3WTSA

Crystal structure of the complex comprised of ets1, runx1, cbfbeta, and the tcralpha gene enhancer dna
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
119
structure length
119
Chain Sequence
b'MGELVRTDSPNFLCSVLPTHWRCNKTLPIAFKVVAKGDVPDGTLVTVMAGNDENYSAELRNATAAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKITVDGPREPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Runt-related transcription factor 1
publication title A novel allosteric mechanism on protein-DNA interactions underlying the phosphorylation-dependent regulation of Ets1 target gene expressions
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription/dna
total genus 20
structure length 119
sequence length 119
chains with identical sequence F
ec nomenclature
pdb deposition date 2014-04-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3wtsA00
4MZRA 3ZMEA 2P52A 2BIPA 1CMOA 2X0VA 3D09A 4IBTA 2ATAA 2IOMA 2J20A 3TS8A 2J1YA 3VD0A 5AOKA 2VUKA 2IOOA 1TUPA 1E50A 2XWRA 2J6WA 3Q05A 4LO9A 5G4MA 5G4NA 2J1XA 3IGLA 1KZYA 5AOMA 2FEJA 3KMDA 2J1WA 2BIMA 3D0AA 4AGMA 3D05A 5A7BA 2PCXA 2XWCA 2OCJA 5BUAA 4IBQA 3IGKA 5LGYA 5ABAA 4IBZA 2WGXA 3VD1A 3WTYA 2X0UA 4G83A 3WTUA 4LOEA 4KVPA 3WTWA 3EXLA 4HJEA 3KZ8A 3D08A 5AOLA 4AGOA 1HJCA 1GZHA 4AGQA 3WTSA 1CO1A 4IBUA 4A63A 4MZIA 2RMNA 2X0WA 3QYNA 2IOIA 4IJTA 2H1LM 3US1A 5AOIA 3QYMA 3VD2A 3US0A 4G82A 4L18A 2YBGA 1HU8A 1T4WA 1YCSA 3WU1A 1EANA 4IBVA 1TSRA 5ECGA 4AGNA 2AC0A 3D07A 2ADYA 3EXJA 5AB9A 5AOJA 4AGLA 5G4OA 4IBYA 2MEJB 4QO1B 3WTTA 1EAOA 2BINA 4XR8C 1HJBC 5KBDA 4LOFA 4IBWA 5LAPA 1GZHC 1UOLA 3WTXA 1LJMA 4AGPA 2BIQA 1H9DA 2AHIA 4GUQA 2J21A 3D06A 4L0ZA 1EAQA 3Q06A 3Q01A 4IBSA 2BIOA 2J1ZA 4L0YA 1IO4C 2GEQA 4GUOA 3WTVA
chains in the Genus database with same CATH superfamily
1QYGL 3QGVA 1CK0H 1T7ZA 1IAKB 4U1IB 5I75C 2DYSB 4UNUA 2GBTA 4NKDA 4OI7A 3JSSA 5E2UL 3M07A 4MD5B 2CK2A 2ZZUT 5HTSA 3QJQB 4HAKA 4H8UA 4HWNA 4IRZH 4AG4L 3WNIA 3ULVE 4ABVA 1WZAA 2HLAB 2BDNL 3MBXH 5KVGL 5ADPH 1E4KA 3MRLA 5AD0A 5AVTB 3HA0A 1Q72L 2YOCA 4IMKA 2NY2D 3SPCA 1LNUB 3PWPD 1GTFA 3U1QA 3SOBH 3STZA 3HAEA 5I6NA 3ZTJG 4NSKA 2A9ML 3CFKA 3CN4A 4R3SB 4PFEA 5CR8A 1I9IH 2NY6C 4LSUL 3UP1A 2OMXA 3G6AB 3HG2A 5DU7A 2V3DA 4LASH 1IGYB 7FABH 1VGEL 1TJXA 4NQDD 1LMKA 4RLDA 3HE7A 4MD4A 4HWZB 2GVYA 4JFED 1NCWL 4QYOB 4UT7H 4GRLD 2R23A 3P77B 3N0AA 3D18B 4LLMB 1UEMA 4U1JA 3TBYA 3OSVA 3LEXA 1FE8L 1CICA 1NBVH 3MJ8B 4WV1A 4BDVB 2AJVH 2ZNWA 2A6IB 2CHDA 4BFBD 1KY7A 2HX9A 3UGXA 3ZDZF 1G9MH 5AEAA 3LPPA 5JPNC 1BM3L 4OV6F 5IVXE 3POHA 3B5TA 2HT3C 4E42B 4GRMB 2D3NA 1IEAB 2BJMH 5B1CA 2MKWA 4RX4D 3RRQA 3EDEA 1BPLB 2HLFD 2YMXH 5CP7B 1Y18A 5MP6H 4R5TA 4DPCX 3NN8B 2Q5BA 2LVCA 4X6DF 4YHIB 3I84A 1QFWH 3IJ7A 2VM9A 3SDYL 4U3XA 2DWEA 2K78A 2G60L 5F9OH 1WFOA 5DC4B 2J2ZA 3CZFB 2R56L 2O6FA 2HRGA 3DJSA 4NLHA 2F54D 2MNWA 1S5IH 1BZ7A 1QD0A 1FFQA 2NY0D 4M48L 2RGSA 4ODWB 4YXLH 1H3PL 4MA1C 2FB4H 4UB0L 3L3OA 5GZOC 5MEQB 4B9KC 5IJKA 4NUJA 2X3BA 4JDZB 4MRBA 4JG9A 1Q0XH 2KERA 4TUKH 4UTAA 3S97C 5SWQB 1TPXC 1OT1A 3BVXA 4PJHB 5FYKE 2AXHA 2W81C 4LSVL 4FTDA 3A67L 2I85A 4QTIL 4XVJL 5E00B 3MNMA 1FZKA 1X5MA 2EKSA 1TF4A 4HFWB 4OGZA 4OZHF 4QAMB 3EGSB 3S2AA 1DFBL 1JZGA 2W9EL 2KDYA 3B2VH 3H1ZA 4G8AC 1RP8A 2AMUA 2XV6B 4LOUD 4PRHD 5E5UB 2X0VA 3QO1A 3DRTB 3ZQWA 2J73A 2WKLA 4EN3C 2Z6FA 2ICWA 4LL4A 4Y7MA 4M1GL 2QZ5A 3R0NA 1EX0A 2C9SA 1YNTF 1HWHB 5CGYC 5AVXB 3SEPA 2YJLA 1WZ1L 4LCCB 4KDWA 1NFDA 2HKAA 4E41B 1AHMA 1JHTA 2WLJA 4OH2A 4Y19A 4XMKH 4MA7L 2ZCKL 3FFOA 1XBDA 1UA6L 3DO3A 3GO1H 3S37X 1PBYA 5T3XE 5GSVB 1OQXA 4RCAA 3PGFL 4KMQA 5I5MA 3TJEL 4WW2C 1NPUA 2B5IC 1XB3A 2OP4H 4PMFA 3MO1B 2PXYD 3EFOA 5HI4C 3ULVC 1VSCA 2AV7A 5CJ8A 2I5YL 3EYOB 3KLAB 2VMCA 3A24A 1KLFA 3Q1SL 4GG6B 4PJGE 4JANB 4RBPH 1LDSA 2YGNA 4UDTA 4P0DA 4UYQA 4DQOL 2ZX5A 5E6RB 3OC5A 4ANUA 5EUOE 2EO1A 3FB6B 3UGEA 1JZ6A 3S35H 3JT2A 3IJSA 3MV7A 3ERXA 3R4RA 1AAJA 1ET8A 3E9UA 2YRLA 4PG2C 3P4NA 3VWJC 3WFEL 4WK0B 2CRZA 4NJ9H 3MJ7A 2NCMA 1NGPH 4Y2DC 3ZUCA 3VXRD 1KCRH 4LP4A 1PZBA 4JFDA 4IOFC 4P2OD 1KLUB 2IGFL 2BX5A 3GNML 3FCTB 1NCTA 4EIZC 2VR4A 3GI9L 4YVNA 2QKIC 2CHZA 2NY4D 3VE0B 1L5GB 5ICYA 3FMGH 3VTMA 1JGVL 3DVGA 4LDLB 3WXWH 5GS0C 3VDAA 2COVD 4KROB 5DUBB 1T1XB 1SXSA 2FCBA 3SD5A 2EEXA 3QFDA 3V6OE 5L4FA 2FEDD 1NSNL 1XGYH 1E4WH 3OPUA 2AGJL 3QZLA 4R6UA 4S1SL 3S5YA 4EMZA 5HYJE 4FQIL 1JHLL 3DETC 4GP8B 3O2WH 2CK0H 5F0MB 2X6UA 1LK3H 4FYSA 4JB9L 4L3EE 5F3HB 4ZFZA 4ETQB 3NA9H 2P42B 1MUJB 2ZJSH 2UWEE 2X1XR 3CMOH 4PJDB 2ZWYA 2Z93A 5B1AB 2EDQA 2Q9OA 2XKNB 3H2QA 3I50H 3QXTA 3WMPA 1XF5A 1SJVA 3BN3B 4DFHA 3F8UB 4L3FA 1HS6A 2VMEA 3AXLA 2HJFB 1INDH 5AQ0A 4NB7A 3MCKA 4YPJA 3QIBC 1UOLA 1Z9LA 2IIJA 3G04B 1YMME 4U1SB 3OHXA 4FFWC 1OE2A 3CSBA 3SKOB 3EJZD 4BE5A 4XN1A 1DJIA 3HE7D 1P7KB 4MQXC 4TLTA 1CGUA 5E9DE 5FF6A 2OL3H 3QQ9C 2HX7A 4JHZA 5D93B 2OMYA 5B4MD 5A2IH 5A2LH 3B9AA 1KWKA 3GJEB 1MCCA 4UT9A 4XO8A 3KPQA 5E94B 1CICD 1R17A 4UDUB 1JF5A 3TS8A 2J4WL 5JIKA 1F3JA 3UZEC 4BZYA 1EVTC 2FR4A 1NCOA 1PX3A 1WIUA 3EJPA 4HCRH 1EHLL 1HDMB 2DYPD 1XZ0A 5IB5B 1KBKA 4WI0B 1TYJA 4GKZB 5DJDB 5E99H 4ONHB 5FHAL 1AGBB 5INCA 4ZFFA 1V8HA 4N24A 2ZICA 3GWJA 3RDJA 4RFNC 4OQ1A 4RSVA 3X3FL 3LMJL 5FR3A 2B8OT 1ID2A 5T33H 4M5SA 4QPEA 3CH8A 1A7BA 1DQIA 4BH8A 1N6UA 1NAMH 5JDJA 4LAJH 3MTXA 2WB7A 4LEOA 3RA7L 1BLNB 5HPOA 5IGXL 1MAKA 5I1CL 3IXTA 1RUKH 3B9VA 4TNVK 4Z7OF 1I4FB 2Q8BH 2AJZA 3MMEA 5FGSA 4NENA 4Q4IA 1ZMYA 4NPYA 4LCWB 5FOJA 1RU9H 1WAPA 4BZ2A 1OXYA 2VDPL 2XHNA 5CAYB 3D2UA 4XBPB 3W0WA 1QNZL 4RBPK 2D03L 3QO0B 1PG7W 4G9FB 5FYJE 5TF0A 1TJIH 4GSQA 2EIEA 4Y8AA 1MH5B 2DLFL 4D8OA 3DMMB 3HLAA 1TEYA 4KTYA 2KQMA 1DVFB 2WUBL 1UH3A 2CIIB 1T4WA 1MFDL 1XXFC 4JG1L 5I0ZA 1I8KB 4ZS6C 4PCYA 1S5HA 5IVOA 3GRWL 4UNVA 1TZGH 4LSDA 5C07B 5D4QA 2J25A 1G6VK 4N0UB 1XBRA 1B4JL 4BJLA 3OD3A 1I9RH 4Y19D 2YARA 3CBRA 1AXSA 5DJ6B 1KCWA 3CVHL 4WWKA 3NABH 1S7XA 3T3MF 3AWGA 3S6CA 1HYSC 4RFEB 4OJDH 2RTTA 2JTYA 3HG1A 1IT9H 3AAZA 3CXDL 5HI3D 2EKJA 3TEZA 5L9DL 5FYLD 1KN4L 1KXVC 1QWUA 3QH3A 1DBBH 1LP9E 3PREA 3FJTA 3UP6A 3PWPE 1RULH 2QV2A 2X4QA 1PLCA 2C4FU 3B34A 4YHLH 1SMDA 4AL8L 4WWID 3EIFA 1DDHB 1ZTXE 2GIYA 1F3DH 1J8RA 1CFQB 4LARH 4MJIB 1RZJC 2VDNL 3PU7A 4UI2A 5CR1A 1CYWA 1ZT4B 5KZCD 5GJTH 4NQDE 3JT0A 3LS5L 3NIGE 1RZKH 3MV7D 4N1CA 3JTSB 2D73A 4JFEE 4WGKA 2QJDA 3ZZ1A 2IOMA 5CKAA 1CN4A 1OP3H 2YD3A 3FN0L 1IU1A 1U4FA 2Q20A 2NW3A 4JFDD 5JPMB 1QATA 2FJSA 3DO7A 1Q9KB 4PTTB 5F7FA 5JHDE 1CD1A 3GIVB 4A7VA 4FI6A 5E8DL 3BDYL 2NY3B 4P3DA 1JTTA 2GTZA 2C7UB 3ENEA 1MOEA 4PRNB 4AQEB 4NQEA 2EE3A 2OYLA 2Z35A 1UKTA 1KEML 1A8JH 1YZZA 3MUUA 5TQ2L 2W1NA 3CFEB 4AM0Q 1ACCA 4D0BA 4Z3TA 1D5BA 3QZNA 3ZUNC 1EHAA 1GS6X 5A1AA 4FKHA 1KPUB 3VFSB 5LGYA 3BUBA 5CD3B 1OSEA 3B83A 2WNXA 3FNKA 5DHMC 1XH2A 4ZW6A 4Z6AT 2A74C 3GD1C 3Q2VA 1JPTL 4GIAA 2H5UA 2A5UA 2BXZA 2VZOA 5ICXB 4YE0A 5B38G 1JE6A 1BYOA 3LH2L 1XF1A 4QHUB 3BRFA 4WSGA 4J4PC 2J44A 3MGTB 3SJVA 4MNGA 1U92B 4AYFA 5IOKA 3OXSA 4MZIA 3Q3GA 4TVUA 3PFUA 4J28A 5EPMB 1IC5H 3I6GB 2I9LB 3S34H 1IMHC 3OZ9L 1DZBA 4DESA 4O02A 2YD9A 3RHWK 3RNKB 2F74A 1JZ3A 2WZ6A 1NEPA 2Z64C 3MQIA 5D2LB 4JDEA 1HILB 1YUKB 3SYAA 4OCRH 4HIIA 3DOIA 4AK2A 2X2YA 4YDZA 1IM9B 2WKOA 3ZQXA 4AYSA 3BO8B 4UOJA 4EI5A 3WEAA 3GMOB 1BX2A 5B38B 1E8WA 5DD6B 4FQQA 5T1KB 1I1YB 1GGIH 1PYWA 3U4KA 3X1EA 1ZXQA 3EGXB 2E76C 1MCBA 3VFNA 5EF3A 4R7NA 3F84A 2A99A 1Q94B 3O45B 1MCNA 2H3NB 1JGLH 3CC5A 3GC3A 4APXA 2YMTA 2GABA 3PDGA 3SDXE 2P7TA 5C2BL 1QO3B 5AYUH 4X5QA 3QCUL 1QKZH 4IS6B 1ZK5A 2MCPH 3MLWH 5LXGH 2DTSA 5JIPA 1LGVA 2L04A 2CLRB 1RPKA 2C9AA 3DX6A 3QEQA 4S0HA 3IK2A 4K8RL 5DHVA 3SIKA 1SM3L 5MI0B 2Q3AA 3I6SA 3SGEI 4S10A 4DEPC 4CUCA 5T3ZE 4OLWH 3VTTA 1GYCA 1YEIL 4HF5H 3G08A 5D7JB 3GMPB 3NCCB 2X2IA 2Y1ZA 1GGCH 4QYAA 5TDOA 3D2UD 1ZT1A 4X7TB 3W0WD 4JS7A 3KD4A 1MHEB 4AXWB 2OJEB 1UKQA 1MZYA 1X5HA 3IDYB 3VXRE 1CFMA 1KPRA 4GRLC 1JFHA 2W38A 2I60L 5DUPL 5E6UB 5C09A 3ABGA 1KMGA 3KXFA 1Q9OA 3FB7A 2J1WA 3VNYA 1OGSA 3MR9A 3WJJA 2GFBB 4K3DL 2JLPA 5ETUA 1OP3K 2F08A 2PTTA 5JNYB 4MDJA 4NRYA 3QAZB 5DD5L 2Z7UA 4TLSA 3G5VA 3MGOB 3VGBA 4JQIL 1THCA 3L3IA 1QUNA 4NZTH 1RHHB 2VISA 4PJCA 1RK7A 4PV8B 4Q0XH 2V2WB 3AZUA 1XT5A 3T6XA 1KGYE 1YC8A 3JYCA 4WWKD 5I71B 1DJYA 3RPBA 2BY0A 3O2DH 4UYPA 2GHZA 3QJUB 3HG1D 1M7IB 2EO9A 4DVRH 5I19L 1A64A 2BLFA 2XVLA 1YEFH 3O4LA 4YSCA 1U21A 1N19A 1Y6KR 2QADB 4RDQG 2M26A 4CN4A 1T2XA 5EBLA 2JKRM 5HHQA 2L0DA 3E6FA 4BBWA 4NAMA 3F7QA 3QFJB 2RCSH 3G5ZB 2RMNA 1SHWA 2J6EA 4QCIB 5EU6B 5GGSB 2ZUUA 5FHBH 4XPBH 2K6YA 5KTEH 1J9TA 3DX9B 1K8DB 5L8LB 1BECA 3JWDL 3KR3L 2VAAB 4YSPA 3OKOB 3QNZA 2HRHA 3CK0H 3KW8A 4P04A 1TTRA 2NY0C 4M62L 3NIDE 4XOBA 3MKKA 3BXNA 3PAZA 4FNLL 2JKSA 3EADA 4KXZH 2XZCL 1OLZA 4F7MB 3OPZL 5G4OA 1P1VA 4WJG3 2WYIA 2XWXA 5I1GL 2ADIA 3O0RL 4GS7C 3DURA 4XWOD 3QT2A 1IE4A 2FX7L 3UXFA 4NHUB 2OJZH 1Q9LB 3RJQB 1Z9PA 5AZEH 3P0GB 4MJ5B 2VITA 4LOUC 2RQ8A 2QQKL 1J5DA 4KJQD 4NQED 3ZO0A 3TEWA 5JW3H 2R0ZL 1B9KA 1GA2A 1IBYA 2Z0UA 4QRBA 1L9SA 3KHOA 3HCVA 2Z8WC 4M6ML 4B0MM 1R5IB 1AZVA 1QX1A 4AMXA 2HKFL 4HFUL 2DQJH 2XWEA 1ACXA 3KLQA 4UQ9A 2YC1B 2AQTA 1C1EH 2GG1A 4Z23A 2ZPKL 2MPAH 5JHAA 2JKJA 3T5WA 2QEJA 2XG5A 3CHOA 3FT0A 4JPVH 1NCAL 5GS3A 2PXYC 4JG5A 1PW3A 1MLBB 4DF9A 5I0WA 5SX5H 5TPWH 4HZAA 3G5YB 1BPVA 2WZAA 3O3AB 2FECI 1AOHA 2WZ0A 1W8EA 4GAGH 4OJCA 2FZ3A 2DQDL 4R0LB 3WY2A 1HSAA 1F02I 2Y06H 4NCC1 1E3XA 3VGGA 1GL4B 4OIFA 1MDTA 2VRKA 4E9YA 1YEHL 5GHWL 2Q1EA 2FT7A 3VA2C 2BVOA 1HSBB 2F7RA 3VXUA 4B41A 2OL3B 3H9HA 4X5LA 3UTQA 4Y1AA 1HN1A 5SWZB 4ZFOA 4GLRH 1AO7B 1T03H 4NAQA 4EI5D 5EBMA 4MQSB 4QAWA 4H7VA 4QTFA 1NUNB 1GGTA 4ISVB 1S9VA 4JFYA 4P2OC 4YHMH 3VI3B 2G3NA 1AHKA 2E9JA 5I6PA 2NNFA 2J55A 2NY4C 2VGLM 3OV6A 1NFDE 2P26A 1PX4A 3AACA 5C0FB 4QLRA 4KKNA 1WWAX 2BSRB 4G8GB 2FEDC 1CD9B 2FYVA 1M6UA 4HJGA 4ODBD 2X6CA 3MXWH 5C0JA 3ILDA 2LR4A 4K94C 5AL0A 4Z78B 4DP8X 3K0YA 1BD2B 3PDOB 2ZOKB 1ZT7A 2OCCB 5FYLE 3T0EB 4EJ1C 3MXVH 3P73A 1C7TA 2W07B 3UYOD 5F0JB 3QEQD 3R1GL 4NKOA 5AW9B 1REIA 4IMKC 1SQMA 1TDQA 1A65A 3M7FB 1BAFL 1OF0A 2IWFA 1NAMB 1KB9J 4WNQB 1MIEH 3IU4H 2CBQA 4KZ0A 5DRWA 1P5VB 3QJHB 1GW0A 3DX3A 1AGCB 4PJXA 1FIEA 1RUPH 4PGJA 5HY9B 2VZUA 2H3XC 5GGTL 3M17A 3QAQA 2OR9H 4PJEF 4MFHA 5DD1L 3CCHA 4EOWH 3EJZC 5T1MA 3HE7C 1L7TL 4H8WC 3VFGH 4BK4A 2QLVB 3HVNA 2BSTA 4JFDE 5C09D 4XR8C 2V5YA 3ME0A 2VH5H 2ZXCA 1WIPA 4GUPB 4LIQE 2QPEB 3KXFD 1OTSC 1ZOXA 4P3CH 5J6HA 1A6PA 1W72H 5A16B 4WV1C 4KKZA 2HUHA 2WWOA 1UB6A 4OQTH 2EIMB 3E3QE 2J71A 1F4YH 1RLBA 4K3JH 4AE0A 4XAWL 2MQ0A 4P5KA 3RWJB 5I1JH 1J1OH 2VB5A 5EEYA 4JKWA 5MEOB 3NCJL 3CDZB 1YDPB 1U8IB 1KJ2A 4TPRL 4WFHD 5FWRA 5HJDA 1YY9D 4GOSA 4NGHH 1JV5A 1EK3A 2BMKB 3K6SA 2FL5A 3K8LA 3B7TA 5I1IH 4AEHH 3MRNA 2AANA 2HP4A 3X12A 5D4JA 1SDAB 1WICA 4JE0A 1V3KA 2N1KA 4H0IA 2FT6A 5I2IB 1E27A 1AYRA 3DX7B 3KH4A 3LVTA 2HRPH 3HS0A 2L7UA 4NDMB 1ZD6A 4JFPB 1VFBB 4JM2F 5A7BA 5A2JH 3L3OC 2D7OA 1JGIA 3VXOB 3L81A 5IJKC 3ESVF 4HUKB 5SX5K 5EFIA 4RISH 4TSCL 2ICWI 5KOVC 1TJMA 5F96L 1KYOJ 3U46A 3HR5B 2IFFL 4KDVA 4DGUA 2VWEE 2R83A 3RWHB 3L8QA 4FJZA 4CILA 3KBEA 4TM9A 3DTDA 3V8CA 2JLLA 3RGBA 3TBTA 4F2FA 4X7DC 1FO0H 1BQUA 1I3GL 1HE8A 1VEPA 1C5CH 2XBTA 4X7SH 2AI0L 1XGRA 4IRJD 3RWEA 1AZNA 1U9KA 3UERA 3K5SA 4ERSH 2MH4A 3LN9A 3SE9L 5L7XL 4N9GB 2Z9TA 1FNLA 2R27A 4EKXA 1YUHA 1HINH 2ENPA 2IDCA 2R29A 2B1AH 4J8QA 3STLA 2I26N 5AENA 4FFYH 4X6CA 5AUMA 1S9XA 1QRNB 2IQAB 2ISDA 1NPJA 4OLUL 4XPTH 1SEBB 4LESA 3PQYA 3ZDYF 2WINB 4YO0B 4ZOAA 2ZWKA 3BJ91 2BHZA 4G6JL 4X0NA 1UZ6F 3VO0A 2EDRA 1AZZC 1I1FA 1XL4A 4I18B 4XWGH 4QHKJ 1IC1A 1CYGA 1CU4L 3BKCL 4Z7QB 1B0IA 1JK8A 3BHBB 2YSTA 2ILLA 1KDJA 4FLHA 4LLUB 2OMNA 1FBIL 1F11A 3BP7B 4LDEB 4XMZA 3W0WE 3IAGC 4FNRA 2ZG3A 5IHUL 3ROLB 3CPUA 3BW9A 4OTXL 3D33A 3ESNA 4PRDA 3VXUD 4LLVB 4YSOA 3CX5K 4Y1AD 3HZVB 3TT3H 4ODVL 4U0QB 4JFFA 4DP2X 3VCLB 4BXSV 3V0IA 3WGUB 4DK6A 4OGXH 2GI0A 1E40A 1X7SA 1U95B 1OARL 2Y36H 4H2AA 4OVUA 3N42F 3QDMB 3LKQB 1SEQL 3CZNA 4YWGH 3ULSB 4Z3IA 1WRFA 1VCAA 3IJHA 2WNKA 3NSXA 3G5XA 5ESQB 3SPGA 3RKPA 1T21A 2LTQC 1MWOA 2W65B 3IBOA 2YMOA 3HC4L 2J20A 3BPNB 4JGNA 5D7SH 2YPVH 1HEHC 4UIKH 3BFOA 3DUSB 2Q7YB 2CDFB 4YR6B 5DR5H 1RIVL 2AEOA 5LCVA 1CR9H 1UB5B 2DQFB 2OXGB 4D7PA 2W9DH 3BAKA 2N7AA 1X4YA 3L2MA 1BXXA 5I1KH 5EOCJ 1YYLH 4N9OB 4RWHA 1UG9A 1NMBH 2O6EA 4W9LC 4JFOB 2B16A 4LRIA 4YFLF 5EZIH 3IETA 2F7PA 4KY2A 4OD1L 3KJ4C 3OHXC 3P9LA 2O6PA 2OYPA 4NC2B 3WCYA 1CDCA 1RIHH 1A2YA 2VC2H 3TCXA 4KX7A 4PW3A 3QDHA 1WEJH 4O2EA 1A7QH 3P4LA 4M7LL 4GP5B 3MRHB 4MZ2A 4GFXA 3MX0B 4HPYH 4YQXL 3NFSH 3UEQA 5KUKA 3D4CA 3FQYA 3W82A 4POYA 4ZQTA 5J1AB 4ZQKB 5HP5A 2BNQD 4FCHA 4BKLB 3KS0H 3U0PB 3KZ8A 5MENE 3CN3A 5DVNA 5BXFB 2VWEC 1OP9A 1UJ3B 3MFFA 3FQ4A 4GKNB 5D2NB 4NEHB 5D6DA 1IGIL 4L8CB 1H5BA 3EJSA 5IESH 4XNAA 1NKRA 3UL4A 4A2MA 4M6OH 2WYTA 1S7SA 1NCHA 1ZSDB 4Q6IB 1BVKA 3U0WL 1JN6B 4X4YB 3US0A 1BOGB 2KBGA 3RNQA 5TFSH 5FWQA 3WFBL 4KAQH 3AUVA 1FP5A 2V5TA 1BQLH 4ZO7A 2QGDA 3FO1A 1IILE 2DLIA 4JRYA 5CBAA 3FCGA 5DK0A 3ULVH 2WXNA 4OGAC 5LKNA 2AJXH 3EBIA 4MNGE 4GAYA 1U8PB 4FFZA 4P2QB 3LEVH 1S3RA 4E5XA 5MERB 1S6NA 3QQ4B 1QBLL 5D1ZB 3FAXA 1T5WB 4OF6A 3N6YA 2W92A 1DO5A 2PWEA 1UADC 2WQ8A 1A3LH 4KU1A 1JJUA 3WHXA 1IE5A 2O4EA 1IJ9A 1HNYA 4FL4C 5ACZA 1YEKH 4KK9C 1KB5H 3JQOB 5JW4Q 2OZ4L 1T0MA 1MQ8A 2K7PA 2LLLA 4LSRL 2IALA 3KLKA 3OVUB 2Y6SD 1RPUA 3WD5L 4XP9H 1AS7A 4XHJC 1FVCA 1HC1A 2Q3XA 1EDYA 4KH2A 1GC1C 5JQIB 2ICCA 5TQ0H 3V7AG 1CGXA 4H5SA 4AZ8A 3WDIA 5GS0H 1E9QA 4NKMB 4XNMB 2A9NH 4Z7QF 3MSPA 3TONA 2Z92B 1UXWA 1CF8H 4GKOA 3I6LD 3I75A 4AK1A 4HH9B 4NQCA 2IBZY 4DN3L 4WWKC 2DQ6A 1IGTB 2E46A 1EAPA 2EUVA 3PQYD 4HJSA 4OGYL 4Y2NA 2ZIDA 4OF0A 2WLHA 3F64A 3QEQE 2G0LA 2F53B 4MDIB 4DKEL 1AIFB 5INDB 2JELL 1X5KA 3NCYP 4PJ9A 2HWZL 4XNUH 2VXTL 1AXTH 1V3LA 4PSPA 5E70A 1ZGLM 5KSAB 3WTYA 3W9DA 4PW9A 4XMXA 5DRXB 2GAZA 2AQSA 4AEIL 4GI6A 4UT6A 1IFHL 4HVBA 4L1LA 3AB0B 4G9DA 4J3BA 5KYUB 4JFFD 2G9HA 1G7QB 1PF3A 3KXFE 4AMKH 4EUPA 2PUQT 3OJVC 4GG8A 3UTTB 1AKPA 5AW1B 3UBXI 2PYFA 2G30A 4PJ5E 3PJLA 5IFAH 4L8BA 3MRPA 5FYKH 3JVGA 5CJOL 2AJSL 5ALCH 2Y22A 1HCVA 4XWOC 4AOFA 1IBZA 1T7WA 3GB7B 4Z3EA 5EUKA 1A6VH 1PNDA 3CFQA 4KJQC 3U7WL 1TVBB 1Q1PA 3ZIMA 4OLZH 2FO4B 1MF2L 3NSFA 4AIXA 3ETSA 3MNDA 3BPLB 3OKMA 4WFHE 3JTTA 5CLTA 2YS4A 3INOA 2BP8A 4Z95L 5EF0A 1Z5LB 4GSUA 1ZLUH 4A7SA 2Z34A 4HALA 3MRBA 1NAKH 3P9MA 4GAJL 4XI5D 4X0KB 1QQDA 4D3CH 3MNZB 4N2AA 5IFHH 1PDKA 2BOCA 2RA1A 4PJBF 3BD4A 5T3XH 5C6TL 4MA3B 3ULUD 1U8CA 1G0DA 3O3DB 5AVQB 3IU3B 2NTSP 3WXVH 3DVFA 3WEOA 2CCVA 3CLWA 4FC3E 5D8JH 1MHCB 2Y3AA 4HOZA 4ILDA 2VSDA 1L9TA 4HCFA 1YQVH 2R9HD 2YN3A 3H53A 1JD9A 2B9BA 1OCCB 1OF2A 3F7YA 1RZ8A 3ZE1B 4BSVB 4HT1H 4LL9A 1FL3B 4N86A 1D3CA 4LHJB 3EO0B 1L9QA 1CZ8H 2CO2A 3DOSB 5LUMA 4LU5L 4NHCL 1OHQA 1B4TA 1AD9A 2ID5A 3PP4H 1BFOA 1FYTB 2FJGB 3NIFE 1JSYA 1ONQB 3DA0A 3OKDA 4I4WB 3ZE0B 1SQ2N 4BQ9A 1E7VA 3LXUX 1N67A 1YHPA 4U0RC 1HH6B 1W72B 3WEMA 3LQZB 5FPIA 5CEYB 3ARYA 4QRSB 1B3IA 4MNHB 2CGRH 4DP6X 5EZJA 2WWNA 4EDXB 4RMRA 3P0YH 1W0VB 4FEMA 1MELA 1CIDA 4BFOA 3N91A 1MFCL 4JUTA 1HL4A 1Z3GH 2R51A 1IQDA 2XTJB 4YDKH 1RUAH 3L3HA 3UABA 1RD6A 1ZDQA 1EO5A 4JRYD 3UTZA 1MWAA 1S78C 2AK4A 2WGXA 4HKZB 4JZJB 4IU2A 3GT6A 5I76B 3RFZA 5BJTA 2GHWB 5CCKH 3MA9L 4X8JB 1WISA 4MJJA 4HWBA 5TJWK 1M7UA 3WJMA 1Z6JT 5JXEA 1KTCA 2XFXB 1UKSA 4RGND 2R1XB 2PNDA 1NPNA 2VLKA 2G5BA 4HIHB 3AG3B 1LEIB 4Y1AE 3V0DA 4OV5A 3V9FA 2EP6A 3FU7B 1DN0A 4EDWL 1BVZA 2FNBA 1DJZA 2VKWA 4FYRA 3RP1A 3SGDH 2QT6A 1ZA3B 3V4VH 4X6BB 1L6XA 3BSZA 4N3UA 5EO9B 4CADB 5HYIA 4OZIA 3L3GA 5EA0H 1A4KA 1G43A 3WJJC 2DJUA 3UMTA 5AWNL 1FO0B 2ZKHH 2QMJA 5I5JA 1RJYA 4RIRA 2XJLA 4I5BA 5J1TC 4RGOL 3HBGA 4IRSB 3OR6B 1BOYA 2JKIS 2XKSA 4NQCD 2C3VA 3ARQA 3DTXA 4Y16A 3WTTA 4AT6B 1R3LA 4WFFD 2VXSH 2Q86B 1CXFA 4URTB 1EHKB 3BUDA 1WBYB 4BUQA 1AGDB 5IHBA 1MZZA 4ZO6A 2W0LA 5HHNB 3CC1A 4YDJA 1J8KA 1MFMA 2XN2A 1OGTB 1VGKA 2MRYA 3D8MA 3IFNL 2E27L 4PJ9D 1CFNB 1T1WA 1VPOH 2NNAB 1GIGL 1ZLUK 4PJXE 3NEXA 4Y1SA 2CLVB 3RPIB 3FQ1A 3ZTEA 5C3LD 3H2WA 1KGIA 4M3KB 2BWQA 4IYKA 1XR9A 1I7UA 1RZJL 4OIBA 1DEEB 4HGWA 2JJUA 5F9WB 1XCQA 2NY6B 4L0PB 4A2HA 1A6ZA 1P7QA 4LZKA 4WCYL 1W16A 2XA8H 4DUVA 2FWOA 2VDKH 2Y2TA 1G1OA 1PNCA 3MRKA 4HSQA 5DLLA 4MXVF 2F18A 3QPQD 1IUZA 4XN7A 2A6DB 2D2CC 2BNQE 4NQQA 3WEBA 2J6WA 5DA4A 2CCLA 5E56A 5FYJH 2VLRE 3SDCA 4N8VA 5IMLB 1U8MA 3FU9A 1WC7B 3F2LA 2NXYD 4Z18A 1T6VN 3U9PH 5GRUH 4KHTH 2EDBA 4AGMA 4AH2A 3U2SB 4X5WB 43C9A 1XCXA 2OX5A 2YWYA 3VFUB 3PABA 5IWLC 1JGDA 1YECH 3BUIA 2OULB 3QR0A 3IJEA 3V0VA 3IVKA 4HPHA 3WSQH 4OJYA 2WBXA 2X10A 3VACA 2EVGA 4YH6A 1HXMA 5CHNA 4G6FB 4G70B 3FU0A 3FUJA 3WTUA 5DJ0B 4M56A 5DQ9A 1JF1A 1ZHKB 3WTWA 1AC0A 1FE8H 4IEFB 3WLBA 3ZE0F 1MRCH 3BH8A 4HAGA 3VGAC 3STBA 3SDAA 2HKHL 2X1QA 5HPMA 3ABMB 3N2JA 1CGWA 2GTQA 4J3SA 3GHBH 1ZTXH 4XMLL 3TBWB 4P23A 1L6ZA 1EFQA 4WEEA 4I0PB 2IDQA 1E6JL 2ESVB 2E0PA 4NO0A 1NGQH 3M1CA 5TD4A 4GMTL 5JIDA 2O5YH 4EIGB 5JW4R 3NJGA 5FV2A 3ZT5A 1PFOA 1RQ5A 5I1DA 3PS6A 3KPPA 1A6WH 2JTDA 3NFPB 3VMOA 5K9JL 3PG2A 5IEHB 5ECGA 1VKXB 1MREH 2CKBL 2ICEB 4JDVA 3BP6A 1RK0B 4LLYA 3WIFB 1BBJB 5AAWA 3QXVA 4HZLB 4RSYA 4ODSH 2X09A 5KAQG 4PLJD 1RHFA 3AM8A 4JBSA 4JN2A 3RY5A 3VW3L 1HAWA 4NUPA 2FEEI 1MG2C 2ZUWA 5T5NG 3I6LE 4PG9B 4RMUA 1FLTX 3MYJA 4LAQL 4X6CE 2C4FT 4KXDA 5T8IA 1RFDL 2ZXAA 5DD0H 1QSEA 5L2KD 4YVUA 2E8ZA 2Y25A 1JPGB 3ARDA 3DGGB 4FZEH 3PQYE 2O5ZH 2AK4D 3ARFA 5CWSA 3TO4A 4EI6A 3TWCL 5FDWA 1SBSH 4L0ZA 1S9WB 2UY7B 3CLEL 1DL7H 2A1WL 4APQB 3WO3B 4WW2B 2ZWSA 3ZSTA 2KYIA 3QUHA 4HGKC 3OKLA 1MVUA 2OTPA 4ZXBA 4L1TA 5JXED 1OKEA 1OEZW 3L16A 3QQXA 4U1NB 2VLKD 5CN2A 4JCLA 2IC2A 3CFTA 3LZFH 3VSVA 1ETA1 4GW5A 5DQDH 3CV5A 2NY5L 4I2XA 2J56A 3NPSC 4J6RL 1I3RA 4JFFE 5IFJB 1TVHA 2X44D 1IGFH 3B6SB 5KVFL 4L5FE 4DSYA 4FOMA 3SCMA 1KB5B 3T8MA 1LLAA 3EBAA 3GMNA 5DZ9A 3VG0L 3L9RB 4JGUA 4Z0XA 2HG0A 2DM2A 2AXWA 2FBJH 3F7VA 1EGJA 4BWUA 4EQ3A 4F80A 3X1GA 4QIRA 4F27A 3GBEA 4F2ME 1VZHA 4YGVA 4MGXA 1M9WA 2KZ1B 3U7YL 4LHUG 2QKIB 3BH9A 4M4PA 4TNEA 4UBDC 5KVEL 4Y16D 3RE0A 4HU2A 3O6LH 1BQRA 4WK2B 4OCYH 5IVXB 1RJZA 3M6DA 3C9NB 1G9HA 4L9LA 4BZ1H 3KAAA 3LKOB 5LBSL 5E2WH 2CXGA 5F3BB 1BQSA 4WENB 1TQTA 4HLJA 5HDQH 5E8NA 3HI1A 5JLZB 1FC2D 4XNDA 1FSKC 3O6FC 4PR5B 3TYGH 1CIUA 2FVNA 2YXMA 3HS0C 1NC4B 3A3YB 4TVPD 2WTOA 3BCFA 2R2BB 2XY1A 1P7QD 3GYRA 1IAKA 2AGJH 4U1IA 5T3ZH 5SWSB 1EVUA 3ZL1A 1PMYA 5C0RL 3X1BA 4UTBA 5JQHC 2PP8A 4MD5A 3CVBA 3MU3A 4GT0A 2BVQB 2WO3B 3BZFA 3BAIA 3ISWA 4LCIH 5DEJA 2D3LA 4DGIL 3VRIB 5FCUH 1QLFB 3SDCD 2NXZB 1LWJA 5I18L 4KMTH 2Y6SC 5F7YC 3C5JA 1LNUA 3P4OB 2ROXA 1CLYL 1EHXA 2Y7NA 1D6EA 1OP5H 3V5KB 3HN8A 4HUVA 3WL9A 1AI1L 3E2HB 1KFAH 3G6AA 2DQMA 4N2HA 3ETBF 4U1GC 4WK4B 5FM8A 5IJCC 2IDTA 2AHIA 4JREB 2WOYA 1IGYA 4XAKD 1ADWA 4ZMNA 3CJJA 2HFGH 1SOQA 5DRNB 5EBGA 3ARWA 4JRYE 4P5MB 4D2NA 1XVSA 3P77A 1FPTL 3D18A 1D6VL 3AS1A 4LLMA 4P4RB 3AWEA 4Q9RH 3MCYA 5LQBL 4WHDA 2XZAL 1OO2A 1H9VA 1M9SA 2DOCA 1QBML 3KJ6H 3SDAD 4NC0B 5AKTA 3JV6B 3BT0A 2EZ0D 3DLQR 1XGQB 3IFOA 2DD8L 4W9DC 3FHAA 1B90A 1V7NH 4E42A 2DWXA 4GRMA 1IEAA 4P23D 4KK5D 4X5XB 3ZLQC 1A7NL 4RGNE 3F58L 4NO0D 3HHSB 2XV3A 3K4ZA 4ODHH 4PJGB 1PG7X 1A14L 2J3SA 3BPOB 4M02A 5F7NC 2EXWD 2WO2B 5E6IB 2VZ3A 1ASPA 4HXBH 4JVUA 1LE5B 4NERA 4XE0A 1J0KA 5DJ2B 5EUOB 1SXBA 5DI8A 1ZLEA 4G5ZH 2ZQKA 2FECL 2C4XA 1F3DJ 3HN3A 4WW2F 3D87B 4K3EH 4XP4H 3V4UL 4YSSA 1EZVX 3ULVF 4MJHA 1OQOA 2FJFB 2FLMA 4LVHC 4D9LH 4YZFE 4HIJB 1USQA 4M29A 3P2BA 1EZLA 1KJVB 4LFHG 4C4BA 4FQLL 1INQB 1QSED 3VQ2C 1E6OL 2XUWA 4CU8A 2DLGA 1HJCA 4NT6B 2W0PA 3ARDD 3QZWG 1OAXL 4JDZA 4Y9CA 3ATBA 5HHMD 3WKMH 3ARFD 5CXPA 3AITA 5SWQA 4K94L 3TO4D 2D03H 2GK0A 5HYJB 4PJHA 4OKVB 5KSVB 4XI5C 3ZHDA 4L3EB 2DTML 5J11B 4HFWA 2UWEB 2V7HB 3EGSA 4NO3B 3ULUC 4XNQB 4XVUD 4ZXBD 3N06B 4BFRA 1SFDA 2K6ZA 4AQ8C 1HEJC 1N8OE 4OSUL 4KTEL 3UDWA 4LCCA 4E41A 3A6BL 2JV6A 3BDXA 5IVXF 2R9HC 2YWZA 2ZYHA 3OL2A 1HK6A 5D1QE 4Y5XA 4UTAH 1M71B 3IKCB 4H8WL 5HYFA 3SCMD 3NDZE 5GSVA 1JI1A 3QRLA 3APDA 1KG0B 1AYOA 1T04B 1ND0B 4I88A 5E9DB 3GKWH 4KMLB 1CE6A 2JQZA 3MO1A 3QXDB 3S37H 2VDQB 3V4VB 2FGZA 3EYOA 5D6DC 1H5BC 1P4BL 1PZ5B 5K59E 3P69A 4GG6A 4JANA 3OQRA 1EXUA 4JQVC 2N1TE 5I30H 5I73B 1UJTA 5LGHL 1H0DB 2HT4D 3UYPB 1JOIA 2E7HA 3UTPE 1VHPA 1IAIH 1B6UA 1KCUL 1WZLA 4EIBA 3F6LA 5DURD 4PB0L 1AXIB 3BEWB 1OP5K 3FUDA 2DQIH 2EDWA 2BP0B 3T0BA 1MFEH 5IROA 2OMTB 3GTTA 2YD7A 2WMPB 1EDQA 4N0YL 1QEWB 3V0EA 3S9DB 3MRGB 3LY6A 1KLUA 4TQPA 3H3PL 5FYLH 1A7OL 4CVXB 2WXMA 3C8DA 5E8DH 2IPTH 1NL0L 4G6AD 3S3DB 3TF4A 1NANH 2R8SL 4WI7A 3VE0A 2E6PA 1COBA 3VD4A 2I9TB 3CZSA 2JIXB 5DUBA 1XDTT 5TQ2H 4A7GF 2JE8A 3B37A 3V5HA 3DXAA 4PU2A 5ICZB 3OLGA 1ED3A 3VD3A 5F3HA 1L9OA 1N0XL 4ETQA 1J8HE 3S5LB 4PJDA 2VDKB 2D9CA 1IGMH 3OKNB 1ET5A 1ZJBA 1AP2B 2J88H 3FQXB 3MRDB 2XKNA 3L45A 5DVOA 1MRDL 4QHMB 4LIQH 2ZX9A 4S2SB 3QC6X 4B9CA 3WJLC 5D5MF 3WFHB 4POUB 2VE6A 4GRWF 3NZHL 4HUXB 4L37B 5AOLA 2P80A 2BK8A 1RL1A 3HG4A 5EWIL 4ELMF 4U1SA 4JFHD 2WP3T 2CO7A 4MCNA 2CRIA 2HYMA 4W4OA 3SKOA 2B4CL 2EEBA 4QXTB 4DKFL 4ZW8A 5L2KE 4MQTB 4QXUL 2VQ1B 5IB4B 4ENED 2XPGA 1KIUB 3GBNL 2AK4E 2X12A 3MNVB 2APXA 3GJEA 2B0SL 4FKEA 3FN9A 1SN0A 3NUKA 2TAAA 3FC8A 5E94A 1OM3H 4UDUA 1WVZA 1Q0EA 1I1AA 2XXFA 3BPCA 1VENA 2EIJB 4PJ9C 2NR6A 4TUUA 4FD0A 1GZPB 4GPVA 1P5UA 2JXMA 1M05B 2K4WA 3FO9B 1EZVY 3D0LB 1J1XL 4JGMA 4XPGL 2W0KA 1DEDA 5IB5A 2NY2B 2Z4QB 1MFUA 2IADA 3PWPB 5DJDA 1O6VA 4DEPB 1T89A 3C5SB 3KPOB 5J6GA 4ONHA 3GSVB 1AGBA 2W60B 4AQOA 3DBSA 4BCXA 3BD3A 2CSPA 1NIBA 3N50A 1U8LB 2TRYA 3HI6H 3ESUF 2QL1A 4E9WA 3F05A 4NQDB 3NIGB 5E1QA 3SBRA 4PRBB 2ZE0A 3T2NH 4OZIE 3A6OA 5C2BH 3G7TA 4Y8DC 1HWWA 3LRHA 3JVGC 1X5YA 1ZRUA 1BXAA 2I24N 1KPVB 3KGRA 2P4AB 4R4ND 3MUGA 1L3WA 3LPFA 4GUOA 4R2GB 5ESAB 4KJYA 3WEXA 3NJLA 5FIEA 1I4FA 5AVWB 3ZDXF 3JWNE 3DYOA 5JHDB 1DDTA 2B59A 4GXVH 4YMPA 3FCSB 4OZFG 4KRNA 3EFDH 2LFEA 1MCWM 3D39B 1J12A 4XBPA 1O5DT 3KEHA 4UQ3A 3ZYIA 2C26A 3C2SA 4MA8H 5TF1L 4XNZB 2WJ5A 1DQQB 5DTFB 4GMSH 4IGBB 2I60H 2R4RH 1MH5A 4G3YL 2BVUA 1A3RH 3DMMA 2E59A 1CURA 1DQJB 2V9RA 2K45A 2AQRA 4QXVA 3KBHE 3HPLB 5C07A 3GMLB 4E41D 5JQ6L 4XC1H 2NCEA 4HYTB 3BIKA 4X4XA 1WUNT 3KG5A 4RVBA 3CQFA 4Y5YB 5FDYA 1QFPA 3ZZSA 2VM3A 2RBLA 1J87A 1Z32X 1Y6NR 2PPEA 5D4IA 4RFEA 2X4UA 1S7UB 4JPQA 4IHOA 1F1GA 3SE3A 3EXLA 1BZOA 2RD0A 2ZYSA 2XY2A 4YK4C 3IJ9A 5E1GA 5ERWA 2PF6A 3NCMA 4UV7H 1UM6L 1E5AA 1K5NB 3T2QA 3SOTA 1PQZB 3MROB 4POZC 4GS7B 4FNUA 4FABL 3LNEA 4LSPL 3VYNA 2KS0A 3D3VE 4PJ8A 1DDHA 2WC7A 3VGDA 5J3HD 1TKWB 4MJIA 3AU0A 4YDLB 2H26A 1HKLL 4PLJC 3O11B 1UXSB 2W59A 2V9UA 4F15B 3M7OA 1BDYA 2FD6L 4XAKE 2GT9B 3RWCA 3SKMB 4G82A 3L08A 4ORGB 1MCFA 3JTSA 4HK0A 4U31A 4XMWA 1CFSA 2H8PA 5IOPB 5DJXA 5EZOL 1R0AL 5EBWB 4G7VL 3NJVA 5IROD 1OB1B 1MW1A 4J3XA 2P9RA 2NT0A 1CLZL 5JPMA 3OX8B 5F70A 1G9NC 2CQVA 2ITCB 1A6AB 1G4MA 1ZS8B 1Q9KA 3BOVA 3C09B 1ORQA 3FYIB 3GLDA 3MRIB 3RFZC 1EAOA 2PTUA 1EMTL 4MXQD 2QQQA 4KROD 2PXYB 1NFIB 2WXHA 4PRNA 4X9YA 4DCQB 3DXAD 2XBDA 4JO3H 5DVMA 2F1BA 5JXEC 1FGNL 2DYRB 1YSOA 4ZG1A 3BWUC 3IDGB 1QW8A 3W11D 4BZ2L 3VFSA 5CD3A 1T0PB 5DYOA 3MBWB 3RX7A 3ZW3A 1P7HL 1ERNA 4NN6B 4IDLA 1SJHA 4QRRB 1J5OL 1V3MA 3HBQA 1XO8A 2GJJA 3G6JF 5AALA 2L7JA 5HGBB 2YD8A 4IRZA 2NLJB 3CMGA 1P4LB 1EEYB 3D69A 4QHUA 3CX5J 2WGNB 4CN1A 4RETB 4IBTA 4W9FC 3H3KA 3VXRB 2P80D 2D7TH 2BXYA 3MGTA 1MFBL 3RVVC 4P2OB 1GC1L 1RUML 2WKGA 1F4WL 1T1ZB 3RILA 1U92A 3NESA 1LP9F 3PF2A 3P40A 1QSEE 4G43B 3GSRB 5EPMA 4Y16C 4HLZH 4R26H 5E23A 1BQ5A 2QR0B 3I6GA 5HHME 2A3TA 2GB2A 5D7IE 3O6KH 3NJNA 2EXTA 2GY7B 4YZWA 2K9UA 3U83A 4XOCA 1LHZA 4FERA 3RNKA 4NP9A 4JFZH 5D2LA 1HILA 1I1AD 4M43L 3NIGF 1KYFA 4HPOH 4LSQL 2NR6D 4XTRC 3MJ9A 1OSZA 2C1OA 4PPTA 3RIAF 2YRZA 1EO8L 5B38A 5DD6A 4TRPH 5AD0B 3U6RA 5T1KA 1I1YA 4QRUA 1VFAB 5BMFL 4I3RL 3EGXA 4XPFH 3STZB 1IL1A 1FAIH 4AW7A 3CFKB 4G83A 5I8CB 4I2XE 4X80H 4N0RA 4WW1A 2D31B 5LB1A 1O6TA 2D2OA 2OMXB 3ZKMD 4K5PA 1NWPA 2AMGA 1Q94A 1EWHA 2R0LH 4X5RA 3N1MC 3PAYA 2KMWA 4BRVA 2H3NA 5CSGA 3HE7B 2YKLL 4MD4B 4DGYL 1HHKA 1DO6A 2HJKA 1E4JA 1U0QA 1L9RA 1QO3A 2R23B 4PAZA 4IS6A 1BQHG 1XL6A 1E8YA 4KZEL 4U1JB 3TBYB 2GKIA 5E5MB 4HXAL 2MJWA 1BAFH 1CICB 1MCHA 3OAUL 5T1DH 4N25A 4ZOCA 3QA3B 3WY1A 3BGFC 3F85A 1YEGH 2AITA 1VFMA 2MQGA 4U4BA 4BQ8A 3NCEB 4RMSA 3FB8B 3GMPA 4DW2L 2IVFC 2DYPB 3K4DA 4OT1H 1NMAL 3GK8H 5HI5D 4Z7UA 1KELL 4X7TA 2PLTA 3HZMB 4X99B 4WGVB 2UXFA 3KPNA 3GSOB 4F37K 3BQUA 1MHEA 4AXWA 3ATAA 2OJEA 3N43B 5F7BA 3MA7A 4X9BA 2X4PA 5JDSB 3DMMD 2EADA 3GMRA 3HB3D 4LRNL 4M8VA 3L13A 1BFVL 1WTGT 4NWUH 4OM0L 2CAKA 1NCUA 2PWFA 3HMXA 2GFBA 5GZND 5DHVH 4YC2C 2FK9A 5C07D 5H4ZA 3MGOA 3MOBH 5EU7C 4M7ZB 3WNKA 2XIDA 4P23C 1RHHA 3QI9A 4KK5C 4PV8A 2OZNA 2HT2C 2V2WA 1N9PA 4HDIA 2A77H 5IHWA 1BZ7B 5E4EC 4CMHC 4DIXA 3RIFF 1CE1H 3S88L 4O02L 1SJXA 4JDTL 4FNTA 1M7IA 1NEUA 4YX2H 1DJSA 2EXWC 2I07B 3AS0A 4GQRA 2Y1VA 4F9LA 3Q2NA 4P46B 3EH2A 4KV5E 5AAWC 4PJ8D 1UA3A 5DT1L 1E50A 4B27A 1FZKB 4QCIA 2EKSB 3QNYA 4W6XB 5T1LA 4MJID 1NDGA 3SDXF 1KXQA 3AM8C 3DX9A 1K8DA 1KYUA 3GLZA 5DJAB 1OAUH 2VAAA 4YDVB 5H37G 2IG2H 3E0GA 1DBKH 4F5CA 2ZT9C 2YXFA 3TZVB 2UZXB 1TQUA 1ZVHA 1QA9B 1NFDB 1ZA6B 2O6CA 5DA0B 4OI8A 4N85A 3ARDC 1FFRA 2Y0SA 3GXNA 5F96H 3ARFC 3OZKA 3TO4C 5I1HH 1UWGL 4FYTA 4PJ7F 4QUOA 3K81A 4N8CH 4U7SA 3QJTB 2XN9A 2NY3D 3BN9D 4CGUB 1SRDA 3OB8A 4C54A 4NHUA 1I3GH 4HW6A 2J6EH 1Q9LA 5IW6B 1OAZL 2QQNL 3EFOB 2WSPA 4MJ5A 2WIIB 4MJ4A 5FW7A 4XVUC 2OSWA 2BVYA 4G6KH 2JSFA 3BAYA 4A6YA 3ZSSA 5L0QB 4JLRA 4OF8A 3S35X 4GQ9H 3CBJB 4KKRA 4UDTB 1VADB 1T6BX 4AJ0A 2YZ8A 4HHWA 3LV3A 5KZCB 2FGWL 2YA2A 4PIRF 4OI9A 2YC1A 3IJSB 4I48B 5JYMA 1WA1X 3G6DL 1AY1L 1F58L 3MLSL 3SQBB 5F7UA 1HHHB 2J57A 4YAQB 5EF2A 4DO5A 4JFDB 3N40F 3MODH 1MLBA 2NTFB 2Y7SA 3QEGH 3RFRA 3G5YA 2AJUH 2NDGA 5ICYB 3AG4B 5CLYA 5G5DA 3DVGB 1FN4A 2GSIA 4MS6A 2R69H 2EDXA 2WANA 4C83B 4EZJA 2BIHA 3HG0A 4WVRA 2LTQB 3QFDB 4CNIA 5A2CA 1EEQA 1H8SA 2CR0A 2TRHA 5KBDA 4GW4A 4OF3A 5B1BB 2R0KL 3KS0J 4ZFZB 2IV8A 2OL3A 4FA6A 1I7TA 2MWCA 2H9GB 5SWZA 5LGKA 5FO9A 1AO7A 4XGZA 2MTPA 3FCUB 3GIZH 1X5FA 3NIDF 3L4TA 2PWDA 5T1KD 2PTVA 2XPYA 3VI3A 1N3NA 3CVDA 4G6AC 4H8HA 5DWPA 4YHKH 3AXLB 3KYAA 4X98B 4ZX3A 4HCRA 5FO8B 5C0FA 4G8GA 1C5BH 1TQBB 4KZCA 1SVZA 2EUXA 3H7BB 4X7FC 3SZKC 4KUZH 2YHGA 4YPGB 4K9EC 3I9GH 1CFBA 5FF6B 1ZEAL 1RIVH 3FFCA 4LVEA 4Z7WE 2YGVA 2OMYB 3PDOA 4O4YL 4TQ8A 2BIIA 3C5ZA 2VDMH 4W9GC 4ZTEA 4LCVA 5E08L 4GEIA 3VTAA 3L1OH 1Q1JL 4MS8D 1RZGA 3ZTNL 2CO1A 1ECYA 4WNQA 2EXYC 3ARGA 2FR4B 1WWBX 3QJHA 3HHRB 2OQJB 4F24A 1AGCA 3BT2L 3SQRA 4BE6A 1UD5A 35C8L 3AG1B 1O7VA 3EH3B 4WEMB 5HYQB 4H8QA 1PCSA 1NUFA 3BQUD 3VXNA 4DEUA 4ENEC 1JXJA 5EO1A 4GUPA 1N5AB 3VQMA 3VSQA 2BS8A 5HVGB 3X1NA 2EC9U 3ZR5A 4QHKI 5A16A 2ATKA 2XXGA 3B5GA 4YBLB 2PP7A 5JR1L 4UWQB 4BH8B 1KEGL 3NJFA 3QG7L 2BP3A 4A2GA 1QLEH 3KGTA 4LEOB 2EH8L 3DXAE 4B97A 3QI9D 1D7BA 4TNGA 3IXTB 2A4ZA 3RWJA 3NPZB 4Z7VE 1U2YA 3INUL 2ZAIA 3DECA 5H2BB 3RL1B 4UILH 4NPYB 1A9EA 1OWRM 4PJDE 4HIXH 2Q6WB 2OBGA 5MEOA 3CDZA 1YDPA 3NCXA 1GYVA 1U8IA 4LPYA 5CU9A 4AVJA 4C56A 3D2UB 2BMKA 4TSBL 1HXYA 1ZXKA 3FO2B 4QLWA 3T2OA 4Q9QH 1FL6B 2V9TA 3WYRA 4AGLA 5T1LD 4DK3A 2Q7NA 2ZG2A 3GXPA 4IBYA 4PSRA 1KGWA 3F6IA 5I2IA 4M6NH 1NUGA 4J3UA 5EIVA 1I3VA 4R4NC 2H6UA 4NDMA 2UZPA 1YN6B 2A9CA 1VFBA 3LZPA 2HPOA 4RRPG 4ZMTA 4KI5D 5DRZA 3RI5F 1AXSB 4GUQA 1FVEA 4Y9GA 4DGVL 3HR5A 3DSFH 1S7XB 1QZNA 4A2DA 5GISH 1IC4L 2XN9D 5JIMA 2EUWA 2IH1B 3AAZB 4DP0X 1BEYL 2FEEL 2YA1A 1WD8A 4MCYB 3HMWL 4UV4H 2ZX8A 1Z9MA 5EEWA 4Y4KB 4LCCC 4N9GA 4ZD3H 1I8LC 2DWTA 3BP4A 2V5RA 1MJUH 4KKAD 4DPAX 2KZBA 2ZXDA 3I3BA 3L5WA 5EDXA 3WN5B 1QRNA 4MMZB 5CCGE 5K1NA 3L5HA 3DHUA 5IKCA 2NW3B 3UO8B 4L1HA 3QJVB 2EICA 4W9CC 2W9LA 2B3IA 1H15B 2G4EA 4TNWK 4YFEA 5ABAA 3D50A 3R19A 4X7EC 4DKAA 3TTYA 4P3DB 2GTZB 3L2LA 5MENB 1ADQH 1JVOA 4XP5H 5J3HC 1WCQA 3UAJA 5LVEA 2VDOH 4WTWA 5FUCC 2R29H 3ROLA 2BSEA 3HS9A 1NIAA 1KJ2L 3HNVH 3LIUA 4LLVA 3CVIH 3CSPA 3D08A 1CXIA 5SWZD 5IROC 1S2EA 1AO7D 1V3JA 2CCWA 4UQIM 3VCLA 1DFXA 3WKNA 4A63A 4PGCA 5CJOH 3UMNA 4L29A 2NT1A 3OJDA 2QSQA 3T04D 2CA4A 2NNXA 2VO8A 3LKQA 3DK2A 1O9VA 2DI9A 4ONGL 1PY9A 3ULSA 3T3PE 3MJ6A 1VACA 5ESQA 4KROC 4G8GD 1UH2A 4MNGB 2XV0A 2W65A 4U6YA 1CBJA 1BZDA 1T5KA 4AYFB 4A68A 4IBVA 1YJDH 3DDGA 3DUSA 3W11C 3B9KB 2Q7YA 3FFCD 1TOXA 3EO9L 4JFSA 2YGPA 4NQSA 4DP7X 3C5ZD 5AAPA 1UB5A 2AABH 3N0PB 3R06B 2OXGA 1IX2A 5CFAA 2F74B 1MW2A 3IMRA 4L5FH 1HJBC 5DZVA 4HIIB 2BSBA 3HE6B 5CLZA 4YHZH 3ARGD 4Y1TA 4EI5B 1NKOA 5E1AB 1N7MH 3DX4A 3H4FA 4JMNA 4BA8A 5KS9A 4FQQB 1FRGL 4R4BA 2PPFA 2R2HB 6FABH 1MAMH 4W4OC 3BZ4A 4RNRB 2E7MA 2PW1B 3IWVA 4PB9H 2XTSA 3VFNB 1NH6A 3VYOA 3AQXA 3DNKA 5D93C 4B5ZA 3MRHA 4NC1C 1SYSB 5LCVH 1TTUA 3T8XA 5HDBE 5KBNC 4FQXA 5CJBA 3FUNA 5J1AA 3GSUA 1TZIB 4ZQKA 3CC5B 4N3TA 3DX0A 3FTXA 3RU8L 1SY6L 4BKLA 2P8LA 5BXFA 5ID1B 3U0PA 4BKSC 1S3KL 1P5UC 4L8CA 4N90D 3B3IB 4FI8A 4LL1A 3VFRB 3QEQB 4JY4A 3CSYA 5DHVB 1DBJL 3HRPA 3OKYA 4KJPD 1T89C 4Q6IA 4XXCA 3FO0L 1OVZA 1JN6A 4X4YA 5D7EA 3LQAL 4K2UH 1WH0A 5DUJA 2ZAGA 3BLBA 3W57A 3ZKMC 3S3PA 3QJRB 4C56D 5DFAA 5TDOB 2CHWA 4ICXA 3WKYA 5BUAA 3H9SB 2Y4SA 4W9ZA 3ARUA 2H1PL 3O2DA 4GSXA 3MCLH 4GINA 1KPRB 1QRKA 2LU7A 4JR9L 4N26A 2OS7A 2QGCA 4XVTH 1DBAH 3KXFB 3VD1A 1Q9OB 1U8PA 2F19L 3FB7B 4P2QA 2CJTA 3QZMA 4I77L 3MR9B 4PJ5B 1KC5L 4W6WB 4AI7A 2PTTB 2VXUH 5D1ZA 5GS1A 2YAEA 4MDJB 4HJEA 1T5WA 4JO4L 1WK0A 4G7QB 3L3IB 2VISB 1DBML 5HI5C 5EORL 1TFPA 3QIWB 3LIZA 2CUHA 1CCZA 4E9VA 4J1UB 5HJ3A 2NQDA 4EBQL 2WTRB 1R3HA 1CTOA 2XQYG 2UVEA 2ODHA 3DMMC 3IN0A 2A6JA 1DVFC 4WF7A 4JHVA 3AROA 5H94B 2Z65C 1ID5I 1Y7VA 5EBLB 3ULUL 5HHQB 3E6FB 4N2FA 1HHGB 4W1TA 3FF7A 3QRFM 4PCSA 2V7NB 3SBWA 3LHPH 4HIPA 3CZKA 4XB8A 3HC0B 2YD4A 2Z92A 2DV6A 2E56A 5AYTA 1QVOB 2FQGA 4Z0BL 4PP1D 5A2BA 3CDCA 1D5RA 1E4XH 2WM0A 3QNZB 2DIEA 2X1OA 4HH9A 3UO1L 5EHFA 1OW0A 5ABZA 4MB3A 2LU5A 1BBDL 1QRND 1IGTA 1P6WA 3M8OL 4JY5L 3CQQA 2QVTA 3NOIA 1BLIA 2ZOTA 5GRVL 3WNMA 2F53A 4MDIA 4FXGA 1AIFA 2YBRA 5INDA 1F8TH 2CBTA 4BSJA 4IIQA 2ADIB 2YD0A 2J8OA 3HJ0A 3DURB 1GIGH 4TMPA 5E4IA 1UWXH 4M61B 2JKWA 2QVMA 4HKBB 3UAJD 3NIFB 1JZHA 5KSAA 4YLBA 4Z7UE 2B2XL 5HYSG 4IRJB 4K0OA 2BSED 2NUPA 1K8IB 3SSGA 1CLOH 1GTNA 5F89B 1P69B 2UYLA 5IB2B 4J2XA 2V3EA 5KYUA 1X5IA 1JD7A 1KV7A 4PJIB 5L2JB 4HCGA 3ZE2E 4HBCL 4IIZA 2EH7L 3D4YA 2MHAB 3THML 5JPMC 3AU1B 43CAA 4KTDL 5KBMA 3O3BA 2X88A 2YO3A 3N44F 1X5ZA 1F90L 2NY3C 2W0FB 2APSA 1ZVSA 1F00I 4DPRA 3GB7A 1IFRA 3UTSE 1HESA 3QNXA 3WELA 4FLQA 1TVBA 4H8VA 1MFAH 4IM8A 1TZHB 2FO4A 4IKKA 3LN4B 5EU3A 1MEXH 2YPKB 3OR7B 4X8CA 3JXAA 5E0FA 3ZVVA 1BSIA 1Z5LA 4R96B 5KN5B 1DSFL 1HSAB 1YNLH 2XLLA 2C9VA 1FFPB 3LZQA 4FQHB 2MNJB 4F57L 1JBJA 2BVOB 1UH4A 3MNZA 3H9HB 2D3JA 3EKCA 1AJ7H 1DLHB 3H55A 2DN7A 4Y1AB 1CD0A 5C0AA 4G1EB 3O3DA 4ZFOB 1QASA 2FO8A 2VDMB 4UMSA 1LTXA 5EBMB 3IGFA 4L3AA 3KYKL 1MRFH 2LE9A 3LZRA 4JFYB 3JTBA 1MIML 3TNMA 2HFEA 3SBQA 5CM1A 2QHLA 3CDYA 4F5CE 1BGXL 3ZMNA 4C47A 3U7AA 1KF9B 4UQCA 2EABA 2FIKB 5AB1A 2HA1A 4ZW3A 3LB6D 4B50A 2EEDA 4M5ZH 2A83A 2YXVA 4XBEH 1URIA 4L9DA 1I7ZA 4ZPVB 3VNZA 2ADJA 5J0BA 2JKXA 2Y5TB 4FQXD 5C0JB 4JCMA 2XN9E 5LDUA 3OLDA 4U6VH 1B2WL 1FYTA 4I4WA 1LO2H 1ILUA 3MLVL 1M3JA 4I87A 3K8KA 2Z91B 2MCG1 3ES6B 5DXWA 4UQBA 1HH6A 4XP6H 2W88A 1MG3C 2PR4L 4PVBA 4NKOB 2N4IA 2ZKMX 3WFCH 2OCFD 5DMKB 1CL7H 3VJ6A 1G9MC 1OOAA 3VW3H 1QFWI 1CFTB 1QLEB 4EDXA 5CJQH 1QLRB 2RACA 3M1BB 1D5MA 4QGTA 4PJXB 3APFA 4UT6L 3KPMB 3M17B 3RBSA 4PJCF 4ATWA 2ZCLH 3PHOB 4ONOA 4OJAA 2RQEA 3AREA 4LLDA 4QKTA 2C7FA 3CLEH 4I3GA 4HKZA 4JZJA 5I0VA 4P2QD 3RUGE 5I1LA 5I76A 2DQUL 2MPVA 2BNQB 3EYFA 3EH1A 3NP3A 1UB6B 4MS8C 5MI0C 3RX9A 4ZW7A 2EVFA 4X8JA 5DZJA 2VLRB 4AITA 4AIEA 1RV6X 1FQ9C 2WLLB 5D7JC 1J0YA 3UFIA 2R1XA 4P5KB 4Y7OC 4MAUH 4E9TA 4M8UA 3JZ7A 1UWXK 3ARZA 3EW3B 1UOWA 4OBRA 3BQUC 2BY1A 3FU7A 3B7RL 1F6LL 4FEIA 1LQBC 2CZNA 2I27N 3IDYC 4UAHA 1ZA3A 4X6BA 4Y0GA 3TX4A 5CINH 4CADA 2FL5B 3I2CL 4GP4B 1X6NA 2AQNA 2ENJA 3MRNB 4TN9A 3X12B 4NZDA 3U7YH 3QAZC 5EH1A 4AEFA 5KVEH 1KCVH 1Z5HA 1HL9A 1IKNC 4OU3A 2CH8A 1KB3A 1TQWA 1KTKE 2XFGB 3GZQA 4IRSA 4CJ0A 4WWPA 5HXMA 2H2PC 3W81A 2BHYA 2VJ0A 3FFCE 3MRFB 4NP4L 1LO0H 5I71C 1DQTA 2Q86A 3VB8A 2ADFL 5I28A 2M83A 2FLRT 1K5WA 5HHNA 4ZNEA 5C0ND 4Z1PA 1G94A 1FZMA 5JW5A 4FFYA 1DVUA 2F53D 4UF7C 2QADC 4HGMA 1OGTA 5GGUB 1CF1A 3R4DA 4AGQA 3CBKB 4X4ME 3ZGIA 1BWWA 1HNFA 2NNAA 2VDRH 2NQCA 4KK6D 3HG5A 5TE7L 5EC1B 3TBTB 4LEXL 5KSAD 2CLVA 2CO6A 3EOBB 3GM0A 4UUJB 1XQ4A 4ZUVB 4ODTH 2AEPH 4DZ8B 3RWEB 4Z3JA 1CFVH 3EG9A 3JWNH 2VDOB 1SJEA 3E8VA 1WFMA 5F1KC 4XT1C 4KI5C 3VA6A 2AXGB 3UCQA 1SMOA 3NJMA 3CHRA 1EJ6A 2Q87A 2A6DA 1WT5A 1WUZA 4FHJA 5AUMB 2EO7A 1S9XB 3L4XA 1MW0A 4AKOA 1R47A 1G9NL 5I15L 3PXHA 1FA4A 5IMLA 1FZJB 4QHLA 4K9JA 1G1CA 3PQYB 1GOFA 5CS7A 2NZ9D 5DMIL 1WC7A 1F1DA 1I1FB 1WHPA 2G3MA 5BQ7B 4OFVA 1IJNA 3GHEL 5CKGA 4LPXA 3U2SA 4HWBL 4PHXA 4XC3H 1XSJA 1KTRL 3T08A 3VFUA 3PCYA 1JK8B 4XB7A 2PWGA 5DEZA 4C56E 3L7EB 1F11B 4TL5A 1ETJA 1U8NB 1MJ8H 3BW9B 2YPVA 4H88L 4PRDB 5E2VL 5C0AD 3SKUD 3WTVA 2B1HL 5DJ0A 3BSZL 2B3RA 3BH4A 4G59C 4JFFB 3T65A 4IEFA 1FH2A 5DWUL 4JPIA 1LEKA 1JPEA 4B6ZA 3S36X 1KN2L 3QZBA 3QCTH 3BVVA 2NSXA 1OB0A 2O5XH 1H3XA 3GXDA 2XWRA 4FRWA 3IJHB 4EI0A 3G5XB 4F2MB 1T21B 1OPGL 2VJ8A 4I0PA 4PJXF 1WQVT 4UQ2A 3KH3A 4YXHL 2ZWNA 2ESVA 2OTUA 4OAWA 3L3JB 4KFMA 1LILA 1MXGA 5IV2B 1QOKA 2R0WL 1BIIA 3NFPA 1FYTD 3S8WA 4M7JL 1J88A 1R6VA 5IEHA 4OIIL 4PJAA 1VKXA 4JHWL 2VSCA 2ICEA 4XCCL 4O9HL 1RK0A 4X4KA 4YSDA 1M3IA 1BBJA 4EXPX 1S7WB 3HZYA 5ENWB 1G4RA 3BLKA 4HZLA 3V4UH 2C3HA 1PIFA 1JS4A 5CFHA 4F7TA 3BKML 2RFXA 3QHTC 1N64L 2GTWA 3BUYB 1H3VA 1HZHL 25C8L 2WQWA 4TVPL 4PG9A 3N85H 3P9LB 1Z0NA 1E6OH 3DTUB 3IF1B 3TURA 3PAUA 3NACH 2Y72A 3O9WB 4IOSA 5D70H 1A2YB 2H1XA 3ARED 5BZDA 2XC8A 4X8XA 2OTWA 2G2RB 3C5ZC 2XRAH 4NUMA 1D5IL 1IAOB 3FTGA 5FV1L 4QRTB 4BHUI 4K3HA 4APQA 4K23H 4HJIA 1A9VA 2BY2A 1JPSL 3MFFB 3S4SG 5ITFB 3BUPA 1ETZB 3W5MA 5J1SC 5F7EH 1H5BB 4JQXA 3HR6A 4KX8A 4KTEH 3I74A 4ZX5A 1N5YL 1DQDH 3O6MH 2C8NA 3K2UL 3HPJB 3R8BB 1Y0LA 2L3BA 3VM7A 4FMKA 3A6BH 3SKJH 3TV3L 4WHYH 3HS8A 2ZX6A 5IFJA 3FOLB 1MI5A 1AACA 3EYUL 3R7RA 2Q2EB 1GJIA 3FUFA 5F1NB 1KB5A 3LJ3A 5C7XL 1MPAH 1SBBA 1ORSA 3FO1B 4JRYB 1XH3A 5CBAB 2AKRB 1D9KB 5DK0B 5J4MA 4O51A 1FNGA 3CN1A 4ZOEA 3SN6N 4AGPA 1FAKT 2CNZA 1Z1WA 3O2VL 4UQEA 1JAEA 1I1CA 1L0PA 4N2LA 2VDLH 4FP8H 3P4MB 4KJPC 4OD3L 4EVNB 2LHAA 1E2WA 1ZHLA 2H0FA 2ZONA 4G1MB 5ID0B 4BA0A 2JB6B 3LKOA 1BZ8A 4RGNB 5KSBA 4HS8L 4Z5RB 4CU7A 4E68A 4X6CF 1KJ3L 2VLLA 1EGJH 2A0LC 5JLZA 2IALB 5KS9E 2XQBH 1I8IA 3QHFH 4G7SB 3L48A 2J8UE 1VESA 4QF1B 4M5YH 3IGLA 1K3IA 1E5CA 2F15A 4OLVL 5FA4A 1NC4A 2IMNA 4P9HC 4H5SB 4IMLA 2R2BA 5B1JA 4AV5A 4LHUA 4N2NA 4W9EC 2AW2A 2FH8A 5LNEA 5D6CB 4ZX4A 5SWSA 4S0SD 4OD2A 1R33A 1ILSA 1UXWB 1F4XL 4XNXL 4WEBH 2DI7A 2EUZA 4JRXA 1RZKC 4KK8D 3I75B 2BVQA 3ARSA 4HOMA 3IRZA 2DQEH 4M93B 1A21A 1QLFA 1EAPB 1GHFL 1UM5H 2K70A 5LNGA 4X9IA 5DFTA 3P4OA 4HJJL 3MLXL 3GI8L 4JG0L 4JVWA 3V5KA 1IZKA 1DQLL 3GHPA 3P3YA 4ZTOH 1F97A 2DH2A 5TH2A 4JPWH 2AXFA 3BAEH 3IMTA 4PWJA 5HD8D 4V11A 3WHE0 1FHNA 3VXSE 4UTBH 3UJTH 4PP1C 1ITBB 1YN7B 5DRNA 3D25B 1WG3A 3LXAA 4G6FD 4G9DB 4RMBA 1AQDB 1J1PH 1WZKA 4P4RA 3UC0L 1I8AA 1KBBA 4GG8B 4P2QE 3N04A 5D1QB 1A0QL 4U05A 2O5NA 2NZIA 3JV6A 1T80A 3T1FB 3VG9B 4I18C 1XGQA 1NBQA 4MKMA 3ULUF 3ARRA 3UAJC 3NH7L 1KJMA 1WAAA 4X5XA 4QXGL 4I0PD 4XPAH 2VMDA 1ES0B 1B0GA 3FL7A 2ESVD 2NXYB 4A66A 1GOHA 3FRUA 2G9KA 3NZUA 1JERA 5IQLA 4PJGA 1KBGL 1N10A 3GBMH 1OK8A 4LKXB 5C70A 3OKMB 2F0CA 1UXMA 5E6IA 4HWEH 3V0GA 4M5TA 5SV4A 4ES8A 3P11L 3UPRB 1LE5A 5EUOA 1L0YA 3BZ5A 1PG7H 1I9JH 1ZTMA 3HN5A 4YHNA 1AFVL 5KVDE 2P28B 1QQDB 4G7YL 1KCSH 2BOCB 1U6AL 1G6RL 4JPKH 2CMRL 3IDIA 3N1PC 5I8EA 1U8CB 1NCCL 1PSKH 3CPLB 5IQOA 2GQHA 3UOAB 5FEBA 3SO3C 4MQ7B 4I3SH 5IUSA 3MV8E 3PXJA 3SYPA 1B3JA 3ZTJH 3QIUB 4HIJA 3ZJAA 5HHOA 2QQLL 1ZV5A 2CLZA 2PYEA 3GKZA 4HA1A 1INQA 1RK1A 4NZ8A 4IOSD 3BPNC 3ZL4H 4AYGA 1RVFH 4NT6A 4K9EL 4F58H 3T4AB 4CMMB 2HTKC 4KI1A 3WIHA 3V6OA 1AQKH 1KGXA 1OF2B 1RZ8B 2AK1H 3BUQA 2F53E 3TH2T 1EEZB 4PS4H 5KSVA 4APQD 1AZUA 2OR7A 2Y1YA 4PVMA 5E2TL 5I1EH 4V2CB 4YK4B 1J8HB 3MRQB 2UWEA 1OCZB 1BFOB 4NO3A 1D7FA 2IBGA 4R7DB 2DBLH 3PWLB 2Y24A 3CHQA 1GCYA 4KVNL 3V7AE 2AV1A 2ZXWB 2IDUA 1OSPH 2CUAA 4ZUWA 2NY7H 4CDGC 1A3QA 5CZXD 4LSTH 5EZJB 3MYZA 4PWIA 4M7KH 3D4ZA 1MI5D 4AQ1B 2LQRA 1VCBC 4NZJA 3BLPX 3M46A 2C9QA 1M71A 4KRMB 5K69A 2QPSA 3WS3A 3QZWA 1WGOA 4FQXC 5L2KB 1KIQB 1T04A 1ND0A 2EE0A 2V4LA 4E9LA 1GAFL 2AK4B 3V4VA 2EDYA 1UJ3C 2F58L 2FBOJ 4KXAA 4Q6KA 5D72L 3WNLA 5AG9A 5CEZD 1G7LA 1TETH 1PZ5A 1RMFH 3QXAB 5E03A 1NOFA 5BJTB 1HX0A 5BNXD 3TA4D 2YPLA 2X4SA 1IAMA 1QTYT 4Q6IC 4XXCC 3QYMA 2WD0A 4XXWA 3IGUA 2YBGA 3CZGA 4ZMXA 2G5BB 2JCCF 3BEWA 4RMQA 4ANWA 2Q10A 5D1ZI 2ZSWA 4YZFF 1K6QH 5C0AE 2BP0A 4OFIA 1UC6A 2OMTA 4PWEA 1DN0B 1V7MH 2WMPA 3F7RA 1QEWA 1T66D 3K46A 3MRGA 5GGVL 3S3JA 4FHBD 4CVXA 3OWRA 2EILB 1A5FL 4PW4A 5T5FL 4LSSH 3SO5A 5JIHA 5DLMH 5DJZB 3LRGA 4KPHL 4OZIB 5AZ2H 3QPXL 5F6IB 1NC4D 1NZRA 4KXZI 4UOZA 1CPUA 1L9PA 4PWGA 5D1ZC 2J72A 4LHUD 1L7IH 1DQML 1JGUL 1A1OA 1RJYB 1GPOL 5SWSD 1FNHA 5I6XB 4E2OA 5J6SA 3PV7A 5ICZA 5GJSL 4JRXD 1N6QH 3RAJH 2N7BA 1LO4L 2C3VB 1SZNA 3AFLA 4JHBA 5HGGS 2BFGA 1FYTE 2VR7A 2HVJA 2KKQA 5GGRY 5DK3A 2NXZD 3PL6D 5LWYL 1FZOB 3IDNB 3MRDA 2WP3O 3QHZL 2D4FA 5CILH 3B7SA 5FYKD 4S2SA 4YXKH 3VRJB 2X87A 3V4PH 2VZTA 2YK1H 3WFHA 5I74B 4L37A 3MLRL 1RUMH 8PAZA 3SBWC 3ARBA 3I6KB 4BUHA 4WY7H 4X9GA 2YLKA 1TJGL 4L4VA 5FW8A 2VQ1A 1MQKH 4HGWB 1IEBB 2ICES 1XCQB 1WFNA 1FG9C 1OW0C 1KIUA 2X6BA 4QWWD 1P7QB 5CZVH 4CSTA 3EOTL 1MY5A 2N3JA 1TR7A 1RUQH 4IK6A 2X53A 3UG4A 4H0LC 3EJRA 3OAWA 2X28A 4LEEA 2FNWA 5TGBA 2GSGA 4YDIH 5T3XD 4FXGC 3RZCA 1LDPL 4IIQC 1LO5A 5F0LB 3F00A 1GZPA 2QVKA 2RAMA 3SDCB 3VFWA 4NO5B 3FO9A 2XNAB 3D0LA 3UROR 2YUVA 5DMGD 5KSAC 1FIGH 3SPVA 5E51A 4YHOH 2Z4QA 2EC9T 4XMVA 3KPOA 4GLRI 3D3VB 3GSVA 4PREB 4AH2B 3IYLW 5CGTA 4NQTA 4FFVD 3AB0C 2OX5B 5IBTH 3PABB 1JGDB 2QELA 5E6ID 4RWYH 3NJIA 3RTQA 1KFGA 3FQ2A 4J3OG 1T2QH 1U8LA 12E8L 2IAAC 4PWFA 4ICWA 2YKLH 3SGKA 1S7QB 2CJUH 3AY2A 4XN2A 3RJDA 3WTSA 4NWTH 1AVAA 2ORBH 3ZDZE 1G0YR 1HXMB 1QFWM 4KZEH 4AJWA 4XOEA 1JF1B 4F8TA 2IFGA 4YEEA 5ESAA 3KL3A 5KG9B 2NZ9C 1N12A 3SDAB 4B7IA 3LKRA 5JHDA 5HHOD 2PYED 4LGPB 5HPMB 2F5BH 4QNPF 4H8PA 4X6DE 4X8GA 4B7LA 3LEYH 3BPLC 4ZNEE 3ALPA 3D39A 1KNOB 1RIUL 4NO0B 3UJIL 2WV3A 3P0VH 4IGBA 4LRNH 2VR3A 4ZBJA 4TTDD 5F0PB 1BFVH 4LPUA 3QJSB 4JDVB 3DPDA 1U8HB 2WVTA 2ENSA 4XVSH 3GTVA 4LLYB 2D0FA 3U82B 4ZOBA 2VXQL 4WQOA 1H8LA 4JKPL 4JN2B 1TJHL 4LFHD 4Y5YA 4ANKA 1VEOA 4FQ2L 4OZFA 2L4OA 3BWUF 1BZEA 4N2DA 2XU9A 4M3JA 4PRPA 1K9TA 3BIBX 4KNSA 1HHJB 3BWAB 5HHMB 3UBHA 2QSTA 5D7IB 1J0HA 3BGMB 4YBQD 1A6UL 5CWSB 1K5NA 5HDOA 5FDWB 4ZFGH 1B2YA 3MROA 4GH7B 3BYYA 3HI5L 1TEFA 5BOZG 2Q76B 1FVDB 2AFNA 3QUKB 7TAAA 3BKJL 2YPLD 1TKWA 5IQNA 3WFDL 1X5JA 5TE4L 3KEDA 3O11A 4ZXBB 1UXSA 1CC3A 2GT9A 1NLDH 4OJFH 4ORGA 5D7KE 1H8OA 4QD2E 3EYSL 5IOPA 2BIMA 4MZ3A 2VDLB 1FDLH 2ZCZA 1OB1A 2XTJC 2DDQH 2EXSA 4IJ3B 3C6LB 4I2XB 1XIWA 4JAMA 3U9UA 1I3RB 1TVHB 4M00A 1RZFL 5BVPH 3OX8A 4LB8A 2ITCA 4JZJC 3SCMB 4ZDHB 5IHHA 1RPQA 3GJFH 1EHNA 2VXVL 3MRIA 5IVZA 1HQRA 1VERA 3WLWD 2P5WE 1LO3L 4M6AA 2DF3A 2QHRL 2RIKA 4FNPA 4NOFA 1NFIA 2DL2A 3ISYA 4F1SA 1C12A 1M1SA 1MCRA 2L7QA 3CQPA 1MVYA 3O0LA 2O1AA 3KL0A 3IDGA 3IFPA 2RJMA 1IBGL 3U1SL 1PLGL 1A4JB 3MBWA 5C0BB 2FGWH 1RJZB 4PJAE 1HCFX 4L9LB 2R4SH 3WIIL 4GSDH 4QRRA 3RVXD 3NAAL 4DFIA 1NGWB 3U36B 4CW1B 5HGBA 5IW3A 3HEIB 1P4LA 2F9BT 1KXHA 1CDGA 2IH8A 3H42H 4LVNB 4WAFA 1EEYA 5FYJD 4AKPA 5IT2L 5KVMC 3PHQA 5E8NB 3L5XL 3D7PA 3ARBD 3DIFB 3HNSH 2W80C 1QABA 3C60B 4LDOB 1CD8A 1RP9A 3VFPA 4L4VD 5K5YA 3C2AL 4WI2A 1X9LA 1IKFH 1MCPL 1TLMA 3GSRA 4IRSC 4HQQL 4R8WL 1XXDC 4S1QL 5IMKA 2K9FB 2QR0A 4F7KA 2HZHA 1N0LB 5GIRA 3SE4A 3LNGA 1BZQK 3E1ZA 1CXHA 4TQEL 1FORH 1FH5H 4PWHA 3RL2A 3QYCA 3OJ2C 3BZFB 3RZCD 1JWUA 3DUUB 4UQAA 3WIAA 1HFUA 4KKBD 5I5RA 4OCXL 2VNCA 3E8UL 1BMGA 3RWIB 3HBZA 1QAWA 1EJOH 3C5JB 1CGVA 2FX8H 4K7PY 1VFAA 1D6EB 3C6SB 3KLSA 5C9JA 2LU3A 1KT2B 1JPST 3CIAA 5F9WC 3WL9B 5I8CA 4HUVB 2D31A 1MI5E 4F9PA 1YYML 3PJNA 1OZTG 3RTQD 1CXEA 1YAIA 1FWXA 2R1WA 4OM1L 2YQGA 2Y07L 5I8OH 1YA5A 3T6VA 1SF5A 1PEWA 4U4IA 5HHXL 4RQQB 4HZ1A 1V55B 4UMGA 1H3WM 3MRJB 3A6CL 3MJ9H 3M45A 4MLIA 3P30H 5CEZE 2I25N 4R4FH 1YNKH 1XCTA 2MFNA 4XP1L 4R2GD 5E5MA 1A66A 4YLQT 1LK2B 3QA3A 5JHDD 1CTNA 1M1XB 4WO4A 3L1EA 3IFOB 3AXIA 3MACH 4TVSa 2OPCA 1WA0X 1XD0A 3FB8A 2DYPA 3D39D 5KSBE 4K7PL 5HD8C 3HZMA 4X99A 1CK0L 3W9EB 3GSOA 1AHWB 4IGBD 5JDSA 3MDJA 4CSPA 2OI9B 2C3GA 4RAVA 3ECQA 5BW7A 4LBEA 3QRBA 5DI8B 5KSUB 1NBCA 3BAJA 2VW6A 3MBXL 4JKMA 5EC2A 5JIQA 1BQHA 5DC9B 5ADPL 3OGOE 5BZZA 4WFGD 4DAGH 4HV8B 5SWSE 3SOBL 2V8LA 1NCGA 2L8AA 3GRWA 3EH4B 3GJFK 4JRXE 1I9IL 4I0PC 4PUBH 4Z7NF 3SHSA 5K1VA 4PRPD 4L8DB 4LASL 7FABL 5IREA 2XYCA 4XE5B 2I07A 4UT7L 5IVNA 2QFRA 3ABZA 4MDRA 2GK0B 5TE6H 1SXCA 2ICEC 3A47A 3DSNA 4P46A 4HULB 4HISA 4JZNB 4AMWA 3HMXH 1Z3RA 4LVOB 4L1DA 1BVLB 3MOAH 4RDBA 1NBVL 1F6AB 1MCLA 4XOAA 3TFKC 2AJVL 5I8KH 1SNRA 1C16A 3EOYG 3K6FA 2MTAA 1G9ML 1PKQE 4ONFH 4OLEA 4HIEA 2B9AA 5DJAA 4N2OA 4YDVA 1Z9OA 2BJML 3BZEA 3TZVA 2UZXA 5MP6L 1GGYA 1QA9A 1ZA6A 2NZ1A 4U49A 1W8NA 1XIWD 1RJCA 2E4FA 2ZUXA 4NQVB 5K93A 4Y5XB 1NEZG 4A7UA 3I85A 1URLA 5DHEA 2FJUB 2XVGA 5F44A 4CA4A 3DX1A 1EAQA 5JXAH 1QFWL 4N1HB 4APQC 4GUCA 4DEWA 1CE6B 4Z7WB 5IIEB 5IW6A 2AAAA 1WAAE 2WIIA 1U3YA 5F9OL 1MCOH 1RI8A 3SY0B 2VCOA 4JQXC 5FGCE 4K55A 3VFTB 2BW4A 3LN5B 1EXUB 2CR3A 2G5UA 5T3ZD 1QHQA 3ILEA 1VADA 4QHPA 1S5IL 4RGMB 1LXMA 5H37A 2ZF9A 2VERA 4QRRD 1EH9A 4YXLL 4WLCA 3FH7A 4WHCA 2FB4L 1E9PA 1E90A 3HOGA