E9LA 5I1LA 4JFPA 2H32A 2VLKE 4L8CB 1NMCC 1BX2B 2Y72A 4KRLB 1DFBL 1IARB 3U9UB 1V7MH 2K1MA 2BOBA 5JO5A 3HHRB 3ZHLA 3AAZB 3ZKXC 1CD1A 1J9CT 2BRRH 1AGFA 1S7RB 2NY0D 4IMLB 4JFDD 2DKMA 2GJ6E 3KPNA 4NQDE 2H2SD 3WS3B 4NZTL 4E41D 2X40A 5GJSH 3IXTB 3LDBB 4GFTB 4N0UE 3DECA 4NO0A 4QRRB 3HC0A 4YHLL 3RUGE 5F8QC 2VZTA 3EYQD 3L5XL 4QHKJ 5D9SA 3DETD 5C0GB 1HWHB 3O6MH 3L3JA 3F7RA 3EHBC 1UZ6F 1MAML 3KYNB 3ARYA 5IEKA 2AJ3B 1DVFB 4XXDB 4RGOL 3DUHA 1R24B 3QDJD 3WL9A 4ZPVB 3CVIL 1KB5A 3ROOA 1HZHH 4MVBC 3QIUD 3UAJD 5TE4L 1F97A 3ULVD 1FL5A 2Z91B 4HIJA 3W39B 4FXGA 4JFPB 5JW4Q 3HLAB 3DBXA 3O2VH 2NZ9C 5KVFH 1MOEA 4LLWA 5TPWL 3DX9A 1I1AA 1BECA 4XPFH 5JO5B 3MV7D 2BOBB 4PD4J 3RWJB 4PJFB 1CD1B 1J0KA 1AQKH 4LARL 3P4MA 3CSGA 3I75A 3JVGA 3R8QA 3VXUD 4U1JA 1BJMA 4YDKL 4RGMC 2Y06L 1IC7L 3HC0B 2X1WL 3UTSB 1FYTD 2YXFA 3I6KB 1ZGLA 2G5RA 1GIGL 2JLLA 4UILL 5FA4A 1A6VH 4JPWL 5JMRA 1UC6A 4GKSA 1BM3H 4JDVA 1H8SA 1OCWH 5I6XB 2Y5EA 2RQ8A 4PS4L 3ECBB 4WWKB 5KVEH 5FCUH 4CU6A 3OAYK 3WL9B 4WW2B 1I7UA 2J6EL 4M7LT 3OPZH 4WUUE 5C6PB 2HMID 5DF0A 3WHE0 1KB5B 3VCLB 5FGSA 3W2DL 5K33A 4QRPE 1FL5B 5ANME 3B5TA 1N5AA 2JB5L 1BFOA 4C58B 1JGLH 1ORQA 2VIRA 2BHYA 4FXGB 5HGDA 1H3VA 3LMJL 5B4MD 3PQYA 1G7IA 3DBXB 5CSGA 2YA1A 4HJ0C 1I75A 1WK0A 1F6AA 1I1AB 1QYGH 5DT1L 1T03L 1YEDA 4NQEB 4FFZL 2R9HC 1SYSA 5ENWB 2QJDA 3T0EE 4WO4B 1IGYA 5SV4A 2I9LA 3I75B 5GS0H 1WTGT 1SYVB 2VLME 4U1JB