3WTSA

Crystal structure of the complex comprised of ets1, runx1, cbfbeta, and the tcralpha gene enhancer dna
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
119
structure length
119
Chain Sequence
b'MGELVRTDSPNFLCSVLPTHWRCNKTLPIAFKVVAKGDVPDGTLVTVMAGNDENYSAELRNATAAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKITVDGPREPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Runt-related transcription factor 1
publication title A novel allosteric mechanism on protein-DNA interactions underlying the phosphorylation-dependent regulation of Ets1 target gene expressions
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription/dna
total genus 20
structure length 119
sequence length 119
chains with identical sequence F
ec nomenclature
pdb deposition date 2014-04-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3wtsA00
3WU1A 5G4OA 4L0YA 4IBYA 4A63A 2ADYA 1HJCA 3QYMA 2YBGA 2H1LM 5AOMA 4IBUA 1E50A 2BIOA 4IBZA 2X0VA 2J1YA 3D09A 3US0A 4G82A 4AGLA 3KZ8A 2BINA 3VD2A 2J1WA 4KVPA 2P52A 2FEJA 3KMDA 1HU8A 4LOEA 3EXLA 4AGNA 5ECGA 3WTSA 3Q06A 1GZHC 2ATAA 5AOLA 2BIMA 4IBQA 5KBDA 3ZMEA 4AGPA 1EAQA 2IOIA 3US1A 2J1XA 1IO4C 2AHIA 3D08A 2X0WA 2XWCA 4IBTA 3WTYA 4MZIA 1YCSA 4GUQA 4XR8C 3EXJA 3WTXA 1H9DA 3TS8A 1UOLA 4AGMA 3QYNA 2XWRA 5ABAA 3VD1A 1EAOA 3D05A 2VUKA 1HJBC 3IGLA 5AOIA 3WTUA 5LGYA 4G83A 1TSRA 1CMOA 3WTVA 2AC0A 4IJTA 4AGOA 4AGQA 2X0UA 4L18A 1EANA 2BIQA 2J6WA 3VD0A 2IOOA 1GZHA 5BUAA 4LO9A 3WTTA 3Q01A 5LAPA 4L0ZA 2BIPA 2PCXA 1T4WA 3Q05A 4HJEA 3D06A 4MZRA 3WTWA 3IGKA 2J1ZA 5AOJA 2WGXA 4LOFA 1LJMA 1CO1A 3D0AA 5G4MA 2OCJA 2RMNA 4QO1B 2IOMA 5AB9A 2MEJB 5G4NA 3D07A 4IBSA 5AOKA 2GEQA 2J20A 1TUPA 4GUOA 4IBWA 4IBVA 5A7BA 2J21A 1KZYA
chains in the Genus database with same CATH superfamily
4NWTH 2FHCA 4MJ6A 5GGUB 2OZ4A 2RIKA 2DM3A 3VGFA 5ENWA 1JRHH 1G1CA 1UWEL 4LFHG 1H6UA 3IAQA 5EBLB 4WDIA 2FJHB 3VGAB 4KROB 4EI6A 2OPCA 3BC9A 4RISH 5D5ME 3V5HB 1DQQB 4QWWD 3T6XA 4L3EB 4WNQA 5DCCA 3DV6B 1VADB 1O7DE 4XVSL 1GMIA 3SYCA 4ZW6A 3CXDH 1UWXH 4Q9CA 2VDOB 1GPOL 2G0LA 4AITA 5GGQH 1ETB1 2R2EA 3SGEH 1MXDA 1U8IB 5GS1C 3L3HB 1OLZA 3B7TA 3ARTA 3G04A 1NLDH 4H8QA 3NFPA 3Q44A 4YSTA 5L4MA 5I75B 4L23A 1QBAA 2CDEA 3SE6A 1JCKA 3RGHA 3FXIC 3VM7A 4CW1A 4ZFGH 2FBOJ 1M2VB 2ZZUT 5I8EA 4RGMC 4U4IA 4WUUA 4IBQA 5KBDA 4UQ2B 1CL7L 4AGPA 3ULVC 2GK0B 1ID5I 3F6IA 4P07A 5CIPH 5IIEA 5GGTL 4HJGB 1S7WA 1D5IL 4G7VH 4R7DA 1A3LH 4L1DA 4W70A 3FFCB 4K7PH 1OPOA 3OKNA 3OB0K 4EN3A 4HHAB 5JXED 5EB9A 3QEQE 1FQ9C 4HBCL 5L0QC 2ZOLA 1Q38A 3TJHD 1IRAY 4TF4A 2X6MA 1CN4A 4O2FA 3MOBH 3TLRA 3NGBC 4I0CC 4YR6B 2E56A 5K9JH 4FZ8L 4DKEL 1X9LA 4JHAH 5LGYA 2AXFB 1NGPL 2IGLA 4PRID 3T2NL 3ZRCC 1NCBL 3CFDA 2NXZD 1PY9A 3FONB 2UXVA 3IFPA 2P42B 1HILA 3CFUA 3LNIA 1JG9A 5KYXB 1EZVY 1JHTA 2NY1B 5DFTA 2KZ1B 4K4KA 3C5ZD 4IJ3C 1KCSL 4XVTH 3Q9PA 4H5SB 1E30A 3FSWA 4FXGC 5AALA 2APVA 5ISZB 5K59E 3REWB 3W56A 1BJMA 1F4HA 3NT0A 1RZPA 4UINH 5HHVL 2DTMH 1P4LB 4GAYA 4GSXA 2JKJA 2FLMA 2PW1A 3BMVA 4NQCD 4O58L 1KYAA 4MWFA 2NY7H 2O5XH 2FJGA 1OP9A 2VZOA 1X5XA 4AMKH 3MRDA 2MPAH 4HPOH 4ZTEA 1C08B 2Q3ZA 2H26B 2UYLA 3L4ZA 4P4KB 4CILA 2GG1A 3IGAB 1ZK5A 2FDBP 1RH8A 4MKMA 5IT2L 2BCKB 3UCRA 4NKIL 4OJEH 3PRZA 2P4AB 5I73B 3BW9B 4PUBH 3WFHB 2APTA 4N9GB 3RYMA 2DKUA 4U49A 1AGDB 2YBGA 4NLAA 3BP7A 5FR3A 1VSCA 2X38A 4G1EB 4TOYL 3V7AG 5LGKA 1PKQB 5J3HD 2O93L 3MV8E 2G75A 2EDDA 2FQDA 3N41F 5DK0A 1MW3A 3OKDB 5DURB 5GRVK 4BFOA 3IDGB 3VX1A 1IC7L 1EHKB 1JGLL 4WV1A 3VFTA 3F12A 1A7RL 2I07A 1H19A 3S3PA 1ZEAH 3AROA 1CIUA 3S8GB 5J11B 2ADFH 1GOHA 2R0WL 4QIRA 4AM0A 1UEMA 4TTGA 3IS1X 43CAA 2VJ8A 1HXYA 3N85L 5HYSA 1OZTG 3K6NA 4MA3B 1OSYA 3LIZH 1O6SA 1DTUA 3OJDB 2X5PA 2H0FA 1BSIA 1IAII 3TNMB 2FE0A 1I3GL 4HJTA 1JSYA 3ZE2F 3CLWA 2JE8A 2EXTA 3FT1A 4RMRA 1G7QB 3CFEB 1RK7A 4QXWA 4NZRL 1LDSA 1T04B 4X6DE 4WWOA 4NEHB 3FCSB 2XSKA 2ZWZA 2PCYA 3N42B 5D7JC 3PS6A 4G9DB 4Q6IA 3KW7A 3PHSA 3VJ6B 1SYVA 2WHVA 3UO1H 3VYNA 1QNZL 3QUMB 3TN0B 3FB8B 4PRHA 4CADB 1NC4B 2AQ2A 4K7PY 4X5XB 3FT4B 3OKMB 3Q5OA 4MSWA 3VFWB 5HHPA 1HKFA 3IGLA 3UGXA 4NRZB 1YVLA 4LQ1A 3IRCA 4R8WL 4NC1E 3CIQA 3BYYA 3KLAB 4OFPA 3VUAA 1PIFA 4I0PC 2YGQA 1P5UB 1AZBA 1GZQB 2X7LB 3IMWA 2DQUL 4H8HA 1NCAH 3QS2A 4PRAA 5PCYA 1RK1B 5EUKA 3GHBL 1BX2A 5LG1A 1QUNA 3FO0L 3PFUA 1CFVL 3MUJA 4OZGA 5TDNA 2ICEC 1R1CA 3TBWA 5L7XH 3W81A 1JD7A 4JG1H 4M1GL 1ZJAA 4PM1A 1H8LA 4F2ME 1RFDH 1Q0YL 5GZOA 4G6JL 3DK0A 1D7FA 3KPMA 1OWWA 4NZUH 1NC2A 5E4EB 3VAEA 4AENB 1M1XB 1R75A 5FKPA 2JCCF 4NWUL 3FQ4A 4YXLH 1QWHA 5HGHA 1B9KA 2QSQA 5T1MA 2B7DT 4ZD3H 1XF2B 1DQJB 4JN1H 5KVDH 1AZUA 5AQ0A 4ODVL 2XN9B 2WQVA 2BOBA 3OLDA 5DMGD 1FL3A 1U8PA 4X4ME 3WE6A 2K6YA 3MZGB 1MCFA 5EOCH 4IOSA 4TSBL 2Y6TE 4JQXC 3L6FA 4WO4D 5F7MC 1E2ZA 4PRNA 4I4WB 3IJHA 1JD9A 5EPMB 5F7DA 4K9EH 5I6MA 5F0LB 1I1AD 1WQVT 3OJMB 5SWZA 1IGYB 1U58B 3OF6D 4LPUA 4GY4A 4XCCL 2IC2A 1HI6A 3L4XA 5DK3A 1UD5A 1G9EA 4FNTA 4NIYE 2YA0A 3DRTA 1VFMA 2X2HA 2GJ6A 2APBA 2CO7A 4HMDA 3VO0A 4I48A 4QRTB 2GJZA 4G80B 2JLLA 2PWHA 4X0KB 3ZE0E 4GXUN 1U8NB 5T1KD 2QT6A 4PVLA 4C47A 5KYYA 3T8XA 2JTYA 1SF5A 3MRCB 1UJ3B 4RVBA 5H35A 4JL2A 3VD3A 4PJ9C 1J87A 3KEDA 4KHTL 1HOEA 4QXTA 5FM8A 2ITCA 1IC4H 3HBZA 2KZBA 4FNPA 4HIEB 4XCFL 3KWWB 1S78D 1IAIL 3S3CB 1JFQH 4KZDH 4AZUA 5EEXA 3BCFA 15C8L 1MJ7H 1U92A 4JO1L 5D6CB 4LLQA 5I6OA 1YPZE 1AJ7H 1OKEA 1VAHA 1D5MB 2UWEA 3OL2A 3PNWA 1TOXA 3DROA 5EH1A 2QDWA 3KWTA 2JV6A 1LQSR 3NCBB 4ETQA 1NEUA 4CSTA 3NFSL 2B1AH 5D1ZI 5DJAA 3GXFA 4G42A 3B9EA 4JDTL 1A65A 1E4XI 1GJUA 2YD9A 4LVNB 3KS0J 2C3VA 3L4WA 4JQVA 3SE4C 5D2NC 1TYEB 1N4XH 4JB9L 3T8VA 5FIEA 3UTSA 3WEMA 4X7SH 4KKAC 1KN2H 2R2BA 1G7HA 4HZLB 3PWNB 4CVZB 3I6KA 5FK9A 5HHOB 5LAPA 1KCBA 1KF9B 2L0DA 3LHPH 2YPLA 4IRJB 4XXWA 1H0DB 4PRDB 2WO2B 4F8NA 1R3HA 5ERWB 2PWDA 2PPEA 4XCYA 3VVWA 1CXLA 3U9PH 1UGNA 4PJBB 4AG4L 4A68A 1FVDB 2H6PB 2PP9A 2A6DB 5EUOE 2NY1D 3OAYH 3O3AB 5B8CA 3C6LB 1WEJH 3P3SA 4YFLI 1SXAA 2J20A 3QG6A 3LVTA 1AP2B 1MAJA 3EFFA 4HETA 4V1DE 3Q48A 1FH2A 4JZOB 3OAUL 5FW7A 5I30H 4Q9BA 1H15B 5DVOA 1Z5YD 4RLDA 3MBED 5EOQH 4BH8B 3MV7B 1TNMA 3QZWG 3VG9C 3GMPA 2D03H 4QLWA 3MOQA 2NW2A 2WBJA 5LKNA 4OTXH 2FB4H 2MMXA 3C60B 2Q1EA 5DD1H 1YLBB 4YBLB 3KWUA 3F62A 4RGNE 1LE5B 3WD5H 1ZA3A 2NTSP 4G5ZH 3ZUCA 5I2IB 2NY0D 1BZ8A 1BQHA 1NMBL 1OQXA 3H3KA 3G5WA 6CGTA 3RA7H 5I71B 3QJTB 5D1XD 4HAGA 3X13B 5HDRA 1KGCD 4P0DA 4KK9D 3T0ED 3D33A 3CZSA 2XYCA 3OHXC 3B9DA 2OSLB 3N3EA 1UWXK 1XD0A 4I13B 2YLKA 2QVMA 4JKKA 1DJGA 3ATDA 1T2XA 5JHAA 5DURD 2J7LA 4UAHA 2WTRA 4FTVD 4ZUWB 4XP6L 2FIKB 1SJEA 2Y7LA 2XY1A 4UIKL 2F54B 3MLWH 4WI0A 3FQ2A 1DEEA 2XCMC 4LLMB 3AM8C 1VEOA 4PVBA 5MP6L 1A6ZA 1G6VK 1ZE3H 3EJRA 4WHYH 2P80A 2XVKA 3ZHDA 3K72B 1IGIH 1UCBL 1G6RL 1LD9B 3LB6C 4LCWE 3QXTA 5B3JE 5F9WB 2OFQA 2DDQH 1EXUA 1FBIL 1I9IH 3MNZA 5A2FA 5KYUB 5E6SB 4OLVH 2AJYH 2HVBA 2IH1B 2JB6A 3O3DB 2OMXB 3WTUA 4R2GD 5SWSA 5EDSA 2V9QA 2NY6B 5A1AA 3OLGA 4QOKA 4NZDA 2XTJE 4JANA 2VITA 3CE1A 4LEBA 3LNDA 4JRXA 1HL8A 1HS6A 5BCAA 3EH5B 2VDNB 1IBGL 4M48H 2LVCA 2XHNA 3CBJB 2NXYC 5HYJB 1JZDC 4FG6C 2ESVB 1NC4D 3ARED 5F9DC 4WQOA 4JUTA 2HWZL 3Q01A 1UA7A 2BFVL 1HAWA 5D5MA 5GQBA 1SLWA 4YSOA 1DVSA 1J0HA 4U7MA 4XMLL 3U0PA 4JCWA 1SY6L 5CO1A 4GRWE 4BM7A 4OAWA 3BPLB 1FORH 1FNHA 4E36A 3MUY1 1EJ6A 4NP9A 3QFJB 4MAYA 1TLMA 1KEMH 5FECB 1BMZA 3QO0B 4HIJA 2M2DA 1HHIA 4HLEA 3HB3D 3GSQB 5AL0A 1M7XA 4Y19B 3M45A 4RRPG 3N5AA 5DRZB 3FO2B 2C4XA 2C7UA 1HE8A 4XVOA 4ENED 1CS6A 3Q2WA 1QFWH 1FP5A 1KXTB 4X7EC 5F1NA 5CR1A 5C0GA 3CVHA 3L13A 4S0HA 3MGTA 3NBNA 2H3KA 1NEZB 1ULVA 1FL5A 2X0VA 4KI5C 4N2OA 4QRPB 1OEZW 4LSTL 5TQ0L 4M61A 4OZFB 5I0YA 1TQWA 3QEQA 1MCHA 1COBA 1I9EA 1DCEA 2J1WA 3HE6A 4UAOC 1U91A 3FO9B 4X4XA 4XVJL 1NOFA 4OU3A 1G9MC 4Y9EA 2D2OA 3V7AE 2VDRB 4MGXA 1NFDE 5FYKU 3QHZL 3GDBA 4FFYH 3EOAA 1OAJA 4GUPB 3REVB 1UC6A 2E76C 1I1YA 1YN7A 3IJ8A 3HZ3A 1ID2A 4ZMVA 3FN3A 3ULUC 5C6PB 1BFOA 4JKLA 1OZUA 3BDXA 1F58L 1ZTXH 4W93A 4UWQB 2GT9A 3V4UL 5IB4B 4B9IA 3KD4A 2I27N 4NQEE 1VB9A 4KQ4L 1TJGH 1INDH 1P1ZB 3SDXB 3T09A 3U79A 4EBQL 2P8MA 4LNRA 3BPNC 2VQUA 2IEPA 1MEXL 4JDEA 2P49B 2FQFA 1MY5A 5CP3A 2N0KA 4IIQB 5I23A 1CI5A 1MSPA 1OCWH 4HEPA 3FTVA 1MFAL 2FATL 3FQTA 5JIDA 2R0ZH 1EJOH 2WLIB 4U1LB 3TA4D 3V5KB 1N2RB 2O4EA 1WGOA 1Q9OA 1JP5A 5EV7A 3U2JA 4ZPVA 4P8QA 3QDAA 4ECNA 2C8NA 4QRQA 4WTWA 4CC1A 1QWNA 4YHMH 4ZFOB 3QORA 4TM9A 1UXWB 2ZX9A 3TVMA 1Y07A 1Z9OA 1ZVSA 1KYUA 2Z35A 1T6VN 3GMOA 2X0UA 3P4NB 5JHLL 4FTDA 3QWQB 4NT6B 3LQZB 3L48A 5TQ2L 5A2KH 2J88H 5DJYB 4GQRA 2G5BA 3DX6A 3EGSB 2W0FB 2CUAA 3G08A 3MV8A 3VD4A 2R2HA 5J06A 3WY2A 5HXMA 2BK8A 3PAYA 5CJOH 3OXRB 2FBJL 2VR6A 2I60L 1U3ZA 2X3AA 3B7SA 5F7EL 4M1DL 2UUDK 4JM2D 3HS0C 4PG2C 2YWYA 1JAEA 1J8RA 3GPSA 3QUGA 4BFKA 4KH2A 1FNSL 2OMBA 4X6EA 4Y5VB 5IFJA 3NIGE 1E27A 1DJHA 2YJQA 1NCGA 4WW2A 1QVOA 4YSUA 3X2QB 4N2AA 4DOHB 1SXCA 2XA8H 1KLUA 3VB8A 3ZIYA 1Q1PA 2WJ7A 1NCJA 4MCYA 1GGBL 1RZIB 4X4KA 3BUIA 2WWOA 1X44A 5JIKA 1AMYA 1ZLUH 3NAAL 1UB5A 3RY4A 1U41A 4JJ5B 3SDDB 5C0CD 1EJ8A 5ESAB 4YHLH 1S5HB 5FGSA 1FZJB 3C2SA 3FOLB 3QWNA 4LU5H 4X6DA 4N28A 1TTBA 1X3DA 2Q7NA 4UQIM 4Y5XA 4RBPH 3DOIA 5F1KC 4DF9A 4UM9A 4KJPC 4Z0BH 3S4SA 1E3FA 3BXNA 3SDCB 1XGUB 2F9BT 4YHNA 3D69A 1K5WA 1FI8C 1BQLL 1J05A 2MRYA 3HJ0A 4L48A 3EYUH 5FA4A 4TSAL 2X44D 2EEFA 4ICWA 4HJUA 1INEH 1E9OA 2Y36H 3H54A 1FZMA 4S1QL 4TQEH 4YSEA 3MV7D 3UCQA 3C5JA 1GOGA 1CGXA 2AK1L 1A7NL 1RZJH 2QKIC 5AOLA 1GGUA 3PLYA 1OB0A 5C09D 3T3PB 2ZX7A 5L2KE 4K71B 2EO7A 1A1MA 3QAZB 5I0WA 3AC0A 5EC2A 5KSAD 1B2WL 3BWZA 2BXYA 5E4OA 4DKFL 2XFGB 3GK8H 2N1KA 1XGPA 3D4CA 4H0LC 5DYFA 4FABL 3I6LE 4OBRA 3TCXA 4M3HA 2WLLB 4F2MA 3L3OB 5DQDH 1DEDA 2AEQH 1P7HL 3GRBA 4WNSA 2YPKB 1YDPB 3HZYB 3KPPA 4W81A 2ETWA 3WS3B 2R1YA 5H37A 3HI5L 3ILPA 3IWUA 3WEXB 1NGZA 1V3LA 1NLBH 1T83A 4GP8B 5ICXA 4HQQH 4Z5RA 1SM3H 3MTXA 2DLEA 3MRNA 1BXVA 2HFEB 2IFGA 3P4OB 2ZSVA 2EAEA 3POCA 3H8NA 3FO1A 4ELME 4IJTA 3QGVA 4AL8L 3GJEB 4PJDF 4X4MA 5DT1L 3PFQA 3CMGA 3LN5B 3SE3A 1L9SA 1MCSA 3GMRB 1Z9MA 3TU6A 5I18H 5KANI 3QUZB 4X5WB 1P2CB 2IANB 2WGNB 2F74B 4G8IA 3DWTA 4E9RA 4RWYL 1ES0B 1JMZA 3MBWB 1G7PB 1N26A 1TKWA 4FULA 4WEBL 3SGDH 4AKQA 4PJCB 2Y07H 5IHUL 2N59A 2QGCA 3ALPA 3MX0A 3SCMD 2F53E 2A1WL 3ARBD 9PCYA 3MR9A 2VLLA 5FFLA 3CDZA 1P7QB 3PPEA 3H2PA 5AB9A 4OJCA 2OSXA 3RTLA 4NI3A 3LEYH 5MHSE 2VXUH 3DX7B 1RUAH 2ZUVA 1PLAA 1XV8A 2ESVD 2Q86A 3BMWA 1GW6A 4PJ5B 4OLYL 1U3HB 4NFCA 4BZ2L 2IWFA 2QADD 1CBJA 1J5DA 3V4PB 3MYJB 4YOKA 5E4IA 1NWOA 2KMWA 4JY6B 5C08B 3UAJA 1NAML 4QAMB 4IBUA 1R3IH 1F4YH 4HIXH 4HIIA 3ZZ1A 4N0UE 1MFBL 2EIZA 5F8RC 5FYJH 5MENB 2FNBA 4AQ1A 4GAJH 2HN7B 2NZ9C 5I1JH 2AABL 3K1DA 1EUTA 3LS4H 4AGLA 5FWRA 1QRKA 2N0MA 1FN4A 2CKBB 3QFDB 4RQQB 5D93B 1F8TH 5IBTH 3FYIB 1YPZA 2BO0A 4L9LB 3HPLB 3RAJL 3T1WA 4AIZA 3HUJB 4EI5A 1XF4B 5C0FA 3CXHK 1MLCA 1W72B 4JVPA 1BGXH 2BERA 2J25A 4NO2B 3GI9H 1O7VA 4F5CE 1T7ZA 2CUHA 1MWAA 2JMRA 4QCIB 2AJZB 3G5VB 4U6XB 3VXPA 3WFDL 4F9LC 2FYYA 4YHIA 4FXKB 1BD2D 3ZMEA 4OZIF 5TH2B 1EAQA 3ESVF 4UT9A 5FO7B 5BOZG 5JZ7D 1E7UA 2NSQA 4WK0B 4PJ8B 4KKCD 3U7AA 3WS6A 5D72H 1YECH 1KB5H 3KVPA 4UOW1 4YAQA 2ZUWA 3VACA 1HX0A 4H26B 4Y4HC 4A2FA 1N7MH 2E7MA 3RJOA 1EO8L 4PCTA 3K8MA 4PJFE 1DLFH 4U1JA 1E0OB 1RHFA 2QQQA 2GTZA 3FHQA 5AW2B 3A4DA 4F3FA 1V54B 1HZKA 5KS9E 4ZAKA 3MXVH 5EUOA 1LE9A 3CFNA 5EORH 4WDIB 4YDKL 4V1DA 5SV4A 3I9GH 1NBYB 3B9AA 4WNQB 1QSFE 1LO3H 2KI6A 5FWQA 4LVOC 3FZUC 5DHMC 5HP5A 1F2XK 5EZOL 4J1UA 5IB3B 3S48A 1CTNA 1QABA 3KH3A 1E4WH 4WTZG 2R2EB 2VR8A 3ETTA 2K70A 2YUVA 2YKLH 3GMMA 3G04B 3RTQB 4X4ZA 3UTTE 3F04A 5DD3L 1RAMA 4C83A 4HSQA 3CXFA 4GQZA 1D7DA 4CW1B 4RIRA 2XC8A 1J0YA 2AK4E 2EC9T 3BD5A 3PWLB 4Y4KC 5I8EB 2WD0A 2HUHA 4WUUB 2A6KA 2V37A 4OI8A 4QHLA 5IIEB 1CT8B 3DTXB 5I5JA 4P2OD 3CH1A 1KC5L 1PNDA 1YYCA 4R7DB 3QJQB 3U36A 1MFUA 2GC4C 2KDYA 2QDVA 5CJQH 3OKNB 4N5ED 3GHEH 2JCWA 4EN3B 1J1XH 2IV9A 4BH7A 3O6MH 5CAYB 5DRXA 2Q8AH 1U4FA 1ZXKA 3WJLA 3OG4B 3IFNL 3WKML 1JJUA 4YH6A 2ODHA 3LEVH 2OMWA 2YD2A 5F9JB 4I9WE 3RE0A 4NQTA 4M1CD 1DE4B 2Z31D 1SHXA 3QXVA 1DR9A 2ZF9A 4TULL 4DEPC 2P9RA 3E8UH 4PB0L 1Q9LA 4WI8A 3T3MF 1A7QH 3IFPB 4H1LG 2Q8BH 2I9LA 2XICA 1HILB 3ALWA 2AANA 4XXDA 5CJBA 4K07A 2EEAA 5DI8B 3ZDZF 3I85A 3OHMB 2FEDC 1P1VA 4AIEA 3BRFA 4LEXL 5IMKA 1RZ7L 2ZP8A 3BOVA 5E00B 4WWNA 1JZGA 4GAYB 1JTTA 2Q9OA 3RWIA 2PW1B 4MWFB 2FJGB 4NZTL 2IAMA 3A67L 3FQWA 3MRDB 4OGZA 4X99A 2HVKA 3U46A 3MC0A 2EYTB 4UQ3A 4YGVA 4UYQA 1BXAA 3SE9L 4HDIA 3SN6N 3ZTJG 3PAUA 4TPRH 4DN4L 3C87A 4ZQTA 3BT2H 4PJGA 1E3ZA 1I8KA 1IILE 2DEYX 3BFQG 1MFDL 2ZT9C 4BJLA 1JHKH 1KYOJ 2G75B 5DK0B 2XUWA 4AGOA 5JUEL 4AGQA 3S97C 4XNXH 1F42A 2VMDA 3H2QA 1QBBA 3VFTB 3UZEC 1TZAA 2AQTA 2YEZA 2I07B 4HOZA 3IEAA 4OCWH 3H55A 1J8HE 2CHDA 2YGVA 2R1WA 4MNHA 5IQ7H 3IDMA 3PF2A 5LGHL 3WN5C 2NYYC 1AGCB 5GGVH 2R8SH 2M8XA 5HYSB 4ADJA 3MLZL 1O6SB 1DZBA 1O9WA 1YJDC 3S5LG 4I77H 3W0WE 3NZHL 1AQKH 1YEGL 4ZTPL 5JIQA 3OZ9H 1CICA 3ZO9A 2PP8A 1MCIA 3DJ9A 2X4NA 4OSUL 1A1OB 4D9QD 3QUZD 2VAJA 4JVWA 5AAPA 4IBVA 2F6AA 3DIFA 3TEYA 2VDMH 3JVFC 1G7IB 3BAEH 2CXKA 4DO5A 1CPUA 3HC2A 2XOTA 4X7TA 4IRZL 4Q6IB 5BNXD 1JPGB 4HMEA 5L9DH 1OHQA 5F9OL 3W39A 1ZV9A 4NQEA 5GJSH 3U82B 3PWJA 4BGLA 4BQCA 2AS5M 4YDZA 3DRQA 4UT6A 4FE9A 1D6VH 1HESA 2HRPH 1L5GA 1I85C 1WITA 3VMOA 1KIUA 4FLOA 3DI2B 4MSWB 4PYHA 5D9SA 3EOBA 2HKHH 4P3DA 5HHPB 1IGFL 4DPAX 4RAHA 1U3HD 1XSKA 3INUL 3O2VL 3FNKA 3N43F 4CU6A 1YEHL 4XP9H 1E65A 3CNKA 4HU8A 3QDGD 2HKFL 2YPVH 1YNKL 4NM8H 4PRAB 3E2HC 4RAUA 3TFBA 2O1AA 5EUKB 5DRWB 1BX2B 2Y06H 1QUNB 3RX8A 3BLPX 1NAKH 4F8PA 5TDNB 1R19A 1TQVA 3TBWB 2FJSA 3BIBX 3WCYA 1ACCA 1BG9A 3KPMB 5FHBL 1NC2B 4FNQA 1H8NA 3FUMA 4YWGL 4NN7C 3D25B 5JPNA 2CKNA 1CC3A 4X98A 1VFAA 5T1MB 3WIAA 1JWUA 4E9WA 2H0JA 1G1YA 2AF2A 1QHOA 1QLEB 1QEWA 1EEQA 2LLNA 4KTEH 1FL6A 2ORBL 1GZPA 2L7QA 2BOBB 2ADIA 5MERB 3ZDXB 5KVGL 4O9HH 2ISDA 1NH6A 1U8PB 3QUYC 2DD8H 4L1LA 4KY1H 3STLB 4GLRH 3WE6B 3TBVA 3QDME 2BH0A 4GMSH 4TLUA 5GS2H 3EO1A 3LPWA 4XGZB 1SFHA 3L6FB 3SGJA 5ID0A 3V55A 4PRNB 5D6DC 4EAEA 1Q0EA 2YO3A 3DDFA 2CK0H 3NSYA 5E6ZA 4BUGA 3L95A 5AZ2L 2BOCA 4HH9A 1V7ML 3ZDYE 2P28B 5LGJA 2YRLA 1HI6B 2F5AL 4MMXB 3VMPA 2GJRA 3DRTB 4W9GC 2JJSA 4XPHH 1TQCB 2CO7B 2GJ6B 2EILB 3WGUB 4I48B 1S3RA 3BO8A 2GJZB 2VLJD 4UV7L 4FFVC 1URZA 2QQNL 4KNSA 4NNYA 4G71B 1JERA 4JEGB 4YFLF 5GGVY 2QGDA 1OAYH 5AKTA 5KYWA 1SN5A 1MRDH 1NMCB 4Y2OA 1LP9E 3V0WH 1ZGLA 2J6EH 3KPRE 4QXTB 2ADJA 1NBCA 4OUUB 2D3NA 3NSCA 5G4OA 4L0YA 3LSOB 3U6XA 1IBHA 1FSKB 2XZQH 5L2KA 3BSHA 3C5SA 1ZXQA 4XC1H 5EEZA 3E9UA 1J5CA 3STZA 2VXTL 1MHCA 3SZKC 4FQIL 2WXJA 1HXKA 2UWEB 5IGXL 2BNUA 1A4CA 3AS2A 3PNWB 1U93A 3DROB 1BVZA 4V2BA 4N0YL 4ETQB 1OY3B 1SZNA 2F8IA 3P30H 5B1JC 2VXVL 4ZW5A 2QTEA 1FGVH 1MCEA 4G42B 1TF4A 1ZT7A 4LDLB 5B7EA 3KYKL 4DP8X 5AW3B 5E7BA 4EN3D 2C3VB 2V6HA 2CWRA 3UTSB 4JFZH 4DVRL 2EDHA 5KBPA 2R2BB 4IDLA 1G7HB 3IXAA 3TO4A 4KY2A 4J3XA 3I6KB 3X1FA 4OD2B 4ELMA 2WN3A 2W9EH 4EZKA 2YPLB 4DO6A 3OD3A 1XGYL 2LQRA 2OX5A 2K7PA 4XWGL 5K69A 4TQIA 5C8JA 3TTSA 1C1EL 3MLRL 4HC1L 4I18B 1DJXA 5JQ6H 1RZFL 1EEYB 1GSKA 3GNML 5CFHA 2G5UA 1DUZB 3G5XA 2R0KL 3NJLA 1OK8A 3QUXA 3PHAA 4ZYKA 4WO0A 1TTAA 1HH6A 3QZNA 4Z3FA 3PCYA 2EXSA 3S3SA 2AV7A 5B8CB 3ARFA 3QZLA 4Y4FB 2TRHA 3QG6B 3FUFA 3EFFB 5IJCC 5DDHB 3P0GB 3L45A 3DUHA 4C4UA 4EIUA 1NKRA 3CVCA 1AZRA 3KPNB 1QHQA 3DYOA 4PP2A 2FR4A 3GMPB 3EYOA 2VLKB 2NW2B 1PX8A 4OQTA 4DP4X 2B0SL 3Q1SL 3SBPA 3T5WA 4JRYE 2NNAB 1ZA3B 1UXSB 3NCYP 4DFIA 1BQHB 3HHMA 3SJVE 4PS4L 5IEKA 2OTWA 2AQ1A 3O8XC 3RKDD 3MFGB 4FXLA 4HGWB 5KTEL 1KCRL 3EG9A 2R0LH 5FX3A 2H0EA 3ZKMC 4YQXH 3S35L 2OK0H 3QISA 1PTZA 3GZQA 2JJTC 3KPLA 3ES6B 3MJ8A 2WTRB 4KMLB 1KMGA 3GSVA 4O00A 3VMNA 1SJEB 1JOIA 5ID1A 4WI0B 4O5LH 1HEZA 3PWPE 5KVFH 2DRUA 4KK6D 1A6ZB 1WAAF 5E9DB 2GBTA 3MA7B 1PD0A 2VDOL 4F5CA 1PVHA 2CBQA 1IB5A 1IM9A 4XNAA 2VXQH 3ZZQA 1RMFH 3T08A 5FCUH 4HD9A 5ITFA 3UROR 3MUUA 4WWID 5GRUL 5JO5A 1YYLL 2Z8SA 3MJ7A 1P84K 1VENA 1EXUB 1RIVL 3TCLA 4D8PA 4PJHF 3MNZB 2Z7WA 4R97C 2QBWA 2JB6B 1AG6A 1EFQA 4TSCH 4WUKH 1REIA 3OGOE 1GGYA 3FBKA 4PJFA 2HT3D 3JWDH 2VKXA 1H5BA 1WAPA 3CZJA 3GMQA 4FQCH 4HWBH 4JANB 4K8RL 2VITB 4ONGH 4TNVF 2BVOA 2DWTA 4JRXB 5FO9A 4DERA 4WK4B 5DHVB 2UXFA 3ATBA 5DRNA 5J13B 2IDUA 5FUOL 2A74B 1BYNA 4PRHD 1QW9A 3BKML 3RPIA 2WNGA 5IROA 4F24A 1K9TA 3RB5A 2B3RA 4HGMA 1DUYA 3V4VL 2CPCA 4PP1C 1AZNA 3UEQA 2YXWA 3FB6A 3U0PB 5GHWH 1QSFA 3LAFA 3SDAA 4ZNCD 5C71A 4OAWB 1FFOA 3AG2B 3S34H 4G8FA 4MAYB 2IQAA 3K4AA 4Z7UF 3S6CA 2AMUA 4Q89A 1D9KC 2EVJA 4WWPA 4JG0H 1H3TA 3E1ZA 1S9XA 2KLRA 3UTTA 2FT7A 2HP4A 1UOVA 3D8MA 1EQWA 4PLKD 3VXMD 2DN7A 3OZKA 4I1NB 2FWLB 2C7UB 1IBYA 5DSCA 2AK4A 3WJJA 4NGHL 1WP6A 4FEMA 3U9UA 3HIZA 1NC2D 5F1NB 1DQIA 3DX2A 5HVHC 5C0GB 1VERA 1PG7L 1TENA 3MGTB 2I9TB 3ZMRA 1ET8A 3CFJA 1FL5B 1K6QH 1W91A 4UUJB 4DAGL 4Y2NA 1TEYA 4M03A 3I2CH 2D73A 4YL4A 4ANWA 4P2YA 1DVXA 3KBPA 4LKXA 4HJJH 3LRKA 4M61B 3ZZLA 3I3DA 2Y7QA 3QEQB 5EU6E 3LN4A 3U4AA 1WPCA 3APCA 4M02A 1A0QH 3HE6B 1U91B 3AU0A 1HL4A 3FH5A 4JS7A 4ONOA 4X4XB 4X8XA 1GXEA 2NTFA 1D6EA 4O4YL 4EXPX 4IOSD 2VIRA 2F15A 3NSJA 1BWWA 4F15C 4ATTA 1I1YB 1YN7B 3P69A 5JTWA 3LIZA 4MQSB 2EE6A 3FW6A 4WY7L 1AZCA 3GWJA 1BFOB 1EBPA 3WHXA 3QJHA 1T0MA 4TNFA 4O02H 5FOBB 2GBUA 4CVUA 2GT9B 3A6BL 3R18A 5SWZD 1PG7W 4NCC1 2VL4A 3WI9A 1E6OL 1XH1A 1FUNA 4P3CH 4LQFH 3VI3A 1TIUA 4GIOA 2X10A 1QG3A 1XMEB 2X05A 1TZ8A 3H3PL 4LNRB 3ARGC 3UMNA 4JDEB 5I1IH 2DBJA 4KHXL 3BVNA 4BZ1L 5E2VH 4QGTA 1UEYA 4I0KA 2F1BA 2ID5A 3FT3A 4MA8H 1RQ5A 4A2EA 3FQTB 5BRQA 3INOA 4KI5E 1QD0A 3AG4B 4K3EH 4YBHA 4LMQI 5CCJA 2DQHL 5IMMB 4KNUA 1WSST 2E9IA 5CUSL 4PRPE 4UANA 1UACL 2BWQA 4JFQB 4QRQB 4S0SD 1IGML 3A4FA 4U0RC 1G5AA 2P5ED 2AJ3A 3IDIA 2V17L 3QORB 3AGWA 3VNYA 3TVMB 5J6SA 5E6IC 5HHME 2Z35B 1WIOA 3X12A 3OXSA 4YEEA 2UZYA 2RBLA 3G6AA 4L8BA 3QUML 2ATAA 1T2JA 2XTLA 5CZRA 2G5BB 3DX6B 3LQMA 3MV8B 3LNGA 3VFNA 2R8SL 3VCLA 2R2HB 2I32A 4JG5A 4BFGA 2AXHA 1EXHA 2VR3A 4LSUL 2O6EA 2ZYHA 3EADA 4U1HB 1J8HA 1AR1D 1A6UH 1SN0A 3FB5A 4GKSA 4LLVA 2A6JA 2Y24A 4XVSH 5M7QA 3KR3L 4I85A 1SYSA 4FXGA 5E23A 1II4E 4X6EB 3EOYG 3V5DA 4BA8A 4E9VA 1E27B 2WM0A 1H6TA 4WW2B 1QVOB 2L04A 4MQXD 1BZ7B 1M4KA 1KLUB 3BKJL 4N86A 1A2YB 4MCYB 2OR9L 3PG2A 1IX2A 4HZ1A 1GC1L 3QIUC 3W0WA 3ZE1F 3C12A 1T66D 3G6DH 4HXAL 1IGJA 3APFA 2VKWA 5JW4M 1OAUL 4I89A 4OGXL 2FX7H 4F7MA 2EE0A 1YQ2A 1D5XB 1KGWA 4XC3L 3B2UD 2PUQT 4FLSA 4LDEB 4PREB 4X6DB 4Y5XB 3SKNA 1D5IH 4PMEA 3IYLW 4ZUSA 1IAOA 3DMMD 2BIQA 1WD9A 4YHNB 2ZCLH 3D69B 1YYMH 3UBFA 4R5TA 5FA4B 1J05B 1OF2A 3ZL2A 2LVEA 2BIPA 3PL6C 5E6UB 1I9RH 1E9OB 2NQ3A 1FZMB 2X4SA 5E1IA 1L7IL 2FH8A 3NA9L 3ZKND 5DS2A 3C5JB 1QBML 4BCZA 3P9LB 2WBJD 3HTLX 3SOTA 4ZUVA 1ZDSA 1CYGA 1WT5C 4FZ8H 4G9FA 2H3XC 1D5ZA 5K1JA 3D34A 2J1KA 1JZEA 1BM3L 1RHHA 3C08L 1FHNA 2OJZH 1NCBH 4LB8A 5BXFA 1J5IA 4ZFQA 3NCJH 4LAQH 3NRQA 1AQMA 3QIBC 1G0YR 1ORSA 3CSBA 2ZXBA 4HS6A 1KCSH 5I0XA 2CCLA 4FQ1L 1HJCA 5FYJE 5HHNA 2IH9A 4F2MB 2NLJA 5AAMC 5KN5A 4GQ9H 5HHVH 4J39A 2XYBA 4R84A 2DYSB 4LARH 3ILPB 3NCWA 5D7JA 4BIKA 25C8H 4MJJA 3FOMA 3VI4E 2BXZA 1MWAL 4Z5RB 5ICXB 4AJ0A 1M05A 3C8HA 5ADPH 4Z9KB 3MRNB 1AS6A 5I1DA 2P80D 3UYPB 2ZSVB 3A4EA 3UZQA 3FO1B 2X1WL 3WUWG 4A2DA 4YHZL 1NMAH 2F1AA 5C0AE 5A43C 4NKIH 3ARVA 4APQD 3QDMA 2BJML 2JVUA 5H8DA 2PR9A 2JK5A 1QZNA 5TDOB 4HHGA 3RKPA 4PY8J 1TVBB 3FU0A 2NX5D 2WLNA 4G8IB 1TKWB 1KUMA 4FFTA 1JK9A 2HJLA 4FQJL 1IC7H 5SWSD 1X5HA 1JGLH 3OKLA 4LHUB 1I3RA 4Y1SA 1JDDA 3VQMA 1A7RH 1JNHB 3MX0B 1R4XA 4OGYL 4X6FA 4BV1A 4APXA 1HZHL 1OCRB 2Q5BA 3MR9B 2VLLB 4JRXD 4WLCA 2NY3B 3CDZB 4ZO9A 3TNNA 3FULA 2ICEA 2AXWA 5BS0D 3HC4H 3KHOA 4F1SA 3CPLA 4IKIA 5I1KL 1YEDA 5D7HA 4JFSA 2Q86B 4EUPH 4KQ3L 1BLNA 5CS7A 3K6FA 1A6WH 1TETH 3ZE0B 3D05A 1OT2A 1I3GH 3NSFA 1GVIA 4AYSA 2CIIA 3D50A 1H6EA 4GKOA 4XNYH 4R7VA 1QA9B 3PDDA 1N70A 1B3IA 1NCNA 1HDMA 4MJIE 4MKTA 4UV4H 1LP9A 2NY2D 3KPRA 4HIIB 1S8DA 3QPQD 3G7TA 2EIZB 1FRGL 2PTVA 3GS7A 1PD6A 4AEHH 1SOQA 4AQ1B 1T7VA 3AMLA 5GS0D 2WBWB 2CRYA 3QNXB 1FN4B 4JQXA 3MCLH 4YDLC 3QQ4A 4MB4A 4PW3A 1YPZB 5C7XL 1W6WA 4X4YA 4AIZB 1MJUH 4EI5B 5C0FB 1MCDA 3ZYZA 1MLCB 4FERA 4JFYB 1EMTL 1JN6A 2P26A 2P8PA 5TGBA 3CV5A 2VERN 4DP0X 5IOKA 2CJTA 4JW3A 1TQBC 4R8WH 4X8CA 5F96L 3D0LA 3H9SB 2RCSH 4MBRA 3VXPB 1PZ2A 5I1AA 4JMNA 2AFNA 3BISA 5BO1L 2GFBA 1XCXA 2AW2A 2NNCA 3QEQD 3RHWF 5J57B 5C6TL 3GHBH 3FCTA 3QR2A 3HE6D 1DVFC 2DMBA 5I6PA 4KVCL 1W8EA 2OMVA 2Z4TA 1TVHA 4YAQB 1IBDA 1JNNL 1KPRB 1OSPL 4ABVA 4M5ZL 2QJDA 4P4RA 5HGAA 4PJ9A 3EBAA 1ZJBA 4CSSA 4U1JB 2ED6A 3VQ2C 4NKMA 3UTPD 2GTZB 5KSBF 2FRGP 1QSEE 4NWUH 4OKVA 4ALAL 4F3FB 5E8NA 1BJ1J 4MS8D 4ZAKB 5DZ9A 2WUBH 3KCPB 5EUOB 3DXAA 1LE9B 4S1SL 3R7RA 1TJHH 3T0DA 4ODVH 3TT3H 4KJQC 1OP4A 3OPZL 4CRPA 1ECZA 2BMKA 2CLRB 1F1DA 3VFSB 1T1WA 4TSBH 3SO5A 4FCHA 3S37L 3EBGA 3KJ4B 2HMID 4RGNB 4J1UB 4JRYA 1FC2D 3LIUA 2PW2A 1H8OA 2NY4C 2A3TA 3BUTA 3HNSL 5D2NA 5IQNA 5LB1A 2UXTA 3GMMB 1PGRB 1TO4A 1T1ZA 3SJVA 4L9DA 4C83B 5IKCA 3QORD 3TVMD 2VDNL 5CN3A 4AJVA 5I1EH 3U6RA 5CEYA 2C9RA 2A6KB 3I6GB 1FNGA 2DQEH 2HTLC 1L3NA 4QHLB 5GRWA 5EO0A 3RGVA 3TO2A 3MV8D 2HT2D 4ZSOE 5DMJB 3CH1B 1OP5H 1I3UA 3U36B 2BW4A 3RL2B 4L8CA 2Z7UA 5I8CA 4ZZFA 4G83A 1PDKA 4N6RA 1J48A 3US9A 1WE5A 1OIOA 3PWPA 4TVUA 4I1PA 5DRXB 3D48R 1V7NL 4TXVB 5DMIL 2Q76A 5E8DL 5D7SL 1CLZL 1KTRL 3ZE2E 4OLWL 4YDJA 4YFDB 3VU1A 2YIHA 2BHUA 3HG4A 4WGVB 3X3FL 4LBAA 2MJWA 4JO1H 1DBML 4LCWB 1UH3A 1NGQL 1GYCA 1Q9LB 4N87A 2ZE0A 2CJUL 1F2QA 2QZQA 3M7FB 3NJHA 3RDTA 4NIKB 2X9XA 3D06A 3JYBA 4XXDB 4M9OA 4Z7NF 1ETZB 1N6QH 3MV11 5DO2C 1X7QA 4F9PC 3BH9A 1I8UA 5LQBH 4UM9D 3PHQA 5IMKB 4NQDE 4PGCA 2FECI 4NRXA 3GJFH 1MXGA 3QZOA 3IMVA 2CDGA 5D1ZC 1EHLL 4NM4L 4LE8A 4ONFL 3RWIB 3L7FA 2PP7A 1EWHA 3ATEA 3CDGA 3BUYA 4E9QA 4NO0D 4RESB 3BUQA 5E1GA 5DMKA 2PMZA 2IAMB 3FQWB 5LNEA 3Q9QA 4X99B 2HVKB 4UDTB 4GXUM 4HK3N 3AM8A 5I16A 3WNLA 4H1LA 4GRWB 4UQ3B 4YGVB 1ZS2A 1LO0L 1I4FA 2UVFA 4RX4D 1P53A 1T1XA 4E9LA 1AH1A 2O6DA 1ZS8A 2D9CA 3G3LA 4A6YA 1I8KB 2WSPA 5SX5H 3VA2C 1IT9L 5C0BE 4QRFA 2WSKA 3QXDA 2J4WL 3CSTA 3OR7A 2JCCE 4MHHG 5TF0A 1JV2A 4M4PA 1ETJA 1JDCA 4PVMA 2E46A 4L4JA 3JT0A 4JGJA 2YEZB 1DFBL 5JIPA 2ZCHL 2R1WB 1XCWA 4MNHB 4HJ0C 3IDMB 2Z7ZA 3V0FA 2C1OA 1F02I 1NMBH 1K85A 1HIML 2VDLB 3D08A 4Z3IA 4WFFD 5DLMH 5EU6A 4OF3A 4ZFOL 1IVLA 4MXWH 5J12C 4BELD 5T33H 5ADOL 5LBGA 1IGCL 2HKAA 1CICB 2K9FB 2D2CC 4FDWA 4K94C 5HYQA 1NFDB 3HHSA 3MRIA 3LZLA 2WNWA 5CJXC 2JI1A 4LLUB 4IM8A 3VD1A 5AW7B 3H9ZA 3DIFB 4OIAA 1AQDB 1M42A 4KH9A 2DH2A 3SD2A 3VWKB 4X7TB 5HD8D 4FNSA 4UBDD 3W39B 4NQEB 2F58H 3DBXA 3MUGA 3PWJB 3RJQB 3QXAA 4GW1B 1TT6A 1XZ0A 4CN6A 1KELH 1DQDH 2WBKA 4NNPH 1PZCA 4OZFH 5HGBA 1PW3A 1I31A 2J6WA 1G6RH 1KIUB 4MTMA 3CFQA 5D9SB 4FYSA 3EOBB 4P3DB 4XN8A 3S5LA 3IVKA 1U3YA 3CWGA 1HEHC 4BHUA 3WKPA 4QTIL 3V10A 3HRPA 1YY9C 4MLSA 4ANKA 1XAKA 4Z7AA 3ML8A 4RAUB 4OFKA 3L5HA 5EZJA 4DP7X 3U83A 1NDTA 5TK2A 4PRIE 4PRPA 1P9MC 1WHPA 1FVCA 2RMNA 1KV3A 1NIDA 2CHXA 5AVQB 3EJTA 4J3WA 1X5GA 4CMMA 2EE9A 5A2AA 1FAIL 1UD2A 4N9OB 1MF2L 1PLGL 3P9WB 4JL1A 4QYAA 4WSKA 5J5EA 2I5YL 4W4OA 1HCFX 4YDNA 4EI5D 2ADYA 2HWZH 5K33A 4WI7A 2BFVH 4X98B 4ZX6A 1VFAB 2PR4L 1JWUB 4LP5A 1MI5E 1PCSA 2J56A 2MH4A 1SJHA 5LNDA 1XO8A 1QEWB 3AU1A 1B3JA 3BAKA 1SY6H 1FL6B 1UYWL 1KNOA 2ADIB 3US0A 4NENA 3SKUD 3O3EA 4RZCA 2Y3NA 1OTSD 2DQGH 3KDMA 4M5YL 3NIGB 3TBVB 2R9HD 3EO1B 4DQOL 1ZDQA 5ID0B 2VDQH 3GHPA 3R06A 1I7TA 1A22B 1G9HA 2P47B 4OIIL 4UTAL 2V5SA 4AGNA 1KULA 3RX9A 2VL5B 3FFOA 1Q9WA 1XEUA 3L95B 2VERA 2BOCB 3EW3B 3TZVC 1S7TA 1XL6A 1NCWH 3QQ3B 4LPYA 4HH9B 5LGJB 1UH2A 3GMLA 3GO1H 4K3JL 4D0BA 3GLZA 3KLSA 4ZS7H 4GI8A 2E6JA 4IDJH 4ZAKD 4WWKD 3Q8FA 3QW9A 5DYOA 3HI6L 5TQ0H 5PAZA 4U1MA 1CFTA 2ZKWA 3GI8L 4TVPL 5GSVA 4V1DD 4NNYB 2PXYD 5T1DH 4M6NH 4B9KC 2F0CA 4XVJH 2YGNA 3OQRA 2PLTA 1H9DA 5KYWB 4A7GA 1A7PH 4FQXC 4NBZB 4Y2OB 2ZOKA 3EJZD 1X4ZA 3EBHA 3QHZH 4HEME 5E5MA 4R4NC 1ZGLB 3A23A 4PG2A 4DGYL 1DBBL 2ADJB 1D3CA 4J2XA 2NYKA 3K8KA 2P48B 1FO0A 3ILQC 4XMTA 1GGCL 2ZWNA 1KJ2L 2VR5A 1QI5A 2C9SA 2ZAIA 4UQEA 1VF5C 4URKA 2IH8A 5L2KB 3STZB 4KKNA 1MHCB 4YC2B 4AQZA 2X6AA 4K5MA 4P46A 3OB8A 1MJ8L 3O6FC 3BRGC 1OTUD 5HJ3A 4L3CA 4KQ4H 4NQSB 3DJTA 3D4GA 1N59A 2BNUB 4LFHD 3AQYA 1XCQA 2JKTM 3GS0A 4J7RA 5AW4B 1U93B 4EBQH 1AHWB 1U8CA 4OH2A 4X5LA 3F7QA 1WWCA 3FU8A 4K23H 1MFAH 1E5YA 2FATH 1ZT7B 1ZV5A 2GTWA 3BDBA 3FRPA 4HCIA 3W11C 3QDHA 4FFZL 4LDCA 4L37A 1CG9B 1T1YB 3VI4A 4AL8C 3MNWB 5KVFE 4Y9GA 4NCDA 3FSAA 1E6JH 4FQHA 1ZY9A 3FYEB 2DIAA 2DI9A 5A6MA 4IGBC 3IXAB 3TO4B 1CLCA 4ELMB 2AJSH 1WG3A 1I8IA 2OLDA 3MGAA 4IBSA 4B3VA 5C0AA 3KS0H 3TBTA 3IKCA 4EOWH 1KXVC 4K3HA 4M93C 2OX5B 1OWRM 5JHLH 5C8JB 1XB8A 2OV0A 3BZ4A 5TQ2H 1JWSB 4X7DC 3WIHL 5A6IA 1M9SA 4ACPA 5J6GA 3VSUA 4U3HA 1DVTA 2R69L 4A04A 4QUOA 2QKIA 2CBOA 5ACZA 1RUML 5EF2A 1KB5A 1W72L 4ZYKB 3QULA 4Z7OF 1HH6B 3DECA 2FBJH 2AV7B 4DVBB 4HULB 2I60H 3ARFB 4GBXA 2XBDA 4M1DH 2WQAA 5B4MC 2F53B 3T0BA 3BZEA 1MJJA 2XTJD 3MNVA 4Y2DA 3JQOB 2N1TE 5L8JB 4P23C 1CZ8L 2V9UA 2MNWA 5FM5M 5C2UB 2GUYA 4UNUA 1FNSH 5LCVH 3MRHA 4QGYA 1GOFA 4J3TA 3V8CA 1WAEA 3DBSA 3RPKA 1F90H 4BK8A 1GGBH 3EYSL 3LXAA 4IBLT 5AZEH 5F3HA 2HLFD 3BGMB 4LOEA 2Q2LA 2IAMD 2V4LA 5AW8B 3V6OE 3ABZA 4XVUD 3BQUC 3E3QC 3LH2L 5DWUL 3RBSA 5IEKB 2OTWB 3EOTH 4IOFC 1UM6L 1CLOH 4N0UB 1NBZA 3EG9B 4QY8A 3U9WA 2WWMC 1QKZL 2DQDL 1J9TA 4LSQL 1JZ6A 3ZJAA 3RVWD 1BQLH 1GHFH 3QRFM 2X9WA 4YPJA 3KPLB 2AVFA 2CGZA 3MJ8B 4S2SA 5JXAL 2NW3A 4OM1L 5ID1B 1OANA 4LL9A 1UOLA 1HEZB 1URLA 1AE6L 1G0DA 3ZL4H 4AW7A 1XT5A 1R33A 3KL3A 2D0FA 2EE2A 3V4PH 3TL5A 1A9BA 2O72A 1IUZA 1K8DA 1SEQL 2VZSA 3WDIA 4B7IA 2GHWB 5ITFB 1NCOA 2WOYA 2G9HA 2KHAA 5DA4A 2VQ1A 1EERB 3E6FA 1B2WH 5JO5B 3CXHJ 1NFKA 1B6DA 3ZMNA 2ZAHA 3MJ7B 1JDAA 1AGFA 4D8PB 1QP1A 2F68X 4NSKB 4FABH 1CICD 1UWGL 5EIVA 3UG3A 4HG4J 5CM1A 4XNUL 1OV8A 3R4DA 4NKOA 1HL5A 4MA7L 4W9KC 2KZWA 3PV6A 2YBRA 2GC7C 4PJFB 1TCRB 1H5BB 3BGFC 1MCLA 3A24A 2K9UA 2XZZA 2BVOB 3WAJA 1AZZC 1RZKL 1QSEA 1K3ZA 4L1SA 5E2WH 3JZ7A 1M9WA 2D4FA 5LAXB 4NQED 5KS9B 5CCKH 2A83B 1JVOA 3RPIB 4YGAB 1FE8L 3WLWC 1CFQA 3NVQA 2ZCZA 1BCIA 4QDGA 4ANUA 5EBMA 1DUYB 3ULVL 4TRPL 4E0RA 1PIGA 4R83A 5I1LA 3WNNA 5DT1H 1OOAA 1QSFB 3GJFK 3SDAB 1FG2A 5IFHL 1FFOB 3ECUA 3PJSA 4G8FB 1LK3L 2IQAB 3SO3B 4OLZL 3PYCA 4RWYH 5DZJA 4F9LA 4WEBH 2YUZA 1XX9C 5IHUH 3N44B 1TYRA 1TZGL 1S9XB 2EE3A 1PJ9A 2OZ4H 2FD6H 3UTTB 2A1WH 5EZLB 3AXHA 4DZBA 1OP3H 2D4DA 3H7LA 1BBDL 3KPQA 4NUGL 1HHHA 5DSCB 2AK4B 4YUEH 2BINA 4XHJC 2AZAA 3VD2A 3U9UB 3D3VD 4RAVA 3BCDA 3QCTL 3V6BR 3PP4L 4KAQH 1XGZA 1L9MA 4OLYH 3BI9X 4BZ2H 4ZSOA 2XACC 2FT6A 3ME0A 4Z77A 1B0RA 5K1VA 4KZCA 3Q06A 4LKXB 3LZFL 4OVUA 5HI3C 1ZVNA 4JVUA 4FFWC 4GUCA 1SHWA 2JKWA 5FS5A 1MFBH 2NTFB 1D6EB 1KOAA 2AABH 1YNLH 2XTSA 3P9MA 5IB1A 1TR7A 3ULSA 2YUWA 2OL3A 3LJ3A 4FL4C 5FCSH 1UUNA 4FZEL 2X12A 4PJBF 3I9IA 3RAJH 1YEFL 3QJHB 3WHXB 2W9LA 4G7RB 4FQLL 4KXZH 1U42A 1JI2A 2ATKA 5J89A 3MNMA 3UC2A 1NPJA 4FTVE 3C6EA 4M7JH 3O11B 4N4YB 1J0IA 5IW1A 3N9GL 4Q9QL 3K81A 4NQDA 4OR1A 4G8EB 2AERT 4WJ5A 3BVNB 3VG0H 1VPOH 3JWNH 5JW4R 2YFOA 1S7XA 2QFRA 3SQOL 3T6WA 2N7BA 1YMHA 3ARQA 5E2UL 3UX9B 4WTQA 2DLHA 3EF7A 3MKKA 2VDKB 2OYKA 2Z4QB 2I24N 2AJ3B 5FAAA 3IDIB 3R0NA 3NGBB 3RI5F 3X12B 3IGKA 1QACA 3K3QA 3OXSB 4JZJC 3VH8B 3WO4C 3G6AB 3TH2T 2WUCH 5C0BA 2TSAA 1LDPH 2AI0L 2V5YA 1EV2E 4XODA 4KWUA 3VFNB 1EH9A 1KACB 3JUZA 3VCLB 1I9JL 1G1OA 2JCCA 4XX1G 3EJSA 1IJ9A 1KZYA 3E6HA 1BLIA 1Z5HA 3EO0A 2YD8A 3FSZA 3H7BA 3K46A 4JLRB 5HGGS 3WGVB 1WK0A 1J8HB 4GKSB 4LLVB 4LGRB 2A6JB 3VDCA 5BZZA 4FXGB 5EZOH 4DUWA 4ODXB 3BP6B 4PJDE 1E42A 3SYAA 4NQXA 3RUGF 3D5OF 4LSVH 3HNTH 4FLRA 3TO4D 3IETA 4HSAC 4LGPB 3W0WB 4UQAA 1QO3A 2AJXL 4OCRL 2H1XA 1BEYH 2BP3A 43C9A 5C0EA 3TC9A 5JOFA 4PV9B 4F7MB 5HDBF 4AV4A 1N5YL 4LPXA 1JCVA 3MNDA 4AWJC 4HJSA 2BDNH 1MW2A 2BVPA 1Q94A 2DWXA 3H4FA 3SKNB 3QUXD 4ZUSB 1IAOB 1CGTA 2K6ZA 3I3BA 4B9CA 2ARWA 1VDGA 1ZGLM 4FAAB 1OF2B 3EF4A 1K4CA 1EAPA 4AQ8C 2XV3A 4J4PC 3ESPA 3IDUA 2X4SB 1E43A 3WKMH 1A7BA 2L7JA 5MHSD 2Y7MA 4OCSH 3WUZA 2DLFL 3UZEA 4ZUVB 3MV9E 3D2UB 1D5ZB 5FF6A 4GKZA 1RHHB 3HEIB 1G5GA 5FA3A 2FSDA 4Z23A 2XIIA 1BZ9A 3FN9A 2TSBA 2EH7L 3U1SH 2FCBA 1O75A 1ZLWK 1R3JA 1ORSB 4J6RH 1EAOA 4LOUD 4HS6B 4PRIA 4U3XA 4UDUA 4XXCC 2LT9A 2J6EA 4J23A 2GJJA 2FO4A 3MOAL 3QI9C 2CXGA 3WTVA 1Y18A 1G7LB 2J55A 4WSJA 3TPUA 1TTCA 2NLJB 4K7FA 3PV7A 1AXSA 2WCSA 2NSXA 1AD0A 5HI4C 1N6VA 5D7JB 4AQEA 2YS4A 3FOMB 3EFOA 2CJ3A 3L2MA 1MI5A 5E8PA 1UUSA 4OZIE 5HDWA 5I1DB 5H94B 3KG5A 1OT1A 1IM9D 2EDFA 3PXHA 4N22A 2P5PA 3MLVH 5JPMC 2KZKA 3B6SA 4X5QA 3QDMB 1R5IA 2Z93B 4LCIL 3DHMA 3EHBB 1F86A 2JK5B 1J9SA 3MRLB 5ITBL 1QLRA 2XZCL 4AYFA 4X50A 2VZ3A 1JK9B 1RP9A 2HJLB 1CD1B 1ZHBA 35C8L 1I3RB 3B37A 4NO5A 1KWKA 4JREB 1J1OL 2FNWA 1U30A 3VXNA 4JFHE 3ZDYB 1G7JA 1S3KH 1SOKA 3TNNB 2CMRL 3RVVD 5IB5A 1GL4B 3CPLB 1EX0A 1YEDB 3SY6A 2X89A 3NEEA 3WUWA 1BLNB 3MLZH 5IROD 1UH4A 5A2CA 1MFEL 2C9PA 1J0KA 2PCPB 4B95C 1Z32X 3PNRB 2CIIB 3SGKC 1RCYA 2AAAA 3E7JA 5DJZA 1QSFD 1PU0A 3Q2VA 1HDMB 1KGJA 4HEMA 3T2QA 1LP9B 1K5NA 3FTWA 3KPRB 4YSDA 1S8DB 1BBJA 3QUYA 3MODL 3IU3B 2EKSA 4HZAA 3A6CL 5TE6H 5KEZA 4PRBA 2ARJQ 4TNEA 4WGWB 1RY7B 3QJVB 3T4AB 1ANUA 3UTTD 3QQ4B 1WC7A 5D6DA 3MJ6A 1D2PA 1F6AB 1AGBA 4O2EA 4X4YB 5DD6A 3MRKA 3CQQA 4MA1C 4B5ZA 1JN6B 4G1MB 2P8PB 5TGBB 3GB7A 1BAFL 4W9CC 2HRLA 3INUH 3O2VH 4AH2A 3WYRA 5F0JB 5I1AB 3GXTA 4WI9A 2YN5A 1HVXA 2I7SA 2GFBB 1YNKH 5EO1A 3G5ZA 3NPSB 2RGSA 4M4RA 4W9IC 3L3KA 2IBZX 5D1QC 5HHXL 4HIPA 2Y5QA 5I74B 4MB5A 5C09E 3T3ME 4L1HA 4Y9BA 2VMFA 3KM1A 2FJUB 4PVNA 3FL7A 1TVHB 5TDPA 2VXQA 3OG6B 5F70A 3QUHA 3BVDB 4P4RB 4JPWH 5HGAB 1MCOL 1ZHLA 3DX3A 5FHBH 2XN2A 1RIHL 4NKMB 3WNPA 1BQRA 3L08A 3RBGA 4DN3H 3AXLA 4OKVB 1FYTD 1YC7A 1L9QA 1IIIA 4BUHA 4ZMXA 4P9ML 4PI0A 3DOSB 3LZOA 3MLUL 1A21A 4QTHA 3ABMB 3Q5YA 3X1NA 5EOTA 3CX5J 3ZXAC 2F61A 5KVGH 2JXMA 2BMKB 1LTXA 4G8AC 2GIXA 3WELA 1WJ3A 2ICWA 1XR8A 2MOVA 2Z34A 5EU4A 2BZCA 1L9TA 3TYGL 1LWJA 3ASNB 1N19A 3ULVD 1T1WB 4IHOA 4TQHA 4HWZA 4FKKA 4M8UA 4ADIA 2X42A 5B1JA 4JRYB 2PW2B 3WG7B 3FMGL 5IK3A 3T3PF 4DFHA 4P57B 5F89A 3IBOA 5I82A 2A9AA 3KGTA 4JR9L 5FM5O 3V6OA 5AZ2H 5EZIH 4GMTL 5EF1A 1T1ZB 1ND0B 3SJVB 5D4HA 5IKCB 3MRGA 1SQ2N 3ZQXA 3VGAC 4KROC 4JY5L 4ZW8A 3QT2A 5GRYA 3U6RB 5CEYB 3MRFA 5A16B 1BVLA 5IBUG 5EO0B 2B4CL 3RGVB 3OF6A 4GSDH 3TO2B 5CGBA 5AYQA 3S3JA 2QQNH 4OFYA 4YHYB 2IADA 1A1NA 1PJWA 2R29L 1CGSH 5I8CB 4L8CB 2JIXA 5EU7C 1OP3K 2XIBA 5G55A 3T4YA 4N6RB 3PWPB 1MFMA 5FO8A 1J8HD 2Q76B 2VDPL 4K5NA 3LPGA 4R4FL 1AKJB 4HIHA 1KGYE 2FWSA 5IEHA 1U8OA 1CR9H 4YDJB 3MUZ1 3CC1A 3HNVL 3VG9B 2VXTH 1IU1A 2EIDA 1UA3A 3W0WD 4ZMNA 4YVNA 4RFOH 3GKWH 4RMWA 3US1A 3ECVA 4K8RC 1L9PA 4PQXA 3RDTB 4PTTA 1MUJA 1IBFA 3WFCL 4PJAF 3RJDA 5FYJU 4N0YH 2XV2A 4R3SB 7CGTA 5L4IA 1X7QB 1TTFA 2OR7A 3BH9B 3I02A 4XMKL 4AC2A 1SXSA 4CJ1A 4U2ZA 1UQSB 3P3RA 2NPLX 3PHQB 5G5DA 4PGCB 2L8AA 3KYKH 4NRXB 2VE6A 4HAFA 3GFUA 2FBRA 2XWRA 4M7LH 4O02A 1NDGB 5LO7A 4CJ0A 5IREA 4FQQB 3CDGB 3BUYB 1DBJH 3WDJA 1BD2E 3BEVA 3BRDA 5DMKB 3ZKXB 5L8LB 2C26A 3KL0A 2EDXA 3F6LA 5I16B 5IR1A 4H1LB 3L1OL 4G9FD 4XWGH 5L2JB 2E6PA 4KX8A 2NY1C 4YIQA 3RFZC 3MLRH 4LSDA 1I4FB 1HHJA 2DL2A 1RZFH 2CQVA 4Q2ZA 3T9WA 2LHAA 1UURA 1ZS8B 3NDZE 2B1HL 2VSDA 4H20H 4A6YB 1NKOA 2CHNA 1INQA 3D9AL 4TKWA 5DK2A 3QXDB 1G9ML 5D7LE 1A9VA 2VWEC 3OR7B 1ZLSH 5E9NA 3GXDA 3FRUA 1CF8H 1E4JA 5CILH 3KHQA 4JHWL 1H3PL 4Y9FA 4J3VA 2B59B 3ULUL 2DAVA 4TUJA 5KANG 3V8OA 4NHCH 2BSSA 4P4KC 4DP1X 1ETA1 2B0SH 3Q1SH 3VFOA 4EI0A 3P02A 4N8VG 5D7JD 1TUPA 1T7WA 4GOSA 2C1OB 5I73C 1N64H 2WYTA 2BVYA 5CGMA 3II2A 1P4IL 5EU6B 4ENZA 4PS4H 5JR1H 1N6UA 1WLHA 5GS0H 4X9HA 4DWHA 1RURL 5J6HA 3GSXA 3QDMD 2IDCA 5EIIG 5KTEH 1NANH 1E50A 1JGUH 2FAUA 3EHBD 5HYQB 3HHSB 3PGFL 3S35H 1LMKA 5F6HJ 3Q7JA 4YZFF 3SKJL 5ICYA 5E24E 1IQWH 1CE1H 3BFWA 3II1A 4UF7C 5J11C 2Y6SC 1DBAL 3HZKA 4I0PD 3BUBA 3BP4A 2Y5TB 4E5XG 2VH5L 3JWOL 1NIBA 2DL9A 2Y4SA 3ELAT 3CVHH 2WANA 1A6AA 1D9KA 2PO6B 3HG5A 4X9BA 2JKIS 2BVQA 3MUGB 3QXAB 2VSCA 4ODSL 4D9LL 3SYOA 1XZ0B 4ES9A 2Z91B 2J57A 4KK5C 5HGBB 5GGTA 4F80A 3EYFA 1OVZA 4AMWA 3IVKB 2XKNB 4XH2A 1JHLH 4MNQD 4WI6A 5GRUH 3X1EA 4HALA 1G84A 1SBBA 2NRDA 2VRAA 2X53A 5CNHA 1JPTH 4ZUTB 1EGJL 3D4YA 4C54A 1FO0L 4Z7WF 2XKUA 3PU7A 5EZJB 4PBWD 3L3GA 4PRPB 4FA6A 3QHFL 3TN0C 2Q87A 4XTRC 5F7AA 4JAMA 4GYBA 2BP8A 4M3JA 4F33A 4AMXA 4CMMB 1A7OH 4KOBA 4RETB 2O6PA 5HHMB 2JKNA 4PMFA 5FUOH 2HTKC 3MHZA 1HXMB 2CRIA 1IKFL 4YNYB 3MRRA 4CN4A 3AQDA 3EO9L 3AS3A 2Z8RA 2UZIH 4PJIF 5CP3H 1ZLVH 3THML 2IALA 1SEBB 4Q4IA 5AVTB 1SJHB 4F57H 1T22A 2VC2L 3AU1B 3ETSA 12E8L 3AREA 3DGGA 1KNOB 2XJLA 4NENB 4QRUB 4XX5A 3O3EB 3UBXI 3TH3T 4RZCB 4MCZB 2JQZA 3KDMB 1GC1C 1ESOA 3ARGA 4PJDA 4PFEA 5LHDA 3FN0L 2W59A 2CE6A 1PAMA 3CN4A 3R06B 1I7TB 2PNDA 5INDA 4IK7A 3O3BB 4PU2A 1XBDA 3FQNA 4AYEC 2BNQD 3L2NA 2ARJA 5SX4H 1Q9WB 1OK0A 2DJ4A 1EAJA 5AOJA 1MRFL 4NGHH 2DEXX 1KCKA 4LSRL 4PJ9D 1S7TB 2IOMA 1Q72L 3X1BA 1WA1X 4OB5L 4F37F 3L3IA 5ANHA 1U6AL 4JDZB 1PG7H 4EZJA 5IW6A 4BSJA 5DD5L 4NFDA 5F6HI 3X3GL 4DAGH 2F7IA 4CDHA 3DXAD 4IRSC 5DYOB 1CVRA 1VKXA 1BOYA 4U1MB 5GSVB 4HCRL 4E41A 1J0JA 1K2DB 4DETA 2XG4B 4JM4H 4AIOA 2K78A 3AQXA 4O4YH 4CMHB 1VGEL 2ZOKB 5E5MB 2YC1B 1U36A 3MV9A 3M07A 2CO1A 4F8LA 1LVEA 1I8MA 5E4AA 4HWUA 1OM9A 4D9QE 3JVGA 4XPGL 2XPYA 1XF3A 5BZDA 4UOQA 1CU4L 2X9ZA 1FWXA 4P46B 3MJ9L 5IMLB 4WFED 5HJ3B 4L3CB 2ZKHH 3KPSD 3O81A 4YHPA 4YZWA 3QIUA 1JZ7A 1YSOA 1XCQB 2W95A 3DPBA 3TIDA 4QMEA 3H3PH 2X40A 4S1RL 3G9VA 2WMPA 3WLBB 4Q9RH 3O4LE 4XNMB 1QUPA 1UJ3C 1YMMB 3QZBA 4KHXH 4BZ1H 4CKQA 3SBRA 2BW5A 4AV5A 3VE0A 5DD0H 2V0AA 5C9JB 2GTWB 3FRPB 2ZWYA 4OJFL 2C9VA 5C1MB 1TQUA 4L37B 3PWPD 3HCVA 2DQHH 4OZIA 2OMYA 2X4UA 5CUSH 1DO5A 1UACH 3O2DL 3LEXA 3RHWK 1IGMH 3PL6A 5ILTL 5F3BA 2F1EA 1DSFH 3QDGE 4LIQL 4PGEA 2V17H 4HKXA 5C0AB 3TBTB 4P59H 3W5MA 1KENL 3IKCB 4FLQA 2VZUA 3EUUA 1TDQA 2FWOB 4GQPH 1HJBC 3WHE1 1FFTB 4E9YA 1C5DB 1VRSA 3I84A 5J6GB 3BPCA 4LSSL 1UZ6F 2QKIB 2JNZA 2UV3A 5ACZB 1GTFA 3UDWA 1Y1UA 4DK5A 1KB5B 3ETBF 3QULB 4LVNC 1WS7A 3PHOA 3UPRA 2ZP9A 1KY6A 4FRWA 3WY3A 4GBXB 3BZEB 5FGBA 4ZFFA 1F4WL 1MJJB 3MNVB 4Y2DB 5BVPL 3F83A 3KR3H 4IRJC 4QXGL 4WU7A 4N0FA 1KIPA 1NUNB 5MP6H 2ZWKA 1PF3A 2GSMB 3BKJH 2XI9A 4JO2L 6PAZA 5F3HB 2CBPA 3WTWA 4Z7UE 1U0QA 4LLDA 4HXAH 3IU4L 3HR5A 3TX4A 4OGXH 4MJIB 3C6LC 4GXVL 1MHEA 1WA0X 4XC3H 2B16A 3CH8A 4A7TA 1S9YA 4R4BB 1NBZB 2LAAA 3ISRA 3O45A 2HCZX 3MRQA 4QY8B 3FF7A 3LB6D 1MHPL 4PV8A 4B9PA 4R90L 3L7EA 3LKSA 3MAWA 3C60C 4YBLC 5E95B 5EU5B 2YFNA 4S2SB 2NW3B 3PXJA 1GRWA 3NA9H 1ZAGA 4M56A 4DP9X 4JFTA 2VLJE 4WAFA 3J07A 2JKSA 4ODTL 1TITA 2WOBA 1MOEA 1XR9A 3I75A 5DQ9A 3VXRD 1K8DB 2IQ9H 4BK4A 5AG8A 3P3YA 4LPTA 3Q1EA 4ODBD 2FVNA 3ZGHA 5IOPA 3QJFA 3L3DA 2IMNA 5AYTA 4GRLC 5GJTH 1PMYA 2NXYD 3BZDA 4FG6D 3E6FB 3R1GH 5K1NA 1IBBA 5EU6D 1KBKA 1EA9C 5BRZE 1AGFB 5C09A 2YJLA 4FQ1H 3IFLL 2HJKB 4NPYA 4CVXA 1VZGA 4NKOB 5IHBA 1MCWW 3PV6B 5KSAA 3GIZL 1V3KA 3QQXA 5AWNL 2X4TA 1LWRA 1SHMA 2QQKL 2VXSL 3DX9A 5J4MA 2H2PC 5CWSA 5D96C 1QSEB 5KJ4A 4S10A 1R5VA 5ICUA 2BVUA 4ZFZA 1QPKA 3QZMA 4EQ3A 2WWNA 1MWAH 2Q3AA 2AJVL 2FTAA 4HT1L 3PABA 3KLLA 1CFQB 4OZ4A 4ZJ9A 3OMAB 4UT9H 5EBMB 2DIEA 5E8DH 1UENA 2YRPA 4E0RB 2VR7A 5I1LB 3BAYA 3HAEG 3T0VA 3ZZSA 5ES4B 5DEZA 2GABA 3CLFL 2NNFA 3PJSB 3JWNE 4FX5A 2NY6C 2X2UA 5DUMH 5IJVA 3SPVB 4KI5D 4NS0A 3KGRA 3A4AA 4X7FC 4AZ8A 3HG1A 3HBQA 5D70L 3U0WH 4FXTA 4HW6A 2DEWX 4MLIA 1R0AH 1CGVA 4IOIA 4PRPD 5F7KC 4BSWB 2ICWJ 1A3RH 1W80A 5BUPA 3AWGA 1HZHH 4Y1AD 2GIMA 1DVFA 3TBSA 2EJ1A 4DZBB 3N41B 3KPQB 4HFWA 4RNRB 5ANME 1HYSC 2GEEA 3BT0A 1HHHB 4LO9A 2AXJA 4E9TA 2CD0A 3HI1A 3HJEA 3LS5L 4BBWA 5BPPA 5I1KH 1FLTX 3ARBA 4CNIA 4KVNH 4GPVA 3BPLC 2XZAH 3ULUD 3KYNA 4ZSOB 5CGYC 5C86A 1FH5L 1GGIL 3O9WB 1IE4A 2MQCA 1YEKH 1B0RB 2E27H 4YXKL 1SVBA 4N8UA 1C5CH 3D30A 1FFQA 5KZCB 1CK0L 4P48A 2VCOA 1VJSA 4L4VE 2NUPA 3NYKA 3ZE1E 1Q0XL 2VR4A 3RZWA 5D4QA 3ZE2B 1KYOK 1S2EA 3QCVL 2FYVA 2DYPD 1FFPB 1A4KA 3ZHKA 5IB1B 4Z8FL 3ULSB 1WUZA 2NY5C 4P9HH 3S7GA 2OL3B 2AJUL 4C55A 3W3BA 4CGTA 4XBEL 3P4LA 4M6OL 2VMCA 5EEYA 4P49A 1OW0C 2ATKB 4FMKA 2CHWA 2Y2YA 3C5XA 1YEJL 5D55A 4BFEA 5IW1B 2KT6A 3IFOA 5A40E 3CU1A 5F96H 3IMBA 3H9HA 4HFUH 5CBAA 4R26H 4NQDB 2VDMB 1BWMA 4B97A 3V9FA 4ZUUA 4RH4A 4JO5A 4WJ5B 4Z7QB 4HGKC 3T6ZA 1OL0A 4OF6A 5HDQL 1DBKH 2R27A 1S7XB 1USQA 4X8JA 1YMHB 3CQPA 4P5KA 5D2LB 5HI5C 1N0LA 1BD2A 5BOPA 4KVCH 1T6BX 4KDWA 4XI5C 5D71L 3BX7C 1G87A 1JNNH 1G6RA 1OSPH 3ML9A 3SIKA 1CXKA 9CGTA 2EZ0C 1J5OL 4M5ZH 3FUIA 1M1SA 2PTTA 5DUBA 4XNZB 4FJZA 4ZBJA 4ABWA 1DJWA 2JQMA 3I3EA 1YJDL 4KUZH 3NK4A 4ALAH 5JW3H 4ETYA 2Z92A 2YXFA 5T5NG 1THCA 3F6JA 4ZQKA 5C0BB 4FOMA 4KKZA 1UB6A 5HDLA 5D7LA 5INCB 4OD3L 1BYPA 3F05A 3OPZH 4AT6A 2VISA 5CZVH 1CCZA 4Z0XB 1CDIA 1MZZA 1UATA 3HW7A 3RDJA 5J7CC 2A73A 2ZSWB 4YXHL 4PRHE 4QJ4B 3E6HB 1B0GA 3EO0B 4JFOA 3H7BB 1UASA 2WB1A 2G0KA 2WP3O 4KKLC 5C2BL 3S37H 1I7ZA 4I3RL 4KJPD 4ZRGA 3MI6A 4GRWH 4LHJB 1ZLVK 5D1ZA 3IBEA 3HNSH 5FGRA 3VXUE 1ORQA 2YQBA 3IETB 1QO3B 3D18B 4ZMPA 1S7VA 1ZVHA 5C0AD 4N3UA 43C9B 4X6BB 5C0EB 8FABB 5JOFB 1E4KC 3IJSA 1OB1A 4QEGA 3EUDA 1ACYL 3VXME 1ZD6A 2V9TA 4ZW7A 2BVPB 5IFAH 1Q94B 2HG5A 4BGDA 1OCZB 1AQHA 2NR6C 1JRHI 4Y5VC 3SQBA 5L4JA 1SOXA 3DETC 2VUYA 2DQMA 5BZXA 2K4WA 2ICES 3ABLB 2WZPD 1P5VA 4YL9A 1MCJA 2EIBA 1E8ZA 2J8UF 4M7KL 5DMIH 3FJTA 1EAPB 2FO8A 2PPCA 1M3IA 3QJZA 4GG8A 5D7SH 1PG7X 3BESR 1YUHB 3M6DA 3SDYH 4OLWH 3SDDC 1NGYA 2EECA 2APXA 2R4RH 2ALWA 4G6KL 5BW7C 1DBMH 1W0WA 1RXLA 3AS0A 1DQLL 4QHKI 5FF6B 5EF3A 5D7KE 5FA3B 4JGMA 1AI1H 3OTTA 3SGEI 3UACA 1SFDA 3GLDA 2BIOA 1PZ5B 2Z31A 4BXSV 3VW3L 4YHKL 3SDCC 4JPKL 1F3JA 1MPAL 2VO8A 4XE0A 1WF5A 4UDUB 4PRIB 5E0QA 2NXZB 3B3IB 2WYIA 2FO4B 3BSZA 4UB0H 5I5RA 1NPNA 1R5WA 3TPKA 1CURA 1Y18B 1L0QA 5FO2A 3TPUB 1XGQA 4CC0A 2EIKB 1A6VH 4K15A 3ARDC 1MFCL 4UT6H 3W9DB 1AXSB 2OTPA 4Z6AT 4NM4H 4JUSA 5CJXA 3RY6A 2D7MA 1AD0B 3K5SA 3AWEA 3TT1H 1GZHC 1OSEA 1WVZA 4AQEB 2XWJA 1M6OA 1MI5B 2Y1ZA 1NUDA 5E8PB 3U1QA 3KYOA 4FMVA 1KIQA 4AM0Q 4DHLA 2YD3A 1LO0H 1TG8A 3HN3A 4FMFA 4FJ6A 4HBQA 4D3CL 3ARRA 4F7TA 5GZNC 5JORA 1RU9L 1U95A 3JZYA 2X0WA 1R5IB 3C2AL 2HRGA 2ICCA 1IT9H 4MZIA 4PIBA 5AVUB 3BLKA 4QHNA 2P5EE 5I5IA 2DMCA 1HWWA 1QLRB 5IBLC 2P1YA 4JBSA 5KSBE 5ESQA 1KJVB 4Q58C 3V0AC 4FEIA 1ZHBB 3CTTA 2PPFA 5C9JA 4NO5B 3VXNB 3ASOB 5JHLA 4BWUA 4C4KO 1P9MA 5KVEL 4UNTA 1G7JB 2EH8L 1P69B 3MTRA 1D5RA 4PJ6A 1KLGA 2NZ9D 4TUOA 3PGDB 1SNRA 2GW5A 1DJYA 4TMPA 1HIMH 2XG5A 2HSIA 3T71A 3ULUF 1NZRA 1EANA 4D7BA 3VFPA 4AX3A 5KVGE 2WQWA 4WEEA 3ESUF 2X4OB 5DS1A 5FUZL 1IGCH 5F7FA 4L0ZA 1IGTA 3QIWC 5HGDA 3MRJB 1ONQA 5IF0B 1K5NB 1KIRA 2RTTA 3PREA 3K2IA 3PP3K 4AVKA 3QUYB 2I85A 4UTBL 4AK1A 2EKSB 4MAZA 2AEPL 2ITFA 2R59A 4NO3A 5AW9B 4PRBB 3B2VL 3D0AA 2E4TA 3U2IA 1YA5A 5F7NC 4Z3HA 3QCUL 1FCCA 3D07A 4M6MH 1E8YA 1WC7B 1RPQA 2K7QA 4O2EB 2LFGA 4JO3H 1BFVL 4F1ZA 4FADA 4NWTL 5DD6B 3MRKB 3ZRSA 3KBFA 4Y4HD 3C8KA 5JOPD 3NSXA 3O4LA 3PE9A 3GB7B 3TZVA 4PGBA 4WZ9A 3V95A 2X1XR 3LOWA 3B5HA 3UAAA 1IFHH 1WAAA 4AH2B 3HKZA 3S8FB 1YNTF 4NAQA 3VD5A 1GYVA 3S5YA 5EO1B 1C5BH 3G5ZB 4M4RB 3L3KB 3TEUA 4MASA 1EHNA 2A38A 2WNXA 5D93C 5MEQA 4Y7MA 3CXDL 2WZ5A 1CXIA 1WWBX 3QDGA 1HKLL 2CM5A 3MBXL 4PJHA 5TDPB 1C12A 5GGQL 3M46A 1MF2H 4FQXA 5D7IF 3FZUD 4Z7NE 1ZHLB 1OPGL 2CNZA 1DQKA 3WFEL 3WBDA 1NLDL 3TEXA 4KPHL 1KTCA 3BHBA 4JRLA 4OF0A 3AXLB 2QHRH 4GXFA 4E2OA 3HR6A 5JMOC 4QTHB 2AV1A 4XZUB 5EOTB 4AIXA 3P73A 5ACMA 5TFSH 1T89C 3WIFA 3QSKB 2WYHA 3O6FA 5HJGA 3RGBA 2JXMB 3GUTA 4PJ8C 5CD5C 2NZIA 1KG0A 4FI6A 1XR8B 4Y4KD 5EU4B 4J8RA 1N18A 1BJ1H 3JV4A 5JW4Q 5CP7A 4HWZB 4A7VA 3AY4C 5DJDB 3LZPA 4MD5A 4DQOH 3MCG1 3KLQA 3W57A 4N2IA 5EULV 3C9NA 2EVGA 2ROYA 5BJTB 1VEPA 3GLAA 2BC4A 2LE9A 4LKCB 1MCWM 1QYGH 3MOBL 1GAFH 5FYLL 5IK3B 4Z7UA 1T0NA 4MDIA 5F89B 2MFNA 3VRLF 5K9JL 3V6FA 3NH7H 1KPUA 5JW4N 4WO4B 2NX5E 5D1QE 4PCKA 5KG9A 4JHAL 2RH0A 3MRGB 2FWUA 4IGBA 3TBCA 5C0RL 5SWSE 1I1AB 1IFRA 1KXVA 3MRFB 1BVLB 1TSHA 4FHJA 5JIHA 1NBQA 3GI8H 1E28A 3L5XL 4XVTL 1FZKA 3T65A 5BS0E 1LEGA 2IADB 1A1NB 3A21A 1Z66A 4OQTH 3CVDA 2JIXB 4RA3A 5BV7H 3ZW3A 3T4YB 3CLEL 4OQ1A 3VTMA 5FO8B 3CUPA 2J71A 2GSGA 4UINL 2VLJA 3QR0A 3UAFA 3RTQC 4DGYH 4HIHB 5CZKA 5T1KB 1TEGA 4P23A 4ZXBA 2NY7L 4GW5A 4JGUA 3HN8A 1U8OB 4BZ2A 5HVFB 5IEHB 4AMKL 4A1RA 1V05A 1AG0A 5TPWL 3U2SA 3L4VA 2VM9A 3HZVB 2YEQA 3QEUA 1MJ8H 4NX0A 2DWEB 3TGXA 4AEEA 5ECJE 3Q3GA 1NAMA 4J3OF 5BRZA 3P11L 4I88A 4LEOA 5DTFA 4PTTB 2ZUYA 1MUJB 5IVXF 1RZKC 3UIZA 1TZHA 3VYOA 1FPTH 4PUBL 2N01B 2GCYA 5LWYH 1WZ1L 1GCFA 2DS4A 1E2VA 3AJ7A 3DHJA 3I02B 5EG6C 3WKNA 4JQIL 4FFZH 1ITCA 2VE6B 3VFVA 2E9GA 4O02B 2V33A 4MNGE 2Y22A 2A77H 1ZEAL 3ESNA 2WLYA 1ODUA 2YEVB 5AEAA 2ADFL 1ZSDA 3ILDA 1WH0A 3BEVB 2PN5A 4YBQC 3TF4A 2QPSA 4H2CA 5EU7E 5BRPA 2A2QT 1VCAA 4LCCB 3F3HA 3CFKA 1F3RB 4PBDA 1UZ8A 4YIQB 2CBTA 4HUXA 5BOJA 4IKLA 4IMLA 4G7YL 1HHJB 3QPXH 2R69H 1M56B 1RUMH 2NYYD 1CFNA 2XQBH 4JPSA 2E7LC 3RI5K 1CDCA 1NJ9A 4DO4A 1INQB 3SOBH 3ERXA 4XAKD 1U8LA 4PV1C 1XGTA 3UTPE 3CC5A 1JK8B 2GIYA 2YWZA 2W60A 1CZ8H 3A6OA 5ANMA 4R97B 2WINB 1WFJA 2ZXDA 3LYRA 2CG9X 4Q7DA 4LLYA 4TUJB 2Q6WA 2BSSB 3OLIA 2UX7A 2WLZA 1HYRC 3EYSH 2VQ4A 4M3KB 4BA0A 3MBEB 1JPSL 2DWDA 4PJXF 4DGIH 1MI5D 1A14L 2DWSA 2NSMA 3BAJA 4UOW0 4Z7IA 1ED3A 1UKQA 2VN4A 1CMOA 2OYMA 4L4VA 1UM6H 3S37X 5LXVA 2NY0B 5J6HB 3ARXA 3EDEA 5D1XB 4UU9A 2A5UA 1X5ZA 3T0EB 5K9KA 4BXVA 2BPBA 1SDYA 5ICYB 3LMJL 2G2PA 3PWUA 4AI7A 1DP0A 1DDTA 3HZKB 2GY5A 2YXMA 3APDA 3BP4B 3DJZA 5T8IA 5ISZE 5DS8A 5L7XL 3PWVA 1A6AB 1AO7D 2PCXA 1RFDL 4NN5B 1MVFA 1AE6H 3P40A 4G3YH 4IMKA 4N8VA 2G2NA 1X5AA 1MZYA 4XMUA 4YPGA 2VWEE 4FTVB 1SEQH 3EYFB 2F7RA 1CGUA 3IDYC 2X89D 3EBIA 4JN1L 5KVDL 4XH2B 5TE7L 1JXJA 3DOHA 4N2KA 4X83A