5KS9A

Bel502-dq8-glia-alpha1 complex
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
182
structure length
182
Chain Sequence
b'DIVADHVASYGVNLYQSYGPSGQYSHEFDGDEEFYVDLERKETVWQLPLFRRFRRFDPQFALTNIAVLKHNLNIVIKRSNSTAATNEVPEVTVFSKSPVTLGQPNTLICLVDNIFPPVVNITWLSNGHSVTEGVSETSFLSKSDHSFFKISYLTFLPSADEIYDCKVEHWGLDEPLLKHWEP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class II histocompatibility antigen, DQ alpha 1 chain
publication title Diverse T Cell Receptor Gene Usage in HLA-DQ8-Associated Celiac Disease Converges into a Consensus Binding Solution.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 39
structure length 182
sequence length 182
chains with identical sequence C
ec nomenclature
pdb deposition date 2016-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00993 MHC_II_alpha Class II histocompatibility antigen, alpha domain
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5ks9A02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 5ks9A01
3FONA 2D2OA 2YD2A 3BD3A 3NFPA 4ELKA 4PRBA 1FGVL 3G08B 4Y1AA 5I8KL 4KHXH 1BMGA 1OAYL 1UB6A 2BNQA 5D70L 3KXFA 5EDXA 1GHFH 2CKBL 1G6RL 5JZ7D 3NIDE 3MA9L 3BEVA 1P2CB 4LCCB 4X7TB 4XNZB 5HDOA 4PP1C 2BNRB 1BREA 1Q9WA 1KPVA 4HMDA 3IJYB 1HCVA 3NIDF 4R96B 4PGBB 5EZIL 2FJGB 4CMMB 5C8JA 1REIA 5K9QI 3QDJA 4P2RE 3DIFA 4XCEA 3LN9A 1JPST 1IC7H 4NQEE 5FB8A 3LKRA 4MVBD 4NQCA 5F7HA 3ZKXB 4KJYA 1S9XA 3BZEA 2BSSB 4UI2A 1N3NB 5IMOA 4X9FA 2GIYA 2X09A 3BPOC 5TDPA 1BZ7B 5DD1L 4QKXB 1QEWA 1MCNA 2NY4C 4HKBB 1AH1A 1EUUA 3BPCB 2AXJA 5J6HB 1SY6A 1XCQA 2VLKD 5DFVD 1N5AA 3U36B 3ARED 1LE5A 5KSBB 3DHMA 1KELL 1YY8A 2I9LB 3GIVB 4RA0C 3M17B 4N0UA 1DN2A 4OD2B 4Y5VC 4DOHB 1SJHB 3VXMA 5IJKC 4YXKL 2WIIB 3UTOA 4FQ1H 2BSRA 2EEAA 1VGKA 5DS8B 3VFVA 2XZCL 3L7FB 2H1PL 3KYOB 4G8GD 4U6HB 3IFOB 3CUPB 3O2DH 1J8HA 3DGGA 3V6OA 4G6ML 2XQYK 3MJ9A 4X4MA 5AZ2L 5EIIA 5HDQL 3V8CA 4BFEA 4I0KA 1W8NA 1ZSDB 1TZIB 1HKFA 4KHTH 2ZUUA 4H8WH 1AJ7H 4BFIB 4UT7L 4QTHB 3WJJC 3B43A 3ULUE 3V0VA 2AABL 3I2CL 2J6EA 2ZUXA 4QXTB 4ODXB 1GOHA 1WT5C 3ULUF 2YMXL 4XC1H 2W9LA 1NCBH 2YSSB 4JPIB 4RCAA 5K9KB 1T1WA 3CFEA 1AI1L 4U6XA 4LK4A 4IRSB 1CE1L 2ZG2A 1BBJB 2E7BA 3E6HA 5K9OB 1BAFL 2XACC 2DS4A 4C54A 4I8DA 5DI8A 4Z7VA 1NEZB 2PW1A 1KXQE 3KPNA 2NXZB 3QULB 4JVPA 2VXVH 1HWHB 3DX7B 3H9SE 4CNIB 3AXLB 1QP1A 4Z95L 4OQ1A 3HS0A 4QRPB 3TGXA 1F90L 5C09E 3HR6A 3FO0L 3GHBH 5IF0A 5BZDB 4NO0B 5ERWB 1EBPA 2YS4A 2NR6C 1WWCA 3QPQD 3RY6A 3UTTA 1FNHA 1A2YB 4HCRA 4I3GA 4W6XB 3BIKB 3LOWA 4Y0GA 4MXQD 4QRRB 1MHEA 2HN7A 4NRXB 2GFBB 4NKDB 3OX8A 2OTWA 1TPXB 4HJGA 1MHCB 4UQ3B 1RULH 3QUML 3CDGA 3IJHB 2CK0H 5D4QA 5A16A 3EYQC 3GSQB 4CVUA 4KVNH 4L3CA 1LK2A 3MLYH 4XNQB 4EEEA 2W91A 5D5MB 1BD2E 5DEGB 2HYMA 1PY4A 3D0VB 3TA3C 2LV4A 3MLVL 4OV6F 3QDGE 2CJUL 4PRPE 3RHWF 4I0CC 5AAMA 4TUKH 3ZHLA 5I8EB 4O2EA 4Y5YA 2Q8AH 2WM0A 2A77H 4ENED 3C8KA 1FVEA 1CICA 5HGBB 1DUZA 1INEL 2DDQL 4WEBH 4ZFZA 2FX9H 2FX7L 3S98A 1OWRM 3IDGB 2VOTA 3CZFB 4WFFD 1OGTA 4YUEH 1MHPH 3N9GL 4IIQC 4MB3A 2W9DH 3GMMA 3UYRH 1P9MA 3V4VL 5MI0C 3MRIB 3GNML 4OCWL 4FFVC 2R2HB 2IANB 1FAIL 3NCEB 3I3BA 1EJOH 3QZWG 4I18A 3HRPA 4Y2DD 5D2LA 4DUVA 3IXAB 1BJ8A 2Z31D 5GS0H 1FPTH 3D2UD 4TSAH 4Q9QL 1FN4A 3ZDZE 5KW9L 3MRBB 4ERSL 5AD0A 4PPTA 2NY0D 1NCAH 2Z35B 1N8ZB 3FZUC 5BS0B 3QWRD 5HHPA 5KN5A 4JY6A 1AKJA 4JRYB 3BQUB 4HK0A 3ZDZF 5GHWH 2XFXB 4JY5L 3MGOB 2CUIA 3DWTA 4ZAKA 4C56A 4HT1H 1CE6B 5MENA 4QTIL 4NWTH 3TZVB 1P53A 3QRGL 5L0QB 4FABH 5L2KD 2OI9C 4OLZH 4XBGA 4N0RA 4XC3H 3MACH 5DWUL 4GXUM 4YXLL 1IJ9A 5FHAH 1YDPB 4PRIA 1Y6MR 4X0KA 2GTWB 4Y19A 4I9WD 2WZPD 5DHVA 1YEHL 4U1IB 1U91B 1D5BB 2BVQA 2ADIA 4D0DA 5BW7C 3DVFA 1TDQA 1A3LL 3QISA 3B4NA 3D39B 3L5WB 3TBTB 1I1AD 4LCYB 1YEJL 3WS6A 1TZGL 3FFCA 3FQWA 4HIHB 2XN9E 4S2SB 1I9RH 4Z8FL 3GJFH 4ODUA 3VMNA 5HYSA 5CWSA 5HBBA 4GLRH 5E2WL 2E8YA 5GPRA 1OP3H 5TQ0H 3A6BH 5CJQL 5KANG 1OT2A 2GHWB 4FXGA 3UJTL 1RZGA 3ARRA 3PJSA 1AO7B 1J88A 2VABA 5HD8D 5JMRA 5DJXA 4PJGE 4X5WB 5I66B 1FBIL 4QLRA 4MAYD 1NKRA 3GSNA 1MFEH 3GSXB 3BXNB 4DEPC 4LVOC 1XGUB 1A4JA 4FTVB 2EE2A 4JFQA 4M6NH 4PJGF 1S7WB 4MJID 3TLRA 1LD9B 3WFZA 3JTSA 1VACA 1WZKA 1YUHB 1FYTE 3K2MC 3GSVB 1A7PL 2F19H 4P2RA 5F1SA 3AS3A 2VR5A 1ND0A 4NQEA 4OV5A 4LEOB 4XHJD 5E99H 3VXTB 3LKNB 4EUPG 2FX8L 3F58H 4PRDA 2HKHL 2IBBA 1ONQB 1WJ3A 4GH7B 5D7IB 5C0IA 4YBHA 1AQDB 3OKEB 3THML 3SPVB 2BFVL 3R8QA 1JE6A 1FORL 5C71A 4R6UA 3FRPG 4RGNC 2BJML 3AMLA 2YC1A 2OQJB 1DQLL 2LFGA 4CADA 1GOFA 5C0BD 4NUJB 5JPNB 4GRLD 5I76B 5L88L 1D5IH 4ZSOB 4AEHL 1KJ2B 2AJZB 4NKOB 3FHQA 2ZG1A 1YMME 2DKSA 3BN3B 5D72H 3W2DL 4EDXB 4XNXL 3OL2A 1TJGL 3L3HB 2XWBB 2AJXH 3NIFE 1JPTL 4MS8C 4YHPB 5B38G 1QBBA 3AU1A 4JZOB 1RHFA 4MA8L 4PBXA 3LIZH 1ZT4A 1ZLSL 4KVCH 3NIFF 2I07A 4IRJA 1FL6B 2BVOB 5KVFL 5ISZD 5IEHA 4W81A 4OM1H 1HSBB 3REVB 1FFNB 3T0VA 4WUUB 3QNXA 1H5BC 3OTTA 4OAWA 4GLRI 4YDJB 4QXUH 4ONGH 5JNYA 2HJLB 1T3FA 1I9JL 1PEZA 1U3HC 3SY0B 4MJ2A 2PO6C 3T0WA 4AY0A 4QY8A 2X4UA 3O9WB 2D3VA 4I0PC 3W9DA 3LMJH 4K23L 4RX4D 4N8CH 3SGEH 1FL3B 1MCBA 2YR3A 3H6JA 5JORA 4LPWA 4FS0A 3HPJB 4U1KA 4UIMB 1JIBA 3LS5H 3AS2A 2O26U 1DQDH 3C60D 2F5BH 4JGMA 1KTDA 3O2WH 1OTSC 1WEJL 3OKNB 4JG1H 5D7SL 5IR1B 1H15B 5ICXB 4M3KB 4UU9B 5F9JB 5I1CH 2IMMA 5C09A 4DN4L 1C16A 4G7YH 5JQ6H 1F6FB 3KJ4B 4LKCB 1JGVH 1S9KC 3RRQA 4QHLA 1D5MA 4JFOA 4M6AA 4R4FL 3VRLE 3VXUE 5BV7B 1UZ8A 4PJ7B 1QFWH 2GJ6B 2WSKA 8CGTA 3DMMC 3MO1B 2AXGA 2YPVH 3VRLF 1VHPA 2ICEA 4NN5C 1MFAL 3CCHA 3GI9L 4G9FD 5KVEH 4WHDA 4LIQL 4P49A 4LPXA 1EGJA 5F97E 3RX8A 3SOBL 1MVUB 1ADQL 1L7IL 1IAIL 3KYNA 4PG9A 1BD2A 3QIWB 5CILH 2JB6A 2R0KH 2BC4A 3QDGA 1QBAA 1R3LB 4OZFB 4PRPA 1GGCL 2YD9A 4V1DE 3LDBB 1RK1B 2PW2B 5B39B 2RGSA 3PGCA 3BE1H 1U95B 1UA6H 5EC2B 3TWCH 2E27H 5C0RH 5C9JA 1JI2A 5KSAB 3BZDA 1XH3A 4U05A 1VPOL 3OKDB 1YN6B 2BK8A 3PWNA 3B3IA 4APQC 4UTBL 2G9HA 5GGVH 2CKBB 5BO1H 3SJVD 1G0YR 3RKDC 3BUYA 2DIAA 4Y88A 4LQ1A 2EC9U 3QXDB 3VXSD 1EFXA 3MLZH 3SQBA 3H8NA 4RAVA 1MF2L 3FO2B 1OARH 5BV7H 4ZDHB 1UB5B 1BQSA 1T7YA 3ZYZA 4ZYKA 2R2EA 3LEXA 1MAMH 2JIXB 1PSKH 4PG2A 4XZUA 1BLNA 1MCJA 4XP9L 2P42B 3HLAB 4E42A 35C8L 3SGEI 4HWBL 3C09B 1N64H 3BDBA 3GJFK 1QQDB 1HI6B 2APXA 3C8DA 4B41A 1NGPL 1DL7L 4QRUB 1U2HA 1E4XH 3GKWL 1OP3K 1FQ9C 4ZOEA 4RNRB 5AEAA 4OZFH 3U9PL 2ICWJ 3TF7C 2ZCKL 4PTTA 5DJ0B 5HHME 3MRQA 1GAFL 4LSVL 1IAOA 3DXAD 4KDTA 3HZKA 4P46D 1RMFL 4LSTL 4X80H 1HKLL 4N5ED 1Z9LA 4ZS7H 4F7EA 1PG7X 4NM8H 2BXZA 2VRAA 5DJZB 2APBA 3FRPA 3DUSB 4JFPB 4FQ2H 1FZKB 2OJEA 4GG6B 1QFWI 1R3JB 3CFKA 1U92B 4O2FB 4Z0XA 2XN9A 1Q0YL 4P23B 3L9RA 4LSDA 2OJZH 1UM4L 1ZLWH 1D5XA 1S7TA 3K1KC 4JFZL 4TOYL 5A2IH 3O3AB 1HH6B 3FT3A 5D7JB 5J6GA 1HK6A 3O45B 2VXSL 5D1QB 3KLHD 1PLGH 5F1KC 3WEXA 3RNQB 1RZFH 1CL7L 3KPQA 4YHOH 1QTYT 1IGMH 1P1ZA 4YDIL 2XXMB 4KRNA 3WNKA 4PJGA 4NPYB 4H1LG 3IRPX 2X7LA 5C3TA 5DK0B 1HINH 4YAQB 3QUYB 2P4AB 1HXYA 1NBZB 1AP2A 1GSMA 4KRPD 5HTSA 1FVDB 3ZT6A 5CUSH 5EA0H 1QUNA 1CGUA 1EFQA 1HN1A 2B2XL 3NCYS 3S8WA 1A0QH 5DHVH 1I4FB 5TDNA 4HBCH 1IC7L 5JMOC 3MLUH 3OGCA 3HE7A 3TT1H 2C7UA 5HDBE 3MBXH 4JFYA 1ES0A 1AGBA 3ARFB 4M93C 3NIGE 1A1OA 4NQUA 2NY1C 2C1PA 5HDBF 1X5IA 2FWOB 4YNYA 1MJ8H 4PR5B 3NIGF 4ZTOL 3QUMB 1MUJB 4M1CD 1PG7L 1ZLUH 4M7KL 2EYSB 2VLJB 5FHBH 2X4NA 4LPYA 1MCHA 2NY5H 1C1EH 5DRXB 3CSGA 3NZ8B 1E4XI 3RGHA 3RUGB 2EH7H 4ODWB 5ILTL 1HHKA 1S9YA 2Q20A 4RSVA 3OKOB 1YMMA 4I2XB 1IFHH 4YR6B 4PJEE 4Z76B 4NZTH 4L4VB 1T2QH 1FP5A 3ZMRA 1S9VA 4C58B 1UACH 2BOBB 1QSFB 1DLHB 2VJXA 3RWDB 4P9HH 5EU6E 5FAAA 2Z8SA 3EFDH 3BO8B 3O2DL 4NFDA 3DUUB 4XVTL 2C3VA 2H8PB 1AGEB 5FYJD 3V5DB 4U1SA 3SE4A 3PP4L 5T1KB 3UAJD 4L8CA 3EO0B 1RD6A 3NVQA 2ENYA 1JF1B 4KHTL 3VGGA 4CGTA 3FQUA 4H8WL 2KBGA 5FDWB 3DGCR 1F6AB 2ZUTA 3WDIA 1KYOJ 2PTUA 3QO0B 2HLFC 1A47A 2F9BT 2GITB 3B8YA 1DZBA 5DRZB 5IJVB 5F7KC 4KZEH 3AAZA 1JRHL 2FIKB 4YXHL 3QSKB 1BBDH 8FABA 4GAGH 4N1HB 4XC1L 1NCBL 1EH9A 5I74C 3ULVH 1PAMA 4X7DC 3LQZA 1UKSA 4OF8A 3MXWH 2PR4L 1BGXL 4RWYH 1D9KB 1ZVSA 3TVMC 5I1HL 1B6DA 4RFEB 4LU5H 5F3HA 3P9MA 4JJ5A 4OI9A 3GBNH 1R3KA 2CLRB 1YEFH 2N7AA 2W65B 1X4XA 1S7QB 4AIOA 5B21A 1TLKA 5LVEA 2HKFH 2VXVL 4Y5YC 5C07D 1MI5B 2DJUA 3F8UB 5D7LB 1I7RB 2OR8A 3SDAD 3GHBL 5GIRA 1EX0A 3T3ME 1YECH 3VXUA 1IKNC 1G9EA 2LU4A 4PGCB 2ED8A 4RRPG 1XGYL 5HYEA 2I25N 4FMFA 4K55A 2X6MA 4OCXH 5DD6B 3T3MF 3OKMB 5D1ZB 3HMWL 1ZGLM 3P73B 1Q72H 5TE6H 4I18C 4MAUH 4GOSA 4GKZB 1D6EB 5B22A 1A6AB 2V5SA 1PYWB 4L29B 5FGRA 4R0LC 4M02A 4KVNL 2Q86A 3MLYL 4J8RA 1IBGL 3EFFA 1RY7B 1U8QB 2JJSA 3MMEA 3BYTA 1HILA 2PXYB 3ARBA 5FA3A 1RZIB 1GGYA 4M03A 3V0AC 2A77L 1IEAA 1UZ6E 4JB9L 5I9QB 3AS0A 3CC5B 1IM9A 3DBXB 4U6TA 4WEBL 2PTTA 4BQ8A 2R1XA 4LCUB 4I5BA 2E9IA 1UZ6F 4U1GC 3O3UN 2JTDA 1MQ8A 3UYRL 5E00B 4JREB 3ABZA 2AEPL 1NBVH 4DKEH 2EDRA 1EJOL 4NGHH 4Q97A 2J5LC 4YHZH 3RWHB 1FPTL 2EEBA 4TSAL 4KK6C 3WS6C 4HUKB 5FGSA 3MNVB 5IW6A 4TUOB 2V7HA 1NCAL 2AQ3A 4NQXB 2NZ9D 1AE6L 1ZTXL 4LCIH 2FO4A 3IXTB 3MRGA 2HVKA 4F3FB 1LVEA 2VR9A 4HT1L 4JM2F 3FRUB 5I16B 5C08D 2APFA 4HV8B 1GGIH 1EXUA 2VQ1A 4PJXF 3DX8B 4LLVA 2KQMA 1KOAA 3GMPA 3F65A 4LCWD 1MWAL 4XC3L 2JJUA 5SWSD 3GRWA 2YD1A 4M5YL 5IT2H 4Q7DA 3RWEB 1QACA 3PIQA 5C6WH 3MRKA 1LEKB 1S8DA 5C9KA 5CAYB 1A7BA 3C5ZD 2R69H 2W59A 5CZKA 4Y4FD 1GGUA 4MXVE 2R29H 3OHXA 4FP8L 4RA3A 3RDTB 4YDLC 4GAFB 3BZ4B 4HKJB 3K8LA 5F89B 4MXVF 4M4PA 4OCRH 3WS3B 1I9RL 2IGFH 1SBBA 4YX2L 1T22B 1KG0A 1I7TA 1UKQA 4P4RA 4FXLA 4KJQD 1X44A 5DDHB 2DLIA 2YN5A 1BOGB 1U8MB 5HYQA 5C86A 1U8JA 3KR3H 3RWJA 4G7VL 1A4KA 4WI7A 5IROA 4XI5C 1OLZA 2HVJB 2ITCB 1A02N 5DVMA 1QVOA 1MFEL 5B3JE 4B7IA 5JXEA 3UTPD 5TDOA 3JWDH 1ZLUK 4WFHD 4OLYL 5H94A 2FJFB 1JWUA 5B3JF 2ZCHH 3TJHD 1X5ZA 5IHUH 3VCLB 5IWLC 4Z7UA 2F19L 3H0TB 4XPTL 3G5YB 4JRWA 4PJFB 5E99L 1R3HA 4IRJC 3F58L 1L7TH 4YIQA 4LSPL 4X7EC 1QRKA 2Z92A 1SBSH 1I8IB 4HDIB 2R0LL 4RFNC 4LHUD 4U1HB 1DE4A 3ULUC 1KACB 1MCLA 2BZDA 4HX1B 4AEIH 4BZYA 3QUXC 3KWWA 3LRSA 4U1LA 4GG8A 3BPOB 4IJ3C 1KCSL 1RUQL 1BF2A 5EN2B 2NY4B 5GSRB 3WD5H 3MUJA 1D5IL 2P7TB 3DETD 4EXKA 1EHNA 1NJ9A 4O2CA 1IGJA 4JFED 4DCQA 5CD3B 5D72L 1OM3H 5DMKB 3EGSB 1FV1A 4PJEA 3X14A 2X2YA 5IG7A 3QEQB 2DIJA 1BQUA 4MSWA 5GRYA 5C2BH 5LGHH 4Y5VB 5EU6A 5DSCB 4G9DB 2H2PD 4X5XB 3C6LD 4TTGA 5IEKA 5C3LD 4KVCL 2P8MB 4XBPA 5IW1B 4X6BA 1BFVH 4OM1L 4HIIB 5KZCB 3G04A 1P4IL 3RVVC 2ORBL 3BSZH 1DDHA 1FNSL 3LKQB 2CDGA 4XB7A 1K2DB 3TJEH 1KJ3H 5C0NC 4YWGH 4QXUL 4ONGL 4YDVA 2GI7A 3ZHKA 4UT9H 1A7RH 2Q76A 3G5XA 1LMKA 4I77H 3L7EB 3WNOA 3LMJL 3TNNA 3T77A 3G9AB 1T5WB 4N8CL 1X7QB 2CIIA 4Z7WA 5D6DC 1T7WA 3KDMA 1HXMB 4YE4H 1DQJB 4IDLA 1ORSB 3VFMB 1SY6L 2KKQA 4Y5XA 1C5DB 1G7IA 3BGFB 5TE4H 1HHGB 1DQDL 3MYJB 4AH2B 4L9DA 3PWPE 1M7DA 5JA8B 1NDGA 1QSED 1FGNL 3EDJA 5FYLD 1KEGH 4HGWA 1IQDA 4S1DD 1CFBA 4MDIB 5F93C 4G7YL 5JQ6L 2Z4QB 3I02A 4YDKL 1JGVL 2W0PA 3S35H 1P4BH 2VC2H 1EAPA 4OD1H 1EO8H 3TO4A 4BH7A 3DX6B 3MJ9L 4JQVA 2YPVL 4WEMB 4WTZG 4GQ9L 1X5AA 4JHWH 5KVEL 4PLJD 1UM5L 2A83B 5CBEA 2R0WL 2ESVD 2LTQC 1S78D 3BRDA 2W07A 2FJHB 1U8KB 4FG6C 3OPZL 4ZUVA 2J6EL 2L4OA 1V3LA 3MOBL 5E5MA 1OP5K 3WUWA 1F11A 3IDJB 5F7EH 4TVPD 1BQLH 3BE1L 4BZ2H 1UA6L 2E27L 5C0RL 4F58H 5E2JA 3TA3B 3RHWK 3LAFA 4PJCB 3QFJE 3ARXA 4C4KO 5EZJB 1MFDL 4KDTC 4OQTA 5BO1L 1OSZB 3LPGA 3ZDXE 5BRZB 5E08L 3RWFB 1I1RA 3QFDB 3B2UC 4IIQB 1DQML 1NCUA 4GKNA 1G7LB 3ZDXF 4CVWA 4OGAD 2WINB 4R90H 2QQNH 4I4WB 5F3BB 3CH8A 5CEXA 3MX0A 3BW9A 3BKCH 3P11L 4PRHA 5EU4B 4PD4K 3L3IB 5HY9A 1N6UA 1PQZA 5KAQG 2D0FA 4Q6IA 4X9BA 4K71C 3K81A 3BZFA 5EOCH 4QHUB 2JB5H 2XWJB 3BKYL 1HNGA 3HI1B 5TJWK 3BFOA 3VD7A 2DKUA 3VXRD 1E4XL 1OAQH 2OYPA 1K6QL 2VDKL 5LXGL 5AWNL 3GFUA 5T3XE 4X99A 2A1WH 2P8LB 2VDLH 5ETUA 1VCAA 3O11A 2VAAA 5E6YA 5IMKA 1HQ4A 2F54E 5FYKD 4ZO7A 3RTQD 2OI9B 4QHKI 4RMUA 4EI6B 2DLEA 5DJCA 4JKMA 4HIXH 5CZXC 5TE7H 3KS0H 2NX5A 3BYYA 4K8RD 4NM8L 5F9OH 1V5JA 3TYGH 4HIEA 4JR9H 1MCKA 2IH3A 4YO0B 4RDQF 5DJYA 1T1ZA 3TM6A 3CPLA 1A9EB 2FBJH 4ZMAT 4W6WB 3V6ZA 2GQHA 1T20A 4NHCL 4ZD3L 3HE7C 4Y4HA 3MBEA 1C5BH 3BGMB 4EBQH 4ELME 2W38A 3SKOB 1RUKH 4KKBC 3FOLA 1RZFL 1G1YA 2QQKH 3KPRB 4MQ7B 4OIIL 5CEYA 4ELMF 4LARH 1E28B 1N0LA 3RGVB 4A2MA 4JGUA 1TQBC 1NGYB 2R4RH 1HINL 1IEHA 3PNWB 2RR3A 1A3RH 2AXFB 1VENA 4QXGL 1A6ZB 4RAHA 1HYSD 2HJFA 1AD0A 1MAKA 4PJHB 4YFLI 4DW2L 3PE9A 5EA0L 1JHTA 2FR4B 1CVSC 3H42H 1RZJH 4DEPB 5DJ6B 1BHGA 1R5WA 3GBML 3QQ4B 4LVOB 2MCG1 2AJVL 3RX5A 4HBCL 1W0VB 4JY4A 4H26A 3K4AA 3T8XB 3RWGA 1RURL 3B9AA 2VLKE 3SE4C 5FK9A 4LL9A 1CFTB 4X6DB 4XAKE 1MQKH 4ZPTB 5ALCH 3TN0A 2BERA 3RL1A 4RDQG 1ZEAH 1NGZB 1KIPA 3VXNA 4H25A 5GJTL 5BVPL 5F96H 1YY9D 2MKLC 4FQQA 5FHBL 3S88H 2FYYA 4G8GE 4A6YB 5FECA 1C1EL 3LCYA 3E3QE 3GUTA 2IH1A 3EYOB 1ZV5A 2YD3A 3HHRB 2GT9B 4RGNB 5MEPA 2DQCH 2C4FT 3T2PA 1IFHL 5ADOH 3EOBA 1Y0LB 4X9GA 1S5IH 4NZTL 1T2QL 1KIUA 4KJPD 5DGQA 3KPPA 3QBTB 5I1KH 4LLMB 4S11A 1ZMYA 1M7XA 2EICA 3SO3C 4YPJA 4U4BA 5ACZA 5EBLA 2GK0A 4P3DB 2BX5A 1MNUL 4IRSD 3CSYA 3WFDH 3Q5TA 4GRWB 3O81A 3MQIA 2ZZUT 2A9NL 2IAMA 1AC0A 1JMXA 2XV6B 5AZEH 4Y4KC 3GMQB 3P3YA 2DQGH 2NXZD 4ZS6C 1H3GA 4FZ8L 3ZHDA 1QLEH 4M61B 2ADGB 4QRPD 1KLFA 1CCZA 3Q3GB 1H5BB 3EOTH 4GAGL 2JK5A 3VGFA 5MEOB 2BSTB 2FIRT 4NO0D 1JYVA 2XQBH 1OGAE 5IOPB 3ULVL 3MLPA 1U3HB 2PO6B 2PYFA 4GJTB 4LU5L 4QRRD 4NNYA 4I0PB 3GBNL 1YEFL 3PWPA 4K94H 4E41B 3A6OA 1QD0A 1SMAA 3KHQA 2YUXA 1HHHB 3TNMA 3ESUF 4G6KH 1CT8A 5J9PA 3I6KA 5E4IA 1TVBB 4LMQE 4OKDA 4YHML 1QG3A 1T1YB 3VFNA 2K7QA 1DP0A 3FB5A 5CCKL 3HR5B 4Z5RA 4HZAA 3WNMA 5I0DA 5IB1B 1Q8MA 1U3YA 5C0AB 5FF6B 1RHHA 1DEEB 2NY7L 2VXQH 3OF6A 4MNQB 4GRWH 4L1DA 3Q5YA 4UTAH 4R4NC 5T33H 1NBYB 1ETZA 3ULUL 3P4NB 3DMMB 4JEGB 1F4YH 4NN5B 4WFFE 1FCCA 1OD9A 5E7FA 1P7HL 2IAND 1UWGL 1Z6JT 3IF1B 3JV0A 4HC1H 5BVJA 4JANB 4TVSa 4XXDA 4F7CA 2AK4E 2X4PB 5CSBA 4PJBB 1K5NB 1XF4A 4NO2B 5F6IC 3ZYIA 1RZ8B 1ZT7A 2GSGB 2ZUSA 1KJVA 5BS0D 3DO7A 3QFJA 4JRYD 4K7PY 2BCKA 2XTJC 4LSSL 1L9NA 5CHNA 3ROLA 1NBVL 3TZVD 2NY3C 3U7AA 4APQB 5CEZE 2UWEB 3L3OA 4P2QB 2O61A 1LEGB 2ZSWB 3GK8H 7FABL 1GZPA 1MREL 3CK0L 3QUZC 5CIPA 4KH2A 1F4AA 4TNWF 4LCIL 3OJDB 4O5LL 4QNPE 4FQIH 4NQSA 3OKKA 3PWLB 5DR5L 5F8QC 3REWB 1B4JL 4JFHD 3D39D 4QNPF 4GUPB 2MHAB 1KT2B 5GQBA 4IEFB 5IROC 3HRZA 3S3SA 3IFLL 3DVGA 2HFEA 2V17L 5IT2L 3GJEA 3MV8B 2DMBA 1U8PA 1Q9KA 3PQYB 5JTWA 2YA1A 1NAMA 5ICZB 3FONB 5HGDA 4KMQA 4IOIA 4M6OL 2R69L 4ZFOL 3NFPB 4ELKB 1EZVX 4PRBB 1AO7D 2ATPA 3HI6H 4Y1AB 3KYMA 4P99A 2BNQB 4PYHA 1UM6L 3O3EA 5BZWA 4KV5E 4HXBH 5HHOE 1QHOA 3BEVB 4OZIB 2IGFL 4WNQB 4FTVD 4KV5F 3FFDA 3GSWA 1OQXA 5DHYB 3B9KC 3LB6D 2Q87A 5C8JB 3MODL 2J8OA 2OXGA 4XCEB 1J0JA 3KR3L 3LV3A 4NQCB 3BJLA 1S9XB 2P1YA 3VGHA 3BZEB 1I3RA 1LO4H 5IHBA 1YEKH 1CZ8H 2ICWA 1QLRB 1QEWB 3CFDB 1J86A 4IMKA 5GSVA 4W6YB 1FDLH 2ZCLH 1I3UA 1TVHA 2ZCHL 1VEMA 4V2CB 4OTXH 5IHUL 1SEBB 2VL5A 4OM0L 1YQVH 5IFAH 4N0UB 5IB4A 3SKMA 3WDJA 3VH8A 2VLKA 1RZ7H 1L7TL 1WUNT 2BSRB 1VGKB 5GS1C 5C0BE 5B8CC 1EK3A 1SBSL 1VEOA 4OGXL 1R5IB 3MJ6A 1JPSH 2X1QA 4WTXA 3D18B 2ARJA 3ULSA 2A6KB 1K8DB 5EIIB 1FH5H 4AEIL 1RUAH 4O00A 2R39A 3BP7B 4M93B 5TFSH 4G8GA 4KXZH 3PP3K 4X6CB 2NY1B 4KMTH 2OL3B 4HFWA 4ODTH 5FOBA 5KVDH 4WUUD 4WGVB 1OM3L 1TTGA 4HQQH 4DZ8A 1O7VA 4Y5XC 3ECBB 3RJQB 1JGUL 3JWOH 1EHLH 2E9JA 3HZMA 3MZGB 1P7KA 2E9WA 5JHLH 5HI5D 1H3TA 3CFEB 1YEIH 1J1OH 3O9WD 3WFHA 1J87A 3DOSA 3UDWA 5DI8B 4Z7VB 5D6CA 1IAKB 4CU7A 1BFVL 3P77B 4HKXA 3KPNB 1IGFH 3WHE1 3BSZL 1IARB 2GEEA 1P69B 3TJEL 3HS0B 4KI1A 3TO4C 4YWGL 5EWIH 3WXVH 2W9EH 3FB7A 1A7RL 3IU3A 4I1NB 2AJUL 3NFSL 2A74B 4I77L 3UTTB 1CXHA 3QXVA 1XGRA 4EZMA 5E8OB 2UZXB 1BJMA 4ODSH 4NZJA 32C2A 2WP3O 3G6AA 1MHEB 2HN7B 2JCCE 3KLAA 4GMTH 4HJJL 2OTWB 4HJGB 1VFBA 1JN6A 2V2TA 2GJ6D 4U7MA 1A7QH 1X3DA 5TE4L 2JCCF 4ODHH 2OL3H 3U4AA 3S5LA 1KEGL 2GCYB 4L3CB 1OQOA 1NLBL 4ZUUA 5BXFB 1J0ZA 3TVMB 3SKNB 4ZUTA 1HHJB 3LRGA 3QIWD 1P5UA 4X98A 5I17A 4O2EB 4FFZH 5DTFA 1VFOA 5BOZG 4EN3A 2VC2L 3C8KB 4OD1L 4NRZB 1ZA3A 4I3SL 1WTLA 5I15H 4JPVH 3HUJE 2DAVA 4ZXBC 5ID0A 1H8OA 4JHWL 5EH1A 5KSAD 2R56H 1L0YA 2X4QA 2XY1A 3UTZA 3O3DA 1G9MC 3HUJF 3MCKA 4JDVA 4FFYL 1QPPA 4TNVK 1H8NA 4EKXA 43C9B 4PREB 4JM2C 4I18B 4HH8A 5D2LB 4KXZI 2JJWA 3MXVH 4R0LB 1HOCA 5BJTB 4BZ2L 2HAZA 5M94B 3F5WA 3OJ2C 1JUFA 4F58L 4Y2DA 5GRUH 5I1LA 5DURB 3VXSE 1H3XA 2FLBT 2JIXD 2Z31A 2DQHH 1OW0A 3D2UA 5DO2D 4M1DH 1TZHB 3ZKSD 1OAKL 1RJYB 5ESVB 3S4SA 1YMHA 2V9TA 4OLWL 4YH6A 2QADC 2QQQA 3V0WL 4ZUWB 2QSQA 2VSDA 1MRCH 3CU1A 4U1GB 3V7MA 5EZOL 1S7SB 1NANH 3B5GA 2O5ZH 5AYQA 3BKCL 1ACYL 2R9HC 3CMOH 5L2KA 2VDPL 3BUTA 2D7PA 4J3XA 2J5LB 4HUMB 2ZNXA 1QBLH 4LOUD 1Y18A 4G43B 4OD3L 2BP3A 4P2OC 4DAGH 1ZXQA 2JB5L 3MBEC 1C08A 5D9SB 4ZNEE 3DXAE 2OTUA 3C5SA 3FFCB 2VH5L 3QCUH 3T4YA 3V5KB 4M7JL 1IC1A 1KTLA 4ODUB 3FO9B 3C9NA 4JKKA 4H20H 1H3PH 2V5MA 4P23D 1I1AA 4XWOD 2VDLL 1ZT1A 4ZTPL 5IMMB 2A6DB 4AT6A 3UC0H 4Y7MA 3MROA 1M05B 1T6WA 4KKCD 5HI3D 4WCYH 5D7JD 5L8KB 1YN7A 3EYVA 5D1QD 2VABB 1BJ1H 4NNPL 3NCFB 4HIXL 5DJXB 1MAJA 5TE7L 2Q7YB 1ODAA 2RFXA 3R0MA 5SWQB 1UJTA 3GSNB 1OWWA 5HHOA 4JFQB 1YEDA 3TFKC 4UINL 3F7VA 5L8JB 3N50A 3TIEA 4Z78A 3QUYD 4UIKH 5F9AC 3HMXA 4YDLB 3JTSB 1VACB 4MAYA 5IGXL 4PV8B 1G1CA 5L8LB 4JO2H 4P2RB 3IDIA 3TN0C 3MLWH 4MJIA 4OV5B 1QBMH 5HJ3A 2B1AL 5CIPH 5TQ2H 1B0GA 4XCCH 1RVFL 1CIDA 4FFWC 5C0IB 2AP2A 2UUDH 3O41A 1KTKE 3TPUA 2HP4A 3CX2A 4N0CD 5I2IB 5CJBA 1EDQA 3P4OB 3ARFD 4RIRA 2EEDA 2XRAH 1UQSB 2WWKO 2QEJA 1E0OB 1RUMH 3DV4B 1JNNH 2OS7A 4CADB 1ZHBB 3H42L 3RPIA 1RZJL 1NFDF 1NCWL 2XKNA 4JGJA 5CJ5A 3RWCA 3QB7C 2VLJD 5MP6L 2YXMA 1CGVA 2D0HA 3QRFM 3U1SL 4F9PA 2X89A 3VA6A 4MDJB 3SDYH 1CD1B 1NANI 5C0BA 1WISA 4GRLA 4RISH 1J0KA 1YNKL 4NSKA 1MQKL 4JCLA 5ALCL 4L4VD 2IAMC 3IDUA 1ZT4B 1ZEAL 2AV7A 3MV9E 2I07B 5D2NE 1QSFD 4PGEB 3DI3B 3V5HB 1E6JH 2NTSP 3FAWA 5DEFB 3S88L 2DM7A 4DN3H 1TIUA 4WW2F 5CLWA 1HIML 4RFNB 3QNXB 4TQEH 5T1KD 3WLWC 5E4EC 4E5XA 1K3ZA 4NKMA 3TIDA 1XF2B 3QUXB 5HI4C 5IB5B 3MPCA 1T3FB 4HWNA 3L95A 4L9LA 5ADOL 4MXWH 1T03L 5DA4A 4BFBD 4IJ3B 2AI0L 4YGVA 3NCCB 2P5EE 3W9DB 5I1KL 2I60H 1OAZL 4WU5A 2P46B 4PUBH 2B5IB 2UYLB 5JORB 3ZDYE 1KIQA 1CTOA 3MJ8A 4U1KB 1JFQH 1FAKT 3QZWB 4JPWH 1FZJA 4MJ5B 1D9KD 4HLJA 4RX4A 3ZDYF 4JZJA 1WZ1H 4O9HH 4OLVH 3H9SB 5ITFA 2ATKA 5EU3A 2BVYA 1RIHL 4K3DH 3MR9A 3EDDA 3MNZB 4G80B 1C16B 3QIBA 4KQ4L 4YFDB 1NKOA 1QLEL 3D5OF 4JDZA 3C60A 1MI5D 2DQFA 4KU1A 3VG9C 4PP2A 5D7LD 3T2OA 2P47B 3IGAA 1OVZA 3K2UH 4U6YB 1J11A 2HA1A 1T4KB 2XQBL 2JCCA 5C07E 2GAZA 2AV1A 3PWJB 2FL5B 5DQ9B 1E27A 2BNUA 4WJ5A 3WXWL 5IQ9A 4D9QD 5D1ZD 4K94L 2A73A 2DL2A 1Z3GH 5IFHL 1AY1H 4HLZG 4XPGL 4JFFB 3KYNB 1NFKA 3MA7A 1BD2B 1KB5B 4U3HA 2CO6B 2JB6B 4TRPH 4GQPH 2BC4B 3EOAA 1DBKH 4MA3A 4G9FA 1KFAH 4PRPB 3ZSSA 1CD0A 3HCVA 3IAPA 1L9MA 5I1DB 4LLWB 2PXYD 3HNVH 3VE0A 2KZWA 4J6RH 4XCNB 1PJ9A 2VLRE 3HUJA 1XH3B 4QYOB 3DSFH 3PWNB 1J0IA 1YYLH 2ED7A 3B3IB 3I50H 43CAA 4UOW1 4AYFA 4UTAL 4GBXC 3WO4C 3SBWA 5T33L 3RFZC 1KXTB 4JQXC 3X13B 1QA9A 3BUYB 4ZO8A 1F4YL 1ITBB 4ZO9A 5CINL 2WWMC 2W60B 1IQWL 4RAVB 3P4MB 2J3SA 3O2VH 2LTQB 5EULV 4UB0L 4NIKB 2XPGB 2IPUK 3CVIL 4JPKL 3FT4A 3G5VA 3VXSA 1FYHB 1RIUH 3RWIA 4E42B 2AJ3A 1LDPH 2BXYA 1MFCH 5IP4A 5HHNB 3L6FB 1HQRA 1M71A 4OT1H 1KB5H 5CJOL 1CFVH 1FVCB 4KROC 3LN5A 3LKPA 2DLHA 4MD4A 1EIBA 5I30H 3HI5H 3MRQB 2QL1A 3LKOB 1IAOB 5HGGS 5C08E 3DYOA 4DKAA 2AQ2A 3GK8L 1CLOH 2YPLE 3PWUB 1BEYH 1IC5L 1V3MA 1CK0L 1WZLA 2LVEA 4O02H 2FZ3A 1KPRB 1A6WH 3VXPB 4ZNEA 3B8SA 3DXAA 3CFKB 4EQ3A 4P46A 5F1NA 4Z0XB 2H2SD 5FCUH 2HT2C 5GZOD 5JZ7C 1N7ML 4OFYD 1C5CL 3QXAA 2NMSA 3QPXH 1XF3A 4IDJH 1MH5B 1WC7B 1S7TB 2FEEL 3F7RA 5T3ZD 3FT3B 1NUGA 5J6GB 1FE8H 3PDOB 3VFPB 3W0WB 3WEXB 5B38B 4BM7A 3KPQB 5HPMA 1FO0A 1HSAB 1AGDA 1UVQA 4PTUB 2GTZB 4XP1L 1GRWA 4IMKC 3ZYJA 3WL9A 4MVBC 2HJKA 1F4XH 5A3ID 1F00I 1A9BB 3I6GA 1R3IH 2VLMD 4OQTL 2IFGA 4Q2ZA 4HXBL 2C3WA 4EUPH 2C1OA 4HF5H 1FYTB 1KNOA 5C0DB 4MQXD 1CFQB 3PHOB 3EOYG 1GZQA 2DQEH 4MCZA 3IU4H 1IL1B 1N2RB 3SCMC 2JJVA 3HE7B 3JV4A 2C7UB 4PP1D 1C12A 4UV7L 1MJJA 4WIQA 1A1OB 1S7RB 3S96B 1A6TA 4XPFH 1EPFA 4GW5A 3VFWB 3WKML 4B50A 4YNYB 2KDGA 2N56A 3W11C 4ZG1A 3EO9H 1FDLL 1TQBB 2R1YA 2ZCLL 2X4NB 1EEQA 4OTXL 1PY9A 5K59E 2Y36H 4LVEA 5JOEA 2OR9H 1YQVL 1CS6A 5IFAL 1HHKB 2GJZB 1S9YB 5FO9A 2QR0A 1YMMB 4XNUL 5K59F 4PB9L 4NC0B 2NTFB 2NY4D 1RZ7L 1E4WH 4P3WA 4X7CC 2XA3A 1B0RB 5HYJD 1JPSL 2AKRB 3QEQD 3LQAH 4WW2A 1EVTC 1C7TA 5IVZA 3HMXH 5FYJU 5DUMH 1FH5L 4CDHA 5KANI 5TF0A 3A6CH 3E1F1 2VMFA 1MY7A 2BSED 3OAUH 5EO9B 4JFXA 2HH0H 5KZCD 2D7MA 5DMGC 5KVDL 4LRIA 3V8OA 1VFMA 1AXTL 5IVNA 5ITBH 1IAIM 1HEZA 4HQQL 2P5EA 4F7MB 8FABB 2VXUH 4X5LA 1MVFA 5IMLA 1AC6A 1EHLL 5ID1B 1RAMA 4K7PH 1S7UB 3MLTB 1U3ZA 4ETYA 5D71L 1IVLA 5DC9B 4NCC1 2VISA 2D7NA 4MXQC 5FO7A 1U8IB 5EFIB 3EBAA 5F3HB 4JJ5B 1NMAH 2EDNA 1RJCA 3SO3B 2XQYG 4CL7A 4WGWB 1IGFL 1I1YB 3NFNB 3VRIA 4EN3C 5EB9A 2YUWA 3MJ7A 3PHQB 2IF7A 4C83A 2VE6B 3VGBA 5JIHA 5IBTH 5ADPH 5AUMB 5JUEH 2K3TA 3QHTC 1F4HA 3LHPH 1T6VN 1TETH 2VIRA 5FYLE 4Q74A 4IHOA 4Y4KB 5FDYA 4ODSL 2MNUA 2HTLC 5C07A 3IT8D 1E6OH 3SDAA 4GMTL 1F45A 5EOQH 4MZ3A 5LAXA 4KKAC 4PY7A 4HHAA 5E5UB 4DVBB 2Y72A 2NR6D 2Q86B 1MIEH 4Z77A 3EFFB 3J8F7 3PL6A 1IEBA 3OB8A 1HILB 4S1QH 5ENWA 4V1DB 3ET9F 4UT6L 4U1NA 1OW0C 4NJAH 5FA3B 4LSQL 4FFZL 4I13B 3I6LD 1AFVL 3EYQD 1FIGH 1NCDH 1RJZA 5LKNA 2B8OT 4H5SA 5E8PA 1HHIA 2VLRA 4G8IA 4PRAA 4KGJA 3TA3D 4YHLH 2DM4A 4LNVA 5JPMA 3WLBA 1DVFB 1AGCB 3CAFA 2EIZA 4CW1A 3TH3T 3UPAA 5BRZD 2A6JA 4F7TA 4PBVC 3SQOH 3BDXA 3MXVL 1NGWA 2BVPA 4HEME 3PWVA 1INDH 3NCJL 2BY2A 2BRRH 2EH8L 1KYOK 1ZS8A 5IW6B 2G2RB 2EDYA 5GRUL 4N9GA 4FFVD 1EMTL 2FO4B 3NABL 1TMCB 5FO8B 3MRGB 4C55A 2DQHL 1YC7A 4NO3A 2VQ1B 2X4SB 3B9VA 5F6IB 2IPTH 4LLVB 3HAEG 1RJLB 1KGCD 2BMKA 3WFBH 1CDIA 3FZUD 5C0CB 4NQTA 3O6KL 2XTJB 5C08A 3B2VH 3K4DA 3H7LA 2O5ZL 2YPLA 1FJ1A 5F70A 4MJ6A 4RMSA 1WV7T 2NY3B 2G5BA 1QBLL 3FJTA 2J88H 1F3JA 4DAGL 4PJDE 4HK3J 5TF1H 3MGTB 4PB0H 5H8DA 3QUZB 3LD8C 1OTUC 1EERB 2P49B 4EOWH 5FKPB 3I3EA 2GSIB 4U1MA 3HE6C 4Y4FA 5DZOA 1NAKL 2M1KA 2D4DA 2FH6A 5B3NA 4H1LH 4F80A 5IUSA 1J1PH 3PABA 1OP9A 5KVMC 4K3EH 5HYQB 2Q8BH 4N8VA 3VXOB 1U8JB 3RZCC 1OOAA 4N9OB 1AD9A 4DVRH 1A4KB 1UKTA 5CKGA 3DTXB 3KPRD 3WO3B 3QH3B 4J3VA 4K9EC 4X4XB 3AB0C 4MGXA 4TUJB 2FGZA 3RGVD 4FZEH 5J57B 5T1MA 1FNAA 5TDOB 3IVKA 1IGYA 5H94B 4N1CA 5GGSY 2APWA 1YNLL 5DVNA 4F9PC 5KSVB 1G7QA 1RUPH 4FHBD 4G8FA 1JNLH 3LSOA 3F12B 4JO2L 4F7PB 5DMIH 1IM3B 5M95B 1B6UA 5TQ2L 3QG6B 2C4FU 5KS9E 5DD5H 3DURA 3FO1A 3VGEA 2Z92B 3B9KB 3BWAA 5KS9F 3AFLA 5KSBE 2V6HA 2ZP0T 2IFFH 2AJSH 2QKIB 3MRPB 2OLDA 2XRAL 1BZQK 2WNGA 1NPUA 3RP1A 3VD9A 1JNNL 3LRSB 4U1LB 4KUCD 4L9LC 5T3XL 5IM7A 1U8LA 2EO1A 3V9FA 1IT9H 5EBMA 3VFRB 3ESVF 2OZ4H 1FO0H 5IIEA 4LHUA 1NJ9B 3UX9B 3LVEA 4O2CB 4QXWA 4RFOH 4DCQB 4EIGB 4RGMC 1ROWA 3SDYL 5AG9A 3DI2B 3X14B 5JIKA 1G9NH 4NCC2 4QCIB 4RGND 3VFUA 4PJIE 5IHZB 4HK3N 5EU6B 1WVZA 4HWZA 5I75C 3VWJC 1T80A 4JZJC 5IEKB 1W72B 1CFSA 3OAZH 4ONHA 4CN6A 4C59B 1CDHA 4RGOH 4PJIF 4GW4A 4P4KC 3R0NA 3UO1H 1LHZA 5GS1B 5HGHA 5B8CB 2X9XA 3TC9A 4D0BB 3QIBC 1E6JL 4W4OA 3G04B 1DCLA 4DK6A 3WFCH 4DN3L 2LU3A 4MS8D 1WBXB 2CDGB 3C6LA 2H3NA 3S6CA 1V05A 1E4KA 2ITDA 3SDCC 3CLEH 2ARJQ 2YWYA 4XP6H 3Q1SL 4YDVB 1R5VB 3N0PB 1LK3H 5ALBH 2EDJA 1EEUA 2Q76B 4J1UB 4BSWB 1SHMA 3BH9A 5I1GL 3QQ9C 2OBGA 1YJDH 3TNNB 3T77B 2F74A 2P44B 4LDEB 2CIIB 1G84A 1PX4A 3SGKA 3RVXC 1FG2A 4NFCA 3MREA 4Y5XB 1K4DA 5LGJB 3BRFA 1JFQL 1U3HD 2PO6D 3BH8B 3FCTA 3MCLL 4JFDB 4HGWB 1WZ1L 4O9HL 4I0PD 4LDOB 4BH8B 1MHHB 1IQDB 3UCRA 4JRXB 4E41D 2MJWA 1ZGLB 4U1JA 4ORGA 2FECI 1HE7A 3AY4A 3AROA 1QSEA 4NFBA 3P0VL 1WCBA 3UROR 3V79C 1EAPB 4DGVL 1OTSD 3TO4B 3SBWC 3BT2H 3C5JA 1QR1B 1LNUB 1KJMA 5C0AD 1G7PA 5D5ME 3VGAC 2P8PA 2V9QA 3JZ7A 1Z3GL 4KMLB 1J5OH 4IBLT 4MNQD 5BQ7B 2JLLA 5FYJH 5IB3A 1XGPA 4HS3A 2W0LA 4YEFA 3KJ6H 5J8OA 3D69B 4JG0H 4L4JA 3BP6A 1DBKL 3CVHA 5E5MB 1KFAL 1Q0XL 4KPHH 1KCUH 3S37H 4GKSA 2ESVA 4MD0A 1ZHNA 4XPHL 4JN2A 1N6QL 4U33A 2AW2A 4J6RL 3UTSB 3GSOA 1S9WA 3DARA 2EZ0C 3GB7A 3DSFL 4HUUB 3U46A 3L3KB 2IALB 4G6JL 4X6FA 3F7PC 4XRCB 3LKSB 2XXCB 3SDDC 5EO1B 4HGKC 4ZXBB 2IADB 4LSRH 1MLCA 2WIMA 5BS0E 1X4YA 2SEBA 4JRYE 3STLA 3O2VL 1YEGL 1Q9OA 1AGFB 3BW9B 4APQD 4P46C 2AAVA 1PQZB 1U41A 4P2QD 4XVJL 3STZA 1FIEA 4JM2B 2JELL 3DV6B 3RKDD 3BZFB 4PJXB 1NGXA 2A6IA 1K9TA 1LO0H 2ADJA 1MJUL 4YHNB 3ALWA 4JDTL 1KCLA 4WHYG 4WO4A 3L5IA 3VWKC 2JE8A 3UBXA 4O51B 1BVKB 4OZHE 3BX7C 4D9RE 2VNCA 5DYOA 4KJWC 1WBYA 5HHQA 4UBDC 4LVNC 4MCYB 3O0RH 3BN9C 4OZHF 2F58H 2QADB 1T5XB 1W0WA 4JFHE 5GISH 3VXRA 1BEYL 3CX5J 2BY3A 5FYKU 4W70A 2WMPA 4HXAH 3MV8D 3PQYD 2EDQA 4D9LL 4FQLH 3INUL 4FN0A 1W8OA 4O02L 5D1XB 2X4OA 4RQQA 4PJDA 3C08L 1UJ3C 1WCQA 1T1ZB 1NLDH 4Y16A 2V9RA 3RTQA 1MEXH 2FLRT 4Y1AD 3LS4L 4JHBA 5EU5A 3QPXL 2BNQD 4UV4L 5I71C 4PR5A 4P2OB 5I8OH 3MBEB 4XH2B 4GAJL 2MQ3A 3T0EE 3G08A 1ERNA 4M8QA 1JPFA 2BDNH 4D3CH 4OCSH 5K9JH 4QHKJ 2YEZA 3O2DA 4LCCA 4X7TA 1CF8L 1F4XL 1KCVH 2HRLA 5ELIA 2DWEA 4S1RH 4NQCD 2IQAA 1UWXK 3QO1B 2FJGA 2HJFB 5L6YH 2ZOKA 3U6RA 1WTGT 1JHTB 4HF5L 5FKAB 4K7PX 2BSSA 4XWGH 1N3NA 2DQEL 4JY4B 4OF5A 1NQBA 3IU4L 1PVHA 1DQQA 5D2NC 3S3JA 3WIHH 3HC0A 1BZ7A 5E2UL 4WW2C 5KS9A 3FQRA 3CFBA 4HKBA 5IB2B 2BVTA 3EYSH 3BPCA 5J6HA 3OAZK 4X7FC 3U36A 5KSBA 4XPFL 1WWAX 3JVGA 1TCMA 3VXNB 3V7AG 3UPRB 5BOPA 4M62H 2I9LA 3CJJA 1XAUA 1FZMB 2YBRB 4ZSOE 3EO9L 1D5ZA 3ARDA 2WIIA 4Q9RH 2FH8A 1T7XA 4QHMA 4BKLA 1KXVC 3G9VA 3O6MH 3IS1X 2OR9L 2IH1B 4NJ9H 5E9DB 4U6HA 4P48A 4Y89A 2NY1D 5F71A 4M6ML 4RWHA 3IYLW 1R0AL 3KPPB 3V6OE 3NACH 2Y07L 4HW6A 4LSUH 3WUZA 4KTEH 1U6AL 4X4ME 1ZSDA 3PUCA 2Z93A 3ZE0E 5ACZB 1P7QB 2A2QT 2GK0B 4M7LT 4WUUE 5CD5C 3HMXL 1I8MB 3RI5K 1DFBL 1JWSA 5EOCJ 2DQDL 4NT6B 3ZE0F 5CS7A 4QXTA 2HG5A 2IAMB 3GMLA 5E70A 1U8OB 1K8IA 5EU7E 1JNHA 3IJSA 2HH0L 4L4TB 3X12B 2YSSA 3HG1D 2GUOA 2DYPB 4JPIA 4OF0A 4IRSA 5ITBL 5DQDL 4P5TA 2OSLB 5K9OA 5E4EB 2JK5B 4ORZC 5H37G 1JZ5A 5DD3L 1QKZH 4LQFH 2ZUQC 1NEZA 5DQJB 1ZAGA 3WN5C 4LEXL 3X17A 3UTTD 4KDVA 3VFSB 1ZLVK 5E6IC 4K9EL 2FGWL 3AXLA 3KS0J 2HLFD 3PL6C 7CGTA 2XNAB 1NMAL 3PWPB 1V7NH 1I9IH 5CMAA 5BZDA 1J1XH 1ZVHA 1A2YA 4LPTA 5IHLB 5ADPL 2XWTB 2GJ6E 4KY1H 2EYTB 3NA9H 2GFBA 4NKDA 5JUEL 5DT1H 3TVMD 3LHPL 1MHCA 1LEIB 1V3JA 3IJHA 5HPOA 3ILPB 3FOMA 3QIUC 4NNXA 1SYSB 1E6OL 4XVSH 2MCPH 4XNQA 5EOQL 2HT4C 2DBLL 3VG9B 2HMIC 5D5MA 1A6VH 5INDB 5DEGA 4FRWA 3D0VA 5K33A 4XCFH 1ETZB 4CU8A 2Y9RT 1I3VA 1MIEL 3IAQA 2DTML 2XZAH 2Z91A 4WY7H 5FUOH 4AZ8A 5I8EA 3EDEA 1HDMB 3BGAA 3SE8H 2WBJC 1V7MH 1CR9H 4JJHA 3LEVH 3MLRH 4F7CB 5L9DL 1NCDL 5E1AB 3KPSE 1XCTB 1KF9B 3MRIA 1ZT7B 1BIIB 2IG2H 2R2BB 4TULH 3GJFA 1KJVB 3DO7B 1DLFL 3RPKA 3QFJB 1HZHH 1MPAH 1RU9L 4NDMB 3QXTA 4YQXH 3N06B 5DURD 3IXAA 5IK3A 1QFUH 5CHNB 2X9YA 5C0FB 4PV9B 3BKMH 2V5RA 4PGZA 1HNFA 4J2XA 5DLMH 1N8ZA 1OY3B 4U31A 5BS0A 4GBXB 3WO4B 2O61B 4HJ0D 1U9KA 3ARWA 3BHBB 4JRYA 3SQOL 1UCBH 2XFXA 5JW5A 4KUZL 5E8DL 3B5HA 2FO1A 2E6PA 4KAQH 4C56E 4FXKB 4WENB 5MENE 2ZKHH 4XPAL 2B4CH 5FUZL 3KG5A 5ICYB 3OKKB 1L0XA 1OCWH 1IAMA 1IGCH 4KK6D 3P2TA 2GTWA 4OZHA 2EKSA 2VN7A 3FFCD 2G5RA 5JXAL 3WFBL 1KPUB 4KGLA 4U1IA 1AXSA 5MHSD 3VFGH 4KJQC 3GJEB 2NNAA 3BIBX 1T0MB 2F54B 3MLXL 1DBJH 1NAMB 3D39A 4UILH 2EE6A 3L5WA 4KROB 4LLYA 2LQRA 5HGDB 4IOIB 1JHKH 1TNNA 2YZ1A 1A5FH 2J8UB 2VAJA 2YUZA 3VI4E 2J88L 2OMBA 3KYMB 2BY1A 3BD5A 4TVPH 4PB0L 3O3EB 5BZWB 4GMSH 3VI4F 1XIWC 4M5ZH 4GXVL 3GGWB 2YUVA 1L6ZA 1I8KB 1AO7A 4ELMB 3FFDB 4M9OA 3ARGC 3T0EA 3K7UA 2PF6A 1J1PL 4K3EL 2V2WB 3GSXA 2Y1VA 3LV3B 1HCFX 3MV7B 1MCWW 4P2RD 4DVRL 1XGUA 4FTVA 4K3GA 3VRJB 1KEML 3FMGH 1LD9A 3TO2A 3DROB 1OTTC 2ICWB 1SYVB 1YUHA 1U2CA 4FZEL 3K8MA 2DLFH 3GSVA 3HTLX 2DQJH 3E0GA 1QFPA 1X6NA 4YPGA 3HC4H 2HLAB 4O58L 3UJJL 5HHVH 4LEOA 4RZCB 3LKNA 4XPBH 3S34H 1J18A 4AENA 1YEEL 1JNLL 2VL5B 1ONQA 4XI5D 1FNEA 5HSFA 1AQDA 3ILQC 3OKEA 5EBGA 3DETC 5FIEA 5AG8A 1K85A 3VH8B 4OCNC 4HWUA 3ULVE 4QGTA 4W4OC 5FYKH 3OR6A 2IBZY 2OQJA 2VLJE 1XF1A 3SCMB 5JPNA 3ULVF 2AJSL 3E6FB 3ULSB 5I76A 3D3VB 1E4KC 4K8RH 4ZSOA 5HYSG 2GY5A 1CDJA 3S7GA 4NKOA 5T1LA 4M48H 2D03H 4GRMB 4F37F 3OG6B 1RSFA 15C8H 4NZUH 4KK8D 2XWBA 5JHDE 4YHPA 4HFWB 3K80A 3FB6B 1FO0L 4GW1B 1QRNE 2WLZA 4JZOA 1QSFE 4JM4L 5FOBB 1TXKA 4RFOL 3RU8H 4PJ5B 5HYIA 3DNKA 3SGKC 3QDHA 2K7PA 3ULUD 1P6AB 4DZ8B 1VDGA 3QUXD 5DUPL 3HZMB 1P7KB 4PJ9C 4ODVH 2BHYA 1JZ8A 1CFNB 3IFPB 3QCTH 1S3KH 5DFTA 1FFNA 4UNUA 1A8JH 4WUUA 2WUCL 2HFFB 2VKWA 1JP5A 4YDJA 4WI6A 3UO1L 5D6CB 2R15A 4NN7C 2ID5A 2HJLA 5FM4A 3O8XD 5GJSH 5I1IH 3B6SB 1YNTB 3WFCL 5L2JA 1LE9A 4NWUL 4YBQC 1X5LA 4H88H 4K2UH 3LEYL 1FL3A 3H9SD 4L8DB 4UDTB 1LK3L 3EJZC 3BJ91 2VSCA 3QA3B 1A6PA 3IETB 3FAXA 1GC1L 1XGRB 4UIMA 1KB9K 1OGAB 3SGDH 3L3DB 2DM3A 32C2B 2BOCB 3RVVD 2QSCH 3OKNA 4Q0XH 2XG5A 5IR1A 1JZ6A 5F1OB 4M9PA 1H15A 1JN6B 1IKFL 4K7FA 5ICXA 5GGSB 3T2NH 3VFOB 4LAQH 4UU9A 5F9JA 2V2TB 2DQIH 5EIQA 4PLJC 3UBXI 3S5LB 4C4KT 1N6VA 4ZUUB 4LKCA 1OAUH 3ROOA 4LPUA 1D6VL 5DA0B 4JKPH 4NOFA 2GJ6A 4JFFD 3QEUA 3F7YB 3U0TA 4D9QE 3MO1A 5I17B 4M8VA 4OI7A 4EN3B 3D85B 3K0WA 2NZIA 3UZQA 1ZA3B 1DANU 3BT2L 1MVUA 4DKFL 1FSKC 1A7NH 2F8VA 2WAHA 5I73B 2QHRH 3QIWA 3TT3L 3O3DB 4OZFA 1R3LA 4F9LA 3MCKB 4JVUA 4EDWL 2OP4H 4JDVB 2HFTA 1RK1A 2PW2A 5FYJL 5B39A 4CJ0A 4ALAH 1U95A 3KJ6L 5EC2A 5JR1H 2H26A 3QI9A 4KPHL 1DBMH 1HOCB 4P57A 2NQCA 3HA0A 2AK4B 2XT1B 4WO4C 3KPSA 4FG6D 1QYGH 3QXDA 1YMHB 1NL0H 4HIJB 3VFTA 2CKNA 3QXUA 3FO2A 2R23B 3UJIH 2J7LA 3OZ9H 1UB5A 4JN1H 4HULB 2JIXA 4EI5C 1JI1A 1QLFA 3SEPA 3T2QA 4AG4H 2Z8VC 3MRJA 3GO1L 4Y16C 4CDGC 5KSUB 3QG7H 5CFHA 1JWMA 4OJFL 4D94A 2WUBH 1HI6A 2FATH 3HFMH 5F6HI 1FLRL 1A21A 4KZDH 3W9EB 2UZIL 4M7ZC 3M8OL 4QRUA 2OK0H 5B4MC 2GY7B 3SGDI 2J1KA 1C08B 1FRGH 3B2UD 1TTUA 2OTUB 3C5SB 4LPVA 1RZKH 5CKAA 1T0NB 3P30H 1DN0B 3C9NB 3JV6B 4D0CB 1GIGH 4NOBA 1MFBH 4LCCC 3O0RL 1ZT1B 3Q6GL 2F58L 5DJZA 3MROB 3DUSA 4JFPA 3T65A 1FZKA 3MNWA 1CGWA 3IKKA 3U83A 4GG6A 3V52L 5KG9B 1QOKA 4KI5D 4HXAL 4O2FA 3W0WD 4H8WC 2NW2A 2AGJH 1WLHA 4P23A 1KC5H 2JF1A 1U58A 3WSQL 2XIDA 1UXWA 1KN2H 1NLDL 2XZQL 1MEXL 3ZKXC 3O3AA 1HH6A 5HHOB 1ZA6B 5GGUB 2Y23A 3F7VB 3O45A 3MYZA 2V7NA 4LASH 4M1GL 5D1QA 3TIEB 4Z78B 5I6XC 1BVLB 2DKMA 5LGKA 5CZXD 1G7MA 2X4RB 3LD8B 2D31B 3MFGB 5DK0A 1FYTD 3HE6B 5C0JB 4YAQA 3JVGC 3QUYA 1B0GB 3BP4B 5E7BA 5JDJA 1NBZA 4XMPH 2DD8H 4LP5A 2FHBA 3O41B 1JBJA 1FVDA 3ARDC 4S1SH 3SGJC 3HE7D 1TCRA 5DVLA 1XF5B 3RZCB 4KKBD 4WW1B 4RIRB 1I4FA 3V6FB 2IPKA 4P3CL 3AB0B 3PDDA 3Q48A 4PJFE 1MCQA 1XT5A 2R4SH 2QHLA 3OB0H 3RWCB 4AM0A 3VMPA 4G6FB 2AJYL 3NTCH 3ARFA 1FZOA 2WQRA 5A1AA 2DMKA 5F9WC 1YYML 2E6QA 3BDYH 4LF3A 2FWOA 1YMMD 5C2UB 2QQLL 1CDYA 5ACMA 4NSKB 4HPOL 1MUJA 4LP4A 3N1MC 4XAWL 3IAGC 2EYSA 2VLJA 4HUNB 1UWEL 5D7KD 5JW3H 1FNFA 3NZ8A 3IDMA 1N4XH 3FN0L 1B2WH 4ODWA 4O4YH 4U0RC 2RJMA 3NCYP 5LBSL 4YR6A 4ZOAA 5HYJE 4Z76A 4P5TC 5JHDA 4L4VA 4PIRF 1IMHC 2JJTC 3QEQE 4E5XB 1QRNA 2BOBA 1QSFA 3TIDB 2AERT 3RWDA 4MWFB 4DQOH 3L95B 3BO8A 3NH7L 3DUUA 4YGVB 3O4LE 4EJ1C 3NACL 4R8WH 5IFJB 4LSUL 4KTEL 3JUZA 4WU5B 1XGTB 3ZL4L 5E8EB 4RGMB 5BMFH 5FDWA 5GS0C 1F6AA 1QSVA 4EIZC 1H8SA 3ZTNH 4WFGD 1BWWA 1A1MB 5SWZE 3FN3A 2NLJA 3FQNB 4IRZH 1FZJB 3FT2B 5DRZA 1NMCC 3VWJB 5C6TL 5I75B 5IJVA 1TPXC 4ZFGH 1WWWX 2FIKA 4OLXL 3QCVH 3C2SA 5EU3B 2OM5A 4P4KB 3SDXB 3LRHA 3MR9B 1I85A 3QIBB 2DOCA 4JDZB 4YHKH 2I5YH 3WFEL 1MCFA 4HFUH 4PP2B 3Q6FB 1BX2A 2CLRA 2W65A 4CMHC 3SDCB 2JCCB 1S7QA 3HZVA 2AV1B 1BJ1J 1KJ2H 4Y4KD 1E27B 4WJ5B 3C2AH 4OGZA 4ZS6D 1X5JA 5FCSH 1I7RA 3VG0H 1V7NL 2A73B 1WFOA 4BFGA 4ETQB 1BP3B 1LO3H 1MJ7H 1JHLH 1J1XL 1C7SA 1HYRC 3MA7B 1OB1A 2XKSA 1FC1A 2IQ9H 4BQ6A 4FQCH 1ED3B 5DD6A 4KY1L 3HCVB 3EDKA 5I1EH 3OKMA 5D1ZA 5JLZB 3DO3A 4MA7H 3P73A 5E56A 2HTKC 4V1DD 4GKZA 1D6EA 3VE0B 2FD6L 3ARQA 2J8HA 1A6AA 2YKLL 3EAKA 4L29A 3IS0X 2R8SH 3MUY1 3HUJB 3FB8A 2MCPL 1U8QA 5DJDB 1T21A 1F2QA 43CAB 2O5YH 4XCFL 3PXJA 1CBVH 3G6JB 4FNLH 5TGBB 5EUOB 3UZVB 5MERB 1QA9B 1RZIA 3UEZA 1DVFD 3T0AA 3U4BL 3QDMD 1OAXL 3SE8L 3VGAB 3LEVL 5L0QC 3RIFF 4AQOA 3CC5A 1F58H 3L5XL 4ZFOA 3DBXA 4FQXD 4LCUA 2VITB 1NSNL 3E8UH 5E00A 5DC4B 4PJ8C 1G6RB 1KENL 1H0DB 2AJ3B 4OZGB 4TULL 2VZ3A 3FQTB 2VQUA 3RWHA 1CD9B 3LZFL 4YQXL 5IW3A 4Z7QE 1Q9LB 3DECA 1VSCA 3MRNA 4XGZB 4X4ZA 4Z7QF 4TUOA 5DLML 3TBYA 2EXWD 2M2DA 5FYLL 2YPKA 9CGTA 1A3QA 4CVZA 5GGRB 5C0CD 3MOAH 4F3FA 5E94A 4JHAH 3SDDB 3DRTA 3FHAA 4TYUA 2W0FB 2XTJD 3FRUA 5I16A 4WI5A 1VKXA 2DMCA 4HV8A 3WNPA 3CFCH 5F1IA 2B4CL 5HVHC 3DRQA 2NY3D 4JQIL 4HKZB 4P46B 1OCWL 1T04B 3HN3A 3ZYOA 3T0EC 4F15B 5EZLB 3L5HA 3RWEA 5KVGL 3LN4B 2AEIT 2O5XH 3QUZD 4WWKB 4U3CA 3CVHL 3VFGL 3QQ3B 3I75A 3PGFH 5FM8A 3VWKB 6FABH 1IRAY 3DX9B 5I8KH 4OFYA 1AGDB 3BZ4A 4NC1C 3RBGA 3MV11 1NFIB 2CKBH 2EC8A 4HKJA 5F89A 4G6AC 3WL9B 1OSPH 1X5HA 2HJKB 1T83A 2VDRH 1EEYB 1NUFA 5J12C 2XICA 3PV6B 1T22A 4NUGH 3I6GB 4TVPL 4PY8I 3QEGH 3KPMB 5DDHA 5IQ7L 4GMSL 4Q2ZB 4XTRC 3H7BA 1M4KA 1BOGA 4XP4L 2WLYA 3HNTL 3HZYA 4NM4H 5DRNB 1UJ3B 4EVNB 5DEZA 1KNOB 2DRUA 2L7UA 2WK2A 2GW5A 2XY2A 5DXWA 2HVJA 2GK2A 2ITCA 3MUGB 4KHXL 5I71B 5DD1H 4KRMB 1GHFL 3GKZA 2E7MA 4R26H 5DJ2B 2FJFA 4FA8A 4PJHE 3AM8A 4MNHA 3RVTC 3B9KD 1KELH 1NFDB 4R9HA 2DLFL 3VCLA 1J10A 2DQJL 4HUXB 4HBQA 3H0TA 3EZ8A 4Z7UE 5EUKB 4PJFA 4YXKH 1XMWA 3KHOA 4XPBL 4I48B 1PDKA 3V6OC 2NCMA 2XZCH 4Z7UF 4AIZB 4E0RA 2QR0B 1I8IA 4X6DE 4HDIA 3EO1B 4JO3H 3K1DA 1NC4B 4U1HA 5AZ2H 5HDQH 4X6DF 4Q9BA 5FYKL 4J4PD 5EU7C 4RAUB 3MV9B 4R2GC 4V2BA 5HI5C 2DF3A 5D2NB 2WP3T 2EXYC 4UT7H 5EN2A 5EU6D 5GSRA 2P7TA 4QHNB 5IVZB 4K8RL 4JKWA 3U9UA 4M48L 4Z7NE 3I2CH 5CD3A 5CGTA 2Q7NA 3VA2C 5H35B 3EGSA 4MZ2A 2O93L 5HYJA 3QEQA 4FQ1L 3JBG7 2YMXH 3CFJB 3V4UH 4Z7NF 4CKVX 4X8JB 3AGVA 4G9DA 4X5XA 3V95A 5IJKA 4PJEF 1CE1H 2P8MA 3MJGX 3VJ6B 2E9BA 3O4LA 2P5EB 4QRTA 5IMLB 4J3OC 1H9VA 4ODVL 2OCFD 4GRWE 3QCTL 3KJ4C 1AJ7L 3LKQA 1K2DA 3RY6C 3TH4T 2CLVA 1X9QA 5SWZA 4GRWF 4MMXC 4IMLB 3VRIB 3UMTA 1AQKH 3MJ7B 3L7EA 1DUYB 4H88L 4LLQB 4JFDD 4K2UL 1X7QA 3U4EA 5CSZB 5DF0A 2R1WB 1BQHA 2LABA 4Z7WE 2NY2C 1DQJA 3OAYH 1KLUA 4JRXD 3VFMA 4OF7A 3QUMH 4QT5A 4IHOB 1OF2B 5JW4Q 1HHGA 2H6PB 4HLZH 4OCLC 4F9LC 3MYJA 4AH2A 4Z7WF 4Q0XL 4E41E 1X5GA 4D8PA 5LAXB 1MLBB 4PY7B 3T0XA 3TO4D 3QI9C 3T2NL 1CICC 5MEQA 5J56B 2ZUQB 3WCYA 4MDIA 4Z77B 2DLGA 3WN5B 3EYFA 1OAUL 4XVUC 5E6IB 2BY0A 1ZHLB 3LPWA 3PL6B 3RL2B 1NCNA 1NH6A 4POZC 4U2ZA 1P9MC 4TNVF 5C0AE 4KKLC 1INEH 2DDQH 3DX6A 2FX7H 2P24B 2H32B 1RULL 2WQ8A 3TESA 3IB4A 2CK0L 2A83A 2B7DT 5KOVC 3WHXA 1YA5A 3ISWA 1GPOH 4LHJB 1U8NA 2VLRB 4WFEE 2EO9A 4MB5A 4OCWH 5AYUH 2FJHA 5IBUB 1FAIH 1U8KA 2P5WD 3MRHA 3UTSD 3WLBB 3W5MA 3QIUB 4Q9QH 3E2HC 3IDJA 4TUKL 4N0YH 5KW9H 4ZAKC 4ALAL 2Q8AL 3QNZA 4FMKA 4JAMB 5JR1L 1ORQB 3L3GA 4ZXBD 1NGWB 1NC2A 2FX9L 1J9CT 1JK8B 3ME0A 4YUEL 1MHPL 2C4XA 2W9DL 4OIBA 3VDAA 5EZJA 2WBJB 1IE5A 3QRGH 2DIBA 2FEDD 1P4LA 4NC2B 4NKIH 4JM2D 1E4JA 5DWUH 3QFDA 4IIQA 2VO5A 4NO3B 2J4WH 2VKXA 5GS0L 2LU7A 5F3BA 3UJIL 3OZ9L 4LHQB 2ZWLT 3ARVA 5EU4A 4JN1L 3L3IA 5ESQA 4PRHE 4XWOC 5E8NA 2H32H 3EHBD 4AG4L 5GHWL 2YPLB 3MC0A 2XWJA 1FJ1B 3HI1A 2HT3C 2Q6WB 2WUBL 5I8CB 3HFML 2QADD 2G5BB 2NY5C 4Z8FH 1ZLWK 4NWTL 1FNLA 1EUTA 1I3GH 2OK0L 4GXUN 4BQCA 4FABL 5E2WH 4OLZL 2FSEA 3MACL 2P8LA 2VLLB 1P5VA 1RZKL 5D1XD 5ESAA 5FHAL 3WNNA 3MV8E 2WWKT 3PQYE 2R9HD 2X42A 4EI6A 2ERJC 1L4IA 2CLZB 4P9HC 2WBKA 4DJMA 1MFBL 4X7SH 2UZYB 3RNKA 3RZWA 3PABB 3WUWG 2NX5E 4P2OD 5EOTB 3TCLB 4N8VB 4YO0A 5JDSB 1AD9B 2DQUH 2F8XC 1B0WA 4P5KA 3C6SB 4DGIH 1PKQB 4DZBB 4OZIE 4ZO6A 3K46A 4NQVA 3WJLA 3BGMA 2VQTA 4UDUB 5T1MB 5TQ0L 3A6BL 1A7PH 1IGYB 1PW3A 4LASL 3KLSA 2ZUVA 4XCYA 3KPRA 3TBVB 2FX8H 1XR9B 1INQA 4OCYH 3ULVC 1E28A 2W1NA 5TPWH 3RGVA 3FQXB 1XIWB 4NN6C 1NGYA 3PNWA 5F7FA 3TFKD 4XHQA 1FORH 4NYLA 1A6ZA 3DURB 4M6NL 3ARGB 1CI5A 4PJHA 3BWAB 4S1SL 2FR4A 4NO5B 4F2MA 3UP1A 5DJ6A 1MFNA 1QSZA 2E7HA 4AEHH 1W0VA 3AS1A 4PBWD 3T8XA 3W2DH 1U8LB 1UXSA 3CDCA 4FFWD 4OF3A 2DB8A 1JPTH 5EBMB 3V2AR 3QAZC 3EZJB 4X6EB 4MA8H 1CFTA 4X6DA 4HG4J 4ZPTA 3ZTJH 3HC3H 2V2XB 4LLUA 1JL8A 2Z9TA 3L3JB 4OUUB 1NGZA 3H9ZA 5E9DD 5T3ZH 3UTQB 5ECJE 3VFUB 1SJVA 3GMNA 2APVA 12E8H 1CFSB 4HUWB 2VZVA 1EV2E 4A6YA 4X6CE 3OR7B 1UGNA 4GW4B 3EYOA 1A22B 2GT9A 1I85C 4L3EB 4PLKC 3X3FH 1P7QD 1JV5B 3QNYB 4X6CF 5IKCB 1Y0LA 5EBWA 1KUMA 1TITA 2R0ZH 3JWNC 2AJXL 2H3NB 2VZSA 4LLMA 4N90E 2IAMD 3OAYK 3LIZL 3WIIH 4QO1A 1WBZB 4L4TD 4F37K 2DYPD 2MMXA 4LPCA 4ZFFA 4R8WL 3ZKMC 2YD7A 4P2YA 1EO7A 4Q58C 1WEJH 3HG1E 5D7SH 1QFHA 1FG2B 2DL9A 1RK0B 3U0PA 3MREB 5A40E 1K4DB 3GMQA 5HI4D 3ZTNL 1N59B 4PJ9B 3H9HB 4DN4H 5CGYC 4M61A 2KUTA 4PJAE 2ADGA 4XX1E 5INCB 4R4FH 2EE9A 3Q3GA 1H5BA 5MEOA 2CRIA 2BSTA 4HC1A 4NN7B 5IOPA 4ORGB 4PJAF 4Z0BH 4YHKL 1U3HA 2XA8H 3MRCB 4OZ4B 1MFAH 4QWWC 3D0LB 4FQHA 1MCEA 4LIQH 3LS5L 2F5BL 5CZVH 3SOBH 1ADQH 3O2WL 4E41A 4JG1L 1KJMB 3HAEB 4U0QB 3X11A 1G7PB 1XGQB 5I9QC 4WHCA 5I1CL 1CIUA 3T4AA 3O6FA 1GGCH 3ELAT 3MUHL 4AK1A 4QOKE 3K8KA 1CXEA 5IB3B 5IB1A 4L8BB 2UVEA 3BP6B 4FQCL 5C0AA 3CVHB 1QFWL 4K07A 5FF6A 2ICCA 2OX5A 1DEEA 4GKSB 4QRSB 4MA7L 1J05B 1VADA 3GMOB 1DQTA 1CQYA 4HUVB 5L7XH 3MRFB 5A43C 4J3SA 1S9WB 1HWGB 1K4CB 5DC0A 4PG2C 1SM3H 3WDHA 3U46B 5CILL 5ACLA 2R0KL 1QFOA 1MF2H 1CBVL 3KPOB 3QFJD 4FNLL 4LBEA 3IF1A 1FSKB 2X4TB 2X4PA 3TWCL 4PJBA 1K5NA 2PN5A 3D48R 1S7XB 4XX1G 3JWDC 3STLB 1RZ8A 1W2KT 35C8H 2GSGA 1Q9OB 1T1XB 4HWBH 3E8UL 1ZANH 3CSBA 4GBXD 4X83A 3S97C 1NGPH 1DL7H 2ZNWA 3HAEH 3OXSB 5GGVL 3WKNA 2A6IB 3GKWH 4MJ4A 1UT9A 3QWOB 3ZKNC 1U8HB 3MV01 5CLTA 2WWMD 5F72S 5CBAB 1X5KA 4WO4B 1GAFH 3MLZL 2H2SC 3WIFB 4LSVH 2ZSWA 5DYOB 4POYA 5MI0B 1OARL 5BV7L 2RCSH 5HHQB 3SHSA 1MAML 5LG1A 1PSKL 2PYED 5T3XD 3OBAA 3MOAL 3R4DA 1N64L 3REWA 1T7ZA 5FFLA 2CK2A 2F54D 4EI5B 1Y6KR 5MHSE 4GUPA 3NGBC 2IPUG 2MHAA 3MRDA 3M1BA 3MTRA 1KT2A 1U93A 4JFZH 4Y16B 2PUQT 4HPYH 2XOTA 1NDMA 2C3XA 1IAII 5EU5B 3MV8A 4M7ZB 3PQYA 1CL7H 4XT1C 3IRZA 4X80L 4YDIH 5ICZA 4ZS7L 4MX7A 2ARWA 3PGFL 6FABL 4MQXC 3AM8C 4HH9A 4M8QB 1JPFB 4G42A 4FQ2L 2HT2D 2Y7QA 2YEZB 1OSPL 4OZIA 2VDRL 4WNQA 1SJEA 3MV7D 2OJZL 2DWEB 4NUGL 2IQAB 3G5ZB 3QEGL 2B2XH 5DHYA 2BNRD 4BYHA 1EEZB 2ZOKB 1PLGL 3U6RB 4YHOL 2C5DC 4NM4L 1IGML 4ZUSB 5J4MA 1W0YT 1WK0A 4PGDB 1YPZE 4NQDB 4HS6A 3D25B 5I6XB 5JOFA 1DQQB 1Q94B 3HC0B 1JYWA 1YPZF 4KK9C 5KS9B 1QLRA 3FQRB 3CFDA 3DSNA 1JTTA 1V8HA 4OBRA 3CFBB 4CUCA 2DI8A 4R26L 2BVUA 3K3QA 3MCG1 4ZTOH 1PG7H 5CUSL 4M7KH 1JYNA 1SEBA 4XAKD 5ILTH 1LP9B 2YK1H 1A0QL 1LO5A 3BI9X 3SCMD 1D5ZB 3T1FA 4CN4A 3ARDB 3D3VD 4QHMB 4BKLB 3MLUL 2VDOH 3TT1L 3NBNA 4QF1A 3MBXL 5DK2A 1R5IA 2ZG3A 2E7CA 5DD0H 2GKIA 1Z5LA 1WFNA 4XVTH 3D18A 4JO3L 3F6LA 1CDGA 2A6KA 3W11D 4PJIB 1K8DA 4PJ5D 1MJ8L 3PP4H 4WI8A 2Z93B 3BP7A 3OKLB 4IOFC 3ES6B 4X6CA 3CX5K 5F9WB 2NY5L 2OL3A 4JLRB 2EH7L 2L7JA 1JWSB 2HG5B 3GMLB 1K8IB 1JRHH 4YXHH 1CL7I 1JNHB 5EC1A 3IJSB 2QLVB 3ECBA 3BGFC 4P5MB 1UACL 3V4UL 4U0RB 2GUOB 3OJVC 4P9HL 1B9ZA 3NPZB 3EFDL 2UY7A 2PR4H 1BGXH 3MFFB 2FCBA 4Q9CA 3O3BB 4P5TB 5I1HH 4UQ2B 4J12A 3S36H 1IAKA 2CPCA 3P77A 3DVNA 3HG1A 2ZPKH 4N5UA 4XXCA 1OGAD 5DMGD 2CO7B 5CMAB 1IGIH 4PJAA 2QV2A 4M7LH 4KZEL 1IGTB 1BBDL 1AQKL 2A74A 1VESA 2VZOA 5E8OA 3VH8G 1XGYH 1NMCB 1ZWIA 3HMWH 3MXWL 4RWYL 2JJSC 1II4E 3S3PA 5DVKA 3FOMB 1A14H 4A6YH 4NNXB 2GCYA 2I9TA 3ARBC 3MRLA 2F15A 1IBGH 2DTSA 3IKCB 3ZE1E 4EN3D 3D85D 2HKFL 5BXFA 4JFFE 3KPTA 4BSVB 3TVMA 1MWAB 1EZVY 3SKNA 3ZE1F 4CMHB 2IBZX 3RJDA 1HHJA 4QOKA 2Z91B 1YECL 5FA4A 3MUZ1 5GS2H 2HTLD 4NRZA 4JB9H 1JGDB 1QPXA 2V5YA 5IVXE 2EDXA 3JTTB 4OCXL 4KKAD 1Q72L 2K9UA 5TE6L 1MY5A 1UYWH 5IVXF 4K3JH 4MAUL 1IKNA 5H2BA 1GPOL 1I7ZA 2AK4D 2NPLX 3KPLB 2AEPH 5AYUL 43C9A 2R2CA 4PREA 3GJFB 2VERN 4JVWA 4F8QA 5F7MC 4NRYA 3CH1A 1UH3A 3H3PH 5IK3B 3VXQB 2CIKB 3RVWC 4R0LA 3GSUB 4N0YL 5BJTA 4HAGA 1XR8B 1AIFB 1JRHI 1AE6H 1ZTXH 3X3GH 3WMSA 5JW5B 1A64A 4X4YA 5CEZD 1TZHA 4WHYH 3DUHA 1RJYA 5ESVA 3BQUD 3WE6B 1RZJC 2EYRB 1CDUA 3ZKQD 4LKXB 1KIRB 1MWAH 4NKIL 3RIFK 4ZUWA 3ZT5A 2ICES 2BHUA 1S5HA 3W39B 4DKEL 4GFTB 4WWID 4NGHL 1T0PB 4YHZL 4M5YH 3S5LG 2J4WL 2F53B 4NHUB 1S7SA 4OZHB 2CDEA 4PJ8B 2EKSB 1EO5A 1UH4A 1AXSB 3FTGA 5L2KE 5E24E 3P0YH 2CXKA 1JZ7A 2NNAB 4FP8H 4G43A 3BOVA 4LLYB 3WJLC 3NAAH 5D9SA 3ARZA 3V5KA 4R7DA 4HZLA 4I9WE 2EIBA 1ZHKA 1FFQA 1GGIL 2KQNA 4YFEA 4YX2H 5HGAA 1I3GL 3FO9A 2F8OA 4YK4C 3QEHA 3RGVC 1F5WA 5IMMA 2A6DA 3CGTA 4KRLB 4KI5E 3W0WE 1M05A 1WFTA 5F88A 5HHOD 2EDKA 5DJ8A 4G7VH 5JXEC 5HVHB 4DFIA 4KI5F 3T0EB 2Q7YA 4X7SL 2Q1EA 2X40A 2R29L 5SWQA 1CD8A 1UB6B 3KXFB 1OTUD 2DQUL 5FM5M 2KPNA 2HWZH 4OCRL 3HE6D 4OLYH 4DGIL 5DUBA 5ANME 4CRPA 3TO2B 3U0WH 1Q9WB 1KPVB 5FV1L 3S4SG 1KLGA 4PV8A 5LWYH 4YPGB 1I1CA 4XPTH 3QDJB 5GRJH 1KB9J 3DIFB 3RZCD 2FB4H 4MJIE 5J12B 5FB8B 3PHSA 4AENB 3LKRB 4OCYL 2VUYA 3RA7H 4BZ1H 1YPZA 4AIXA 4LSPH 1NMBH 2CGRH 1FNEB 5TPWL 1PGRB 4KJYB 5IMOB 4XNYH 3RVUC 2V5TA 5J1SC 2R0LH 5TDPB 5I2IA 4K94C 2WBWB 3U2SA 4G6FD 3HPLA 3P4OA 2XZZA 1F2XK 3JWDL 1UQSA 2X89D 2PKDA 3DV4A 4L5FH 1XCQB 2MKWA 3OR6B 1N5AB 1LE5B 1ZHBA 1KCSH 4YHYC 3GEWB 1RUQH 4OKVA 1YY8B 4M43H 3BRGC 5GS3A 5T1LB 2MWCA 3VXMB 4MDJA 3EJYC 1CD1A 3AREA 3VGDA 4TTDC 5GZNC 3VFVB 5D7KE 5IWLA 2J2ZA 1AR2A 3HC3L 1JZ4A 4MB4A 1J8HB 3DGGB 5T3ZL 1QO3A 5HVFB 4PGEA 1LO2H 1CXFA 5FOJA 3V5HA 1Z9OA 4MHHI 1CYGA 4JE4B 5DEFA 1P4IH 2E7LA 2ORBH 12E8L 3S35X 1FNSH 3ALXA 3WD5L 5LQBH 1I8LA 2A9MH 4OGYH 3V0VB 2WW8A 1XF2A 4MA1C 3QUXA 4MNGE 3X3FL 2H9GA 5IB5A 5ISZE 1Z0NA 4R2GB 5L2JB 1LE9B 2R0ZL 5H37H 5C0EA 5C2BL 3VWJD 5LGHL 3ARPA 1QZ1A 1T1WB 2UYLA 4U6XB 4WFGE 3WIIL 1X4ZA 4P4KD 3O8XA 3H2WA 1SY6H 3E6HB 3QIBD 3O6FC 3QZWA 2PW1B 2W0KA 1F4WH 1FGNH 2X70A 4MJ5A 3H9SA 1CGXA 4K7FB 5EO0A 3SDCD 5JIIA 4QRQA 1KJ3L 1IC4H 4U2YA 3MNZA 4G80A 5IF0B 4UT9L 5FUCE 4JQVC 3QQ9D 4YDKH 3TYFA 3ROOB 4U6YA 1T4KA 4LAJH 3RVXD 3QEUB 3U0TB 4Z0BL 5CP7A 3MJ9H 3OX8B 3PG2A 3PWJA 1NUDA 1UENA 1JGEA 2FL5A 2XA8L 4YE4L 5DQ9A 4GQ9H 1I1FA 3CDGB 1UM5H 5A16B 2R0WH 5CZVL 25C8H 2D9CA