3WTSA

Crystal structure of the complex comprised of ets1, runx1, cbfbeta, and the tcralpha gene enhancer dna
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
119
structure length
119
Chain Sequence
MGELVRTDSPNFLCSVLPTHWRCNKTLPIAFKVVAKGDVPDGTLVTVMAGNDENYSAELRNATAAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKITVDGPREPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A novel allosteric mechanism on protein-DNA interactions underlying the phosphorylation-dependent regulation of Ets1 target gene expressions
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription/dna
molecule keywords Runt-related transcription factor 1
total genus 20
structure length 119
sequence length 119
chains with identical sequence F
ec nomenclature
pdb deposition date 2014-04-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3wtsA00
1TSRA 3IGKA 3VD2A 2BIPA 4MZIA 3KZ8A 3D0AA 2PCXA 3US1A 2AC0A 2X0VA 2AHIA 4AGNA 4QO1B 2P52A 4G83A 1KZYA 2J1YA 3US0A 3WTUA 3WTVA 3QYMA 3VD1A 3Q06A 2X0UA 1HJCA 2GEQA 3Q01A 4MZRA 3D09A 2J21A 2BIQA 4IBTA 4AGOA 2OCJA 4IBWA 2ATAA 4AGPA 1E50A 1CMOA 2XWCA 4GUQA 5AOIA 1TUPA 5G4NA 5A7BA 1IO4C 2J1ZA 1UOLA 1EANA 3WTSA 3EXLA 3ZMEA 1YCSA 3WTXA 2IOIA 4IBUA 3EXJA 1GZHC 5AB9A 1LJMA 4LO9A 4AGQA 4LOEA 2XWRA 5AOMA 4IBSA 2RMNA 4KVPA 2WGXA 5LAPA 1EAQA 2J1WA 3VD0A 3QYNA 3WTYA 2ADYA 3TS8A 4IBYA 5G4OA 4IBQA 4HJEA 4IBZA 4L0ZA 5AOKA 5AOJA 2IOMA 2IOOA 1CO1A 3D06A 1HU8A 5ABAA 3WU1A 3WTTA 2BIOA 1T4WA 4IJTA 2FEJA 1GZHA 4IBVA 4L0YA 1H9DA 4GUOA 5KBDA 3KMDA 4L18A 5AOLA 5BUAA 2J20A 1EAOA 2MEJB 2J6WA 5G4MA 2X0WA 2H1LM 3D07A 3IGLA 4AGMA 2BIMA 5ECGA 2VUKA 4G82A 1HJBC 5LGYA 3Q05A 4A63A 4XR8C 3WTWA 4AGLA 2BINA 3D08A 2J1XA 3D05A 4LOFA 2YBGA
chains in the Genus database with same CATH superfamily
4HJTA 4PWGA 3UBXA 5JXEC 4JPIB 2G5BB 4W70A 2YOCA 1LP9F 1A6TA 1AXSB 5IROA 2V7HB 5KVDH 3BSZL 3RPIA 2A3TA 4M5SA 1UQSA 5DR5H 3T9WA 1E3XA 2YUVA 4GG8B 4P23C 3ENEA 3FSAA 4Q4EA 4F9PC 3MV8A 4MCNA 5IKCB 2YQ3A 3QPKA 4XO4A 2ESVB 3V4PH 1GOFA 4JQXA 4LHUD 2HVBA 3ARPA 5D7LE 4PEEA 5KS9F 5AYTA 4MJID 5LXGL 2VXSH 2VXQL 3LXCA 2C26A 3IU3B 1MHEB 4XVSH 5E6IB 1TU2B 1COBA 3AS2A 3ZMRA 3KBFA 3NZUA 5D4QA 4PJ7F 3TM6A 3WO4B 4MJJA 4GT0A 4AC4A 2JTYA 4MB3A 2AJUH 4PJXA 4Q6IB 4NQDE 2COQA 2DMBA 2HLAB 4N90E 4FA6A 1U3HA 3U9WA 1BBDL 3U0PA 1NCDL 2KUTA 5HHOA 3NN8B 1GGTA 1L9RA 2YXFA 4S1DD 5AZUA 3K72A 1CVSC 4J8RB 2P28B 2D7NA 2ZUVA 5IUSA 1QQDB 2CJUH 1PLCA 1IGMH 2EQDA 3NQIA 4JS7A 5HY9A 2BOCA 3KD4A 3QVAA 4BZ2A 3JYCA 5F93C 4KXZI 2HB0A 2WSKA 1NZRA 4JMNA 5FKAA 1ZGLB 3TL5A 2VMDA 3QUML 4FDWA 1FF5A 1ZLSH 3VG0L 1ODUA 4D0DA 3BE1L 4G7QB 4DNLA 5I5MA 1IL1B 3U48A 4Z6AT 4H8UA 1MWAH 2VDOB 4HJ1A 4DHLA 2K3TA 4PP1C 5EC1A 1FIGH 3VTMA 3WAKA 3KM1A 4E9SA 1IKOP 2NT0A 5J1AB 1U3JA 3QB7C 1QLEH 3L5WB 4I4WB 1KXQE 4WIQA 3DMMD 3N5AA 4W9FC 3U30C 1QUNB 3T3ME 4Y7OC 4JFVA 1NSNH 4JREB 3D2UD 4J6RH 4MTMA 5EU6A 1GVIA 3P2DA 3D5OF 1MXDA 1I85C 3V79C 1WICA 4NQVB 4UNIA 4FQ2L 4AQZA 1DBJL 2CO7A 5LGJA 4PH8A 2CLVB 4G6JL 2Z34A 5MEOA 5I2IA 4KVNH 1A7OL 3SODB 2V3DA 3DX3A 4YZWA 4OZHB 2BNRE 2Z9TA 3NN8A 4ZFZB 5EOQH 1J9CT 1VAHA 2OW6A 5EOQL 5FYJL 3WTWA 1R75A 2J12B 5IQNA 3VRJB 2GT9A 2VLKE 4LSPL 1KTDA 4G8GB 4ADJA 2DW5A 2ETWA 4HH9A 1JRHI 1YEJH 2BS9A 4X83A 1RIUL 2KZWA 3F7PC 3T3PF 5C7XL 3AUVA 4WU7A 3SDYH 1Z0MA 3OKYA 1UKTA 4JREC 4WNSA 1EHAA 1IC0A 4M8VA 2JI3A 4YHPB 3G3LA 1THCA 4IW4C 4Y8DC 3C12A 5EEUA 1NAKL 2V5SA 4JX0A 4P9HL 4KZEH 1QRNB 2NNAA 3S3JA 4LNRB 4R5TA 4KRLB 4LKXB 2VQ4A 1I9EA 1U8IA 2C1OA 5F9DC 3RIKA 2IADB 3EJJX 2R8SH 4X4XB 4RQQB 2DAVA 5GZND 4JFDB 2A6DB 1AD0A 2K8QA 4NQCB 4J27A 3FZUD 2G30A 4EI6B 4PW9A 4GUCA 3HZYB 5J57B 3JV6B 5KOVC 3KPPB 1N67A 3W39A 5KSAB 1FNLA 3QPXL 3KEDA 1XGZA 3EH5B 3QIWA 4HKJA 3CZJA 3OBAA 4LEOB 1E4KA 4H0IA 1BEYH 3WY1A 4G5ZH 3KE0A 2YN3A 1SRDA 1QSEA 4IU3B 3NMEA 4JFEE 1E30A 2CK0L 4F9LA 5I17B 1MCPH 1T6WA 1OF0A 1YQVH 2ICEB 2X05A 3VI3B 3RBGA 3GLDA 1B4TA 1CLCA 1AXTH 3ZSSA 4WI0B 4EN3B 5AEAA 5IHZB 4JANA 3MRCB 1PZBA 3EIFA 5GS3A 1PZ5A 2ZJSL 2ERJC 2EYSA 4BH7A 4GXUM 1DSFH 4PVMA 4ODTH 1P4LA 3E8UH 4X4YB 2F53B 2HTKC 3HS8A 1ZLWK 4NZFA 2ZNXA 1T0OA 5IBTH 4NDMA 1LE9A 1OAQL 1BVNP 4F27A 4YSRA 3OZKA 32C2A 3IRCA 1JWUB 3IJ9A 2OZ4A 3OMAB 2HUHA 4YDIH 1O6SB 2AV7B 2MMXA 3THMH 5HGAA 4XPAL 5FKPB 3WEOA 2VJ8A 4TVSa 2FK9A 1YPZA 5CLTA 1UEYA 1RUAL 1IUZA 2KLTA 4Y4FA 3TEYA 3QRFM 4KROD 3ZT7A 1MAMH 3EUUA 3GRGA 1FI8C 1H3WM 4JY4B 3Q44A 1B4LA 1XR9B 3GXDA 5FC9A 1A3RH 5IK3A 1U3HC 2KQMA 4Q4IA 5J1TC 1LE5A 1JK9B 2KMWA 1SJHA 3H7BB 3QG6A 1IBBA 4MGXA 5LNDA 5F1NB 3VX1A 2BP8A 2ICEA 3VI3A 4LOFA 1E40A 2DMHA 1PLBA 1MW1A 1R5WB 3HNTL 1TZIB 4YAQA 4OT1L 1A65A 5DK0B 1FZKA 3VB8A 1IJNA 2KZKA 1KACB 5HXMA 1KTJA 2PNDA 1QVOB 2QQKL 2VDLB 3OHXA 5EUOA 5HDQL 4QLWA 3S35H 5FW6A 3LRGA 4JFQA 3M86A 4LP5A 2P80D 2C9VA 1FFRA 2Z91A 3CVIL 2EIBA 2NLJA 3DXAB 3K6SB 1CU4L 1UURA 4L8SB 5AW4B 3VQ1C 1CU4H 4E0RB 4K5PA 3SE3C 1AKJD 3VWJC 1KGXA 5E9NA 2WUBL 2ZKYA 5GISL 3T0WA 2AQTA 3UCRA 4JFHE 4CGUB 3E6FA 5EFIB 5GIRB 3KWTA 1SYSA 2JNZA 3QC6X 5CJXC 1W8EA 2ZX5A 1CMOA 4BGLA 3AU1A 1GGIH 4Y9EA 4HFUL 2IDFA 2EVFA 4XX5A 2XBZA 4XMZA 3L16A 3ML9A 2PXYC 2P42B 3BN9D 3FMGL 4KX9A 1PD0A 1JGUL 2F6AA 2E3VA 3P3SA 1M7IA 4MD5B 4ES9A 5GRUH 1OGTA 1NUFA 4B9KC 2BERA 2GY7B 4A7UA 3FB8B 3LHPL 4FQLL 4KOCA 4NJAH 5F9JA 1ITBB 3CLEL 4DQOH 5HTSA 4HZLA 1AH1A 4GMTH 2D7MA 4QTFA 1I3UA 1U8MB 2DQGL 5D2LA 3ZSTA 2JCCF 2P8PB 3NABL 4O9HL 2MHAA 1S7WA 1SM3L 3I3BA 3NABH 2VE6B 3DGGB 2IPKB 5DVNA 3BUYA 5IFAH 5DEJA 2OQJA 3RWCA 4RMSA 4IRJD 3R4RA 4KQ4L 1I3VA 4NZUL 4ANXA 1CFNB 2FJGA 4YK4B 3P4NA 2XTJB 3GUTB 1L0XA 3BGFC 3GSWB 3IRPX 4RAVA 1W72L 3U1SL 4DERA 2D0FA 5EEXA 2VQ1A 2YARA 2YD2A 4GAYB 1JHKL 5I23A 3GC3A 5I1KH 5I0DA 3FB5A 1NAMH 5INCA 3UDWC 4XXCA 5K69A 1Z9LA 4GSQA 5DEGA 4K3GA 2WN3A 3MREB 3V6OA 2BP0B 1S7XA 3TWCL 2G4EA 3SYOA 5MEPA 5IROC 2VWEE 4M7KL 4WEUD 1BXUA 3N41B 2NX5D 3MJ9L 3ZQ9A 4K71B 4XVTL 2BXZA 3L7FB 4NUGL 3ILQD 5TQ0H 1EEYB 3BEVB 5E8PB 3ZL2A 5KVFH 1B6DA 4W4OC 4OCYH 3KYNA 3W81A 1IARB 5KVEE 2PO6D 1CXFA 3GJFH 1IAOA 4L9DA 1BFTA 2HT4C 4DPCX 4U1KB 3MOAL 4FEIA 1WVZA 3UPCA 4A63A 4FI7A 2FUTA 3BZ4A 1MI5B 3U0TA 1CGYA 1GW0A 5DUBB 5ADPH 4Z78A 3W9DB 2IH1B 3HHRB 4UQ2A 3T4AB 4DVRH 4G9FB 2VDNB 3QQ3A 1J8HE 1SXBA 3MRHB 3TC9A 3CH8A 5ACZB 5IESL 4OF7A 3H3PL 4GBXD 4H7VA 2YGPA 4KRNA 5HD8C 3NEXA 1E9QA 2HRPH 4B3VA 3V4PB 2FX7L 4H25A 4YZFF 4KPHL 2BNUB 1QLEL 3GI9L 4LLDA 2Z7YA 3H42H 4IOIB 3O4LA 3EBAA 3RRQA 2RCSL 2FEEL 4OFVA 3T0EA 3KPSD 4CILA 2WXLA 3P3YA 5DO2C 3LN5B 3QNZA 3ULUH 4HU2A 2MWCA 1RMFL 5G4NA 1AGBB 2NLJB 4B9CA 2WIIA 3INUH 3WS3A 2NUPA 4YHLH 4W9GC 1NFKA 5K59E 2OMVA 1MG2C 1AXSA 1Q0YH 1R5WA 1WZLA 2DIBA 5CNHA 1MCQA 3Q5YA 3RKPA 3ZUCA 1FG2B 3DOSA 4M8QA 4F58H 3WFEH 1HEZA 1JN6A 2EACA 3A3YB 2OFQA 4EUPG 5AB9A 3O3AB 4CUCA 1T20A 2ZWKA 3NG5A 3AB0B 1OTUD 4LHUB 1TQCB 3PABB 1X5HA 1T22A 3JV4B 1U42A 2J2ZA 5D71L 4I13B 4DEPC 5I6OA 4WWKA 3FFDB 4P9HH 1ZLWH 4BM7A 4KZEL 3U7AA 5EORH 2YPLB 4OLWL 3POHA 4KMTH 5SWSD 2XA3A 1ICTA 3TN0D 1MHCB 5D1XC 1P2CA 4HUVA 2FJSA 3TBTB 1JGEA 1N2RB 3MNZA 1G7MB 1E2WA 3VA6A 2B7DT 2MOVA 2BNQE 3WFHA 5AWNL 3MRIB 1VACB 3KYKL 4JY5L 4PBDA 1MWAB 5C86A 5JHAA 5DTFB 4CJ0A 2YPVA 4Q52A 2YD8A 5GRXG 3DO7B 3K71A 3FH7A 3MLXL 1I8LA 2X6MA 3RURA 3LRLA 1RZKH 1P4BH 4GIOA 1C5CH 3HPJA 5E8DH 4WUUD 3U6XS 3U2SB 3PWLA 2VITA 1A4CA 3OL2A 5H37G 3PL6D 5GSVA 3ARWA 1AQDA 3TBVB 4FJYA 5EN3A 3AZUA 1OSYA 3NDZE 3LD8C 2N7SA 5CWSB 2YBRA 4X5XA 4ALAC 2W0PA 3UGUA 4JPQA 3JTSB 4Q74A 1M2OA 1OE2A 1CQYA 4PJFE 4Z7VE 1JNLL 4ZXBC 3UG4A 4TXVB 3ZDZF 3L3OC 4OKVA 3UO8B 4X8JB 4H1LH 1NL0H 4PG9A 1X5JA 5T1LB 2FJUB 2DZEA 4Q6YA 4PRAB 4MD4B 3EYUH 3F64A 3D18A 3JQOB 4OQTA 1IBZA 2XN0A 3FQRA 3RTQC 4TVPD 5J6HB 5I1LA 3G6DL 1ZA3B 4J23A 4PJHB 3CE1A 4ZFFB 1JF1A 4U3CA 3M1BB 2I9LA 4U31A 1GJUA 4FLHA 4F7MA 1WF5A 1JPFB 4ZMPA 4L8DA 1CICB 1IQWL 4R2GD 1HKLH 1HCYA 2XKNB 3ARRA 3QXAA 1I8KB 2YD5A 3MV9A 2CHNA 2BOLA 3QUYD 5DMKA 2ODIA 1P84J 5AVSB 4AM0Q 5ISZB 5I1GL 5L88H 3RGHA 1OP3K 5E99L 5GGTH 3DX8B 2CO3A 3FOMA 5A2AA 1G87A 2H32A 5DQJA 1IBGH 2ZUUA 3BD4A 2SEBB 3EYOA 2F7IA 4HZAA 1Q8MA 4XE5B 3O3DB 4HOZA 1I7ZB 1NBYB 1XT5A 3OAUL 2I32A 4JLRA 3HRZA 3V0JA 1A6PA 1HI6A 2C3GA 3D85A 1QA9B 3G5XB 3TASA 4N2BA 4GRLA 2GT9B 4P4KD 5D1QB 1RZFL 5TJWK 1HWHB 4MD4A 4NNYA 4PJ7E 2PPDA 4HWUA 5HDBE 4ZFZA 4X6DF 3VXTA 1P1VA 1JGUH 4BZ2H 5T1LA 1VCBC 3F00A 3HCVB 3KGTA 5GXBB 4NJAL 1QFPA 1QPPA 2O26U 3DI3B 4GMTL 5DCCA 4BKLB 5DJYB 1VHPA 1BOGA 4WWPA 3IJYB 3FN9A 4B7IA 4X7CC 1QSFA 1VGKB 3RY6C 4WKZA 3GMNB 4MS6A 4WNQB 2FO1A 1R3JB 4HXBH 2E46A 5LDUA 1IQDB 2EIZA 3ZZSA 2QZ5A 3K1KC 4H8PA 4NCC2 2G2NA 2EDTA 4CSPA 1VF5C 4DKFH 3KWWA 4R4NC 4NHUB 1U8HB 4OI9A 3GSNH 2DLIA 4LOUC 2B9BA 5HI4C 4OZ4B 1KB9K 2QQLL 4QF1B 2WNXA 1QLRB 1QKZH 3PWJA 4PAZA 2BVQB 3VJ6B 1FO0L 2TSBA 3PWNA 3ZL4H 3MXWH 4AY0A 1BVKA 1KJVA 4UTAL 2J1XA 2HG0A 1G0XA 3CFTA 2H0EA 4XVTH 5HDRA 1R3LB 5CCGE 4R6UA 4HHWA 3FB6A 5F0MB 3WJJA 1N3NA 5IHBA 1KELH 2WWNA 3US1A 4AGNA 1TCRA 1PMYA 1SY6L 1MW0A 3EG9B 3T2PA 3BVVA 2A9BA 3KHOA 4Z76B 3UYPA 1T2XA 4KY2A 2NNFA 1VPOL 5DA4A 1NAML 2BLFA 3CK0H 4FFZH 3CK0L 3OHXC 4HFWB 2JKJA 2N59A 5EU5B 4UT9A 2AJYL 1WWCA 4HJ0D 4OVVA 2QEJA 3QA3B 4PRPE 2J21A 1G9ML 3H9SD 2UV3A 5DYOB 2G2RA 3WNOA 3FC8A 1B0RA 1MWAL 4ZZFA 5KS9B 1S7SB 2WAQA 1EPFA 3OSKA 4L9LB 4XB7A 4YO0A 4X8CA 1JIBA 1S7SA 2BH0A 3X1FA 5TE6H 1TR7A 4JFFE 1M9WA 4JGJA 1H3PL 3EJTA 3U9UA 1VEPA 1LL1A 4PB0H 2Z93A 5FF6B 4CVWA 3ASOB 1FC2D 3NSFA 4PJBA 5I9QB 2WXKA 3GSQA 3G6JA 1L7TH 5CGBA 5GGUB 4LDOB 4M5ZL 3Q2LA 1MZYA 4Z7NB 3BP4A 3FU7B 2DQEL 3AQDA 3BH9B 4JM0A 4W9KC 2DBLL 5J13C 1QPKA 1YQVL 3X3GL 3QFJD 4L3EE 3UAJC 1FA4A 5H35A 3INUL 5E00A 3FB6B 3I6KB 5FX3A 3WJLA 4JJOA 3FZUC 2IH1A 5JOPE 4GKSB 5T5FL 2G3ZA 3UYPB 1NC4A 4NO0D 3Q8CA 2YD9A 4FEMA 3S37L 3S37H 3QYNA 1KYFA 1GZPA 1SEQH 2K7PA 2E27H 5I9QC 1V8HA 4RRPM 2WYTA 4M5YL 4P9HC 2L3BA 5H37H 2BY0A 4U1GB 2AZAA 2Z65C 3J8F7 4FA8A 2FCBA 3HN8A 4KK5C 2H26A 1DE4B 1IILE 3ARDB 4OH2A 4NENB 3C60B 5F1OB 5I0ZA 3B2DC 1R5VB 2XG4A 3LIZA 3N55A 5MEPB 5IM7B 2FE0A 3VJ6A 5EBWB 1I3GL 3U4EB 3U36B 3MREA 3T2NL 2YWYA 2EC9U 4NO3B 4K23L 1ZHBB 4S2SB 1BQHB 1BD2D 1EAPB 5E6ZA 2AI0H 1KEML 1I9RL 2AJSH 3EH4B 4RMUA 1WS8A 1JGDA 4W4OA 5IHLB 3WCYA 1Q1JH 4PRID 2WXPA 4NM8L 5C0CB 4HIXH 1GZQA 2WVVA 2BHUA 4ZMZA 4H8QA 4GKOA 4ZMNA 3JYBA 4MS8C 3N04A 5HI4D 2LGNA 4PGCA 4DPBX 3PHSA 1FBIH 3K6IA 2JCCA 4LPUA 1MCLA 2MHAB 4QUOA 5LG6A 2G0LA 4BKLA 3P0VL 1QP1A 2R23A 4WTWA 4AMXA 5I5IA 3P0VH 3QORA 1T04A 3WY4A 3LRSA 4WGVB 2DY2A 1EEZA 5F9JB 1Z5LA 1YDPA 1JNNL 1NL0L 3ESPA 2VJ0A 4PJ7A 1P0SE 1SN2A 3PS6A 4QTIL 4TSAL 4FTVA 1AOZA 1G84A 3O6FA 2OJ1A 3S36L 2OMWA 1DQJB 1UXSA 3DSFH 4OKDA 5CMAB 2X70A 3QH3B 1XSOA 3FT9A 3I2CL 1JV2A 2IMMA 2FIRT 3OZLA 1SYSB 4P2RA 5HI3C 3WXWH 5TDPA 3L5HA 4AL8L 1RFDL 1WPCA 3BYTA 3M8OL 3PE9A 4HJ0C 4Z0BL 4U49A 5AVYB 1BFSA 4PJIB 4AL8C 1XAKA 5BRZB 3FQRB 3BJ91 5J6HA 2A6JB 3KXFB 2JLLA 4AEHH 1YMMD 1WCQA 4OIIH 5I1GH 2BSSB 2YSTA 3EXJA 3QI9A 3SGKC 2VZTA 1FQ9C 4O9HH 4FQQB 3B83A 5IMLB 4JHWL 1HKFA 4CL7A 2EDKA 2WCGA 4HCRA 2E59A 3HLAA 1O9ZA 2J57A 2YBRB 4NZUH 3CSBA 1XGRA 1QFUH 1V5JA 3O2DA 1AQDB 5I15H 3KS0J 1W72H 4S1DC 2LE9A 4ZNEA 2R7EA 4GRMB 3D39E 4L4VD 3ARFA 4OM1L 5IF0B 3PV6B 4KKAD 1YMMA 4HT1H 4BZ2L 5C8JA 3O2VL 5IT2H 4HUNB 3I6LD 2IDUA 5C09E 3GRWL 5FO9B 1WBZA 5MEQA 4JBSA 4UOW1 2BFGA 4K3JH 3DIFA 5AW5B 3BN3B 1UJ3C 5DRXA 3CBRA 5CP7A 2AV7A 1T03L 1ZSDA 1HDMB 5AL8A 3BSZA 1PGRB 3VCLB 4F8NA 1N6VA 3B9KC 4P3DA 4I48B 1FVCB 4MAZA 4IGBD 3I02B 3K71B 1CBVL 4AQ1C 1U3NA 4I9WD 3Q7JA 4O2FA 1ET5A 1JBJA 1OAKL 4X2UA 4AT6B 1INEH 4BZ1A 4X9FA 5I18L 3KPLB 2DD8L 5TF0A 5GRUL 3C8DA 4TVPL 5FO2A 2DD8H 4HUVB 2PYED 3N42F 3KPTA 3TA3B 4DQAA 2QQLH 1FYTA 2LOEA 4EN3A 1KXVA 4KZDH 3OGOE 1HEZB 3H3PH 4PWFA 3IMBA 3F8UB 1TQSA 2QT6A 3VI4B 3JWDC 5C2BL 3ARDD 5FYLL 2FIKB 2DMCA 1MIMH 5CLZA 5FYLH 1XIWB 4DVBB 1CYGA 3WKQA 4NPYB 2HMIC 3O41A 5TTRA 2EXYD 1HILA 1E5UI 4L8BA 2ZOLB 4LHUG 4MB5A 4K4KA 1DVFC 2OXGB 1E0OB 2PO6B 2DWSA 5CBEA 1NDMA 3G6JB 5KSBE 3HE7A 4MRBA 4ANKA 5A2FA 4DF9A 1AZBA 4ENZA 4EI6A 4P46D 4XCFH 4N87A 1FO0H 4I1RA 1VEMA 3QIUC 1EHXA 5IHUH 3UDWA 5CFHA 3HVDA 4PB9L 4NN6C 2WB7A 7TAAA 1CB4A 3K2IA 2ZZUT 3VFOA 4YHKL 4PJFB 1ZTXE 4U1LA 4JG5A 3MODH 5KSVB 3SGDH 3IAGC 4X9BA 4MMXB 3CFIC 4TUJB 1TVDA 3B2MA 5F2FA 2D9QB 1W15A 3P69A 2ADGA 1RZ8A 4FKHA 1OGAA 1JZ8A 4AV5A 3IPFA 2ZAGA 1F2QA 1J0ZA 4Q2ZB 2ENJA 1H8NA 1PZDA 3DARA 4Q56A 1K9TA 2AXGB 1UFUA 2OL3L 2OYKA 3ZHNA 1OAXL 4UQDA 1FHGA 4XXDA 1E9QB 3DHMA 2B5IC 3G5ZA 4R7DB 3EYVB 1P9MA 1U95B 3ET9F 1IGCL 2VR5A 3RL1B 1JF5A 2IXQB 1I1AD 4FI6A 4M62L 4WV1A 2AJUL 5CP3H 3NJHA 4A2DA 4M62H 4BKTC 5ISZE 2QKIC 4QHPA 4HAFA 3SPIA 4OV6F 5DUBA 3HFML 2NY0D 3X1NA 2Y69B 2XA8H 4ZS6D 3HS0A 5KOMC 4JFEA 1TZHB 2IAAC 2EYRA 4G6FD 4KKQA 2DI9A 3CDYA 1ZLVH 1G7QA 2BVQA 4JW3A 5ICXA 4L29A 3H42L 4EZLA 2JXMA 2UUDK 5DEGB 3ZRFC 3T8MA 5DQDL 2A4EA 5DMIL 3OR7B 2XNAA 3GYRA 2XY1A 5DMIH 3EJRA 1N6UA 5GS2H 1MCEA 4XNZB 1SHMA 3F85A 3OX8A 3DIDA 1PFCA 2VABB 3O3EA 1UWXK 1IEBB 3ISRA 2CBOA 4IMKC 4YS4A 1DHKA 4UTAA 1MJUH 2W9LA 3CGTA 5MHSD 3RFZA 1CYXA 2ADIA 2JJWA 1CJYA 1ZRUA 1H15B 4DN4H 1PX3A 1FFTB 5F1KC 4QRAA 3TNMA 3OAWA 2HJLB 1FIEA 4RWHA 3WTUA 4GINA 4FXLA 4TOYL 2YD0A 5F3BB 1A8ZA 4Z7WF 1G1KA 1LO5B 3FF8A 4ZTPL 2B0SH 4A7SA 3RUGF 3MCLH 3V6FB 2WXHA 4QRPD 4IOSA 3MCLL 4UT9L 3RWJB 1NEZA 3VH8G 3BW9B 2TRYA 5FOBA 1DBJH 4Q97A 5BV7L 1OARL 4PREA 3CHSA 3V5DB 1FBIL 1NTDA 1QA9A 3G5XA 4RGNC 2FWOB 5AVXB 4IU2A 4IRZA 2ZF9A 2YOAA 4PJXB 1JPTL 3WNNA 2YEVB 3VXRA 4P4RA 5FYJH 3REWB 2AABH 4IK7A 4X98A 1OL0A 2RFXB 3E6HA 3I84A 4AUYA 1D7FA 2VSMB 5CEXB 4XI5D 1JWMA 3GWJA 1B88A 2Q8AL 1BJ1H 1PY0A 3SKOA 4YHYB 2HMID 5E08H 4NM8H 1LVEA 3ZMEA 5L2KB 1EFXA 2Y7NA 3IDXH 1GYUA 3B3BA 2YA0A 4M43H 4WW2C 2MJWA 4FQPA 5FV2A 1EQWA 2J73A 3ULSB 4FADA 2A9MH 1ASOA 2DMGA 3F7YA 5DS8B 4F5CE 4PLNC 4GG8A 2IWFA 4W6WB 1A6UH 4HSAC 1F13A 5IY5B 3WFCH 1MREH 2OZ4H 4HIHA 4OFKA 3QWOA 3AT9A 3ULUE 4LSVL 4KAQH 4X7TB 3SJVE 5AD0B 1GIGL 3LX9A 4XOEA 3MRGA 1CFQA 3TBBA 1EX0A 3DWTA 3PV7A 4P2OA 5DZVA 2TAAA 5MP6L 3PDDA 2JJSC 2L04A 4PS7A 1NCOA 5DJ6B 5DZOA 4AIXA 4EEEA 4NKOA 5TQ2L 4JHWH 1NUDA 1RUPL 4OI7A 4PY8I 4W4NA 1R0AL 1W16A 1CFMA 3OB0H 3ZT5A 4PGEA 2ZUTA 1RJCA 5CEZH 4K5NA 3KGSA 1U3ZA 4IJTA 2WINB 2ZKXA 5F88B 2KHAA 2VQUA 2PYEE 4AX3A 3V4UH 3GMQA 2FO4A 2VXQH 3N9GL 3OKLA 5B1JA 3I3EA 5DWPA 3UG5A 2AEQH 1KPRB 2N0MA 2KL6A 2JF1A 3O2VH 3SJVB 4U6TA 2ZOWA 2YD1A 4JCLA 1PEZA 3MRLA 4ZD3H 4LEBA 1HK6A 5HHOE 5SWSE 4LCCA 2Y07L 2NY5H 1JFHA 1R19A 2YPVH 3D2UA 1SDDB 3WY2A 5HDLA 1J0JA 2Z4QB 4WI0A 3MDJA 2Z7ZA 1ZSHA 5C0GB 4X7EC 1T0MB 3OAYH 5C6WH 4BINA 2R2EA 1P4LB 4GW4A 2QVTA 2R4RL 2BY2A 3UBHA 5A1AA 2JB5H 2EYSB 5TE7L 3ZZ1A 5J6GB 3QXDB 1T22B 2VN7A 1YEDB 25C8L 4KUZL 5D6DC 1KV3A 3GHBH 2VUYA 3Q1EA 4V11A 2AJYH 4XN2A 1BECA 3NCYP 2Y72A 3SBQA 1XZ0B 3MLWL 3TH4T 3HZYA 4UV7H 5SWSB 5FGCE 2R1YB 3NCBB 4HKBA 5MHSE 3X13A 2B8OT 5I75B 3QUZB 1CFBA 3L9BA 3N1QC 4BXVA 2OA9A 1E6JH 3WS3B 1J8HB 3GZQA 4JRLA 2JK5B 2C1OB 3F7KA 4PWIA 2EDFA 1SBSL 4K07A 2MNWA 3FPYA 1YNKH 4H2CA 4KK6C 5FM4A 4LHQB 5L2KA 3PHOB 2IDQA 5A6MA 2VXQA 3VE0A 1F56A 4OBRA 5I18H 4R4BB 3AT8A 1L7IL 4N2MA 3IDMA 2ZAIA 2AJVL 5DZLA 1QKZL 4X4KA 3BAXA 3UJIH 3BDYH 2DJUA 4LNRA 3VXRB 2WP3O 3MRNB 2VQTA 3MJ8A 3O4LE 4N1HB 2NY4B 1ETB1 3E80A 4H8VA 4PN6A 3WXVH 1BW8A 4X0NA 4WWKD 3H9SB 4N9GA 3ALWA 5I75C 1F4YL 3MODL 3T4AC 1WG3A 4XN8A 3NFNB 1PG7X 4Z7WA 3EW3B 4IRSB 4AVIA 1C08B 4QHMA 4QRTA 2BX5A 1SGKA 5SX5H 2BJMH 4WEEA 1N4XL 3ZW3A 1INDH 1SEQL 1T04B 3U30B 2Y7LA 3G04B 4I18B 4ODXB 3WNJA 3RU8H 5FM5O 3Q0HA 4FFZL 3L4ZA 4P2CG 3MYZA 3RU8L 1TVBB 4ZMYA 1IC5H 1K4DB 1Q9KA 4JFYA 4FX5A 5IHUL 5IQOA 4FQ1L 1AKJB 3KYOA 3Q43A 1XHHA 2AXFA 4FQ1H 2J20A 3K4DA 4I87A 4BFFA 1JZDC 3MLZH 1H6UA 3W37A 4AYDC 3BH4A 5BVPH 5F7MC 3Q6GL 4P5RA 4ICXA 2WLLA 3TU6A 3NCEB 4ZMOA 4HG4J 1UGNA 1PSKL 4AIOA 2WTOA 4EZJA 4N4YB 2R83A 4D0DB 1Y1UA 3IBEA 4KKLD 3Q1SH 5C3LD 3R8QA 2EYRB 5J1AA 3QCUH 5C08E 4PJ9D 4GAYA 5FKAB 5EC1B 5HVHB 3ZE1E 4JJHA 5KBKA 2QPEB 5HDWA 2IWGA 4WK4B 3B2UC 4QJ3B 3SDAD 1CBJA 4H1LB 1MF2L 1PDKB 2AEPL 5ENWB 5JIKA 5B1KA 5MI0B 1GSKA 4M7KH 3GFUA 2GJRA 5KBMA 1YMME 2DQDH 1AG0A 4LSQL 3SDDB 4P2RE 5GRJL 4G80B 4ZYKB 1QRNE 4MRCA 1N6QL 3ATAA 1T21A 3EGSA 2YHGA 2YGQA 3HS0C 1DSFL 2VLKD 4TSAH 15C8H 1G9NC 3LD8B 3KWXA 5E95B 2R0ZH 3QJHA 1IGML 3T65B 4Z7UF 4QXVA 1BVZA 1OB1A 4PLJC 3FT2A 3V9FA 1SJVA 1JVKA 1T89C 4Q6IA 1LWRA 1R17A 3P4LA 1KIPA 1HVXA 4JFZH 3A6CH 2VM3A 4EXKA 4W9ZA 4FMKA 4PJBB 1J1PH 3GZPA 3SKNB 4HZ1A 2O61B 1MY5A 1M3IA 3L45A 1AMYA 3SKMA 1ZLUH 1E8ZA 3NPSC 5MERA 1G7HA 1NCBH 3DJZA 5BMFH 2CBPA 2CD0A 3EZJB 5H2BA 2OXGA 1PZCA 2BNRB 2Q0ZX 5C0BB 1EDQA 5KYYB 4ZFGH 5E4OA 1G7JA 5B39B 4PJ8A 2XJLA 3H7LA 3MGOA 1QSZA 5ITBH 3QRBA 3LB6D 2CM5A 2XRAH 1GGBH 5SWSA 4Y2LA 1KEGH 4IBZA 5IBLD 1BSIA 1XH1A 3KHQA 2BIIA 3T08A 3ZMNA 1IV8A 3LQZA 3MACL 1PZSA 4UCFA 5I19H 4M1GH 2UZXB 5KYUA 1FFNB 3NRFA 5GS0L 1ONQB 2EKJA 5GS0H 3K74B 4HIIB 1WAAA 4GSUA 3MNWB 4E9TA 6FABH 5CINL 2YMXL 4YFLI 4JL2A 1ND0A 3E0GA 4IJ3B 1KCVL 1F6AA 3UAFA 5MP6H 3WHXA 4C56D 3KAAA 2XBDA 5C7XH 5A2LH 4F93B 2EVHA 3VXRD 2A2QT 5JW4M 3I9AA 4KTGA 4NUPA 1ZS8A 2DWDA 4HBCL 4L3FA 1JD9A 5ESAA 1FVCA 4HFUH 2ARWA 3S98A 3LKPB 4O51A 2FYVA 2VGLM 4N2AA 3K5RA 3QJOA 5E2UH 5EHFA 4X0KB 2XTSA 4M61A 3DJTA 5HYQB 2RR3A 1RAMA 1GIGH 4L4VA 4MVBD 4ONOA 4YC2B 3R4DA 4AW7A 4ZOEA 4U6XB 5IJVA 2D73A 1AHWB 1T7VA 4JFFD 1GMEA 4LSSL 2ZQKA 4XMKH 1NUGA 3T0XA 5IHZA 4R9HA 4A2FA 4JM2F 4HWBH 2DLFH 3FPXA 1A9BA 1PG7L 2WLIB 4JDZA 4KI5E 4CGTA 3VSVA 2CHDA 4CVXA 3KLAA 5D96B 5E94B 1E4XI 4ZFOB 3TNNB 5IJBC 2EADA 4X5WA 4NQEE 4ZUVA 3KPQA 3TO4D 3D6GA 5ITFA 3VXQB 1PJ9A 1IBFA 2XZCH 1AIFA 4YXKH 2CSPA 2Y0SA 3EGXA 4RAUB 2Q1EA 4KX8A 1M1XA 4W9IC 3WMQA 3G08B 2NY6C 1B9ZA 1LEGB 4HS3B 1MSPA 1M3JA 1QACA 1BFOA 3WBDA 3HRZB 2PLTA 5DMYA 1CLOH 1SQ2N 2AKRA 4V33A 4MDIB 1FGVL 1I8IA 1T1XA 2QGCA 1V3JA 3BQUD 1INQA 1L9SA 4Y5YC 3NIGF 4UZSA 2OULB 2VR8A 1S8DA 1UYWH 1QZ1A 3CDFA 3HC4L 3O9WD 4OD3H 1TMCB 2FSEB 3FS9A 3TVMB 4TRPH 3DDFA 2VCOA 4O5LH 1W0YT 2EXWC 4N8VA 5JYLA 1A2YA 2CDFB 2MH4A 4GFXA 4LPWA 4K8RC 3RAJL 5SX5K 2AEIT 2YIHA 3GSNA 5IFHL 4YLQT 1DVXA 1OHQA 5JHDA 1WZAA 1SJXA 2AGJL 4IBQA 3AG4B 5IVZA 5KEZA 2AGJH 4FD0A 1Z6JT 4PREB 4NQDB 2Y7QB 4MNQA 3VG9B 3VU1A 2NW3B 5EF0A 4F91B 2ISDA 2J5WA 2EDJA 1HHGA 4Z7OF 4MJ5A 1UB5A 3IPEA 2QMJA 1N18A 4L3EA 1ETZA 5D7LD 4DFHA 4YHIB 2VZSA 3SE8L 3ULUL 3MRJA 2RACA 5C0GA 1NGXB 2AJVH 3MUY1 1WD8A 4QNPF 1SDDA 1I7TA 1D5ZA 3L8QA 3GSXA 4WAFA 4GAGH 5D7SH 1QAWA 1OY3B 3BP5B 3BVWA 43C9A 1T83A 3IYLW 4YHLL 4U6XA 1OW0A 3C60A 2N7BA 3L1OL 3V0VB 3DO7A 2AXJA 4KI1A 2X4NB 4PJDA 3MRLB 1EFXD 5I71C 2NSQA 4Y16B 3WFHB 1IL1A 3MRRA 3VFUB 3FHEA 1SYVA 4PMFA 1G7MA 3RZWA 3KGUA 3APMA 1HXKA 3Q01A 3V4PL 3VFSB 4M5TA 4MZRA 1X5IA 1T66D 3ZZLA 5AKSA 3SPHA 4L1DA 4PJ8C 4ZUSB 1MRCH 3BOVA 1PLAA 3WYRA 4N0YL 3OKDB 2H47C 1ZT7A 1YG9A 4N0YH 1XZWA 4UIMA 2XWXA 3MRBA 4I7ZC 4E9QA 1DSWA 2ALAA 3CMOL 1C7TA 2X4SB 1LHZA 3SKJL 1O7DE 2IXQA 3LS4L 4JFXB 2BNQA 3ZE0F 2HFFA 2IVFC 3TBSA 2YQGA 2AEPH 5AOIA 4LMQE 3LVTA 2R4SH 3FUHA 4PJGA 1ID5I 1URLA 2N4IA 3CX2A 3MCG1 4H26B 4MZ2A 5B3JF 1BIIA 3QFJB 4NYLB 1YNTF 3BP4B 2JIXB 3N6YA 3OAYK 1OOAA 3NCWA 3FOLA 2QPFA 4UQAA 1N6QH 1HXYB 1B3IA 1EWHA 2W60A 2W9EH 4N0CD 4OLVH 5FO8B 5I6MA 5I6KA 3GBMH 2VDMB 4KJYA 3PNWB 1G1CA 5CUSH 5DS1A 4F33A 1NUNB 2ZP0T 4NO0B 3QAZC 1ORSA 4PJFF 4MMXA 4G43B 5JPMC 3UP1A 4PJFA 3D25B 1FAKT 4XCEB 3WL9B 1ZLSL 1TQWA 5D7IE 5IJCC 3V6ZA 2OMUA 2WO2B 3L4CA 4JB9H 1NMCB 5TF1H 2PABA 5LAPA 4ZSOE 1ZVSA 2MQGA 3GTVA 2AQNA 4GO8A 2W94A 4RZCB 1QYGH 3C2AH 1AS8A 3NTCH 3WFDL 1HNGA 4J12A 3OTTA 2C4FT 2ZOLA 1F41A 4QY8A 3RB7A 3N44B 4Q14A 3QR1A 2FEDD 2VDLL 2O5NA 3H2QA 4G8EB 4MMYB 1R0AH 2QBWA 1X9LA 3RWJA 4P4KC 5E2VH 5CEZL 4ZFGL 2VR3A 4Y5XC 2VT0A 4XP1L 3RVUC 3QHZH 5GS1C 4FQ2H 1MI5D 3BZFA 2DQEH 3RE0A 4W6YB 2K6YA 2ZAHA 3FN3A 3FCSB 2AMGA 2WWMC 3QQXA 3X3GH 4KITB 3MACH 5FYKU 1YA5A 2H9GB 4ZS7H 4Y1SA 4PV9A 4BFIB 1RCYA 4KROB 3BP7A 4Z7OE 4DP0X 5F0JB 2CUHA 3MRRB 3VFUA 4ZUWA 5DFTA 4ZNEE 2ZXEB 1Z3RA 4B50A 2Z35A 3MA7A 3SYQA 2P43B 4QRRE 1JPEA 1JGLH 2LVCA 3HMWL 4U2ZA 1KJ3L 2BRQA 2FQDA 4UIKH 4ZMQA 3BPCA 4KMQA 5EZJB 3F12B 5DD0H 4BE6A 1KB5H 1K6QH 3US0A 5ITBL 2A9CA 1EGJL 3POCA 4JDEA 2WTRA 3MLRL 2N1KA 3PL6C 3WGVB 4N2CA 3HRPA 2W9DH 1WBZB 4RFNB 5EC2B 4Z7QB 2DKUA 1A1NA 2ZPKL 4QRSB 3P4MB 3S4SA 2PMZA 5D72L 2OMTB 3LN4B 3WJMA 2GUYA 4PFEA 1J9SA 1ET7A 3K6OA 3EO0A 2IPKA 5A7BA 1J11A 1H0DB 1Q1JL 2KDYA 1UTDA 1DVTA 4M1DL 3FAWA 2YRBA 4OFDA 4KKCD 4FQQA 3M07A 4PIRF 5D71H 3UABA 2B59B 2GSIA 2KS0A 5C0JB 2PWFA 3EYOB 1UADC 4DEUA 1DVFD 4PP2B 4C59B 3SB3A 1UCBL 1IM3B 3BGMA 4BRJA 5JW3L 5FO7B 4KMTL 4PRBA 2AEQL 2YLHA 3LIUA 4RA0C 4A39A 4PJCF 5IB2B 2YKLH 1I7UB 3TOPA 5IQ7H 3LEVL 1BD2B 1U21A 3FO9A 1OP4A 4AGQA 4RFOL 4LVHC 2DLFL 4PS4L 5EWIH 1EV2E 1IE4A 3KYKH 3NSXA 3FFCB 3V2AR 2Q2LA 5I1HH 1OWRM 4UOJA 2FZ3A 2FR4A 2G4GA 4TQEH 1FFOB 3VD0A 1WK0A 2VW6A 1ZA3A 1DQJA 1UXSB 3DIVA 2J8UA 3FU0A 4PJ9A 1X4YA 5HVFB 1OAQH 4HETA 3LH8A 3G08A 2WD0A 1JVLA 1E4JA 2CKBL 3A23A 5ID0A 2QGEA 5B38B 1XR8A 1MCRA 1PW3A 1QI5A 3NAAL 4KJPC 4YDLB 4BH8A 1UWEL 2D7PA 5DD6B 1DO5A 3QUZA 2XVKA 5BUAA 4L3AA 3V5HB 4X5WB 4NM4H 2NCMA 3HNSH 1WTGT 4OF6A 3MLZL 2MPVA 2R69A 1W6LA 3PXHA 4G1EA 4GQ9H 2RA1A 3LNHA 1AYRA 3D33A 5K1JA 4BD4A 3UMNA 2W59A 3JUZA 4JQIL 2PTVA 1WCBA 2AFNA 1FYHB 3JUYA 3QEHB 4WJG3 2AMUA 4OF5A 4AKQA 4AT6A 3JTBA 1YNKL 1OF2A 1NMBH 3PDOA 3LQAL 2M1KA 2VXSL 5INDB 5DFAA 2I26N 3S35L 1A1MA 2OBGA 5HGHA 3T71A 1L6XA 3FO0L 3P3UA 4E41A 1BQLH 5IJDC 3PPSA 3A6BL 3AM8A 3OF6A 3W1ZA 3WUWB 3KPNA 4N2FA 4FNQA 4EN3C 4QHLB 5FK9A 4F3FA 4FQXD 3CN1A 5C2UB 1H6EA 3WXVL 4PCTA 1D9KB 1NGPL 5GISH 4LSQH 2B16A 4HS8L 3WHE0 3WN6A 4F2EA 2NW2A 3GF8A 4N2OA 4Z3EA 3ARGA 3KPRE 3ARVA 1GZPB 4L8SC 3PLYA 5F88A 2G2PA 3K1DA 2F19H 1ADWA 1NC4B 1Z9OA 3FQXB 5DGQA 2E27L 3HPLA 3GNMH 4LLYA 3F2LA 5DJXA 4D0CA 2N01B 2NY7L 1ACYL 3D39D 5DJ2A 1GHFL 1FH2A 2VDQB 4RMTA 3T4YA 3SKUD 1Z9NA 1Q9WB 1ZMYA 4RIRB 1CC3A 3MGOB 5DHYB 2AF2A 5AENA 4PJHF 2YAEA 3LKOB 1KXQA 2GKIA 2ED7A 3ESOA 3SN6N 8CGTA 5FA3B 1FHNA 1FZOB 2ZXQA 3FU7A 1JZIA 5ETUA 4EQ2A 1NIDA 4NO5A 7FABL 1U0QA 2L7QA 3GSQB 2FEDC 5F3HA 3QZNA 1Y7VA 3OXRB 1FJ1B 5IWLA 3B4NA 3FBQA 3ZHLA 2FR4B 1JMXA 3WLWC 3VDAA 1GYAA 4J6RL 4IOIA 3VWKC 5E2WH 2QZQA 2APWA 2F54E 3GSNL 2FNBA 1SFDA 3H3KA 1QWHA 1F02I 3EOAA 2P3YA 1G7PA 2W92A 3GMMA 4LVNC 4ZODA 3GKWL 4UYQA 1TQBB 1GKOA 4N6RB 4OLZH 2FLBT 4YHPA 4U1SB 3RNKA 2JE8A 4DPAX 4WO4B 4X6DE 3BGFB 2R29L 1G6RA 2BIOA 5D7JD 1TTFA 5EU5A 4YGVB 1G6RL 1HE7A 5EA0L 3P73B 5AUMB 4RRPA 3VD7A 1WAAF 2CDGB 4OLXL 3QP3A 1KTDB 4G8GA 2FX8H 3ETBF 4HX1A 4IMLB 5E8NB 4A38A 4R7LA 3DK0A 3EO0B 2XQ0A 1EA9C 2NQCA 1JUFA 1ZT4A 2CJUL 1MCBA 2DWYA 3GTNA 3KYNB 3QJSB 4ONGH 4P59L 4APXB 1G9NH 2PXYB 2ZXWB 3QFDA 4YSPA 2EC8A 2JJVA 3P1VA 3TO4C 1BJ8A 2ZIDA 4KKAC 3HC0A 1G7LB 3ARED 5D1ZD 3M8OH 3KLHD 4Z0BH 2HJLA 2AC0A 2NXYD 2V5RA 1TJGH 4WO4C 5EBLB 5C0DA 2WNGA 3RY4A 2PCPA 1DQDH 4P48A 1DBAH 1ACCA 3ELAT 3REVA 3CSYB 2O6PA 2KLRA 1NGZA 4NHUA 2ZT9C 2ZYHA 2NUTA 3S37X 2ARJA 4B0MB 4CSTA 3UZVB 4MB1A 2DBJA 2GIMA 1WISA 2XTJC 1UXWB 2Y5TA 5E2VL 2R1WA 1QPXA 1BPVA 2WQAA 1DLHB 1G1OA 2NCEA 5F7HA 2LAGB 3O2DH 4JFYB 3TONA 2V9RA 3ZDXF 4MLSA 4CNIA 2GPZA 2XZAH 3ABGA 3BEWA 4ODXA 5LCVA 1Z9PA 4MAYB 5FB8A 5DA0B 3SQRA 3TV3H 2C7UB 4NP4H 3QGVA 3B7RL 3H2WA 1KG0B 3K72B 3EHBB 4J8RA 4XPBH 4XMXA 4MSWB 5FLVA 3TBYA 3QI9C 2VC2H 4JZNA 2IDTA 4U1HA 5GS0C 4LPXA 4PJIE 4FHBD 4GI6A 4XXDB 1TTBA 2Q86B 2VC2B 4YE4L 4WFHD 3HMXA 2G75B 3UTPD 2WZ0A 3BH9A 4JPWL 2YRLA 5KBPA 4NRZB 4PGBA 3VSUA 5JW5A 2Y6SC 4KXCA 3E6FB 5EFIA 5TH2A 1ZVSB 3BFQG 1N12A 4ELMB 3WAJA 2LQRA 1N7ML 3E3QE 2W9DL 1TU2A 2E6QA 4JKLA 2Y7OA 4TVPH 3V6ZB 3ZT6A 1CGTA 1UZ8B 3KH3A 1IU1A 1KBGL 3JZYA 3T2NH 4QJ5B 1NFAA 1DFXA 4L8DB 3T6WA 2HKFH 3MV8B 5IKCA 1MUJB 3LZQA 3SQOH 5AWNH 1UJ3B 3L6FA 1HZKA 1JF1B 2E74C 1JAEA 1FCGA 2VDML 4HWEH 5IW6B 1A6TB 3BQVA 3ZGIA 4XXWC 1T5XA 3L3KB 1E3FA 1DO6A 4JM2D 1U8QA 4YDJA 2XVLA 3RWGA 1UGKA 5DT1H 3II1A 3DVGB 4H26A 4LSUL 1MOEA 4F7PA 2BDNL 2HJFB 3DX6B 2NR6D 1QX1A 3L3OB 3O41B 3U7YL 4PJGB 4Z3HA 5JDSA 1CDHA 1JXFA 3WNPA 4ALAL 3KPSA 3ARSA 4RX4D 3CVIH 3BFWA 1JZFA 4O00A 4YXKL 1XTMA 2IFFL 3IMSA 1HHKB 1ORQB 2W88A 3RLSA 3QZOA 1C12A 1AXTL 4E5XB 3LHAA 1D3CA 3MOQA 5PCYA 2E75C 3QG7L 1JNLH 4G7SB 3QG7H 4JN1L 4HDIB 4ODBD 3RPBA 4AEIL 1NDTA 3DPBA 1L5GB 5I1HL 3NEEA 1RKRA 2P49B 3ILPB 3ILEA 4QYAA 3WUWA 1QBBA 1UWGL 3ZIYA 4IEFB 1KXHA 3IKCB 3UTZA 3VX0A 2ADJB 2NY3C 3MRQB 5L9DL 2GEQA 2NZ9C 2R0LH 4PCYA 4AE1A 3ULVH 4UILL 4U05A 4HOWA 2WVSA 4LLVB 4PMEA 3LJ3A 1AJ7H 4ZJ9A 3AREC 1AJ7L 4M3HA 3MA9H 5D1ZC 5CFAA 4RFEA 4AGOA 2XN9D 5C1MB 2D0HA 1PFOA 4JM2B 1IQDA 2EIZB 3S5ZA 4QOKD 1WT5A 4NUJB 4HXAH 5E7BA 1PNCA 5IMMA 4G1EB 1O0VA 2YUZA 3DUUB 2EIEA 4R7NA 4F2MB 3RWHA 3TIDB 3QBTB 5FO9A 2WXMA 1ZK9A 1FZMA 3QJUB 3CVHA 2XZQH 4DSYA 5DRNB 3VI3F 4G7VH 5DD6A 4R3SA 1O6TA 5DK2A 4APQC 5JDSB 1IGJB 5BQ7B 4LRIC 3M7OA 4HKJB 2BC4A 1EHNA 4OLVL 3X2QB 2F8IA 3O2WL 4NFCA 1EHLH 4J2XA 4AIZB 2WZ6A 5KSAA 2HVJA 4GQPH 4LCVA 3H1ZA 4HIHB 2Q8BH 4Z3FA 1T3FA 1FGNL 1KENL 2C7FA 4QRBA 2FZ3B 4G3YL 3LNIA 4X4XA 1A4AA 5LWYH 1HCVA 1A7NH 5DJAA 4LKXA 5JQHC 1BBJA 5BJTA 2WGXA 3RZCB 3F6IA 3TEWA 2CRYA 2GJJA 5K1NA 3L1OH 5HBBA 5TQ0L 3F58H 2Y7MA 3IWUA 5F3FA 4ZMAT 3GINA 4O02A 2CRIA 1T1YB 2VXVL 1C5BL 1CBVH 4A2EA 4BDVB 2Q3ZA 3O11A 4HIPA 5GS0D 4P8QA 4C58B 4LPCA 3GPSA 3DV6B 5EO9B 4H25B 3EYQC 2XDHA 1M2VA 4FTVB 5K9OB 2J6WA 2Y2YA 5KJRL 3D8MA 1EMTL 3BDYL 5EIIG 3O45B 4BSWB 2DQIL 2N1TE 4PG9B 5BQ7A 3QPQD 1F4WL 1XCQB 2OMTA 3LRSB 5J3HC 3T4AA 3DPDA 3VD3A 1G6RH 4GUPA 4JFDE 5T1MA 2OMXB 2DH2A 4RSYA 4XAKD 1N5AA 4NZRH 5D2NA 4N0UA 2MTAA 4ZX5A 3GI9H 4XCYB 4N0FA 1RIUH 1MRDH 2QPSA 1DJHA 2OMYA 3KYAA 5IIEA 1I9IH 3IDXL 1JZEA 1D6EA 2G60L 4MCMA 4P06A 5I6XC 1EDYA 3I50H 2OTWA 4JM2A 1JZ6A 4DOHB 1AHWA 5EZJA 1Z5HA 4E9RA 1A6UL 3TVMD 3BUPA 5JPMA 3TURA 1PAMA 3L9RA 3OV6A 4PUBL 1WITA 2CMRH 3K2KA 4YN3A 1HYSC 5ICZA 3NIDF 4GXUN 3WEBA 2GB2A 2LABA 4YHKH 4QHNA 4TSCL 4LEXH 2R8SL 3PDGA 5I0XA 4S1QL 1FN4B 5F7FA 3KVQA 5I8CB 3ILPA 1XH2A 1XD1A 2VO8A 3DI2B 2B1HH 3SGEI 3N42B 1EFQA 3TN0B 1H3PH 3BESR 5I73B 4KI5F 1K4CB 1MRFL 1TPXB 5BOZG 5JA8B 1MRFH 3FRPB 5C07D 4J7RA 2Z7WA 3TPKA 1IGTB 1VFAA 1UWFA 5E5MB 3MJWA 4Y4KA 1HHKA 1ORQA 1HWWA 3NQKA 3QCUL 5DJCB 3BUYB 3FQ1A 1OZTG 5EOCJ 5ADPL 4LHUA 1II4E 2JI2A 3ROOB 4OVUA 1OAUL 3D69B 3G9AB 4FLOA 5DQ9B 2GTWA 1OAUH 1QATA 5DD3L 3B8SA 3NJIA 3BIBX 3QIBB 4CA4A 5L2KE 4GQQA 4R26L 5KSBF 5FDWB 1E8WA 1DLFH 1S7RA 1E27A 3S3BB 1J0KA 4LLQB 2OMVB 1KTLB 2FX7H 4GKLA 1NIAA 2YGOA 4ZAKB 1J0YA 4HCIA 1MUJA 4NCDA 4UDTA 1NICA 3FRUA 5ABDE 2YC1B 3APFA 2P5WD 4QYOB 4P0DA 2H1XA 2VZUA 1B0GA 2JB6A 3B9EA 1KZQA 4KK6D 1OQXA 3R06A 2R2HA 3ZYIA 4KKCC 1BCIA 5DD0L 1JXJA 1LWHA 3VTTA 1KLGA 2RIKA 1G7HB 3KEHA 1XF3A 3D0VB 2F08A 1EZUA 3KPRA 3IMUA 3DSNB 1TITA 4ZTOL 3NAAH 4ZTOH 1CL7H 3ULVC 4KNUA 4LLDB 1NDMB 2V8MA 3LKSB 2PPFA 12E8H 1WHOA 1KIPB 4UMGA 4A2LA 4BFKA 1BF5A 2O6DA 3KXFE 4FXKC 2B1AL 4TL4A 4JFOA 5BO0D 1KJ2A 3ULUD 1F8TL 4BCZA 1WHPA 1X9QA 4L9LC 1D5MA 5D5ME 4NNPH 3WFEL 2Z31B 1S7RB 2UX6A 3QQ3B 1MCWM 3JV5A 4WV1C 5L2JB 1T2QH 3KPRD 2C7UA 3MTRA 3IFPA 3QG6B 3CFUA 5CZXC 1SJHB 3H7BA 5IMKB 1AR1B 3LH2L 3KJ4C 1RI8A 3KM2A 1NEZG 4G83A 5F1SA 4DGIH 3OB0K 2VDPB 1F97A 3M6DA 3OKOB 2MCPH 4Y16A 4M1GL 4J3UA 2XHNA 3PYCA 3WD5H 1HNFA 4G8AC 1NDGA 5DEFB 1NCAH 4XVOA 4KK9D 2HKHL 3BP5A 5KANG 3PQYD 4JG9A 1RLBA 4M29A 2FSDA 4OZ4A 5CP7B 2QSCL 3KLQA 4Q9BA 2HX9A 4YXLL 3D30A 3KWWB 4OZHE 1RZKL 4WI5A 3VRLF 1OLLA 4YBLB 1LD9B 2X6BA 4IOSD 1N4XH 1I8LC 3IK2A 2F19L 4YHIA 5BZWB 2CRMA 4RVBA 1U92B 2EDLA 4PJ9C 1WBYA 4Y9FA 4DUWA 4XRCA 1TTGA 4DUVA 3UG3A 5HHPA 3WKMH 5E2UL 1KUMA 2VLJD 1MELA 3BC9A 5TPWL 1B2WL 4MA3B 2NY0B 1F0LA 3CNKA 3K6FA 4XMPH 2IWKA 5T3XD 1OQOA 1TVBA 3MJ7B 4IMLA 4D9LL 3MRKB 1KYUA 2QHRL 4FNPA 2K1MA 1J5OL 1I9JL 3VGEA 5F6IC 3D52A 5TFSH 2Y3NA 3MBWA 3QXUA 3RWFB 3SOBL 4ZFOL 1T1WB 3BZDA 3AY4C 5DC9B 5L9DH 3NYKA 3PHQB 1BVNT 1S78C 1NCIA 1VIWA 4PS8A 5D1QD 1IKNA 2YPLE 3LCYA 3TFBA 4YBLC 4C4BA 4IBSA 1BF2A 2H4EA 4V1DB 4XVJH 2P24A 4N9GB 4PJ9B 2QVMA 1PYWB 3KGRA 3MR9A 5EO9A 3CV5A 2ZUQC 4JFDA 2J72A 4OZGF 4JHVA 4DAGL 5BS0D 1RV6X 4PR5A 1IX2A 3DX8A 4HH8A 3E38A 4QRPA 1QRNA 2NNAB 1U8KA 3QK0A 3CZFB 2OM5A 3GJEB 3WE6A 5IVXB 4HS8H 1XGPB 3T6VA 3RZCA 4PIBA 4DETA 1NCDH 3F58L 4HSCX 1HHIA 4JFQB 1V05A 1YEWA 4Y4HB 2Y5EA 4ZMXA 2R4RH 1NLDL 4G82A 1R5IA 3T3MB 1R4XA 1Q9WA 5EOCL 4HH9B 4AYSA 2D2CC 1EEQA 1EVTC 2BOBB 5D2LF 1VGEL 4GRWF 4U0RB 4CU8A 1WT5C 25C8H 4JO5A 5FS5A 5C3IA 1BJ1J 3RVWC 3JZ7A 1CE1L 3UBGA 4BJLA 1XIWC 3FQ2A 3NJKA 4CDGC 4K94L 5CKGA 1L9QA 1KZYA 4Q9RL 3HE6B 5HP5A 1CXLA 5MI0C 4NB7A 5DHXB 1OCOB 2YD4A 4X5XB 2ZSWA 1N59B 4OJFL 3G6JE 4OAWB 4ZOAA 4QOKB 4NZRL 2NYKA 4OZGB 1C5BH 2IAND 5EN2B 1YEGL 3TFKC 4DCQA 5FK9B 3QNFA 3EJUA 5HGAB 3KPNB 4NUJA 3HPJB 3U2JA 2IBZX 3MX0A 5DZNA 2EDNA 32C2B 4NWUL 2M8XA 2GUOB 3TPUA 4ADIA 1UUNA 4PBWD 4KH9A 3WS6C 4LPTA 3QUYA 1XAUA 3VGDA 4PRDA 1UC6A 4O2CB 3F62A 4X6CA 5CP3A 2H6PA 3S0PA 3U9PH 1OW0C 1SPDA 3OJVC 1TG8A 2HUEA 3MNWA 2YSSB 4QKXB 4ESKA 1UH4A 1D6VL 4POUB 4EN3D 4P2OD 1AHKA 4H8WH 4WI4A 4U3XA 4EBQL 1C12B 5CLWA 4LCWA 1RZPA 3MO1A 4YE4H 4XTRD 4FYSA 3I9GL 4BQ9A 3DMMC 3Q5OA 2F53D 4IDLA 1T20B 4GT7A 4RISH 4LVEA 3R0NA 1G9NL 4RISL 3ARXA 1SUJA 4MMXC 5I8KL 4FCAA 1WBXB 1ZCRA 1U8QB 1NIEA 2J6EL 3SKJH 4XO3A 5G5DB 2J6EH 5GGUA 5JO5A 4O2EB 3P2BA 5EOTA 1YRKA 3QW9A 5EEZA 2XX0A 3IDJB 9PCYA 3OPZH 4JJ5A 3T6XA 5I6NA 5GGRB 5CJBA 4HG4K 1MNNA 2IOOA 5BVJA 4KY1L 4PSPA 5SWQB 3HFMH 4PU2A 4DGUA 2EDMA 1WEJH 5GZOD 5HYJB 4UM9D 3O8XB 3FO9B 5F96H 1VKXB 4HD9A 1X4XA 3Q2VA 3ARFD 5BUPA 2VERN 3ZHDA 4HHAB 3WKYA 2PTTB 5IB5B 3TZVB 1DVFB 1KN4L 4HK3J 3V52L 2I5YH 4U7SA 3GJFK 2A74A 1P4BL 3RGVA 1TTUA 5IVXE 1A1OA 1VFOA 3REWA 3QXTA 2B59A 2GSIB 1E27B 4FHJA 1NPUA 4RA3A 3GMLA 1BZ7B 2GC4C 3B7SA 4HC1H 4G8FA 3ZQWA 4UQBA 3G6AB 3VFPA 2UY7B 2Y6TE 1ZLDA 4YL4A 3IJSB 4Z76A 5HHQA 4CVZA 5F7EH 3UAJA 3ETSA 1XF2A 3H0TB 4V2CB 4LRNH 3VXSB 3UROR 4PRNB 3UTQB 2CJTA 3HG1A 1N8ZB 1QRND 2B1AH 4G42B 3NJJA 2P52A 1OSZB 3GSOB 2KPNA 3P0YL 2IPUK 3P4MA 4R4FH 4YH6A 2WNKA 1ZT1A 1T2QL 2CLZB 4NQVA 1XSJA 5I76B 2V37A 2FEEI 4JKWA 3WIIL 3QHZL 4HS6B 1RJLB 3WIIH 1UT1A 1TZGH 4P2QB 3H53A 5ILTL 1HL9A 4JFZL 2Q87A 4AGPA 4X80H 1IMHC 4HUCA 4KRPC 2MCPL 4KZ0A 3WLBB 2D4DA 2GTZA 4AEHL 3ML8A 4HSQA 5GGTA 3CFJB 2AABL 3NP4A 4PI2A 1FNGA 5L88L 1S7XB 4XO8A 3HRZC 4TLKA 4CSZA 2FT7A 1GGUA 4DGWC 3HG3A 3QNXA 1IBGL 3UAAA 3ZDXB 3C6LA 1SN0A 4ODVL 4PV9B 3RIAF 4CBPA 3HHMA 4EIUA 1FE8H 4UNUA 2E9JA 2BVYA 3NH7H 3ES6A 4L3EB 3CZLA 2WBJD 4M6AA 2VDQL 3HC0B 2OMXA 1H3XA 5I1DB 4EUPH 4FP8L 5HGDB 2G9HA 1HHGB 4Z77B 3OLGA 3C2SA 1XCQA 2IO5A 3D4CA 3NT0A 2UVEA 4L2YA 2E76C 4KBPA 3RL1A 5EUOF 1BM3H 3EYVA 1KXVC 4PYGA 3EFOB 5SV4A 3V4LA 4K5LA 4DZBB 1WD9A 4QXUH 1E4WH 1C9SA 1OGAD 5AG9A 2X41A 5I66B 1BQKA 2WUBH 1I9JH 1T03H 2K7QA 2PYEB 2PYFA 3TA3D 5KVDL 4H5SA 4YPJA 1UWGH 3O6LL 4WO4A 3FT1A 2ICWA 2R0WH 1Y6NR 4K2UL 4LASH 2WCSA 4QRQA 4HBCH 5JUEL 3AQXA 3FT3B 3QWQB 2OZNA 4Z7VF 2R0LL 3QR0A 3WL9A 1BGXH 5DUPL 4JCWA 2ADFL 3AWFA 1S5IH 4U1LB 1MAKA 2OPCA 2XKNA 3NK4A 2CGZA 5AVQB 3DKHA 1TTRA 1MEXL 3PNWA 4F33B 1HCFX 1U8PB 2X4OB 3VRIA 3N43F 2P8LB 4GKZA 5DC0A 3UTTE 4HKZA 5ECGA 5IBLC 2F1EA 2DQGH 4L4TB 1A7PL 4RH4A 2R15A 2P48B 1EXUB 2NXYB 2AVGA 2R4SL 1M1XB 5JIDA 1BIIB 3QFJA 4NYLA 3ULAB 3VRLE 3OLDA 4OZHF 2YS4A 1O9VA 4F37F 3V5KB 5EUOB 5AVRB 2CKBH 1OAYL 2G60H 3VFRA 3HZMB 5LB1A 2HN7B 3UTSE 5AW8B 2K4WA 3ZE2B 1VRSA 4U1JB 3T3PB 4Z7NE 2J3SA 2BS8A 3LPPA 1NPJA 1A25A 3H55A 3L2MA 1FYTB 1A7RH 3SBWC 1A3QA 2R0KH 3L5JA 1A14H 4G71B 4WI2A 4JY4A 4NAJA 2QQNL 1CI3M 5CHNB 1NFDB 4IBWA 1X5MA 5AW0B 3FQWA 2G3XA 3QHFH 2NXYC 3V7AE 1E5AA 3WOVA 5DJ8A 2NXZD 4Y2DC 4Y88A 4YLBA 1MWAA 1LTXA 3EHBD 4MNGA 3EGDA 1FVDA 1E6JL 1TQBC 3NTCL 4PJIF 4XTRC 3G5YA 4A7TA 4L3CB 2DH3A 2H8PA 3O9WB 1GS6X 2UYLA 3DVNB 1CGSH 1I8MA 3MLYL 5J06A 4N3UA 3PGCB 5H8DA 4X7DC 5INDA 4R0LB 5EZLA 5F7DB 1O5PA 3FO0H 2FQFA 5H4YA 1ETZB 1E4KC 1GTNA 5HVGB 5HJDA 5IESH 4N3TA 5G2NA 4R26H 5C8JB 1EMTH 4MX7A 1AD9B 3BWZA 1XF4B 1C5DB 3FCBA 3O3AA 1H5BC 1Y18B 4JDVA 1MCIA 2NW3A 1CFQB 1RU9H 4DK6A 1NGPH 4XMLH 4UINL 1MIML 2Y4SA 5T5FA 1BP3B 2GK0A 2HLFC 3MRPA 3HZMA 3ZL1A 1O5DT 1YEJL 4M7ZB 1EJOL 1EJOH 1TSHA 4IU3A 2GBVA 1CLYH 1ZD6A 1CLYL 3MLPA 3I9GH 1K6QL 3VGFA 2VLJA 1S5HB 3Q2CA 2CPCA 2PPAA 3FF7A 1ZLVK 5GS1B 3GJEA 3WE6B 1MFDL 1BV8A 1MJUL 4GUOA 4PJIA 5FFGA 3F6LA 4PUBH 2HWZH 3L5XL 3SKOB 4FQXB 4ZX6A 3GLAA 4PR5B 1W6WA 2V8LA 5ACMA 2WQ8A 4H44C 2WLKA 4P5MA 2PYFB 1JV2B 4UTBA 2WYIA 3ARBA 2VN5A 3ZE1B 5JPNB 2IALB 4YHZH 1NEUA 5EUKA 1KLFB 5EIQA 4FMVA 3W56A 2O93L 2EP6A 4N8CH 4PW4A 1I8AA 4U1MB 2YBGA 4NI3A 1JHTA 1SLVA 2NSMA 3K0YA 5D7LB 5ACZA 2F8OA 4NQXB 2OL3H 4U4BA 3TIEB 1P53A 1KNOA 1CDUA 3NIDE 2BP3A 3GJFB 1OD7A 3L3GA 3GKWH 4EOWH 1IGCH 3AXLB 4HC1L 3IMTA 4HC1A 4BQ8A 1S9KC 3HG1D 4I0PA 3QZMA 4K9JA 4MA3A 5C6TL 2J8OA 1DLHA 2V5YA 3V55A 1PVHA 5B3SB 4UAOC 3EOTH 1YUHB 4LCUB 4X9GA 3L5IA 4YSTA 4QGYA 3AABA 4UYPA 5E08L 2CLVA 3CFJA 4Z3GA 3BAKA 1YC8A 1T83C 1AS7A 3IMRA 1KPUB 3F5WA 3ZYZA 3UAEA 5HGGS 1KB3A 3I2CH 5FUOL 4HMDA 3WXWL 4L37B 3NSJA 4Y1AB 1I4FB 3CDZA 1WAEA 4FLRA 2C1PA 4IS6A 1QOKA 4O51B 5DFWH 4KMLB 5DVKA 4K3EH 1TZHA 3GSUB 4KC3B 2A99A 4JB9L 4AZ8B 3C5ZB 1GKEA 2Z1PA 1KGUA 2XWBB 1DQDL 1RUAH 1Z5YD 4PJEA 2CR0A 1H8LA 1EZLA 1LNUA 3LMJL 3SYAA 5TFSL 2CO6B 4BIKA 1FYTD 1JUFB 3EYUL 4Z0XA 3QUGA 1SQMA 5IW3A 35C8H 1ZGLA 4EZKA 1MFNA 2DTML 3CX5J 4HWBA 2V3FA 1U8MA 5CF3A 2C3VB 2HT3D 1OCRB 3AMKA 3O2DL 3DX7A 4OZFG 1XWVA 4J4PC 3VAEA 4CC4C 5D1ZI 4FKEA 4QHUA 3CFEB 1FV1A 1BJMA 5HYSA 2BP5M 5HDQH 2G3NA 1WRFA 43CAB 4JFFB 1DVFA 1LDPH 1RP9A 3K0WA 3N1MC 2I7SA 2WKGA 1B4RA 4NP4L 4ZD3L 4K7FA 2IDCA 3NCFB 4WF7A 5CM1A 3BCFA 3GRWH 5AB0A 2V2TA 2P5EE 3IS0X 4JHUA 1BREA 4G6KL 4KKBD 3ROLB 2K9UA 2WYZA 3IJ8A 1A1OB 2YMOA 1KGCD 1ROWA 3C6SB 3IDMB 2Z93B 4OGZA 3OXRA 5EEWA 1MJJA 2GG1A 4FJ6A 3O0LA 1KB5L 2VUKA 3HI6L 4NO5B 3TX4A 5KG9B 4M4RA 4YEEA 3FTGA 5CS7A 4BQCA 3JWNE 1ACYH 4WDIA 1U2HA 3HC3L 3WKML 1AQMA 2Y06L 1KOAA 3P4OB 4XNXL 1FSKC 3MCYA 2CK2A 4MJ2A 4MFHA 3WHE1 4WEMB 2OTUA 4K94H 4HFWA 5FDWA 3CIAA 1BAGA 1A7BA 4XP6L 5DD1L 2AW2A 2O5XH 1F4XL 4M48L 4WTQA 3DBXA 1DDHB 1SM3H 3EOYG 4CN4A 2B9AA 2Q7YB 4KH2A 3D1MC 3QJFA 1QBLH 4AUJA 4MX7B 3L1EA 4PYHA 3Q13A 4JMXA 2BSRA 2X4SA 4KKPA 2CKNA 1AOHA 1N8OE 2DLHA 2ATAA 1S5IL 4BWTA 2WO3B 3E1ZA 2YA1A 5E2WL 3U7YH 3CC1A 4EI5B 3TN0A 4YMPA 2BFVL 3DUSA 4M7JL 3VD5A 4JZJA 4XMWA 1CURA 4NUQA 1U2CA 2CIIB 1JWUA 5BZDB 4M03A 3MX0B 2CDEB 1HDMA 5J5EA 5JXEA 4NC1C 5CEZD 4LDCA 5CR8A 3S96B 4CADB 3DX0A 1IEHA 1MDTA 5C09A 3DYMA 4JRXD 2Y07H 3CZGA 3QUYB 2XVGA 5IMOA 4ZUTB 3RVXD 1FGVH 1TNNA 3VSTA 4LSDA 1SXSA 4Y9GA 3FQWB 3E2HB 4BK5A 3K7UA 1PKQE 2HT2C 3DXAD 4FERA 4MB4A 2MPAL 4P46B 4YDMA 3ZDYE 5HGBA 2ZG3A 3BKYH 3HFFA 5EZOH 1UYWL 5AVTB 4TUOB 3KW8A 3NBNA 5D4JA 2Z8VC 2F68X 1VGKA 4LOUD 2PXYD 1X7SA 4KGLA 3VWKB 3SEPA 4NSKA 5JZ7C 1PY9A 4PRHD 3RVUD 3M46A 1FH5L 2I60H 3CDCA 3H54A 2QPUA 4F20A 4S0SD 1A6ZA 1QFOA 3HZ3A 1U58B 3MLSH 4NN5B 4OU3A 5E2TH 2WBXA 5IB3B 3UFIA 5D6CB 5E2TL 3MZGB 3K91A 3FQTB 3O4OB 4KQ3L 1QZNA 4K5MA 2H0JA 3CFKB 5HYIA 4BKSC 1BYOA 1HI6B 1MCNA 2FJHA 2R56L 2XLLA 3D4GA 5AG8A 4XHQA 2ZCHL 3O3DA 4LT7A 5TGBB 1IFHH 1RIHL 2YWZA 4MNQD 2IMNA 3UERA 4XP4H 3VWJA 1JVOA 4P5TB 3LQAH 4V2BA 1YEFL 3G5VB 2X40A 3SE8H 3EO9L 3BIAX 5CZVL 3T1FB 1AZUA 1T89A 1TXKA 4J3WA 4HK0A 2ZUXA 1DQML 3HG1E 2VN3A 2CAKA 1IZJA 2VO5A 2E7BA 3D05A 4H20L 4MHHI 3RVVC 2EDXA 1IM3A 2ZX6A 3RX9A 5HDBF 2DWEA 3T3MF 2M2DA 4OCLC 4Z5RA 3SQBB 4NQUA 2YJQA 3FAXA 5D7JA 2X0VA 5DVLA 5JHDD 5L8JB 2NSXA 1Q0YL 3QIBC 3C5ZD 1J10A 4Y2OA 2HJKB 1L9MA 1XZ0A 1H0DA 2BJML 1NCJA 3BP6B 1KGCE 1NCWH 3BT2H 3FSZA 3BSGA 3HLKA 1SXZA 1RERA 1T7WA 1ZE3H 1T5WA 4R7VA 3ZGHA 4X8JA 1ZV9A 3V8CA 1A6ZB 4DOHE 1MCJA 4K0OA 1J87A 2EE3A 2HX7A 3EKCA 4GKNB 5I28A 4UT9H 1QTSA 4BV1A 4ZUUB 5GS2D 5EC2A 3X11A 5I1IH 4Q7DA 1M6OB 2GAZB 4ZPTA 4PBXA 2GSMB 5BZWA 3FN0H 3ASWA 5A7EA 3QQ9C 3U6XA 2Y22A 4KDTA 3OPZL 3TBWA 5HHPB 4RMQA 5BMFL 4WW2A 3H9HB 2QFPA 2HZHA 4DN3L 4EIGB 2Q20A 2K9FB 1V7NL 3L4UA 1Q0XL 3BUDA 3BWUC 5C09B 5ERWA 1Q9LA 3C09C 1KPRA 2CQVA 3MLXH 1MLCA 4PSRA 4ZUWB 2JSFA 1L0YA 4NS0A 3UTSB 2FO4B 4HS6A 1IIKA 3UH8A 1D5RA 4BFIA 8PAZA 4AXWB 1KGJA 3EH1A 3PF2A 2A74C 4RGND 5ESAB 4A6YB 3HVNA 1PJWA 4XNQA 2FVNA 1JXKA 1KT2B 3RJDA 4HMCA 4AKOA 4E2OA 1BZ9B 4KKBC 5CLYA 3KLKA 4AYBA 3DO4A 5F9WC 4C56E 2IH9A 3W5MA 5HYFA 3EH3B 3KJ4B 3NIFB 4N85A 4ATWA 5HHOB 4GRWH 1M6UA 4FNUA 1GJIA 3VA2C 2QTVA 5CIPH 1FFNA 3SBPA 3LKNB 1DUYA 3DSFL 3O6LH 4N5UA 5GJTH 2WXRA 3C09B 3L3KA 3QQDA 5FUOH 4YFEA 4ZMVA 4MYWB 3IF1A 3UTTA 4YE0A 3X12B 2AS5M 4PRIB 5C07A 2JFCA 3MA9L 2IDSA 2IG2L 1KJ2B 1E4XH 4NLHA 2FGWH 4TUKL 5E4EC 5KYXA 1SVCP 2Z64C 5FFOA 5FUCE 1PIFA 4HHAA 1VEOA 1T4KB 1ZPUA 1LDPL 4HXAL 3V10A 3VFOB 4UTBL 4G43A 1YZZA 1ASQA 3CHOA 3LEXA 3D08A 5CEXA 1IAKB 4G6KH 3ZU8A 4NHCH 5KYWB 1FNFA 1FL3B 5C6PB 1UUSA 4QTHA 5BRQA 3RPIB 3S5LA 4Y5YA 5JDJA 2PWGA 2X4RA 1W0WA 3FONB 3ROLA 1QSFD 4NRZA 4PJAE 1A8JH 5J89A 2G75A 1HH6A 4JO2H 3FRUB 3RILA 2ILLA 1ZWIB 3AREA 4MJHA 4OM1H 5D1ZA 1LILA 43CAA 2ICWI 3VGHA 3ECQA 1MAJA 1KTLA 1N3NB 3AFLA 5IT2L 1SMOA 3MRHA 2FIKA 1Y07A 1XBRA 1KPVB 2CBQA 2F18A 1DCEA 2YXWA 2R0KL 5CN2A 4MNGE 1RJYA 1IKFL 4LP8A 5DUMH 3TTYA 3IPBA 1BX2B 4QIRA 4YR6B 5LO7A 1FO0B 1BIHA 1G9MC 1KCVH 2JV6A 3PL6B 3HUJF 2VTFA 1B90A 1OT2A 1E5BA 2ITCA 4X6EB 5I8OH 3RTQD 2VMFA 2F1BA 4LRIA 3HC4H 3TYFB 4OGAD 4PTUB 1SBSH 3H85A 3ORJA 3UJTH 1E43A 1HT6A 1M1SA 3O3UN 4HP5A 5C0ND 3T0VA 3V0VA 3RX8A 1N7MH 3HAEH 1M7DB 2XNAB 2YD3A 2BPBA 4PLKD 1I4FA 4WNQA 3ME0A 3QRLA 1KBGH 5IQ7L 3WSQL 4FLQA 1C16B 3KR3H 2WLLB 3FQUB 4OCWH 4XP6H 5DD1H 1E9OB 1EAJA 4KROC 1L6ZA 1LEIB 1DJYA 1F4WH 3DECA 5D7JC 4Y2DD 1RUKL 4LLUA 3RZCC 2ZSVA 2YUXA 1RUKH 3DURB 5KAQG 3JT0A 1N5AB 2PP9A 3OC5A 2DRUA 4IGBC 1MXGA 4XMLL 3BPOB 1OE1A 1W72B 3IJHB 2FYYB 3FL7A 3UL4A 3ILQC 2VLRE 1QD0A 4HEPA 4TQEL 4AQ1A 5IB1B 5B7MA 3JSSA 4JDTH 1H3UA 4MQTB 5GJSH 3W3BA 1J1XL 3LZRA 4N0FB 1SHSA 1MFEH 1MFEL 1FAIL 2KLSA 2OCFD 3QWRA 2GABA 5AAMC 4KWUA 5TD4A 3G04A 3X1EA 4JLRB 1IVLA 1MVFA 3FFCE 3QUMA 4EZMA 5SWZB 2IH3A 2PP7A 5IW1B 3TJHC 1FH5H 3CFMA 1NKOA 2VH5L 1CT8B 4KJWD 4GG6A 1ZPLA 2Y36H 3KLHC 4L18A 2H2PC 2OJZL 2CMRL 2Y36L 1OGAE 3RUGE 3MLSL 4O02B 4WO4D 4Z7VB 3EO1A 3GEWB 1H19A 3BT0A 4KZCA 4P23D 1G0DA 2P46B 2IAMD 3QS2A 3CPLA 3ESMA 1KN2L 2IGLA 3QDJB 1J12A 2LT9A 1T6BX 3S36X 3TT3H 3LQAC 3TJPA 3FTVA 4FC3E 3W0WB 4UQEA 4UILH 3HUJE 3QZWG 4OY9A 1NBCA 4P3CL 3ZTJG 5C9JB 3IGKA 5B7EA 2BIPA 2PCFB 1O7SA 4PJCA 2XY2A 4JZJC 3S2CA 1A6AB 4U6VH 1T3FB 3BIKB 1RXLA 2P24B 4NRYA 4XNZC 2X9YA 4ISVA 2FNWA 2VM4A 4RLDA 4E0RA 4EIZC 4YVUA 3VQ2C 1DQMH 3PP3H 4PRAA 4PJAB 5DJAB 2BC4B 3RKDC 4QCIA 4NT6A 3VXOA 4Q9QL 4N1EA 2BM3A 3EF7A 1HL8A 1WFUA 3MGTA 3QORB 1RU9L 5CJQH 5FW8A 4X4MA 5F8QC 2XA8L 3CFDA 4MHHG 4AIZA 2COVD 4RWYL 5D2NC 4RWYH 3N0PB 2IWEA 3FQXA 1Q1PA 4FMFA 5D7IA 5IJKC 1IZKA 1MCFA 2Y1VA 5F0LB 3TWYA 1X6NA 5TK4A 2NYZA 4Z95H 2AERT 2WZAA 1P9MC 4U7KA 4A7VA 5C92A 5EZLB 5D7SL 4M61B 4N2NA 3MBEA 1EEUA 4CC1A 2Z4QA 1F4HA 2FATH 1RH8A 1J1PL 3S8FB 2MKWA 1QASA 4IYKA 2D2OA 3MNZB 1M7DA 3EBIA 4XNMA 4OJFH 1F8TH 1ZSDB 1Z9SA 7FABH 4J3OH 1ZS8B 2DWDB 1BAFH 2FUQA 5K39B 1QW8A 1AYOA 1NDGB 2E4FA 1WFMA 4TOYH 1JNJA 5LBVA 1CDJA 3QT2A 1OALA 4AUUA 1DANT 2AJZA 1ND0B 4ZW5A 3DJSA 3D3VD 3M1OA 2AQSA 2HG5B 3EFDH 1HE8A 4G59C 2DOCA 2XRAL 1KTCA 4D9RE 3CBKB 1OAJA 3D34A 5EIIA 1VLXA 4I2XA 3NFPB 1BQRA 1HTYA 4UM9A 2DWTA 4LSPH 1KWGA 4J3BA 2J8UF 1ZIAA 3IU4H 3KNBB 4XCNB 2WIIB 2HJFA 3DX6A 3RIFF 1AGCA 5HHNB 1S9WB 1Q0XH 4NGHL 2DM2A 4NGHH 3BO8A 3SCMC 4HIQA 3PFUA 4ZOBA 1OK8A 2X2HA 4LSRL 3ESNA 3S5LB 4NQCA 2CIKA 1AXIB 4EPSA 1YSOA 4LLAA 1UWYA 3PAZA 3SKNA 1FRGL 5F1IA 1FL6A 5TH2B 3NJGA 5ID1A 3GBDA 5TPWH 3BD3A 4PGBB 4Y16C 3MLUH 1BD2A 1MH5B 3BXNA 4N8VG 2X1XR 4XMPL 3VXSE 1A3ZA 3V95A 3ECBA 3FBKA 5DGRA 1RZGB 3BWAB 4LKCA 4UTBH 3Q06A 2OYPA 2OCCB 3VGAC 5JMOC 3L95A 4P9ML 1YHPA 3PWUA 3UC0H 3ZE0B 1RUPH 2LW3A 3IBOA 2W0FA 1WWBX 35C8L 2EABA 2IH3B 4M93B 4KHTH 1FPTH 2BIQA 4L8CB 1D5XA 1FPTL 2XN2A 1R3IL 3C8KB 5I16A 1ET8A 1MLBA 2JJTC 5EU6E 1UD8A 1SY6A 4RDQF 5IOPB 5FIEA 3B43A 3N9GH 4MASA 2CK0H 3L2NA 2CO6A 4JPVL 2VUOA 4S1SL 3QFJE 1AP2A 1KGWA 1IRAY 1YPZE 1QI4A 4ZW3A 5F3BA 4U6HA 3S4SB 1KT2A 2DQHL 1NCNA 5F9OH 1UCTA 2LLNA 2ITDB 2ARJB 1MFVA 3O6KL 4KDWA 1WGVA 3PWNB 4Y4KD 1E9OA 5DMGD 4RFOH 1DZBA 5FGCB 3ZY7A 3VGAB 3C6LB 3UTSA 4AE0A 1QUNA 2CALA 4GXFA 4UF7C 3B2PA 1B4JL 2WBKA 4R7XA 1JGLL 1X7TA 4UIKL 3KPMB 4MMZC 1VESA 4HEME 2CCWA 4JPWH 2QDVA 4EDXA 2YLKA 1QEWB 3MBXH 4K3DH 3STZA 1NFDE 3IB4A 4B27A 3T6QC 3D9AH 1AHMA 1S9XB 4WNJA 4O5LL 5B1JC 1I7RA 2ZNWA 4YDKH 4X5LA 2VIRA 1UWEH 4XOAA 4XX1E 3N44F 1KTKE 2ENPA 1ACXA 4RGMB 2VDOH 2ZPKH 3IJYA 3MLWH 4CAGA 2XTLA 1FO0A 2QVIA 3VFNB 4A6YH 4I18A 1UVQA 2Y3AA 3HUJA 3SDCD 4DGVL 3AROA 4JHAH 1BZDA 1P69B 1RSFA 3C6LC 4JRYE 4P2OC 4KQ3H 2WPGA 2HT2D 1YAZA 3GB7A 1YLBB 3OMZA 5A2IH 4HW6A 3WLWD 4H2AA 3TCLA 1EBPA 5A6IA 3GZKA 5K9QG 3C5SA 5HHQB 1P7BA 5T8IA 2JQMA 2LU5A 2IALA 2XKUA 2AXGA 3VFPB 1I7ZA 1NBYA 4M3KB 1IM9B 4OUOA 4WFEE 4P5MB 5EF3A 3A6BH 3FO1A 4HIEA 1BM3L 4XR8C 2H32B 5DQJB 1L9PA 4AGLA 1BF8A 1I3RB 1F1AA 2VH5H 3CSTA 3S35X 2GSGA 5IV2A 3DX1A 3RDJA 1MHEA 1BYNA 3NEOA 2BWQA 3LEXB 3ECBB 4NQQA 2NPLX 3EDKA 5F3HB 1TETL 2HKHH 1RUMH 4G7YH 4WRLA 2LAAA 2K6WA 3PCYA 1G94A 4QEGA 3RVTD 3RFZC 2WP3T 1MVYA 1PZ3A 1QLFB 2V5MA 4HJIA 3RDTA 4WJ5B 5D5MF 4C56A 2YXVA 2ED9A 3M1BA 5TGBA 1CLVA 4RCAA 1N0XL 4PRIA 4JCMA 1BG1A 5DK0A 2CG9X 5IBUB 4AW4A 5C08B 4KKLC 4NNXA 3HA0A 3RVWD 1L3WA 2YGNA 3QDMB 2FBJH 3GK8L 1BQUA 4FYRA 4QAWA 4EQ3A 3LHPH 1QSVA 4FQLH 4LSTH 4M7ZC 4DQOL 5T3XE 1U9KA 2QKIA 4LSTL 1JK9A 4WI7A 5GGSY 3BUBA 4AYGA 5BV7C 2ESVE 1KY7A 3HHSA 4ORGB 5PAZA 4DVBA