4LOEA

Human p53 core domain mutant n239y
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
194
structure length
194
Chain Sequence
b'SVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCYSSCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cellular tumor antigen p53
publication title Structures of oncogenic, suppressor and rescued p53 core-domain variants: mechanisms of mutant p53 rescue.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Apoptosis
total genus 45
structure length 194
sequence length 194
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00870 P53 P53 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4loeA00
4AGPA 4IBTA 2PCXA 1GZHC 3Q06A 2J21A 3D06A 4AGOA 2BIMA 3Q01A 4XR8C 4KVPA 3KZ8A 4IBUA 2BIOA 2BINA 2VUKA 3WTVA 2X0VA 3EXJA 3VD1A 3D05A 3QYNA 2MEJB 2J6WA 3WTXA 2X0WA 2IOOA 2OCJA 4QO1B 5A7BA 1CMOA 1HJBC 4IBSA 2X0UA 2RMNA 3US1A 1HJCA 2XWRA 3IGKA 1IO4C 4AGMA 4MZIA 4IBWA 3WTSA 3IGLA 3Q05A 2J1XA 3WTYA 4HJEA 1TUPA 1KZYA 2H1LM 3TS8A 1YCSA 4LOEA 1GZHA 2P52A 5KBDA 5AOKA 3D09A 4IBZA 3ZMEA 4L18A 4G82A 2FEJA 4AGNA 4AGQA 4GUQA 4GUOA 1HU8A 2J1YA 5G4OA 5LGYA 4IBQA 5G4NA 2J1WA 5AOMA 4AGLA 2BIQA 4L0ZA 3EXLA 1EAOA 4IBYA 3WTTA 2AC0A 5AOJA 3WU1A 3D08A 5AB9A 5LAPA 5AOIA 4A63A 2AHIA 3VD2A 1T4WA 1E50A 2IOIA 3US0A 2IOMA 1EANA 3D0AA 3WTWA 4LOFA 1UOLA 2WGXA 1CO1A 4MZRA 4LO9A 1TSRA 2GEQA 2XWCA 3D07A 5ABAA 5AOLA 2BIPA 4IBVA 2J1ZA 4L0YA 2YBGA 5BUAA 5G4MA 2ADYA 3VD0A 5ECGA 4IJTA 3QYMA 1H9DA 1LJMA 4G83A 3WTUA 1EAQA 2J20A 2ATAA 3KMDA
chains in the Genus database with same CATH superfamily
1R1CA 2VJ0A 1E2WA 3EYFB 3Q06A 5B3JF 3P2BA 1J05B 1FE8H 4FQCL 5DZVA 5C70A 1QKZH 2Z8SA 3RVWD 2R2HB 3VH8G 5HPMA 2JI1A 1DL7H 4MGXA 2V7NA 1QYGH 1J8HA 3IWVA 5F2FA 1JYNA 5DC0A 4GBXC 5AENA 2GJZA 4OQTL 4UQCA 3BEVB 3NAAH 4P3DB 2C9UA 2IOOA 1UUNA 5EU6D 3DSFH 2EDNA 1QNIA 3MOAL 4Y2NA 4Z7OF 3L7EA 4AYMC 4Y9EA 2YKLH 3FQYA 1PQZB 4RGMB 4MXQC 1H8OA 3BP7A 1G9ML 1WFTA 2UZXB 5HI4D 1D7FA 5IK3B 3TYGH 4WFED 2LABA 4MJ6B 1A5FH 4FKHA 3K6NA 5J1AA 3LKNA 3OTTA 4WNSA 1R3LA 2OMUA 1PLGH 4H1LG 4TNWF 3VSQA 4DGIH 1AIZA 4HCRH 3TIDA 1OAQH 2KI6A 5F6IB 5LVEA 3OKDA 4N90E 3KPNA 1XH0A 3TGXA 2AK4A 3LHPL 4AL8L 3OKNA 5KANI 3ZDXF 3KYMB 3FUNA 1FL3A 5BZDA 3RHWK 4CBZA 2FGZA 1U8NB 2QGDA 4DP8X 2GJ6B 2D7QA 5AZUA 1COBA 1NOAA 4F8NA 4YR6A 1JNNH 2FHFA 4KI5D 4F7EB 1J9CT 5AUMA 2XZZA 1HWWA 1OAKL 4QRUB 4XCCL 3GMMA 1FE8L 3L9RB 1E8WA 4LHUD 5IGXL 5AOJA 2C9RA 4Y4FD 3SYOA 1YQVL 4K94H 5DD3H 1CI3M 1UQSA 4LCCC 2Q8AH 1DL7L 1X5LA 3QJZA 4YXKH 4A2GA 2M83A 4PJHB 3S88H 1A4JB 4HT1H 1XO8A 2N0MA 4ILDA 3EYSH 1FZMB 1AR2A 3NAAL 5KYUB 1AHKA 1PZAA 1SFDA 1KXVA 4HKZA 5EOQL 4B41A 1WAEA 1ADQH 2VQ1A 3GRWL 4E9LA 1EQWA 2BVTA 3BE1L 2R0WH 5CBAB 3EH4B 3T04D 2DRUA 2F0CA 2BIPA 2YKLL 2EXYD 1I8IA 2A2QT 2Z8VC 3WIHL 1EZVX 2ZG2A 3P69A 3LH8A 1T0MB 1RU9H 2NDFA 4PWIA 5E6SB 3CCHA 3INUH 1MWAA 3K4AA 3ZE2E 2ZCKL 4KXDA 2ZX7A 3O3EA 5A6MA 3BDYH 1G6VK 2CLZA 4AEIL 1ZT7A 1R0AL 1F0LA 4WUKL 4CVZB 2H1PL 4W70A 1A7QH 3JWDC 1KV7A 4GYBA 5EWIL 1LK2A 4QF1B 5F7AA 3NMEA 4AGOA 4NN7C 4OAWB 3TVMC 3GSRB 2HLAA 3GLEA 3N2JA 3AWGA 3MLSH 4GMTH 5KVGL 4WTZG 1NANI 3QPQD 2QDVA 3ES6B 2VLKD 3QUKA 3CMOL 4JFED 1Z9MA 1T0NB 2LE9A 4UIMB 4PJCF 2DPKA 2V33A 4N6RB 3HG3A 3BGFB 3NBNA 4LCWE 5JQ6H 1N8ZB 3L4CA 3LSOB 4K94L 5DD3L 2V3EA 3V9FA 1OZTG 3ISYA 2A74B 2Q8AL 1NPJA 2XN9E 4XC1H 4FQQB 4YXKL 1JHLL 4HJUA 2Y25A 4HXAH 2QKIA 1CQYA 3JWOC 3MRIA 1KBKA 3CFUA 1L9MA 4ZX6A 1GTFA 2FD6H 1F6LL 3ISRA 4YHKH 1RLBA 3CSPA 3FQUB 2B1HH 4M9PA 2OULB 4WNQA 1AKPA 1ADQL 5CP3H 4B0MB 2BIHA 4FTVD 4OV5A 2X40A 4FFZH 4PJDF 5F1NB 1A7PH 1EBAA 1HH9B 3AS2A 1MG2C 3DETD 5DMGC 3V5HA 4CILA 2XUWA 3Q5TA 2HRPL 2X42A 3GS0A 4WW1B 2PCFB 3MLTA 1RU9L 4XRCB 4ZS6D 4F1ZA 4JFTA 4BDVB 4NQTA 1G7IA 3V6FA 3HHSB 1SVZA 1H3TA 1U92A 3ULVD 1SLWA 2BPBA 4WKZB 1H6TA 2KLTA 3BDYL 1RJZB 1CR9H 1CFSA 5DJAB 3KS0H 1YNKH 3J8F7 4M4RB 43CAA 2EUXA 3BRFA 1A7QL 3ZE2B 5DD6B 4AIOA 3VD5A 1YDPA 4WWOA 3DMMB 1CL7H 5GSVA 1X4XA 3RY6A 3SO5A 4GMTL 3ARFA 3AG3B 5FA3A 4WU5A 4P3CH 3MLRH 1U93A 4L4TA 3BP4B 2ITDB 2Z31A 3AUVA 2WQVA 5D7JA 2B8OT 1P7KA 4L2YA 5LDUA 1ANUA 3OR6A 2OJZL 2UZIL 3KNBA 5JIQA 2JIXD 5D70H 3MJ8B 4LDEB 1IZJA 3QJVB 4YHLH 2UV3A 4H4NA 3E80A 1LK3H 1R33A 1Y0LA 5JQ6L 4XAWL 5D7IF 3REWB 3DX8B 4G5AA 4BSVB 4G43B 4H40A 4CGTA 2FIKB 3GGWB 3P0VL 3HPJB 4LQ1A 4YHPB 5LG1A 2X3BA 3AAZA 3QI9C 4XN9A 4M93C 3SGDI 4LCWB 5D7LE 1OSYA 2HT2C 5ICZB 3H9SE 1MCLA 1GGCH 2FD6L 1IAKB 2XN9B 1FG2A 3QORB 2PWDA 3QUYB 4IJTA 5CWSA 3K91A 2AJZB 1XGUA 1A6TA 2IDCA 4U6YA 1FFPA 5HGBA 4GEIA 3L4TA 1X44A 4OJDH 2OQJB 4YDJB 5HI5C 5FGSA 1ZANH 3PABB 1VCBC 3TBVB 5FUCE 4G80A 3U0TA 3GI8H 4TOYH 4JM4L 5MEPA 3ILEA 1XMEB 4XPAH 2P45B 4WVRA 3DARA 3SY0A 3PWJA 1I1FB 3CDZA 2BWQA 2VW6A 3MVSA 3KHOA 4IKNA 4DPBX 1AD9B 1YNKL 2F08A 2LW3A 3C09B 4G1MB 4JFPB 4N2FA 4PJBA 3SGJC 1N6QH 1MCBA 2GTQA 3II2A 2ZKYA 2EVIA 3KDMB 3GJEB 4M5TA 2IDUA 3FSOA 3GDCA 3HKZA 4FFTA 4DZBB 1CBVL 2A4EA 4GFTB 4R4NC 2FJHB 2NXYB 4NKQB 4OLYH 1G84A 2ZWLT 4EXKA 4U1NB 3MU3A 3FT3B 4PVNA 2YOCA 1WS7A 3S2AA 3HG2A 3MZTA 2Y9RT 4YHLL 1GRWA 4QIRA 2F53D 3V4LA 3CHOA 1PKOA 4ALAC 5GS0D 3MGOA 4PV8A 3MLVL 1OSEA 1AKJB 1MIML 1ODAA 4H5SB 4IKKA 4AJVA 4BGDA 2NY3C 1OGPA 4GMSL 2HTLC 3UZEC 4XCFH 5I6KA 4V2BA 2MCG1 1YECL 5DD1L 2WVSA 3NJJA 2XA3A 3LN9A 2QFRA 4OJEH 4EOWH 3P73A 2ODIA 1J1PH 2V3DA 4HAFA 5F72S 5FWQA 1X3DA 1ZGLP 2IAAC 1OE3A 5TJWK 1B0RB 3DBSA 3KGRA 4X0KB 4K7PX 5IM7B 1ZANL 4MJHA 5D7LB 4HLEA 3WLWC 3MRJB 4HISA 3FBKA 1OW0C 3LYRA 4L8SC 4UAHA 4XN1A 3NIDB 4YEFA 3N3EA 3HA0A 1AQ8A 1BREA 3I6SA 3TEXA 3VVWA 5B3NA 4U1IB 3TN0B 3T6WA 1A7BA 4CGUB 2YD4A 2Z93A 1YMHA 4ZODA 4EIGB 4L9LA 3LZPA 4U3SB 5IBTH 1JPFA 5KSBF 5IHHA 3RAJH 2JSFA 4HFWB 3L2MA 3BPLB 3IBEA 2A9CA 4XOEA 5AB1A 1I8LC 3OKLA 5GGQL 3WS3B 1WAPA 3ARDC 2K7QA 3MUUA 3PG2A 2Y36H 1EPFA 3BD3A 2HMID 2GFBB 5E7FA 5E2JA 2DEWX 1OGSA 2YRLA 3RWCB 1LEIB 1QFUL 3NJVA 4KO5A 4YE0A 1ML0A 4QOKE 4XPTL 3EZJB 5FCUH 4ZQKA 2BRRH 2I5YH 4KUZH 2D3JA 1AGCA 4LNRB 1NIBA 1M56B 2DWTA 1C5CL 2XJKA 5IHZA 4XX1G 3K4ZA 4GW1A 8FABA 2A9DA 1DJSA 1SGKA 3MXWL 2I25N 2H6PA 2VSDA 2VDMH 1FAIH 4XCFL 2QEJA 2YPLD 2M26A 3OM3B 4YC2C 4N2AA 2ZD0A 4AYDC 4Z7OE 4DZ8B 1J1PL 2VDKB 1E30A 4KVPA 2XZAH 5EEZA 4ZX4A 4FQIL 5E8OA 3FCTB 4JFFE 3CDGB 4HS6A 4OR1A 2I07A 3A6CL 4P3WA 3OMAB 4JY4B 4C56A 1L6PA 5E8EB 4PW3A 2P46B 3A5VA 4Y5YA 2MTAA 4HUXA 4M43L 4MHHI 5CUSH 1QW9A 4DSYA 3QO1A 1M7XA 3AY2A 4M7LT 5I28A 2CJTA 1MCDA 5IBTL 1AYOA 2VWEC 3RAJL 2EIJB 3TCLA 4JK0D 3KBHE 3RG1C 1CLCA 1U9KA 4PBDA 3LRSB 3Q2VA 4NGHL 4DAGH 3NFNB 2PN5A 2EYSA 4X9HA 2Y1YA 2HFGH 3ARYA 3UPRB 4KC3B 5JHLL 1VDGA 4Y0GA 1H6UA 1UKTA 2FSEA 5FDWB 1I1RA 3UDWC 1CD1B 3PPEA 3FSVA 5I5MA 2I5YL 4OM0H 5I1EH 4OZIE 4HD9A 3UJIH 2XBDA 1CDYA 1JP5A 3R7RA 1YC7A 1UHVA 3VXMD 4ZPVB 1NGZB 3APMA 3NEOA 4OZ4B 5F96L 3A6OA 5EPMB 1WIPA 4JHAH 1NFDA 1PYWA 2DD8L 1P84J 4UM8A 2CGYA 3DRQA 4L0ZA 1J1OH 3GSVA 3VQ1C 2H7WA 1WGOA 4NQDA 4QI3A 5IMLA 4G6MH 2X89A 1OD7A 2XZAL 3HC0B 2P43B 1A25A 1WWAX 1QLFA 1X5YA 1D6EB 2FH8A 3IKCA 2K8MA 1DLFH 4HIHB 4UB0H 3FFCE 2Y5EA 4FFWC 2HT3C 4NO5B 4UUJB 2NUTB 1A9VA 3VFOA 5DSCB 4K5PA 1JWMA 5H35B 4FADA 4N2LA 5D2LA 2ZXQA 3QT2A 2E86A 3QUMA 4L8DB 4ZYKB 2D03L 4U6XA 2AVGA 4YFLF 5E24E 3OHXA 3UO8B 4YXLL 3DGGA 4P5TC 1RJCA 1UB6A 5MERA 4RNRB 4DAGL 3CC5A 4YDZA 5HD8C 1K5NA 4AY0A 35C8H 1AQMA 2A99A 5KANG 1GC1C 4HKXA 1TENA 5DEGA 4PJCE 1AHWB 1T5WB 1WICA 4P2OB 1E8XA 3C5ZC 3GJFA 2GC4C 3FONB 2XG4A 1WZLA 1SLUA 4Y5VA 1Y1UA 4XR8C 3ZL4H 4G9DB 2JLPA 1I7ZA 4OV6F 5I23A 3EDDA 3VRIA 4EVNA 4L4TD 4KKCC 3U1SL 2AJVL 2FQDA 2Z31D 5DRXA 4ODTH 1RVFH 4OZIB 1MCFA 3MOQA 1AXTH 3ESPA 2J73A 3L3DA 3BP5A 1UGNA 3K8MA 5C07A 4MAUH 5L2KB 1HIMH 4G6ML 1S9YB 2R27A 3FFOA 2EDDA 1HJCA 4KY1H 3RNKB 1FGVH 1DLFL 1S9XA 1UFGA 2OMZB 4PGEB 5FHBH 4TN9A 5JA9A 3ZZQA 4F92B 2VGLM 3CFQA 2ARJA 2BFVL 4CJ0A 1EEZA 3MA7B 3RIKA 2F1EA 4G6FD 4PRDB 2KZKA 5KVEE 1XT5A 3FFCB 3TNMB 1V7ML 2RR3A 3FO0H 2V2WA 3U46A 5JDSB 3IFNH 1H3PH 3VDAA 1TPXC 1NCNA 2P52A 4PJIA 4CA4A 2VTFA 1YLBB 1JZHA 1S7UB 1NDGA 1W9XA 1I8MA 3PYCA 2PNDA 2X70A 5DYOB 2FO4B 2ZUVA 3BHBA 2DJSA 1JWSA 35C8L 1BPLB 2XV6B 2ZKHH 3E1ZA 4L1DA 3ZE0B 2FBJH 4QRBA 1EXUA 1M71A 3D0LB 5J3HD 4HWBA 1OK0A 3S4SA 5DJZB 5ETUB 1FC1A 1A4KB 5C0BA 2AERT 2HAZA 4P23B 5EZJA 2OZ4H 4AZ8B 1SFHA 4WEMB 2W1NA 1T1ZA 1E5CA 4UM9A 3EJRA 1BBJA 4YHML 4N85A 3RWJA 2APBA 2MQGA 3VD2A 3DIVA 2NW3B 4CC4C 2IOIA 4A2MA 4I5BB 2XG5A 5CJXA 1TZIB 2EECA 1BZOA 5DD5H 3U6RB 5D1XA 5I9QB 1HIML 2GK2A 4I2XE 2DMBA 4KY1L 1FGVL 4AM0A 4LVNB 3OKMA 1Q9KA 2YJLA 3BZ5A 4LLDA 2NLJA 3KM2A 4LRIC 1LXMA 1UZ6E 4GG6A 4HUKB 1KENH 2L7EA 4RBPH 3DUUB 5DHVA 2XQYK 3ARGA 2R29H 3AMLA 5KTEL 1DBJH 3Q8FA 4FLRA 4KKBC 1SXBA 2HWZL 4M7LL 5EC2A 5LXGL 3QXAB 1MFEH 3Q2CA 2OMXB 3ZLQC 3U7WH 3HG1D 1MN4A 5IIEB 3WTUA 2GSIB 2VDKL 2WO2B 3OKEA 4AEEA 3IWUA 4BE5A 2CIKA 1T83C 4AMWA 2FAUA 5CF3A 1JMZA 2YPVH 2Y7LA 3RU8L 4Y19B 1N18A 3DYPA 3GSWA 1C8PA 3MNMA 2ZKHL 5BVPL 5LLIC 3ULUE 5E1AA 1RZIA 2BINA 3L9YA 3IN0A 1H0DB 2DN7A 4IGBD 5TF1L 3DKHA 1UZ8A 2R7EB 3DROA 3FU6A 3OD3A 3PJSB 4GRLA 5CLTA 1A6UH 1KYOK 2X9WA 2CBQA 3QIWA 4B7LA 2KDYA 2W0PA 2WZ5A 1NIEA 3SE8H 4OFYA 1UT1A 3WEXA 2XZQL 3KLLA 4WCYH 4NBXB 1H6FA 4JRXA 3W81A 4A6YB 1EEYB 2WBJA 3TCTA 3C2SA 5DRWB 3B6SB 4TSCH 4WJ5B 4BXVA 1OP9A 5HGHA 3A4FA 1T1WA 3QULA 2IO5A 3MRPB 3ZDWA 3HNTH 3K6SA 3GMRB 2PO6C 5AYUL 2WD0A 1ZSDA 3P1VA 3L3JB 3WAKA 3BOVA 2OW6A 1A14H 3D3VE 3KW7A 3IETA 5BXFA 2BIIA 1DQVA 2GYSA 1SMOA 3B43A 1VFAA 2OCCB 3CTTA 3I6GB 5F21B 3CXFA 5FC9A 4AIZA 2ITCA 3ZDYB 3WNMA 5FLVA 4I2XB 2A9NH 1KENL 3B56A 3WFBH 3RPKA 1MRFH 1QR1B 3ATAA 5KSBE 5L7XH 2JCCE 4IBLT 1NBZA 1F41A 4JFYB 3DO3A 1QFHA 1MFEL 1RUPH 4PY7A 3KBEA 2I24N 4NRXB 1RZ8B 2AGJL 4POUB 3RKDC 3EJSA 2Q0ZX 2ZQKA 1GXEA 2YPVL 2APFA 3L5IA 1NWOA 3L7FA 5GS2H 3VXSB 1W72A 4Z95L 4X80L 3CFBB 5LNGA 4OFVA 1MFAL 2YS4A 4Y2OA 1A6UL 2BOCB 4JO3H 4MNGA 2WAHA 2K6YA 5FX3A 4CVUA 1CO1A 2WUCL 3VO0A 4GBXB 3N85H 1R5IA 3L3IA 3VFSA 3N1FC 4GKOA 4WCYL 5SWZE 2ZX9A 2N56A 2UY6B 2XSKA 2YK1H 4L5FE 2JNZA 5LBSH 5GZND 3O9WC 2OAAA 3POHA 4IMKC 5C3TA 1W0WA 3MX0B 1JZJA 2QR0A 2BH0A 1G7LB 3LS4H 1IL1B 5CP7B 5C9KA 3W82A 4QHMA 5CN1A 2BCKA 1J48A 1TT6A 2AK1L 3NSXA 5DMKA 3VE0A 4GXUN 2B5IC 4S0HA 1KJVA 4XNBA 2XTLA 1BFSA 2BC4A 1A14L 1FPTH 4GP5B 1TTGA 2V17H 5HGGS 2WQ8A 3LEYL 2EIEA 3AITA 1MCCA 4AV4A 3HN8A 2WWMD 5H94A 3T8VA 2X4TA 3GSOB 3D3VB 2O5ZH 2C9SA 5EU4A 1F2XK 2A9NL 2EDKA 3WFBL 1X5MA 4GQ9H 4G5ZL 1A9BB 2UXGA 2YD9A 4IIQC 1T0OA 1MLCA 1WE5A 2HTKC 3LH2H 4OZHA 3C08H 4P99A 2XU9A 5EUKA 1RUPL 2OYPA 3T2LA 5T3ZD 2Q87A 4N87A 1AD0A 4XPBL 2JCCB 4FRWA 1OSZA 3SE3C 2PWEA 3EYOB 4OCWL 4QY8B 1INDH 2AXGB 3WNIA 4C83A 3VXUB 3MRKB 3TWYA 1INEH 4N90D 4AH2B 5D7KE 1MEXH 3LPOA 3IFPB 4YZFF 2EE9A 1UYWH 4CDGC 3KYNB 1E42A 4OCYH 3N44B 4KROB 4LCCB 4ZMTA 1I7RB 4A67A 1GOHA 1XIWA 4FQLH 3FKUS 1IM9A 2NRDA 2OMTA 4UF7C 4WW2B 3OQRA 3KDPB 5KVEH 2F68X 3MRGB 2MTPA 3VNZA 1P5VA 3DWTA 1RHHA 1G94A 1PLAA 2C9XA 2OKMA 2CHNA 4Y4KB 1IGIH 4K9JA 5SWZB 1UXSA 1YN7B 3SOTA 1F6AA 1PKQB 1ZHNB 1HHJA 2DICA 2HYMA 3FU7A 4PJXF 4RIRB 3KW8A 4UDUB 2WK2A 4WGVB 2J44A 3KLQA 5EZIH 2NW2B 2V17L 4BD4A 1OGTA 2HRGA 1Q9LB 5I1GL 1T5XB 4NN5C 3FB8A 1JPTL 1Y1DA 1D7DA 4APQA 5F0LB 4Q0XH 3G08A 3LV3B 3JVGC 1K8IB 3BSGA 2C3GA 4GQ9L 1R3HA 3OR7A 1UB5A 1QBML 4H8QA 3S36X 3TJHC 3RTQD 3TYFA 3TVMB 5B38A 1I31A 3SPGA 4PJEB 5FECB 4JMNA 5ACMA 4Z77B 1HFUA 1HOEA 1F3DH 4MHHG 2VXVH 1HSBA 3S3SA 5I1AB 2QT6A 3MBWB 2QTEA 4O2CB 4POYA 3ATDA 4OVUA 5E70A 4U4IA 3SDDC 1BLNA 3D39E 1R9FA 3DPDA 2L7QA 5JHAA 3RL2A 1IV8A 1UYWL 4OCYL 5GZOD 1XZWA 4XB7A 5GGSA 1FAKT 3BGMB 2WLYA 4FQLL 4AYEC 4UWQB 5ICYB 5IB4B 3VD3A 2ADYA 4UT6L 2R39A 5BQDA 4GIPD 5KVDL 1A6WH 3VD7A 3QWNA 4ZX3A 2YXVA 2WVTA 5C0ND 1N9PA 3F7VA 2Y22A 3MXVL 1P2CB 1KGCD 3NIFE 4IBTA 1MW0A 3TA4D 2D3LA 4GAYB 5DQJB 2AV1A 2CBPA 3FT2A 1LO3H 1DQML 5JOFB 2J6EA 3QIBA 2CM5A 1U33A 1XV8A 4XP5H 5SWQB 4FG2A 3QUYD 2DQGH 2EYRB 2WXQA 5KWYC 4A6YL 1RMFL 4XNDA 5K9QI 2GTZA 3PWPE 3RNQB 5C0DB 4N2IA 3O3AA 1A9EA 1ETZB 2NZIA 2FJFA 5H8DA 2BVQB 1EFXB 2VXTL 5BZZA 2FWLB 2HX7A 3DX9B 4QO1B 1E4KA 2R1WA 3V0DA 5ES4B 1YPZE 3MLXL 2QGCA 2Y1AA 4HU8A 1AQKH 3A47A 3M1OA 1BLIA 5A2KH 4QXGH 3OJMB 5MEOB 4MZIA 5IUCA 4M02A 3Q1SH 2VXVL 4GUPB 1YNTB 3VI3F 3D33A 5LUMA 3FBQA 4NLHA 3ETTA 4ZNEA 3LQZA 1RPKA 3SBWA 1F45A 5J0BA 4TQIA 2AMGA 2XWEA 4LKXA 1XF5B 1TKWA 5KBDA 1IAOB 3KPRA 2AEOA 3O4LA 4KTEH 3QI9B 4MNQB 1EO7A 2Z0UA 4GUQA 1OP5K 1K9TA 3DDGA 3MREA 1GGTA 3GMQB 4Y8DC 5EC1B 2F54E 2DYPD 2ZAHA 4IRZH 4DQOH 2APSA 3LPGA 1TCRA 2WLMA 3HMXA 4GW4B 2XACC 3ZYOA 1DE4A 2O6FA 3OXRA 1KB5A 2G9KA 2Q76B 4LMQE 3GHEL 5IMKA 3IS1X 4M8QA 3HKFA 3ULUL 5IHUL 1LNUB 3IJSB 3K46A 3NIFB 4TVPE 1K72A 1G4MA 4OZFB 4X7TB 3C60C 1U3JA 4FZ8L 3R1GH 4JM2C 4Q6IB 4QRPA 1JK9B 4RDQF 5D7LD 5FKAA 5IUSA 3D34A 4Z7WB 4WEBL 4CNIB 5JUEH 2A6KB 4X8JA 1MAMH 1IGJB 1WAAE 4M7KH 1FCCA 1USZA 2DLHA 5E2WL 6PCYA 5ACZB 2JK5B 3MLZH 4L5FH 4QWWC 4ZBJA 3TN0D 3ZRSA 4PLOB 5LBGA 1QUNA 1NCTA 1VFMA 3LEXA 4R0LB 3UPCA 3BGAA 3VXRE 4WTXA 1CLVA 1JFQH 3L8QA 2YBGA 5IF0B 1KJ3L 1AHMA 3Q1SL 4QRFA 2B9BA 2B1OA 2QVIA 3EFOA 5AVZB 1YPZB 3LKQB 4HS3A 1S5HB 1T66D 2Q7YA 4WHYH 4BWTA 3S0PA 1KGJA 4GAFB 1G7JB 4KXZH 4N0RA 4AYFB 3RX7A 3DRTA 4R9HA 4CW1A 2F9BT 5AW3B 4K8RH 1JD9A 3IFLH 3ZL1A 1IM3B 5DMJB 4ZD3L 2WY3B 5D2NA 3APCA 3P3UA 2K1MA 3HI1A 3LN5A 4DQOL 4HXBL 4IRZL 1B90A 2JB6A 3QEQE 4HW6A 5C6WH 1A2YA 5LG6A 3K8KA 1RJYB 3PREA 2A7BA 5I75C 5I16B 1YUKB 4LLQB 3CVHB 1QA9A 5DJ6A 1FSKC 3GZQA 5AVYB 2H0FA 2F54B 5F44A 1SZNA 3QG7H 1AZRA 2OXGA 1IGTA 2V2XA 2Z0BA 4X6EA 1QD0A 2ZX8A 1KCUH 2X5PA 4MBRA 5A7BA 1JSYA 1BF2A 2Y6SC 2ENJA 4J27A 3HB3C 2AJ3A 3BW9B 4AT6B 5LQBH 3V6ZB 2BXZA 3BP6A 3CBJB 1TQSA 3FQWA 4JZNB 4Z7UF 2J8HA 3IE4A 3GKZA 4NC1C 1CBJA 5CD5C 1I7TB 2XWTA 3ARDB 5DF0A 1JGUL 3F6JA 3MLZL 4UTCA 2BHZA 2QGEA 2JQZA 4WNJA 3QUHA 2BSDA 5L8JB 1BG1A 3F6IA 1X4YA 2XY2A 2XYBA 1KCBA 2VABA 3AABA 1JFQL 1WA2X 4J6RL 2W07A 3LCYA 3NA4A 4NUJA 3SKJH 2OSLA 4JY5H 3L6FA 2RALA 4CU7A 2BW5A 4KHTL 4HJJL 2VLJE 2Z8RA 3KPLA 3JWDL 1OP3K 3WE1A 1E4XI 2E7LC 1Q9WB 4X9GA 5H2BB 3TBYA 3APDA 3DX6B 4J1UB 4K8RL 1UEMA 4UQ3A 4GSQA 4M6AA 4NQSB 3KYOB 1ZLWK 5K1VA 2X4NA 3O6FA 1AI1H 3ABLB 1MREH 3D12B 4L1TA 1I1AC 4L37B 3P4MA 1C08B 4HUWA 3K80A 3TBBA 1PD0A 3KR3L 1E50A 3BUPA 3BRDA 3WKNA 1UXMA 3RX5A 4N9GA 1IM9D 1MHHB 1EMTL 3TNNB 1N2RB 1KLFA 3PWVB 1KCUL 4XMLL 3G5VA 1DBKH 4PJ8B 1ZAGA 1UXLA 4JFXB 5C3IA 5LQBL 1MHEA 5A6IA 5E8PB 3EOBA 5JLZB 1IC0A 1Q0XH 1PTZA 4AVKA 4DEPC 1JNHA 3QEHA 2GK0A 3VCLA 4NZDA 4POZD 3MLYH 4OFIA 1H8NA 4WF7A 1CJYA 4FQJH 5EDSA 4QRTA 2C9AA 3K0WA 5IFHL 1FH5H 2XVBA 1GGUA 2ZSVB 4KH9A 3X1GA 4MQTB 2HFTA 2VIRA 4JFZH 5EULV 4OZFH 2CUAA 2KZ1B 4O02B 3KPQB 4YZFE 5DLLA 1F97A 3K2IA 4ATWA 4OGYH 3CFMA 3GHPA 1KCWA 3ZTJH 4WI3A 2JJSC 1MPAL 2PTTB 3EYVB 4OT1H 1F00I 4HJGB 5I30H 2BLFA 3IU4L 1U3NA 4S1SL 4BK8A 4X6DA 4J8QA 1IMHC 4P2OD 1J9TA 2YD5A 5I8CB 4ZZKA 1BVLB 4YSQA 3WHE0 4J3TA 3E1F1 4IBSA 2LGNA 1GOFA 4PJXE 5ESVB 5F3HB 2WAQA 1QVOA 4F5CA 2DJUA 1MJ7H 4YHYC 3OLIA 3RVUC 1DN0B 1JK8B 3RILA 4IHOA 5E4EB 1L7IH 4F9PC 2AEQH 3BD5A 2ZXDA 4LASH 1TITA 4CMMA 2B0SH 1DBKL 1AXSA 1FZJB 4FXGB 5BQ7A 5L2KD 4D0CA 1NCCH 5A3IC 4OTXL 3VRLE 2Y7NA 1IARB 5IEKA 4LESA 4LLUB 4X5WA 1LP9B 3QIBD 4PGBB 3PL6C 1ETB1 4WV1C 1CFVL 1D9KC 2J2ZB 3CK0L 3HZYA 3LRLA 5BRQA 3WSQH 4HKBA 3BAEL 2DKUA 3FFCD 5B4MD 1JERA 3QZWG 1UD5A 3MCKB 3GXUB 1SVCP 2ZX6A 2FLRT 5DO2D 1GL4B 3HMWL 3O41A 3KPTA 1D5MB 3UGEA 2VDLB 1A3LH 4N25A 4YZWA 4NRZA 3NFPB 3T0EE 1S7QA 2ENSA 4TVPH 4PGCB 2DB8A 1J88A 3IRPX 5DS1A 4H20H 3BRGC 2EH8H 3IPBA 3CVDA 4P2QA 4N3TA 3MNZB 4OCLC 1T3FB 3B2PA 4P23D 1ILUA 3IGAB 4MX7A 4HBCH 4U1JA 3DHPA 3UTPE 5FF6A 1T2XA 4NFDA 2XA8H 3F2LA 2J1ZA 4PRIE 3KPRD 3MUGB 4XBMA 4NYLA 5AW0B 15C8H 1P5UC 2TAAA 5JORB 2LAAA 4AEHH 3OAZK 5KOVC 1MNUH 1OB1B 1L7IL 1R3IH 3FB6B 5KW9H 1CS6A 4MA1C 5TDPB 3K1KC 3OAWA 3UTQB 3L5JA 4WQOA 1OKEA 3ULAB 4JPWL 4BINA 1OPGH 4OJYA 3VSUA 3NN8A 1EAQA 2VMEA 2OYLA 5KSUA 5KAQF 4YK4B 3EUDA 4DEWA 3FW6A 1HHHA 2MMXA 1YAIA 4G7SB 3CVHL 1T89A 4KAQL 4FLSA 4XXWA 1HI6A 4XP9L 4H25B 2EJ1A 2B08A 3MNVB 1CL7I 4OSUL 5AYQA 1Q0YL 3BZEB 1UWYA 3AU1B 4UCFA 2AABL 4HDIB 2LFGA 5AVRB 5I5IA 2OV0A 4Y7MA 3S96A 2WWKT 4LQFH 1XL4A 4G71B 1U8QB 1NCGA 4MS6A 3WIAA 4FNQA 1PY0A 3B2XA 5J6GA 1ACXA 2X88A 5DEJA 5C7XH 1FFQA 4Y19D 5KSAD 1YHPA 1CZ8H 4TVPL 1VFBA 2DEYX 1BEXA 3RUGA 3KVDD 4LVOC 4LCUB 2EYTB 1DSWA 4GJTB 4H20L 2EH8L 1YEHL 1A64A 1XQ4A 4GP4B 4KK8D 4F7TA 3T0EB 5JZ7C 2ZF8A 3S8FB 3D2UA 4JO4L 3HIZA 3VXOB 5ADPH 5IMOB 3UEQA 1DDTA 2BRQA 3BQUB 1U3ZA 4IU2B 3E8UH 4O02H 1MJJB 1LD9A 15C8L 2BY1A 1O5DT 4MD5A 2MHAB 2Z4TA 3K81A 3EDEA 2HG5B 2NUPA 1MNUL 3TCXA 3FOLA 5GRXG 5BCAA 4LHJB 1F4WH 5E1HB 3RWIB 1W8NA 2DDQH 3T09A 3JTTA 2MPVA 1XCQB 3BN9D 3CPLA 1OPGL 4WFHE 3CVBA 3ZKND 3ZT5A 3HCVA 1E28B 4NKDB 4W1TA 5HY9B 4XNMB 4PS3A 1DSYA 2QSCH 4NT6A 4RDBA 3BSZL 3EO0A 2G2RA 2RJMA 2A3TA 4NO0B 3A67H 4XVSH 5E9AA 4WFFE 1SDDB 4MZ3A 4L3EA 5EIIB 4X6CA 5K1JA 3CZEA 5K9QG 4GH7B 2O5YH 2O6DA 3CBRA 4QLWA 5JNYB 4HHGA 2B16A 3UTSA 2JE8A 4LQFL 1G1CA 2WXIA 4FJZA 4JUSA 5CZXC 2OJ1A 3ZKMD 1MCJA 2WZ6A 2E9WA 2KLRA 3D8MA 5HHNA 4XN7A 1KTJA 3QCTH 3QARA 1WC7A 3VXSD 2WOYA 4PJGE 4MBOA 1NKGA 4RFOH 5F9JA 1XGYL 5ENWA 4XOBA 3RJQB 4PLJD 3TH4T 4D9LH 4DKFH 4S1DC 1JF5A 3ULUD 4GBXD 3VFNA 4L8SA 1XGRA 5GRZA 3KLDA 5J56B 1GAFL 4QRRE 1K8DA 4O02L 4UDTB 5DHYA 1N64H 3QS3A 5DURD 3MUZ1 1T03H 1CVSC 3JV4B 3MRNA 2Y5TB 4LF3A 1X5XA 4OCMC 1F4WL 1NJ9A 3HS9A 4V1DE 1L9SA 1TG8A 2DDQL 3KH3A 4PP1C 4KRMB 5D7SH 2XBZA 1FCGA 4Z7UE 5ANMB 5J11C 1Q1PA 4P2RD 2Q8BL 4IKLA 1E4XL 2HJLA 3GBEA 4MAYA 3W3BA 2O26U 5TGBA 4A7GF 4YDVA 4F27A 4X8CA 4XVSL 5B39A 4RETB 2F7IA 4ZOAA 4ZUUB 4BSJA 4CUCA 4ZW5A 3H7BA 4FS0A 2GITA 2JVUA 1K3IA 5EN3A 3LIZL 5D1ZC 5SWSA 2XQBL 3L95B 5KBMA 3JT0A 3CLWA 5ISZD 4AVHA 2YEZA 3OJ2C 9PCYA 1E9PA 2PW2A 3MTXA 2DQUH 3MNWB 2Q20A 4GAJH 4NZRL 5F7FA 3V52L 3CXHJ 5IP4A 1VLXA 5LGJB 1ETJA 4HLZG 4QJ4B 2N7BA 4Z3TA 5CKAA 4KUCD 3VYNA 5JW5B 4K3EH 4UZUA 3MRFB 4R97C 3QCTL 2H8PB 2YZ1A 2X4RA 2ZCLL 4O51B 3G6AB 4XO8A 1PAZA 3QUGA 4J4PC 5FM4A 1G6RH 5EO0A 5JPNA 4AXWB 3WKYA 1HXMA 2FJSA 4D9LL 4F20A 2R56L 4H0LC 5J13B 5ERWA 4UMGA 4F8TA 4PJGB 2B5IB 4XGZB 3FFDA 3BISA 4KKAC 4ONGH 1OB0A 3QNYB 4RFNB 2Y07L 1U36A 4AYGA 4G11A 2VDLL 3RWFB 2CQVA 4ONOA 3R0MA 1J9QA 4MB4A 5SWZD 3OAUH 4QRRB 2ZOLA 2NR6A 5C8JA 4NP9A 1GS7A 4AYSA 3PQYE 4IIQB 3PU7A 1P4IL 4N86A 3WN6A 4G7VH 3VFRB 4V1DB 3GS7A 3IMRA 2R83A 1W0VB 1X9LA 4OLEA 1DVTA 1TYEB 3KCPA 1I3VA 4ODSH 1HE8A 3H42H 1ZVSA 3UDWA 1KT2B 3ZHDA 3CAFA 1CFNB 1KG0B 1T1YA 5FOBA 1KTLA 3D85A 4W6WB 2OX5B 3BFQG 4N2BA 3W56A 1VGEL 1KPRB 4O4YH 3TVMD 3TTYA 1BXUA 1LTXA 1NSNH 4NFCA 3NSYA 5C2BL 1LO2H 1NGYB 1CICC 3B9KA 4I0PB 2WSDA 2VDNB 3UYRH 3WJJC 2F7OA 4B3EA 1Z9PA 2ED7A 1O6SA 3ML9A 2C3HA 5I8OH 5AL0A 4B9JA 1C12B 2H47C 4LSUH 3ZSSA 4TNEA 1Y07A 3IDGB 4W68A 4FCHA 2HKAA 3PV7A 5E94A 3TO2B 2FX9H 4LCYB 3RX8A 4K3JL 2I27N 3VGGA 2E3VA 3FHAA 1DLHB 4JVPA 5I1DA 4OF3A 3RGVC 1G7MB 1MIEL 4ONGL 4KQ4H 2X7LA 2CGZA 4P5MA 5D4QA 5B7EA 4P2QD 5GGRB 1S78C 4UV4H 3L4XA 4BFKA 2AF2A 1A47A 1NCIA 5DMGD 5HGAB 1U8PA 4JFOB 4X2UA 3IF1A 4KO6A 4KFMA 5L8KB 4F8QA 1TZHA 4G7VL 4UNIA 4LCVA 4HCRA 1HXYA 1ED3B 1VGKA 5GGTL 3VWKA 3H42L 4PRNA 3QDGB 4J8RA 5K9KA 4D8PA 1EFXD 3P4LA 2OTWA 5IVZA 4FX5A 2QKSA 3UL4A 1VA9A 5LDSA 4P05A 4JKLA 4O4YL 1QNZL 1Q38A 4AJYV 2XDHA 4UTAL 4KK5C 1LO2L 2PKDA 1M2VA 1ITCA 2X1OA 1LO5A 2J25A 3UYRL 1T21A 5HYJA 4Z5RA 2N7SA 3ROLB 3LQAH 1NC2A 5DFVC 5I8OL 2P5WA 4LSUL 4XMVA 3PUUA 3HHMA 3ULSA 4OVVA 4F9LA 3EGXA 3WNOA 2DQCL 3LVTA 3EG9B 5HYSB 3V0JA 4XP6L 4B53A 5A6LA 5KS9E 3ZIYA 2P8MA 1DO6A 1N5AB 4UQBA 1UJTA 3QI9D 1HHGA 4LEOA 4MNQD 3ZO9A 3TF4A 4NX0A 2HT2D 5AAWC 2DZEA 2OMVB 3RWGA 4W9DC 3UZVA 1R5VB 4L4VE 1CFQA 5AVQB 3DTXA 5HI5D 4WUUE 3IJHB 4UV4L 5CJQL 5TQ2H 2CU9A 3IGFA 1DBAL 3D2UD 3NH7H 3DVNB 4FQXB 4I77H 4QLRA 4BK5A 2R1YB 4D2NA 1DQQB 1MVUA 2DQMA 4E5XA 1LILA 3BUYA 4PJFE 4GW5A 2EIZA 2ZYHA 4EDXA 2NSQA 2J8UA 4DK3A 4WI7A 4E5XG 1HCFX 2WQUA 5MP6H 1TVHB 3QRGH 5IQ9B 1REIA 1BM3H 4ZW7A 3OZKA 4J12A 1Z7JA 2OL3A 2PP8A 5DJ8B 4ANUA 5JHBA 4ZFGH 1HH6A 3N06B 4XCYB 4XWGH 2EIKB 4KFZC 3PF2A 3IJYA 2A0LC 3SDCB 4Q52A 4R4ND 1E8YA 2QLYA 4MKTA 1O9VA 3TZVA 4I18C 1NIFA 4NWTH 3U36A 2RGSA 4ZUSA 5L88H 3BN3B 4H44C 4L3ED 4AZUA 4K2UH 1P4BH 1RJLA 1T20B 5IVXE 4MJJA 3BESR 1HQRB 2NY6C 5H37H 1J0KA 4N4YB 3VGHA 3BT2H 2WIIA 1HQ4B 3ZY7A 4HSQA 4QT5A 3UTSD 3AXLB 2EE0A 2QHLA 2XV3A 2J43A 1KN4L 3J07A 3BKJH 3VM5A 2AKRA 4ANXA 5FA4B 4FAAB 1SDYA 2DTSA 1IM3D 2GUYA 2NY3D 3T8MA 3KL5A 3FYEB 4O58L 2R0LH 4GAGH 4LRIA 5J57B 5KS9B 3KPSE 1MG3C 2G4GA 4PREB 2IXQA 3VFGL 3VI4F 5CP3A 4CC1A 4HGWB 5I6XB 4L1HA 1BW8A 3WTYA 3WLWD 4FFZA 3T4YB 1J05A 5D96B 1HDMA 2C7FA 1GW0A 1L5GA 2O1AA 3O45A 2VXSH 3ZZSA 4P57B 4LSQH 1T83A 4HJIA 4WZ9A 1KJ2B 4F15C 4L3CB 1SN2A 3R4RA 2NCEA 3DSNA 3RZCA 3S5LB 2R0ZL 1PG7H 1BM3L 4C4BA 2H6OA 4PJFB 1IGMH 1U6AH 3LZFH 1A1OB 5EIIG 3QC5X 4JZOB 3P54A 4NC0B 4S0TD 1KEMH 1DEEB 3V0FA 3CHXA 3DBXB 3ARDD 4O00A 4BRJA 4TUJA 2UZXA 4XNYH 3UJJL 4NWTL 2VITA 1NOLA 4GT0A 4HPYH 1T80A 3QH3A 4NOBA 4K2UL 4WK2B 4Y16C 5EU7C 5A7EA 5GJSH 3F12B 1AY1H 1D5IH 1FVCA 4X83A 1BZ7A 2BMKB 2FSDA 5FM5O 1JV2B 3EIFA 4I1PA 3GSUA 4Z7NB 3ZT7A 3W5NA 5IVXB 1BD2A 2PO6A 4R7NB 1ZVNA 1TJMA 4NC2B 1DVFB 2GUOB 3HI6L 1U8NA 3E6HA 4KNQA 2GJ6A 2BP8B 1FJ1A 3NSFA 5CEYA 1CGXA 1T6BX 1CDCA 4F7EA 2VDNL 2L4OA 4GRMA 1QFOA 1ZS8B 3RBSA 4MTMA 3HB3B 5GHWH 3EADA 5ADOH 1HT6A 4YLQT 2VXSL 1EHKB 3KPSB 4ELMB 1SYSA 3STLA 2EO1A 4LSQL 3HOGA 4OKVA 1F1AA 2NDGA 1PG7L 2OR9L 2CLRA 2H2SD 3PHQB 1U6AL 5EO1A 3WENA 1LLAA 1TOXA 4NQVB 3VG0L 2CO3A 3O2DA 4OCXL 2J7LA 3RWEA 4RZCA 4XVTH 5ANHA 4F8OA 3DVFA 4OFKA 4ONHB 3ELAT 1YN6B 4YBLC 3S34H 3JV6A 1IAIM 1T0MA 1N67A 4TRPL 3O9WA 1AY1L 1D5IL 3ESNA 5JIMA 1BVOA 3D85D 3FK3A 1OSPL 4JPKH 4MRCA 3RVTC 1S9WB 1ZHLA 4LLVB 3APFA 1QFWM 1QEWB 3BKCL 3OXSB 5ALBL 1QRNE 2ESVE 1VKXA 1FZKA 3T0XA 3UBGA 2IAMA 4LU5H 5EMYA 4DVRH 4TSBH 5JA8B 4DNLA 1G9NC 4Y4HA 4TTDC 3ARBB 1BIIA 3M7OA 4GQQA 1H9VA 1U58A 2Q5BA 4JN2B 4XO9A 3PP4H 3MRBB 5HHQA 2DTMH 4PRAB 4JKKA 2HT3D 3LSOA 4E0RA 4O2FA 2EE2A 3AGVA 2OJEB 1JRHH 4XC3L 3SE3A 3QCVH 3WKMH 4ZS7H 4X99A 1WITA 4EZLA 3EBIA 4LEXH 4QHNB 1AZUA 3FF8A 3GMNB 3UAJC 1KCRH 1JGEB 2CJUL 4E42A 2EZ0C 4P5TD 3FQUA 5K9OB 5E9DE 3ZE1B 3OLDA 4N2CA 1U3HC 1JHTB 3ML8A 5HD8D 1HYRC 3MACH 4Q4IA 4H2CA 4XVTL 5CCGE 2DLGA 3JYBA 3QPXL 4XN4A 1E65A 3QSKB 3WL9B 5T5NF 2OSYA 4BH8B 5DUPH 5EEUA 1QQDA 1LEKB 4R7DB 1PU0A 3ZHKA 3KCWA 4XVOA 3KXFD 4LKCA 2CLVB 1EO5A 3C5ZD 5C09E 3GYRA 4NWUL 5J06A 2V2TB 2ZPKH 4KNSA 4XP1H 3LN4A 1NH6A 2HVKB 4C59B 3B3BA 3FB5A 5DHEA 1ZLVK 2FB4L 3FOMB 4KKCD 3DMMA 3NQKA 4A7QA 4PLKC 5BOJA 4RX4D 2KUTA 3MYJB 4LU5L 3WI9A 4TSBL 4Z7AA 4XODA 4HCIA 2CPUA 1NC4A 1KIUB 3U1QA 4KJWC 3BP4A 3O0LA 4MAZA 1QRNB 1OCZB 2ESVB 2K6WA 2JV6A 1DUZA 2QPSA 3E3QC 2RFXB 2YN3A 4NNXA 3PL6B 3GSXB 3F3HA 1EAJA 3GGWA 1JRHL 3MRQA 4YHPA 4ZW6A 2D73A 3WKML 5DI8A 5J1TC 1EJ8A 4KOCA 5E99L 3F01A 4J7RA 4LCWA 3SDDA 1QWNA 2AXJA 4E41E 2HFEB 3QORA 1KCRL 4U6HA 2PCYA 1E9QA 2JMRA 5DJCB 4EQ2A 1M7DB 5C08A 4K9EH 1TQUA 4ZSOE 1HWGB 3C5JA 3PABA 3EDJA 3TBVA 4EIUA 1Z5YD 4QTFA 3Q2LA 1WJ3A 2I7OA 1KJ2L 4BQ9A 4FOMA 1RP8A 4AYBA 1PZCA 5EZOL 2D0FA 2DWDA 5CFAA 1S7TB 4M8UA 5E1IA 2CK2A 4XNXL 4KBPA 5IKCB 2ZPKL 4GLRH 4H0IA 4RMUA 4XP1L 4P4RA 1AD9A 2R23A 4CDHA 4JFPA 5HYSG 4EQ3A 1NLDH 4WO4B 5FUZH 2BNRB 2RA1A 2NY4B 2I9TA 2PYEE 5C09B 2ZKMX 1ZPLA 1OAUH 3QISA 4RMSA 3SJVB 3KLHC 2EC8A 1SHSA 3QCUL 2XTJC 4M5SA 1XR9A 2R9HC 4ZUWB 1ZHKA 2Z35A 3LKPA 1RP9A 4CVXA 1B6UA 4JRWA 4KJQC 1U41A 5JW4N 2Z64C 1X5AA 2WBKA 3FT3A 4LGSB 4ETQB 3CJJA 3ARXA 4QRQB 1T2QH 2D8KA 5CZRA 1N59A 1P4LA 4C58B 4UQEA 1SMAA 1IUZA 3DTUB 4KZDH 4P9HH 4WTWA 5DUMH 3JT2A 1UM5L 1AKJA 5I0XA 1OQXA 1HS6A 4HJ0C 4PB9H 2C3VA 1BJ1J 2OYKA 3T6QC 4KKBD 5C0CB 4U7MA 1CFTB 5HPOA 1ZGLM 4ZFOB 2WC7A 2G60H 4JQIH 1BQUA 1ES0B 4GSUA 4X50A 4NO0D 2IPTH 4K5MA 4K9EL 2NZ9C 4U05A 3PNRB 4ZMAT 3H9SA 1HC1A 2P48B 5KOMC 5JR1L 4OB5H 4BHUA 2EXTA 2ZX5A 3EF7A 2ZJSL 3HE6A 2MCMA 3EAKA 3PE9A 1MRCH 4ZSOB 3N1PC 1TVDA 4BV1A 3L48A 4OLXH 1Z9OA 1ZLUK 1UGKA 3NUKA 3E7JA 5E00B 5JW4R 3B1UA 3HE7C 4ETYA 4L3AA 4R5TA 3TA3C 5IVNA 2FX8H 4JHWH 1JWUB 3WS3A 2FO8A 4F7CB 3MV7E 5I1KH 4XBPB 1OAUL 4PRPB 2RHEA 1I9IH 2TSAA 1OCOB 4ZDHB 4BZ1H 4ES8A 2B59B 2IALA 4JM2A 3A21A 1D5RA 3VI4E 1TEYA 2PO6D 5EN2A 4JFHE 4LSDA 4PCSA 2J6WA 1N10A 1Q4NX 1HCVA 1JXGA 5E2UH 1K6QL 3MUHL 5D1ZI 5FGCB 4H8WC 1YYMH 5D4IA 2AEPL 5HHOA 3L5XH 2ZOTA 2F7PA 2HT4C 4N26A 5ELIA 2BJML 4OGXL 2VUYA 3O6ML 3D51A 3QR0A 1DCEA 4U7KA 3WTSA 3INOA 1SJVA 3ZO0A 4ERSL 4LSTH 1XL6A 2EAEA 5D71L 1UEYA 3LZRA 2G60L 5KYXB 1FFNA 3FQRA 1DUYA 4QXUH 3IDXH 4NZJA 1ZEAH 4N8CL 4XCEB 3FCTA 3VFWA 1S7XB 3M1CA 1ZJBA 2YEQA 2HN7A 2MQ3A 2WKOA 3WAJA 4XMXA 4IOSD 4RMQA 3FU3A 1QFPA 2NX5E 1MRCL 3NQIA 1YNLL 3B2DC 4BUHA 3LIUA 2K8QA 4BKTC 4Y2DC 4FG6C 4YIQA 3BWAB 3P3SA 1KPVA 4JREB 1OZUA 4NZUL 5F6HJ 2OZ4A 4HZLA 1RZ7L 5JHMA 3OMNB 5MHSD 2GABA 2O72A 1ZRUA 2AEIT 2FX8L 3MBEC 1AO7E 2CBMA 3LRSA 4FXKC 3O9WD 5I1KL 1BVNP 2BW4A 1WUNT 3KJ6H 2YQGA 4QAMB 5IB5B 2WLNA 1LHZA 1KXTA 3HRZC 4XB8A 3DJRA 3MV7B 4ZAKC 3V0AC 2X1PA 1CD1A 3FUFA 3NFSH 2VXUH 5J11B 5E2UL 1OO2A 1MFCH 3OVUB 5IV2B 4K7PH 4Z7VF 5T3XD 4QOKA 3HRPA 2WKLA 3L5XL 5AOLA 3IMSA 3V9EA 4QRRD 4ZPVA 1NGZA 2LVEA 3AMKA 4F91B 3DX1A 4I48A 4PSPA 5EPMA 2V0AA 2R29A 4NN6B 5GISL 2HTKD 3QWRD 3OC8A 4QHKJ 1GZQB 2BNQD 2FRGP 4LSTL 4ZFZB 3L1EA 2G5UA 3LKOA 4QXUL 1VADB 3IDXL 1A6AA 2KH2B 1ZEAL 4IKIA 4LLWB 2OM5A 4TUOB 5KG9A 1D6EA 3MV9E 3ZMNA 1L0XA 1F42A 2Q86A 4O5LL 1UH3A 2HVJB 2WLLA 1I1AA 2EACA 5T33L 2P7TB 1XX9C 4JFFA 2F8OA 1WZAA 3KWWB 2EUWA 4M5YH 1KTKE 1M3IA 2NX5B 2VMFA 3QEGH 3P2DA 3QO0B 5EDXA 4P4KB 2A6IB 4S2SB 3L5WB 3MOBH 5FYJE 3GSNB 5DQDL 2VSCA 4MDJB 4Z78B 3US1A 2DM7A 2FH6A 1U8MB 3KBPA 1JFHA 4JO5A 4DN3H 1AO7B 1E5AA 5BVJB 3IVKB 4LCIH 2IPKB 3NABH 4DGYL 4WI0B 3MA9H 1ZCRA 3UOAB 2VXUL 3B3IB 3V2AR 5B22A 3CGTA 1PS3A 1Z5LA 4MD4B 4J3BA 5TDOA 1XXFC 4UNTA 1T7XA 1E5UI 3PJLA 3NZHH 4K7PL 1YJDL 2C3XA 2Y06L 2VAJA 4U3CA 5T1MA 5L6YH 4YWGH 3S97C 1G7PB 2L0DA 1OARH 3GMLB 5L0QB 2ORBL 4TSAL 2DOCA 5A2CA 2WINA 5E2TH 4FQ2L 1CICB 1MZYA 1HSAA 4N24A 5DMIH 2BERA 1U30A 1TU2A 4IBQA 3VXQA 1EJOL 3FYIB 4OJFH 2KBGA 3RI5K 1IZKA 1U95A 2UX6A 3QDGD 4PTTA 3P9WB 4Q2ZA 3SDDD 2AJSL 3BD4A 1OAYH 2YAOA 3QQDA 1JZ7A 4HWZA 1O7SA 2AJUL 3GBML 3DYOA 4OIAA 3MV9B 4XTRC 5C08D 1A22B 3TNMA 1F18A 4G6JL 3PHAA 4R84A 2R2CA 4M5YL 1T4WA 3EDKA 3LNIA 4MDRA 4ZFOL 2RAMA 3L3HB 4YX2L 4HC1L 1EV2E 1CF8L 4FNTA 4KX9A 1S7UA 3HVDA 4DKDC 1ZLDA 5LBSA 4Q6KA 4ISVB 5DYOA 2EKSA 2PYFB 3P4NB 1F4YL 4H26A 3OB0K 3T08A 4DN3L 2EDFA 1YYCA 4ODVH 4PJ5B 3NABL 3IJEB 1BAGA 2AITA 3WNJA 3MA9L 4D9RE 3QUZB 4WV1A 4F37K 1D9KA 2G3XA 2WMPB 2X6MA 2ICWI 4HKJB 4MXWL 4DN4H 3CZFA 3QEUA 1M7IA 3L08A 4PJCA 4MQ7A 4TNGA 5BV7B 4HULB 5L6YL 5HHXH 3U2SA 5DWUL 5JIPA 2GT9B 1OARL 4EI6B 3MV8E 4IRJB 5D1QE 4L8CA 2PTUA 1WIOA 3CSYA 1O7DE 1CE6A 3OPZL 5HVWA 3ESMA 3GMPA 3WFEH 1TJGH 2VR7A 4BKLB 4LBEA 4TQ8A 3IDIB 4MA7L 3D05A 1LM8V 3JV0A 4HIPA 2PW1A 3SB3A 4ZUTB 4PJDA 2Q1EA 2Z91B 3OG6B 1MUJA 3RPIB 3QQ3A 5I17A 1S3KH 4RFEB 5IFAH 3RURA 4ODXA 1P5UA 3ECBA 4K7FB 4LSVH 4PW9A 4BFFA 2XZCH 2XT1B 3DV4A 5GRYA 2GY5A 4F3FB 1IEBB 4HEPG 2V9QA 1NFIA 3IGLA 4BZ2A 2F58L 2O6CA 2PLTA 1OHZA 3QDJA 3F58H 3U4EB 1I8KA 2H1LM 3N1GC 4LL9A 1XHHA 3N42F 3TPUA 1KJMA 1VFUA 5F93C 3OLGA 4ODVL 2CAKA 4E9WA 4O2EB 1Z9LA 4X7SH 3SY6A 1I75A 3F65A 1VJSA 4MA3B 1IGFH 5E8DL 3QUXB 2BSTB 4P07A 4YDKH 4DN4L 5BS0E 4TVUA 1C1EL 5E03A 3UTTE 3C60D 2E6QA 1E5YA 5IG7B 1Q9OB 2F1AA 3ZIMA 2G0KA 4PTUB 4DOHE 3GSNH 4R7VA 4X6FB 4JRLA 5D7IA 5HHXL 2ZOKA 3TO4A 5J12C 3KLSA 2ICWB 4QWWD 1LE5B 1EA9C 4KI5F 1J87A 1YUHA 3LB6C 1UKSA 2Y3NA 4K23H 3WFCL 3EBGA 4R4FH 3O8XA 4NHCL 5HHOD 4JGUA 5BRZE 1TSHA 4Y88A 3ZJAA 2H9GA 5CD3B 3SODB 5HYQA 3B2VH 5D1QB 3GXMA 3EJYC 5AD0B 4AQZA 5GRUH 2VJ8A 2VXQL 3B9VA 3L2LA 4X5RA 5JW4Q 3AG2B 4NKOB 1FG9C 3LTVA 5GS1A 4I2XA 1S3KL 2DQTH 3LOWA 2VLMD 3TIEB 4HLJA 3NCWA 5I6NA 1MW2A 3VXNA 1QR1A 1SM3H 5I1CH 4JFYA 1D5XB 2XZCL 4NCC1 4F57H 1RQ5A 1GW6A 1U2HA 4C8XA 1SQ2N 5F70A 4G7QB 2ARWA 1OF0A 3EGSA 1QEXA 3L5HA 4NKMB 1NBQA 2EDWA 5AW8B 2J4WL 4XXCA 1S7WB 1KY6A 4YPJA 5L2JB 3WHXA 2WYIA 2YMXL 5KYNA 2ZT9C 1OM3H 2QVMA 3CFBA 1MFBH 3OKOB 2UZPA 1DHKA 3P9MB 5TE4H 5JW3H 2BS9A 4F15B 1LE9B 1XTLA 2BOCA 4PIBA 2Y6SD 3EJPA 5LCVH 1MAJA 4ICWA 1E9OB 4AQAB 1JNLH 3EGDB 4PSRA 3S35X 3HB3D 4FLHA 5EF2A 4XBEH 3QZBA 1H15A 4X6DF 5C0EB 3GSNL 1KXVC 1BXAA 2DWYA 3MGTB 1M3JA 4XMPH 1W8OA 2A73B 1EVUA 5CD5D 3MX0A 4LAQH 1IAII 3DHUA 5LN4A 3Q2NA 3D18A 1G7LA 1ZE3C 5FYJH 4K23L 3BMVA 2D9CA 5ICXB 5HP5A 4OLVL 4R4FL 3U0WL 4P9HC 3K6IA 1QFWI 1ZTMA 4LT7A 3SPHA 3QDME 1YEDA 2GBUA 1FLRH 4ZW3A 4QJ3B 3OJDA 5BRZB 3D3VA 5BV7H 4H8UA 4NM8H 5IMMA 1Y18B 2DQTL 3QA3A 4M6MH 1UURA 5AVTB 4LXFA 1SM3L 3KH4A 3EOAA 5I1CL 3NZ8B 2E75C 1DQTA 4A2DA 3MROA 1B3JA 4M62L 2AQQA 5KSBA 3K6FA 1I1AD 2ZP8A 4IRZA 3J2PA 3BZFB 1FYTA 1L9PA 1NFAA 4NBYB 2E5EA 2G4EA 1FL5B 1OM3L 4JO2H 4Y89A 1C5BH 3DO7A 2WLHA 2IWEA 1PIFA 3ULVF 2X9XA 4G42B 3LDBC 1DVZA 3PIQA 3PNWB 3R0NA 4Z7VE 5LCVL 32C2B 3RFZC 5IQOA 2QKIC 4N8PA 3CDFA 1Z2KA 3X14A 5D1ZA 5HDQL 3V4VH 2NNXA 4HH9A 2ZWYA 5KJ4A 1YY8B 4IYKA 4JPVL 4XMPL 1RZJC 3HUJF 4LOFA 4M29A 2YC1A 4JB9L 2H32H 4NZFA 5FYJL 1IQWL 2HFFA 3O2VL 1HNFA 4JDVB 2FWOA 1RIHH 2QHRL 4Z6AT 2G3ZA 3VA2C 1IC7H 4YHIA 4NM4H 4UOW1 1XAUA 3BZ4B 3X3GH 1Y6NR 1FO0H 1EZVY 5FYLL 3L13A 1WPCA 1TLMA 2KPNA 1Q9LA 2XIBA 4L0YA 2GJPA 5E08H 4D3CH 4MKMA 5B8CA 5CAYB 1BHGA 4KJYB 5IFJB 3DLQR 3CFCH 2P5EB 3P0YH 1JF6A 4I4WB 4JKNA 3IMTA 4MMXC 4BFIA 5BV7L 1K8IA 1QG3A 4D9QE 1I8UA 4HMEA 5ITBL 1XBRA 3VFVA 5IB1A 3V7AE 5EU3B 2YD7A 2H5UA 1KXHA 1P7QB 3ARFC 3HZMB 3NIGE 4KKZA 2VL5B 1TVBB 5E6IA 4GKNB 3IMUA 2JELH 1V8HA 4B9YA 4Z77A 2NMSA 4J3OC 1JGDB 4KHXL 1PZ5B 4FFYH 3I74A 5D7JC 1OTSC 2IQAB 4JDZB 3FB7B 1OF2A 2WJ7A 3D9AH 3U0PA 3RVUD 3BVXA 1HILB 5I0WA 4JO2L 3FT4A 1BGXH 2WWOA 4QCIB 3VD1A 5FR3A 1MCIA 3ZXAC 1RZKH 4WY7L 3ZDZE 3II1A 3QAQA 2UVEA 4I9WE 2FO1A 25C8H 4GO6B 1BWWA 3U30C 4ZW8A 5ICYA 1YEFL 3DV6B 4TPRL 3BH9B 3Q8BA 1JPGA 2YBRA 3UG5A 5A3ID 1QRND 1X5KA 2ESVD 1JVOA 3NYKA 1NCBH 4KDWA 4IU3A 3IFOB 2GAZA 2E9BA 4Z7VB 3LY6A 2P24B 4CN1A 1RZGA 3IDMB 3PL6D 3BPCB 3TT1H 1D9KD 3WFHB 3X3FL 4DCQA 1XZ0A 3WJJA 2VDQH 2HJKA 1CLZL 2UWEE 1RIHL 4XNZC 4NQXB 4XZ4A 4Z3HA 1T4KA 4P5KB 3VSTA 5JOFA 4NM4L 4OBSA 3X3GL 1VPOL 1JNJA 4XAKD 1WZ1L 2MQ0A 1F2QA 1O9ZA 2E76C 2W88A 4GFXA 3I6LD 4IRSC 4XNQB 5TQ0H 2VW7A 2E7MA 5FO2A 1W16A 2QV4A 2X3CA 1C7SA 3DURA 2IANE 4U3XA 2PXYA 1S4IA 5DJYB 3ZR5A 3RFRA 4S11A 1KBGH 2DH2A 3L3KB 1OGAB 4PWHA 1WTLA 1F4XH 3AREA 1YEKL 2VR9A 3NSJA 5D9SA 1MH5B 1IBDA 5I74C 5G4NA 5CGMA 3PUCA 5AOMA 3IDJB 2WP3O 3QJTB 4PLNC 1HZHH 2R2EB 1LDPH 1U8OA 3EHBC 3W9EA 1OLLA 5LB1A 1UACH 3NEXA 4FFYL 1T1XA 1BEYH 1KY7A 3BAKA 3QAZC 4WO4D 1ZD6A 2BNRD 3NIGB 5FUOH 4DH2A 4KX8A 5HYIA 1DANT 1KELL 3CFDA 2ZP0T 3VU2A 3SJVD 2ALAA 1N0LB 1UXWA 1DVYA 1BGXL 3TJEL 2VERN 4XN8A 1IAOA 3CU1A 4B3VA 1U2CA 5I73C 3BXNA 4FXLA 1JV5B 4H2AA 1DFBH 1DQLH 25C8L 3MUJA 3D39A 2GC7C 3QDJD 5IB3B 3S8WA 3I75B 4KGLA 4KXAA 3WEAA 1U8CB 2MPAL 4JE0A 3ZDZB 3DXAE 1RUQH 5I15L 3VMNA 5ITFA 1MI5D 1KB9K 1LO0H 4BYHA 3BC9A 1QRKA 2WUBH 3AUWB 1WH0A 2X6VA 3CFJA 4Z8FL 4XP4H 2ADIA 5FKPA 2M8XA 5KYWB 3NDYE 5C0CD 5D8JH 3CHRA 2OI9B 2PCPB 3IJSA 3NT0A 3N40P 3FMGL 5HHVL 3RY5A 3NEEA 5CLWA 2UWEB 5D5MF 3SCMA 1GGBH 1XR8A 3KMDA 4OZFA 2VAAA 4L9LC 4Q6IA 4I8DA 2VQ4A 3BFOA 1JK9A 5IOPA 4DGVH 2ZNWA 1OOWA 1ORQB 3Q01A 1VSCA 3K71B 4U1KB 1IGJA 1KBGL 2MOQA 4M1GL 3PWPA 5EU6E 5BMFL 3SDYH 4R96B 1W80A 4PJ7E 2XFXB 4NB7A 4M5ZH 2IANB 2I60H 5JZ7D 1BXXA 1E27B 1EXGA 2RCSH 3CIQA 1J5CA 5IF0A 4R7XA 4WFEE 4NOFA 4JFDB 3O6LL 5CSZB 1URIA 3U9UA 2W59A 3L81A 3O3DA 1VEOA 1Z3GH 4TULH 3T4AB 4HA1A 4HS8L 2G9HA 2BO0A 2WVVA 3K2MC 2VR4A 4MMYB 5D72H 4PRPD 5JIHA 1G7JA 4AYFA 2XQ0A 3F62A 5EOCJ 3WO4C 4B9FA 4PWKA 5EZLA 4IK6A 3VD9A 3G5ZA 4PMEA 3ECWA 3MN8A 4TQPA 2BFGA 1XSOA 2YAHA 4JG1H 3HC4H 2GCYA 2QTVA 2IH3B 2Y7MA 1XDTT 4UBDC 1MNNA 2A4ZA 2B7DT 5F89B 4EKXA 4KI5E 3Q6GH 1RJYA 2XNAA 4I18A 3RWHB 5EBLB 2WUBL 4NQEB 5CR8A 1GOGA 2CJSA 1WVZA 2IADA 3B2MA 3WKQA 2WLIA 3PWNA 4E9TA 4MA8H 1XH1A 4XP4L 3TFKC 3S36L 5DJXB 1NBYA 1L3WA 3PDOA 3H9HB 2C9VA 4NENB 1WWCA 4PG9B 4YN3A 1PZDA 5CZXD 3TV3H 2E7BA 5ALCH 2EILB 3H7LA 4JR9H 4JZNA 1KLGB 4TNVK 3SE9H 3VTMA 3WNPA 4JRYB 5I18H 1NGXB 5EA0L 3DECA 3WY2A 5K59F 4B9ZA 5JOPD 1U8KA 4F2FA 3SDYL 1A7RH 1YEGL 12E8L 1DJGA 4GS7B 2WWKO 1CT8A 3LZNA 2X4OA 4S1DD 3W9DB 5K39B 2ZUTA 4X4YA 2IQ9H 4KWUA 3LNEA 2DIJA 1NMBH 4PJ7B 5KJRL 1IT9H 2Z3FA 4HAKA 3VXRA 5JIDA 2IGLA 4X4ZA 4PU2A 4X98A 5H2BA 5ILTL 1QFWL 3UG3A 3R8BB 4PP1D 2VZUA 4R3SB 3VFTA 4JG1L 1FYTD 4NIYE 3HC4L 3GUTA 3IAQA 4FQ1H 2XXGA 4DP0X 1IIIA 1G9NL 1UCBH 2HKHH 1PZ2A 1BOGA 5IESH 4Q9RL 1HN1A 4FA7B 3EH1A 2VLKE 5AZEH 4JFHD 4E9VA 1P7BA 4JFEE 1F6FB 1SEBA 1ZT4A 2PP7A 4EN3A 2CO4A 4MA8L 1B9KA 3QEQA 1R5WB 4NO3A 5ESAB 2XCMC 1P53A 3WY1A 1VZIA 5CJBA 1BM7A 3B7YA 3A3YB 4BCXA 2WZPA 1EAPA 4Y2DB 4AKQA 3NJMA 4PGJA 1WLHA 2QL1A 4NSKB 3OHXC 2C3WA 2SEBB 5TFSL 1YYLH 2W8CA 1PD1A 1BZ9B 2WNGA 4FXKB 4J4PD 4ANKA 5I18L 5M7QA 3QS2A 1A02N 1ZIAA 1A7RL 1I3RB 1EHNA 4FYSA 3HRZB 2D7MA 5FHAL 1BMWA 3BZDA 2NX5D 2IQ9L 1EZLA 3FQXB 1M1XA 4KKAD 2VRKA 4L23A 3W5MA 1BFOB 2ATPA 2EUVA 1NMBL 1ZPUA 5L4MA 5DK2A 3ULVE 3UC0H 4Y5VC 3BFWA 5CGYC 2PTTA 2VN5A 3EYVA 5BOPA 2EDOA 2CO6B 4HVBA 3FZUC 3CH1B 1AO7D 3CFEA 2J12B 1GS6X 2VLJA 5LKNA 3QJXA 5I8CA 2N59A 4KX7A 1BVLA 4F7MA 1UCBL 2HKHL 3V0VA 3JV5A 5C9JA 5IESL 3CHPA 3HR5A 3MRDA 3U25A 4MD0B 3AZUA 1ZHBB 2WTRA 5F3HA 5PAZA 2XRAH 5ABDE 4E9SA 3RL1A 4HQQL 3BYYA 4TKWA 2LR4A 1HOCB 3DPBA 5A2FA 4IBYA 4UILH 2ITFA 4D0DB 2XN0A 5EG6C 2VLKB 3EYUL 3KJ4C 1SOSA 4JFEB 1NCOA 4Y1AA 2BP3A 1FZJA 5IW1A 4M1DL 1EZSA 4P46C 4LL1A 3LXAA 4TMPA 3FO2A 3JYCA 3US0A 1CICD 1TEGA 1XF2A 4KTGA 2MQCA 3V0HA 1PCSA 2A6DB 3ENEA 3MLWL 4GB9A 1CTNA 1YYLL 4XZUB 3C6LB 3EJTA 2F7RA 3K5SA 2X2HA 4XH2B 1UUSA 1ZA3A 1KFAH 4PY8J 3MV9D 1PDKA 1UD6A 4GRWB 4YPGA 4ZTPL 3RGVD 4EUPB 3K2KA 4AUUA 4KMLB 1FL6A 2HX9A 2PETA 4FZEH 3H85A 4Q9CA 1G7HA 2IDFA 5EF0A 1BQ5A 1D5MA 2AFNA 3HLAB 3NA9L 3H0TA 2OMWA 3UC0L 2CDEA 4WJG3 5CCKH 1S78D 4D7PA 3CQPA 1SXCA 4JRFA 2MNWA 2H3KA 4I13B 3QGVA 1A0QH 3C75A 1FFOB 4PJ5D 2UXFA 2NT1A 1U3HA 1FRGH 5A2LH 2MIZA 1CVRA 4JW3A 1J86A 1ZA6A 5FYLD 3C9NB 3MJ7A 4LEEA 3OSVA 1KBWA 3GFUA 4OI9A 1IX2A 7FABH 3W39A 2DWSA 1A1MA 4G8GA 3UCRA 3BKYH 1OB1A 2OCJA 4UILL 4V33A 4NHUB 3DJTA 3T8XA 5I71B 1QBLL 2F53E 3HAEA 4PJXA 2P1YA 2PF6A 3ARGC 3JTSB 4KK5D 1ROCA 2DM4A 2IGFH 5F1OB 1U91A 5DRNA 2CKBH 3VG9B 3HAEG 4NXSA 2FATH 3FTUA 3N43F 1RIUH 5DDHB 2X4QA 1TNNA 4WI2A 1ZLEA 4KRPB 5DFVD 4X6BB 5EO9B 1T22A 3WNLA 1HKFA 1M53A 5IR1B 3AS0A 2BP0B 4LGPB 5GRVK 1G6RA 2AV7A 2D2OA 3BQVA 3MNVA 2XKSA 1VZGA 1G1YA 1CUOA 1KFAL 1HYSC 3ABMB 1OCCB 3H8NA 3QJFB 4FZEL 4EZMA 4GRLC 1GGIH 3QIWC 4O9HH 2NY1C 2XWBB 4GSDH 5AL8A 3GRGA 3TXAA 5DJDA 5I24A 5EBMB 1UM4L 4Y2LA 4ODWB 2XV2A 2WBJC 3F8UB 4NQCA 1BZ8A 4G8IB 1A0QL 2NY5C 3MRMB 1JUFB 3V6OE 1JN6B 1J9RA 2J88H 3T0EA 3LKSA 5D6DC 4GI6A 3MO1A 5AB9A 3VXOA 4AG4H 1SJHB 2XIDA 2IG2L 5B1AB 1PX3A 2IH9A 2AK4E 3BQUA 2XVLA 3NZSA 3ESUF 4RMVA 2VM9A 4YE4L 5HHMB 1UOLA 2RQ8A 2WYHA 4H8WL 4MCMA 1GJIA 1EHLH 4G6KL 2HP4A 4WWPA 5F1KC 3WV0A 3GEWB 4AQ1A 3BKYL 3WD5L 4AENB 1DVQA 2CZNA 5JO5B 1GSKA 2BM3A 5LWYH 4PRIA 4QDGA 5D5ME 5T5FH 4TQEL 3WKPA 1PMYA 1XCQA 1DFXA 2QZQA 1XGTB 1F11A 4FYTA 1B2WL 5I0ZA 4ZMYA 3BWSA 4YDLC 1E28A 4DP1X 1KUMA 2CDGB 2COQA 3DYMA 3IPEA 2NY6D 3FRUB 3N0PB 2YPLE 4X5XA 3IXTA 3PAZA 4C55A 5IJVB 3QYMA 2J5LB 4DFHA 2YPKB 2LHAA 4MQXC 5AOZA 2X10A 3R8QA 1CFBA 4G83A 4PJHF 4Z7QB 4HHAB 1ERNA 1U8IB 3OAYK 4JO1H 2WXRA 3GM0A 3NJKA 4BA8A 5JNYA 3T2NH 4NUMA 5D6CA 5D55A 5HPMB 4BFEA 3CZLA 2EC9T 3M8OL 2D7TH 2V7NB 4WO0A 4EI5C 3COOA 3LVEA 1I9EA 3GXPA 4HJSA 2EDEA 4RGNC 3VI3A 3SQRA 2GJZB 1Z0MA 1PZUB 1QSEA 1X7QA 1P9MA 3E2HC 1J5IA 1UJ3A 2XICA 5J12B 3L7EB 2J88L 1ZGLA 4EUPH 4M6NH 3EH5B 3DX7A 3O11A 3BP7B 2BVUA 1L0YA 1TXKA 3P11H 1QOKA 5J1AB 1MXDA 3LKNB 2Q2EB 5EEWA 1R3LB 2OMUB 2Z7YA 3P77A 4JO8A 3TIDB 4JM0A 2P28B 3N41B 3DHMA 4JG9A 2J1XA 3SQBB 2Y5TA 5GXBB 4YFEA 2V5YA 3S3JA 3KPNB 4UT9H 1ORSB 3MDJA 1IEAA 2AK4B 2EEFA 2EDJA 3OKNB 5T5FL 1NBVH 3GSQA 5BZDB 3TA3A 1YEEH 3ULVH 2K4AA 1F3DJ 4QAWA 4CN6A 2JCWA 4JANA 3VXME 3UP6A 1JF1B 1RPQA 3E6FB 2Y2WA 4Y16D 4R83A 3NTCL 4M61A 3AROA 5IJKA 4YR6B 2H4EA 4YSPA 3SDAC 3Q6FA 3QRLA 5EIQA 2RH0A 5BRZD 4J28A 3TONA 4OIBA 3X1EA 2Y23A 5D7HA 3GMMB 3P3TA 1RCYA 4JO1L 4ZFFA 4TLUA 5CBEA 5M94B 3Q8AA 2YFOA 4QD2E 2DBLH 3T2NL 4PGDA 1PEZA 3I6KB 1UQSB 3T3PB 5AWNH 1VFOA 3MNWA 3P3YA 2C26A 1XIWC 2ZIDA 4DO4A 1IE5A 1FORH 4NJ9L 1OIOA 1H6EA 4S1QH 4X42A 3ZU8A 1YMMD 3TBWA 4O51A 4HKZB 3FL7A 2W9DL 2MKWA 2VQ1B 4JL2A 5AKSA 2VISA 2CK0H 4HYTB 1I8IB 4LLMA 2AJYL 4M7ZB 4PJGA 1JCVA 1P4UA 5DJ0A 3ZL2A 2QVKA 3GNMH 3ZE2F 4CAGA 1IKNA 3A4EA 2DKSA 3CCHB 4U3HA 3RWFA 3UX9B 1BZEA 4JN1H 3CN4A 3FCSA 4LSPH 3RPBA 3O3EB 1JI1A 2CLZB 3KVQA 4APQC 1ZT7B 4Y9FA 1NBVL 4RGOH 5JHDA 4DK6A 4AYID 1LK2B 2PUQT 3MJ6A 1ESOA 4L4TE 5CZVL 2R59A 3UBFA 2XLLA 2FUQA 1KWGA 1WWBX 2HLAB 4LSRH 5HSFA 5H37A 4HX1A 1W0VA 4NS0A 3QUKB 1L0QA 1QHPA 1WEJH 2OR7A 2P5ED 4Z7UA 3RVTD 1C8QA 4ZAKA 2R4SL 4JAMA 3ZW3A 1WFNA 2ZKWA 4WDIA 3QYCA 1NIAA 3CSTA 4YHZH 4YSTA 3CMGA 3K5RA 5AWNL 3LDBB 4NO2A 4DUVA 3A24A 4LFHG 4KXBA 1ILSA 3FQNA 4I0PA 5KVGE 3GK8L 4ANVA 2QKIB 2YAMA 4TTDD 4XBGA 5G5DB 5GS0H 1DVSA 3HN5A 5BW7A 5KYYA 1C12A 4ZTEA 2YR3A 4P48A 3VW3H 3L16A 4GQZA 4PM1A 4U1LB 4UIKL 4OV5B 1NCUA 1L9TA 5F3BA 1CU4H 1G7MA 2RD0A 3W11C 3F04A 2BS8A 3V5HB 1YCSA 3MLTB 3AWEA 4PJBE 4WK0B 3UAJD 3C5SA 1G7IB 1R24A 3GINA 1DO5A 3CZGA 1U92B 2EZ0D 3GXFA 1UC6A 4I1NB 3GHBH 2X44D 5GGRA 1QO3A 1XSIA 4OF7A 3ARTA 2QQNH 3T9WA 3ZTNH 1CFSB 4YSEA 3N0AA 43CAB 4HV8A 4RGOL 4UV7L 1E4KC 1K2DA 4H1LH 5DUBA 5GSVB 2E59A 2M1KA 4G8GD 5D4HA 3ARFB 5FA3B 1Z66A 2HXAA 4PR5A 3MBXH 4WU5B 3PQYA 2AXFB 3GBNH 1U93B 4L4TB 1KEGH 1FV1A 4L1BA 1W6LA 2Z31B 5HVHB 5D7JB 1P7KB 3OR6B 3F7RA 2FVNA 3GC3A 4K15A 4ZMZA 1HHIA 1JPSH 1OGAD 3ME0A 1F3JA 5CSBA 4YHZL 3D0AA 2WTPA 1Y0LB 2WGXA 3I50H 4BGLA 5DLMH 5KVFE 2Z8WC 4N2KA 2VZSA 1QZNA 3IAGC 5FK9A 4P9MH 5EBGA 4GXVL 2W95A 3X17A 1TSRA 3C2AL 2J5WA 3AAZB 4WK4B 4CL7A 1WBYA 3IS0X 1UT9A 3NIDF 3HG1E 5INCA 1FG2B 3N1MC 3DVGA 5CWSB 4BCYA 2AXWA 1XGUB 2B2XH 4U6YB 1FFPB 2V7HA 4G6FB 4FMKA 2IBGA 4ORGA 3FTGA 5F0MB 1LO4L 2VKXA 1KGUA 4G80B 4YAQA 3U0TB 3BVNA 4IIZA 3I9PA 4XNZB 5I8EA 3RBGA 5J6HB 5MEPB 5CEZD 2Q3ZA 2ADGA 4OIFA 3RA7H 3SY0B 3PWJB 3GHBL 1AE6H 4DP4X 2F1BA 2QQNL 4PJBB 1SBBA 1CGVA 5GRWA 1AQDA 1OALA 3P3RA 2ENPA 2EO9A 3RY4A 1ASQA 4HBQA 2VL4A 3VYOA 4XX1E 1D5BA 1CG9A 1YA5A 5I74B 6PAZA 1HEZA 2CIIB 3NPZB 4X5QA 2IV8A 2VSKB 3AADB 4EZJA 5DXWA 3EHBB 1IFHL 3SDXF 3H3BC 4QHLA 2WXHA 4JGMA 2DIEA 3QAZB 2FECI 3S37X 2QMJA 2X6BA 4JGJA 5KVMC 3B34A 4K3DH 1NLBL 3I50L 2XTJD 3CX2A 2R9HD 2IAND 3G7TA 1UA3A 1SY6H 2LU4A 3MGOB 4OQTH 3ETSA 4PV8B 1MCNA 1DVXA 4KJQD 5I73B 4G8AC 2HLEB 5FO9A 1OP5H 1NUNB 4JFDD 5EU5A 4MJIA 3MOAH 3FNKA 4AIXA 1XB3A 2XBTA 3P73B 5DS2A 1G9MH 1OV8A 3BLKA 3AXLA 2X1QA 2G2PA 4N2NA 4XMUA 4JFUA 3HG1B 4HJ0D 3UERA 2C8NA 5F0PB 1GYAA 1NBCA 2J1WA 3LHPH 3LZQA 4AL8H 4TS6A 1AANA 3QJRB 2IEPA 1R47A 1X5IA 2N0KA 2Z93B 3BUDA 1AE6L 1YMHB 4NQED 3KVPA 2NZ9D 4L9LB 5HI3D 1JPFB 4HGWA 3RIAK 2E7HA 1UOVA 2FBRA 3QIUA 4L4VA 1T6VN 4ORZC 3S3BB 4HWEL 3OKLB 3UGUA 2I9LA 4WUUA 2FYYA 3IDYB 1OAKH 5IBLC 3CG8A 4F2MA 5D93C 4MS8C 4XCCH 3N43B 3HE7D 1FUNA 2NNRA 2VNCA 4PJHE 3BT0A 4PJFA 3UTZA 4HZAA 2DQEH 3TA3D 5IGXH 4GKZA 1YQVH 5KAQG 4ZQKB 2GSGA 4JRYD 2HUEA 2P5PA 1AGCB 4IHBA 5TDNB 5DK3A 1NFDE 4K3DL 3W0WA 5G4MA 5IHZB 4U6VL 4GW1B 5CIPH 1SY6L 8FABB 4NQDE 2JKSA 2VZTA 5EOQH 4Y9CA 4DGUA 3F12A 2H6PB 3R06A 3GRWH 5F97E 4JHBA 4PWFA 1XSJA 3BE1H 2OMBA 4RAVB 3O6FC 2BMKA 1QI3A 1JV2A 3T3ME 3OSKA 5T3ZE 4QTIH 3WIHH 2P3YA 1J8RA 3LKRA 1SHXA 3Q3GA 5T1DL 3AB0B 2J21A 4P49A 1QSZA 5TPWL 2YA2A 5E8OB 2QFPA 1DVFA 4HS6B 2GUOA 1DBBL 2HT4D 2I07B 4KH2A 1V3LA 4ABQA 2ZCKH 4NEHB 4ODBD 4DO5A 2ZNXA 4K71C 3SGEI 4C56B 2EICA 3L9EA 4PS8A 5FFLA 2FCBA 3AFLA 2DYRB 4AEIH 4Y5YB 3ECVA 1R0AH 1FVDA 4HUXB 4WUKH 4PP2A 2F5AL 2F74A 2H1PH 3U83A 5EWIH 3T77A 4Z3EA 2V5RA 3QO1B 3WJMA 3NCMA 3UAFA 5EORL 2BZDA 4XB3A 3TCLB 4QXTA 4A2LA 5KVGH 1HNGA 1RZJL 3LAFA 4U4BA 3F7LA 1EUTA 3BIKA 2EYSB 4J3SA 4XNUH 3CMOH 3VU1A 2TRHA 2NTFA 1QPXA 4OGQC 4GQPH 2AMUA 4Y2DD 4FG6D 4KRNA 3CDCA 2IPUG 2OZNA 4RQQA 2FSEB 2DQEL 5JHDD 4PVBA 4Z76A 3FUJA 4MCZA 1BDYA 1RY7B 3CLEH 4NQQA 4JKPH 4FHBD 3MBED 4OZIF 1JHLH 1SXZA 3I9IA 2FQEA 1XWVA 3UYPA 2YFNA 4WWKA 1F4HA 4ONHA 1ZLWH 1XSKA 1HE7A 4YUEL 5C07E 1DDHA 2CR0A 4ZAKD 1RK0A 4N0UA 1NFDB 4FABH 1WISA 2AANA 2W9EL 4UM8B 3DRQB 4PAZA 3IGUA 4LFHD 3GSVB 1CYXA 3TOPA 4DP5X 4QTIL 4NQDB 1S9WA 2XPGA 4LLVA 2HRPH 3GKWL 4ES9A 3Q43A 1QLFB 4PUBL 3IKCB 3O4OB 3T3MB 1TF4A 1PZ3A 3SIKA 5I0VA 3KWVA 3OKKB 5IWLC 4Z1PA 3TESA 1AR1B 2BSED 3VFOB 1TYJA 3FC8A 1JWMB 4Y5XC 2AZAA 2HCZX 1G7QA 4MYWB 2EIDA 4CU6A 2UYLA 4JQIA 5KVFH 5DK0A 1SLVA 4N8VA 3ZE0F 1G43A 3I9GH 4OJAA 1PX8A 3OHXB 3DGGB 5MERB 1UB6B 3MRBA 4CKQA 1Z9SA 3CC5B 1L9QA 1XGQA 2ICEC 4XNUL 1K5NB 3B1TA 3D2TA 3MLUH 4G8EB 4MJ5B 1KGCE 4FP8L 4KPHH 2G30A 3SYAA 2P49B 2OJZH 2UZIH 2Q6WB 3IU3A 4RH4A 4MSWA 5DEGB 3GMNA 3WEMA 1OAXH 3BPOC 3T0BA 4A7GA 4XAWH 5KN5A 1TTBA 3KWXA 3CLEL 1MJ8L 4JKPL 4OH2A 2VE6B 2EDQA 2XG4B 3C6LD 3P0VH 1JI2A 4OD3L 3TT3H 2WJ5A 4Y5VB 3ABGA 3RFZA 4EIZC 4W9EC 4H8HA 1I7ZB 3IMVA 1B3IA 1J12A 4BZ1A 4ZPTB 3VRIB 5D1XE 4EVNB 2O5NA 4IJ3B 4QTHA 2ZSWA 3RP1A 4FABL 4MMZC 1S7RA