3WTSA

Crystal structure of the complex comprised of ets1, runx1, cbfbeta, and the tcralpha gene enhancer dna
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
119
structure length
119
Chain Sequence
MGELVRTDSPNFLCSVLPTHWRCNKTLPIAFKVVAKGDVPDGTLVTVMAGNDENYSAELRNATAAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKITVDGPREPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/dna
molecule keywords Runt-related transcription factor 1
publication title A novel allosteric mechanism on protein-DNA interactions underlying the phosphorylation-dependent regulation of Ets1 target gene expressions
pubmed doi rcsb
source organism Mus musculus
total genus 20
structure length 119
sequence length 119
chains with identical sequence F
ec nomenclature
pdb deposition date 2014-04-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3wtsA00
3D07A 5ECGA 3VD0A 3QYMA 1HJCA 2IOOA 2J1ZA 2X0WA 3US0A 3D09A 2BIMA 4AGNA 5G4NA 3QYNA 3VD1A 2X0VA 4IBQA 1HU8A 3WTTA 4IBTA 4IBVA 4LO9A 2P52A 3WTYA 4AGOA 4LOEA 2BIQA 2AHIA 2FEJA 1TSRA 1GZHC 3Q01A 2BINA 2J21A 2GEQA 2J1WA 1EANA 2RMNA 5KBDA 5A7BA 3IGLA 1E50A 2WGXA 4MZIA 3Q06A 5AOLA 5AB9A 3US1A 1CO1A 5ABAA 3WTWA 4GUOA 4GUQA 3VD2A 2XWCA 3Q05A 2J6WA 4IBZA 5AOKA 2IOIA 4KVPA 4XR8C 2J1XA 3IGKA 5LGYA 2H1LM 5LAPA 3WTUA 2MEJB 3KZ8A 3ZMEA 4LOFA 4QO1B 4IBUA 4IBYA 4AGPA 2X0UA 4A63A 4G82A 1CMOA 5AOMA 4MZRA 2ATAA 5G4MA 4G83A 3D08A 4HJEA 1KZYA 4IBSA 1TUPA 4L18A 1UOLA 3WTVA 3TS8A 1GZHA 1T4WA 3EXLA 2J1YA 1YCSA 3EXJA 4L0ZA 4IJTA 3WTSA 2BIOA 2ADYA 1HJBC 2PCXA 1EAQA 3KMDA 3WU1A 5G4OA 1LJMA 4IBWA 2BIPA 2VUKA 1EAOA 5BUAA 2OCJA 3D06A 3D0AA 2XWRA 3WTXA 2J20A 3D05A 5AOIA 1H9DA 2AC0A 4AGQA 4AGMA 4AGLA 5AOJA 2YBGA 4L0YA 1IO4C 2IOMA
chains in the Genus database with same CATH superfamily
3RVXD 1ZGLB 5GXBB 1HSAA 4FN0A 2CJUH 1ADQL 3AREC 4DESA 4TVPD 2VW7A 2X3CA 4EBQL 1CGSH 4O2EA 3FFDB 2BIMA 3QDJB 4UQBA 3B83A 3WBDA 5T3ZL 3VXOB 1B4RA 4AL8C 4X7FC 1IC1A 3QJVB 4NHUB 2VDRB 2FYYB 1B4JL 3O4LD 3M86A 3DJ9A 2ORBH 2YSSB 3I50L 1E9OA 4AYID 3L9EA 3I6LD 4O2FA 3UTQA 3A3YB 4KI5F 1PLCA 4GS7B 4XOEA 1CS6A 5H8DA 1IT9H 3OJ2C 3VFVB 2CCVA 4Y0GA 2EEBA 4UNIA 3DUSA 4LRNH 5CBEA 1V10A 2EIDA 2UWEF 3RVUD 1U8NB 4A68A 4XP1L 3DURA 2MCPL 2P7TA 5JHLL 5LAXB 3SGEH 4LEXH 2AJXL 2CPCA 2VDOB 3VXSE 3MCKA 3SJVA 1WFNA 4AW7A 3RTLA 2WCPA 1UXLA 3IRPX 3C8KA 1Z9NA 3D18B 1EA9C 5AZUA 4OFYD 1H6UA 5DI8A 5KS9F 3QDGA 5CSBA 1L6ZA 4Y1SA 4BK5C 4GY4A 2E9BA 4AVKA 2NYZA 5AOMA 5KSBB 5DUJA 5T33L 4FHKA 2F19L 3O3UN 3TNMB 2EAEA 1DDTA 3O9WD 4WQOA 5MENA 2XIDA 2EEXA 2HKHH 3HC0A 4UYPA 3LPFA 2L7QA 4UT6A 1ZV9A 4A7QA 3JWNE 4HS3A 1T2JA 4K9EH 4Y9GA 5DRNB 4F20A 4PSRA 3T0ED 4I77H 1Q94A 4NBXB 3FPYA 3ZQXA 2WLYA 1QSFA 2XX1A 4APQB 2FHCA 5GSRB 1FH5L 2Z8SA 2EICA 3DK2A 3IFOB 1VB9A 4PJHA 3LN9A 1TVHA 1DVTA 3RY6A 4X99A 1G1YA 1YJDC 2ADIB 2UZXB 5J1SC 4L1LA 3BW9A 3FB8A 4NEHB 1KELL 4B7IA 5EEYA 2VMCA 4G6ML 2N1TE 2ZP8A 4JDTL 2WUCH 5DQDH 1NC2B 3FXIC 3KJ6H 4OF5A 2CIKB 5T1DH 3RVTD 3UBFA 2TRYA 1N0LA 4DPBX 1SDDB 5C7XH 2PYFA 1OB0A 4NGHL 5FUCC 4NSKB 1WS8A 3SBRA 4JGJA 2WWMC 4TTGA 2Q9OA 3QEUB 4IK7A 1HXYA 4HETA 1SLXA 3K7UA 1GIGL 3CC5A 3KWWA 2EH7L 3FCBA 1RZ7H 1TPXC 1KT2B 2CH8A 1BP3B 4WW2C 2DLGA 5IEKB 2QT6A 2VLJE 1O7DC 2QQKL 4MXVE 5D6CA 4GUCA 3LOWA 4MYPA 4OD2A 4IKJA 3VWJB 1TJIL 2PWDA 5E51A 3DSNA 4MNGE 4PB0H 1W0VA 3E8UH 4LSQL 3WSQL 2C7UA 5FK9B 2FIKB 5EBGA 2XICA 1EXHA 2BINA 5IHLB 1OTSD 4MCYB 5ABDE 1NCTA 2Q10A 1R3KB 3QWOA 4FZEL 2X1XR 3RHWF 3AZUA 4HCGA 1CD1A 5EDXA 1YPZE 5IB4B 2VT0A 3ZE2F 4O00A 5JR1L 1MCIA 2AP2A 3B5GA 4ZAKA 5I9QB 4P57B 1TZHA 2VZVA 1HWHB 4BWWA 1E5UI 4ZTOL 1QUNA 2ZX5A 5JLZB 3BSZL 1TJHL 4KZCA 4KKZA 1SJMA 1M53A 1UQSB 1AC6A 2N3JA 2VXQH 3W57A 5DJDB 4BSWA 4KUZL 5AOKA 3QRLA 1WBXA 4KRMB 4L4VD 1L3NA 1ZKAA 3CN1A 3KHQA 2CSPA 4CDHA 5L4JA 4X5QA 3WEBA 1IFHH 4X4KA 2C7FA 1CTOA 5BQ7B 2XETA 4WK2B 4MJ6B 4X6EB 3LPGA 2VDML 3MA7B 5SWSD 4AGPA 5CM1A 3HG2A 1X9LA 4GKZB 1HKFA 1FVCB 5F71A 1WA1X 2WINA 2X4RB 4FFVC 1XL6A 4KDVA 5EO1A 5FX3A 1U8QA 2PXYC 4GRWH 4NQVB 5C09A 5I6NA 4ZFFA 2WUBL 3OGCB 2H9GB 3ARVA 2PYEB 2FGWL 5D7LB 1TTRA 4OM0H 2G75B 3QDHA 3CFJA 5L4FA 5FM5O 2QELA 1SRDA 2JB6A 3OC8A 1I3RA 4BWTA 4DOHE 5I8OL 4ETQA 1E30A 3LEXB 2CAKA 5AVQB 3B7YA 2XPYA 4G42A 3WHE1 1A6PA 3SQRA 1MY7A 3VA2C 1HQRA 2CR6A 4Y4HB 1MFCL 3VQLA 3PAVA 4KXZH 1JZDC 1FDLH 1H3WM 2JKRM 3IFLH 3MNZB 4LCYA 4F2EA 1HDMB 3RRQA 3W82A 4KVCH 4Y1AB 4YSRA 2E7HA 3WFZA 1A6VH 1PZDA 1JZFA 4XXWC 1CBJA 1JWUB 3QI9A 1MFBH 4DPCX 2X70B 4BSJA 4U1GB 3RL2A 1KTKE 4Y2DB 3PAUA 4PIRF 4RISL 2P80D 3BUDA 3ARFD 3HAEB 4X4YA 4LL9A 5JW4M 1KPUB 1W0YT 4NO0A 1T20B 1OD7A 4YSOA 4YE0A 4YHOH 2H41A 1TJGL 4HBCL 1G5AA 4QAMB 3BQUC 2VDMB 3ZYJA 4PWJA 4AT6A 1OSPL 4ZI8A 2AJUH 3HFML 3TCLA 2XVBA 5FHBH 1T1YA 1OLZA 2D03H 4K8RD 2QZQA 4KV5E 5DD3L 1VESA 2GC4C 2Y72A 3NYKA 4NQXA 4TSBH 4OH2A 4Q58C 2X4NA 3SDYH 2YO3A 2X0VA 2HN7B 4PGBB 5L8LB 1R3HB 5K39A 2YZ8A 5FKPB 1M7DB 5ANME 2DQ6A 1I3UA 4NN5B 3VXRB 3O4OB 1GGUA 3A4FA 2R8SH 4JPVH 5C07E 3B9KB 1C5BH 1L0YA 1SJVA 3E6FB 1FNSH 4HEPG 1OCWH 4NJAL 3PWPB 1JVOA 3J7HA 2JI3A 1XIWB 4G6AC 4N9OB 2CGRH 3VD5A 1LP9F 2VOTA 5AVSB 4WI0A 5DHYB 4JG9A 1KJ3L 1NA8A 2EDOA 3L3HA 3MLYL 4HWUA 2BHYA 4N22A 5TDPA 1ECYA 4KK5C 2XN9E 3EYOA 3Q8CA 5D1QE 1ZANH 1SEBB 3CVDA 3OPZL 3LSOA 4MDJA 3DRTB 4R4FH 4D9LL 1F11A 2OM5A 2NOYA 2ZXBA 1G4RA 2B9BA 2CJ3A 2KZWA 3O2VH 4ATTA 3J8F7 3TEUA 4LCIH 1DQDH 4LOFA 1ES0B 2OMBA 4D8OA 4TLUA 4E42A 2ZTBA 3IU4L 3CZNA 1FI8C 3EBIA 4A63A 2AFNA 4NT6A 5I66A 3C9NB 1YMME 5E2JA 5BZXA 1Y7VA 2R59A 3D0VA 3S9DB 1RPUA 35C8H 4G7SB 2WXKA 2WJ7A 1KZYA 4JFDE 4P9HH 2AV1B 3NK3A 2A9NH 1P84J 2GIMA 4L1SA 3L7EA 1ZS8B 5DQ9A 4O5LH 2KYIA 3VXSB 2PUQT 5LQBH 7CGTA 4MMXB 5FCSH 2R56L 2W07A 2Q20A 3T2NL 1HHHB 1AQMA 4C47A 3F85A 3WGUB 2FJFA 2YPLA 5AVZB 7FABL 4CJ0A 2E9JA 3M88A 3D33A 4ZD3H 4LCUB 5I1JL 1RIHH 3QZMA 5M94B 3P77A 4KO5A 4NQDA 4YJZL 3D0AA 1OP4A 3MPCA 1YDPA 3OWRA 3QRBA 2NNCA 4G9DA 4BSVA 4MD5A 4Q8BA 2Y7QB 2X5PA 2X40A 4IRZH 2DJMA 1IJ9A 1TZAA 1AQKH 2GJ6A 3ULSA 1E6OH 1WTLA 1C5CL 2VLME 3DGDA 2AW2A 1RJLB 1QWHA 3JTSB 2DIEA 3GNML 3V6FA 1MCCA 3PU7A 1TTAA 4L29B 4WTQA 4C54A 2ITDA 3V0VB 1NIAA 1UWEH 3TZVA 1MHPL 4BQCA 2Y1VA 2APXA 5DEZA 2UXGA 5CLWA 3NJGA 3QHFH 3LZFH 2C3GA 1TZOA 1T5KA 3IETA 3GO1L 4MWFA 3VGEA 4L3EA 5JW5A 5IQNA 5EOCH 1HVXA 3QZWG 2ADFL 2GK2A 5DFVC 5MEND 3SDAB 1MCKA 1UCBH 3AU1A 1WFMA 5HHOE 3CHOA 3SYQA 4NHCL 3ROLB 4MX7B 1AG6A 5F9WC 3RPIB 3QB7C 1QD0A 4PRDB 3EUUA 2KQMA 5D8JL 5GS0D 4H88H 5B1BB 1FHNA 1AD9A 2PNDA 4G7YH 4EPSA 1QSFD 1GGIH 3VX0A 2XV2A 3VFMA 4P5TB 3R7QA 1TITA 2GQHA 2VL5B 1ZSDA 1AYRA 2OSLA 4GQ9L 5EMYA 2VLJB 3IRCA 4OLYL 4DZBB 4YAQB 3TBVB 5KSAB 4ZODA 4GRLD 1SUJA 2NW3A 3EJTA 5I5JA 3K6OA 2Z7UA 4Q52A 3VH8A 3PWJB 2I07A 1JGUL 3ZDXE 1UD3A 4MNGB 4OQTH 3S3JA 4EKJA 1W72L 3LMJH 3TBSA 1S8DB 4X50A 3RVWC 4NO2A 3BUYB 3P2BA 1S7VA 1G87A 4HXAH 3U36A 4YHIB 2KDYA 5HGBA 2KLSA 3RU8H 2P5EA 4N0RA 1ZA6A 4TNVK 1YPZB 1MRCH 3LKNB 1OEZW 1SFDA 1I3VA 1A3LH 2VABB 4XPBH 4XB3A 5F7YC 3WMQA 4ZMLA 1WCQA 1I7ZA 1PKQA 2IDQA 3FTSA 3G5YB 3QNYA 3SE6A 3VACA 5K69A 4F27A 5C0DB 1D6EB 4OZIF 4WWKA 1AKPA 4DAGL 4WTXA 1INDL 4ODTL 1X5MA 5IB1B 3MLVH 5CZRA 4PJXA 2OYKA 3WKNA 1JXJA 3UZQB 1MJ7L 2DI7A 1Q0YL 4OLUH 1GMEA 3FT0A 2GJZA 2H5UA 4TL4A 2GB2A 1DQVA 4EDWH 1U8MA 4WKZA 2Q8BL 4LBEB 3L7FB 4NUGL 4O2CB 2ZICA 2Y6TE 3ZE1F 1EERB 2VC2H 4YSQA 4F7EB 3JZ7A 3W5MA 3D2UB 4ZAKD 2LW3A 2QQNH 2ZG3A 4I9XA 5EUKB 3T0EC 5IV2A 2EDQA 2B1HL 3LH8A 2FX7L 5E8DL 3TJEL 1IGJB 5B21A 3UERA 3KPMB 1U4EA 5H94A 4URKA 1VADA 3QHZL 3B7RL 2X9XA 2G5RA 3BVVA 2ALAA 2VERA 2KPNA 4R4ND 5JIQA 2IMNA 3D39E 1JAEA 3L3OA 3UBHA 5IF0A 4LF3B 5CUSH 3WFBH 5EU5A 5KN5B 4QYOA 1EGJA 2VRQA 3IJYB 4IBVA 4M48H 4YHNA 3RVTC 4QRQA 4XMZA 1MRFL 4X6CF 3IBEA 3PGFH 1M42A 3I6GA 3FT4A 3TFBA 3TBTB 4FQCH 2XTSA 5C09D 5KYXB 1CG9A 5DRWB 1CDBA 1JGVL 3KPLB 1R5VA 2MJWA 5KSUB 1FNFA 4PREA 4AIOA 5IQMA 4IKKA 1FL6A 5I71C 2FQEA 2VXVH 4XXDB 3Q8BA 3RVVC 2IDFA 1IGIH 4NN7C 3IDGA 4C55A 4MQ7A 3H9SA 5C08D 2DQTH 5K1NA 2OMVB 3QDMD 1X4ZA 4HIXH 2YPVH 5B1CA 4A2MA 5DHEA 2AEPH 5CIPB 3L4YA 3Q44A 1OTSC 4DPAX 1E6JL 2V9UA 1TENA 2NXYC 3FPXA 4P9ML 3WTUA 4I18C 1FO0L 4LKXA 1JF6A 3SIKA 5C0EB 4C4BA 1U8OB 1UJ3B 2DS4A 4LEBA 5C07B 4GXUM 3IXAB 3X14A 2F08A 4ZOAA 1EHLH 3C08H 3QNZA 4L5FE 2Z92B 4PPTA 5L4IA 2A0LC 2HFGH 1A7NL 1ZHKA 4QOKB 3HE7A 1Q72H 1OTTD 1WBYA 1GGTA 1DLFH 4QD2E 4FZ8H 3KHOA 3K4AA 4LASH 2GKIA 3DI3B 3BJLA 1IKNC 2IQ9H 2XN9B 3OQRA 2YD4A 5IB5B 2JQMA 1J8HE 3BEWA 5BVPH 1E7UA 3VRJA 3PWNA 4TLTA 1AMXA 4MMZB 4ODSL 3O6FB 1GTFA 2CR0A 1CFTA 3OM3B 3VSTA 4HIHA 4LVOC 1OO2A 1RVFL 3FCGA 3CZLA 3MLSH 1NGXA 4RBPH 2CCWA 1QEWA 4HUVB 2DBJA 3ATAA 1YMMB 3ZVVA 2WO3B 2H26B 2ZUSA 4FXKB 5ALBH 1FN4A 4JFDB 1EAPB 4P3DB 1PG7W 2L04A 4XBEL 1UB5A 2VR4A 1D5BB 3JWDH 4JM0A 4MQSB 2JV6A 1FO0B 4HEMA 2Y1AA 2AXHA 4L05A 2WQUA 4FQLL 1DSWA 4ANWA 4WI3A 2H0EA 4IMKA 2DB8A 1DVYA 4Z7QF 4FDWA 4E36A 4F58L 3QFJA 3D1MC 5FV2A 1A9BA 2HJKA 4DFIA 5FCUH 3MROB 3STZB 4KFZC 1B0RA 2IWKA 3TH2T 4AM0A 3PDOB 4E9LA 4J2QA 2UY6A 1HU8A 1TEFA 3ARFC 3QQ3A 1I8LA 1BVOA 3VA6A 1AXTH 2Y2TA 3BGAA 3GI9L 1T0NB 4X42A 4PCSA 4PJBF 5EULV 2YA0A 3ISYA 1HNYA 2BOBB 3AM8C 4YWGH 5HYQA 5IWLA 4AQEB 3GXPA 3P0GB 4AH2B 1C8PA 2XZQH 3SY0A 4K8RC 4ODBD 3VI4B 1PG7H 3QO0B 2F1BA 4RFNC 4BUQA 1NCJA 1FH2A 4O9HH 1NGPL 1AO7E 1IC7L 2F7RA 4D8PA 1DQQA 3N6YA 1K2DA 2FECL 4PY8J 2J8UF 1SDYA 4HV8A 4G3YH 2IALB 1MWAA 1GY2A 1AXSA 2CDEA 4NQDD 5DJ0B 1JYNA 2IFGA 3GTNA 4XNQB 4AEFA 4OGYL 2BY3A 3K3QA 1BQHG 2LOEA 4Q89A 3A0OA 3CXHK 3UEZA 3FF8A 4PTTA 4QI3A 4F57H 1QQDA 1JFHA 2A4EA 2XC8A 4KRPB 4G7VL 3V4PA 3KM2A 1TUPA 3MQIA 4FADA 3CMOL 4GUPA 2XV3A 4ZO9A 1CXIA 3M8OL 2BOCA 1XXDC 1CUOA 3TZVD 5KBPA 5LBSL 1RIUH 2ENYA 3VU1A 4OD3L 5E5LA 2YIHA 2EIZA 1ZLWK 5IHBA 1UB6A 2HSIA 2QGEA 3QQ4B 5GS2H 4IRJA 3D3VE 5J13B 1J5DA 1KEMH 4L3ED 1KCVL 1OF2A 4YO0A 2XWBB 4HGKC 3MXWL 3WE6A 4AQAB 3E6HB 2P5WE 1MELA 3GI8H 2FEDC 3EFFA 1QKZH 2C1OA 3RLSA 3UPCA 3MV8E 1ZHNB 3OR7B 5KVFE 1RZPA 3VFRA 2VXQA 1ZGLA 1DZ0A 3UGUA 3KWXA 4PP1D 3CZSA 1JZ6A 3DO3A 3HIZA 3FFOA 2MKLC 5D71L 5IBLC 6FABL 1G6VK 3FFDA 3BN9D 5DD6B 1J5HA 1AD0A 4LSRH 3QDJA 3GTVA 5DUBB 5EIVA 1BXAA 3VXOA 5H4YA 1RUQH 4NHUA 5FW6A 3CU7A 3FUEA 5BV7H 3H85A 3NJHA 4X7SH 4P07A 2X0WA 1J1PH 2IAAC 1WZLA 4YGVB 3C09C 1KCRH 4TLKA 2PWHA 3D0LB 2J2ZB 3C60D 1N6QH 1VPOL 1ACYL 1FJ1B 3VFVA 2ZX9A 1ULVA 2JKWA 1H5BB 2NCEA 3ARSA 2AHIA 1U8NA 1QFUH 2BHFA 2ICWB 3RTQA 1XR8A 1XVSA 4JZOB 2A3TA 3OMIB 5EZIH 1AGFB 2B4CL 5KW9L 4JS7A 4XZUB 5LAXA 1DJWA 1L7IL 3ZQ9A 3Q43A 2QPSA 4RDBA 4WWKD 4WU5A 4DP5X 3ZYOA 4JRLA 5F7DB 1CF8H 3MZGB 1NC4B 2NY3B 5DQJB 1RD6A 4E68A 3NCWA 1HXMB 1U33A 3D39B 4KX9A 1E4XI 4KVNH 5DZVA 5EA0H 5AAWA 3RL1A 1ADQA 4JFUA 3EZJB 1FPTL 3DHJA 2ZKXA 2YLKA 4XC3L 1EFQA 4M1CD 3TNMA 5BOZG 3TVMA 1SXAA 2A74C 2CGZA 5TE4L 4P2RD 3FT3B 5T5FL 4V2BA 2QPEB 1BZ9A 4G72B 4WGKA 5GS0C 3L2NA 3EBAA 1B2WH 5DRNA 2VDQH 1ZEAL 1ML0A 4RMSA 3KYNB 3KGTA 4YXKL 3QBTB 5DUMH 4APQA 5EU3A 3B2XA 2RD0A 2P9RA 5GSRA 1PLBA 3MHZA 4NRYB 4GRLC 3IFOA 4OZFB 3KR3L 1R6VA 3O45B 1QZ1A 4G1MA 4PJ7E 1KCUL 4MVBD 2UZXA 2VN3A 5EPMA 3T9WA 2K4WA 5A7EA 3PL6B 3RFZB 1ROCA 2YBRB 2WKGA 2ZYRA 3JWOH 1LWJA 1NC2A 5DDHA 1P7BA 2CIKA 4XC1H 2NDGA 3GSWB 4O02L 4AUUA 4ZUWB 2F5AH 4NSKA 3NABH 4Q6IC 5TF1H 5JOPE 3BO8B 3P69A 4F8PA 4YSPA 1E2WA 5I8CB 4OCSH 5EG6C 3BVNB 1KT2A 4MD0A 4QXWA 4BEIA 3H9SD 5IEKA 4Z3TA 3VQ2C 2K8QA 4F8LA 3FB5A 3IFNH 4Z3GA 1AYOA 3UPAA 3VWJA 4MQTB 2EXSA 5AKSA 5JPNC 2W0FB 2NX5E 4JW3A 4X2UA 3ARBD 5DSCB 4LSUL 1J8HB 2VW4A 3P0VL 1VCBC 1B9KA 2Y5TB 3QJHA 5F6HI 3CVIH 4KKPA 3SOBH 3VGAC 1AP2B 1YNLH 5FK9A 2FIKA 3CZGA 3ETTA 3QCUH 5D1ZD 4MCYA 1DQLL 4HP5A 1R3KA 3SKJL 2OX5A 3GRWL 5D1XC 5KAQF 1XF2B 1OAJA 2I69A 5IB4A 3ULAB 3B7UX 4PGDB 4TNFA 2XPZA 3SO3B 4P57A 2O5ZL 3M45A 3NIGF 3QSKB 5AVVB 1AOZA 1PX3A 5EU6E 5DEJA 4WFHE 5JLZA 4Z7NE 1YEGH 3VFWB 4LCCC 1DFXA 5CN2A 3VDCA 2NR6C 3SGKA 4R4NC 5JIPA 5I1AB 2HFTA 4FABL 5JIIA 2WPGA 4O02B 1IB5A 1L6PA 3CG8A 1XMEB 3NZHH 4IIQB 1TZIB 5AG8A 1DR9A 1A1MA 3IMVA 3UJJH 3MBWB 3MXVH 5JUEL 3AY4A 4UM9A 3S35X 4CSPA 1DBML 1YEDB 4QTHA 1NGQL 3TESA 1BJ8A 3GXTA 3CU1A 3W3BA 4RDQF 1OAXH 5I1KH 5CCJA 4MJ6A 4OLEA 4LCVA 2NY5C 4EUPB 5IW6B 2MPAL 3H7LA 2ADJB 1O6SB 4GKZA 1OAZL 2X4RA 4L8CB 1KBPA 3ZZSA 2QHRH 4DEUA 3O6LH 4NQVA 4POUB 5B1JA 4PGZA 1MCOH 1F58H 4K3EH 1F4WL 2H9GA 1MKFA 2MHAB 1PAZA 2CHZA 2PYEA 5D7LA 3FBKA 2R1XB 2WQ8A 4QHNB 4AMKL 2G75A 2C3HA 2QVMA 2W9DH 3A6CH 4XPHL 4KDTC 3PDGA 1TVDA 2ZWYA 3OMZA 3LEXA 3N9GH 2NY2D 3LH2L 1MVYA 4LLMB 1BIHA 4DWHA 4EQ2A 3QFJD 5IQ9B 4Y4HA 4TSAL 4HWNA 5ESVB 5LDUA 3FU7B 1MH5B 3FCSA 1Z32X 2UZIH 3MNZA 4Z7UE 1HDMA 4A67A 3BSZA 1RMFL 4Y1AA 1OHZA 1TZ8A 3PPEA 4RBPK 4KJYB 4BFIB 2D7OA 1XDTT 4N8PA 2EDEA 2X70A 4TQIA 1R19A 4FFYH 3VXUE 2HP4A 2B0SL 5FYLH 4XOAA 1HI6B 3CHSA 3HAEA 5E4AA 3TV8A 1P2CB 4Z6AT 3MLZL 1J9RA 1CR9H 1NCOA 3KAAA 2OL3L 2F8VA 1T20A 2WLJA 4RAVB 4CU8A 1JMXA 4GP8B 5AAPA 4OIBA 5JZ7D 2QPUA 4GP5B 2F58L 2EIEA 2X3AA 4A7TA 4JFEE 1QWUA 1JERA 5HPMB 4JO3H 4MS6A 3QZPA 1VGEH 5AVTB 2NSXA 4QUOA 2BFVL 2PMZA 4MAYA 5I8EB 4F8QA 1BF8A 2VO8A 4J3OD 4NM4L 3VFPB 5TE6L 4DP6X 1OGAA 3P3SA 3VXPB 2HN7A 1FZOB 4TTDC 2UZYB 4PGBA 4UIKH 1I8IA 2YD6A 4CSSA 3G5WA 3N3EA 1PEZA 2R0KL 1M7DA 1UXWB 4IKIA 3D3VB 3TT3L 1YO4A 2J1ZA 3NRQA 1AANA 3UJIH 2PWEA 2YD2A 3VXRA 4QJ5B 4YMPA 2BVQA 5C97A 4Y7OC 1KYOJ 1SLWA 1JGDB 2GC7C 3QQNA 3DYOA 3PHOB 2BDNL 3B9KA 4M7KL 3VGBA 4Z95H 4G6KH 5A2LH 2XQBL 3F00A 2D3VA 3PWPA 4FCAA 4DN3H 2YGNA 1OLLA 1XIWA 3OKDB 3IF1A 2E4FA 3UEQA 3MV8B 4YZFF 3V4VB 5KOMC 5DHYA 1WFOA 4XMPH 4M7ZB 3UAFA 3TNNB 4ZNEE 1RLBA 4WNSA 1ETA1 4WSGA 4XWOD 1SEBA 3LXCA 3BKML 1U21A 1SHXA 3DRTA 2OL3B 4JK0D 4IRJD 1OD9A 4FYTA 3ZYIA 1JZ8A 2I7OA 1JGEB 3K74B 3I75B 3JSSA 2ZUUA 4AQ1B 4R90L 3VD2A 1ES0A 4ZFGH 1GGCL 3QUXA 2DEXX 4DGVH 3C9NA 3UOAB 1E9PB 5IVNA 4HC1L 4M3JA 5TE7H 4CC1A 1BFTA 3R1GH 4IJ3C 4R2GD 4UAOC 4A38A 2C9XA 2EC9U 1KCSL 2Y06L 2AV1A 4EN3B 1VEOA 1VFBB 1CMOA 1J9CT 4KAQL 3VWKC 4H0LC 4MD4B 1A6ZB 1ZS8A 3QZBA 2X12A 3VXSA 3QDJD 2E3VA 4X7EC 3FN0L 4MB4A 1RULL 1NEZG 1HHHA 3F64A 3LXAA 4HLEA 1WWBX 1I9JH 5CP7A 1OGSA 1P7KB 4ZSOA 1L7TH 3G08B 1IQWH 5DCCA 3WIHA 2L7EA 4LCUA 1Z9OA 3B43A 1JBJA 2QPDB 5JIKA 2YXMA 3L4CA 4QHKJ 5JNYB 2WXFA 5TK2A 4LT7A 4XNZB 3RIAK 2Y7QA 4W81A 4PJ8B 2HFFB 2BSTB 3TN0A 2OCJA 2EJ1A 4JE0A 2YRBA 3RTQD 5K9OA 5C2BL 4AE1A 2W60B 3RDTB 3NSDA 2FB4L 1PW3A 1RJLA 1J5OH 1RHHA 3TZVC 4L29A 1CXLA 1YA5A 4JVUA 3V0VA 1IJNA 5HHMD 2VUOA 1RP8A 2EIMB 4IMLA 4NCC2 3KLLA 4YIQB 4B5ZA 3A5VA 1F5WA 3VTAA 4U6VL 5D2LA 2NTFA 4KRLB 4X4ZA 1OF0A 1NCCL 4KXAA 4PJ7B 4ALAH 3QXDB 4NLAA 1CYXA 3WFDH 3QYMA 1KTJA 2G3NA 3WHE0 5CZXD 4WDIA 5TDNB 3RZCD 1RK1A 1TJXA 3PXLA 1WDAA 4UT9L 3C5ZC 3TVMD 1V7MH 5T3ZD 3L54A 4K7FB 4UI2A 4QRPE 4WY7H 1XGQB 3QIUB 1XGRB 1QFWH 1TR7A 2MTPA 3LTVA 4MX7A 3ROLA 3RPIA 4NQEE 3F05A 4PP1C 1BG1A 4PRDA 2I60L 4L9DA 3MRRB 1XGTB 2UXFA 3ASOB 4HG4J 4Z7OE 3BN9C 3TYGH 4JB9L 4APQD 3P9LB 1QLEL 3RJQB 1A3ZA 3U30C 3ARPA 4WCYH 3X3GL 2XX0A 1QATA 2VLJA 4DZBA 2RACA 4YAQA 3TBVA 1U8CA 4KXDA 1E50A 1MFMA 2EO9A 5JDJA 1DCLA 2F74B 2NX5B 4NRZB 7TAAA 2Q2LA 5GS1C 1ZD6A 3C60C 3NT0A 3ARXA 4U0RB 4AEIL 4X98B 5CINL 2CR3A 1S8DA 3UDWC 5M7QA 1E4HA 2IH1A 3BUYA 3ZL4H 2Y0SA 3P3YA 5IM7B 4YHIA 1KGUA 2NT0A 2A1WL 4FG2A 5DR5H 4HS8H 3VNYA 3UBXB 1HKLH 2V5YA 1YPZA 5GRXG 3PPSA 3LKNA 4Y4FB 4YDKL 1X7SA 3EJPA 1C1EL 2ZUVA 3JT2A 4YXHL 3L9YA 5EU6B 3BZDA 4JJ5B 4Z7NB 1PNCA 1S7QB 3GFUA 1CICA 3QJZA 5C0DA 4ZPTB 3KJ6L 4OCXH 3IKCB 3VWJD 4TUOB 5IB1A 4Q4EA 3BP7B 3HPJB 3R19A 1DN2A 3JXAA 3UZQA 3RWEB 1PZSA 5ITFA 5AKVA 2N7BA 4UTCA 2BSRB 5DUPL 3ARUA 4N2MA 4M1CC 1QLEB 2QADB 3L7FA 5E99H 5JMRA 4O2CA 3JV5A 3AXLB 3IMTA 4PS4H 2EVJA 1OALA 3NP4A 4POZD 5E0QA 5HDRA 4F7EA 3BN3B 1Y6NR 4AIXA 3KJ4B 3NFSH 4PI2A 1XZ0B 3CIAA 3D2UA 5HI3D 3DI2B 4KGJA 3PIQB 4PSPA 4UV4H 1KJ2H 3HZMB 3FCTB 4LVHC 5BO1L 3V4UH 2PPCA 3P30H 3L16A 1KFAL 1YLBB 2F5BH 1XSOA 3FSVA 3GSNH 3KPMA 4HU2A 3UGXA 2CG9X 3QG6B 3GMLB 4FJZA 5IGXL 4U6TA 4JPWH 1GSKA 3L3OC 5ENWB 1EZLA 1WWWX 4LIQH 3MRBB 4YHML 4UM9D 1FIGH 3DX0A 4LF3A 1X5GA 4Z7UB 4FP8L 4FKHA 3GZPA 3B2VH 3T0AA 1S7SB 3QAZC 3IJYA 3CN2A 4PU2A 2AJSL 3V0DA 4AI7A 2E86A 3VXUB 3TBTA 4KUCF 1P53A 4Q9QL 3AY2A 1G7QA 5KYXA 5DRWA 4DKAA 3KPLA 5BNXD 2HRHA 2PYED 4FQQB 1WLHA 2WVTA 4JPIA 1W6WA 3AWGA 1UOVA 1XR9A 4JHAH 4XXDA 4HIIB 2DQGH 3AG3B 4LPYA 3QCTH 2K45A 2ZKYA 4TUUA 5E8OB 3KXFA 4Y4HD 5LNDA 1R3IH 3D2TA 3ARBC 1KXTA 4JM4H 4WGVB 2NLJB 2OMVA 5HYJA 4BGDA 4LNRB 1J8RA 3VI3E 1WWCA 2QVTA 3F7LA 2C1PB 1V3KA 1ZHBB 5CIPA 2A5UA 4NNPL 4KO6A 5D1ZC 3DUHA 4R83A 3VFOB 1MRDH 4MA8L 5ANMA 2B3RA 3JVFC 1E4XH 1AKJB 2V4LA 3WMPA 5C0EA 4U1HB 3IDMB 3L4XA 1U8OA 1UJ3A 1N0XL 1NSNL 5C07A 3ATEA 3IXAA 2WOBA 2XV0A 4WW2F 3W38A 2Z92A 1OARH 4KVCL 2Z35B 3HNTH 5BUGA 3SDXF 1HT6A 2B59A 4A2EA 1BD2B 3ESUF 3O6MH 3ZTCC 3S88H 3FT2A 4ZMZA 3ZIYA 3DVNB 1HK6A 1E65A 4GI8A 4U1JB 4FXGC 4MAYD 1LEIB 5EU7C 2XN9A 1OGAD 2YAHA 3LZQA 5D1QA 5F3FA 5IB5A 5IHHA 2YPKB 4UDTB 5D7IF 4XMVA 4MMZA 1UUSA 3BIKB 5K9QG 1QPKA 3O6FA 1O75A 2JLPA 1NJ9A 4UILL 4YHOL 5FGBA 5F7HA 4UIMB 3BDYL 1YEKL 1INQB 3B9KD 1OAYH 5F9OL 3SDDB 4DKDC 1P7QB 4TSBL 4HUVA 4ZS6C 4YN3A 3KVPA 5HHVL 1YMMA 5M95B 1UM4H 2G4GA 2H26A 3F83A 4FXKA 5KOVC 4S1QH 2IEPA 1EAPA 4P3DA 3KVDD 1D5BA 3OLEA 3QVAA 4CKQA 6TAAA 5JHDE 3LPWA 4JY4B 4DEPB 1O9WA 4DCQB 2H0FA 2CDGB 3BXNB 1NCAL 4JPVL 5FM5M 4KXCA 4OJYA 4P04A 5IOKA 1IBGL 4F92B 1XH3B 3BD5A 1XBDA 1XV8A 2GIXA 3V5KB 2AI0L 1NUDA 3MROA 3STZA 2HB0A 1JYWA 3K6FA 4A6YL 3PDOA 4N5ED 4K9EC 3VFTB 1KB3A 4OZHF 2Q6WB 1AR1B 1J8SA 4JUTA 4P23C 3QUXD 4GAJL 2CHNA 1S7RB 4W4OA 2ZKMX 4RMQA 2RA1A 4F24A 3OAUL 4C8XA 1S46A 3GLEA 5GISL 2DY2A 1VFAB 2C9SA 1K6QL 1T0NA 4QY8B 5JZ7C 1I9IH 3VD1A 2BOBA 3NRFA 5KSBF 1YY8B 4AQEA 3WTTA 1EWHA 2KDGA 1BMWA 4AH2A 3S3PA 4XVSL 3AG4B 2R69A 1TETL 3RHWK 3II2A 3UAJD 3U1QA 4F2FA 2X10A 4MBRA 3VXSD 1V55B 4M3KB 3NA9H 4FOMA 3Q9PA 4QMEA 3FS9A 1PX4A 3O2DH 4NPKA 2IALA 2FD6H 2A6IB 4FKKA 3UZVB 1ZRUA 4ZTPH 5DJ0A 4FL4B 4ZTEA 4XNQA 2V7NB 3NPSB 5DS8B 3TT1H 4ZNCD 2A9NL 3OKNB 4KKNA 3UXFA 2YAFA 1YN6B 3R06B 3T0DA 4ESKA 3TN0D 1TCRB 3WN5C 4QRPB 5HHOA 1A7BA 1MLCB 5CD3B 5E2UH 2DLFH 1Z9PA 2JIXB 3QZOA 4NQEB 4A6YB 3IGKA 4W68A 3DECA 4WI4A 3ASWA 3WNOA 1PKOA 4XWOC 2GSGB 5JIMA 3SQBA 1DBKH 3G5VB 2ZCKL 1BOGB 1K85A 4OJFL 4Q0XH 2C9UA 4L0PB 4IRJC 1AQKL 2YAOA 3QQ4A 5AUMB 1IAOB 5DMYA 4NNYB 4ELMF 1JV5B 1XXFC 4AJVA 4E9VA 4F9PA 5CU9A 2XWBA 1A1NB 3W2DH 3LVTA 4PS7A 4AQAA 3E6HA 4R2GC 1RERA 3R4RA 4XAKE 1HEZB 3GMOB 2IGFH 2NSMA 1N18A 4XN4A 1ZHNA 2LFGA 3ETSA 3LZFL 1BM7A 1JI2A 1XAUA 4HSQA 1A4BA 2VXSL 4QXGH 1A66A 4ZBJA 1G5GA 4YDLB 4OV5B 2XXGA 5EOCL 5DD6A 1XO8A 2M1KA 3KLSA 4IDJH 4TM9A 2EIJB 5DUBA 3KBFA 3HVDA 4PTUA 5E4EC 5DC2A 3HS0B 1OP5K 2XWTA 3DETC 3HRPA 1I9RH 1SMOA 5GJTL 4YGVA 4H88L 4UOJA 4XB7A 3BWUC 2XN2A 4NP9A 3VW3L 3D0LA 2J2ZA 2YUVA 5ECJE 2H4EA 4IGBC 2NNXA 2Z4TA 3AB0B 1FJ1A 1YYLH 3CFEA 3RTQC 1BZDA 1OSZA 1KEGL 3ZT6A 4UM8B 1H5BA 1ONQB 5DD0L 4B3VA 4ODWB 5I1IH 1KYAA 4JZOA 5K33A 3U4EB 4GEJA 1AGFA 5INCB 2B20A 1DSYA 4XZUA 1BFOA 2J12B 2W0KA 1NAKH 2Y36H 3H7BB 1WZ1H 3ALWA 1TTGA 1CICD 1EK3A 3MJ9H 5DYFA 4JO5A 4QLWA 4EZLA 4ZX6A 2DLIA 4LOEA 5CO1A 4FQ2L 2FEJA 4QGTA 5AAWC 1NC4A 5DQJA 2BIHA 4OLWH 1HXMA 4DGIH 2V17L 2ICWJ 3D39A 5CZVH 3DX3A 1XF5B 4FFYA 4JZJC 2PCPA 4U6HB 1A3LL 4WEBH 3TF7C 5CZXC 3RZCC 4NENB 1OM3L 3TVMC 2ENPA 3CHRA 3HB3B 4AY0A 4HULB 3UYPB 1QR1A 5KYWA 1LK3H 1FV1B 4PGEB 3DOIA 3FT3A 3D2UD 2GG1A 3KCPB 3WO4B 3MLVL 4K15A 4GUQA 5J1AB 2DLTA 2Y69B 4HAFA 1K4DB 2Z64C 2P48B 1N4XL 4L4TD 1ZXQA 2LT9A 5LAPA 4KMQA 2NPLX 1VZIA 3O6KH 3NEOA 3KYNA 4WWPA 1SM3L 4V1DD 1LO0H 1KCLA 1QRNE 5DC4B 1CT8A 1G94A 2CKNA 4NRYA 3VFUB 3I6SA 4NFBA 3WKQA 5F3HB 2HCZX 4OZFA 1UG9A 2EH8H 2R4SL 5I24A 2E7LC 3VI3B 4G11A 4YR6B 3U79A 2X2IA 3K2IA 3N41F 1I1RA 3HZKB 5L9DH 3KLKA 5DFTA 3L3GA 4FQ1H 2ODIA 4YFLF 1DE4B 3H3PH 2HAZA 3GSWA 2VLKE 5FS5A 2VN7A 5IJKA 2J7LA 4GFXA 3WU1A 4ZUWA 3S5LB 2LGNA 3OZLA 3L5WB 3BO8A 2MRYA 4AYFB 2V9TA 3E9TA 3GMRA 1QBMH 5I8CA 3BPOC 15C8L 2CNZA 2BRRL 3BVNA 1T6WA 4LL1A 2G9HA 3KXFD 3OAZH 2H32B 1NCDL 1S9YB 1MCWW 3FTXA 5T5FA 5HYJD 4XCCL 2PO6A 1NEPA 1RZIB 2W0FA 3INUL 3CCHB 1HYSC 5DSCA 3FBQA 2V8MA 1J8HA 3CX5K 5F9JB 5FO9B 2AXFB 1BIIB 2DLEA 3T2PA 4P9HC 3OKMB 4MNHB 4POZC 4TPRL 3PGCB 5HI3C 3R8QA 4S1RL 3APDA 1XF2A 3P73B 1EJOH 2P44B 3GM8A 1JPSL 5EZOL 4HIXL 2YPVL 5IOPB 1CGXA 3SGKC 5IG7B 2IH3B 1YECH 2PF6A 3HRZB 2A6DB 3RAJH 3V4LA 5JHDB 5EEZA 5I1AA 1EXGA 2P26A 3SPIA 1X5YA 2FH8A 5F7WC 1MY5A 2XN9D 4JQIH 4O02A 4YLQT 3TO4B 3V6ZB 5D1QD 4AM0Q 4NZFA 4UINH 1TZIA 1DBBH 2N7SA 1J0ZA 2C9VA 1X6NA 1W91A 4Y5XB 1YEDA 4FQPA 4W9JC 3WKML 1MG2C 1KLUB 5MHSD 4PG9B 5IW6A 4EUPA 1IL1B 2BY2A 4ABWA 1Q72L 1UWGL 2ADJA 1GGBH 2D0HA 4L8CA 4N0UE 1DLFL 2CUIA 3BAEH 3UP6A 1XF3A 1F00I 4YLBA 3RWGB 5ABAA 4N87A 3RILA 1TSHA 4GUOA 5I1HH 1GJWA 1CFVH 1EAJA 2MHAA 4YPGB 4ZDHB 1MAMH 2R1XA 4IBZA 4MA1B 4QHNA 3V7AE 5ACZB 3FULA 3ULVE 3SE9L 2C9RA 1R1CA 3M1OA 1N12A 4HGMA 4A7GF 3NCCB 1RFDH 3A24A 2F7OA 1KPRA 3GRWA 4LLMA 3E2HC 5JXAH 5IQ9A 4M29A 2EC8A 1AO7A 5ESVA 3PCYA 3FU7A 1MH5A 2NSQA 5ELIA 3HN3A 4DGYL 2O93L 4LSDA 1NMAH 4ONFH 3F01A 2PR9A 4PJIA 5F7AA 3EJZD 2AQTA 3UP1A 4J1UB 5F0MB 4YQXH 4DTGL 2I7SA 3B2MA 1ACZA 1AHWC 3IDJB 2GABA 4OCWL 3F7VA 3GC3A 1HI6A 1BVLB 4Y4KC 4KZ0A 1PF3A 3HC3H 3F84A 2CO1A 1P2CA 4JY6B 4OLZH 3G04B 1DEDA 2VLMD 5KVEH 2FT7A 1RUAH 4BZ2L 2R23B 2ERJB 1HOCB 2ATKB 3HMXH 5CHNB 4ATWA 2GPZA 2J88H 4MAYC 1NKOA 3UG5A 5HPMA 2Y6SC 2HRPH 4UQAA 3QUYC 1EO8H 1T0OA 3P9MB 4DZ8B 5C92A 1AXTL 3VXPA 1N5AB 1FZOA 1OAQH 2IGTA 4J3UA 4M9OA 2FBRA 2H1PH 4FF9A 4JFTA 1UASA 5I1DB 3HN5A 1UXWA 3D3VA 2XZQL 4J3TA 4J3WA 5AG9A 2FWUA 4D3CH 1RH8A 5FYKE 1JGDA 3PHOA 4L8BA 2BJML 1LILA 4J7RA 3ZHFA 4JNXA 3NCEB 2P5WA 5HHOD 3X17A 4NUQA 1HJCA 4P06A 4HT1H 4F91B 3OKDA 1NFDF 2Q0ZX 2PN5A 2MQ3A 3MV8A 3V9EA 4DW2L 3RKDC 1PPIA 1URIA 3V4VA 4KI5E 5A6MA 4R0LB 5E4IA 2ZAGA 2G3MA 3BKCL 5HGGS 1R24B 3TNNA 4G8GD 3WLWD 4KK8C 1WT5C 1OAUH 2UWEE 5DLMH 3RWJB 1P9MC 1I8UA 4H8WH 2EECA 4KHXH 4NKQB 4XODA 5AVXB 2UY7B 3ZSSA 1XCWA 4N5EC 4ZW8A 5CSGA 4AG4L 4F57L 4OLXL 1JGEA 5KG9A 2GTWB 4M43L 3I75A 3QUXC 4ZFZB 3RWIB 1XB6A 4ZXBD 4KZEH 5B7FA 4EI6A 1IBZA 3LQAH 4GOSA 4FQIH 3P1VA 2JSFA 1P4LB 1QNZH 3ME0B 5KJ4A 2HG0A 3S96B 3GBNH 3MTRA 4YSSA 1E9PA 3N04A 5KS9E 2HLAB 4CSZA 1G9MH 4FMKA 3UAJC 3HG5A 1QP1A 1TQUA 3EKCA 3BAIA 4EN3A 1VFBA 1QEXA 3FOLB 3L3IB 2FUQA 5IBUB 4MD4A 3QQDA 4B5EA 2ATPB 4LLUB 1TIUA 2OP4L 1J05B 3G08A 1QKZL 3B7TA 4GW5B 4AYBA 5ID0B 4WU7B 5L0QB 3L4ZA 4HJEA 2CO6B 3IAQA 1KIQB 1GKOA 1FYTE 2G60H 4YDIL 1DP0A 5JNYA 1OZUA 3BCFA 3ECBA 3TN0C 3QEGH 1X5JA 1T4WA 4HPHA 1IC0A 2UYLA 4JMNA 4JKKA 1C12B 1SOXA 2HFFA 4M62L 1BQKA 2OMTA 1EUUA 2W60A 4Q74A 3GD1C 3RDTA 3V0WL 2XA3A 2WKLA 2YQGA 5KANI 4YL4A 1ZV5A 3ZKMC 1F3DH 3PS6A 1ODUA 1KCRL 3GS0A 1ZTXH 4FTVE 4BDVA 4K4KA 1K8IB 2CBPA 4PRAB 5TQ2H 4YDZA 4H7VA 4NP4L 1JNJA 3BEVB 1CTMA 1QRNB 1SMAA 2NY3D 4YIQA 5J6HB 3DDGA 1KBGL 2WNGA 3DPBB 3D39D 4QWWD 4BELD 5I18H 3VDAA 5LLIC 2J4WH 4JREC 3GJEB 5F89B 4PJ7A 2YUXA 3QXDA 4U7MA 5EIIB 5IMLA 2WQVA 4GG8B 5TDNA 5B3NA 5IJVB 1FNHA 1ZT7B 1HNGA 3OLIA 4ERSL 2FX9H 4K7FA 5DK3A 1JNLL 1JCKA 3QIUA 2WWNA 2VLKB 3WIIH 4XI5D 1N68A 3BFWA 2NZ9C 3L1OH 2W92A 4K9JA 4M8QB 2HZHA 1Z9MA 5KEZA 3OZ9H 1XGTA 4WUKH 2NY6B 3MV7A 3Q8EA 4PV1C 3BI9X 4Z7AA 3LNFA 2VMFA 4ZOEA 2GK0B 4RGND 5E6RB 3TBBA 4NN6B 5FGRA 3ZE2E 3U4BL 2ZPKL 3GHBL 3X13B 1QUPA 1K4CB 4FAAB 4AYSA 4FLSA 2EDMA 3GSUB 2I25N 4UB0H 2OSYA 1YY9D 1WAAA 3U7YH 2VDQL 5AYQA 2QSCL 4DK6A 4LL4A 3MSPA 4JZNB 5BQDA 5DVMA 3JWDC 4YX2H 1TMQA 4MA7L 5IM7A 3T3PF 5EF1A 3Q06A 3T8XB 3UBXA 3K1DA 1CFMA 3S5ZA 3X2QB 4Y4FA 3HPLA 3QJSB 2PP9A 1A8ZA 1CPUA 1CICC 3S0PA 4A7UA 1BDYA 2J6EL 5EU6A 3BP4B 3BAXA 3CDCA 3FUIA 3Q2WA 1S7QA 5DHVB 4ORGB 5PAZA 5GJSL 4ZPTA 1CDIA 3CSYA 3CDGB 3IKCA 3GEFA 3KPOA 3MUZ1 2PO6D 4EAEA 4TUOA 3C2AH 1JK8B 3H55A 1CLVA 3BP7A 3HPJA 5DURB 4ADGA 4JKPH 3IDXH 3RWEA 1CFBA 3MTXA 1U3NA 4S0TD 4MZRA 1YAIA 3RWDB 2BSRA 3TL5A 3DC0A 1AGEA 1OHQA 5I30H 5JHMA 1NUFA 3FN9A 4CVWA 25C8H 2W95A 4JM2C 5IMMB 2B5IC 4Z5RB 3AQYA 2BVPB 4X6DA 3BPNC 3E7JA 2K6ZA 1G9NL 2LHAA 3BGMB 3NG5A 5A2CA 3HTLX 4KO7A 3HZMA 4ENZA 2VDQB 4QKTA 3AT8A 4A2GA 3ARRA 3FFCA 1FL3B 3OAZK 3ZT5A 3SOBL 5DTFB 4RMUA 1XB3A 3IEAA 3S35H 5HD8C 5IMOB 1DZBA 2ZYIA 5K59F 3O2DA 1UZ6F 3QG6A 5I1CL 1NDTA 3GMLA 4K7PX 2ENJA 3F7PC 4N2DA 5ENWA 5FYKL 5EF0A 1KIUB 4GSDH 4U6XB 3CN0A 3MRBA 4LMQE 3EYUL 3BAYA 3VI4F 3SYAA 4EJ1C 4HYTB 4AIEA 3L81A 4Z7UA 2EXYD 1R5WA 3CQFA 2WZAA 1S7SA 5CJQH 2ZG1A 1CDCA 1YEGL 5HVHB 1TTUA 3AT0A 3C6SA 2NXZB 2MOQA 1NBYB 1SXSA 3RIKA 2IOMA 2VDLL 4WFFE 3EYVA 1KV7A 4FQQA 1U91A 1V7NH 5E2VH 3ZRSA 5EWIH 1DLHB 3WMSA 2P42B 2IOOA 3KLAB 4HIIA 3SN6N 3EDDA 2K1MA 3WJLA 1I4FB 1OM9A 5L2JB 1NBVH 3N85H 3B56A 1RZ8B 4JFEA 1A9VA 4Q2ZB 1AO7D 1IU1A 2NLJA 3H42H 2QVIA 3H56A 3LX9A 4LNRA 4ZK8A 2C1PA 5I28A 1ZHBA 4JO2H 1LP9E 1M1XB 3MBXH 1JFQL 1U2CA 1X5HA 1ORQB 3NTCL 3NIFF 2QKIC 2W9DL 2XNAB 3VFOA 1Z66A 4RA3A 5LWYH 1QHQA 1SQ2N 1AKJA 3N9GL 3ZDZF 4U1HA 3IDMA 5JA8B 4UNUA 4L3CB 5KTEH 2XN1A 2J71A 2XYBA 2EYTA 2X2YA 2CHDA 2WXPA 5GGTA 5FB8B 1A02N 3EDFA 3IS1X 3W11D 2Z35A 5BV7C 1BLIA 3WHXB 2R29H 1CDHA 1KB5H 2MNJB 2X4QB 4NS0A 5D1QC 2ZKWA 2X05A 4CMHC 4U1JA 3MCLH 4N85A 1UURA 5E56A 5I6LA 4ZNEA 2X1WL 2VDLB 2WXOA 2UWEB 3X1EA 2VIRB 3MLRH 3X3FH 2YPKA 3BUPA 3ECQA 2F9BT 4UDTA 5MI0C 1NCIA 3ENEA 3D3VD 4JFHE 4UIMA 1R3JB 1ZLEA 1JHTB 5E08L 3O8XA 1PSKL 3HUJF 3OB0H 2JNZA 5DK2B 1JL8A 4JGUA 4I4WA 3SDDA 3U9PH 2P5WD 3VRIA 1KIPB 3FSWA 3IXTB 1P4BL 5F7EL 4M93B 1MCSA 5KS9B 1BOYA 5LBVA 1MCPL 3MV8D 3L13A 3O3BB 4LAJH 3EJSA 4GIOA 1O9VA 4F7PB 3RGVB 4LLAA 4JFWA 3DX7B 4ZOBA 3NCJH 4JY4A 4DCQA 1UA7A 4MA3B 4DKFH 4KTDL 3W0WE 4ZMAT 1J5IA 4XP4L 1CXFA 4Z95L 3DRQB 5IR1B 1XH3A 3C6LB 3DTDA 3EJZC 2O30A 1S9XB 1A14L 1J88A 1Q9OB 2XSKA 4HOZA 5SWZE 4G8AC 1AQ8A 3VFTA 4PVNA 2Q6WA 1QX1A 1FYTB 3KW8A 3WG7B 2ZNWA 1XSJA 3TA3C 3COOA 2RGSA 2AJVH 2OR7A 5IJCC 1VFAA 4GQRA 1LO3H 1QFOA 4YHYC 3N0PB 4N9GB 5FA4B 1YY8A 4NRXB 4QRAA 2WSKA 5I1EL 4EN3D 3JTBA 4PD4K 2IAMB 2GHZA 1NUNB 4FTVB 1KWGA 1JWSB 4TUKL 4AGNA 3JWOC 3FO2B 4OUUB 1TO4A 5D7JB 5CFAA 4Z8FH 2LTQB 3H2QA 5CJOL 3HLAB 2A6IA 1UACL 5CXPA 3ATDA 2HLFD 3UZVA 3ULUE 3VD4A 4YHZH 5DS8A 2V7NA 5I15H 3OKNA 5EZLA 5MEPB 1MCBA 1AIZA 3DMMC 1ADWA 3LEYH 1RK0A 3BAKA 3CFTA 1YN6A 3R06A 4H0GA 3MLTB 1KB9K 1TCRA 3IMSA 3OKEB 1SYVB 4NO5A 4OFQA 1XF4A 3RDTD 5AVRB 1L7TL 5JHBA 3N5AA 2JIXA 4NQEA 2A99A 1IQWL 5B1KA 3TPKA 3WLWC 1F90H 3CHPA 2KC0A 2BHUA 2OYMA 3MGOB 4JDEA 4JHVA 2GSGA 1J11A 3HLKA 4XX5A 5DO8A 3DTXB 3G5VA 3U82B 1KG0B 1RUPH 3ZE2B 1U8LB 4J6RH 5G55A 5B38G 1A21A 4OGQC 5AUMA 4ZXBC 2VJ8A 1P5VA 1URLA 3GK8H 1IAOA 4NNYA 2KI6A 1JV5A 4RFOL 1ZVHA 1FRGH 3GXDA 4UV7L 3T0BA 1J5OL 1UWXH 4S2SA 5IT2L 4OZIE 1A1NA 1J48A 4X4XB 3DBXA 5IQ7L 2ZCHL 3SKMA 2JB5L 3GPSA 3QIUD 1HEZA 4MHHI 4FYRA 3GMOA 4BFOA 4PJCF 5J57B 4I3GA 3L9RA 5BS0E 2BWIA 3L4WA 4M6OH 4ZRGA 5JOPD 1HE7A 5IQOA 1HHKB 1XGYH 1E5AA 3DV4B 1G7JB 3MV7D 4NZUH 3WFDL 4I3SL 2PCXA 4J4PA 1YEFH 2IPUG 5KVGH 3II1A 3ZE1E 2MCG1 3T6XA 2B08A 2R4RL 1V7ML 2IBZY 4NC2B 1DJSA 2DQIH 4LDCA 2P1YA 3FYIB 4J23A 5FO7B 3NFNB 3HS0A 1P5UC 3KEHA 2EUZA 3V0JA 3A6BH 4O58L 3CXHJ 3ISRA 1KBWA 5T3XE 1VEMA 2ZJSL 3QUMH 4PLNC 3EO0B 2FZ3B 4YHKL 4RZKA 1KY7A 1GL4B 1XB8A 4N8CH 1BAFH 4UM8A 4XTRD 3FMGL 5FM4A 1O6TA 4L8SB 1U8JB 2XG4B 3GBML 4ODWA 4Y4FD 1MAKA 1FG2B 4BQ6A 1AVAA 3U4EA 1U9KA 2NY4B 4NOBA 5INCA 5EU6D 4PJGF 4WFHD 5TJWK 1A9EB 4UNVA 3BZEB 2WIIB 3H7BA 4X6CE 2ITFA 2HT4C 3L17A 2FDBP 1MVFA 4U1SA 2O5YL 4QWWC 1JNHA 3QORB 5DR5L 4HS8L 3RKPA 3ZKXC 3SE4C 5FW7A 4Z7VF 5ITBH 1HKLL 4FA8A 5B7MA 1RU9H 1QASA 1XF5A 4U6HA 1HIML 4HKJB 2O6CA 3GBDA 4NENA 2QADD 3I6KB 4XPTL 2E8ZA 4YUEL 4F7TA 3W37A 5D7KD 5BCAA 3GKZA 4CN1A 1IBHA 3DO7A 5C0ND 3KVQA 3LD8C 4PWEA 2KBGA 3UYPA 2VSMB 3IE4A 1FV1A 4OCXL 1L3WA 2E9WA 2LU7A 4RGOH 3KCPA 4YFEA 2OZ4L 3SE3A 5J1AA 2BNQE 3P11H 1K4DA 4NZJA 2Z4QB 3FFCD 3M1BB 1HZHL 1A5FH 4RGNC 4D9RE 5EOCJ 2WVUA 3JZYA 4UTAH 1U0QA 1ZS2A 5AZ2H 3PXHA 2C4FT 1WHPA 3CQQA 5BRQA 5F7UA 1YY9C 4XPGL 3NFSL 4ZMNA 4I89A 3VI3A 2HWZL 4IU3B 4NWTH 1G7PA 1LP9B 4UV4L 1OQOA 2KLRA 5GS3A 3WXWL 2GJRA 5I0VA 2BC4B 3HZKA 3S34L 3EIFA 1BLNB 2CJSA 2QQLH 1JVKA 5HVFB 3GBEA 1DE4A 1MLBB 3CVHL 5JW3L 1QACA 3DSFL 3SPGA 3S5LA 4MKMA 3VSVA 4AYFA 3L5WA 5D96B 3TGXA 1QW9A 3KL5A 5C0JB 4F8OA 4F3FB 2X38A 4JFED 1WZAA 5C9JB 2PO6C 3MZTA 3QEHA 5I82A 2H32A 5JQ6H 1S9YA 1A3QA 1KV3A 3SY6A 3MRLA 5GGVH 1FFQA 1B6DA 1RZIA 5J12C 3CJJA 5FGCE 4B0MB 3CCHA 2XBTA 4OIIH 1RUMH 2EDLA 1KENH 3SDCB 3ZX1A 5F9JA 1RZJL 5FO9A 4JFOB 4YBLC 5C0IB 3WTXA 3BWAB 2DQGL 3BGFC 3ILQD 1AKJD 1XL4A 3GSXB 3OKMA 4PWKA 4QXTB 2AEQH 3PGCA 3UAEA 1DFBH 1LMKA 2N01B 3D51A 5T1JA 3MBEA 3P73A 1DBJL 4JM4L 2CK2A 4HW6A 3GIVB 4S1DD 4BINA 5IOPA 2Y2YA 1I8MB 3QRGL 2IH3A 3QXUA 5IG7A 4LVNC 2WP3T 3VD0A 3HRZA 3ULUL 2A6DA 4Y5YB 3CVHB 1FQ9C 4KKLD 3T4YB 4H40A 4LP8A 3JVGA 2X87A 1E4XL 2ZOUA 1D6VL 3BYYA 5I6XC 3W0WB 4NBYB 3TO4A 3V6ZA 2FHBA 2FATH 5FWQA 3PF2A 2EXYC 5B8CA 1PMYA 2ZOTA 4MHHG 3U2JA 4BXVA 5PCYA 5I26A 1KLUA 2DQEH 4PG2C 4PG9A 1CE1H 1P0SE 5SWZB 1JYXA 1IL1A 3HNTL 3O8XD 5C0RH 1JN6B 2B7DT 2AQQA 1A7OH 3SDDD 3TV3L 2B2XH 1PZBA 2YR3A 5HDOA 1IAIL 3CSFA 2J8UE 2WXMA 3DXAD 3GSQB 1JNNL 4TNEA 2BP8B 5AKTA 4APXA 1OW0C 5ACZA 4E9QA 2E56A 2CRZA 4YE4H 5AYUH 4I85A 4ALAC 5CEZE 3LRSB 2E59A 2QV4A 4YLCA 1OGTA 1GXEA 2KL6A 4ZFQA 3QULB 1TEYA 1GYWA 4U1IB 1J0HA 3MRHB 4I8DA 4DP0X 3DJZA 1AZUA 4XP9H 1HL5A 2QDVA 2WO2B 3BH8B 1MF2H 1F45A 4S1QL 5E8PA 2XIBA 5C0GB 1AR1D 5KJRL 4J1UA 3V52H 5HVWA 4HA1A 3OHXC 4N4YB 1CXKA 5DHXB 1SVZA 2MCAA 3IDJA 4U4BA 1JRHH 2XRAL 4NUJB 4QTIL 1BVLA 1VRSA 3QC6X 4JO8A 4JY6A 4D0BB 1SJXA 3G04A 2A38A 3C5XA 3FJTA 4P2OC 5SWQB 2NUPB 4ZX3A 4HMCA 5DS2A 4HK3J 2R23A 1HOCA 2ATKA 5BPPA 2UUDH 5CHNA 1RURH 2BIOA 4R5TA 5T3XL 3CLFH 1ZE3H 3S37L 1IFRA 3LZNA 3TWYA 5IKCA 4K3DL 1RJYB 1JHKL 2OYLA 3K6NA 4QHMA 4DZ8A 1DJIA 1LDPH 4ZMXA 5EF3A 1D5ZB 1XH2A 2ED9A 3CFIC 4GAGL 1HXKA 2YGVA 3WNJA 4Q6YA 4M00A 2FLRT 5D2NE 3VD7A 4Q97A 5T8IA 5I0XA 4TYUA 4HUWB 3IVKB 2WXRA 4DT2A 3THML 1JUFB 3OR6B 4OZIB 1ZPLA 3D85D 4P5SA 1IM9B 4Y2LA 1JTTA 1L5GB 4AGMA 5I19H 3MFGB 4DP2X 3SE8L 2JIXD 1CGWA 1DQJB 3S3SA 5A2BA 4G59C 4XO4A 5BS0B 3MREB 1B88A 4JFZL 5BMFL 4R0LA 1DVQA 5ECGA 2BVEA 2YUWA 1QBLL 2R0LH 3LEVH 4BKLB 2VDNL 4ZOCA 3FU6A 3O0RH 3KPSD 1F86A 3MCG1 5E0FA 5F7KC 2E9IA 1SHMA 4H25A 4PJDF 2JWYA 4KJQD 3TTSA 2UY7A 2F15A 2VLLB 2LLNA 2GTWA 4ZFZA 3RWIA 2DKMA 1WIUA 2APFA 4XNBA 1IC5H 3ZTNH 1JZ2A 2X6UA 5IJBC 1I1AB 3V55A 2BIQA 5HPOA 1P4LA 3ME0A 1AQHA 3ZTEA 3S96A 4PJ9B 1OOAA 1ZVSB 5FUOL 5C3LD 4RVBA 3DWTA 4Q0XL 5IUSA 1SXBA 4PFEA 2IH9A 2HLAA 3AS1A 5HDWA 4LQ1A 4RCAA 3WNNA 3FHAA 3MFFB 5HHQB 3FH7A 1X5AA 2X41A 4OR1A 4J4PD 5IJDC 4OGXL 2C3VB 1TQCC 3FOLA 1DQML 3L3IA 4N8VB 4I9WE 4X6CB 5HHXH 2GEEA 3HR5B 1JD7A 3W2DL 4UQ3B 4BZ1H 1F6LL 4A39A 3BLBA 4QDGA 1M9SA 2IGFL 1AI1L 1J05A 2HLFC 4FI8A 1UWXK 2R2BB 1SF3A 4WU7A 5ID0A 2CO6A 4HK3N 1KIQA 3FTWA 2CDFB 1ID5I 5I76B 4N28A 4YBQC 2VDNB 3VGDA 1AFVL 4MAZA 1NLDH 5J6SA 4JRYE 1CLOL 1RP9A 5DJ2B 2BNQB 3Q5OA 1MFUA 1GYAA 1PDKB 1I9RL 2OQJB 2W0LA 4IHOB 3RA7H 1XWVA 2DWDB 5FA3B 4KDWA 4PRAA 3VD3A 4D0DA 1GH7A 2ZNXA 3BEVA 5E03A 5E94B 1UWYA 5IMKA 3UTTE 4XMTA 1UM5H 2L7UA 1SY6L 2E0PA 3O3DB 2NY7H 3ZHDA 4BUGA 1LDSA 1A6WH 4HBQA 5F89A 2WBJD 2Z93B 3PYCA 4XMUA 2Z9TA 1I1FA 3ECVA 4TKWA 3IJHB 3RX8A 4GG8A 1WZ1L 3ZKND 3CSPA 3QUKA 3CLEL 4J3BA 4NQUA 1NPUA 4NUMA 2I5YL 1U3YA 3DX8B 3GIZL 1ZIBA 3U2SB 2VLKA 4BE5A 1VZHA 1HCYA 2XY2A 43CAB 4M8QA 2PABA 4B9JA 4WEBL 2CNYA 4JO4H 4L0YA 2B1AL 3QFDB 4AKOA 1XSKA 5GHWH 2GK0A 3ARGB 3VB9A 4JHWH 3ZKQD 4X7TB 4XVJH 2DQDL 5D7SH 4NUPA 1K4CA 3K81A 1EFXB 2CM6A 3UZEC 4AJWA 3NIGE 2F53E 1NM4A 1KLGB 5FGCB 3GSUA 3IJSB 1IVTA 3LKPB 3V5DB 3ARDA 4DP8X 2YD8A 3QJFB 5HGHB 4K2UL 4HCFA 3S5YA 5I6PA 3PP3K 1H3GA 3O6KL 4FYQA 3QXAB 1WE5A 4JFFD 1LO0L 2X4PB 1DDHB 3LJ3A 2IADB 4G70B 2IQAB 4HIQA 3US9A 3Q1SH 3Q01A 4EDXB 3NPZB 2VE6B 1TTFA 3WUWB 2X6CA 2YSTA 4I2XE 1DUYB 3B8SA 1H3PH 1FGVL 1CTNA 3BP4A 4GRWF 3QW9A 1W9XA 1QYGL 2OR9L 4ORGA 1F41A 2VITB 1G7HB 4NQSB 1T83A 3CDGA 3BWUF 4XP5H 2PR4H 3NIDF 9CGTA 5C6TL 3H3KA 3WTWA 1JK8A 1DL7H 1AHKA 3K91A 1WFUA 3TYFB 3GINA 1WEJH 3QIWC 4OKDA 4PY7A 4KNTA 4Y16A 1CN4A 3RWDA 5FV1L 1QBML 1H15A 2AABH 5AEAA 3NP3A 4E5XG 5FR3A 3T4AC 3FC8A 4KOBA 1TZGH 3CTTA 4OKVA 3MBED 3WFEL 4UQDA 4N0UA 4Z5RA 2DZEA 5D72L 1GAFL 2BVPA 1LQBC 5F1NB 2J8UB 4LEEA 4OTXL 3SCMD 5FGSA 3GSOA 2R2HB 4TRPH 4PRHE 4YXLL 3KYOB 4C59B 1FL3A 3H6JA 5DTFA 5SX4H 2WN3A 5IMOA 4ES8A 2XTJC 1C7TA 1OANA 4YK4B 4Y19D 2VN4A 3O3EA 3TO4D 1T7XA 2X28A 1NLBH 1KIUA 2DI8A 4U6XA 3VG0H 1EJOL 4MDIB 3VUAA 5JXEC 4PRID 4B27A 2VXUL 2J6EA 5CBAB 4KX8A 3CHQA 2G0LA 2GY7B 4XNYH 1YECL 4E0RB 1UKTA 1GHFH 4LRIA 1BF5A 1IGML 2D7NA 3SSGA 2PWFA 1IMHC 1JF1A 3S4SB 2HH0L 5KZCB 2OR8A 2A6JB 1NBYA 4JQIL 4A55A 2MTAA 3P4OB 1O7SA 2FBJH 2XUWA 5DRXB 4UOW0 1DLHA 3M17B 3H53A 3PJSB 4XAWH 5D7HA 3CSGA 2OK0L 3KLAA 3MRFB 4P4KC 2JF1A 2FIRT 4XB8A 5I73B 1I4FA 5L2JA 2IANE 2Y1ZA 2WNKA 4OJCA 1RZ8A 3MLWL 4R84A 4Q2ZA 3AU0A 2BCKB 3WNKA 1YEIH 2WXLA 5DYOA 4WK4B 3LV3B 4YZFE 5F7FA 2XI9A 4KROD 1ORQA 3ILQC 3MLUH 2LABA 4WNQB 3HR6A 5IREA 5D2NB 2XNAA 1FNAA 2EXWD 2X4OB 3P0YL 1T2QL 4X80L 4WTZG 4ONGL 4L3CA 2BNUB 4XH2A 1R75A 1Q9LB 4S1DC 3WY3A 2DPKA 4NI6A 4OT1H 4H4NA 1N9PA 1U3HB 1Q9WB 1P4IH 3PWVB 4PBVC 5CU5A 1NMAL 5FLUA 4IRSC 5ES4B 4WJG3 4KKLC 2AGJL 3WHXA 3PRZA 4FEIA 2GUOB 3IK2A 2X4QA 1Y07A 1GSMA 2EQDA 5DT1H 1RZKL 3MKKA 5FHAL 5DA4A 5I75B 2UWEA 5H2BA 2VIRA 4AV4A 2P8LB 3DX6B 4BIKA 5E8EB 3GHEH 2EE6A 3O8XC 5KVEL 4OCRL 2E46A 4GJTB 1QSVA 4XE5B 2M83A 1JZHA 2GTZB 3ZXAC 4G71B 5DK2A 3MMEB 5TFSH 5HYSB 4PBDA 4XAKD 3IXTA 3RQ3A 3N1GC 1KYOK 1S5IH 2FQGA 2VJ0A 5KS9A 3I9GH 3STLB 2BZCA 4JG1L 3ETBF 4Z7WF 3O3BA 4P46D 4DEPC 1NCGA 4PJ5E 4XNUL 4F7PA 2RQEA 4NJ9H 3RGVA 5LHDA 1NMCB 1QFPA 3V8OA 3QNXA 4MA3A 3EJRA 1V3MA 1HL9A 3EXJA 4FFZL 4HPYH 2CRYA 2Q7YB 1U30A 4HZLB 3DRQA 4EO5A 2WLMA 3LRHA 1BX2B 4M5SA 1XF1A 2K3TA 5D1ZI 3P54A 4LDEB 1S9XA 4G9FE 2BWDA 4HJ1A 1BFSA 1Q9OA 2XZAL 5J56B 2JKJA 1KACB 2W81C 4EMZA 1CLYH 5E6SB 4LSTH 2VLRE 1ROWA 3N1MC 4UT6H 2QJDA 5DLML 4A7SA 2QV2A 2WTOA 4Z3IA 4JRYB 4N3UA 1YEJL 4N9GA 4NRXA 3W9EB 2WQXA 4EI5D 4QRTB 5A16B 3CFQA 3CAFA 5IHWA 3IM1A 2CJTA 4KNUA 4FTVA 1NAMH 1JWSA 3D52A 3ZW3A 4NLHA 2ICCA 5CJBA 3QUZB 3FO2A 1JGIA 1NUGA 2DQHL 1BQLL 2JKXA 4L9LC 4OUUA 5D7JA 1VACB 3EH1A 4JY5L 2FCBA 1FFNB 4KY1L 1KPVB 4U2YA 3HLAA 4JN1H 1G9ML 3V0IA 1BGXL 3MV01 4Z0BH 1FE8H 5MEPA 4M61B 3KWVA 4PS3A 4BZYA 3MLTA 3ZDWA 2WLZA 5F9DC 3UFIA 3VH8G 2Y07L 4MDRA 2CLRB 3NAAH 3DVIA 3EG9A 5F72S 2G4EA 2KZKA 2G60L 3WIFB 5K5YA 4EEEA 2IFFL 3MGOA 3HOGA 4U3XA 1QNIA 2BSSB 3IN0A 4KJQC 3BE1L 3RY4A 4XBPB 1DANT 3CN4A 1S2EA 2IIJA 3X12B 3N44F 4OGZA 1CFNB 2F53B 5FYJE 1PGRB 3P2DA 2Z8WC 1GOFA 5K9JL 1RCYA 1ZTXL 4XR8C 1KGXA 2WB7A 4X4XA 5TQ2L 1E9QB 1N70A 1MFDH 3CFKB 4HIJB 1TQVA 3QH3B 5A6LA 3K6DA 1CYGA 1D5MB 3SZKC 2DQUL 5BVJB 5IHUL 2OSXA 2D7TL 4BKSC 2DWYA 1OVZA 3DV4A 1G7JA 2NY6D 4I2XB 3REVB 3FQYA 4W93A 2CA4A 5BZDB 1C9SA 1Z0MA 4FTDA 5AW9B 3TCTA 4HDIB 4POYA 4FG4A 3NFNA 2XV6B 5TDOB 4ZZFA 3WIIL 4XN1A 1H0DA 3ARDD 4FNRA 3CUPA 3PNWA 5L4MA 4CU6A 3LS4H 5HYIA 3ILPB 1U8IB 1YEWA 4NKIH 5D5MF 1X3DA 3EO0A 2FZ3A 1BQRA 4DK3A 3G6DH 5DXWA 4L8SA 1U8JA 2XG4A 1FG2A 1JV2B 1VSCA 4UB0L 3NJMA 4PRHB 1A9EA 1IUZA 2AJYH 4W4NA 3BZEA 2WIIA 2QGCA 3CXDL 1N2RB 5ISZE 2D31A 3QORA 4WJ5B 3VCLB 2VRAA 5DURD 1E2VA 4TQEH 4XNXL 2WBJC 4V2CB 1NOAA 2NNAB 1F4XH 4H2AA 1B9ZA 1EEYA 1YN7B 3QQ9C 4RMVA 5CSZB 5BZWB 4Y16D 2Z8RA 1IC4H 3PHQB 4HKJA 3ZKNC 2LLLA 3I6KA 2VH5H 3L9BA 4CW1B 3MRDA 4UUJB 1E5CA 4N20A 2NY1C 3SE3C 3IDYC 4I3RL 4MAUL 1QZNA 4NAQA 4K7PH 3NSCA 5G5DA 1N7ML 3ESPA 3MRQB 1RUKH 4JKPL 1QI4A 3M7OA 5FUCE 4C58B 3ULVD 3M1BA 1HEJC 4Z23A 4KITB 1MCRA 2JK5B 5JO5B 3K2KA 5C86A 3AQXA 3NJNA 2WAQA 1E3FA 5I30L 1JF5A 1T5WA 2E8YA 2IANB 5LG1A 5E00B 1AH1A 1KGWA 2FGZA 1O7DE 1S9KC 1KBKA 2W1NA 4X5WB 1NMBL 4IU3A 4HGWA 1PFOA 1LP9A 3O11B 3WJMB 4Z77A 3SDXE 3ESOA 3NSXA 1VFUA 1RHFA 1PJWA 3T6VA 2LV4A 3CH1A 4AX3A 1OY3B 1IFGA 4LHQB 4AQ8A 5HGDB 3NEEA 4Q9RH 3EBGA 3TP4A 4DVRH 2UVFA 1KYDA 4L1BA 5D7IE 1JZ3A 4LZKA 2ICEB 3WFCH 1DN0B 4JCWA 1FORL 4H8WC 3FCUB 2EYRB 4PWHA 4IOSA 5CGTA 3QCVH 3RBGA 5C0JA 3EBHA 4F3FA 5ICZB 2JCWA 2WYIA 2KHAA 4HISA 3UYRL 5DVNA 2HTKD 5E2WH 5C9JA 2C26A 1N6UA 4DUWA 3LQAC 1IKOP 1E4KC 1T0PB 4H1LB 2OZ4A 2LVEA 1E4WH 1ZT1B 3KYAA 1MVUB 1ILSA 1MEXL 2XJKA 3TBWB 3CVBA 5CR8A 3SDCA 2EABA 4Y2OB 5E2VL 4O51B 4HUUB 4YEFA 1JGLL 1KXQE 5K1JA 5CAYB 1G9MC 1JHLH 1PLAA 5C0IA 5FLVA 3BWAA 1OE3A 3MBEC 4QXTA 1TCMA 1WYJA 3GSXA 1NBVL 3EGXB 3MA9H 4PRPE 4PB9H 3SCMC 2ZWLT 3OD3A 3NGBB 2O6FA 5DWUH 4HH9B 1JXKA 2OMUA 3OC5A 5JIDA 3GF8A 1I8MA 4OZHE 1OCRB 4HUXB 4KI5D 1AJ7L 1L9MA 2APSA 4PJ5B 4YHLL 3EYQC 4Y5YA 5I74B 3CVHA 3ES6B 3T4YA 2V3DA 4KTEL 3BPLB 3K71B 5B8CC 4OSUH 2HYMA 4GIPD 3W0WA 3CZEA 5ANHA 2Z31D 4GT0A 4B50A 4NZRL 3OKKB 4X7CC 4HJGA 4BFFA 5KSBE 4PJ6A 4HF5H 1FNGA 4JM2F 4J3XA 4JQVA 4ISVB 3MJ8B 4G9FB 1ZLUK 1PEWA 5KYUB 1N64L 4WO4B 5SWZA 4QRRE 1JN6A 3RIFF 1MFNA 3E3QC 1UC6A 4J3OG 4WW1B 4XN2A 4ZW5A 2VLRB 2R0ZH 3GSQA 3M46A 1VGKB 1ASPA 1ZHLB 2BP8A 2BNRE 1FSKB 3GLAA 3U46A 3MOAL 1PJ9A 2PPEA 3RGVD 4AL8L 1BF2A 2CMRH 3CX5J 3LRSA 4EXPX 2IBBA 1HINL 2RMNA 4GSQA 4M5YH 3IT8D 3LS5H 4YVNA 2Q2EB 4P3CH 4FQXB 1QFWM 3A22A 3IMWA 2FX8H 4LSVL 4U1IA 3MRHA 4KROC 1KC5H 1I31A 1HL8A 1AQDB 4M9PA 3VXNB 4RAHA 2EXWC 3SYCA 5E9DE 1BQUA 3KEDA 5C0GA 2AXGB 5KBLA 4GMSH 4RGMC 1BPLB 4N2AA 3Q05A 1A4AA 1GMIA 3V0FA 3TBYA 1SJHB 2J1XA 2XWXA 4NUJA 4U49A 1OP9A 3RDJA 1A7PH 2DD8L 2WMPB 3NJLA 3LKOB 4FQJH 4D0BA 1COBA 4ELME 3KZ8A 4QO1B 5SWQA 4NKDB 2NUPA 1C08A 4GQZA 3FQTB 3LPPA 1CU4H 3NN8A 2CKBB 2P5PA 1HE8A 4FTVD 4R97C 4BQ8A 2CGYA 4CSTA 5ALCH 3NCXA 2A9MH 3AREB 1QSEA 4FG0A 5HJDA 1RJYA 3CH8A 1NCWH 4D2NA 5I1LB 3LHPL 5AOZA 4AJ0A 3EHBC 2FBOJ 4YC2C 1D5ZA 1Q38A 2DLHA 3OJVC 3QIBD 1G0DA 3NCFB 2ADYA 4HUWA 3FQXB 1JUFA 2E7DA 3KMDA 2KUTA 4XX1G 2OAAA 4EZKA 4CNIB 2CA3A 3OR6A 4OZIA 1X7TA 1YUHB 1IM9A 4B0MM 1YEEL 4F93B 1L5GA 4P46C 4G8EB 1H9VA 2LU5A 1W0WA 4N0FB 1DQJA 3NJFA 2JCCF 5BS0A 1W80A 1A6UL 1SOQA 3MREA 2WXJA 4XPAL 1IRAY 1BYPA 3TA4D 3HKFA 4YHZL 2RJMA 2Y25A 1YJDL 3CPLB 2DYPB 5CCKL 5I15L 4UAHA 1Q0XL 4BKLA 4B7LA 2HMID 2DEWX 5ADPH 5F96H 3S8FB 4G43B 2L8AA 1W2KT 1K3IA 1DVFB 1XT5A 2BPBA 2EUVA 2VLLA 4LQFH 3AABA 1Q9KB 5GRJL 4BKTC 1J9TA 4DP4X 4I48B 3US0A 1MCDA 1CWVA 2JELH 4EIUA 4UBDC 2ICES 1ZVSA 4ZYKB 3G9AB 1DO5A 4AKPA 4J6RL 1QI3A 1YRKA 1XX9C 1G7IB 4XCFL 2VJXA 1GC1H 1S78C 4EI5C 3VE0B 3HE6C 3N40F 3MFFA 1D2PA 5E1AB 5T1LB 2C3VA 4QGYA 4N8VA 3R8BB 2WNXA 4X6CA 4HHGA 2J1WA 2H3KA 2BSDA 2YGQA 5F6HJ 1DBAL 4AVHA 2ETWA 2MWCA 3BISA 1G0XA 2LAAA 4I1PA 5L0QC 4J3VA 4EE2A 2ZKHL 4P5RA 4XCEB 3AG1B 5DZLA 1O9ZA 4M6OL 2R2BA 3SGJA 4N25A 4DFHA 1VCAA 3CDYA 2CDFA 1EGJH 2Z0UA 3KYKH 4NZUL 5I76A 3APMA 5KVGL 3ATFA 2EEAA 3B3IB 1EHKB 4YVUA 1R4XA 4KVPA 2AF2A 4FHBD 2ZCLH 4TUJB 5AQ0A 1PS3A 4KBPA 4HU8A 5DJ2A 2NY4D 2BNQA 5AZEL 1UFUA 2XZZA 1PDKA 3UO1H 2OQJA 4IHOA 3U1SL 2ID5A 3A6BL 4TVPE 2DWDA 2EEFA 1JOIA 4KPHL 3QORD 3PABB 2NZ1A 5E94A 1EZVY 1TPXB 2O6EA 2IF7A 4WW2B 3HC4H 1PFCA 3O3DA 3WEXA 2X7LB 3MJWA 3MRPB 3O4LE 4FULA 3WS6A 1G7LB 2Z93A 2F18A 4Y5VA 3I6LE 4G6FD 3SDXB 2XQYK 3IJHA 1FNEB 1WA0X 2IWFA 4Q7DA 4W6XB 5E6IA 4ZQKB 1SN5A 3V6OC 4EKXA 1GR7A 4B60A 3SQOH 1FAIH 5FUZL 3DX8A 3ZGIA 3HNVH 3S36L 4HJUA 2EDHA 4N0CD 4WFFD 3V0EA 4JRFA 4KQ4H 4DNLA 5ITBL 5D7IB 4XO8A 5A2AA 2HT2D 3QFDA 4ORZC 4EVNB 5J6GA 2GBUA 2V2TB 3IJEA 4MZ3A 3ARGA 3L2LA 4X7TA 1A25A 4JGNA 3WL9A 1OOWA 3D12B 3ARDC 2AKRB 4D7BA 1CIUA 2IG2L 4ODVH 5T5NG 3IJSA 3P11L 4W9FC 1MIEH 3BCDA 3QJFA 1HX0A 5E5RB 5HGHA 1MIML 3TEXA 3PUCA 2H3XC 5K93A 1RY7B 3QXAA 2E9GA 5T1MA 2XBZA 2XXCB 1SY6A 2X4PA 3GB7B 2YZ1A 2IADA 2IQAA 4H44C 4PRPB 4IEFA 4BH8B 4EDXA 5I2IB 4R5XA 2VE6A 4N86A 2C5DC 4CN4A 2PXYB 3WUWA 4IOSD 4MMYA 1DUYA 2GSMB 2X2JA 3GMPB 4KKCC 4OZHB 5DD1L 2EVGA 5DJXB 3T5WA 3WKPA 3QJTB 5CZKA 2KS0A 3MGTA 1Z6JT 1S7UB 2VITA 1G7HA 4NQSA 1JPTL 4XZ4A 3U0TB 3TWCL 2ZD0A 1Q1JL 3IDIB 4Y16C 4PJBA 2G9KA 3LRMA 4PW9A 1A3RH 4G5ZH 1F13A 4HS6B 2DKUA 1TQTA 3APFA 4K3GA 3BH4A 3ZDYF 5AB9A 3WO3B 4HJJL 4JFHD 4QRRB 1AIFA 2MMXA 3DPDA 3BMWA 3RWFB 3HI5L 3O41B 1V5JA 1KN2H 5F1NA 2J8UA 1CLZH 3ULVC 4ZUSB 1NAMA 4OIIL 2R2HA 2BNRB 1OSEA 1RUML 5EBMB 3OZKA 4NC1C 3V6BR 1UATA 2PP7A 4J3SA 2XWZA 3EYFB 3K2UL 2JJTA 3BQUB 3HAEG 4HSCX 5EO9B 3W0WD 2Y3NA 2AEQL 1BBDL 1N5YL 1DFBL 2VZSA 3Q0HA 4MDIA 4J3OH 3RNKB 5F8QC 5LO7A 4PHZA 1DUZB 4GXVL 4LRIC 1MWAH 5CBAA 2QSTA 4HJSA 5SWZD 5E9DB 1QFHA 1ZVYA 3ZT7A 4E0RA 2ZP9A 3FHEA 2R1YB 2FAUA 2JTDA 3ZYZA 3M6DA 1RJZB 3RNQB 3S4SA 2A6JA 3ARQA 4X5XB 4EI0A 2E5EA 3P4OA 1J1OH 1EAOA 1D5XB 4OD1L 4HX1B 2YRZA 3ZK0A 5LG6A 1TQBC 5DRXA 3M17A 4ELMB 1D5IH 3V4PH 4KK6D 3MRFA 4PRNB 5LCVL 3N42F 4XXCA 2ZXDA 5FF6A 1LEKB 1TLKA 4RMTA 1UXSB 3L48A 2BCKA 1H9DA 4Q6KA 4P4RA 2HVBA 3V79C 1OTUD 1NFDE 5E6ZA 3VSUA 3MJ7B 3F5WB 3LV3A 1ITCA 3CBJB 4FFWD 4I0PC 3SKNA 4WNQA 1UA6H 5D2NA 3PFUA 5D55A 4M56A 1E4JA 5DGRA 5HGAB 1BEYH 1IEHA 2GBAA 1MFEH 2Z34A 1J87A 3DUUB 1SLVA 5IROA 2CU9A 2BNUA 1Q9LA 2BMKB 1U3HA 3P4NA 2RR3A 1Q9WA 4FG6D 4M7LL 3T1FB 2EDYA 3PWVA 4W9KC 1E0OB 4QJ3B 4LK4A 4OLVL 2ZT9C 2GUOA 2IPTH 4AZUA 2Z31C 1QSED 3TPUB 4KK9D 1LTXA 3RZWA 4ABQA 4K94H 4PJFB 2VDRH 3UBGA 3DX6A 3PY9A 3EYSH 4JFXA 5E8EA 4W9LC 3T3MF 1OV8A 3NACL 4RRPM 1I7UB 5TPWL 3AXHA 3QJUB 4UQEA 3L95A 4FJ6A 4CJ1A 4TVPL 2GTZA 1IM9D 4GBXC 1MQKL 2W65B 3CLFL 3MMEA 4MJID 1FLRH 3BVUA 3HCVB 3N50A 4H5SB 5BW7A 5HYSA 3PV7A 5I0WA 3STLA 5BS0D 3K6SB 4C4KO 2V8LA 3DJSA 5EIQA 4AKQA 4EIGB 2Y7SA 4E5XA 2OTUB 5E9AA 1ERNA 1PZ5A 1QW8A 5FAAA 5ERWB 3RYMA 3CPUA 1V54B 1HCFX 1NGZA 2VDOH 3MNVB 3CZFB 2VR9A 5CILL 1Q0EA 5JW4N 5C0BD 3JWNG 2Q7YA 2UV3A 4D0CA 4OZGF 1CVSC