4LOEA

Human p53 core domain mutant n239y
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
194
structure length
194
Chain Sequence
SVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCYSSCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cellular tumor antigen p53
publication title Structures of oncogenic, suppressor and rescued p53 core-domain variants: mechanisms of mutant p53 rescue.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Apoptosis
total genus 45
structure length 194
sequence length 194
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00870 P53 P53 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4loeA00
3D0AA 2X0UA 4LOFA 3QYMA 3VD1A 1E50A 2RMNA 1EAQA 3D08A 2VUKA 4AGOA 5KBDA 3WTTA 2IOMA 2ADYA 2PCXA 1YCSA 4L18A 4LO9A 5AOKA 3EXJA 4KVPA 5G4MA 3WTVA 3WTSA 3KZ8A 3VD0A 2BIQA 2J6WA 4G82A 2YBGA 4IBWA 2J20A 2IOOA 5BUAA 3WTYA 3D07A 1CO1A 2WGXA 4IBQA 2J21A 2MEJB 4XR8C 4L0YA 4A63A 3IGLA 5AOJA 1HU8A 4IJTA 5G4OA 2GEQA 4AGMA 4IBVA 2J1WA 2AHIA 2J1XA 2X0WA 5LAPA 3US0A 3ZMEA 1UOLA 5AOMA 1LJMA 5AOIA 2J1YA 5LGYA 3WTUA 4IBSA 2ATAA 2OCJA 1CMOA 2J1ZA 2X0VA 3D05A 4MZRA 3IGKA 5AOLA 2BINA 4IBUA 4HJEA 3WTWA 1T4WA 2AC0A 1GZHC 2BIMA 3US1A 1TSRA 4GUQA 4IBZA 1EANA 3WTXA 4L0ZA 2BIPA 5ECGA 4AGQA 3D06A 4AGLA 3EXLA 3QYNA 1HJBC 3Q05A 1HJCA 5G4NA 2P52A 1KZYA 4AGNA 3WU1A 5ABAA 2H1LM 5AB9A 4LOEA 1H9DA 3Q06A 1IO4C 2BIOA 2XWCA 5A7BA 4G83A 3Q01A 4AGPA 2IOIA 3VD2A 3KMDA 4GUOA 1TUPA 4IBTA 3TS8A 4QO1B 4IBYA 2XWRA 3D09A 4MZIA 2FEJA 1GZHA 1EAOA
chains in the Genus database with same CATH superfamily
1J05B 5C8JA 2QEJA 3ULSB 2UUDK 5FM5M 1OVZA 3EDJA 1OAKH 3QZNA 2YQ2A 2BSED 5CMAA 2AK1L 1KCKA 4BFFA 3LN5A 3I75B 1M2VB 2FO4A 3HFML 5DK0B 5FO9B 4J3OH 2EC8A 5DR5L 1A7OL 3DJRA 2D0HA 2WLLA 4Z7VE 5BRZA 1RUML 3MRPB 4Z7WF 1SJHA 1PLBA 5AW5B 1RJLA 2Y23A 5DMIH 2R2BA 5H35B 4BGDA 4XPTH 4M4RA 3MV8A 4YIQB 1QRND 4UQ2B 1V7NH 5JW4N 1E5ZA 3LN9A 2VO8A 4Z7NB 2OMZA 2JIXA 3UJTH 1MREH 4MJIE 5F89B 3BWAB 4F2ME 3UX9B 3VGDA 3T2PA 1OP5H 3RB7A 5KSUB 1GGIL 2OMUB 5EU7E 3A6OA 3ASOB 3GHBH 4JPKL 4L8BA 3O3DA 4OZFA 2PXYC 4OZHA 3HS8A 2WBXA 2B9AA 2XWTB 5DD0H 3H2QA 4ZS7L 1S4IA 1FIGH 4ZO6A 1EX0A 1VERA 4JKPH 1BZ7A 3RWHA 3MLWL 3DX9B 4GAYB 5AOMA 2KZKA 4TVPL 4NKDA 4XWOC 2Y24A 1X6LA 3IF1B 3RWEB 4N3TA 5G5DA 3T1WA 2EVFA 4QXTB 2WANA 3CLEH 2MKWA 4EQ3A 5IT2H 4GT7A 4L4JA 4YWGL 1NGXA 3ZT5A 2VQUA 4GBXC 5HPOA 3QO0A 3QZMA 4H44C 2OMWB 1M71B 5EEUA 2ATKA 3C5ZA 5EU5A 3CN0A 2ZCLH 4JHBA 2JFCA 4GW1B 1TNMA 1WA1X 1NJ9A 2WXNA 4EDWL 2ZXCA 3LQAL 4JCMA 4PP1C 3SKOA 4IRJB 1TEGA 3UTTD 3GPEA 2WXOA 4A7TA 3QUKA 1B3IA 2QL1A 2Z92B 3FKUS 2GFBB 4DK3A 2ZAHA 2BSSB 5DUJA 3MZGB 5T33H 2YQGA 4E41B 5CBAA 5EU3A 4QHLB 2GQHA 2EYRA 1YEFL 3KPQA 3MV9E 3AXLA 3RWCA 1CD1A 3QXAB 3HRZA 1DTUA 1GJIA 2YKLH 2RA1A 1TVBB 5AVUB 3LPGA 2CQVA 3GO1L 1T6BX 4J8RA 4J39A 3MODH 5DFAA 3QJHB 1A4JA 2GBTA 1S7VB 2YFNA 3QZLA 5ITBL 3EBAA 4KK9C 3D85D 4FI7A 1ZLSH 2NXYD 2ED6A 4FQQA 4MVBC 1XIWA 4QRRD 1N0LB 4HLJA 4OAWA 3C75A 5PAZA 5DRWA 2WVTA 3MNVB 5IROD 2ENQA 1A7PH 1ETJA 1KXVA 5FOJA 2AXFB 4NQSA 4U1MB 3D0AA 3ABMB 5AAPA 3EBGA 3SPIA 4FTVA 5CCHE 1MN4A 2PW1B 3BP5A 2VLRD 4MMZB 5FX3A 1KJVB 4ORZC 3SCMB 4G6KH 2W5PA 2P44B 1WZLA 2VUKA 1D5ZB 2VW7A 3SBWC 1NBYA 3L5HA 3D7PA 5B39G 1UM4L 4YHIA 5ID1A 3FTGA 5DJCB 4LIQH 4NBYB 1TO4A 1MDAA 3FBKA 4Z7OF 5DJYB 2FQGA 1GCFA 4XNXH 4YJZL 4OB5H 1VAHA 1XGRA 1Q0YH 2VXSL 2K3TA 1UM5H 4RX4D 1PQZA 3NIGB 3QUHA 3FCGA 5AKSA 5JW4R 1W72B 5FYKE 1WS7A 2EVHA 5F7UA 1ZSHA 5EEVA 4XR8C 3U30C 5I1LB 3ARTA 2BERA 5JHLA 1HU8A 3BT2L 3H42H 4KQ0A 2AV1B 2OZ4A 3THMH 1N3NB 3ZE2B 3QA3B 2J1WA 4RMWA 5IB1A 2FNWA 5F1KC 2ROXA 3B8YA 1QUPA 1FBIL 4R26H 4OM0L 3BAIA 5ABDE 2XACC 2YAHA 5D1QD 2AJSH 3QEQA 2B4CL 4IOIA 3G08B 4NQED 1FDLH 3DXAE 4GEIA 1QW9A 2CPCA 2W91A 2V0AA 4WSGA 5DD1H 3QXWA 5EO1B 1NBQA 3EADA 4CAGA 4N2NA 2DM7A 2ZWKA 3KR3L 4ZPVA 5CN3A 2HLAB 3MYJB 3H55A 1T4WA 4NAQA 4AH2B 4HXBH 3ULUH 3KJ4C 3GSOB 3CFTA 2J8UB 1HAWA 4U1NA 5EF3A 3NCWA 1HCZA 5HHOB 4LBEB 1MI5E 3CD4A 1A8JH 3L5WA 4ZUTA 1OWRM 5I8EA 4AEEA 3AQDA 3QUMA 2OXHA 1NMAH 5C08E 4FZ8H 4OF7A 1IC4H 2E5EA 1E6OH 1UJ3B 1DVFC 1VFAB 2B1HL 3B1UA 3RZWA 2DKUA 4I18C 5A16A 4X6CA 2KYIA 4L05A 1LEKA 2XUWA 4ZMZA 3T2NL 1KB5L 3E6HB 4KK6D 5TJWK 3QZPA 1MIEH 3DBSA 1PDKB 2IOIA 2DLFL 4FFYL 1DZ0A 3IJSA 3P0YH 2DIBA 1ND0B 2YD4A 5L9DH 3SPVA 3JV5A 1TZAA 5C0IA 5F9AC 4X83A 2Z3FA 4IS6B 1LO4H 2YMTA 2DS4A 1OEZW 3SJVB 3V7AG 3V5KA 4LP5A 2AQNA 3B43A 1WCBA 4NKQB 3QQ9D 4N68A 4DPBX 4AM0A 1CLVA 2GT9A 3Q2WA 3WDJA 4N2GA 3TL5A 4XVUC 2Z7YA 1BHGA 2W07A 3K4AA 3T3PE 1JGVH 3RVXC 5HSFA 2DH2A 2CDEB 3V7MA 4FP8L 1CIDA 3O2WL 1LEIB 1IAOA 2DBLH 1JWSA 2Z7ZA 4GEJA 2YN3A 4X6FB 4K07A 2FATL 3HE7D 5IG7A 1JF5A 1MHEA 3O6KH 1AZVA 4CN6A 3OVUB 3ATBA 1RZGB 1CT8A 1U3HA 3CC5B 3PV7A 3U9PH 3UZEA 1ZVSA 3ABLB 5LN8A 3D34A 3BKML 4HHAA 3CZFB 1ZGLB 1FGNH 2CMRH 3QHTC 3UFIA 4PWEA 4IOSD 1A4KA 5BJTA 5F7MC 3EGDB 3VFOA 1U8IA 1I7UB 4FCAA 4ZT1A 3BP4A 4Y5YB 3FFCA 1DUZA 3FAXA 4YE0A 1L9OA 5D7KD 3VFWB 1GY2A 4WDIB 1J1PH 4AEFA 2X4NA 4OLUH 1NTDA 1TCMA 2R0WL 4KDTA 4ZTPL 2DWSA 2VQTA 3F7YB 4XMLH 1AD0A 4MMYB 1OAXL 1T83A 2HTLD 4JQXC 4X4ZA 1ONQB 1KPVB 4K7PL 2A9MH 3D0VB 4KMTL 2BWDA 3K1KC 1CGWA 1NCDL 3SKJH 3ASWA 3CVHA 3O2DL 3ZR6A 4EO5A 4M7JL 3M7FB 5DTFB 2ZG3A 5A3IC 3J8F7 3Q1SH 4XN7A 5HI4C 3VXRE 1SJMA 1H5BC 4RMRA 5AW7B 4LMQI 5G2NA 3D87B 3FONB 1QSZA 3GSXA 1T5XB 1Z9SB 3HG2A 4B96A 5A2BA 1CGVA 3M07A 3ROLB 3UDWC 2AW2A 1BJ8A 1C7TA 1TJIH 1IC0A 2CLRA 1UWGH 1RURH 2B14A 2FJUB 3VFMA 1JF6A 5L88H 4LPYA 4HULB 3G6JE 1B3JA 1CICA 2NY3B 1MSPA 3DUUB 3T65A 4CC1A 1MEXH 3WKQA 4NN6B 4ETYA 4KX9A 4UQBA 2WSPA 1RZ8A 4PI2A 3TN0D 1BFOA 1DBJL 1NMCB 4F9PC 2V33A 4WQOA 2SEBB 5E7FA 4DP4X 4RFOL 1KJMA 4YO0A 3CXHJ 1OM3L 4Q89A 5BVPL 5E70A 1BX2A 5GS1A 1ZHKA 1WISA 5EO0B 3L16A 3ZYIA 2QVTA 2YS4A 4M6MH 1XH1A 4X7FC 4YDIL 4KKCD 3WG7B 4WFED 3QHFL 5HDLA 1PKOA 1QFPA 1XWVA 4NP9A 5LBSH 3BZ5A 3HVNA 3RTLA 1TQUA 1OB0A 2VISB 3T0ED 1LDPH 1T0MB 1NCIA 1ZHNA 4KI5D 3WIHL 2VXTL 3PU7A 2CO6B 4UNUA 4L3EB 1I3GL 1LO5A 1YMMD 2DQIH 2HFTA 3GDCA 5J13B 1YYMH 1UZ6E 2QMJA 2D3VA 4HJGA 1QSEB 5DI8A 3ZE0E 3K5RA 4NOFA 1AYOA 1GKEA 4UAOB 2CHDA 3NACH 3WY1A 3ZUCA 2LQRA 4O02L 2J4WL 1EZSA 1UB6A 3HS0C 2OXGA 2AK1H 1ZT4B 1RAMA 1NFDF 4AXWA 4HIXH 3HFMH 4JCWA 3V6OA 2XWDA 4OCRL 1AR1C 1A7OH 1UQSB 1UXSA 1HNFA 1AMXA 5ICXB 3MUUA 4ZNEA 5B7EA 1T1WB 4U6XA 1KCUL 2QQNH 4YBLB 2PP7A 2IH3B 2EDTA 4BZYA 3QNXA 3RIFK 4Y5XC 5KVEE 1FIEA 5HDOA 2MCPL 3GINA 5T3XL 5TDPB 4N2KA 5I1CL 2TRYA 4LLYB 5BOPA 3UIYA 3RYMA 1U8HB 4ZFZB 2OBGA 4YGAB 2VT0A 1H0DB 3AT9A 3FPXA 2BSEA 3DVGA 3IDXL 2XRAL 1WIPA 1GGIH 2VABB 4L0ZA 5E2UL 4EZKA 2A5UA 3HLAA 3WFBH 4AE0A 5IB5A 4WEBL 1P9MC 3CVCA 3ZTNL 1MFCL 2C3WA 3FU9A 4QF1B 4G6MH 2WBKA 4FERA 1KXQE 12E8L 1U58B 5DMYA 3IJYB 3RB5A 3S36X 1I9JL 5FECA 3BCDA 2XX0A 5FO7A 3NBNA 4OU3A 1QRNA 4JFFB 5TE6H 1JNJA 4LSDA 3S5LB 3D2UD 3LS5H 5HPMB 2JSFA 4NCC2 2RFXA 1QWHA 2F1BA 2ZCHL 3BUQA 2RGSA 2NY5C 2FUTA 5JYMA 2ZP0T 4JFOB 4PJ6A 5TDNA 4BSWB 5KOMC 1SLWA 1AQHA 1TQVA 2N7AA 1NANH 4DP9X 2IPKB 3OKDB 4NO5A 3ZW3A 4WTQA 3VTAA 4IMKA 5KYWA 2K6YA 1NDMA 1EXUA 4IGBD 2E9BA 3QQ3B 4WFGE 5GGVL 1JVOA 4TSAL 4Z0BH 3A0OA 2H26B 2NY2C 1FO0B 1UC6A 2MIZA 1BREA 3QPQC 4QXUL 4AWJC 5IB2A 3LHPL 2YAQA 2WOYA 4ODUA 4FKKA 4HWBA 1YEFH 4QNPE 4BUHA 2DQEL 5HYSB 3GSVA 4HWUA 2UX7A 4YHLH 4A6YH 5AB0A 5DS8B 2PPFA 4L18A 1V5JA 2O26U 3GO1H 4U6VL 2ODHA 4UANA 5GSVA 4FXGA 3VXSE 1AGDA 3UTTA 1U3NA 1DCLA 1R3KA 2G3ZA 3PGFH 4G8GB 3FCSB 4LLAA 2K6ZA 3I6KB 3IDJB 3ULVE 4OF6A 4WO4D 2GBVA 3F2LA 3GLDA 1JHTA 4F24A 1TKWA 4KUZH 4NSKA 4XMVA 2ZUSA 5E2WL 4R2GD 3V9CA 5JW4Q 5BOJA 3GBEA 4HUCA 4J6RL 4AQAB 4KO6A 4F7KA 2WNWA 1JYXA 3QIBD 3R8QA 2CGRL 4GRLD 5IFAH 1KCBA 1XD1A 3DVIA 3ZKNC 5KS9F 1G7QB 2G3NA 1S8DB 4PVMA 5I6OA 1EEQA 2GTWB 1GMIA 4PG9A 3LIUA 4TNFA 5J8OA 1CXFA 2CJ3A 4JR9L 1ZS8B 4TLSA 2EO7A 5FYLH 4Z7UF 3HAEA 1M42A 1Q9OA 4PIRF 3D85A 1UM4H 3UBGA 4QRRA 1B4RA 4FD0A 5GJTH 3MLXL 1DSFL 2N7BA 5IKCB 2LV4A 2V5RA 3QH3A 3RA7L 4F7TB 5KVGE 4MNGA 1E8YA 2EE6A 1ZTMA 2MQ3A 4W9CC 4FZEL 3QDMB 1QR1B 1HXYA 5D1XE 3LNIA 4LLUA 2R56L 4Q4EA 3KGTA 3SGKA 3EYFA 1AG6A 4LASL 5BZDA 4X0KA 1R3IH 1PIFA 3RVUC 3SDXB 1F2QA 3HZ3A 3ARRA 3FU6A 3MXWL 4NUJA 1D9KD 2J12B 1QUNA 3BHBA 2YGQA 4ZRGA 2HFGH 3NGBB 1FBIH 4BH8B 4UQIM 4O4YH 4OM0H 1C5DA 3EDEA 3T3MB 5J6GB 4P5TD 4KK5D 2HX9A 4L8SB 3STZB 1A02N 3X14A 2VDNH 4RX4A 1ZT7B 4OJFL 1UD3A 5FLUA 1J5HA 5EIIA 4PSRA 5HVHC 2O6PA 3MMEA 5MERB 3Q01A 1Z5YD 3S6CA 2NXZB 3QIWB 4XI5D 2LLLA 4D8OA 3VB8A 1JGLL 1KC5H 2J1KA 1EA9C 4NLHA 5D2NE 3TFBA 2ZOKB 2Z35A 5CZVL 5ESVB 3B4NA 3HNVL 2F68X 1F58L 1WD9A 4DW2H 2DMCA 5D1QA 5EA0H 3TBYA 1OHQA 1OW0C 4PJHA 4R8WL 2VN6A 4OI8A 1RZ7L 1G4RA 3JYBA 5I6XB 3D33A 2GJPA 2VOTA 3OXRA 4U2ZA 4ZPTA 2I9TA 4F3FA 3BP6A 3CHXA 3ROOB 1PNCA 1B6DA 2ICCA 2VE6B 3TYGH 2EZ0D 3TIDA 4Z7VF 4BELD 4GKZB 3L4WA 5CS7A 1GTNA 1VZGA 3VVWA 5ERWB 4AUYA 3RHWK 4F7CA 4MSWB 1EXHA 1Z3GL 2GG1A 4UOJA 5C0RH 1K8IB 3T2NH 3UCQA 1YPZE 1ZVYA 1J8KA 1CXLA 2DLFH 4LSTL 3W38A 4A2LA 1AMYA 2ZF9A 1BFTA 3DOHA 4M6AA 4WCYL 4POZD 3WFZA 3MA9H 4IU2B 2UV3A 4WUUD 1IUZA 3KXFB 3GLZA 5DQ9A 1G7MA 2CHZA 2WN2A 4PJ8B 2NNFA 4L4VB 4JFEE 4GQZA 5CN1A 4PJ9C 1KIQB 1G6RH 1T0OA 4N86A 2N01B 1EV2E 1G87A 3RQ3A 5LCVL 1DVUA 4G6FD 2E7MA 2P5EA 1JPSL 1IQDB 4L23A 3QUXD 1L9SA 2H6UA 3V0VB 4BEIA 3QJXA 2DLIA 1E43A 3QAZB 4J3WA 4OFYD 4UBDC 3B2VL 3DX6B 4FP8H 3O2WH 5AWNL 3DTUB 1KBBA 3PHOA 4M8QB 3VYNA 1XGPA 3FFOA 3N40F 3CFDA 3PQYE 5I5MA 1GVIA 3L7EB 1E6JL 2FSEB 3KLQA 1D5XB 1Y6MR 3U36B 5I9QC 5JIMA 2NW3B 2QGCA 4FHKA 1NCBL 5CKAA 5T5FL 1KLUB 1YN6A 4IBZA 1B4JL 2CSPA 4WGWB 2CRZA 1OIOA 2IPTH 1CF8L 3G3LA 2MCAA 4OLXH 1CWVA 1D5IL 2NY5L 4PLJD 4C58B 3BYYA 2C1OB 5C0AD 2BCMA 2Y2YA 1BZ9B 3PE9A 3D4GA 3P4MA 4G7YL 2LVEA 3LH2L 4XBEL 1IGJA 4Q0XL 1I1FB 3DROA 4HAGA 4DP2X 5IVXF 3BOVA 4PW4A 3V5DA 4TSBL 2ZOLA 2R69H 5EOCH 3MRGA 3LZFL 1UXWB 4FCHA 2X7LB 3DRTB 2YUZA 4X6BB 1WBZA 4GUPA 3RWIB 1X7SA 3C6LC 4L3ED 1JZ7A 3HE7A 4DSYA 2WVSA 2XA8L 4B0MB 1H9DA 3JSSA 2NPLX 3MLTB 2C26A 4ZTPH 1BVLA 4PUBH 1CR9L 4QGYA 3MRCA 3G5ZB 2AP2A 3Q6GL 3SDAC 4QO1B 4PJAA 2PABA 4Y16C 4IOSA 3BZEB 4OV5A 5EC1B 2ORBH 3NJJA 4KMTH 4XNQB 1NCDH 3BUPA 4JMXA 4PJFF 4X98A 4NM8H 3II1A 3RL1A 1LLAA 4NRYA 1UKQA 4A2DA 3BD4A 5F3BB 4M7JH 2GJZA 3T1FA 2QTEA 4GP4B 1LNUB 1DQVA 3T0XA 3A6CH 2YLKA 1MVUA 2BP0A 3I85A 3R18A 4B41A 1CFQB 1J05A 2VRQA 4A2FA 4DESA 4XCNA 4AYMC 3ULSA 1RMFH 3A67H 2X3CA 2Z65C 4OJYA 1A2YB 3HZYB 3GMOB 3TWCL 2B39A 2J3SA 3VRIA 1S9XA 4B53A 3U2JA 1L0YA 4FA6A 3TU6A 2NLJA 3P9LB 5A2IH 1IU1A 1RZJC 1VIWA 4HU2A 2V9QA 1JK9B 3O3AA 2ZJSL 2VDMH 4HALA 1IE5A 4WI0B 4J1UB 4ODWB 4TOYL 2M8XA 1S9YA 5GRJH 5H35A 4X5QA 1DBJH 1IJ9A 3POCA 1VFOA 1C7SA 1NCWH 4N8VG 4YIQA 3KBEA 1QD0A 3NCFB 3NZSA 1OAUH 2F8IA 1CDUA 5GGTL 2HFFB 2YC1A 2DY2A 1OGAE 2UXGA 3VXPB 1HILB 2R29L 3Q5YA 4IRSB 4LRNL 4PQXA 4KTEH 5IW1B 2FK9A 1OCZB 3PL6D 1OZTG 5GS3A 5KSUA 4I0KA 1XXDC 4ZMOA 3JWNC 4Q4IA 43CAB 4LARL 2O6FA 3UC0L 1HQ4B 3HG1D 3MV7E 43C9A 1D5BA 4CU6A 4UDTA 5HXMA 5DWUH 3UABA 3HE6C 4KZCA 2A9DA 4BA0A 5L6YL 3RBGA 5LNDA 4JVWA 1NBVH 4PGBA 3TN0A 2X40A 3WGVB 2V2TB 2EACA 3D8MA 1I3GH 2AZAA 1DN0B 3SYOA 1MCPL 1SUHA 3KS0H 4OI9A 1KLGA 3ZYZA 5CLYA 4FKHA 5KYUB 2FR4B 2DPKA 1IVTA 2AJYH 4PRDA 2DZEA 2FD6L 4UILH 1M71A 4P2CG 1BYPA 4CDGC 3VXTA 1HEHC 1MELA 2BOCB 3FN9A 1WA2X 3AT0A 3FB7A 3WAKA 3L3OA 3O41B 4MJJA 2WUCH 3CQQA 3MSPA 2GUOB 1LP9A 3C2AL 3U9UB 1RZIA 2N7SA 1OF2A 2FJHB 1N26A 1BP3B 2FWOA 2J25A 4OCRH 5HTSA 3T0EA 4GKSA 3OSKA 3N85H 4X7DC 1R4XA 3I02A 5FO2A 3L3IB 3T71A 3X3GL 5DURB 4P2QB 1K8DB 4KKAC 1YMMA 4S2SA 5H8DA 1AZNA 3GMMB 4EI6A 5K1JA 5J6HB 1DQLH 5HI3D 4YXLL 4FLQA 3CG8A 2EXWC 2MCPH 3QXAA 1O9ZA 1NBZB 4IQHA 1HIML 3V9EA 4P57A 3KMDA 2X3AA 3NYKA 4KO9A 5C86A 1VESA 2VXUH 1JDDA 2D7QA 1Z7JA 2N0KA 3ILDA 4QRQA 4F8LA 5CWSB 1YRKA 4UCFA 1KELL 5D7IE 4AIXA 4CADA 3GI8L 3S8FB 1MFCH 3VXMB 4M43L 1N0LA 1MCRA 3QI9D 2XPYA 1SMOA 5ANMB 5TE7H 1JNNL 2AK4E 1JAEA 2FQDA 3MNVA 2WQXA 3QULB 4V2BA 1ZV9A 4LCWB 1I9JH 5KBDA 5AOZA 3T3PF 4S1RL 1K5NB 2A77L 1YUHB 3AABA 3LH8A 3GTTA 1LEGB 4XPGL 5AVYB 5IHUL 3ARUA 4FXLA 4MQXC 3H9SB 4P23B 4PGCA 1D6EB 2ZCHH 4P5MA 4R7XA 1CE6B 4PGEA 1U91A 5DO8A 2APXA 3N42B 1USQA 2FCBA 4G9FD 2DIAA 4KVNH 4S1DC 4XVSL 3UO8B 4HOWA 5EOQH 3ZTCC 1FSKC 1ZA3B 3QS3A 3OD3A 2KZBA 4FLOA 1R9FA 2ZKXA 2YPLB 5IWLA 2X28A 2Z7WA 3U6XA 3D2UA 3PHAA 1E3XA 5D4JA 5IUCA 5GGRA 4KNQA 2XU9A 3SO5A 4MQSB 3FHAA 2XXFA 3DVNB 3QA3A 4AEIL 1T1YA 4U6VH 4MNQB 3AS0A 1FE8L 5CJQL 1CMOA 4D0CA 5GGQH 4ZJ9A 2VSDA 3GZKA 4IGBA 1EQWA 2Y6SC 2LU5A 1GAFH 1J1OL 4AYSA 1HT6A 1ZDQA 4WK4B 2VDPH 3QK0A 5DQJB 5EBLB 1SUJA 1KUMA 5E2WH 2Z0UA 5GHWH 3TURA 4QXWA 4IU3A 1K2DA 5FGCB 4H2CA 5I75C 1IBZA 3RKDD 3PXLA 4B95C 3VWJB 3WJLC 5C6WH 2ZTBA 2ZE0A 4HOZA 1CXEA 2ZUXA 3MO1B 4NKIH 1UACH 2AVGA 4JR9H 3L5XL 4OR1A 5D7JB 3GTNA 3PXJA 3VRJA 4AJVA 2O72A 4OZHE 3DMMB 2OYLA 3SPCA 4LPCA 4BCXA 1SPDA 1I85A 3VFSA 3ARBB 3MLXH 4WO4A 1NFAA 1A6UL 1DSFH 1JPGA 3K2MC 2WTRA 4S1QH 2IH8A 1WSST 1GW6A 3MCYA 3FQWA 1UJ3A 1SBSL 3G6JF 3TPUA 5CIPH 2ITFA 1JV5B 1LM8V 1XGUA 4PREA 1NBCA 2R56H 1GKOA 3SGDI 3VG0L 4ZYKA 1BMWA 3QIBA 1OK8A 4LHUG 4GRLA 5CGYC 1RJYA 4NCC1 5KBKA 5IJKC 4LASH 4EXKA 1UD5A 4P2OB 2CNYA 1U9KA 2GITB 2P49B 4FFWC 2MHAB 3QORC 4W9EC 1D5RA 4KOCA 4RQQB 3MXWH 5EZLB 4JKNA 4TUJA 3SD2A 1QNIA 2JB5L 3C6EA 4LK4A 3HB3D 5JMOC 4PTTA 1MJUL 4I87A 4BH7B 2H32A 1JTPA 1SM3L 1TDQA 2VC2L 1HDMA 1Q9KA 2AJ3B 5I6MA 2IV8A 3EF7A 3DDGA 1B0WA 4IRZH 5DMKA 5HDRA 1MCLA 3BPLB 1N0XL 1NOAA 1G7LB 3ZR5A 1PKQE 2VMDA 4JM4L 1KGXA 4ABUA 3OB0K 5F88B 4Y19B 1HC1A 2C3VA 4PS3A 5F7AA 1IZKA 3Q44A 3P3RA 4E2OA 5HHXL 2GK2A 5LXGL 4Z5RB 5ETUB 4PSPA 3DSFL 4LCCB 5FYJD 5DGRA 1PLAA 1D9KA 1S9WB 3DBXA 4JZJA 3DGGA 1KSRA 3X12B 1PZ2A 4Y5VA 1K4CB 2I24N 2VW6A 4BFIB 7PCYA 1WBYB 4P5TA 2LT9A 1RZ7H 1UYWL 3SGEI 1GZQA 1A21A 1F4AA 3PYCA 4XP1L 1TFPA 4DKDC 4ONGL 4PCKA 5ESQA 3UAFA 4FTVE 5F0LB 2HT2D 1ANUA 1J8SA 2J5LB 2C9SA 5IP4A 4XXWA 1K85A 5JHMA 1XBRA 4HIEB 5DA4A 2X4QA 4Y5YA 1KN2L 1RHHB 3B56A 3BUTA 3PWPD 4XOBA 1N67A 2FYYA 2NCEA 4HPYL 2AXGA 4HC1A 1M53A 4WCYH 4YMPA 2EUVA 3A5VA 1HX0A 2PCPB 3M1BB 3K72A 2ZXQA 3EO0A 1OALA 1JJUA 1QFUL 1VF5C 2GY7B 1GYAA 2CBOA 4MJ6B 4AJWA 2E7LA 2G75B 1X5FA 1D2OA 3G9VA 2HRGA 2H6OA 4WW1B 2E6PA 5LCVH 4UT7H 1I3RB 3KYNB 5FEBA 3ESPA 3FHQA 1AANA 3TYFA 1CG9A 1Q0EA 3CZGA 4LF3B 5IZ7A 3ARYA 3ILEA 1KFAL 3B2VH 4H0GA 4B9FA 4D7BA 3MBED 2PCFA 4HUVB 3LXAA 3HBQA 4XB7A 1HHKB 2A74A 4WUUA 1FGVH 4QAMB 1CURA 3VGAC 5GSRB 3F65A 4WSJA 3P3YA 2WNKA 1NCBH 4HFWB 1TOXA 5T5FH 1Z6JT 2PO6B 1B4JH 4OLWH 5F7BA 4HKZB 1N5YH 2NR6C 3QJUB 4AIZB 1U4FA 3K6OA 1CF8H 4N0UE 3BPNB 5IQOA 2NY5H 4U6YB 5BV7C 3BJLA 1L6PA 3QUXA 3CFNA 2LLGA 4N5UA 4R5VA 3ZTDC 4G7YH 4XBEH 5DHYB 3SB3A 3D69A 3RFZB 4Q0XH 1PX8A 4OFYA 4QNPF 4OLZL 1S7QA 2B16A 2VDKL 2OQJA 4TSBH 2H2SC 3V4VL 1IC1A 2AEQL 4NFDA 1I8MB 2C4XA 1FL6B 3SDDB 2C1PA 1RIUL 2EDBA 3FT1A 1BLIA 1NC2B 3ILQC 4FADA 2EDXA 3TEZA 1E90A 1CR9H 2IBBA 2APVA 1EGJA 5D7LD 4X8CA 3ULVF 4TTGA 1T22B 4NO0B 1A9EB 5C0AA 2ESVB 2HX8A 4UTCA 5CJOL 5H37H 4N6QA 3SDCC 4HSCX 5IV2A 2WJ5A 3ZT6A 2MQCA 1WDAA 3IDMB 4HUWA 3ZKQD 5HHMD 4L3EA 4PGJA 3MJ9H 3BEVA 4QKTA 3RU8H 1T03L 2CDFB 3ZDYE 4E68A 4OFQA 3JVGC 1AGCA 2JQMA 3OKYA 4HEME 3IFLL 5E99L 3IFPB 4HD5A 1M6UA 2HYMA 3TH2T 3FQRB 3GI9H 4WGKA 3ZDZE 5J12C 4X0NA 1L0QA 4HKXB 1W15A 3N3EA 4WHDA 3VRLE 4RSVA 4WWOA 2WLMA 4GW4A 3N1QC 5DD6B 4JGMA 3DETD 3RKPA 2XI9A 1UQSA 3HG4A 2OA9A 1DQDL 4NYLA 5DJ8B 1KGUA 5E8PB 1T1WA 4AVKA 2ZJSH 4YDZA 3FDWA 2V37A 3VXMD 1TXKA 2X12A 3L3KA 4NC0B 3PWLA 4JG9A 4UQ3A 5K1VA 3KPSE 5SX4I 5JHBA 1NUFA 3DVFA 4KKNA 3RTQC 5IMMB 1QLRB 2OR9L 3B37A 4JVPA 2VITB 3OMNB 5HGHA 1TQWA 4U49A 1U8HA 2R29H 3PGCB 3GXUB 4TUKH 2DMKA 4JN2A 5BS0D 3L7FB 4UTAL 1MWAL 3NK3A 3RZCB 3UTZB 1TTGA 2HH0L 2HKAA 2Y4SA 5B8CA 5EORH 1A6ZA 2PYED 3KLDA 4OGYL 1G7IA 5AZ2L 3RDTB 1FVCA 2EE2A 3TT1L 4B3EA 2P46B 4Z3HA 5ACMA 2F19L 3EJSA 3JWOC 5EUKA 4DUWA 3C60B 1U3YA 5KJ7E 1UTDA 4L9LA 3A4EA 4D3CH 4JM2B 2E8ZA 4OZGF 1IRAY 5F1SA 1URLA 2AQ3A 1MCPH 4X4ME 4F8OA 3ARDD 3NJLA 3T6ZA 2V5SA 1UVQB 4R96A 2FD6H 5E9DD 4ZD3H 3PL6A 2CUIA 5LWYL 3B9VA 2IPKA 4FG2A 4MNQD 3HG1A 1SXCA 4M3JA 2XG5A 1HL5A 1QPXA 1J8HD 3BGMA 3MRFB 3C2AH 5I74C 4AGOA 4APQA 3WEXB 3GUTA 1MQ8A 5B1JA 5HDQH 4KOBA 3I2CH 2H26A 3PY9A 5HD8D 4NRXA 5DD5H 2IC2A 2CO3A 3DTDA 5DSCB 1BBJB 1KBWA 4WKXA 1JPFB 4PJXF 2VMJA 1P5UC 4FQ2L 5DYOB 2DQFA 4NZUL 4P05A 2UX6A 3EDDA 2J55A 1J7VR 1U8CA 1YPZF 2C5DC 2J20A 3MNZA 4YBQC 1JTTA 1O5PA 2B7DT 4LPXA 2DQJL 5C0DB 2MQGA 3GKZA 3CIAA 1BOGB 4WJKB 2X4TB 4YHYC 3ARGD 1A64A 5TD4A 4AYID 2ZXWB 1F02I 3ESMA 5JOFB 4DP5X 4G6JL 2YKKA 3GRBA 4NKOB 1FZKB 5JXEC 4DEUA 4F37K 3PJSA 3GI8H 4Z7QE 4GNKB 3ARBD 2O5NA 2APBA 2K8QA 2NX5B 2FQFA 3ECUA 4CA4A 1JNNH 4FE9A 2AV7B 2VL5B 3LOWA 3C8KA 3PRZA 3OPZH 3QEHB 3VI4A 2A77H 3LEYL 4HS3A 3CX2A 3O2VH 3ZRFC 4FQIH 5IHUH 3BH8B 3L48A 4LLWB 4JFQB 5ILTL 1S7WA 2Q8AL 2E7CA 2HFEB 4GPVA 1UCBH 2IAMB 2Q2LA 4CU8A 3RWGB 4AENA 3KLAB 2ZIDA 3N0PB 3QI9A 1QBML 4Z76B 1TZIB 4EE2A 1J0YA 4U0QB 4ANKA 2HP4A 3FO1B 4YSDA 4H88H 3UACA 1RIHL 1AY1L 2YD1A 1T20B 1IGTB 1N6QL 2VERN 1YNKL 1BQHB 1XTMA 5J11C 3DYOA 4DPRA 5E2TL 3SDXA 4RH4A 4MS8C 1O75A 3AAZA 2NY0D 3KPLB 3QYCA 1CGYA 1U2CA 4XH2B 3U7WH 4BH8A 2CLVB 1PX3A 2VWEC 3AWGA 3BIKA 4UF7C 4G9FA 3TBWB 2XCMC 4JG0L 1LO3L 3MLSH 2KQMA 4JLRB 1J1OH 4QRUB 3U0WL 4ZNEE 2P1YA 1ZT7A 5GS0D 3VNZA 1C16A 4YSEA 4DIXA 1BECA 2WO4A 2QSQA 5D8JL 4NJ9L 5DVNA 4NENB 3EHBB 3WJJA 4IKLA 4G9DA 2OP4L 4OZ4A 2B3IA 3FOMB 2FBJL 4WWNA 2ZOKA 3BCFA 2B5IB 4OGAC 4MBRA 2HUHA 1MFUA 2OR7A 1KTDA 1Q94B 2H6PA 4DT2A 4C83A 2YGPA 4GSXA 3E0GA 3V52H 2VLLA 1F8TL 3NIDE 3QNFA 4EN3B 4WW2B 4HH9A 3V79C 3VXNB 3VFRA 4M1DL 5EUOB 2ZP8A 1DJYA 1SBSH 4M6OH 2I27N 4MNHB 5DJAB 1B88A 2ALWA 3B6SB 4UOQA 2Z91B 1S5HA 5AVZB 5IM7B 1BA9A 3MCKB 1J5OL 3C2SA 2WINB 1PZSA 1GMEA 5CEZD 3RGVB 1RZJH 3RWFB 3OGCA 1YEWA 5TQ0L 3BQUD 3ZE1F 4HJ0D 2WYHA 4DKEL 3RUGA 3OKKA 2V7HB 3LVEA 2VC2H 5CXPA 3QARA 2X1QA 1BCIA 1TENA 1KJ2L 4F80A 3NCYP 2OW7A 4KJYB 3MJ8A 1N0XH 2ZSWA 5E0QA 3NZ8A 3TO4B 3D3VB 2FUQA 1V54B 4JM4H 3BUIA 4Y4FB 2QPEB 5HHVL 1F00I 5L2KD 3KPOB 2IBGA 1VADA 4LGSB 3WLBB 3WY2A 5HHNB 1J0IA 4DP0X 3JWNH 3LPOA 3DSFH 3ISWA 3IETA 3FB6A 1YSOA 5FO8A 1XSJA 4GI8A 5E24E 1GSMA 3IJHA 1XEDA 3ETBF 4MA3A 5F9WB 1V3KA 2NW3A 3TA3D 4MMXA 1NCNA 4KH9A 3N6YA 1UYWH 3LRSB 2BLFA 4W68A 4YQXL 2BWIA 4FQXD 2ARJQ 4IIQA 4J3OD 1W91A 1DLHB 2GJJA 1S3KL 3BUYB 1F0LA 1NCUA 4KV5E 1JIBA 3E2HB 3CMOH 5DD3L 3KYOB 4LSUL 1I1FA 2F54E 4BKLB 4HMCA 4M93B 5CU9A 2X7LA 2VZUA 4J28A 5DMGC 4WTZA 2L04A 2VXVL 2VB5A 5AAWA 5FGBA 5HI5D 3ASNB 3A6BH 4HPYH 1IGCL 4QRRE 1HKFA 1T7XA 4PRIB 1KCRL 4R7NB 2HT4D 3QIUB 3S37H 3GZPA 1IT9L 2KQNA 4MNGE 4Y1AD 1QFUH 2DD8L 5E51A 1ZDSA 2G0KA 5ID0B 2BNRB 1OWWA 1H8LA 3HBPA 3IRCA 4ORGB 2JKIS 2VLRE 1H6FA 2O61B 5EU6B 2HJKB 5C7XL 1BXAA 2XZAL 1PZCA 4XNQA 4N8UA 3TBSA 2X3BA 2DTML 3PWPA 2P47B 1CFSB 4FFVC 4BGLA 4LSVH 1IAII 1J88A 4MCZB 2J6WA 1LNUA 2PUQT 1AP2A 4LRIC 4HEPA 1T0NB 4RMSA 1LO0H 2O5YL 2AQ1A 2AJZA 3BI9X 4BQ8A 5AYQA 4IBQA 5J1TC 2WVVB 4AYBA 5K9QG 2X4UB 4P2RD 1NKRA 3MFGB 3ZTEA 3L3HB 3PHSA 4BYHA 4HJSA 5C2BH 4CJ1A 4U1HA 3RDTD 5EWIL 5E0FA 2NQCA 4FXKC 4APXB 3GF8A 5E9NA 5JOPD 3LHAA 4O2EA 2JKJA 5I1KL 3T77A 2VXQH 4Q9RH 4L8DA 4PJ5D 3RL2B 3MBEA 3NIFE 3V4VH 2WBJD 4QOKE 5KVMC 5F7EL 5LGYA 5CHNB 5D1QE 1IEBA 5CEYA 3FQXA 4RZCB 4U7KA 1MCWW 5FYKL 1OCWL 3E80A 3LKOA 2ICWI 4NQEE 4PRHD 3DOIA 1CPUA 5IJVB 3QNZA 3B9AA 5SWZB 3SN6N 1EO8L 3CDZA 2XVBA 3NH7L 3HAEG 4QY8B 1YDPA 4HXAH 1IFHL 4MHHG 4G43A 3HZMB 4RBPH 4Y1SA 3ISYA 5IBUG 1FLRH 2KBGA 4WU5B 1MNUL 3ZKXC 3V8CA 3EYSL 3FC8A 5CJOH 1LILA 1WYJA 2ADJB 4DAGL 4HWEH 3T5WA 2F58L 1WT5A 5DRZB 4XX1E 4KRNA 3VFVA 4W6XB 1B0RA 4OLEA 3W5NA 5DO2D 1CDCA 5JDSA 4DEPC 4E9QA 3RX5A 5KYUA 4JANB 3SZ6A 1AACA 2IV9A 4OZHF 4DGWC 1SQ2N 3CWGA 4UOZA 1FC1A 2APWA 3TX4A 3LKQA 3BW9B 5D7LA 4P46B 3O41A 4X8GA 4EJ1C 1OTTD 3IFNL 3WE1A 4HDIB 1W0WB 4UQAA 1G0DA 2YWYA 2L4OA 4W93A 4XE0A 2XTJE 5DFTA 5EIIG 1LL1A 2YRLA 5IMKA 2P48B 1YEHH 3T0VA 1TYJA 3VFGL 1C5CH 1X9LA 1BPLB 2BZDA 4BWTA 5D5MB 3BVTA 1MLBA 2X4RB 4WGVB 3UPRA 4XCYA 1CYWA 1SOKA 3RIFF 2VZ3A 2WMPA 4X7TA 4CMMB 4EI5D 3GBNL 5MEOB 4Q97A 4IRJC 2FX7L 4F15B 4JZNB 2L7QA 4DUXA 5EC2A 3V5HA 4HWNA 3FB5B 4NEHB 4BQ9A 3GDBA 2IAMD 3NP4A 4GSRA 3ETTA 5AZ2H 4N6RB 4PJDB 1U41A 4FNSA 3CN1A 3VXMA 2F19H 1YY9C 4HSAC 1M56B 3WSQH 2MMXA 2WTPA 3P0VH 4P4KD 3C08L 1I7ZA 3R0MA 3P77B 1ZRUA 3BDYH 3KEDA 2Y07L 2ZYRA 4LFHD 5FAAA 1JZHA 1JYWA 5BS0A 4GQ9L 1WZAA 4KXDA 2YD9A 4U7MA 4FC3E 4XX1G 2C9VA 1XH3B 4TTDC 1WFNA 4FQHB 2PYEA 4PJAE 3E38A 4KRLB 3S3SA 2W0FA 5FYJU 1Q90A 4NZDA 3O11A 1JPST 2EDWA 4F2FA 5I66A 2C4FT 1F1DA 3L08A 3V0FA 3JYCA 3MRNA 4N0RA 4TQEH 2XN9D 3GSNH 4R4BB 5D7KE 4P4RB 1P0SE 2EKJA 4A38A 1LK3L 4FQ2H 1IC7H 3HPJB 4PD4J 4UU9A 2D7TL 5F8RC 3ARDA 4OFPA 2PTTB 3K6SB 1R46A 3EKCA 3EHBD 4Y4KC 2GB2A 5E9DA 1X5JA 3QSKB 5C0NC 4MNQA 4UQ9A 4G42A 3WTXA 4EXPX 2WLKA 2VMCA 2YPVL 1J8HA 1J5CA 3Q9QA 4XPFH 2CHXA 2CKBL 5IK3B 3OAUL 3CFJA 1SDDA 4HQQH 4K5NA 4WWKB 3FAWA 3H53A 1WFJA 5E6UB 5ESAA 3GGWB 1GS7A 2KMWA 2CK2A 1SJXA 2EE3A 4XNYH 2UWEA 4OUUA 1YNTA 3LEYH 2XOTA 2VNCA 4M48H 4Z7NE 5F3HB 5LXVA 2GABA 1R3HB 3ARGA 3P3TA 3NJMA 1RZKC 2XFXB 3P9MB 4FEIA 4OM1L 3AY4C 4AT6A 2J2ZA 5AW3B 3X1EA 2NYYD 3DTXB 1F4WL 1XX9C 4NWUL 5CP7A 3F7LA 5B4MC 3WN5A 4JQIH 5JW4M 4U05A 4DKFL 5KANG 1EZLA 1U42A 3ARBA 1QBMH 3TASA 4BFBD 2XWJB 2HRLA 3QC5X 2VGLM 1RL1A 2VL4A 5SWSB 3W11D 4ZXBB 3ARSA 5BRQA 4Y9FA 1JV5A 2EIBA 4RA3A 3D3VD 3TO4D 3BAYA 5LAXB 2UZXB 1AY1H 4X8XA 1XL4A 5L2JA 4BK5C 2A6JA 3VXQA 1E4WL 4LKCB 1RFDL 1M3IA 1M4KA 1YECL 2QR0A 3ECVA 5BV7H 4WFEE 3OJMB 3F62A 2V4LA 2HVKA 5KAQG 5IVOA 3GJFB 1N2RB 1RHFA 1GXEA 4JW3A 4KJPC 1LO3H 4JPIB 1BG9A 1ET7A 4KI5E 5HGDA 4G8EA 4X6CF 5JPNB 2BVYA 2JKSA 1IGIL 4YHML 5I8OH 1J9QA 1HNYA 1YYCA 4AW7A 1HEZB 1KIPB 4XN2A 2Z31C 3GMNA 2ICEA 3F8UB 3NRQA 3QAQA 1URZA 5F1NB 4DVRL 2FJGA 1ZTXE 4NJ9H 1BM3H 3B2MA 5D6DA 1LE9B 3OGOE 4KUCF 3VQ2C 1OE2A 4XN5A 3CFEA 5BMFH 3BMWA 2UY7B 3L1OH 3X12A 2IDCA 1KLFA 4BFIA 1MFVA 3FT0A 3BC9A 4OLYH 1F8TH 2OR8A 3VRLF 1NFIA 3QIUD 4FABH 2A9BA 1PYWB 3QRGL 1G6RB 2M83A 4XMKL 5EU4A 3ZDXB 4ANWA 5I17B 5GIRB 1IGFH 1ZVHA 1PVHA 2R4RH 3E8VA 5B3JF 2P3YA 2H0JA 2CH8A 2PXYB 3QRBA 4JJHA 2HX7A 4M1GL 1J5OH 4BZ1A 3P73B 2EO9A 4MAUL 2ZUYA 2E27H 2AJXH 5ACLA 4W4OC 2NUTB 2EADA 3GSRB 3LB6D 4XAKD 2XN0A 1RHHA 3RHWF 4HKBA 2DMBA 5TQ0H 2GI0A 5DJXB 3UJIL 1R17A 2EYSB 1I1CA 3H3PH 5KVEL 4HS6B 4JMNA 1EAPB 4QRPD 5JHDB 1BQUA 5LQBL 3MRMB 1JYVA 1KJ2H 4GBXB 3N44F 2GTZB 4CNIA 3WUWB 3NIGE 4OY9A 4YL4A 4QHUA 1J5IA 2CKNA 3C9NA 1CL7I 1DBBL 4H2AA 4WW1A 3WO3B 5DFVD 1R34A 1GGCL 3AU1B 1JI2A 2XT1B 4B6ZA 4HCIA 1DJIA 4X6DB 3W56A 2DAVA 3ZE2E 4ENED 4NKMA 3MCLH 2AJVH 3AG1B 3BQUA 3HKFA 5CD3A 4F5CA 3JWOH 1EEUA 3IDIA 1PPIA 1NIBA 4DOHE 3HC4L 4ZUSA 2BFGA 4ANXA 3WENA 4YXKL 3MBXL 3QXDA 3BAXA 4V1DD 1GGUA 3FL7A 1BVNT 2WWKT 5IQ9A 2W1NA 4AQOA 5L2KA 2BZCA 1S3KH 2NYZA 3FTUA 4N0YH 1YAIA 3E1ZA 1NGYA 5C0FB 1QASA 5DHYA 3B5HA 4LSUH 2J8UE 2H9GA 4ZZKA 1ORSB 1DL7H 1KIRB 3FQTA 1WC7B 3GMLA 3L3JB 2VXVH 4XMPH 5IESH 2Y36L 3VMNA 2W9EL 4HS8L 1IGCH 4PBXA 3TA3A 1SN5A 2WUBL 3PFQA 4G6AC 5F1IB 4PJGB 5DRNB 1Q1PA 3GIVB 4PWKA 2K0RA 4YPGA 1IT9H 4JHZA 2Q87A 5I1EL 3S0PA 3SO3B 4HV8A 3T6XA 1ZMYA 4JHWH 4FQXA 2DD8H 4MDIB 3U7AA 2IG2L 5A2CA 2NY3C 3LV3B 4P46D 4Z7QF 5F71A 1C8PA 5IW6A 4NN6C 1A1MB 2AFNA 2VQ1B 1THCA 1M7DB 5EOCJ 1UM6H 4BSVB 5A40E 3KM2A 2PR4L 3UP1A 4DGYL 4G1MA 4GRWH 4PBDA 4U1SA 3S35H 5B7FA 2XZAH 4ZSOB 3IMRA 3EH2A 1JWUA 1X4ZA 2ITDB 3ULVL 5HDWA 3GRWL 3BFWA 1OGPA 2E76C 2YFOA 1CFBA 1TT6A 2J1ZA 1M7XA 2FIRT 1X44A 3RWJA 2PPCA 4EIGB 1YQVL 3FBQA 4IBLT 1TVHA 2R0LL 4Y1AA 2EIZB 1BLNB 4JDVB 2O5YH 3Q3GB 1E4XI 4XCEB 4KRPD 3CFKA 3ARQA 3PNWB 2WN3A 1SMDA 3L13A 2G2RB 3PIQB 4GG6A 2GSMB 5DD6A 1H8OA 1IB5A 4XPBL 2JWYA 3T0DA 4WI9A 4AEHL 3NEEA 5H2BA 5E8PA 1IMHC 2ID5A 5EWIH 1T2JA 3PWJB 4KPHH 3L4CA 2YUWA 1HYSC 2DWYA 4QRTB 2DKMA 5KVGL 3B2DC 1ORQB 1ZLWK 2P52A 1KZYA 3IE9A 5DA0B 5IMMA 4X8JB 4AOFA 1OCWH 2QSCH 1AKJB 2XKNB 4WNQA 1ROWA 4F57L 3PDOB 1I1YB 2DJ4A 4P2RA 1IFHH 4FJZA 3CSYA 2YA1A 4AL8C 2YRPA 3WEBA 3RRQA 2MCG1 5DMJB 1A5FL 4JFHD 1G0YR 3FZUD 1JZ2A 1T5WA 4PN6A 3RDTA 4YBLC 1Y18A 3BWUF 1MNUH 3DGCR 4F8NA 3PWVA 3HUJA 3EYSH 2QKIA 3TTSA 15C8L 4PJ7A 3WLWD 5JIDA 4F7PB 2ERJB 4DAGH 1AQMA 4PJ5A 1KTRL 1ACYL 1EEYB 1TTFA 4CJ0A 2WBJA 2ZYSA 4YSOA 1JN6B 1T89A 4DZBB 2RMNA 1H6EA 3O3BA 4UI2A 1AD9B 2NZIA 4DN4L 4I18B 2DJSA 4PRHA 3WNIA 4JY6A 5B3SB 3U0TB 3VM7A 3RPIA 5C2UB 3CSGA 5DS1A 5FYLD 1UWFA 1ZV5A 2PTVA 2HN7A 3DJSA 3EGSA 3Q48A 3NIDF 3ES6B 4RFEB 3GJEB 1BFVH 3CBJB 4AUUA 2A6IA 3IM1A 3SYPA 4C56A 4XWGH 1MCSA 4BE6A 5D1ZD 3NVQA 3LKPA 3OR6B 1T21A 4Z3IA 1GYCA 4H1LB 3KS0J 1JOIA 5D55A 4GFTB 4NRZB 2YPKA 3FUEA 4QCIB 1SFHA 1BBJA 4Q9QH 5AAMA 4IJTA 1IGML 4N2BA 3C12A 5M95B 5CLXA 4YDJA 3AQZA 2WZAA 4G8FB 5IBTH 5I1DA 4AVIA 4NT6A 2ZUQB 3AM8A 2ZX9A 3GBNH 3AACA 3FO9A 4MJ2A 1AAJA 1PZBA 1CYGA 2X4SB 2Q3AA 5JUEH 3BLKA 1U2YA 2Z8VC 3F3HA 4N5EC 3VGGA 1DQQB 1YN7B 3K3QA 2K4AA 2AXHA 5JPMA 5CILH 2MH4A 2XYCA 1J0KA 1MW1A 2VUYA 1EDQA 2E59A 4I2XA 3BMVA 5KYXA 2P8MA 4K7PX 5ENWB 5K1NA 2XJKA 5SWSD 4ZXBD 2JB6A 1X7QA 3C08H 4HLZG 1JNLL 3D9AL 5L8JB 3DC0A 3IAGC 5EMYA 5SWQB 3BH8A 3DX3A 2Y07H 4KHTL 4EI5A 1P7QA 3H3KA 4R7DB 5D71L 4JFQA 2HG5B 5ISZB 5A6MA 3OKOB 2AKRB 3CHRA 5C0AE 1BSIA 5IMOA 3SGDH 4QRFA 3UBXB 2IAMA 5IY5B 1JGEA 2VDPB 3RWGA 2BVQA 4LEOB 3TVMA 3GSUB 1A0QH 3A47A 3BN3B 4U6HB 4ABVA 3EJZC 4I8DA 4UTBH 2JKXA 3KPNA 4KV5F 4L3EE 1QHQA 3FO1A 4P4KA 3U1PA 3WFCL 3RI5K 4UUJB 3EJYC 1PLGH 1YY8A 3S96B 1CTNA 3UXFA 3KLHC 4UM8B 1AZZC 1JK8B 1LK3H 1OSYA 4P99A 1QSEE 2E8YA 4QTFA 4X7SL 5C0GA 5I1JL 1BQHA 1ZIBA 4RAVA 5C0BB 3RJOA 2VRAA 3M1CA 3O8XD 3KPLA 2IADB 4XH2A 1FNGB 1T1ZB 4LHJB 3U0PA 3EOAA 3TBWA 2CKBH 4G1EB 4JY4B 1LYQA 3VM5A 1KN4L 4ZW6A 3X3FL 5ACZB 1T1XB 3FQ2A 1X5HA 1H5BB 4JRFA 5H94A 2XN9A 3RY6C 1CXIA 5E1AB 2KPWA 4ZUUB 5CBEB 3ARZA 1IBYA 3I84A 3KBPA 3V4PL 4U7SA 4JDTL 5F72S 1NGWB 1AOZA 3OJDA 2DI8A 4YR6A 3K7UA 3IWUA 3X17A 4GFXA 2CLZA 2PXYD 2G2NA 1GJWA 5FXCH 3DXAD 1RVFL 3LXBA 3OXSB 3P2BA 4L2YA 3KWUA 3DK0A 3OKLB 3TV3L 5EF1A 3H7BB 3VX1A 1HQRA 5IB4A 4L8SC 4XWOD 3I9PA 3VH8B 2UY6B 4N25A 4NWUH 4Z18A 3FT2B 2F61A 2F1EA 3QJSB 2Q1EA 4JL2A 1EUUA 3BP7B 4ZW7A 5I18L 4A63A 4HKJB 4U0RB 4YL9A 1W8EA 1Q9WB 1YMHA 1HKLH 3RNKB 1MCFA 4JFFE 2DI9A 2NXZC 2Y1ZA 1KPUB 3QIWC 4OF5A 5DJAA 4Z9KB 4UAHA 4TNEA 3M17B 2G5BB 1M9SA 4B97A 4HZ1A 5INDA 2Z91A 1MI5D 3Q13A 1MIMH 2XVKA 1ZXKA 1E4WH 3NIFF 4JFPB 4PP1D 4Q6YA 5CD5D 5K9QI 5IM7A 3UAAA 4JM0A 4PJHF 4FFZL 5C08D 1YECH 5AUMB 5FWRA 3HG1E 3A4DA 5INCB 2J44A 4YPJA 5IBLC 2V7HA 4IBUA 4CL7A 3BZFB 4HOMA 2R0KL 1GZHC 5BZWB 1IGIH 5BUGA 1DVXA 4L3CA 2IGFH 4YHMH 1A1NA 2Z7UA 4X4XA 5TGBA 1U8KB 3QXVA 3D3VA 5KG9A 3OJVC 2XWXA 1IAIL 1QVOA 3HS0B 4JDZA 1HH9B 2OL3A 1HSBB 3NSYA 1AOHA 3B9DA 4FI6A 4MHHI 1JZIA 4ADIA 4F8PA 4KK9D 1AR1B 4L2LA 3D06A 4MVBD 2CRYA 4LOUC 1SXSA 2EYTA 2JCWA 3ECQA 4MZ2A 2MJWA 1IFGA 3W9EB 3BO8A 5DVMA 1UH2A 1XIWC 2WXMA 4PJ8C 3BN9C 1VPOL 4C4UA 4Y5XB 4ACTA 5KYYB 2V17L 4ZZFA 4WI4A 2R2HA 1KEGL 1KXVC 2YZ8A 1BAFH 4KKRA 3KE0A 5EDSA 4OCXL 2EH7L 4OLVL 4IDLA 3VI4E 1OSPL 4W9LC 4Q74A 3WNLA 2FEJA 3HZVB 4R97B 2NY6C 2PP9A 2VLKD 4F93B 1WWCA 3VFPB 1E67A 3DSNA 4TL4A 4XMUA 3RVVC 2QPFA 1YAZA 5D9SA 3BUDA 4X4YB 1EFXB 2YA2A 4BD4A 4ZAKC 2NNAA 3JXAA 4JO3L 3L4XA 3SE3A 1IBDA 3QIUA 1FZMA 1QNZL 1R3JA 5CR8A 2YEVB 3TH4T 5LQBH 1N5AB 1VKXB 1NEZB 2BNQB 2AANA 1YCSA 3QDME 4G5ZH 1N59B 5FDWB 5DC4B 4PS8A 5FUOH 3FRUB 4CBZA 1QBLL 3KM1A 4LKXA 4KHXH 1FV1A 2W38A 2OSWA 3IJEB 5DDHA 2WZPD 2Z4TA 2A38A 3SDXE 3ZTJG 3ZQ9A 4CN4A 1RK1A 2WGXA 3D50A 2NY2B 4CU7A 1CFSA 1MRFL 1OB1A 3UPAA 5HGBB 3CH1A 3T3ME 4G9FE 3BSZH 4UNIA 4QRPA 3NAAL 5DZNA 3KNBB 4ONFH 4YHZL 2DQTL 3HLKA 4DN3H 4YXKH 4AYDC 4XXDB 1GC1C 1YLBB 4PJAF 2WLIB 2E0PA 3UEQA 1R3LA 5LDUA 2E86A 5LBSA 5DJDB 3ZHDA 2IFGA 5J3HD 1P6FA 1C08A 2WXLA 2R9HC 4JDEA 3CFBA 4Y2OA 3VXRD 1DDHB 1OP5K 2X53A 1A3QA 1OT1A 4R3SA 2F5AL 4CILA 2R1YB 5KAQF 2Z0BA 1MWOA 1TETL 1L5GA 1UZ8A 3GSQB 4FNLL 4ADGA 6TAAA 4XB3A 4XNMB 5AW1B 1Y0LA 5CHNA 5FUZH 1T2QL 1AGFB 1DVFD 3APFA 2BIMA 3TJEH 2Q76A 2W9EH 5ICYB 3QZOA 1CGXA 2FYVA 5IJVA 4V1DA 4CGTA 1TQCC 3F6JA 3Q9PA 1XF5A 4P5SA 4QY8A 3WIAA 3O0RH 4N1HB 5I1EH 2IG2H 4FS0A 4L8CB 4PV8A 3NG5A 4F9LA 5MHSD 4K8RC 4QLWA 2ZONA 2HVBA 2V2XA 5T1MB 3UL4A 2PR4H 1XEUA 1AGBB 1HVXA 1DO5A 2NTFA 4XP9L 1BXXA 2DQ6A 2HMIC 3ARFB 4L5FH 4DUVA 5J5EA 3GRWH 3WHE1 4Z7WB 5D6CB 4IK6A 1W72H 4IRSC 1S7UA 3DOSB 4LCIH 2XWCA 1XCTB 5DJ2B 2GVYA 3KXFE 4A7GF 2Q86B 4L4VE 4QD2E 1YEKH 2W65B 4XVUD 3F00A 3K80A 5J0BA 3MA7A 4XT1C 3R4DA 2ZSVA 3RVXD 3WNPA 5FUCE 3MHZA 4CVXA 1QFWI 1HXMA 1RZKH 4H4NA 1RY7B 2R7EB 4CC4A 4NERA 1G9NC 1ACCA 3DRQA 3LQMA 3JV4B 3D39D 4LCYB 4U1GC 4KTDL 2AJUL 4Y8DC 1Q0XL 2UUDH 5KANI 2AEPL 3ESUF 4W9DC 2CRMA 5IIEA 3GEWB 4AITA 4DGVL 4MS6A 2PCXA 5HVHB 4ZX3A 3UZEC 4TF4A 3G6DH 4YUEL 5TDOB 4OKDA 1IM9A 1LP9F 5F7YC 4LAQL 3HHMA 1OAYL 4K2UL 4R90H 1NGQH 4KI5F 5ISZD 2Z93A 2P5WB 4C8XA 3FTSA 1E8ZA 4EEEA 4ZFQA 5FYJE 2VH5H 3Q8FA 3C5SA 15C8H 2F7IA 3G5VB 3NJXA 4PRNA 1JV2B 1XB3A 3FCTA 3EAKA 3FTXA 2VLJB 2JJSA 5SV3A 3TTYA 1ACYH 1P1VA 1LO2H 1G9MC 3TZVB 4A6YA 2C7FA 3DPDA 4MAYC 2YMXL 4DQAA 5ADOL 4Z7VA 4JJOA 3C6SA 1MHHA 2PWFA 1T83C 2RCSH 2WLZA 2ENSA 4KMLB 1D6VL 4UB0L 4IEFB 5EZPA 1HINL 2H0PA 5I5IA 4FQHA 5F7NC 2ZOOA 2V9TA 3DA0A 5FB8A 3DURA 4WFHD 5DJ6A 1Y1UA 4R0LB 3WFEL 5EEYA 1ZE3C 2W92A 4RZKA 3TT3L 4UT9H 4ANVA 1QSFB 1X5KA 2FJFA 1QHOA 2W59A 4I88A 4P3WA 1RIVH 2VRKA 3PWPE 4P4RA 1M05A 1DUYA 2OW6A 3L3DB 1QPKA 4P23C 4JPWH 2QZQA 2Q10A 3MAWA 2QQLL 4PJ9B 1WPCA 4KZDL 5EFIB 1TFHA 1E9QA 1IE4A 4WFGD 2JKTM 3MRKA 5FA4B 1NL0H 1ZLDA 3U6RB 3LEXB 4WNSA 4GG8B 5KUKA 4FLSA 1VGKB 1EZVY 3FH8A 4NQVB 2CIKA 2EDNA 3GB7B 1IKFH 2AVFA 4OCNC 2B15A 3DV6A 3NZUA 1FH5L 4TQ8A 3NIGF 4YN3A 5J1AA 3WHXB 4FL4B 2WWNA 5DRXA 3HC0B 5D1ZA 2OLDA 3H9HB 2X42A 5I9QB 4XP5L 1ECZA 4Y0GA 1MAML 4O5LH 1A6WL 1R5WB 1U4EA 3LKSB 4KKBC 1JXKA 3LZNA 4F37F 4Z7OB 4K7FA 3ZE2F 4G2AA 4RGNB 2XVLA 2BCKA 3L8QA 5F3HA 1U8MB 5JHLL 2CDGA 3ALXA 4YXHL 4KHTH 3S34L 4D94A 4WTZG 1FORH 2ZUUA 3VQ1C 3ELQA 2OZ4L 1N6VA 4DK6A 5HHQA 3JTSB 5LGHL 4XNBA 2X05A 2WYZA 1Q1JH 3HI5L 1N18A 2HRPH 3ATEA 5BUPA 3MYZA 3NSDA 1KXHA 2M2DA 3NDYE 1MFDL 4TQIA 4A39A 3V0HA 5CZXD 2YWZA 2WZ5A 5SWSA 4WHTA 2AMGA 4NNXB 1Q8MA 2J8UF 5LAXA 1F6LL 3CZUB 3QE5A 3B34A 2N3JA 5EF2A 2C9AA 1I8LA 1GGBL 2L0DA 3CDFA 4NQXA 5C09B 3Q8CA 3SDAB 5I1JH 1TNNA 3CNKA 5D7JC 5E4AA 4QHNA 4I4WB 3DMMC 3VFTA 5A2FA 2YEZA 2CIIA 4FMVA 5D7LE 3D5OF 4G8IA 1I9RL 5KVDH 2VIRA 1CL7L 1N2RA 4HEPG 1GCYA 1BW8A 3GSWB 4EZLA 1G7PB 3X3FH 1KN4H 2OSXA 4FLHA 4OUOA 2OCFD 5T1KB 3BWUC 2V3FA 5HHME 4ES8A 3EFFB 3QUML 2XZCL 5CJ8A 3RJQB 3ALPA 1I31A 3M88A 4PM1A 1JFQL 1RULH 2Q8BL 3NZHL 4TL5A 5JQIB 4LLDA 2RAMA 3LKRB 3MQIA 2J1YA 4JDTH 4RMQA 5F1NA 3WIFB 2ILLA 8FABB 2OMXB 3IDUA 3FQYA 2Q7YB 2X09A 1XCQB 4P5KA 1U8QA 2NY4B 3BXNB 3GXIA 4HHWA 2JJVA 5D2LA 1SLVA 3O8XA 1FYHB 2AMUA 1ZHBA 1AO7B 1WF5A 3AQXA 1CU4H 2XV2A 4G72B 2VC2B 4W81A 1Z9NA 2DQHL 3FMGL 2D7PA 4NZTH 3QXUA 4XBGB 2VN7A 4Z3EA 1A6TA 3TFKC 1TCRB 3CLFL 3VXME 5B1BB 5EOTA 1Z5LB 4W9GC 1ETA1 1VFBA 1G6RA 5I17A 3HMXA 4RRPM 5I28A 4JPVL 3OHXA 5CEXB 1E9OA 1K9TA 4AGLA 2PXYA 3H9SE 2VSMB 3DXAA 5BS0E 3N1FC 3WMQA 1FZJA 3HE6B 3LRHA 2DYPA 2JLLA 3D4ZA 1ZA6A 2JNZA 4IMKC 4HIPA 5ADPH 3V6FA 1UWYA 4GAGH 4I1NB 2NY2D 4K5OA 5IHBA 4NGHL 5IOPB 2VM9A 2PYEE 1GS8A 2JKNA 3O45A 1IFRA 4LSPL 4BWWA 3ISRA 4DK5A 4L29B 4RAUB 4K7PY 4YK4C 1SEBB 2AF2A 2Y72A 3MRMA 4LNVA 3B5GA 4GLRI 2JKWA 2GJRA 1IKNC 5F93C 1CFTA 4I3RH 1Y6NR 3NJKA 1A4CA 2BS8A 1QMUA 1IAIH 3VGFA 4U3SB 5T5NG 2X0UA 1MI5A 4HG4J 3AU1A 3HC3H 4DVBB 2VQ4A 3H0TA 5E9DE 2R69A 4E9VA 3G04B 4FXGC 4AL8H 3TPKA 5C08A 4XO8A 1E4XL 1TJGH 1KT2B 3QPXH 2OV0A 4MNQE 4QXGH 5DLLA 1L7TL 4HJJH 3MGOB 1J8HE 3NCCB 1BIHA 1GIGL 1TLMA 4QHMB 4ELKA 3WKNA 3ATDA 1KCLA 4Q6IC 4JVUA 1G9ML 2V7NB 3SQBB 3Q5OA 3ZKND 3B9KB 4NZFA 2K6WA 4IMLB 3IU3B 3SGJC 3LS4H 5C0EB 4FQPA 3ZVVA 4RAHA 3MBWB 2UWEE 3PQYD 4OLVH 4IJ3B 1NLDL 3S48A 2DDQH 4AV0A 4I3SL 3GKWH 3MNWA 2A9AA 1M1XA 2HJLB 4M29A 1F3JB 2BMKB 3WFHA 1R5IB 2EDHA 2G5UA 1FFTB 1P4IL 2NY7L 2ZQKA 1ORSA 5L7XL 4EUPA 3L3JA 1BZDA 4YSRA 3CVHL 3BQVA 3TLRA 2ENPA 1UD2A 2PO6C 2G9KA 3PWNA 3QG6A 1NUDA 4JUSA 2EDYA 1QNZH 1G43A 1UJTA 4L48A 1QEWB 4M7LL 2UYLB 1QQDA 4MZ3A 4BXVA 1QBBA 1CDIA 1HXKA 3RVUD 4Y1TA 4XGZB 3SBWA 4PJIB 5E23A 4AZUA 4NNPL 1S5IL 5FHAL 3RFZC 1BVOA 1M7DA 1QBLH 4BSVA 4Q52A 4HT1L 1J9SA 3L6FB 5EN2A 2VLKA 1CI5A 2VDKB 3WTWA 1IV8A 3V4VB 4H8PA 3DIFA 1FSKB 2Y06H 1FO0H 4JY5H 4Z6AT 2D31B 2E46A 1EJ6A 2X4OA 1KBKA 1M7UA 1MRFH 2OSLB 1F4XL 2WP3O 3N9GL 3PAVA 5F44A 1JDAA 4WJG3 1T7WA 4YHZH 1HSAB 5DUPL 2CM6A 1DQJB 5ICZB 2EIZA 4MDJB 4TPRH 1MUJB 3JT0A 4I48B 3U2SA 2WNGA 4XHQA 1HJBC 1CF1A 2QMKA 4Y19E 4E5XA 4OT1H 2X4PB 3TCLB 4ZOCA 2P5WD 3FFDB 4U1JB 4OVVA 4ZI8A 4KAQH 4XODA 1NLBL 3K0YA 5IQ7H 5C0CB 1OKEA 2WZPA 2E9WA 4MD0B 5IFJA 2D7OA 3ILPA 1DBML 2YOAA 3QEUA 2YOCA 3AWEA 2VLJD 1HHGB 4E9SA 1G7JB 4FNLH 1IGYB 3T8XB 3TEWA 1T2QH 2BP8A 2L8AA 4JZOA 4J4PC 2WLNA 4LPUA 1I9IH 5CP3H 3U7YH 1QTSA 4BA8A 4XCFH 4Z7IA 3ZRCC 3JUZA 1BQKA 3KGSA 1SHWA 2VR3A 2D9CA 2EQDA 1ZSDA 3HS9A 4V2CB 3VWKB 1LK2B 1ZCRA 5IHLB 4KY1L 4LZKA 4O2CB 5I8CA 3VXRA 4PD4K 1D3CA 1OGAD 4GKNA 3UTSD 2VR5A 1PS3A 4PY7B 1NFDB 4UIMA 4GMTH 3BLBA 1WITA 5GRUL 4XP9H 1KMGA 1QSFD 3ZHKA 4BE5A 1WO2A 1DVFA 2H1PL 5T1DH 4KVPA 4N2HA 4I18A 4KXAA 3OLDA 2A83B 3RZCC 2X6MA 4I9WD 1MWAB 5E8OB 5GGVY 4AC4A 4WK0B 3CCHB 3MR9B 4LVOB 2EDQA 4OVUA 5EBMB 5EF0A 4UBDD 4WEMB 4KK6C 1DDTA 1RXLA 2MNWA 3FS9A 5ITFA 1I8KA 3CPLA 2Y7MA 1TEFA 4AM0Q 4LVNC 1B0IA 3NFPA 4NRZA 1H3VA 4KTDH 2CA3A 4PRPB 4PWGA 4I5BB 3U4KA 1Q0XH 4F5CE 4UOW0 4YEFA 4E0RB 2BFVL 4DGVH 2ODIA 1RZQA 2B59B 3HHRB 3U4EB 4NIYE 5BRPA 3K6NA 3AADB 5MEND 3QO1B 3A23A 3VYPA 6CGTA 1ES0B 1FYTD 3Q6FB 3QQ9C 3KPTA 4H8UA 5KBNC 4LAQH 5DJ0B 1U93B 5I2IA 3RE0A 5L2KE 3S37X 4ZNCD 2ZX5A 4PV9B 4ZQKB 2IAND 1UWEL 2ENYA 4FEMA 2FT7A 3DJZA 3PUUA 3WXVL 2ARJB 3C6LD 3ZKMC 1BPVA 2A6KB 5KVFE 3D39A 4NFCA 2N1TE 4M5ZL 1NOFA 1S7RB 2CO7B 1R24B 1A7RL 1WG3A 4YHNA 1UB5B 3CN3A 4HWBL 2YMXH 2BOLA 5ADOH 1XF4B 3IVKB 4CRPA 3B7YA 1MH5A 5DJZA 4Y16D 3S8GB 5CJXC 2AK4D 3QDGB 4UB0H 5F0PB 3TCTA 3W2DL 4ZMYA 2EC9T 2V9UA 3UZQB 3CHOA 3C5XA 1IBGH 2ESVE 4UDUA 1JUFA 4R7VA 3UBXA 1FRGL 3IGUA 4YAQB 4PYHA 4YBHA 4LEOA 3P30L 5KN5A 3WFEH 4ODHH 4C4BA 2FAUA 3VI4F 3QUZD 2ALAA 1FZOB 4ZMAT 3JV6B 3VXUD 3NPSC 1M6OA 4UUJA 3WY3A 5F0MB 4UM8A 4YDVB 1BF8A 2VN4A 4C47A 1AQKH 1PG7L 2QQLH 4JQXA 3OLGA 2Y69B 4KZDH 3V6ZA 4Y1AE 3LTVA 4GUCA 2GC4C 3OZ9H 2DQUL 5GGSB 3UZVB 4AKOA 3D08A 3PXHA 4XAWH 4NAJA 5KS9B 1AO7D 1M1SA 1FNGA 3HHSA 2Y1AA 3TF4A 2XBTA 3IFOA 1FH5H 3VI3A 3TC9A 5ACZA 3OM3B 1NC4B 5DVLA 3VGAB 3H6AA 5CIPA 3ULUC 2DIJA 3HEIB 1DANU 2DQGH 3KPRB 1Z5HA 3MOBH 1AXTL 5T3ZL 5BQ7B 3UDWA 3SOBL 3SDXF 4P9ML 3TCXA 1NGWA 3WJMB 1SF3A 4NQDB 2P4AB 1KULA 4KFZC 1BXVA 2XICA 3IJ7A 5MEPA 5JHLH 32C2A 5I6KA 4RIRA 3T3MF 2EDEA 3S34H 5I1HL 1V7ML 2E3VA 2OZ4H 4NP4L 3MJGX 4BHUA 3DO4A 2C9QA 3MROB 5KEZA 3B7UX 1A3LL 4OTXH 5HGAA 2F5BL 3I6GA 1KGYE 4PVLA 4IRZA 4F9PA 3HUJE 3PLYA 2CD0A 1XZWA 3TN0C 5JOPE 1XZ0B 4J3OG 5I30H 4TULL 3FQUA 4HKJA 4PJ5E 4YDKH 1B4TA 1F45A 2XLLA 5K9OA 2N4IA 3OX8B 3HI1B 4XNZC 3L95B 5I15L 1J86A 3DHMA 1QRKA 2FLBT 1GC1H 4XMXA 4LLMB 1XL6A 2BC4A 3HN5A 4U1LB 4X42A 1KBVA 1KWGA 1FHNA 1AVAA 2R23A 1U33A 4JHAH 5AUMA 1S9VB 4UV4L 2Y25A 5IGXL 2J8OA 4RCAA 4Z3JA 1I9RH 5AVSB 3T0EC 4EN3C 3LPFA 1CL7H 4WW2C 4NO3A 5BVJB 1VCAA 2EXWD 4X5LA 2E9JA 4R83A 1QLFA 1EMTH 3QHZL 3QUMH 3VYOA 1KYUA 1NAKL 3BDBA 4PJEA 2Q8BH 1BQLH 4CUCA 1HSBA 3B8SA 3RGVC 4YSUA 5C9JB 4YHOL 5I1IH 1FL3B 2VMFA 5F9JA 3RUGF 3B9EA 3CLWA 4KX8A 2IQAB 2KT6A 5CLZA 4LCUA 4K8RH 1DQML 3E3QE 1KV7A 2H3NA 3D51A 2A9CA 4LIQE 4W9FC 5TQ2H 4G83A 4P9HC 4BDVB 3GBML 1OF0A 3O3EB 4K3DL 4NHCL 3TBVA 1KJ2B 4Y5XA 2W9DL 3D0LA 3CDCA 5CF3A 3CHSA 1QYGH 1I8IA 4WSKA 2VZ1A 1QA9A 1J87A 2NX5E 4F2MB 4Y4FC 5AVXB 2EDMA 5TH2A 3RX9A 5E08L 5I1AA 3OHMB 5D7SL 4LXFA 2MRYA 2Y5EA 1L6ZA 2VO5A 3HI6H 2DW5A 2OYPA 2XZZA 2GSGB 1K5WA 2C3GA 3SQOL 5LJYH 1X4XA 2YIHA 3IBEA 3R06A 1P9MA 1MCIA 3FQ1A 4S1DD 3RJDA 1G9NH 1F1AA 3OAYK 3BYTA 4X4YA 1JPTL 4KZEL 2WIIB 2KH2B 4YX2H 4J5VA 1VACA 4GAFB 2H45A 1C5BH 3L17A 4S0TD 4ODVH 5B39B 3MUGB 1EEZA 1OTSC 5E8NA 1P1ZA 2IXQA 1FLTX 4FQJL 2IH1B 1JG9A 1FG2B 2G0LA 3IDNA 4LL1A 5AW8B 3WMPA 3E2HC 1OGTA 4X80L 5KTEH 3L9EA 1OARL 4NBZB 3ULUE 5JIIA 2CXKA 1A6VL 2BNUA 3REVA 3BFQG 3KDPB 1A7QL 2EABA 2QQKL 3C5JA 4FG6C 2BDNL 5I74B 3NQKA 4W6YB 2Y6SD 4F92B 1HI6B 4NDMB 3LZRA 4X99A 3QFJB 4B5EA 5F9DC 3L9RB 4RLDA 3RNQA 1NCHA 2HJFB 3OMAB 3L2LA 4IGBC 5AW0B 3CN2A 1L7TH 1PMYA 1GPOH 3SDYH 1QFWL 5IVXB 3MV9B 4PGDA 1OD9A 1P5UB 4Z78B 1BIIB 1XSOA 3ML8A 3V0GA 4NQUA 5JW5A 1G9MH 4XXDA 2WSDA 1YPZA 4P07A 5AOLA 4S10A 3VSQA 2DBJA 1XTLA 3HRPA 3RGBA 5H37A 3AY2A 1N8ZA 2NNCA 1NLDH 1DJXA 4I3SH 5G55A 3PV6A 1SLUA 1DDHA 4PVBA 3BE1L 3MJ9A 1HHHA 4Q7DA 4K5PA 2NY1C 2GI7A 1E7UA 5GZND 4N2AA 3DYMA 3DKHA 4U1IB 4MD4B 1ZE3H 1ASPA 5KYNA 1CDBA 1I85C 2H8PB 2GK0B 1AGFA 4BJLA 3CVHH 4WO4C 4PJFB 5ICYA 4M5YL 2DYRB 1TVDA 1DEEA 2O5ZH 4YGVA 2DMGA 3OKNB 2YK1H 2ZPKH 5EUOE 5I73C 4M7LH 2A73A 2H1LM 4QJ5B 4GRLC 1KPRA 3QORD 3NA9L 3GMRB 3HNSL 3PQYA 2CCWA 4L8CA 4TVSa 5FHAH 4Q2ZB 2Y7QB 3VUAA 3OKMB 4HT1H 3VW3H 4PLKD 1T0PB 1XCXA 4IKNA 4BZ2A 4E42B 2W81C 5DZLA 3B2XA 3BWZA 3BKYL 1BQHG 4LFHG 4QRSB 3SY0A 3VG9B 2AI0H 2JV6A 3LPPA 4JRYB 4MXQC 1IIKA 1FFNA 2WC7A 1WJ3A 5L0QB 4OJCA 2CGYA 2VCOA 5I5RA 4D7PA 2OK0H 5J11B 3O6LH 5AZEL 5I8KH 2W65A 1PZUB 4BWUA 5I71B 3D3VE 1RJZA 2Y1VA 2QZ5A 4KUCD 4I1RA 3INUH 2MTAA 4QTIL 3CAFA 3MRJA 1PZ5A 1MFAH 4B9YA 5IFHL 3W9DB 1D9KC 2DKSA 2GCYB 1B9ZA 3JV4A 4LCYA 2QGEA 2DWDA 1DBMH 1PCXA 3HNTL 3KH4A 4PRBB 5CGMA 1A1OB 5IQLA 1NCJA 4FDWA 4F1ZA 1QZ1A 4IBWA 3WL9B 1JWMB 2MQ0A 4XVJL 1NGPL 2F53B 3BZ4A 3VTMA 4GRMA 1NH6A 3G6AB 4UINL 5MEQB 1CLCA 2QELA 5EEWA 2IH9A 2HWZH 1J10A 2XNAA 3QDGD 4QMEA 5BXFA 2GC7C 2XPGB 2XSKA 3KHQA 4XI5C 2P5WA 5DUML 4XXWC 4KQ4L 1KJ3L 5J56B 2EKSB 2R1WA 3ECWA 4JJ5B 4Y4HB 1R1CA 2WXFA 1RP9A 2C7UA 3V4LA 1JV2A 4ZG1A 2WAHA 4NPJA 4PP2A 4Y2NA 4KBPA 3MXVH 4QUOA 1U8NB 2A7BA 2H1PH 4ANUA 1R33A 3T4YB 4ZMTA 4PRIE 1XF2A 4U1KA 5JZ7C 2VDRL 4M3KB 1JCVA 3LQAC 4D8PA 3X1GA 4F15C 2FX8L 3GIZL 2EUWA 1H8SA 4PTTB 2WK2A 2YBRB 4MX7B 4DTGL 2YR3A 4PS4L 2BNRE 2E56A 2HSIA 2C4FU 2OTUA 3FT3A 4UYPA 4WI8A 1GL4B 2EH8H 3MRBA 1PCSA 1HHIB 3GMQA 1HYRC 3JTTB 1DQIA 1OGAA 1PSKL 2BVTA 4Q56A 3UTSA 5I19H 4GO9A 4P9HL 2Q9OA 4AQ1C 5HHPB 2QFRA 1JTOA 4XAKE 3RFRA 3PNRB 3SEPA 2CBQA 2AABL 2W95A 4Y89A 4BK8A 1NOLA 3B7RL 4GIOA 4UQDA 3FH7A 5LB1A 1G5GA 2NR6D 2P7TA 3N41F 3H2WA 3QQDA 2IF7A 1DVQA 4L4TD 4NQDD 4QRPE 5EFIA 3FN0H 1AFVL 1MZZA 3N42F 1MJ7H 4UT6H 3VCLB 4ABWA 3NCMA 3KYKH 2OMYB 2I7SA 5JLZB 1INQB 1F90L 1I7TA 1UWEH 2H2SD 3MACL 4MWFB 1P4LB 2Z8WC 3OR7A 4MQ7A 3WXVH 5IHZB 2IGTA 2W80C 1C1EL 4FA7B 1QO3A 4N3UA 1QTPA 4JRXD 4M5ZH 4OFDA 3QJRB 1AR2A 3IXAA 5L4IA 3QYMA 3T6VA 25C8L 5F21B 5FOBB 1QW8A 4M6NL 2QJDA 1NIAA 1HL9A 3MLYH 1M2OA 5EHFA 5MENA 3OC5A 4V1DE 3FK3A 5SWZE 1FYTA 4G3YL 4KVCL 3OQRA 2OMTA 3HR5A 3KWWB 3CVDA 3DO7A 3SDCD 5K9KB 2CKBB 5AOKA 2IANA 3VFNB 4DP8X 3W2DH 4JFDD 4OKVA 1CFNA 3C6LA 5DHXB 4WWKC 2GUYA 3KCPB 4HA1A 3SE9L 1JHLL 1EIBA 1AGEA 3P30H 2BX5A 3MKGA 1JF1A 2UWEF 2IALA 2R2EB 4MQTB 1JRHH 4Z0XB 1I7RA 1JVLA 4PEEA 3E9UA 1OSZA 2O1AA 1QEXA 4WI3A 2EDOA 3OLIA 3K5SA 5D7IA 1DSYA 1PG7H 3D4YA 2UXTA 3RI5F 4Z77B 4Y16A 3U2IA 3MOAL 1RUQL 5IEHB 2AK4A 4I4WA 4WENB 1W0YT 5GJSL 2EIMB 1JGIA 3US0A 2B4CC 4D0BB 4PB9H 4HUNB 2F74B 3EUDA 4M62L 4GQQA 5DUBA 4AG4L 4ELMA 3HAEH 4TN9A 2VR4A 1P4UA 3GS4A 3RTQD 2D03L 1TTAA 3HIZA 5F2FA 5JQ6H 1HE8A 3QUZA 5EZOL 4AQEA 2X0VA 3PAZA 4LSQL 1PNDA 5CUSH 1UKSA 3VXUA 5KSBA 2QADC 4FQLL 3MREA 5T3ZH 1HH6B 5JA9A 1FG9C 1BDYA 4FYRA 4OD3H 3IDGB 2AC0A 4GSDH 3EYQD 3MGTA 4KROC 3TO2B 2OMXA 4YNYA 5A2KH 3DYPA 3C87A 3G6JB 1XCQA 3QQ4B 1KYFA 1K6QL 3BXNA 1BEXA 4GAAA 4N0FA 3F85A 1KXTA 4FXKB 1B2WH 4YSCA 5B8CC 4NP4H 1AO7A 3TONA 3OG6B 4HGWA 2VR6A 1MHPH 3IWVA 2QHRL 1T80A 1A3LH 1YEIL 1Z3RA 5JPNC 3NESA 3NFNB 4YHKL 3IN2A 4NO2B 2X9YA 4I13B 4OJDH 4PJDE 1TCRA 5F96L 4WKZA 1A6AB 5G4NA 4TULH 3MLRL 1KTLB 4JO4H 5AW2B 3HJEA 3S8WA 4LNRB 4P2YA 5I15H 1BM7A 1BZ8A 1SYVA 1P84J 2J88H 1ZWIB 3F83A 2XV6B 3WKML 3AGVA 2JJTA 2D4DA 3S4SA 5I0VA 4XZ4A 4Z23A 4M7KH 3ZKXB 4K3EL 5IF0A 4JFYA 3D48R 3F6IA 1F4YL 4BFNA 2DQDL 3CX5J 1A3RL 4UV4H 1ICTA 3B2UD 4JFHE 4J6IA 4APQC 1N9PA 5F97E 4HJ1A 3KVDD 3JWDL 4DEPB 1SEBA 1HHJA 3U4AA 1GZPB 1XHHA 4YBQD 1DJZA 2EIJB 1AHWB 1RUPL 2FL5A 3KPPB 2MFNA 4GW5A 3DNKA 3DHUA 3KPMA 5LGKA 4FYQA 2VLME 5T1LB 4HK3N 4DZ8B 4YHOH 2BVEA 2ZXBA 4ONHB 2BK8A 1XGZA 3SSGA 5FYLE 3WHE0 3IN0A 3WS3A 5JXED 4B7IA 5EZJA 2R1XA 5BPPA 4K3DH 4NHCH 2IDFA 5E8EA 3R4RA 3MLZL 4HC1L 2W9DH 4PTUA 1JPEA 3EFOA 4WU7A 4ZOBA 3ME0B 1E7VA 4CSTA 1PZAA 1EJOH 2K9FB 5KSVA 1JCKA 3S3DB 3MBWA 4PMEA 2EIKB 4MD5B 5GZOC 4QJ3B 3LNHA 2FRGP 3ESNA 3IGFA 5TE4L 3K6DA 4PBVC 2OMNA 4ZUVA 1AZCA 1BFSA 1WLHA 1BG1A 4U4BA 4HCFA 4J7RA 5C07B 5DF0A 3V2AR 4WHCA 3FW6A 2QVKA 1FN4A 1PKQA 1S7XA 1XGYL 1M9WA 3AZUA 5E2JA 5AVTB 5LGJB 1D7CA 3P4LA 3QG7H 2Y3NA 4CVZA 1CLYL 3T4AA 3DUSB 4JRYD 3T8MA 4DO6A 5D70H 2F54D 4L1SA 4HCRH 1I1AC 5SWSE 3REWB 2BSRA 1KEML 4GUQA 1BBDH 2CK0L 1PAMA 4MS8D 4PJIA 5E6IA 4XCCL 2C3XA 1FNEB 1OARH 3LDBC 3CHPA 1A6VH 4IHBA 3BKCL 1SY6H 3LJ3A 3R1GH 4QIRA 1A7QH 3ZL4L 2QQKH 2VXQA 1PD0A 1NPJA 2BDNH 4TSCH 1NIEA 4DJMA 1TZOA 4XC1L 4OGQC 3DX0A 3LIZH 4H25A 5FA3B 4HISA