3WTSA

Crystal structure of the complex comprised of ets1, runx1, cbfbeta, and the tcralpha gene enhancer dna
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
119
structure length
119
Chain Sequence
MGELVRTDSPNFLCSVLPTHWRCNKTLPIAFKVVAKGDVPDGTLVTVMAGNDENYSAELRNATAAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKITVDGPREPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Runt-related transcription factor 1
publication title A novel allosteric mechanism on protein-DNA interactions underlying the phosphorylation-dependent regulation of Ets1 target gene expressions
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription/dna
total genus 20
structure length 119
sequence length 119
chains with identical sequence F
ec nomenclature
pdb deposition date 2014-04-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3wtsA00
4MZIA 3D09A 2ADYA 4IBVA 5AOIA 1KZYA 4QO1B 2H1LM 5A7BA 2VUKA 2IOIA 5ABAA 3US0A 5ECGA 2BINA 4HJEA 3D08A 4KVPA 1HU8A 5G4OA 4IBSA 1YCSA 2J20A 1CO1A 1GZHA 2J1YA 2YBGA 3VD0A 2IOMA 2BIOA 2BIPA 4LO9A 3WTVA 2J21A 4LOEA 3D0AA 2IOOA 2P52A 3WTYA 5LGYA 4LOFA 4MZRA 3WTWA 5AB9A 2RMNA 1GZHC 2X0VA 5AOLA 3D05A 5LAPA 3IGLA 4L0ZA 4AGNA 3WTTA 3WU1A 2ATAA 2AHIA 1EAQA 1E50A 3QYMA 1HJBC 4A63A 4GUQA 5BUAA 3WTSA 2GEQA 3VD2A 2WGXA 2BIQA 2AC0A 3D07A 4G82A 4L0YA 4IBUA 2J1ZA 1IO4C 3IGKA 5AOJA 4XR8C 2PCXA 4AGQA 1HJCA 3ZMEA 2J1WA 4AGOA 1EAOA 5G4MA 3EXLA 4AGMA 1LJMA 3US1A 4IBQA 2MEJB 2XWRA 3WTXA 4AGPA 4AGLA 1EANA 1CMOA 4G83A 4IJTA 3Q05A 3D06A 1T4WA 1H9DA 3EXJA 3VD1A 2X0UA 3TS8A 4L18A 2X0WA 2XWCA 3WTUA 3Q06A 4GUOA 3KMDA 3KZ8A 4IBWA 1UOLA 5G4NA 2BIMA 1TUPA 3Q01A 2J1XA 2FEJA 4IBYA 1TSRA 3QYNA 4IBTA 4IBZA 5AOMA 2J6WA 2OCJA 5AOKA 5KBDA
chains in the Genus database with same CATH superfamily
1UT9A 3FRPA 4ZMZA 3SQRA 1L9SA 4JB9L 4Y4KC 3KJ4C 4UTBL 2G2RA 2BSRB 1YEHH 3TIDB 3ZIYA 4A2MA 3F2LA 2HA1A 3JV0A 2IOIA 4LGRB 1DSWA 4URTB 1C5DB 3FO1B 3GKZA 5JW5B 2R29A 5AB2A 1X5FA 3CZLA 1UM5H 3CH1A 4ZG1A 4MCYA 3D18A 4NAMA 2CHNA 4RQQB 3IPFA 4AXWA 4F3FA 2FX9L 1TU2A 2VM4A 2X44D 4S2SB 2YRBA 3FB6A 3GSRB 1GMIA 3II3A 3MFFB 4JRYE 3SDXF 5HVWA 2W8CA 2OMVB 5IFHL 3D4YA 2X4QB 1BVOA 1AH1A 1H6UA 4KWUA 1PDKA 2XVBA 3VXUE 1JHKL 1LVEA 4BDVA 2QVFB 2WZPD 2WXMA 3QUXD 4KXZH 25C8L 5GGRB 4U1HB 2XZCH 1RUKH 4HGWB 3VGAB 2PW2B 1YC8A 2Q8BH 6FABH 1KSRA 2FWUA 5BVJA 2XOTA 4PTUB 2WGXA 2CU9A 2AC0A 3ARDB 4NPYA 1UH3A 4PJAB 2FNWA 4Y4KD 5DRXA 5E00B 4KK8C 5DMJB 3QO0B 4Z0XA 4EI5C 4LLYB 4P9HL 3U2IA 2BNQE 3QQNA 5B1AB 4RWYL 1YEJL 2YD7A 1NAKH 2JKWA 4JFEA 4YXKH 1I8KB 2N3JA 3TBYA 3O0LA 3P2TA 1NFDB 2PUQT 4H25A 4PJ9A 4WLCA 3WFBH 1KN2H 4BEIA 4P23A 3T8VA 1QO3B 3RNKA 1SLWA 3CC5A 3QUML 4BCXA 1CN4A 1CIUA 2IANE 4CC4A 2X2UA 3GXTA 3JV6B 2G2RB 1S5IL 2Z4QB 1CFVL 2JTDA 1ZHLB 4UZSA 2X9WA 2F8VA 3L1EA 3GMQA 5CJ5A 3QHTC 3SGKA 4I77L 3DTUB 3O3EA 1KTJA 4XWGL 1RULH 2GIXA 1Z5HA 1WH0A 4LPCA 1I7RB 1UOLA 4OZFB 1ZV2A 3QDGD 3SDCC 3U9PL 3LY6A 3HKFA 2J44A 4NC2B 4AXWB 3HZYB 3MLYH 1A47A 2H26A 1TU2B 5GZOD 5ESVB 3RHWK 1WJ3A 3TEUA 2CLRA 3BCDA 2Y7LA 4KX9A 3FB6B 1CLYL 2VAAB 3ZL1A 4ZYKA 4XXWA 1PZAA 3HG4A 1WZ1L 4UINH 1IC4L 3Q5YA 4ONGL 4K2UL 4XHJC 4KK8D 2NW2B 2A6JB 5D55A 4EI5D 3V4PH 5DJ6A 1UFGA 2BPBA 35C8L 5D93B 3GLDA 1OAYH 1KFGA 4ABQA 5D7LB 5D1XE 1GCFA 5AZEL 1F00I 4FL4B 5C3TA 2RBLA 1T6VN 3OKKB 4X8XA 3VXMB 1SN2A 3BZEB 1P0SE 3DXAE 2Z8SA 5FO2A 5IQNA 4PJGA 4GBXA 3G9VA 2RFXA 4K9EC 4MKTA 3T6VA 5L8JB 4GW5A 3CLEL 4JM0A 2XWDA 2IGFL 3G5YA 3HI5H 4KGLA 1K4CB 1X5ZA 3M17B 1IEBB 1BVZA 3FCTB 4RAHA 3FUJA 3BESR 3V4VB 2DEXX 3DPBA 3SDCD 5BMFH 3CC5B 1FH5H 1A9EB 3EW3B 1ZJBA 4AGNA 4H1LA 1UASA 4NQVB 3EO1A 4PJEE 4GXUM 5ID1B 1ZK9A 1ZTXL 4X80L 3O3EB 4WFFD 1NIAA 2XA8H 1E4JA 3QUXB 3WSQL 4XHJD 3IJ7A 3SYPA 4JFDE 2I9TB 4BQ8A 5I30H 3BYYA 2CJ3A 3N85H 4YDJA 5JQIB 1Q0XH 1XB3A 2IWEA 3W11C 5I17A 4CKQA 4FTVA 4Y4KB 2ZUVA 3KJ4B 2XI9A 3PPEA 3BHBA 2FT6A 3O3AA 4HEMA 1TO4A 1RZJL 2PR9A 3PQYD 1DFXA 5HDQH 2X70A 4KK6C 4MCMA 3OKDA 5MEPB 2DD8H 4I9WD 4JRXA 5IK3A 2R27A 2VMJA 4LSSL 4P2CG 5JR1L 2VSMB 5KJ7E 3WNOA 4MJ5B 3EH5B 1XDTT 4N8PA 2ADFL 1MCJA 2NY5L 2CDGA 2BC4A 2X7LB 4B41A 1QFUL 4NWUH 4NRYA 5B3JE 1X3DA 4BK5C 2XVKA 1N67A 4JZNA 2FUTA 1ET7A 4OQTH 5IBTL 5F9WC 1R3LA 2WBKA 2BVOA 5TQ0L 1PX8A 5FUOL 4KQ4L 1V8HA 2E56A 3TFKD 3QDGB 1FL3A 4JDTH 1KTDB 5HDBF 4UM9D 5FOJA 1MCQA 3CXFA 4QTIL 2FB4L 5E9DB 5C92A 4AEIH 1KCLA 1F45A 3K6NA 3RGVA 1H0DA 3EHBC 5LGHL 1RSFA 2WYZA 4BQBA 3HJEA 1CDJA 2X1XR 3B2DC 4G9FD 3FCUB 2JE8A 3W11D 3MN8A 2HKFH 3IMSA 4FYSA 4F8TA 1JV5A 4KFMA 5CUSL 4EI5B 2X2IA 4GI9A 5LBVA 3FXIC 2W0PA 5GRWA 2VZOA 4OLXL 2BVYA 1QFWH 1CT8B 5KUMA 2XZQL 1F3JA 1XGTB 2ZX9A 3IF1B 3KXFE 2Z8WC 4GO6B 4MA3B 4RAVA 2N7BA 3U46B 2IFFL 4N0UB 3E7JA 2EEFA 1IKFL 1XGUA 5GGUB 1Q72L 4QY8A 2DLHA 4TQHA 4HEPG 1RUQH 2IPTH 2IOMA 2BNRA 3AWGA 2CO6B 1VF5C 3BHBB 4YOKA 3V7AE 1ZV9A 3HC0A 5TDOB 3D0AA 3FTWA 4LGPB 4GIPD 5AVRB 5IV2A 5JPMC 2VN5A 5HHME 3VGGA 1M7XA 4NC1E 1MUJA 2LLLA 3KPRA 3LNIA 3QXVA 4WW2A 4X7TA 4OY9A 1FSKC 1G7LA 1VFAA 1QNIA 4XPFH 3S8WA 4HISA 4RMVA 5IW6B 3HG1A 3O0RH 3P0GB 3R06A 4M4RA 1C5CL 4QLWA 2VXQH 3SDCB 5AKSA 1SF5A 4Y2LA 5AW5B 1IGMH 3SE4C 1LP9E 2BC4B 1X6LA 2VN6A 4JPWH 3VXOB 3B2UC 2TRHA 2CM5A 3EHBD 5HHXL 1D5MA 5L4MA 2EE2A 3PP3K 1V27A 3ROOB 3MV01 1GGUA 3NPSC 3IJ9A 2XC8A 1DCLA 2ADGA 1UKTA 3MMEA 2MPAL 5IB1B 1QSFD 4NZUH 4M03A 4QAWA 1CICC 4R90H 5KS9A 2DV6A 3RGBA 2FEEL 4YSSA 2A7BA 1NQBA 1CK0L 3BP6A 3FHAA 1FVCB 3BZ4A 4HT1L 3BFWA 4KO6A 4YSOA 2ZUQC 4HH9A 4PJAF 5EOTB 5F7EL 3O6MH 3PGDB 4WEUD 4XMLL 3SDAA 1WS7A 1H0DB 1TIUA 5L2JB 4PGCB 2Q3XA 5ISZA 3VI3E 2WIIA 3PQYB 4XOBA 1PMYA 4OCWH 1NFDF 4KZCA 4PPTA 3CMOH 4AGLA 2DRUA 2BP8A 1JK8A 5BZXA 5EO1A 4MAUL 5GJSH 2V7NA 5C0EA 3D34A 5D7IE 3S97C 3JYBA 5IWLC 2JFCA 2EKSA 4XPGH 4NHUA 3WFZA 3WFCH 2H45A 1T66D 2XRAL 3BLBA 3PV7A 3IE9A 3BH9A 4LCVA 4NS0A 3ZL4H 5ADOH 4QY8B 2YARA 3UBGA 3CDZB 2HUEA 1MHPH 3FUHA 3CVDA 5JW3L 4RFOL 2NZ9C 1ANUA 3B2UD 2D3VA 5IV2B 1JFQL 4LHUG 2EJ1A 1Y18A 2WO3B 4XRCA 3IKKA 4PS4L 1U8JA 3SDDC 1FRGH 1K5WA 4UM9B 1IBGH 5D2LE 1T5KA 4P2OC 1UEYA 1CICD 1KFAH 4G3YH 3V8OA 3ASOB 3HG1B 4G8GE 5EDXA 3L5HA 1NMBL 4HS3A 4BZ1L 3HC4L 4XN1A 4XNYL 2GK0B 4G9FB 4R26H 4HUUA 1RZFH 3MLXH 3GZOA 5DO8A 4WF7A 3ZKXC 2XG5B 4PCKA 1A3ZA 3LHAA 2Z0BA 3F58L 2P80D 3PWJB 2WINB 3T0AA 3UCRA 3OAZK 3ARZA 4OT1H 2D0HA 3AQXA 2JKLA 3IXTA 3A6CH 4RRPA 3AC0A 3TX4A 4POYA 5KS9B 1LMKA 4IIQA 3BEVA 2Q7AA 4HWBH 3NFPB 4PHZA 3WS3A 3WNMA 1TTFA 1TTCA 4ONFL 3FTGA 2CBQA 3QFJE 3DUUA 1JGEA 1AR2A 3UH8A 5IJKC 1P7KA 2YKKA 3R1GH 3ARSA 5ISZB 4GAJL 4GUCA 5EUOB 3CZKA 2IAND 2WIIB 4TLSA 4D0DA 2EVHA 1IGYB 4XN2A 2CO3A 5EIQA 3A4EA 1MVUA 2WTOA 1C7TA 1NCGA 2D3NA 5CD5C 2NY6D 3PL6C 2NZ9D 5F9WB 4XMVA 5KW9H 3RURA 1D2OA 4ZMOA 4O9HH 2XV2A 4LE8A 3SDDD 1F1AA 3ESPA 4HG4J 1G9ML 1INQB 4D7BA 3HR5A 1G1YA 1ES0A 3GS7A 3P4NA 4HJGA 1NPNA 3QRBA 1HKLL 3EHBB 3RDTD 1MHEB 4JFYB 5HYQA 3U0WL 3LH2H 2O26U 2NQDA 5JHLH 1NEUA 5DT1H 2VMEA 1MPAL 3G5VB 3NCYS 2QZ5A 3PDGA 4M48L 4MHHI 3SD5A 3TTSA 3QDJA 3AXHA 1PKQA 2I85A 1DQIA 4L3CB 3N42B 3VFTB 5D1XD 1A66A 1BQHA 2VITA 3MGOA 4MJ4A 2Y2TA 3RL2B 2V2TB 4MMYB 4U1IA 3CVIH 1NC2A 3FCGA 1T0NA 4LPWA 4Q6KA 3TGXA 2RA1A 3V5KB 5JPMB 2VJ0A 5KANG 5DEFB 4ATWA 4DKAA 5L2KE 2OS7A 3TIEA 3BWUC 2WN3A 5DMKB 3F01A 5E8PA 5CD5D 4OIAA 3PL6D 1FSKB 4P2OA 3WS3B 3I50L 5FX3A 4Y2NA 3ZW3A 4OI9A 2BOBB 2OJ1A 2HYMA 3MXVL 4TM9A 3UGXA 4WSKA 1ADWA 1H3VA 2IWKA 4HLEA 3AY4A 4NLHA 4PB9H 4RGNC 4U49A 5T8IA 3BO8B 1ZSDA 2ZCLH 4QLRA 3NPSB 2QGEA 4Y2DD 5CN1A 2WQAA 4QOKD 1CLZH 5TDNA 3JWOL 5E0QA 4LBAA 5E1AA 1QZNA 1CICB 3GXDA 2EYSA 3TL5A 3UZQB 4Z5RB 3DHPA 4XO4A 5GS2D 5DK2B 2ENQA 3LHPL 1DFBH 2JI1A 5A7BA 4JFDD 2ZUQB 3RPIB 2NSQA 1GYVA 2YAOA 1VADA 1I7UA 4TVPH 1VDGA 3QHFH 1KYAA 2ICWJ 1KENL 2VDNL 4U1LA 3MUZ1 4AMWA 4HMCA 3BJ91 1JK9B 2P5WA 4GQ9L 1Q0EA 2SODB 2X88A 4KTDH 1C16A 3DHUA 3QQ3B 2XSKA 3OJ2C 4RAUB 1KWGA 1TKWB 5FR3A 3RY4A 5B7EA 2IGTA 3QQ9C 4J39A 3SBWC 4X2UA 1PKQB 3PXJA 4A2GA 4M00A 3MV7A 1QPXA 3MRNA 1BWMA 4E2OA 4XGZB 3MJ9L 5HPOA 2IANB 3CVHA 5FYKE 1BIIB 2CGRH 1AP2B 2MRYA 1T20A 4HVBA 1OSZA 2DMHA 3BUIA 2A6IB 3OZKA 2WXGA 3MR9A 1FPTH 3OVUB 4J7RA 1YECH 3SDDB 2A9ML 4A39A 2OTUA 4R84A 3GPEA 3D39B 1KBPA 3ZY7A 3JTSB 4P2OB 1KLGB 1KXVA 4ZQTA 4ERSH 3LKPB 5C6PB 2X41A 5KVFL 5J57B 4JJ5B 3OF6A 3ZKXB 5FF6A 2WSKA 1LWHA 1X5LA 5D1ZC 1I3VA 3SZ6A 1IM9B 2ATPB 4PWFA 5DQ9A 1IB5A 2EEAA 4I1PA 2OX5A 2PN5A 3AXLA 2WZ0A 4FNUA 4XAWH 3ASWA 5GSVB 3HEIB 3D69A 5IY5B 3LDBC 5CJQL 3KXFD 2BY2A 2NOYA 4KTEH 1J05B 4KH9A 5HPMA 3OGCA 4UIMB 1QLFB 5CWSB 1E4XL 4BCZA 2AABH 5DD0H 5J6HB 5A2AA 1DO5A 4OFQA 2ED9A 3SQBA 4OFIA 1YJDH 5T5FH 1FZJA 1QSEE 1C16B 5TH2B 2PWEA 3Q13A 4LDEB 3FQWB 2M26A 4TXVB 3PL6B 2M83A 5FHAH 4JPSA 3ZX1A 2HSIA 2PTVA 1U21A 2Y5TB 3MUUA 1UXLA 5FYJE 5D72H 3HI1B 3LH8A 5HYIA 1TJIH 4KNUA 4PJCE 4JGMA 2J6WA 3CHQA 3WS6C 2CRMA 3UPRB 1Z9PA 4L5FH 1X5GA 5FO9A 4ODHL 1EEZA 3CVHB 5BOJA 1KPUA 4LOVA 1TMCB 2ZP9A 1NLDL 4QOKB 1SDYA 1KCUL 1U8HB 1ETZB 3HTLX 3KL0A 3LIZL 3KLKA 3VTMA 4WEMB 4DKFL 1RXLA 4RMSA 4JFDB 4ISVA 1HNYA 3BT2L 4LSPH 3IS0X 3SBWA 4ESKA 2G0KA 4G7RB 3ULAB 5G4OA 1KXQE 1ZIBA 3IDXL 3MO1A 2Y07L 4G1MA 2I60H 1WP6A 2OTWB 1JNHB 3L2LA 3K6FA 3C5XA 5EU6D 3ZYJA 5IJBC 4KKAC 4WZ9A 1AHMA 1Z9SA 5HDOA 4UU9A 2CNZA 1PU0A 3T65A 1PD6A 4G72B 5EUOF 5C0RL 5JIQA 4NNXA 2XT1B 3IFPA 4ODSH 1XSIA 3VRJB 4BFNA 5B39G 2TAAA 2R23A 2Y36L 2Y9RT 3QUYC 4WTZA 4LCWE 4J3UA 2WBWB 4CMMA 1NBZA 2K45A 4QEGA 4RGNB 4GO9A 1KWKA 1P7QA 3L95A 1WT5A 1FO0A 1HH6B 1USZA 4N5ED 3X1FA 1WZLA 4A55A 3PP4H 2JKTM 3UJIL 1K8IB 5FB8A 2Y22A 4M7KH 4N22A 5FGSA 2OMWA 1RJYA 2F7IA 2VZSA 4K0OA 1CR9L 1ZXQA 4Z7VE 1MVFA 4G8GD 2ZKHH 2X89A 3FHEA 5FO9B 4QHNA 4KJPD 3DX9B 5AEAA 4NO0D 5CEZE 1O75A 4CSPA 1UWGH 1CG9A 4HKBB 1GH7A 1RK0B 2ICWI 4R7LA 1ROCA 4DFIA 4EZJA 2K4WA 1PY9A 2G4EA 3CDYA 5CJOH 2YGOA 3H85A 4YS4A 4EKXA 3KEDA 3QR0A 3EJPA 2VYRE 2P7TB 3PXLA 1G7PA 3VXNB 4ZFFA 2LW3A 4JN2A 3IETB 3CSFA 1F1DA 2H6PB 5EEXA 3MRCA 4YK4C 4DGIL 4HWNA 5D71L 1P1VA 2H41A 3DPDA 5E99H 2E76C 3E1F1 3QUYD 1ZLDA 3E9TA 1I9IH 1F2QA 4ATTA 1FIEA 1TENA 1IU1A 3MNDA 4HZLA 4KDWA 4NENB 4H88L 1XGPB 3N5AA 5EZOH 4ZD3L 3RJQB 4H0HB 4O02B 4DSYA 3FO9A 5GISL 3Q5TA 1SXBA 2D7TL 3DX3A 1H9VA 3QUGA 1T0MA 2CKBA 4N0CC 3BUBA 1NC4D 1MLBB 3FUDA 4TN9A 12E8L 3UGUA 3PAUA 2VUKA 2ED8A 3GIZL 5H37H 1MREH 3BH8B 5IMKA 3RVWC 5C0BE 5E2WL 3P0YL 3P0VH 1R3JA 3QGVA 4FKHA 4CMMB 4EZMA 1YYCA 2XXFA 3FFOA 1T21A 1HXMA 4C54A 3L95B 5IMMB 1FO0B 2AQ2A 3APFA 5D1ZB 3MNWB 1JIBA 1NMAH 1RY7B 4HQQL 5AW8B 1T04A 2VR6A 2OMUA 2Y7QB 1RFDL 1J1PH 2OMWB 3OC5A 3VUAA 3GRWA 3O11B 4NQCE 3LDBB 2YPVA 1URIA 5E03A 2AQPA 3B9AA 4JM4H 3CZGA 4M3JA 5EU6B 1OP5H 1R34A 3U6XS 5CJXC 1U30A 3I6LD 3IB4A 3VXTB 4DZ8B 2YMXH 4DGVL 2AMGA 4NKIH 5CCJA 1Y07A 1WC7B 1WAAA 4Y4FA 3D48R 5GRYA 5L2KD 1FFTB 5BXFB 5JYLA 5HHVH 1BBDL 2Y25A 1G7PB 2DQFB 4O5LL 1J1OH 3QUHA 4H8PA 1DL7H 4GKNA 4JN2B 1JGVH 1Q9KB 4FEMA 1AIZA 3GK8L 3VG0H 1ZEAL 4N0CD 3WN6A 4Y1AB 3TLRA 1TEYA 3H7BB 3RVWD 1RCYA 3CFQA 2G5UA 3FPYA 4LOUC 1G9HA 1JXKA 1RMFL 1WHPA 1XH3B 3UZVA 4F7PB 1EX0A 5EWIH 4HIHA 1PD1A 5K9QG 5F6HJ 3W39A 1N6UA 4PIRF 3RWIA 3KPQA 3VQ1C 2BSDA 4NO5A 1JNJA 4HWEL 3JV4A 5H94B 3QIBC 4UYQA 3EGDA 3LRSB 3CXDL 5TTRA 3C2AL 2KC0A 1Z66A 4NO0B 1WTGT 1OD7A 1SPDA 3A67L 1R3JB 2KHAA 4WI7A 1ZHBB 4YMPA 1K8DB 1T21B 2W60A 2J4WL 2QEJA 5C07D 1LDSA 4N8VA 5KN5B 5DA4A 3VA2C 5I28A 4WEEA 2JB5L 4DW2H 3MV8A 2HLFC 4K23L 3EDEA 1D6EA 1IAKA 5FFOA 2X6MA 4NO2B 3IGAB 3RILA 3ARWA 5HYEA 2H1PL 3QC6X 4JDZA 3T0BA 2HP4A 4HF5H 4P57B 5HJGA 3TBTB 1MAJA 4MDJA 3HR6A 2O5ZL 3QUYB 5FYKD 7PAZA 5DYOA 3IDGA 3QEUB 3MFGB 3FO2B 5B7FA 1V10A 4YR6B 4K94L 4ZSOA 4Z7OE 2DQIH 4LOUD 5FDWB 4OFDA 1NCDH 4LNVA 4W70A 4QO1B 4TQPA 3V8CA 3K2IA 1KXTA 4YBQC 5C2UB 3RTQC 5ACLA 5JW4M 2LABA 2A9CA 1NC4B 1WRFA 4B7IA 1E4KA 4OJDH 3D08A 3GUTB 2P48B 2V2XB 4LVEA 4OF5A 3V6OE 3BD5A 3QIBD 1MWAA 1AGCA 2G3XA 3BSZH 2G60H 4FZ8L 2MH4A 3W1ZA 3T2NH 1KGIA 4MJIE 1E9OB 3RVVC 4DQAA 1JXDA 4JK0D 3EDJA 3DTXB 4R6UA 1K4DA 1H8LA 1DVTA 4M1DH 3L7EB 2IH3A 3O8XD 2FIKA 4LOEA 3DRQB 3FUEA 2X40A 4WU7A 3WIHA 3ZQWA 2BRQA 3U4EB 3WENA 1SMOA 4K3JL 5EIIA 2C1PA 3FQUB 3RWIB 5LCVL 5I1JL 1XCWA 3BRDA 2V9QA 3JV4B 1HSAA 2WWNA 3DX7B 3RTLA 2EIMB 1ZJAA 3H42L 4K4KA 2EVGA 4Z7WE 3WTTA 2JCCA 2DW5A 2G2PA 4XP1L 4YK4B 1XF3B 2MSPA 4N8CH 5I8OH 3VQLA 1Z0MA 3BWUF 1UM6L 3ZXAC 4B0MM 4UMGA 4ODBD 3EG9B 1E6JH 4GXVL 3L6FA 2RCSH 1E2VA 3KM1A 4YGVA 5DUBB 1A0QH 3C08H 5L2KB 2NTSP 1VFOA 4X9IA 3FTSA 5TE7H 3MV8B 4XNUL 3UBXG 1QLEH 2VW4A 1LEGB 5FYJD 1KJ3L 4IBLT 1E8XA 2O30A 4YBQD 3RTQD 3RVUC 1OCWH 4L8SC 3MRMA 2TSBA 4PG2C 5HDLA 1SN0A 1WEJL 4PG9A 1TTRA 3G6DL 4AW4A 4YIQA 5I1KH 1WGVA 3UROR 1KCSH 3L5XL 1E90A 3RVVD 5IOPA 2DM7A 2XFGB 1UWYA 3CQPA 4FOMA 4ZTOH 5ETUB 2PR4L 2ESVD 3ZN6A 2UYLA 1RJZB 3CQFA 1KXTB 1OAKH 5I76A 4NERA 3V7AG 4EUPH 1A6WL 2NR6C 2VB5A 1DVXA 4X4YA 5FCUH 3QW9A 3TZVA 4OFYA 2OXHB 5DK3A 1CFQB 3UTQA 5EZLA 4XWOC 3EO9L 2K8MA 5C07B 1U8QB 5EBLB 4JO4L 3F7QA 4FFYL 3KYKL 3CU7A 1WCBA 4L9LA 2FIKB 4X9BA 4HWZB 5JOPD 5IQ9A 4R7DA 1YPZA 3QJFB 3VFOA 1ED3A 1OWWA 1LL1A 4NZRH 4DK6A 1YY8B 2DQDH 2ZUWA 2Z3FA 1G0XA 4LU5H 4J3OH 4PGBB 2NX5D 2IMMA 2JCCB 4M3KB 4XNQA 1GGTA 2W5PA 5A16B 3T3PE 3RVUD 4JBSA 5MENE 4LCWD 3EAKA 3FRUA 4UILL 3ILPB 4H26B 3STLB 5HHOB 2VDPH 3EYVB 4DVBB 1JTPA 1P5VA 3RWCB 4YGVB 4TUJB 3DOSA 1ASQA 1BZ7A 2PYEA 2WLNA 3U0PB 2R0KL 2Y5EA 5GZNC 4B27A 4IU3B 3OKOB 2VR8A 3GBML 2EIEA 2O5YL 3KE0A 1CO1A 3E6FB 3QIBB 5EU5B 5IVZB 5F6HI 3RWJB 2WK2A 2Z7YA 3UX9B 4XAKE 1W6WA 3WGUB 2P52A 2QZQA 1MJJB 2NR6D 4K3DH 4POUB 4K7FA 5CEZD 4N2HA 5AQ0A 3QDME 2YUWA 3HZKB 1T1ZB 3N40F 4YHYC 1ACYH 2X4NA 1J8RA 3HAEB 1DBAH 4MA8H 1RZ7H 2CALA 2SEBB 4L0PB 4XWOD 3VQ2C 4WUKL 4AQEA 4DAGH 1BZEA 3OJDA 1N70A 1H3PH 5A2FA 5KSUA 2C26A 5I1CH 1BFVL 2JJUA 4PRNB 2XBZA 3VXSA 1U3HA 4A63A 3KPNA 3CFMA 1JFHA 4Z6AT 3APMA 2X4UA 1K5NA 3B2VL 4ZTPL 1ZT1A 3UTQB 1B0RB 3LN4A 1ICTA 1ZCRA 3BEWA 3RZCC 1BEYL 2OL3A 3VQMA 1MCRA 4KXBA 1WBYB 1ZVSB 2AXGB 5CCGE 5DUPH 5LVEA 2ARJQ 5IQ9B 3GF8A 1MFAL 1RK1B 4R7DB 5E2UH 4YWGH 5JUEH 4OCMC 3RTQB 1ED3B 3RKDC 4U1GC 4XNXL 5CEYB 5GZND 2Q5BA 3B9KC 4LL1A 4EVNA 1RIVL 3RLSA 2AV1B 2XWRA 3AUVA 4HLJA 2JF1A 2VDLL 1L9NA 3H9YA 4LAJH 5EORL 5C0BD 5KSBE 2QDWA 4FP8L 1IFRA 1JWSB 2BW5A 2C5DC 5IT2H 5F1NA 2CO2A 2X0WA 2ESVB 1ZLVK 1P6AB 2E86A 2FJHA 5FV2A 1A7QL 4W9JC 1V3KA 5GHWH 4P04A 5HGBB 2XV3A 1AHWA 1HCYA 1DUZA 4FMFA 4AYFA 3GDBA 4R4BA 1BGXH 1YEFH 2XA3A 3ARGC 4JN1H 2YOAA 4QXTB 4K7FB 4MWFB 4DVRH 3VWJC 5AOMA 2GCYA 4POZC 3RZCD 2ZSWA 5H37G 1HC1A 2O4EA 4MZIA 1TEFA 4JPKH 1CCZA 1AXSB 4MXWL 5DA0B 4DZBA 4IBVA 4FQXA 2C3WA 5TJWK 1MFCH 4MNHB 3QIWC 1ZPLA 2ADJA 5I1IH 4GFTB 4FQ2H 2FECL 3VFMB 1R6VA 2NX5B 3PXHA 5E4AA 2J5WA 2B39A 3RKDD 4L8SB 1VKXA 4HC1A 2EDWA 2J43A 1WAEA 1OAQH 4MDIA 5CLWA 2Q6WB 3B8SA 3QEHA 5SV3A 3G6JA 5EDSA 3VMPA 4JMXA 3SKJL 5HJ3B 2PPEA 4KJQD 1ZLUK 3IRPX 1MEXL 2CLZA 4LO9A 2NY7L 5B1JC 2FO8A 4I4WA 5K69A 3F04A 2Z8RA 4R96A 3ZTJH 4IOFC 5IKCB 1RUPH 2AVGA 3GRBA 1GYWA 4WW1A 2BP0A 4LF3B 3I9AA 2Y1ZA 4QI3A 5CZXC 5DRWA 5IB5A 1B2WH 2HPOA 4EVNB 5LN8A 3QORC 2NW3B 1MIEL 3ZZLA 3KPSA 4ZOAA 3O45B 3QNYA 1AZCA 3EOYG 1J48A 3ARGD 2DLFH 1AZUA 2UV3A 4XP6H 2R0WL 1HH9A 2ZYIA 3KLSA 4LEOA 3HNVL 4MMZC 2X6VA 1FAIH 2GEQA 2XTJC 2YQBA 3ZRSA 4WY7L 4HS6A 4U7KA 4DQOL 1L5GA 1GRWA 3EDFA 5E4OA 3KD4A 2GEEA 5C0AA 1MSPA 3B9KA 4JHAL 5KZCB 2RJMA 1JZJA 4PREA 3FO0L 2BNUA 3IKCB 4KNQA 2WKOF 5CD3A 4N1EA 4OD2B 4PP2B 2XYBA 2A83A 1QMUA 2WZAA 2Q2EB 4X4ZA 2ZSWB 1XB8A 1UCBL 1ZANL 3CHPA 5IVXB 4YAQA 4M6NH 3C6LC 1XZ0A 2DDQH 1ZTXE 3LJ3A 2VL5A 1JZDC 3AQDA 4RIRB 2ITDA 1I3RB 1T7WA 4L4TA 3EF7A 3ISYA 2ADJB 1S9XA 2ZCZA 3ESNA 1XV8A 1SYVA 1DQMH 4IOFD 3AITA 4WSJA 4WVRA 5DD5L 1S9WB 5C0BB 1IAOA 2EKJA 3V5HB 4GUOA 2OSWA 3QORD 4TSCL 2ZPKH 4TSBL 4YHYB 2MHAB 2G5RA 3DVNB 1I4FA 1Q9WA 3FUIA 1U41A 3LKQA 3P11H 4R96B 4UANA 1FV1A 3IFNL 4JEGB 2XTJD 3B3IB 3HZVB 3LSOA 4WW1B 3ZE0E 4BKLA 3OAYK 4HS8H 4LEXH 4ZFQA 3SOBH 3VX0A 3EGXB 3AU1B 3KS0H 2XPYA 1BXVA 4R8WL 3C12A 5JW4R 1WO2A 3RZCB 1WFJA 1MCEA 2APBA 4O51A 2GPZA 3VFSB 4EDXB 5BS0E 2QLVB 4S1SL 4L8BA 1BAFL 2FVNA 1LDPL 3UO1L 5ESAB 2JCCF 4BWTA 3KGUA 2WXIA 1OARH 1QQDA 5AZ2H 3QK0A 5F7HA 1OZUA 3DX1A 3C6LD 1KBGH 3C60D 4JR9L 3ULUL 4U1GB 3MLUL 3L3OA 1KBVA 1XL4A 2LU7A 3B9KB 4OGAC 2ZOKA 4N2FA 3GJEB 3S5YA 4F2MA 4HEPA 3UC0H 3FF7A 3ZYOA 4U3SB 4JHWL 2Q86B 1II4E 1WFTA 3K2UH 3VSQA 4KUCF 3VI4A 1U8LA 1YMMA 4UT9H 5EULV 2WUCH 3AQZA 5BQ7B 2CCVA 3VGDA 5D7KD 3VNZA 2F58L 4EI6B 2H2SC 4X6FB 1J8HE 1CXLA 4JLRA 3BWSA 2DQGL 1JPGA 3QZMA 4GLRI 3GSXB 3K8LA 4OD1L 1KIQA 4HUXA 4IKJA 3F7YB 3FQRA 3HE6A 3P2DA 4AIEA 1DBJH 1B0GB 4KROD 4XP9H 1S7VB 5HDWA 3ARGB 2V5TA 5EO0A 1SMAA 4XCEB 1XGQA 1XD1A 2EDLA 3CTTA 4JG0H 3BVWA 4PRDB 3IYLW 4WI6A 3S5LG 2L0DA 3VWJB 3VSTA 3IE4A 2E6QA 2A9NH 5EFIA 3C75A 3PHOB 4N1HB 1JYXA 3DKHA 4TKWA 1I4FB 5ICYA 4NQDA 3B34A 2R7EA 1M05B 1IVLA 2V3DA 1EDHA 1FV1B 2BJML 3QIWB 3MROB 3FSZA 3BFOA 3E38A 2VERA 4HFUH 4UT6A 3QA3B 4PH8A 1U42A 2WXNA 3WY2A 1UWEL 4KKQA 1NJ9A 4OGAD 2NNAA 3LPOA 4M93C 4EIGB 3APNA 5C0DA 1AIFA 1WBZA 1J9CT 4EUPG 2CPUA 1NOLA 2PP7A 4O51B 2GBAA 2J8UA 5JW4Q 4PW3A 3RY5A 4DP8X 1PG7W 2OXGA 2NY4C 5T1LA 2WNKA 2P5PA 1IL1B 4JQVC 4ICWA 3LS4H 2H2SD 3LIUA 2ZG3A 3TV8A 5MI0C 1OE1A 4JPVL 3JZYA 1BVKB 4JY6B 1HHHB 2VISB 3QRGL 1ADQH 4OFPA 3E8UL 5F1IA 4EBQL 3ZDYB 3QORB 3QJRB 1UG9A 2HX9A 1BZDA 1A02N 1QVOA 3QI9C 4UTBH 4ZBJA 4LHUA 3MLTA 3OZ9H 3VI4B 4S1QH 5CKGA 4MMZB 4KVNL 1Y6NR 5LAXB 4OF8A 3CN1A 3BKML 3EZ8A 2DQMA 3L13A 4OV6F 2XTJB 2BRRH 5EZPA 4CNIB 3V52L 3OAZH 3FUMA 3T04D 2OMZA 3K0WA 4RX4A 5AW0B 1U8PA 1YYLL 3OTTA 1PIFA 1ONQB 1P69B 2EIJB 4JFOB 1VZIA 1TT6A 1ULVA 2GBUA 1KDIA 1F02I 4NNPL 2DM3A 1PS3A 2FX9H 4FA8A 2ITCB 4O2CA 3AGVA 4KKZA 4KAQL 1GA2A 1F4YH 1JP5A 5ID0A 5CLYA 1TCRB 2YGNA 3KWUA 2P5ED 1ZLWK 43CAA 4F8NA 5IFHH 1MRFL 2NNFA 1DJZA 3C6LB 5KVGH 4NIYE 3GRWL 4NO3B 1OAXH 2YPVL 1VGEL 3A6BL 1JHKH 3CFDB 2HFGL 1HYRC 1UXWA 4C56E 2I5YL 5JIMA 1HK6A 5KSAA 25C8H 4GAGL 4IM8A 1YQVH 2IGLA 3UYPB 3DYOA 3R18A 4ZX3A 4WNQA 4WHDA 4ZO7A 5AOLA 3X3FL 2DMGA 4I8DA 1JF1A 2OSYA 4KKBC 1JERA 4PJDA 3QI9D 2J8UB 3V0HA 3WDJA 2DIAA 4P9HH 2OXGB 3NZHL 4RWYH 1YEJH 1YUHA 1C12B 2HRPL 3DETC 4OUOA 4ZMVA 5IQ7L 5EF2A 4KITB 5IBUG 5AL8A 4ZNCD 1MDAA 4N2IA 5DU7A 1OPGL 2ZWSA 3P4OA 2CJUH 1A1NA 3VGEA 3LEVL 3DBXB 5DR5L 3GSNH 1KT2B 2A1WL 5HD8C 3FYIB 4RVBA 5L4FA 4HCFA 4BINA 4AH2B 3QUMH 5JQ6L 1DEEA 1IBZA 2NXZD 2Z35A 4HUKB 1S5IH 1B4LA 3GD1C 3LV3B 3MLTB 4MA7L 1CFVH 1UD4A 1SYSB 2X5PA 3IJYA 1UXSA 3MNVA 4XNDA 2D3JA 4G6ML 1IBFA 4I77H 2C7UB 3QHZL 4W9FC 4FQPA 4JQVA 4XWGH 5DZAA 3O2WH 4KFZC 2ENSA 4O00A 3LKRA 4CVXA 1EANA 5IESL 5F7DB 3B6SA 3Q05A 4NIKB 2Z7ZA 1CL7I 4G5ZL 5IVXF 3T2OA 5D7HA 4U1JB 4Z3TA 2BVQA 4HX1B 5J4MA 1DJGA 1JUFA 3ET9F 2VLKE 5F7MC 4AJ0A 1CLYH 2XWBA 3GBNL 4YHML 5GZOA 1FORL 2I07B 1WZ1H 2F5BL 3RPKA 1MH5A 2JIXD 1IC4H 3RIAF 4ONGH 3CZFB 4QGYA 5ILTL 2E8YA 3P4LA 3O6LL 3DNKA 2R0ZL 4K2UH 3P4MA 4KKBD 3VFVB 3QFGA 2CHXA 5D1QA 3FFDA 4W9KC 1AZBA 3DETD 3WGVB 35C8H 2UY6B 1BX2B 1M9SA 1SVZA 2FHFA 1CB4A 4F33B 1E3ZA 1I7TA 3FB5B 5B7MA 5AZEH 3NJGA 4AJWA 5HD8D 3OKMA 5IBLC 4X5LA 1UQSB 1BQSA 3KBFA 4YSUA 5J9PA 4PVLA 4LARL 5IHUH 4JFQB 4GG6A 3GMPB 1S9YB 1UWXK 1QFOA 4KZ0A 3CLEH 1KV3A 4M9PA 2IGFH 4GT0A 5ABAA 4LVHC 1TYJA 3P4OB 4JFHD 4Q0XL 1NGZB 3K91A 32C2B 4MNQB 4UQCA 1D2PA 3AWFA 3KWWB 5JA8B 1RHHB 5BRZA 3S37X 4M93B 2PPDA 1L0PA 2Y7SA 4HD5A 2P5EB 4QRPD 5BOZG 4L37B 1F6AB 4WI0B 2G5BA 2MTPA 5FO8A 3FTVA 3TPUA 3BVNA 2RACA 5JORA 5BZWA 1UXSB 2EACA 2LTQC 3MNVB 2PPFA 4F58L 3SCMC 2NY4B 3BPOC 1KJ2L 2F74A 1ZTXH 1AXIB 4N90E 4RDBA 5AVWB 4MQ7B 3W0WD 1DVFA 1N3NA 3O4LE 5MI0B 1IUZA 4U3CA 4P5TC 4XVJL 4PRPE 4AZ8A 2J25A 3LZRA 1L7IL 1EAPA 3IVKB 3V0AC 2W9DH 5LHDA 1S7RA 3KG5A 3QI9B 3VRLE 2QKIA 2V2WA 2GTWA 1RZJH 2FEDC 3FUKA 5IBLD 5DI8A 3IS1X 1GKOA 2DQCL 3EIFA 1SEBA 4Z7UB 2K6ZA 1SF3A 2R56L 4LSSH 3FFDB 5JR1H 3CX2A 3SPCA 3H7LA 1HXYA 4XZUB 3V4PB 1OP9A 1DQJA 4WUUD 1WPCA 4JFZH 1QFUH 5I6PA 2VW6A 4NQSB 5BS0D 5F70A 5E2JA 1P2CB 4M56A 4KO7A 5IBTH 1HYSC 3EUUA 1EFQA 2VNCA 1DQQA 3HPJA 4KQ4H 5FUOH 4YHZL 5JHDD 5IG7B 1I8MA 3F7RA 4OQTA 2B1AL 1KPVB 4UWQB 4XX1E 4YXHH 1JZ5A 1OWRM 4ACTA 1HSBB 1WZMA 1LEKB 2BY1A 2FB4H 3QJZA 4V1DA 4BGLA 5IHHA 1IAII 3FSAA 5EUKA 5KVFE 4DH2A 2OI9C 4KZDL 4P5TD 5DHMC 1DJSA 4PP1C 4Y19D 1NUNB 3BP4A 3QZBA 3FT1A 5J5EA 2DQEL 2DTMH 3BVNB 4ALAL 3VH8B 3HJ0A 3Q1SL 4NXSA 4HCGA 5CUSH 3BUDA 3ZDYF 2FEDD 3ASNB 1GS8A 4OLXH 5JZ7C 4W9GC 4HOWA 2HVKB 3LNEA 4FN0A 2XZQH 3ZZQA 1NGWB 4J5VA 3ETBF 4KXDA 2IFFH 2VUYA 5IJVA 3L48A 1IKFH 4HH8A 1LLAA 1AQMA 4WO0A 4UOJA 5C0NC 5IIEA 1Q72H 1EAPB 1UKQA 1PZ3A 1S7RB 1W0WA 3DO7A 2HVJB 5D7JC 4XPAL 3RB7A 3GMOB 3S3DB 4D0CB 4PBVC 4N9GA 3WFHA 3WXWL 3GIVB 1W16A 3IMTA 1WICA 3CD4A 5J3HC 4OZHA 3TNNA 4N6RA 4A6YB 3VE0A 2P28B 4MD5B 3WLBB 1HYSD 3RWHB 2EYRB 3VD0A 1C5CH 1FC2D 2H5UA 1E28A 4PD4J 4YEEA 1UADC 2J3SA 4AJYV 5FFGA 4QRPB 1NWPA 2XG4A 3GMLA 1KELH 5FAAA 2F54D 1UATA 1S8DB 4PP1D 2ED6A 1IEAB 2ALAA 3CBJB 3DRTB 3W0WB 2PYFB 4L0ZA 3QCUL 3B7SA 2OBGA 2HTLC 2ZP0T 5E51A 1MCNA 3HLAA 4PJFB 1AGDB 1CK0H 5B38B 1R5WA 4HT1H 2QPSA 5B39A 4Q2ZA 1QSFA 5BUAA 2C3VB 2FYYA 2GY5A 5F7EH 2UZYA 3ZKND 2J8UF 4AQ1A 4XMLH 5PCYA 4F7CA 4MQXD 1UUNA 1U95A 5KBMA 5IHZB 1FVEB 3ARFA 4ZUUA 3ZKMC 4GUPA 2RAMA 4QTHB 5CGTA 3F00A 5T3ZE 1A3RH 3L3KA 1CDYA 4YZFF 2QQKL 4JPIB 4M43L 4MAUH 5D7JD 4ZFOA 5D5MB 1INEH 3SYOA 4CBZA 2WMPB 3CU1A 4LVHB 5J3HD 4PR5A 3P9MA 3KPMB 4ZPTA 3GBEA 4WUUB 5F7WC 2XRAH 1ZT4A 4JY5H 1SXZA 5EEUA 5E5LA 1EHLL 4MNGE 4HKZA 3X13B 3GZKA 1VRSA 5JW3H 4QRBA 3GI9L 4QHMB 4RFOH 3KCPB 3VFNA 1JFQH 2UZIL 2LTQB 5JHDB 4UV7L 3SCMB 4PS4H 3BPOB 4X6DE 4JRYA 5EPMB 3QB7C 3CFCL 1WYJA 4KV5F 5JO5A 4KK9C 1MFUA 2AI0L 4P5TB 3FQ2A 4M5TA 3UAJA 3VXUA 5D70L 4Y19B 1MHHB 2R39A 3HC4H 3MNMA 4WEBL 4BFGA 4BZ1H 2H8PB 1NM9A 1TZ8A 1I1AD 4P5MB 1MCBA 5CFAA 3I74A 3H9HB 4OJYA 4BFRA 1S7UB 1QA9A 2F0CA 3X11B 2J57A 1J7VR 5D9SA 3IM1A 4AE1A 1ZE3H 2RHEA 2D7MA 5C09A 3WY3A 1BFSA 1Z9NA 1JZEA 5C9JB 5DZPA 2BNQA 4HC1L 1HL9A 4J4PD 4ONFH 1R0AL 2B15A 2FAUA 5CSZA 2ZIDA 3S35X 1N64H 3DK2A 2XWEA 4PMFA 1U95B 2CXGA 4GAJH 4EIBA 4IS6A 2X4SA 5DD3H 4ZUUB 1PD0A 3LXCA 1YCSA 2LVEA 3UTTE 4KX7A 4FQIL 2VDQL 1BIHA 4P59L 1CS6A 5IROC 3DHMA 4LBEA 3D87B 5C0IB 4E68A 1ZGLA 1FBIL 5EO9A 3VAEA 4M8QA 4NBXB 3DO4A 1G9MH 2IALA 4GNKB 3DECA 3CN4A 3H1ZA 4U7MA 2E47A 4CRPA 3T1FA 1T1WB 1HKLH 1IC7L 2F54B 4KK9D 2OI9B 3LB6C 3SDYL 2KLRA 1NCJA 2HJKA 1L0YA 1MQKL 1YZZA 4OF7A 4Y2OA 5ACZA 3MOBL 1UD8A 2P8LB 3GSVB 4FXTA 2BSTB 3RDTA 1MPAH 5EHFA 4OKDA 1AO7D 3PHQB 5JHLA 5DF0A 1NEPA 1OF2A 3FFCA 2W81C 3U0TA 3D07A 3EYQC 1W80A 3MUY1 2G4GA 1CGUA 4AG4H 2XWXA 1SDDB 1QI3A 1RJLB 3OHXC 3DV4A 4Z7UF 2P42B 5DEZA 3LH9A 5AAMC 2AJ3A 3UDWC 1CXIA 2JB6A 4FERA 3G08A 5D1XA 3CFKA 5HYSB 5CMAB 5FKPB 2XBTA 3BVVA 3LRMA 5D7JB 1B6UA 4NKMB 4U6VL 1W72H 5AYQA 5M94B 1NUGA 2CUAA 5C09B 4KNTA 2PW1B 3PIQA 3DXAA 2C4FU 1BVLA 4OZGB 3I50H 3AS3A 1DSFL 5IROD 5MEOA 1I1FB 4HKXB 5IW1B 3WEXB 2CSPA 4JGUA 1G0YR 2Q0ZX 4M61B 4WHYH 5CSZB 3MLWL 2B4CL 1TYEB 2X4SB 1KNOB 4HOXA 3LB6D 5F3HB 1PX3A 3C6EA 4N26A 2YEQA 1KB9K 5EC1B 3AZUA 4YSEA 4ILDA 3LKSB 1T22B 4PY8J 5T5NG 4N90D 4EN3C 4Y2DA 5F2FA 3LHPH 1S5HA 4PJEA 3ALPA 1S7WB 5ANME 1ZGLB 5E8EB 3FYEB 3Q2NA 4F5CE 1P4LA 2XLLA 3ECBB 1PY0A 2FJGB 1KENH 2VDNH 2WSPA 4OZIE 3IJ8A 5D7SL 2R83A 2ADYA 2XETA 4GQ9H 1MCFA 3PWNA 3K80A 3O3DA 5GS0L 1U3JA 5I23A 3RIFK 1FVDB 3DV6A 2WAHA 5E8DL 2FGWL 5B4MC 2ZONA 2IV8A 1BXXA 1R3HA 2FZ3B 4IK6A 2QELA 4X5RA 4XMPL 5IEKB 4QHLA 5J56B 2G9HA 3JVGA 3PWPB 3QNXB 4H8WL 3ZRFC 2CXKA 4XB7A 3WJJC 2HT3C 3NESA 2X53A 3MJ9H 2Q2LA 3GJFB 3PWUB 4FQLL 4Y5YC 4JFWA 2AJ3B 3I9PA 1BXAA 1X5JA 2J21A 1X4XA 3IDYC 1LE5A 2DS4A 4WK0B 1J9QA 3ZHLA 3CFUA 3OB8A 3WMPA 2BY3A 3Q8EA 3VRIA 1DUYB 4LOFA 5HGDA 5FK9B 1H15B 3Q48A 4W9ZA 2EUWA 3JWNE 2HLEB 4IOSD 2FT8A 5FPIA 5J89A 3HG3A 2YAHA 1AC0A 1LO2L 8CGTA 5C6TL 2BOLA 3NGBC 3S6CA 1BHGA 5C08D 1UZ6E 1PZ5B 3FTZA 3Q6FA 1OD9A 4KO5A 3WE6B 5KVFH 5CCHE 2QPFA 4PJFF 5E4IA 4BZ2L 2WLIB 4J6RH 3MRJB 1AO7B 1BQKA 4N3TA 5FUCC 4Z76A 1DZBA 2J1ZA 3UBXA 1HZLA 1AJ7L 5MHSE 1AD9A 4JHVA 1PL3A 4HHAB 4YNYA 2MCG1 4UT6L 2OMTB 3IXAA 1JNNL 4F57L 1CF1A 2IAMC 3SB3A 3IAGC 5L8LB 3VU1A 3GXMA 5C0FA 1C9SA 3N41B 1P4LB 3H55A 1EVUA 1E4XH 5D5MF 2HT3D 3KXFA 3QIUA 4LRIC 3TNMA 3EGSB 1WD9A 3TCTA 2XN0A 3T8XA 2ODHA 1C08B 3L3JA 1G7MA 3PJSB 5D6DC 5BQDA 5FGRA 4I2XE 5T5FA 4E42A 3GLEA 4IKKA 4NUJB 4TPRL 5T3XD 3WTUA 4Y5XC 3NJIA 4Z18A 3LZOA 1DSYA 4QCIB 5E6RB 3IU3A 4H2CA 1KLUA 2MNWA 3HC3H 5IEHA 4AYMC 2OP4H 5ELIA 2EABA 4WCYL 4KOCA 4ODHH 1N18A 1BYOA 1NMCC 4MJHA 4X4XB 1DTUA 3ATBA 2VT0A 4JL1A 4AIZA 3MI6A 4JQXA 4XCCL 1NLDH 1W8OA 1KCUH 4QTFA 3TO4C 3VRIB 1LP9A 2EXYC 3TP4A 2QFRA 1D9KC 1AQDB 4NCDA 1WIPA 2BZCA 4HIXH 3GNML 3BT2H 4FQ1L 2CQVA 2Q7YB 5FA3B 1IEHA 3SKOA 3NFNB 4LFHG 1KYFA 1HWHB 1XF4A 4RDQG 2EDQA 5FECB 2IAMD 3OHXB 3NVQA 3IDXH 4AV4A 1Z2KA 1M7DB 2Y07H 3DJ9A 4QHPA 3S37L 2NYZA 4GW4A 3VI3A 2C9XA 5KBLA 3VM7A 3EJUA 4HCRL 5C0RH 5FHBL 1REIA 3ZHKA 1CDUA 4W6XB 5D4IA 2DQJL 3H56A 4I48B 4IKNA 2A6DA 4ZQKA 3NJXA 4W9LC 4U1KA 2BMKB 5D7IA 2ZOOA 1E5YA 2Y36H 2A6KA 2G3ZA 2B59B 4JRLA 5FS5A 1CE6B 4AKQA 1XXDC 3U1SL 1R5IA 3OD3A 4XMWA 1UYWL 2WVVA 5T1JA 4PJHE 1BFOA 1P4BL 3ZUNC 4APQC 3UJIH 4J2XA 2R8SL 3BGMB 3TO4D 4UB0L 2EXYD 5EBGA 4JUSA 4LP4A 4MD0A 1WWWX 5GGVH 1DJWA 2GJZB 5CNHA 2ZOWA 4EN3B 1XCTA 1CR9H 1KLUB 5C08B 3V0DA 2YD2A 4X6BA 1JXFA 4PY8I 3SY0A 5E8OA 4MJ6B 3BKJL 4I0CC 3S36H 4X8JA 2VZVA 3RWFB 2C34A 1OSPL 3W37A 4ZO8A 1ZD6A 4Z95L 4G8GA 1OPOA 4A7VA 5I82A 3SJVD 1MOEA 5D6DA 5EN2A 1ZLVH 3ZVVA 2E7BA 4G11A 1V05A 4W6YB 4XOAA 2X12A 1V5JA 1XO8A 3F7KA 4Y88A 3OAWA 1J1XL 1Q1JL 4KI1A 2B9AA 5GS1C 2IPUG 1NBQA 2Y6SC 4ADIA 2KKQA 4XN9A 2GJRA 4PGEB 5CGMA 2D9CA 3VFPA 4GMTL 1HE8A 3IJHB 3QO1A 5D71H 1HEZA 4F8OA 4Y5YB 1MCPH 1G94A 3B9EA 1NDGB 3IDYB 1FNSH 3QFJA 5HGHA 3T6XA 1BD2D 4M7LT 5MEQA 4OZGF 3LN9A 3OHMB 1CXHA 1ERNA 2F15A 2IQ9L 3BP5B 5KOVC 2PPAA 3UTTD 2VXVL 4KRNA 3F8UB 4H88H 4PJXB 1IX2A 5EU3B 3L1FA 4NN5C 2P8PB 1OTUD 5GISH 4NYLB 2Y2WA 4XC1L 1FAKT 1ZA3A 3IDIA 3MBEC 3V6ZB 4U1KB 3NGBB 2NRDA 4JM2C 3DX0A 4X4KA 4NAQA 3NFSL 5E2WH 3BVUA 4KMQA 3U4AA 4B97A 2ZYRA 5F3BB 2IXQB 4GFXA 5H37A 4EDWL 3P9WB 4CVZB 4FXKC 4NXKA 2GSGB 2WVTA 4PEEA 1X6NA 3L16A 5DHXB 2PTTA 3FH7A 1DE4A 3DLQR 3C87A 3PFQA 5DJCB 5BPPA 2R1XB 4HQQH 3I84A 3V0IA 5JA9A 2CM6A 4XH2B 3FPXA 4TNVF 3K1DA 1RFDH 3G3LA 1N0LA 3ZK0A 2IAMB 2E5EA 5CR8A 1JYNA 4FXGC 5DQJB 5DHVB 2NY1D 4RETB 4DK5A 5J06A 3T0EC 2Y6SD 1KIRB 5AVSB 3SN6N 4H1LH 1FZMA 4P4KD 3T3MB 1YYML 4J3TA 5E2TH 4WFGE 1W9XA 2JK5B 5DJXB 3MRHB 4DGVH 4APQA 2YN5A 1SBSH 3CFTA 4RESB 4FI8A 4BA8A 4Y5XB 1EV2E 3VU2A 2PO6C 3B7RL 2HTKC 2APTA 4O5LH 2X4RA 4JANA 3CMGA 3GK8H 3VFPB 3MBED 2NCEA 1ZEAH 3SE8L 4WI3A 1HEZB 1T2XA 2GITA 4UQBA 1NMCB 2FLBT 3CBRA 1PZDA 1MFBL 4NM4L 1ZY9A 1FNEB 4GRLA 2H32A 4GSRA 4ORGA 2AANA 4HMEA 3SE3C 3TO4B 3KPPA 4ETQA 3TEXA 1D9KB 2BS8A 1FA4A 1T6BX 1M6UA 4OLYH 2VAJA 1PZBA 2DLIA 5L7XL 1ODUA 3M88A 4U3HA 4U4BA 4K9EL 4WK4B 3MOAL 2DMCA 1G1OA 4YN3A 5JLZA 3C2AH 1N6QH 1QRND 4N25A 1IC1A 3GMRA 3U36B 1AQHA 1YSOA 5DZLA 2ITFA 5FGCB 5DJZA 3A67H 3SJVB 2AJZA 2D9QB 2V37A 5C3IA 2H7WA 2DWDA 1F6FB 2J4WH 1FFNB 3N41F 3T77B 2AK4E 4AI7A 2JB5H 4M8RA 1QW8A 4K23H 2PF6A 3EH2A 1XCXA 1UJ3C 3RY6C 3TBSB 2H1PH 1M2VA 3GS0A 2HTKD 5E7FA 3ARQA 4JM2A 1O6SA 2O5ZH 1GTNA 1BD2B 3OAYH 4XXCA 2FR4A 1A6ZB 4AQOA 3OR7B 3NIGB 4A2HA 3RWEA 1EFXD 3ECUA 3M7OA 1IM3B 4K94H 4J8RB 3D3VA 1A4KB 4APQB 2F7OA 2VM3A 2JJSC 4FNTA 3QC5X 4F24A 1GHFH 1OSEA 1T89A 4RLDA 2XFXA 4DTGL 2DICA 3TO2B 3LZPA 1IAMA 5IJDC 5EF3A 1NBYB 3HG2A 4Y5VC 3EYFA 4FZ8H 3UTZA 4WWID 1W0YT 4I0PC 3D12B 1LGVA 4AZUA 3T0EA 4QJ3B 4YHLH 2GITB 4J3OC 3ZR6A 4F91B 3S35L 5GGTL 3BSZA 4KDTA 2GB2A 1YEEH 1ZKAA 5AYUH 1KYDA 1ROWA 4ORGB 2DIBA 2YA1A 3KPPB 4K3JH 3RBSA 3ZE1E 1MELA 4ABVA 3O8XA 1KIPA 5LCVH 5I1JH 3RNQA 4O4YL 2PO6A 3CUPA 2Z0UA 4LPVA 1QI4A 2NT0A 3H42H 5D7EA 3AG1B 4OLZL 2D2CC 1JV2A 5GS1B 2H4EA 3DWTA 4LHJB 5AVXB 1TNMA 1A21A 2R69L 3IMRA 4W9HC 1A14L 1RZ8A 1UM6H 2F19H 1AGEA 5MP6L 2WLKA 2AJZB 1Y6KR 4GW1A 2NCMA 4GXVH 4Z3IA 1A6AA 3HZMA 2JKXA 5ESQB 1FQ9C 1IGTB 1HOCB 4XX1G 2R4SL 3G04A 1H3GA 4N86A 5AD0B 3TBBA 1UTDA 1QSEA 1FZOA 4NN5B 4XNUH 5F7FA 3S4SB 1L6ZA 5B21A 2OJEA 1KJ3H 3MBEB 1M6OB 3QYCA 2CIIA 1WEJH 1HHIA 4JM2B 3G6DH 4L1LA 5DC2A 3S5LA 2J6EL 3SPIA 1OP3K 4PJCA 1QATA 5A6MA 4I0PD 3L5XH 4X6CE 5HVGB 4B9YA 4CBPA 1H5BC 2QSCL 4FXKB 4J3OD 3RWEB 2JI3A 4ZFOL 4XR8C 1QBLL 5C1MB 4Z77B 4ZZKA 5KVEL 1E2ZA 3MA7A 4ANVA 1Z9MA 2XHNA 1OAUL 4EXKA 1F8TL 5E24E 3TJHD 2BSED 2HRHA 3NCEB 3T6WA 1SJEA 1QRNB 1MLCA 5F0PB 1GSMA 3PYCA 1BBJA 4PRBB 1A6WH 2XFXB 4X5PA 4FXGB 4EUPA 2ICEC 3TYGL 3UTZB 3KLHC 3FOMA 4FQQA 3T0EB 2CCLA 3FULA 3EO9H 3P73A 2X0UA 4N0FB 1T1YB 1MNUL 4TUOB 3NEEA 4FFYH 3ELQA 4NRZA 3MLZL 1E4WL 2YKLL 4MCZA 2C9UA 2E9GA 3RI5F 5AVTB 2B16A 2FJFA 5D2NE 1JZGA 1KIPB 1VEPA 2JJSA 3AT9A 4QXUL 2APSA 1KJVB 5F88B 2PO6B 3CUPB 1LO4H 1DJYA 4PLNC 4K9JA 3IT8D 4PJ8D 5TGBA 3ZDZE 2KZBA 5SWQB 1D5IH 1MCSA 3WNIA 1NDTA 5MERA 4KUZL 1KPRA 4PJXF 5FM5M 3O3BB 1BECA 1AI1L 1G6RL 4DHLA 3S96B 3QISA 4BUQA 4GW1B 4UAOC 3STZB 4LCWA 4E9LA 2NMSA 3SGJA 2NXYC 4C47A 1JYWA 3NA4A 3OXSB 2M2DA 5C0CA 3A5VA 1ZLWH 1RUML 2BSSA 2O5YH 3C8KB 3GBMH 1VZGA 2CDEB 2VRAA 4PRID 2AK1L 2UWEE 4OTXL 2EIZB 3D0LA 1INDL 2CIIB 4OFKA 3KAAA 1PYWB 3S5LB 4WU5B 4HIPA 2JXMB 4UNVA 3OPZL 3KLHD 5AVVB 4PJ7B 1QLRA 3MX0A 2NUTB 4L1DA 3UTPE 3K6DA 3I6GA 1CYXA 5J1AB 3CFEB 3DROA 2WIMA 1BFVH 1A7BA 2YSSA 1UJ3B 4NT6A 1D5BA 4OUUA 1RV6X 3T3MF 1CTNA 3HE7C 3MLVL 3X1NA 3T0XA 4LLDA 3MRFA 3T1WA 4QHUB 2WAQA 3NJJA 1HAUA 1OALA 2WLHA 4ZTPH 2VQUA 2ZAHA 4FQQB 3BUYA 3ZDXB 5DXWA 1UZGA 4WNSA 1YEGL 1E9QA 1F4XL 2VGLM 3B7YA 1FNHA 1H5BA 1IC0A 2HRGA 4XPHL 4NRZB 5JNYA 4F2EA 2OCFD 4ZNEE 4X42A 3V2AR 1R3KA 4YEFA 1MFAH 1N4XH 3CK0L 3GQFA 2NXYD 3UXFA 4XNXH 3EJSA 2OK0L 2QQLL 1H8OA 1DLFH 1E7VA 2UX6A 4RFNC 2AMUA 4DP0X 5AOJA 4Y5VB 4YXLL 1KPRB 2VDLH 2XWJB 4I0PB 5EORH 3V6FA 3PWVB 4WWKA 1J88A 4NLAA 5IHWA 1KUMA 4FP8H 3SYCA 3IRZA 2H0EA 2VLJE 4GSDL 2P26A 4N2DA 3L5WB 1F11B 4N24A 4Y0GA 5FYLE 2YPLD 1JN6A 1A7QH 4AQAB 5JXAL 1MW2A 3NSCA 4X7SL 3OMAB 4X7FC 4PIBA 2D4FA 3ZT7A 3KYNB 3IJSA 4J3VA 3JV5A 3T2LA 4NQCA 2EDEA 3X1BA 4Y4HD 1ETJA 2GSMB 2DWSA 3D7PA 2BXZA 4HYTB 1ASOA 1XXFC 3GSOA 3CCHA 3UG5A 1MRCL 3S34L 3PWLB 4XN4A 5I0YA 4NQEE 2ZOLB 3RFZC 5ENWB 4DPRA 4MXWH 5ABDE 1R47A 3VXRE 5DJ8B 3H9SB 3ZTDC 3NIGF 2E9IA 3GSUA 4FFZL 4XBMA 3GRGA 2R0LL 3NJVA 1EEQA 1CZ8L 4LLVB 2EADA 1U93A 5F7YC 4MB4A 3KBPA 4E36A 1H5BB 4MGXA 3VXQB 3TWCL 3SKJH 2X1QA 1JYVA 3E1ZA 5K9KB 1MEXH 5IBUB 4FJ6A 3FK3A 1R3KB 2HB0A 3AMKA 5DZJA 2CIKA 4AUJA 2BINA 4J3SA 4PRIB 4KHXH 4TYUA 5CGBA 1HHKB 3SSGA 3FONB 1T1XA 2FEEI 2DM2A 2R4RL 3BISA 4GO8A 3DIFA 2H0FA 4HA1A 1D7BA 2GQHA 2GBTA 2ICEB 1MIEH 4N3UA 2J2ZA 5DS8A 2FX7L 3O41A 2CDFB 3NJLA 3TN0C 4NCC2 4YHNB 1ZHNB 4K8RC 4QRSA 4ELKB 2R0WH 4LLWA 3HNVH 4TSAL 3MRIA 2VDKL 2BVUA 3GXPA 5F7AA 4M5SA 3TCLB 4WY7H 1NDMA 5HHNB 3C5JB 3CXHJ 3OMZA 4DQOH 3PGFL 4K15A 2CPCA 3CC1A 4B9PA 5JDSB 5K9OB 3EFOA 3RL1B 3VVWA 1A64A 1SOSA 4IRZL 1ZLSH 5J6GA 3TH3T 3FO0H 3V5DA 3S7GA 2H1XA 2PCPA 3MJ8A 2X4TA 4ZXBA 5ICXA 4PI0A 1HI6A 1SHMA 3BAEL 4G8FA 2JV6A 1CU4L 4UAOB 2FWOB 5CLZA 2GY7B 3BKCH 3WFEL 5BUPA 1UCBH 1M71A 1ZANH 3MZGB 5K59F 2NXYB 3MC0A 1OGPA 3M45A 1HHJB 4JM2F 4MB3A 3VMOA 4RNRA 3VFWB 2DM4A 4OLEA 1LWRA 1QBAA 4N87A 2QGCA 4WKZA 4XCNB 4HDIB 5DD5H 3STBA 3WXVH 3FNKA 4AK1A 5AWNL 1J5OH 4MYPA 3B5GA 5HJDA 2K6YA 2R2HB 2Y2YA 2YPLB 1OXYA 5E1IA 1JCVA 4TSCH 4PTTA 2GFBA 4TSBH 4QNPE 4ELMB 1IGJB 4MJIA 5A7EA 4K8RD 5ECJE 4AK2A 2A73A 1LILA 2E74C 4U1NA 2EDYA 1QHPA 2DKSA 3IFNH 3Q43A 2HG5B 4IU2A 1N7ML 1I8UA 1U8CA 2VLME 3HE7B 4OKVB 4O02L 3I02B 3BAXA 3DVGA 3DIDA 1KV7A 4R8WH 5DS8B 3JWNG 4Z7WA 2YK1L 2PP9A 4QRSB 4BELD 4LLWB 1JZ8A 4S1SH 4OLWL 1LDPH 3UO1H 3K46A 4E9RA 2AERT 2CK0L 2MQCA 3P3YA 2ZSVB 1RIHL 4JR9H 1NCAL 3P3TA 3ULUH 5M7QA 3GMMB 3HN3A 2OQJA 5E1GA 4WENB 1RKRA 1WVZA 3F6JA 4RFNB 2XKUA 3C60A 3V5DB 2PCPB 3WOVA 4IGBC 4JHWH 4B5ZA 5SV4A 3D1MC 3EYUL 5KYXA 5E6IA 3BIBX 3QCVL 2YS4A 4NDMB 3VW3L 4GMSL 5GRVL 2WVUA 1FCGA 2F58H 5C8JB 4D9LL 1S6NA 4UT9A 3MA9L 4U6XA 4AOFA 3P40A 4OAWB 3HI6L 4XBEL 4HIIA 2DQGH 2VIRB 2HH0L 2WJ5A 1AKJD 4DESA 3U30C 4LDLB 4PJ7F 4BQ9A 2CUIA 4N0YL 4X8GA 2R1WA 1QFPA 3X12A 5A6IA 4KRMB 4F9PA 2ZX5A 3EO0A 4HFWB 4K5MA 2DYRB 3SDXE 1IQWL 3QJHA 4XBPA 3G6AA 3ES6A 2RR3A 4W4OA 3W9EA 4X50A 3ERXA 3RFZB 4I3GA 4UQ9A 3ZDXF 1HQ4A 2BJMH 4P9HC 3P02A 4TRPL 2A2QT 2NUPA 5C0GA 1A8ZA 1YEWA 1AZVA 1B4TA 4UOQA 5JMRA 1GOFA 2YA2A 5CLXA 1H8SA 4UZGA 1UWEH 1QBMH 3UIZA 4HPHA 3UABA 5DRNA 4N2NA 1U58B 1KB5A 3QZWG 4JZJC 5E7BA 2QPDB 1AXTL 4KOBA 5MENA 1EEUA 1UHVA 4OBSA 2X4OB 2ZCHL 1A4AA 4CILA 3WIFA 3BXNB 1TZIA 4KTGA 2WUBL 3S2CA 2HPTA 4J3OF 1I9RL 4G7QB 4U33A 5E1QA 4ZFZB 4LSTL 4YHIA 5C0JB 4JPVH 1NUFA 3MRGB 3ZKSD 1ORSA 4E41E 1CDIA 5EA0L 1T4WA 3HUJB 1FHGA 1TVBA 4NRXA 5GSRA 4PJBB 4EBQH 5CEXB 5DVOA 4L8DA 3J07A 4OGXL 4WI5A 5IHBA 1FGNH 5BO1L 3TN0B 1LO5B 1IKNC 2V3FA 3ZE1B 4KVNH 5I16B 3ALWA 1LK3H 1HHGA 4PWGA 3SKUD 4UTBA 3CZJA 3BKMH 4ODXB 2DMBA 3QDMA 4RMBA 1PJ9A 2ICES 2XIDA 4TNEA 2G75B 4BSVB 8FABA 2V33A 3V52H 3Q01A 2A74A 1A3LL 1ORQA 5IVNA 2NY0D 3UAFA 5F7UA 1DQDL 1EJFA 2VO8A 2CBOA 5FGBA 2R1WB 3MRDA 1JNLL 5T1KD 4H5SA 1FYTE 1H3XA 4NNPH 5LO7A 4LQFL 4KAQH 2QBWA 4ODUA 1RZKC 1DANU 1G5AA 2VLLB 1VGKA 3Q3GA 3UTSB 4UQIM 1MRFH 1IRAY 3LOWA 4XP4L 2ZZUT 1UD5A 1KCWA 4LZKA 2QV2A 3GRWH 3V9CA 4G80A 1FYHB 2YPVH 1VGEH 3A6BH 1CXEA 1CXFA 4H8UA 2E4TA 1CFNA 2HFGH 1SRDA 3O2VL 1N0XL 4G8EA 3SGDH 2YD1A 1T03L 3BPLC 1Z3GH 1AYOA 1LE9A 1ILUA 4MMXC 4TL4A 1U92A 5IB3B 2WTRA 1ZHKB 1AGFB 1XWVA 3B1TA 2P45B 3D2UA 4IKLA 4JJOA 4XXDB 1NAMB 1UUSA 3NPZB 5FYLD 3RKPA 5KSBA 4JKNA 1OW0C 3FW6A 5DSCA 4K7PX 5GGSA 3NZHH 3WE1A 1TZIB 5IQ7H 1TLKA 3KYMA 4DIXA 3GO1L 3MBWA 3NACH 2VZ3A 1PIGA 3ETTA 1WLHA 1OPGH 2ORBL 4RMTA 4YSDA 4WV1C 3D4CA 3QULA 4IDJH 4G9DB 3UYRL 3EUDA 1E8WA 3LEVH 5DR5H 4WDIB 2A1WH 1HCZA 2AV7B 5C7XL 3RHWF 4L1BA 3MJ7A 3SKMB 4X5WA 2GK2A 3JWDH 4GRWB 4KK5D 3ULVH 5JQ6H 1JRHI 1CE1H 4C83A 2DLGA 4MXQC 3CFBB 5BZZA 5INDB 3VD2A 3BDYH 3QUMA 2Y24A 1TMQA 3QXDB 3BP7A 1S4IA 4G6MH 3KEHA 1PAMA 1RZJC 2FCBA 1BZ8A 3QHZH 3L7FB 3RAJH 4V11A 4KRLB 1OAJA 1K3ZA 1QFWM 1ORQB 2K7PA 3VFRB 3WNJA 1PF3A 4BFKA 3EFDL 3EOTL 3FAXA 4Q6YA 1UFUA 5IESH 3SQOL 1OOAA 4WI8A 1XBRA 2HX7A 3CFIC 1ZVYA 2DAVA 4I3RL 5I2IA 4IGBB 1TNNA 4ENEC 2N56A 1PQZB 3EOBA 4EEEA 2BCKB 2CLVA 4YHMH 1FORH 2ZF9A 2EDHA 3FBQA 4Q8BA 4ZUWB 1Q0YL 1SEQH 5H4YA 3HMWL 3BQUC 4CSTA 5ILTH 3TBVA 2PCFA 1CQKA 3O6LH 4MAYC 4ZOEA 1DBBL 4DF9A 1V3MA 3U30B 4NZJA 4G7VL 4CW1B 1KBWA 3IDNB 4ELMF 1DBKH 1OTSC 4ZUSA 5DS1A 2WNWA 1NICA 1UB5A 1BWWA 4G1EA 3E6HB 4PJ5D 4IMKA 4D0BA 5EEWA 5FYKL 1SHSA 3DUSA 2WO4A 4U6YB 1J0JA 3G5ZB 4L3EE 2BFVL 1JF5A 3EJZC 4LARH 5GRXG 2WLMA 3QXTA 1T5WA 4HXAL 1AE6L 3J7HA 4MXQD 1YEKL 4MAZA 2NNRA 4OCRL 4BKTC 1PEZA 3K6SA 4JVWA 3FB7B 3GEWB 3MBWB 2G9KA 1WFNA 5ITBH 4H4NA 2EILB 3TBWA 2YRZA 3S3SA 5T1KB 4XE5B 4Q0XH 3EJYC 1MWAH 1KBKA 1TF4A 4CVWA 8PAZA 1BZ9A 4OD3L 4P2QE 4MMXA 1RH8A 1F58L 4O58L 1JCKA 4R2GC 3TYFA 5HI5C 3GSNB 4JZJB 2GI0A 2FD6H 2ZICA 1FCCA 3WIHH 1BJMA 1KIUB 3QUMB 4ENED 2HMID 4F58H 3WJMA 3CVBA 3ABLB 1KJ2H 2X42A 4X6EA 5ICZB 1J11A 3BQUD 3QNZA 3U82B 2IH1B 1E7UA 5DUJA 2WVSA 3E3QE 3TXAA 1OB1B 2XUWA 4H8VA 3UG3A 4YDIL 1I85C 2DQUL 3BLPX 1OTSD 5I2IB 2Z1PA 4JGJA 1CFSB 4JFFA 3QQDA 5CHNA 1NGQL 1RURL 3D50A 2V8LA 4Y16C 3NZUA 3N50A 2DQCH 1S9VB 1P7HL 4NUPA 3EJZD 4G42B 4WHTB 1C5BH 1J5CA 2R56H 4HIJA 4NUGL 1FF5A 4OZ4B 4Z3HA 2VLMD 5CP7B 5FYJL 4PGJA 4BWWA 5KYNA 2UY7A 3HB3D 4JZOB 3EJYD 2BIQA 4Q9RH 1A9VA 2LU3A 2PWFA 2O6PA 4AEEA 3KR3H 3KVDD 4Z78A 2EH8H 2KDYA 5DZOA 5HI5D 4IEFA 4EOWH 4WJ5B 1MKFA 2C9SA 4MAYA 4PJAE 1PLGL 2ISDA 4PV9A 1EXUA 4PJIB 3ZHFA 4BV1A 1XR9B 2W59A 4IRSD 4YHZH 4BXSV 4I9XA 2B1AH 2AS5M 3NCMA 2GSIA 4KHTL 1ITCA 1OY3B 3WG7B 1AACA 2WNXA 3TT3L 1QUNA 3OKNB 3BPLB 4AT6B 1NFDE 4MMXB 4KZDH 1WD8A 4OB5L 3TM6A 2H3NB 3PF2A 1K72A 2VQ1A 2BLFA 3L3HB 3WMSA 1T7XA 3RA7L 4ALAH 3HUJF 3Q1SH 5C70A 4PJBF 4WTWA 1ZGLM 5AAWA 3QNZB 3MCKA 2A0LC 5FW8A 5TF1L 3CSBA 3ZE1F 1JPEA 4WV1B 1I8LA 1J8HA 2BP3A 3QVAA 1MI5D 4IOIB 1XSOA 4PJ5B 4DP2X 4IRJA 4NHCL 5ERWA 2IQAA 1KOAA 3AABA 5KVDL 3ZO0A 1QEWA 4JFFB 3QQDB 4L4VB 4JCMA 4JGNA 1L6PA 2YAFA 4WKXA 3WXWH 4H0LC 4K7PY 2Z93B 2YUXA 3AREC 1N59B 1U8KB 2IEPA 5I1AA 3QWQB 2H3XC 1O7SA 2YSTA 4CN1A 1BV8A 1M7IB 1ZE3C 5CS7A 3MUHL 2IDSA 2WOBA 1G7IA 5DD1L 4UDUB 4M6OL 4XC3L 3MRRA 3L3DB 1D5XB 15C8L 4QKTA 1LYQA 5D7LE 3ZTEA 5CEZL 1D6VL 1IGCL 4Z3EA 3NCJL 4IEFB 4MSWB 5FW6A 1AGBA 3HG0A 3VXME 1N26A 3BQUB 3SPVA 3ME0B 3R4RA 3VVVA 3FUNA 1KY6A 4MAYB 3ZSSA 4JW3A 1U8IB 1AZRA 1EXUB 1CD1A 3H2WA 4BH7B 4EO5A 4NJ9L 2R2EA 2PXYC 4UUJA 5IHLB 3CV5A 5EU4A 1UWFA 3ZRCC 2X1WL 4E41D 1GZPA 2A0LD 2O6DA 1E8ZA 1GXEA 1B6DA 1X7QB 1G9MC 1UVQA 4LCUB 1BJ1J 4DP1X 3WUWG 5CINL 2MJWA 3NIDB 4JDEA 4DOHB 1NEZB 1VJSA 2AQRA 2QQKH 4F9LC 1Y1DA 4HUNB 1BOGA 3VD9A 2ZCKH 5JPNC 4GRWF 4MZ2A 2EO9A 4LKCA 4N0RA 1LD9A 3ARED 3C09C 1BAGA 3NA9L 4ABUA 5IB2B 5B1KA 2AJXL 1S78C 2XPGA 2RIKA 4JQIL 2Y0SA 3T8MA 4NSKA 5LXVA 2CWRA 2OR8A 5BZDB 3DGCR 5I66A 2HX8A 1EHLH 4R2GB 4J1UA 4YJZL 1UCTA 1GVIA 4D8PB 2JJTC 3GI9H 3LZNA 1JG9A 2AAVA 2HLAB 3QEQD 4JFPA 3D25B 3IDJA 4WHCA 4UV7H 1XR8A 1HL8A 3ARVA 3B43A 3FL7A 3IU4L 1PBYA 3BIKA 3LMJH 3CFCH 1XF5A 1OGTA 4YHPB 2AI0H 2GHWB 3OWRA 2PXYD 5DRZB 5M95B 2XNAB 5D70H 4BJLA 2F53D 1FGVH 3QUZC 4C56A 3NSDA 1VEMA 3UZEC 4BZ1A 3QH3B 4E9SA 4HHGA 3F5WA 4YPGB 5C9KA 3KZ8A 3IFOB 5GGQL 3C9NB 4Y16B 4U7SA 5EMYA 3TONA 3VB9A 3NTCH 5AL0A 1OGAB 3WNLA 2PKDA 1LEIA 3KVPA 3QYNA 4XNAA 1CD1B 2W0FB 3L4CA 4FNPA 1MI5B 2CG9X 2O6FA 5HXMA 1DLHB 2WKGA 4HC1H 3F12A 1QX1A 3C5SB 1GZPB 3QDGE 3C6SB 1S78D 5FM4A 3EDKA 4DPBX 1LHZA 5E9DE 1K6QL 4LCCA 3H0TA 5AUMB 1XCQB 1ET8A 5I1EL 2PETA 3WMQA 2APWA 4ETYA 4FQIH 1A1MB 1BOGB 2VDQH 5AW4B 2Y72A 4H8QA 3JT0A 3GB7B 2QQQA 4Q9BA 2EUXA 3BWZA 4MYWB 1BLNA 1FBIH 1GPOL 3I9GL 5JIKA 3OSVA 5IQOA 1EIBA 2G2NA 4OCSL 2XYCA 3EH3B 1XAKA 3VO0A 4E5XB 2AAAA 4N0UE 3SDYH 3WTVA 3KH3A 4GRMB 1MQKH 3RUGB 3QUZD 5FO7A 1Q9LB 1F90L 2VLKA 4L3FA 1OF0A 1P84K 1A1OA 1KGXA 5JPNA 2ZAIA 3E3QC 5KYYB 5AALA 1EMTL 3CSTA 1GGBL 1P4IL 4XBGB 2YXVA 2FL5A 1YRKA 2XN1A 3KH4A 4HUWB 3WN5C 1F2XK 3BSGA 4DEPC 3EOAA 1HWGB 2WLLB 1MHCA 1OK0A 1Z32X 4IHOA 1T5XA 4KH2A 4U6HA 5DDHB 4X5XA 1AG6A 4TLKA 2F61A 2RB8A 4L0YA 4L3ED 3RVXC 1ID2A 1OQXA 3D85D 4U6VH 4UF7C 5IMOB 3AREB 4OCYL 5CBAA 4PCSA 1XD0A 2KT6A 3E8VA 1SVCP 4A2FA 3T4YB 1G7QA 1EGJL 4R3SA 4CAGA 4KMTL 4PJIF 4RCAA 3MLWH 1Q1PA 2DYPD 3MUGB 3RWDA 4X83A 3UYOD 5FOBB 3D30A 3QEQB 4AGPA 4OM0H 1YNTB 1OHQA 4KKRA 2JLPA 4PLOB 2E9JA 4LVNC 4M9OA 4L18A 5F1KC 3LEXB 2BCMA 1AZZC 2KZWA 5KJ4A 4KGJA 4LPYA 1ZA6A 2PXYB 4P3DB 2F53B 5KYUB 1JDCA 2N4IA 4PVMA 3DOHA 5IMLA 1XIWA 7CGTA 1B4JL 3O4LA 2XWTA 2GJ6A 5D7SH 1TSRA 3WELA 2AQ1A 4G6JL 4PRPA 5K33A 3DX8A 4LQ1A 3BH4A 1NOAA 2X38A 5GS0H 5L6YL 5FO7B 3J8F7 5E8DH 2FGWH 3NJKA 1NKRA 2VDRH 4KXAA 2Z7UA 1TZOA 4XMPH 4YUEL 2IF7A 3MDJA 4JJHA 5JPNB 2FQGA 1XH2A 4GEIA 1OM9A 3P1VA 4H8WH 3C09B 4C59B 1NCTA 2V0AA 2LU4A 2WBJA 5ITFA 3CHRA 4N2EA 5E6YA 5SWZD 4FFWC 1YG9A 5DC4B 5KG9A 2ATKA 3HG1E 4FQLH 2EEXA 3Q9QA 3V0JA 4U6HB 4GKSA 1NGYB 1AQKL 3MJ9A 3QWRD 4KKLD 4DCQA 3AAZA 2DJUA 1LK2A 3QG6A 5B22A 5T33L 3ARDD 2EYTB 1U8NA 4K7PL 1F3RB 1JXJA 4L1TA 4UI2A 5ICUA 5AB0A 1W72B 1IBYA 1LO2H 3LKNB 4YO0A 1JD7A 4HJ0C 1JPSH 5KS9E 5C6TH 1G7QB 1IFGA 3QUZB 1SGKA 1XMWA 3MV9A 4KC3B 4X7DC 5HGGS 1QUPA 4BZ2H 3LZQA 4GP8B 1D5ZA 3VJ6A 2XJLA 3MJWA 5ISZE 2K3TA 2F9BT 4K5NA 5LXGL 1GIGL 2DPKA 1AJ7H 3M8OL 3ZSTA 2OMYA 4EZLA 2YOCA 4UT6H 1JNNH 1PLBA 2WXQA 3OM3B 3NIDF 1O7DC 4NZFA 1IAIM 3PLYA 2LQRA 4PJ9C 2YO3A 1KB5L 4JO3L 1F0LA 4P23C 4OZFH 2WXHA 2EH7L 4FFWD 4L3EB 4CC4C 1IILE 4JCLA 1JZ3A 4ODTL 1JGUL 1ND0B 3QS2A 1D7DA 2J1WA 2RALA 4Q4EA 4R7NA 3CQQA 4OVVA 4F27A 4XT1C 3SGKC 4YSTA 3ZZ1A 3EJTA 5B8CA 5C71A 4HJTA 2EDFA 3Q2LA 3AG2B 5T1MA 1T2QL 5I1LB 4XCFL 4AMXA 1A6TA 1V3JA 2WYIA 2AKRB 4HJ0D 4DNLA 2XN9A 2AXFA 1JWUB 1QSVA 4RDQF 2VLRA 5D7LD 1Q9OB 4ZS6D 1VACA 4XCCH 5JIIA 4LLMA 1LK2B 4XXWC 1QR1A 2BHUA 3U2SA 5KVEE 3VXMD 2XZCL 4ZUVB 4IBWA 1KN4L 3LIZA 4KMLB 2O5NA 3I3EA 4FQ1H 3DOIA 3MRKA 3TWYA 4CJ0A 2VMDA 4JFED 1JHTA 3AT0A 4QT5B 2Y23A 4JDVA 1U0QA 4YPJA 3W81A 3WN5B 4DEPB 1L9OA 3OAUH 4U4IA 1ZLEA 4I5BB 2NZ1A 3REVA 4PJ9D 2P24B 4H40A 4RMQA 2AQTA 5IF0A 3S37H 5SWSA 3VJ6B 4P23D 3JTTA 3OG6B 4P2AA 4PWKA 2MCPH 1KN2L 2X9XA 3ESUF 4A66A 3FQNA 4AKOA 4GBXC 4DP4X 4HCRH 4GKZA 3FU9A 5FHBH 2IPKA 2CGYA 5SWZB 5I6OA 2DQJH 1ZPUA 2FQDA 2BZDA 5CZRA 3HS0A 3ZIMA 2BO0A 5I8CA 4KVPA 3UL4A 4E0RA 1CFTB 1GSKA 1XT5A 3QR2A 5DJ0A 2J20A 4J3WA 2ZWNA 3TF7C 4UM8B 1RULL 3WLWC 1DDHA 5HHQA 2GAZA 2X2YA 4MNGA 3U1SH 3RJOA 5E6SB 1UYWH 4LVNB 2KQMA 1EAJA 1P4BH 4R7NB 2R8SH 1I9EA 4UB0H 1I3GL 2WW8A 4QD2E 5KSVA 1A6PA 2BOCA 3RUGF 2NLJB 2X0VA 4X6DA 4UINL 4E9XA 3X14A 4HK3J 3WYRA 1PKQE 3ROLB 1A6UL 4LKXB 4C55A 1UA6H 4JFTA 5ALCL 3FRPB 3I75A 1TVHA 4Z95H 3CHXA 4FJYA 1Z5LA 3V4PL 1ZVNA 5HVFB 4HOZA 2YMTA 2MIZA 3OJMB 5KYWA 2IBBA 1FWXA 4GBXD 2YXFA 1J1XH 3CH1B 1Q1JH 4MCYB 3D18B 3D39E 2YJQA 5DMGC 4GMTH 3TTYA 3ZR5A 2WSDA 5FFLA 1CGXA 4F3FB 5G4MA 5E9DD 2HFFA 4AYGA 5FEBA 5K1VA 4HG4K 2IQ9H 1S46A 3GUFA 1G4MA 2EE0A 2VXVH 5LBSA 3SGEH 3GXNA 3L81A 5DZNA 2BVTA 1FIGH 2X6UA 1PDKB 1YNTF 4XMKL 5AFAA 5JHBA 4PV8A 5DD6A 4BDVB 4HBCH 4FAAB 4Q56A 2OLDA 2EUVA 1SUHA 2PABA 2Z64C 3QZNA 1ZWIA 1X44A 3A24A 3RGVC 4C57C 1F18A 4TTGA 5DJ0B 2DL2A 4EDWH 1T0PB 4IYKA 5BVJB 4RMUA 4Q7DA 4NPYB 4GKLA 4LLQA 4FTVD 1SJHA 1KG0A 1KTLA 1HZHH 5DRXB 4Z0XB 3SO5A 3DURA 4K94C 4LSRL 4JFEB 5F71A 1XQ4A 3SYAA 1JZ7A 2LOEA 3W57A 4J3XA 3TBYB 2AXWA 4JRXD 1CGVA 4U05A 5HY9A 4MLIA 4A6YL 4RFEA 4H25B 3TV3L 3PAZA 4PJ9B 3HOGA 3MLPA 1F5WA 4P23B 2XPZA 3KGTA 2XY1A 3RNKB 1TVHB