4LOEA

Human p53 core domain mutant n239y
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
194
structure length
194
Chain Sequence
SVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCYSSCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Apoptosis
molecule keywords Cellular tumor antigen p53
publication title Structures of oncogenic, suppressor and rescued p53 core-domain variants: mechanisms of mutant p53 rescue.
pubmed doi rcsb
source organism Homo sapiens
total genus 45
structure length 194
sequence length 194
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00870 P53 P53 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4loeA00
5AOJA 1LJMA 4AGLA 3WTVA 4AGOA 3WTXA 3US1A 2J20A 4HJEA 2BIQA 5G4NA 2J1WA 5ABAA 2PCXA 1CMOA 1TUPA 4IJTA 2X0UA 2FEJA 1YCSA 1H9DA 4MZRA 2BIOA 4GUOA 3WTUA 2WGXA 2GEQA 3VD0A 3Q05A 5AOMA 4IBSA 5BUAA 2X0VA 4IBZA 2J1YA 3D05A 2AHIA 2OCJA 4KVPA 1EANA 1EAOA 3WTWA 3IGLA 1CO1A 3Q01A 3WU1A 2YBGA 2J1XA 5KBDA 2XWCA 4IBUA 3D07A 5AOLA 4QO1B 4XR8C 3VD1A 2BINA 3D0AA 4IBVA 2J1ZA 5G4MA 4G83A 2H1LM 2IOMA 5G4OA 5ECGA 1E50A 5AB9A 5LAPA 3VD2A 5A7BA 4IBWA 4IBQA 2BIMA 3WTTA 3KMDA 4LOFA 2IOIA 3EXJA 2XWRA 3QYNA 4L18A 4G82A 3KZ8A 2MEJB 1EAQA 2X0WA 4GUQA 3US0A 4L0ZA 1GZHC 1TSRA 3WTYA 4AGMA 4AGPA 1HJBC 5AOKA 4L0YA 2IOOA 2VUKA 1HJCA 3ZMEA 2AC0A 1KZYA 2RMNA 1IO4C 3D09A 3WTSA 2P52A 3D08A 2ADYA 4MZIA 4A63A 4LO9A 4IBTA 2J21A 3Q06A 4AGNA 3EXLA 3TS8A 4IBYA 3D06A 5AOIA 1HU8A 1GZHA 4AGQA 4LOEA 5LGYA 3IGKA 2BIPA 1T4WA 1UOLA 2ATAA 2J6WA 3QYMA
chains in the Genus database with same CATH superfamily
3D69A 2VLRD 2DQHH 2VL5B 4K8RC 1B4LA 1EH9A 2YAMA 3C6LD 3Q2NA 5IEKB 1QHQA 2LU3A 4XBEL 3JYCA 2WNGA 4JY6B 1FBIH 1N2RB 1PZBA 3PXLA 5TDOA 4JRYE 1EHNA 3WS3B 3MV9B 3PCYA 3KPSD 1YY8A 2DB8A 3X1EA 5EORL 5B8CC 1E90A 3U7WL 2DJ4A 1BQUA 2ZYIA 3BEVA 5CIPB 4NQED 4WTZG 4CKQA 3I9AA 3GBEA 3ZO0A 3I3BA 2JIXB 4YDNA 4M6MH 4XMKH 1MFCH 2C1PA 3IDJA 4A7GF 3VG0L 3HZKB 4RESB 3T6XA 3NCWA 1GHFL 3X13B 1ZANH 4PJGF 3L7EA 1EZSA 5F1IA 2APBA 2EDMA 2KUTA 3LN9A 3HZMB 3ORJA 2VXQH 3QZBA 4NIYE 1KCSL 4H2CA 3VA2C 4DN3L 2EH7H 1CYXA 3HZ3A 2QBWA 2A74A 1G7LA 2BWQA 2HG5A 2OL3A 4CGTA 1KENH 4G7SB 5JXED 2VABA 5BO1L 3KYKL 3IDNA 2JQZA 3X2QB 3HE7C 2X87A 1IM9B 1GGCL 4S1DC 3ZUCA 4BFGA 4LKCA 4E41A 3VG9B 3GM8A 4S1QH 2VERA 3GSNH 4N2LA 3HS0A 5T3ZL 1VGKB 2R0KL 3OGOE 4MS8D 2X53A 4BSVA 4JQVA 3II3A 3MBEC 4Q0XH 4PJCF 3AWFA 5L8LB 2MRYA 3I50L 3O0RH 4UQ3A 3F6IA 2X4RA 2HB0A 3UTTA 4OTXH 2YXFA 4JJHA 3STLB 4GW5B 1A1OA 3DBSA 1VKXA 5C0RH 3ZU8A 3FN3A 2V2WA 1MWAL 3D39A 4CAGA 4JLRA 3Q2LA 5IBLC 1L7TH 4ZFOB 2X05A 5E5RB 1BGXH 3OKNA 4PWFA 1ZHNB 2BVOA 1VF5C 2KKQA 3JXAA 3S34L 3VXSD 3R7RA 3BH8B 1CE6A 2NY5H 5IJBC 2LABA 3LKQA 1AZNA 5C1MB 4GSUA 1BZOA 2P43B 2QFRA 3UYRH 5D55A 4RMRA 2A4EA 1S9YB 2WTRB 4JANA 3WFEH 5F9JA 1DVQA 3QNYA 4ORGA 3D06A 1T04B 4PWGA 1BLNB 2VE6B 2YZ8A 1AI1H 5HHXL 4J3OG 5AENA 2XUWA 3FUKA 1WAAA 1K4DB 1N64L 2Y2TA 5DHVB 2Q2EB 2MPVA 4HF5L 5AOZA 5CP3A 3QB7C 3Q3GA 4QXUH 1M42A 4G6AC 4HLEA 3UO1L 3VB9A 4W9LC 1QNZL 4WKXA 4Q9CA 4QXTB 1ZHBB 4HXBH 3MNZB 3C2AL 4WUUE 2J88H 3IBOA 4W1TA 2MMXA 2WIIA 4K5NA 1UM4H 5T1KB 3IWVA 3DJZA 3VAEA 1X4ZA 3BQUA 1CXLA 2HPOA 4TNWK 1HCFX 5I2IA 4LU5H 1KCBA 4UT9L 2E74C 2YHGA 1X5FA 1JN6B 2ED9A 1QWUA 3O2VH 2CCWA 3T77A 2Y7QB 1WP6A 1P4UA 4GB9A 4PJ8A 4AE0A 3TZVD 1W0WB 4YAQA 3EYOA 4X7CC 1N18A 4O4YL 5JQHC 2ICCA 2WXHA 4L5FL 4PV9B 3OKOB 5BV7C 2NY1C 4ELKB 2UYLB 3BC9A 3EFOB 3RNKB 2EDLA 1OZTG 2W9DH 3H9SD 2LU7A 4A39A 4FXTA 3LNEA 2J4WL 3VI3E 1NJ9B 2WBWB 7TAAA 3FO1A 5JZ7D 4LLQA 3EGXA 5KVEE 2FQFA 4LRIA 3O2DA 1RZGA 1M7IA 3QNXA 1WBYA 4QI3A 5CZKA 1A7NL 5BJTA 2G5UA 2A73B 4NWUL 4PBWD 5FM4A 1ZK9A 4J8QA 3DHJA 5AUMA 3D4ZA 1XSOA 2IFFL 2RBLA 3VM5A 3H2QA 3OHMB 4K5LA 3CXDH 1DLHA 4CVXA 3ZIMA 4GINA 1V27A 3L95B 2I60H 4JB9L 4JPVL 3DX4A 4LCYA 3K71B 2WXQA 3CPLA 3BT0A 1HAWA 2DQ6A 1G1KA 2DH2A 8FABB 4L0ZA 4ZMWA 5T1JA 4MQXC 4UM8A 4LCVA 4XXCA 2GABA 3O4LE 2VGLM 1KB9J 3RKDD 2WVSA 5DC4B 4JRWA 3ARRA 1UWGH 2O26U 5F2FA 1LE9B 2VLJD 3KYAA 5TQ2H 5FAAA 2VN4A 2ZSVB 3DA0A 4FFWC 3SHSA 2WYTA 3CDFA 4YSCA 1FZMB 2G9KA 1TTRA 4OD2B 4ZMPA 1IKNA 2V5RA 3RKPA 2OPCA 3RBSA 1O6TA 1JK9A 4ONHB 4JJ5B 4QLRA 3IFNH 1BZEA 5DI8A 2HT3D 3FTXA 1K4CA 1NFDB 2ATKB 5E5UB 3WIHL 4LHUA 3CLEL 5EBLB 5E4EB 1BFOA 4LOVA 3GXMA 5ITFA 1YECL 4D8OA 3MUJA 4Y9EA 3Q8CA 5BW7C 4TUUA 3LZLA 2ZP9A 4R7DA 3SY0A 5BZWA 4Z3GA 1NCIA 1A2YB 2NY3C 3ISWA 4NC1C 3S5YA 3RURA 4HAKA 2EXTA 5I5IA 4FYRA 3GI8H 4FGMA 3QQ4B 4IU3B 3JWDL 2W9EL 2VDPB 4WQOA 4MD0A 1CFVL 2CBPA 2WXPA 35C8L 4YDLC 3W82A 3HNSH 1ETJA 3U0WL 4K8RL 1LNUA 2F18A 2G5BB 3HHSB 5DXWA 5TDOB 4Z7VB 3ABGA 4FI8A 1R5VA 1TMCB 3DGGB 5EA0L 1K9TA 2N7SA 2WLLB 4FL4B 4G70B 5JHLL 2YGNA 5J8OA 4PWKA 2FJHA 3ALPA 2HVJA 1KB5L 5AVUB 3DROA 4Q9RH 3KL5A 1CDBA 1D5IL 3OKEA 3HS9A 2BERA 1CGSL 2Y1VA 3LEYL 4WUKL 3SDAB 1U95B 4UILL 5I8OL 4DGWC 4R0LC 1R3KB 5AAMA 3CFKB 1IGTB 3IVKA 5BZZA 2DQFB 5D72H 4FXGC 4PPTA 3VQ2C 4PRHD 4X8GA 5TF1L 4B5ZA 4FHBD 4JKKA 5EUKB 1PZ2A 1NCBL 3EHBD 3HI6L 1BVOA 4GMTH 3IDNB 3ARBD 1JK8B 3FCTB 4N2GA 2E47A 2CLZA 4QHMB 2B4CC 1HZLA 3HMXA 4LSVH 4ZFGH 1L6PA 4WENB 4AMKL 1T5WA 4DEUA 1WITA 3HS0B 4Y9FA 3V0WH 3VXUB 2F74A 4M7LL 3K6FA 4BSVB 1M3JA 3X12A 4GSDH 2WLIA 4Q58C 3KWWB 4N2IA 3BO8B 3Q8EA 4HHGA 2IQ9L 4PB0H 3OAYH 4GQZA 5HDBF 4UQ3B 3WDIA 1MAML 1GYUA 2FLRT 2X4RB 4KDWA 1TSRA 3JT2A 2PO6C 1GJUA 5DEFA 5CSZB 2QQKH 2X2UA 1INQA 2W0PA 4QT5A 2TAAA 1FSKB 2R1YA 2R4SH 3PV6A 2IV8A 2EVIA 1YMME 1F3JA 3BSZL 3D39B 3SDXA 5DA4A 2XRAH 4PJXF 2C34A 1WHPA 1W80A 2BNRD 1NIEA 4OD1L 5IW6A 4KZDL 2BVOB 1LWHA 4MQTB 4ZYKB 1QFWL 1CE6B 2OXGB 5J3HC 4YSAA 4H8HA 5CBAA 1DQJA 3GYRA 1N6QL 4YHYC 4TNWF 3TGXA 1KXQE 4FFVC 3GSXB 1YO4A 3KBHE 1HSBB 5HHPA 4MVBD 4OD3H 4P05A 2Q0ZX 5F9DC 3ZDXB 2D7QA 5HHOD 3B7UX 2A9ML 1GZHA 1WC7A 3T08A 4KHXH 2F7OA 3BSHA 5HDRA 5CILL 3VGEA 3AG4B 5D1ZD 1DO6A 4KJWD 4O51B 4IKLA 4R4ND 4WHYG 2WBKA 3Q3GB 2HWZH 3CHPA 3SYCA 3HRZC 2WM0A 3EBHA 3NTCH 5JW5B 3B6SB 2Y0SA 3SJVA 5E2TH 3RY4A 5IZ7A 1HS6A 2VMFA 1OGSA 1O6VA 2Y2WA 4BZ1A 2C9QA 3PWUA 1IKFH 2XN1A 3D9AL 1JXGA 4UT6A 4AQAB 4ZAKC 1NOLA 1IGML 4X9IA 2ZOLB 1SQMA 4K71C 4KXZI 3VFGH 4G6JH 5D1QE 1XR8B 2Y25A 4JAMA 3TEXA 3T77B 4G5ZH 4MRCA 1H8SA 3VWKA 2Y5TA 4PP1C 4YAQB 5I19H 1M6UA 3EYOB 4FQIH 4ZS6D 2BIHA 3KWXA 4WO4B 1RUML 1T21A 3IGAA 5D1QC 3I9GH 3RUGA 3UTSE 3CFBA 2BSED 4YS4A 3V0DA 4R3SA 5FLVA 1BXXA 1GYCA 1PAZA 1RHHA 3ESMA 3WD5H 2E7HA 3IMVA 4F3FA 2YMXH 3KYMA 5BV7L 2F1EA 4QRRA 1OW0C 1KNOA 1I8LC 4NBZB 2CNYA 3SDYL 2ZX6A 3EYUL 3BWZA 1OWWA 3GMPA 1ZT1A 3ENEA 3CQPA 2ZOKB 1EBPA 1FRGH 3TEYA 3QS3A 4CC4C 5JIPA 1YEFH 1AS7A 4AM0Q 1AJ7L 1DBJL 2G9HB 1QEWB 3AWEA 4GUPB 3DVGB 3D3VD 3NEXA 2DD8H 1MIMH 4JFEA 2YKKA 3O6FC 4PJHE 1SHXA 4XWGL 4Z7IA 2O93L 4KI5E 4CVXB 5T5FH 1NCOA 4ETQB 5KVEL 4F2FA 1FNEA 4L3EA 2W07B 4UQ9A 4IGBD 3CPLB 1E8YA 2DH3A 1KFAL 2F53D 3QFJE 3VA6A 3WBDA 4R83A 3WN6A 5J1SC 3WTYA 1HILB 4LCWD 5BNXD 5A40E 5I23A 1HJBC 2A4CA 4UM8B 1DBKL 3IMTA 5DFVC 4FNUA 4JE0A 3EDJA 3NJVA 4X4YB 1RUPL 3T65B 3IBEA 3ABKB 6FABL 4ZFZA 3OHXC 4G9FD 2OV0A 2WKGA 4YPGA 3MLXL 4M8QB 3TF7C 3RJOA 2NR6D 2G75A 4V2BA 4F37F 4OLXL 2BY1A 1XF3A 5C0NC 5HHNA 2ORBH 2OZNA 3C2SA 5CLZA 3SYAA 3TCLA 4OIAA 1MFEL 3ZDYB 2BNQA 2X09A 4LCUA 1U8PA 1HK6A 3HA0A 2H7WA 2IG2L 1BFOB 1QLEB 2EDNA 4N6QA 5L0QB 5AZ2H 3AFLA 1VACA 4PRPA 4Y2LA 6CGTA 2QZQA 3F5WA 3GLDA 4PGCA 3I6LD 3WJLC 3W9EB 4PRBB 1BX2A 3A67H 4B9YA 3FU7A 1QO3A 2DQJH 5J12C 1HXKA 1EXGA 5J1TC 4L4TD 1RJLA 2HRPL 1ACXA 3GSUA 1KLGA 1R5WA 2F7PA 1MLBB 2EYRB 4ABQA 5IM7A 4OFPA 1AIFA 1FFRA 2IC2A 4ALAL 1UWEH 1LNUB 3HLAA 2Q87A 2BXYA 5IF0B 4Z95H 4UT7H 3UBFA 4NZUH 4I2XE 2J8HA 2I7SA 5J13B 2IALA 5AOMA 4EDWL 2HVJB 4JKMA 3DROB 1YEIL 5AW6B 4KXBA 1SJHB 3GIVA 4MX7A 4P59H 2GBUA 1JUFB 2VZTA 3X17A 4U1GB 1DVXA 3A4FA 4NHCL 4HLZH 1N0LA 3ZE0E 3IYLW 4J12A 4JQXA 1FORH 1RPQA 1F4WH 4ZOBA 5AVYB 3N5AA 2P47B 4KJPC 1P84K 4G6KL 1GPOH 2RD0A 3CUPB 4GXUM 4RIRA 2GYSA 1SJEB 5JHDE 2EUZA 2O6EA 4WNQA 1UM6L 1D5MA 4RA3A 4XCFH 2AJUL 3BMWA 3MTXA 3WO4C 3NPSB 4A2GA 2C9VA 3OM3B 3FUNA 4FTVA 5B7EA 4AGQA 3EFDL 2FE0A 2AJZA 2LGNA 2B4CL 3MLUH 2OULB 4WJG3 3VFUB 2F74B 4QXWA 4KRPC 3GSQB 4KFZC 3FK3A 1E4XH 3PGCB 4JHZA 3KZ8A 1UA7A 1PD0A 4DN4L 4NCDA 3IGUA 1AXTL 1DVFA 5KW9H 2ZF9A 1BZDA 4I0PD 3OXSA 3RX9A 1FE8L 3VU2A 2Q10A 3TT1H 5IFJA 3QA3A 1H15A 4O9HH 3VXPB 3QIBC 1F3JB 1YEEL 2Z1PA 3BLBA 3E1ZA 1HSAA 5IW6B 2YZ1A 2MTAA 3MRGA 1EEYB 3P11H 3HHMA 3II1A 4J4PA 1G9ML 4ES9A 2NZ1A 4FI6A 5A1AA 5F6IC 3TBYA 2O6FA 2YQBA 1HH9B 3HB3C 3EJRA 5D70H 5CJQH 4R4FH 5CBAB 3UJTL 4ZMOA 1IEHA 3KLSA 1ECYA 2OMZA 2VXSH 3ZL4H 1S6NA 4MQSB 1A8ZA 3S3CB 2PR9A 1RIUH 4L4JA 1KIUA 5ES4B 4KO7A 5AG8A 1KEGL 2J57A 2A6IA 2NY6D 3WNIA 1GRWA 2JJTC 4KZ0A 2VW7A 1ODUA 3SOTA 5IHZB 3V5DB 2R69A 2NSMA 4CVWA 1DQQA 1OAQL 1NMBH 3L13A 5HI5D 5TJWK 3JZYA 4UNUA 4S1RH 1MCWW 2XWBA 2Q76A 1IAII 4BE5A 5IFAL 4XH2A 3HC4H 5DGQA 1D9KA 3KM1A 1OAUH 4WSGA 3VXMD 1U33A 1LK3L 4F5CA 1BZ9B 4I9WE 3AGVA 1YYLH 2YAHA 1ZTMA 2WUBH 3WJJA 1K8IA 1C5BH 4YR6A 1IAOA 3TNMA 4JCWA 1SYSA 2B2XL 4X6DF 4OY9A 3IPBA 5IB3A 3K1DA 4IQHA 4PGBA 1BA9A 4HV8A 2WBXA 3IGAB 2WNXA 3G9VA 3H7BB 4K3EH 4NFBA 4GIOA 3RUGB 3VD4A 4QKTA 3CN3A 1SN5A 5E24E 4Y1TA 4GT7A 5F7YC 3VNYA 2BVPA 3AADB 1B3IA 2IXQA 3BFQG 1OARH 1ZGLM 4XP9L 5ICXB 1RHHB 3W0WB 1NEZA 3D2UA 2WW8A 3D51A 3FRPG 5HHQB 5JW4Q 4Z8FH 1KNOB 1KPUB 1UJ3C 4MSWB 1I85A 1S2EA 3M45A 1J8SA 1OP5K 3UP6A 1WG3A 1IL1B 3GMPB 3LZQA 1KGJA 4MZ3A 4O2CA 5EU6E 4KUZH 1UD8A 4BZ2A 3ROOA 1HN1A 1I75A 4BK4A 4L8DA 3ARGA 3BP4B 3ML8A 1DZBA 2V2XB 1CLYH 3O41A 3KNBA 1W72B 4P3CL 4M4RB 4N90E 4R5VA 2YA0A 4K3JH 4EVNB 4ZMQA 4ENEC 1NFKA 1QYGL 3UZEC 5IQLA 4MNQE 5M94B 1UZGA 3QJOA 2YLHA 4YL9A 1BMWA 2R2BA 3WEAA 1NCCH 5EN2A 5TE6H 3RVUD 2NT0A 4LMQI 2CR6A 4NZDA 4HIJA 1F4XH 4ZUTA 5L7XL 3HFML 3NJIA 3LKOA 5DJ2A 5CEXA 5CM1A 4P57B 5D7KE 4AVHA 1TVHB 5IW1A 3SDDA 2EIEA 6PCYA 1L0PA 1WFTA 3SE3C 1PSKL 4FLOA 3DHUA 1C9SA 4JR9L 3JTBA 2UXGA 3TPUB 1CJYA 3RYMA 4BFFA 4YBLB 4DTGH 3DIVA 4PUBH 3V4PL 4LOUD 3LHAA 1NINA 3C9NB 4LPYA 2IANB 1KIQB 4XCYB 1OZUA 3DX7B 5D7IA 4NN5B 1ZT7A 5GHWH 4P5TA 5L88H 2CDFA 1JNLH 2J8UA 3KVQA 1EMTL 2JI3A 3A4EA 3NDYE 3TCLB 4H1LH 1M1SA 1MI5A 2CR3A 5I1LA 2DQTH 1JPFA 2BNQB 1TJHH 1GYWA 5JW3H 1JPTL 3BP5A 2WQWA 5HJ3B 4LEXH 4G6MH 5C0JB 4QRTB 1NBCA 4RMQA 4H8WH 4IIZA 4N5EC 2WVTA 3L2MA 3CTTA 3E3QE 5F8QC 1KCLA 1GKEA 1J11A 4PGCB 3ZDZB 4ZMZA 3FU7B 4FA6A 4IRJC 5ANME 4Y16C 2Z7UA 3RDJA 2X4NA 1HCYA 3NCMA 1RJLB 2FX7H 4AOFA 1KLGB 2VNCA 3NABL 3NJLA 2BSSA 1KF9B 1HCVA 1MDTA 2W1NA 4JVUA 3FHEA 4OJDH 2BIOA 2VQ4A 3S36H 4JFYA 4K73A 5FO7B 4OV6F 4DPCX 1AQKH 4M1GL 4C59B 1E9OA 5FFGA 5SWZD 1OVZA 1OAZH 4OM1H 1VIWA 4OCSL 1G7PA 3OPZL 1EZLA 2Z65C 1GMIA 4M1CC 4DGUA 4OF5A 5M95B 4IIQC 3GWJA 3WI9A 2VLRB 3GIVB 4ONGL 2KH2B 4MA8L 1EAOA 1QI5A 1EZVX 3DIFA 4EN3A 3E8VA 3PPEA 2O1AA 3EYVA 3IT8D 4OLYH 4G7RB 4AKOA 4CSTA 3IGFA 5BZDA 4H2AA 2QSTA 4U6YB 1NAMA 4W9GC 1E3ZA 2IDTA 1FV1A 5HJGA 3ARYA 1W91A 2PYEE 3KPSB 2GJ6A 2H6PA 4HKBB 3A6BL 4PJ7E 1XEDA 1BZ7B 2CD0A 3FRPB 4RIRB 4ISVA 1G1OA 4RFOH 2BJML 1E43A 2BFVL 3MVSA 1IC7L 4LLDA 3CVHA 4MHHG 4XHJC 3V0FA 1RPUA 1QEXA 4HS6A 5A7EA 2D7MA 5HGAB 1QBLL 1MPAH 4X4KA 2F58L 1BXAA 4LAJH 1ZGLP 1G5GA 2G2PA 1C12A 3JVFC 3KR3L 1M05A 1UHVA 3S3BB 5K69A 4JKLA 5KBPA 1MQ8A 2BW4A 4BK5A 4ZMAT 2P9RA 1CGXA 3T3MB 3WHE0 4FNLH 5ITBH 2VQTA 3BZ5A 1DVFB 4Q2ZA 4I89A 2FO4B 3OXSB 1ZTXE 1KT2A 4AX3A 2B20A 5CJ8A 5IWLC 4BRVA 4JDZA 2LU5A 2C9AA 4BBWA 5I1DA 1G9NC 4YIQA 3LH9A 3HG1A 4OGXH 2ZONA 1MCNA 4RFNC 2D9CA 4U3HA 3M07A 1B9KA 3CXFA 3BUDA 1WD9A 1WVZA 4Y19E 2GBTA 3KXFB 4KJQD 1CFTB 4TLKA 1MZYA 1FL3B 3CSGA 4WI0A 4Q9QH 3B9KC 1G6RA 3FTSA 4G43A 4OZ4A 3BUTA 4X2UA 4EOWL 1J12A 2CSPA 2YK1H 3TIEB 1I9IL 4N1HB 1QRND 2RQEA 1QHPA 5GS0C 3ZKND 5IR1A 3ZE1F 1JNNL 3T6WA 4NJAL 4EE2A 1MREL 4YSOA 4PJBA 4YEFA 3BISA 1ZY9A 2A6IB 2CO7A 3DSFH 3TL5A 3GJFB 3GJEB 5IV2A 4MXWL 2EYTB 1PG7L 4GOSA 3QYMA 1IC5L 3HCVA 1QRKA 2AXJA 2J25A 5F3FA 1S3KL 5T1MA 2ICEC 3DV6A 3VXSB 2GUYA 5I30H 1B88A 5BVPH 5G4NA 2XWBB 2Q76B 4N8CL 3F58L 5E9DD 2GBAA 4F33A 4M8RA 2JTYA 1YNLH 4ZG1A 4UNVA 5J6HA 2VDQL 1BJ1H 3M1CA 3WY3A 5JW4R 1DEEB 1ZV9A 3KGUA 5KVGH 5FKAA 1FGNL 1NDMA 3DVFA 5FYJH 3ZKXC 1R3IH 2NLJA 1I8IB 2CMRL 4CBPA 1P1ZB 3FOLA 1IIKA 1GKOA 1JZGA 5DUJA 4EBQL 2WYIA 2XWZA 3APFA 5IB3B 2Y6SC 2R0WL 2DMHA 2UZYA 5EFIA 5ICZA 4PGBB 4HV8B 3LPFA 5F7DA 2OX5B 4N0UB 4QTHB 3QUYC 2NTFB 4NQCE 3MACH 4I3RL 4F57L 2OSLA 1IB5A 3QWOA 5IESL 5DMGD 2XTJE 2SEBA 2DI8A 2K1MA 2VM4A 3VI4E 4N5UA 3NIFE 4QF1A 5H8DA 3ULVF 5K39A 1PZAA 2IMNA 3PNWB 4AQEB 4X6CB 1VRSA 4CN4A 5AVQB 3JWOL 3IS0X 1F3DH 4OLUL 3TZVB 3A47A 4OCWH 2FJUB 3PHQA 1INDL 1RMFH 4PVMA 3TJPA 2ZXBA 3QUGA 4KO6A 2N0KA 3VFMB 1R24A 2QGEA 1XBRA 1GOHA 4FP8L 2GSGB 2APFA 3O9WC 2ATPA 1FVEA 3OD3A 4Q6IA 2CKBA 3UDWA 1OCCB 4F8LA 3H9SB 4C56B 2Z9TA 1NCJA 3VTMA 4QIRA 3B2DC 3DPDA 2ZSWB 4HQQL 1MQKL 4XP4L 3HE6A 3RPIA 3DX9A 5G55A 2VR9A 1L9SA 2X89A 1HKFA 1AS6A 3MRJA 5IQ7L 1RZPA 3S7GA 4PJBF 4OJFL 3FN0H 4GKSA 4OM0H 1BPVA 4AMXA 4W6XB 3ZLQC 4R7VA 4OV5B 4K7PL 2HCZX 3BVVA 3SBQA 4PJFF 4HPHA 1Y18A 5J89A 3R1GL 1QFUL 3HI1B 2HJKB 4RISL 1ZT7B 2KI6A 2IEPA 3M8OL 1JRHL 2J8UB 4R2GB 1JGIA 3T4AB 5I1LB 3PWVB 5DMYA 1F4YH 1JPFB 1S8DB 1H5BA 2CJUH 2Y36L 2PR4H 3BP5B 1DUYB 1ZLEA 4BGLA 2JLPA 1SF5A 4FA8A 1MZZA 1U8HA 1SXCA 3WG7B 1VZIA 2VLJB 4P2OA 3RFRA 3V0EA 5LVEA 3T0XA 2GK0A 3A22A 3MRKA 5I1GL 2FL5A 2GEEA 5K1NA 2DQIL 2MPAL 4E9VA 4KY2A 1UYWL 3MQIA 4KX8A 1BEYH 4QUOA 4X5QA 4HJ1A 4M6OL 1U30A 4F9LA 5HDLA 1QD0A 3J7HA 1CIUA 4RGMB 2X42A 1H9DA 1E27A 2JJWA 5EEVA 2OQJA 5AVXB 3TH3T 4HT1L 3VXTA 5ALBL 3WIIL 4PCSA 5B1BB 3FQRB 4TLTA 1E9OB 1DQLL 2BP5M 5E7FA 4ELME 3JYBA 4IBSA 3UGUA 4HCRL 3MXVL 5GRVL 3C8DA 1Q0YL 4HHAA 2OJZH 4MNHB 2FH8A 3DMMC 2AJXL 2FJSA 4JO2H 5BMFH 4J6RH 1PZ5B 1P69B 1UD2A 2DQDL 2JQMA 2VC2H 3BKYH 3DIFB 3MOBH 3SYPA 3ME0A 4EN3B 1U8MA 4EKXA 3O6KH 2Y1YA 2B5IB 3P30H 3DLQR 1KYOJ 3G5VA 1NAMB 2H1PH 1HNYA 1FV1B 4JGNA 3UPRA 2F8VA 4WCYL 2R8SH 4P5KA 2GJ6B 1R33A 2FGWH 4IBLT 1SFDA 4PGZA 5F1NB 4ISVB 4NRZB 3UJIL 2CA3A 3CMOL 2ZKHH 5DJYA 3EJCA 4EZJA 4NKDA 3Q7JA 1MW0A 4ICXA 3BUQA 1J9TA 4IHOB 3G6AA 3HUJE 4LCIL 5FK9A 3T2NH 4URKA 1CZ8L 3L81A 5G2NA 2Q7YA 2R7EB 2W0LA 3QG6B 1E9QA 5KSAC 3GTNA 3EHBB 3ARBB 3QNZA 3FW6A 1KT2B 3EFFA 3MNWB 4ODXB 1O0VA 2VN6A 5ACLA 3L6FB 5DMIL 4WWKA 4FG6D 1NCGA 1FCCA 2HJLA 3LRKA 2LW3A 3PHOA 2NY5C 2X1WL 3THML 4MYWB 3OX8A 2H45A 3U4AA 2ROXA 4G8FB 3MODH 4E42B 2FX8H 3G6JB 5INCA 3MRHA 3WE6A 3H3PH 4M3JA 1ZTXL 1Q9KB 4F7KA 2B3IA 4WI0B 4P2RE 3BJ91 1NEUA 1G6RB 3I02B 4G43B 4NNYA 2Z35B 3FQTA 2FD6L 3II2A 4PU2A 3H8NA 4XCEA 2ITCB 2MNWA 2YEZA 2FB4L 3AW5A 5FWQA 2NMSA 1AAJA 2FQGA 3FFCE 3TTSA 4TPRL 5IVXB 1QSEA 3INUL 1HT6A 1S7XA 2CO7B 4X7DC 5LBGA 1ZEAH 1NCDL 5GS0L 1LJMA 2FIKB 4HAFA 3F6LA 3HCVB 3BLPX 1E6JH 2GVYA 3EF7A 1CXHA 4AK1A 1WS7A 4GSXA 5ISZE 5CGTA 3CHXA 1MCHA 2QVKA 1OPGH 4F33B 1BQHA 1FDLL 3VFWA 2AAAA 5KYUA 3V4UL 1BV8A 2DTSA 1JZHA 2X1QA 3GF8A 1L7IH 5CR1A 3CQQA 2QV2A 5F1SA 5JDJA 4XPFL 4U1NA 5DJ6B 1NDMB 3ULAB 4G80B 2EICA 3AS1A 5IB5A 4R9HA 3CIAA 2K3HA 3FOLB 1J1PL 2WXJA 2E9IA 5D1ZB 3VI3F 3ULUF 2EE2A 2FYYA 4FQ1H 4X8JB 1SGKA 1KTDB 3RJDA 4KVPA 4PW3A 3UZVA 3A3YB 2UVFA 5F7DB 3PQYA 2CLRB 4XNAA 1HFUA 1BDYA 1DEDA 3QWOB 4G42B 1PBYA 5FX3A 3WFBL 3BPCA 1QW8A 1XB3A 4XWOD 4Y2NA 1G0DA 2H3NA 3QRGH 3W39B 3MRIB 4TTDC 5SX5K 4XP6L 5J11B 4Y4KA 4GAAA 5HVWA 5HDQL 3IDYC 2NY2D 2OMBA 4NZRH 4I4WB 1JWMA 5DJXA 3VRJB 3PHQB 3QJQB 5LG6A 2JF1A 3IU4L 4PJDB 1S7UA 4X80H 4H0GA 3DO3A 4PJIA 1HHKB 3OSKA 1WZMA 4F7PA 5HYJA 2Y3AA 3EO9L 3CPUA 2ZOUA 3Q5YA 3FFOA 1AYRA 1MCEA 3TN0D 5EC2B 2ZKWA 4OGAC 2CKBB 4FQCH 4P0DA 3MV11 1NIAA 2K78A 1KLFB 5DQDL 3V52L 4WY7H 1K3ZA 2DIJA 2YRZA 5DRNB 4HS8H 2D3LA 4Y5XC 1A1NA 5CCHE 2AGJL 2CNZA 2AEOA 3QDMD 5TE4H 4FNRA 4FQXC 2VW4A 4U6HA 4HWEH 1QSZA 4AVJA 2ICWB 4K23H 4YHNB 5FCUH 3BPNB 1IGCH 3SN6N 2XV6B 3GHBL 3WFHA 2YPLD 2F19L 2W95A 4EZMA 5B3SB 5C0AB 5CR8A 4HGWA 1B0GA 3QXDA 2DLHA 3PIQB 2AZUA 4IGBB 3S5ZA 2F53B 4L9LC 3VG9C 4LCWB 1BREA 2AK4A 3BDYH 5LCVL 4MDJB 5CIPH 4LSTH 1D6EA 1WFUA 5KUKA 2HVKA 1CD9B 1TETL 4WI4A 2F7IA 1BFVL 1BG9A 1M7XA 2CHWA 1YNTA 1MCQA 2UV3A 3FSZA 1JP5A 3V4VA 4MAZA 5A2BA 4FQJH 4P2OB 3TF4A 1WUZA 3OBAA 2FQEA 3HBPA 1BQHG 1OAKH 3MRKB 1TU2A 1ERNA 2FL5B 4B9ZA 1CMOA 5TDNA 4Y4HD 1QR4A 2FEDC 2ENJA 5F97E 5MI0B 2JB6A 4GLRH 1TZHA 3TO4B 1KPVA 4X50A 1E6OL 3QUZA 2JKJA 3VXTB 3SE4C 1LDSA 3ZE2B 4O5LH 1RULH 1T20A 4LRNH 1IBZA 1YEKL 5DK2B 4U1SB 3ESUF 4ZW3A 5FYLH 4GQRA 4I18B 1CLOH 4QRSB 1NL0L 5ENWA 4Y2OA 3S35H 4BSJA 1LEGB 3NCYS 4XXWC 4M6ML 2Z4QA 4L4TB 1MFCL 1UXLA 3QSKB 1VB9A 1KMGA 2XJLA 2VZOA 1ZANL 3S5LG 3MJ8A 3E6HB 1ZCRA 4X7FC 2YC1B 3ZT6A 1T1XB 4PBVC 2VXQL 5JORA 4BSWB 2WBJD 1PIFA 2P46B 5B39G 4JZJA 5HI3D 3U7AA 4MS6A 3TX4A 1NSNH 1W2KT 2K0RA 4JG1H 1KENL 4P4KA 5HHVL 4G7VH 1F18A 4OBRA 5HVFB 3RVWD 4FHJA 3GZKA 4F1ZA 4AVKA 4Z3HA 4PJEA 1S78C 4D0DB 1M71A 1NCAL 3HNVL 3Q2VA 4JMNA 3O6FA 3GSNL 3QCVL 4OB5H 5LBSH 1EGJH 3X1FA 2OSYA 2ZYRA 4Z6AT 5CCJA 1ADQH 1AR1B 1XT5A 4I0KA 3ZMNA 4BK8A 4AYFB 1XGQB 1U8JA 1DQKA 1RZKL 1MVUA 3N06B 3MUUA 4APQA 5DHVH 1I8MB 2A3TA 2H26B 4OZHE 2FECI 3EFFB 1EHXA 1CICA 4URTB 2VH5H 4HCIA 2AI0L 2RFXA 1XIWC 4WWKB 2OMYB 4WFED 5TDPA 2EVJA 2CIIA 5DD1H 3NFPA 3OX8B 1L7TL 4QRAA 4F2EA 2BMKA 3IFLH 1DFXA 2YSSA 5DS2A 4PJ5A 1H3GA 3DRTA 2F61A 4NPYB 3NCJL 2VSDA 3U6XA 4HA1A 1MOEA 1TZGH 2DS4A 4YK4C 4U3CA 1CDIA 3LEVH 4IMKA 1CL7I 2X2JA 4U1MB 4N9GA 4NKMB 3WLBB 4FMFA 2EUXA 4L8BA 3BAEL 3BWUC 1QSEB 3JTTA 3V5HB 5LG1A 5GZNA 3D85A 1R6VA 1S7XB 3CDCA 1UWXK 1U8QB 1BVNT 1I1CA 3U30B 4DPRA 2X12A 5ABDE 1FL6A 3CH1A 3EDKA 4OT1H 2UXFA 2IQAB 4EXKA 2F1AA 1PQZA 1V7ML 2X0UA 2NDGA 1FPTH 3HPJA 3TJHC 4FG4A 2Z92A 1N6UA 4OUUA 4XB3A 3KL0A 4IDJL 4U1NB 2G3NA 4QOKD 2GEQA 4LU5L 1ZLUK 4XP5H 4MFHA 2NY6B 3HVNA 5CD3B 1GL4B 2ZXCA 1A9EA 3NIGB 4M1DL 2H4EA 2DI7A 5F7UA 4NC0B 2F15A 2VLME 3LPGA 1X9QA 2JXMA 3UZVB 1D2OA 3V6OE 1KCWA 2OI9C 3GMQA 2EIBA 1LMIA 1LO0H 1RJZA 3VXMB 1M7UA 2DIAA 1MELA 2N7BA 4JUTA 4PJHF 3S5LB 5C3LD 4GAYA 2E7CA 4H0HB 4P4RA 5B39B 4Y4KB 4CADA 5AKTA 3L3HA 2P7TB 1E5AA 1AGDA 4PLOB 1ZVHA 4H4NA 3ZYOA 3FT2B 5E6SB 1HHJA 2JCCA 4XN1A 3LQZA 2NSXA 4ZUVA 3X3FL 2CBQA 2F7QA 3I6KB 4A2HA 4HPOL 1BD2D 2F5BL 1OB1A 2RAMA 5FOJA 3CXDL 3PP3H 1MCOH 4KQ4H 3RL2B 3PWJA 1KYDA 2Y7OA 5EBGA 3PE9A 4PJ9C 3RA7H 4GQPH 2VERN 3RTQD 1IUZA 2ZWKA 1J05A 1Q9WB 3QEQA 4FI7A 4N3UA 5L2KA 3MRRA 4UTBH 4MXQD 4AGPA 1BPLB 2HTKD 2YPKA 4G3YH 4WEBH 3ZX1A 2ZAIA 2OMUB 4FZ8H 2WGNB 4UQEA 5AKVA 2X4TB 4MA3A 3TM6A 1PX3A 2A1WH 4XBPA 3Q8BA 1VCBC 1IO4C 4FXKC 2A2QT 4M7ZC 4Q6KA 3K0WA 1FFPA 2JKSA 2WO2B 3WMSA 4ZNEA 2PXYA 4U1JB 2CLVB 4YFEA 1OO2A 4NN6C 2ZICA 2EO7A 3MRLA 3T3PB 4N8UA 5LXGH 3IRZA 4JNXA 4ADJA 4MJ5B 1F86A 3V7AG 4Y1AD 3S3PA 1T03L 4NKQB 5CN3A 3MYZA 2AMUA 4DEWA 3WHE1 2QMKA 3EJYD 2AK4B 3VFPB 3IGKA 3IB4A 5EBWA 1EPFA 3KPOB 1KBKA 2UY6A 2WLMA 3WKML 1D5BA 3PXJA 5E8DL 4XNXH 1FJ1A 3BIAX 2A77H 4LKXA 2XN9A 3LRSA 4P46C 1YN6B 5TDNB 2NXZD 2HPTA 5CD5C 5ETUB 1H3VA 2DN7A 4FJYA 2JB6B 1TZHB 5BRZD 5GS1B 4QHPA 4JFXA 1FAIH 2PF6A 3HNSL 2X38A 2YRBA 2PP7A 1EAPB 3ZE0F 4YDVA 1U8LA 3F8UB 3LN5B 3NCFB 4NZTL 1T20B 2NCMA 3WS6C 4YDKH 1CDYA 4Z3EA 4XBMA 2WANA 5ID1B 4PH8A 1IU1A 4Y2OB 3HZVB 4MZ2A 3CK0L 1NQBA 3QK0A 5CSBA 2YBGA 1KCRL 2EDYA 3W56A 4FFZA 4IBUA 5SV4A 4HULB 3MJ8B 1JHKL 4Z7WF 1DHKA 1I53A 4I77L 5JORB 1DJZA 2R2HA 3ZTNH 4PEEA 3HS8A 3RWEB 1CXEA 5B7MA 4JZJB 4YN3A 1KYFA 4N2KA 2O5YH 5KSBF 5K9KA 2MOGA 3ZOAA 1BEXA 3L3KA 4F8NA 2IBZY 4F24A 4I87A 4N8PA 4WW1B 4TUOA 1RZ7L 3LH8A 1IJ9A 2XWEA 5HY9A 2QGDA 3AABA 4FD0A 4ZFGL 4PRIE 1E65A 5ICYB 3BRDA 2CDGA 1AFVL 1ZSHA 3CMGA 3U7YL 1F42A 1LQSR 1VFAA 2GJPA 4NP9A 4L18A 1QBAA 2DI9A 3MR9B 1ZA3B 3NP3A 1U8JB 4P07A 5T1DH 1BG1A 3QDJA 5B1KA 1TNNA 5I8EA 2H32A 1XO8A 4PB0L 5F9OH 4PMEA 4O02B 1Z5LB 3U9UA 5CP3H 1KJ2A 2QQKL 1B3JA 3ZN6A 1OY3B 1Y0LB 2IH1B 1E4WH 3FU3A 4GY4A 3ZIYA 1CI3M 3WDHA 2CIIB 4N86A 3TFBA 1JWSB 1JGVL 2IPUK 3CC1A 3NFPB 3VU1A 3FMGH 1QUNB 2ADYA 4LLWA 1OV8A 1WA0X 3W11C 2C4FU 3SKNA 2BMKB 2P5WE 5BUPA 2AJYH 1KGIA 2COVD 2YSSB 3AREC 5JIHA 3DUHA 2X6VA 5I15H 3ULVD 2Y23A 2EDQA 4D0BA 3BGFC 4KKLD 3WFCH 3MOQA 3SGDI 5I0XA 4D0CB 5D7LD 3UERA 2FR4A 4A04A 2E7LA 4YSRA 4KHXL 4KQ3H 3C5ZC 4DGIL 1WT5C 4XCCH 2V5TA 3GK8H 3WIAA 3L5HA 1JL8A 1M7DB 2QT6A 1BBDH 1OTSC 1Z9OA 2HWZL 3E8UH 4IHBA 4JRXD 4KTYA 3MRPA 4Y16A 4CSPA 4OCYL 4Y9GA 1OM3L 2B0SH 2FDBP 1PQZB 1RK0B 4FRWA 4GT0A 3VRLE 1VFMA 3HPJB 2XACC 2V8LA 4ZX5A 1QRNB 3O2DH 43CAA 3BPOC 4NQSB 5I17A 5JHMA 2PWHA 3FQUA 3P9LA 2XA8H 4LB8A 2BWDA 4H20H 4RMTA 1SEQL 3IRPX 3NRQA 2AP2A 4LVHC 3BKMH 3CDGA 1A4BA 4K8RD 5EF1A 5IUCA 2YOAA 4UWQB 3BFOA 5F6HJ 3V6FB 3FB7A 2QQLH 3N43B 2NUTA 5FYKH 3US9A 1S7SA 4LEBA 4UAHA 3GMOB 3KPRA 4IOSD 3JV6A 1F8TL 3WD5L 1X5XA 2L8AA 3ZT7A 2UZXA 1S7VB 2G2NA 5EG6C 4N68A 4M29A 3AGWA 3VD2A 1J7VR 3MGTB 1I3GL 4JRYD 4XZUA 2EDOA 5DD3H 1FRGL 3OLGA 1YEFL 1J1OL 2JCCB 3SB3A 3VCLB 3LQZB 2XQYK 1AGCA 2P26A 5CSGA 1ES0A 2DD8L 2FNBA 1MIML 4KMTH 4NQEE 1SHMA 3RG1C 4BQ9A 1AZZC 1XH3B 1SZNA 2X0WA 3PWJB 2CM5A 4BXVA 2FVNA 1QLEH 2IH9A 5L2KB 2MKWA 5D2NA 1EXHA 3QHZL 1RERA 4ZXBA 3HE7D 4DEPB 4OI7A 2D0GA 4S1DD 4MA3B 1BECA 3IFPA 5CU9A 4CVZB 2CO1A 4JN1L 2KZ1B 3RPKA 4K9JA 4H25A 2I9TA 3VFOA 3LS4H 1XGPA 5D71H 2GSMB 4OF7A 4I3SL 3CE1A 1GS7A 1T83C 2NX5A 3MBED 5IVZA 2FIRT 3GSOB 4AG4H 2YRLA 3SKMB 4LDLB 4GBXC 1RVFH 4PS4H 4H8WC 3C6EA 3KVDD 5F3HB 3GI9L 1GS8A 3GS0A 1T4WA 1AY1H 3LDBC 3C60A 4XNZC 2MQGA 1D5BB 4ZW8A 5IBLD 5CJXC 4NSKB 1WWCA 2D0FA 4HXAL 25C8H 1Q9LB 2OMTB 4UQ2A 4LKXB 1RIHL 4IOIB 4WHCA 5E5LA 4MMZC 2ZUXA 5EPMA 2WOYA 1FNFA 1I4FA 5DUBB 1AKJD 4JFFA 5C2UB 2B1OA 2VDKB 4IJ3C 3WEXB 1PFOA 1BCIA 1KJ3H 3H3BC 1LO4H 5JDSA 4JFXB 3NFNA 4XI5C 3HMXH 4A7QA 5CGBA 2DIBA 5SWSE 2MNUA 4NQDA 4UT7L 3DGCR 4J3XA 3UJJH 3TT3L 1H3XA 4KXAA 4NPJA 4D8PA 1F90H 2IO5A 3NFSH 4G6AD 4PGDB 3TWCH 1NGZB 1FFTB 1HE8A 2EADA 3P3YA 2TRHA 1REIA 1HZKA 3HVDA 3F83A 3QUYA 4OQTA 3R4DA 4BFJA 2WMPA 3REWA 1ILUA 4P06A 3UPAA 1FNGA 5HDBB 2FRGP 1GW6A 2OZ4A 4KKCC 4PI2A 4RNRB 3F7VA 5KS9E 1JF5A 2KLRA 1N8OE 1HQRB 3SKOB 1NBVH 2GUOA 4OIIH 2OMVA 4Y7OC 4QYAA 5JPNA 1QSFE 4CN1A 4PJXB 1PFCA 4NFDA 1P5UC 3IMUA 3W5NA 2CBTA 2BSDA 4TUOB 3BPLB 3G6DH 4U1IA 5CGMA 4LARL 3O3AA 2V8MA 2CPUA 4HETA 4NO2B 4L4VE 2CDGB 1Z5HA 2NY1D 5T33H 5CJOH 1X5JA 5CZXD 3SPVA 3ES6A 5HP5A 3ESNA 4MB5A 4NC2B 4TRPH 3BAKA 1IC1A 4OLVH 5F89A 3QC6X 5E56A 5KEZA 2X2IA 3DXAA 1JZEA 2VZSA 1KN4H 4MA1C 3UBXA 1DANT 4JO3H 2BCMA 3QDJB 5AOKA 2YD3A 4GJTB 1BYNA 2BVUA 1IAMA 1C16B 1WZKA 3KS0H 3EGDA 1ZOXA 2YXWA 3I2CL 1DQDL 1Q94B 4GG6E 1KXVA 1TEGA 5EZPA 4O9HL 1H6FA 1X4XA 1ZPLA 3OB8A 4U49A 2ZX5A 1CI5A 1BP3B 2E4FA 4KVCH 4WJ5A 2DMBA 4LLWB 5DTFB 3UC0H 4BZ1H 2GC4C 3P11L 3VRIB 1T5KA 5IHUH 3Q06A 1G94A 2UVEA 4UT6H 5FXCH 5AW4B 1U0QA 5CJQL 3QUHA 4HWBA 4CMHC 2Q1EA 4TNEA 5BS0A 4JS7A 4OZFB 5B1CA 3O2WH 3ZL4L 1ZIBA 4D0BB 4MQXD 2I25N 3FB8B 4V11A 4Z78B 1RIUL 1E9PB 4G8GA 4P49A 4H7VA 4B0MB 2A6JB 4YSUA 4LLMA 4AGOA 4ZODA 2NYYC 1Q72H 3O4LD 5ESQA 4FFWD 5FYJE 3X11B 5JUEH 2H0FA 1Z9NA 1UB5B 3LZRA 3OPUA 4RDQG 4S1RL 2IDCA 1R9FA 3L54A 4F8OA 4HKJB 1SOXA 5F7AA 3FUDA 1QACA 3OAWA 3SDCC 1O7SA 1DQML 3KYOA 1PTZA 4NUJB 2ZP0T 5L8KB 5JPMA 4M5SA 4W93A 3ECBA 3F7LA 3Q05A 3STZA 4NUGH 1YYLL 2Q8AL 1W72H 5BVJA 3FQUB 2DWDA 3ZYZA 3VI4F 4YZFE 5HHMD 3NIFF 2NY3D 5A6IA 1KPRA 3OZ9H 3CDGB 4ZOAA 3DMMA 4GRLA 4O00A 4Z77A 3BSGA 4YFDB 4KDTA 5AOLA 3T6QC 3FB7B 4YLQT 2ZAHA 1E4XI 1FFNA 3HOGA 1CLZH 4WFGD 1JCVA 1HXYB 2JFCA 4NAQA 3TC9A 5FC9A 2UZXB 1F58L 5HVHC 2Y1ZA 2G60H 4ICWA 5D2LA 3V10A 3S88L 4L3CB 4OZGA 1N6VA 5A7BA 3S2CA 4AYSA 4NZJA 1AG0A 2ZNXA 2IOIA 3U0PA 5I66A 1U6AL 3BWAB 5AAWA 1MJJA 1CLYL 4TSCH 1KJMB 5F7NC 5L8JB 2W60A 3L3DA 1KXHA 4PHZA 4X9YA 2EP6A 3QUML 3QIUA 1PKQE 1SDYA 5DJCA 3UBXG 1N5YL 2FATH 3DC0A 3PL6C 1PYWA 1TPXB 1NCCL 1YEWA 3UP1A 4DVBA 1A9BB 3GMMA 3MUHL 3KH3A 1BOGB 5TE6L 4BKLB 1N12A 4JM2C 4QRQB 3LKSA 1LP9B 1EEZA 1WEJH 1EO5A 2EE3A 3L4WA 5D2NB 2KZBA 2X9YA 1FWXA 1GZQA 3HNTL 4PRHE 1FH5L 2CBOA 1ACZA 2NY2B 1SEBA 3F3HA 2AJ3A 3O11A 1YC8A 4HEMA 3C6SA 2VMEA 4WWOA 5C0EB 5FOBA 5AALA 1YRKA 2H8PB 2HT2C 3LKPB 2UY7B 4DERA 1T2XA 1E8XA 1IGJB 2P8PA 4NM4L 5HYJD 4G8IA 3S4SB 2OCCB 4PUBL 3TN0B 4BCYA 3VUAA 3EOYG 2NUPA 4JHWH 4ZDHB 1JZ5A 4J27A 1I8AA 2KDGA 5D1XC 1JNLL 2NW3A 2GIMA 2PO6D 4RBPH 1S3RA 1TJHL 1G7JA 1YHPA 3FNKA 4G6ML 3BN9C 3C60B 4KTDH 5F7LB 4R7NA 2J43A 2JQAA 5BXFB 3BAWA 1ZLWH 4GP8B 3LB6C 2YPLB 1YMMD 2AVFA 4OFYA 2HT4C 5J3HD 5EU4A 4ELMF 5CP7B 3MO1B 2BNRE 3QPXH 4IRSC 5FM8A 3L4TA 1LTXA 4FFVD 5B7FA 3KE0A 1TTFA 1FHNA 1LQBC 2EC9U 3B5TA 1QG3A 3SOBL 5JDSB 5F3BB 2CJSA 3KPLA 3S36L 1L9QA 1T0PB 3G5XA 4OZGF 3O8XC 2VDRB 5IROD 1AQKL 3L3JA 2Q6WA 1A66A 5HHOE 4LCCA 4X7TA 4ATTA 4OM1L 5EH1A 4QYOA 5FW7A 2YXMA 5DJ0B 1NPNA 1JSYA 2C9SA 4Y4HB 2YFOA 2WMPB 3REWB 3S6CA 1FNGB 1P4IH 1ID2A 4LSPL 1TQSA 4MXVF 4DUWA 4DP4X 5D6DC 3UOAB 3RFZA 4HWUA 3KDMB 1T1YB 2Z91A 3QWRA 2H2SD 3FTZA 4DKTA 1HINL 3FO0H 4ZAKD 4Q74A 2APXA 3HUJF 4X5WB 3BAXA 4HFWA 3SO3C 1PPIA 3Q9QA 1M1XB 1DR9A 4GEJA 1LM8V 3MRDA 4P8QA 1LEKA 2MKLC 3P0YH 4PP1D 4KHTH 5FB8B 1UFGA 3AQZA 1BAFL 1ZHKA 5D1QD 4QRPD 5DHMC 1HKLH 2QHLA 2BFGA 2GI0A 3QW9A 4UQAA 2P5ED 4UT9A 1B6UA 1MPAL 4QRFA 5F93C 2CK0H 4HKXA 4R6UA 4LF3B 3JVGA 4MCYB 1RURL 4M9OA 4JFPB 1U92A 2WBJB 4J28A 3UBXB 3A5VA 5A2IH 1T0OA 4LNRA 3QORA 1FVDA 2Y72A 2AK1L 4XOEA 2R69H 1BVLA 5I9QC 1RFDH 5IJCC 3MU3A 2UWEE 4FHKA 4QY8A 4OGXL 1I9RL 5I1KL 5KYYB 3IMRA 4EI5B 4LLYA 3BI9X 3L1OH 3MYJA 1SXBA 1ZS8A 2R0LH 3IXTA 3FO9B 5DSCA 1CK0H 3D3VE 5E8NB 1MCIA 4XPGH 1ZS2A 5E6IA 1UACH 2ZWYA 4Q9QL 1KZQA 4L9LA 1A6PA 3ARXA 3CFCL 4XO8A 1RUQH 2YK1L 5HGHB 3IF1B 4X6DB 2AAVA 5DFVD 3CG8A 3QFJD 2WJ7A 4ZUSB 4O2FB 3KBPA 4OKDA 5F9WC 5C9JA 3EOTL 1USQA 3KLQA 4NKIL 3OAUH 2EH8H 2ZT9C 4OFQA 5EOTA 2ED8A 1P53A 3AWGA 1RLWA 4YVNA 4JDEA 1G5AA 4FE9A 4LLMB 3GMNB 4XPBH 5E1AA 3UTPE 4OCXH 1N68A 1MHHA 5EUOE 5IFHL 2WQUA 3FB6A 4G9FE 5E1QA 4J8RB 3D50A 4AT6A 4PJ5D 4V1DE 4YGAB 4A6YA 3RDTC 5C0ND 1YNLL 3FKUS 1M6OA 4MCZB 1A7QL 3KYOB 1FNSH 3VWJC 3PFUA 2X88A 1MCCA 1EUUA 3T0VA 3V95A 4BZ2H 2W91A 3SPGA 5HGBA 3STZB 5FYJL 1P6FA 1SF3A 2HLAB 2DWDB 3D48R 5CCKH 5KZCD 1T7VA 2X9WA 1GXEA 3B3IB 3KPPB 2C7UA 3QDHA 5C08B 3AXHA 1F45A 3HC0B 1QBML 4XXWA 2ZCHH 1BM3H 3LMJH 1UZ6E 3T0EE 3GBMH 4NAMA 1NC4A 1OGAA 2JKXA 3CHOA 4F8PA 1IKOP 1RLBA 2XXFA 4QJ4B 5DS8A 1ODAA 3T0EC 4XPAH 4HWNA 3SQRA 4R8WL 5D7JC 3IMSA 4QOKB 4EZKA 1DFBH 2N1KA 4JZOB 5D2LB 1EJ8A 2A9NH 5IREA 5GRWA 4YHOL 5DQJA 4EI6A 2VLKD 2NXYB 3ZQ9A 1KXTA 4FQ2H 4YJZL 4HGKC 3UZQB 3L4VA 1RMFL 3EZ8A 1YEGH 1F13A 2W60B 3Q8FA 1EAQA 5DJCB 1Q0XH 4WSJA 3FT3B 4WHDA 5JHLA 2NNCA 2LLGA 4KJPD 3QEUA 4Z0BH 1KB5A 2M8XA 3GZPA 1EEZB 1OAYH 2R2CA 3N3EA 1QUPA 1GZQB 1JZ8A 4J5VA 5FW8A 5ACZA 2XVLA 1SEBB 3N2JA 4IYKA 3AVEA 3O11B 2TSAA 2JK5B 3C5JA 1UASA 5TPWH 2J6EL 3T8VA 1BD2B 2P8PB 4AWJC 2J21A 1RZ8B 2Q9OA 2V9TA 4KRPD 4XGZA 5KVFE 2X4UA 4WI9A 4WV1A 5HGDA 3RTQB 3WN5A 4NERA 4UDUA 2OYKA 4AC4A 4EIUA 3GBNH 2W94A 5LO7A 4A66A 5EEZA 2L7JA 2WKOA 4Y5YB 1Q9OB 1G7JB 3B2VH 5FHAH 3RWHB 5I6XB 2P8MA 2R0ZH 4ZPVB 4ZUWB 3BQVA 3HR5A 3QIBD 3CC5A 2LOEA 2BC4A 5C3TA 4FYTA 1IBGH 4AIEA 5INDA 2YPVL 4U7MA 4U6VL 1KGYE 1J8HB 3ESOA 4F2MB 3QO1A 1OP5H 4TLSA 3QXVA 2DQCH 2FT7A 1NAMH 2YEQA 3HB3D 4AEEA 4WW2C 1CFQB 4PWEA 1OLLA 2XT1B 5EBMA 5FYLE 4TQEH 4B3VA 1MWAB 2DYRB 5AKSA 1PDKB 3DV4A 4K4KA 1A7PH 4PYHA 3N40P 5LAXB 4Z7QE 1DVYA 4ANUA 4U7SA 3CVHH 3VXQB 3G5XB 1ED3A 3B2PA 3AM8A 5A6MA 2W65A 3L3JB 5F21B 3V9FA 3P3UA 3WJMA 1JZ6A 1XAUA 1MCDA 4Z7NF 3HG0A 4GKNA 4NENB 3ROLA 5KJRL 3K6SA 1AGFA 1U8CB 3ARDA 2VIRB 3BOVA 2NXZB 2UUDH 4I1NB 2OJZL 4QO1A 4ZQKA 4CMMB 4KZEH 3O4OC 5BMFL 4J6RL 3FT9A 4RSYA 5C70A 1XDTT 2DRUA 5BRZB 3ZYIA 3Q5TA 1OK0A 4Z7OE 5DJ8A 3KLDA 3OKMB 2Y7LA 1XF2A 4MQ7A 4HFWB 4YDJB 5GRJL 3RY6C 4MB1A 1UT9A 1F4HA 4U0RB 1LEKB 3NAAL 5JHBA 3UTOA 1EERB 5T5FA 4RQQA 1SPDA 2LLLA 1ZHKB 2AEQH 4W4OC 4X83A 2ITEA 4CJ1A 1QMUA 1O7DE 3S8FB 1DJHA 1YPZE 1G6RH 1VA9A 4NQVA 1BYOA 5KBMA 1CBJA 4LQ1A 4QTIH 4PJ9A 1O7DC 5I74B 4E5XA 4WUUA 1U92B 1AP2B 3NACH 4JDTH 3QZPA 1IBFA 2IAMA 5E1IA 2EIJB 2QPSA 1LE5A 1CWVA 5DC0A 9CGTA 2EDXA 5EZJA 3G08A 2PW2A 3QJHA 2WSKA 1MVFA 4ZI8A 1A7RH 1EHLL 3BWUF 4ANWA 1DJXA 1MEXH 2R51A 4Z7UF 2DQEL 3PWPE 5EU6D 4UDTA 5L9DH 1ASQA 1T3FB 3TA3A 1DDTA 4ENED 4LLYB 1EHKB 1NWPA 1WIOA 1VJSA 1ZS8B 2E7DA 1QA9A 2VLLA 2FX8L 1J0IA 5IEHB 3SQBA 1JNHB 4XTRC 3H3PL 1SMOA 3AU1B 1NFIA 3P0VH 3BH4A 4GO8A 4MNQD 4XC1H 5E6IB 1NCTA 4RAUB 5I76A 1T1WA 4LEOA 4N9OB 3HI5H 3CZEA 4QCIA 4FMKA 5E8PA 5IJVB 1S9WA 2HKHL 1QAWA 4GAJH 2F7RA 1AD0B 5EOTB 5HYQA 3EOAB 1CGYA 1ZHLA 1XAKA 5FECB 1WIPA 3AROA 1IFHH 5DCCA 5DLLA 3O45A 3GHEH 2X4PB 1T4KB 5FDWA 3F05A 2F54A 4AT6B 4PJGE 1OPGL 4GAGL 5FA4B 1S5HA 4M48H 4MJID 4PLKC 5C0BA 5D7LB 1QZNA 1S9XB 3HAEB 5C07D 5T3XH 4BEIA 4QEGA 3NH7H 4N5ED 3WS6A 4KK9C 1FLTX 4J7RA 3L7FB 4XODA 1AZVA 4KPHH 5AB1A 1OHQA 4WLCA 2E8ZA 4IRJD 2CKBH 4ODUB 4JRXB 4Y16D 2CCVA 4MMXB 1F5WA 1PW3A 2ZKXA 5I75B 1OGAB 2J12B 1NCNA 3DX0A 3VDBA 2AXWA 3B2MA 3DWTA 1EX0A 3MV7E 4F1SA 1C08A 3DHMA 3UAFA 4PJCE 4ELDA 1TVDA 2CCLA 3GUFA 1AO7A 3DO4A 3MMEA 2C1OA 1QPPA 3VJ6A 1AE6L 4EI6B 1X5MA 1HHIA 1Z7JA 4M1CD 4NZRL 1MF2L 4PJFB 3WFDL 4U1KA 2ZUSA 3AC0A 4YFLI 4XZ4A 3V0HA 5SWZE 3TNNB 3GRWL 4JO4L 1BMZA 3ABMB 4FDWA 2YGOA 4M5YL 5F1OB 2YAFA 4OF3A 2MFNA 1MHPL 1KJVA 3PRZA 4HLJA 3EDDA 2IGLA 5ADPH 3MREB 1XSJA 5E94A 4WY7L 1KB5B 1CN4A 1MJ7H 4JL1A 5B8CB 4PRNA 3M6DA 4HS8L 4JRYB 4JN2A 3Q6GL 3TVMA 1XCTB 4XCNA 1WRFA 5DHXB 5DFWH 2V7HB 3ZKQD 2PYED 4LFHD 2X9XA 4S2SB 4YGVB 4XHJD 4A55A 2ZOWA 1XGZA 3WXWH 2CDEA 5FHBL 5E03A 1F11A 1I1RA 2P45B 4UOW0 2DL2A 4FL4C 4HJUA 2X4UB 3G5WA 1KB3A 5HGDB 4FFTA 4TTGA 2WQAA 3MDJA 2FZ3A 3J27A 3LXAA 3V0JA 3KD4A 3NSJA 4L3AA 4Y4FA 1INEH 3QEHB 1BVNP 3QAQA 3HE7B 5DYOA 3SGJC 4AW7A 1DDHA 1IGFL 3BDYL 3OR7B 2J6WA 3P2BA 2B59B 3MGOA 4LSTL 1G4MA 1T0MA 5KVFL 3M1BA 3UABA 4J3BA 1FFQA 2BC4B 2Y06H 2GJJA 5INDB 1VENA 1MW1A 1IGYA 1NEPA 3R06A 4XB7A 4E41E 1OAKL 3QO1B 1EWHA 1CGVA 3BKCH 2B1HH 4OZIA 1B4JL 1LLAA 3L5XL 4MZRA 3B9KD 4XNQA 4AEIH 1BJ8A 2YQ3A 3CZFB 1LD9B 2DDQL 2KQMA 3IETA 1E2VA 1SVBA 4MNGB 5GS0D 3HS0C 3M7FB 4XX1E 1J5HA 2FBJL 1SN0A 5FUCE 1NM4A 4TOYL 4JVWA 1RULL 1V7NH 4JQVC 4F9PA 5JIDA 4LRNL 2W65B 3V0AC 1KOAA 1Z0NA 5FYLL 2GT9A 3B2XA 4YNYB 4Q89A 3VFSA 4BYHA 1P4BL 3OB0K 2EDJA 3RRQA 4F7MB 5I8KL 1A6VH 5CEZH 4ZQKB 4QO1B 1I1YB 4MTMA 5LQBL 1HWGB 1FSKC 3WKPA 4FFYL 5IT2H 4E0RA 1CDCA 4Y88A 1BVKA 3NA9L 4N6RA 5E9DE 1OAJA 5IOPA 2XCMC 4Y5VA 3E9TA 5DJ8B 2PW1B 4G1MB 5MEOA 2XKUA 3VFTB 3FQNB 2I26N 2OMXB 2WLNA 4NQDD 5EO1A 5KUMA 3L1FA 2BZDA 3M88A 1TR7A 3QRLA 4HC1H 4LPCA 3P4OB 1B9ZA 4ZX3A 3O6MH 43C9B 3C08H 4ZMLA 2Y6SD 1I1FB 4RMBA 1PLAA 3AQYA 4JDVB 3RI5K 1WAAE 1UD4A 4OJYA 3QUYD 4WK0B 2EDDA 2GHZA 3OV6A 1EGJL 4A37A 3VXRA 4KTEL 5GGUA 5EEUA 1I1AA 5EIVA 2WPGA 2BVTA 2WWMC 1N5AA 4NQCD 4UMSA 1SDDA 2IAMB 4OBSA 1P84J 1A6WH 4PCKA 3VX0A 1LE5B 3IU3B 1HTYA 4ETYA 4C83A 1C1EH 3CVBA 3G08B 4DGYH 2PW2B 2WZ6A 4UZGA 1U8KA 2VH5L 1TITA 3BQUC 4KROB 5DD1L 2NY1B 4DKEH 5BV7B 3ILDA 1FG9C 3KPQA 2DJMA 2VO8A 3O9WD 2COQA 1RUKL 1D6VH 2VLLB 4H1LA 3SQBB 3UTSA 3D25A 4PJ8C 4GLRI 5D6CA 4F58H 2ARJB 4L37A 2XWJA 5ABZA 5DD5H 3OLEA 3ZSTA 2DYPB 1TZGL 3VI3B 1S9WB 3ZL1A 1DCEA 3N41F 4IRZL 5CWSA 3RGVA 3UAEA 4ZS7H 1LK2A 5HYQB 4QR7A 4Z76A 2I07A 3E1F1 3MN8A 5JOPD 1TG8A 1KTLA 1S7WB 3BGMB 1FL5A 4P9MH 2FEJA 3JSSA 2HUEA 2PNDA 1KDIA 1ML0A 4LRIC 4XN7A 5FO9A 2GY5A 2UZIL 3RWFB 1P7KB 5DRXB 1I7RB 3KVPA 1GGBH 2R4RL 1PZ3A 1S5HB 1JFHA 1GOGA 3QJZA 1VHPA 2P49B 2AQTA 4NJ9H 1SLUA 4UU9B 4XMWA 1COBA 5IG7B 4G8GD 4QRBA 1I3RA 3C8KA 3Q1SH 2VAAA 4RAVA 4XP5L 4WU5A 5FYKE 3ALWA 4ODSL 4B7IA 1TVBA 5I18L 5F71A 4PQXA 1Z1WA 4D3CH 3CFJA 4GIAA 5KG9A 3O4LB 4R5XA 2EC8A 3B2UC 4XP1L 3TYGL 3RZWA 1R3HB 5D5MA 2WOBA 3V0VA 2GITB 3U46B 4P99A 2ZCZA 1NKRA 2IWKA 3QJUB 4B5EA 1A3RH 4PVBA 4U3SB 1GSMA 2AQPA 2XZQH 5GRZA 3IMBA 5B21A 1KTKE 5T1LD 1LO0L 3B1TA 1C08B 4IMLB 2YBRA 3OJVC 5IMLA 2NQDA 3FL7A 1CR9L 2WV3A 5HDBE 8CGTA 3HZYB 2HJFA 2RCSH 4Y2DA 3RU8H 4U1HA 3NPZB 3QCTH 3VJ6B 4KNUA 3ILPA 2VUYA 3X3GL 2NY3B 32C2A 1EEQA 2ADJB 2W5PA 4UZUA 2X70A 3DURA 4N0YH 3DMMD 3B9DA 5L0QC 1XB6A 3CCHB 3MLTA 4JKPH 2OK0H 5EZIH 1MCRA 3N0AA 4DGVH 2LFGA 2DQUL 2ILLA 1KJVB 1ZLVH 3B43A 4UYPA 3RA7L 5A2CA 5CJ5A 4BKSC 5E94B 4WEBL 4QTFA 1OCWL 1EV2E 3V4VH 3VXNB 1W6WA 5FO8B 4FZ8L 5C6WH 4JN2B 2ADIA 5GGTL 3V8OA 4XCNB 2O5XL 1RKRA 4L1BA 5CUSH 3TBSA 3ATFA 3VDCA 3KBFA 2DLFH 1T6WA 3CZGA 4HBCL 3QULB 4B27A 1VGEH 1OE2A 4MBRA 2V2TA 4DCQA 3V2AR 1F11B 2V5YA 4MD5A 1GSKA 2IV9A 4FXGB 4XMXA 5MEND 4I88A 5KSAD 4X5LA 3VMNA 5LXGL 2WSDA 4BFRA 2BCKA 2M2DA 4I5BA 2LLNA 4Y4FB 2RJMA 1DDHB 4M5TA 5KYXA 3FTGA 1Z9LA 2BVQB 1ZSDA 5JHDA 2B14A 5AAMC 4FF9A 1NUFA 3AT8A 4AI7A 4QNPF 3OZKA 1B2WH 4XNXL 4Z0XA 1LWRA 1MCSA 1KY6A 2FNWA 5D5MF 5DWUL 2CE6A 3HJ0A 4LSSH 1T89A 1Q1JL 1U8OB 1RZIA 2OL3L 3NPSC 2XQBH 4KKZA 1BWWA 2ZIDA 1CFNA 2X4SA 3BP6B 4YHZH 3TBTB 1XZWA 1YDPB 4EIZC 4CU7A 2PO6B 5IMMB 2YGPA 1V8HA 3HN3A 2VDOL 2Z8SA 4P2RD 3V0IA 2DJUA 3LRHA 1VSCA 2EE0A 3T9WA 5K9OB 1JFQL 4R90H 1U9KA 4N26A 4HU8A 1CTNA 2BS71 4GEIA 3FFCD 1OT2A 4PG2A 5MP6H 5E2WH 3GXNA 3UFIA 1YMMB 3FCSA 2YA2A 1FYTA 2WUCL 5GGSA 4MWFA 2CQVA 5J4MA 3SDXE 4HH9B 3SGEH 3K3QA 1NMAH 2Z6FA 4KRMB 1EO8H 5F44A 3UMTA 5ISZD 1IBDA 3SSGA 3IJSA 2CG9X 5D9SA 5IOPB 5GS2H 1B2YA 4CL7A 1ZKAA 5DDHB 1JTTA 3MLWH 4S1SH 4DOHE 5MEOB 3RZCA 4FERA 3NQIA 5EU5B 1FHGA 4AQOA 4Z7AA 1HESA 1CFMA 3HRZB 3GGWA 4Q4IA 3VE0B 3OGCA 4YMPA 1CDHA 3VVVA 2ZD0A 3UADA 3WY4A 5C2BH 4GG6F 1GZHC 3LN4B 5ANHA 2X3AA 2QPFA 1EJOH 1UD5A 3QDGD 2DTML 3ATBA 3DX8B 4KV5F 4OR1A 1N5AB 3SJVE 3U4EB 3GMRA 2WLHA 4UM9A 4K71B 5F9OL 1OALA 4TTDD 2Z31A 3QI9A 4LVOC 1XTLA 3PJSA 2GFBB 5C0CA 3IJHA 3EO0A 3DTXA 1R46A 4KI1A 4YXLH 3LSOA 4KK5C 1RCYA 5D1QB 3PHAA 5JQIB 1WIUA 2YARA 2FSEB 1CU4H 5IBTH 3WNMA 1N7MH 3CBJB 3KYNA 1KIPB 3UTSB 3DJTA 5DURB 2WC7A 3IMWA 1DBAH 3VWKC 5D1XA 3EUDA 2ZJSH 2A6DB 2ITDB 3HEIB 4P5MB 4ABWA 2OCFD 1E28A 2BK8A 2IF7A 3UTQA 2XZZA 3JWNG 3WKNA 4HG4K 4MJ6A 5MEQA 3MLZH 3HR6A 2B39A 5CEYB 3SKJH 3WFCL 4BHUI 2KPNA 1IC4L 4DQAA 3DNKA 4FQXD 4QRRE 4TUKL 5GZOA 4HJEA 4HK0B 2BOCA 4UINL 5CWSB 5FUZL 5AB2A 1LK2B 2EEXA 2PCXA 1A6AA 1OKEA 3BUIA 4Z76B 2I07B 1OE3A 3QDME 5JO5A 1HL9A 3O3UN 4HDIA 1TUPA 3MLSH 4XRCB 3QCUH 4PVNA 4XMLH 3BDBA 1O7VA 4L1TA 5ALCH 1KN2H 1AHKA 4NNXA 4PJHB 4NQUA 5FF6A 3L9RA 3HIZA 1YJDH 4JFEE 1HEZA 3WY2A 4I1PA 2CO6A 4UOJA 1XF4B 2I9LA 5F7MC 2FUTA 4L3EE 3EIFA 3O2DL 4U0QB 4D9RE 3V4PB 3QFJB 1IBHA 4PTUB 3QFDA 4ADGA 3ZL2A 1FZJA 3PDOA 3FOMA 2B1AH 2CR0A 2YIHA 5K9JH 4RAVB 4WU5B 1TVBB 4KOBA 5ADOL 4WU7A 3CFJB 2XBZA 2PTVA 4F7EB 4YUEL 2P44B 3KLHC 1G6VK 2VRKA 2E4TA 1YVLA 1SUHA 1UA6L 3PWLA 2PWDA 1WHOA 1ZLSH 5EU7E 3W3BA 2FEDD 1RL1A 2VDKL 3NYKA 5G5DA 5B38G 4AV5A 5FYKL 4KC3B 4TVSa 3LZNA 5ECGA 3B3BA 3OR6B 2G0LA 4LDCA 3ARUA 1ZDSA 4JY4B 1WICA 3POHA 3C09C 4TSBL 2WLKA 3BVXA 2BIMA 5DLML 2HJFB 4Y2DB 1OQXA 1SYVA 3R4RA 1QTSA 1TCMA 4NN5C 1GC1L 4FC3E 4KQ0A 5DVPA 5J12B 2ODIA 3ASNB 3DSNB 2Y7MA 4PRPE 4ODBD 5EZOH 1MHCA 2XPYA 1UA3A 3MV8A 5F70A 1OTUC 1YN7A 4PJAA 2BRQA 1AQDA 2JMRA 4WAFA 4IOFC 5ID0A 4N2OA 1OD7A 5E8OB 1GGTA 5KYWA 1OD9A 2YGQA 2ZWZA 4UV4L 4H88H 3NJKA 2NNFA 1JGDA 4J3TA 1HWHB 2AV1A 2VISB 4RGOH 1Y6MR 1H8LA 1W9XA 4QAWA 5I73C 2WINA 4RRPA 5C6TH 3WTSA 4JFHE 4B9FA 1FO0A 3QQDA 4I2XB 1S78D 3QHFH 3W1ZA 2O61A 4RSVA 4NNPH 5C09A 5CXPA 4LO9A 3FBKA 3AACA 1MJUL 1DLFH 4PIRF 4PS7A 2V2TB 1QKZH 2P80D 3NZUA 2IWGA 4MD5B 3K46A 2VJXA 2N0MA 4R96A 1MHEB 2XPGA 5CNHA 2ISDA 3ZE0B 3N42F 4XBGA 2YOCA 3NSYA 1UOLA 1YG9A 3P77A 1T2QL 4AG4L 1RVFL 4CNIB 4YH6A 5GGRB 2VOTA 3WO4B 3WSQH 1XIWD 3CFNA 3GXTA 4P2QD 4APXA 4Q97A 1ZSDB 1CG9A 4XOCA 4PJ7A 3UGXA 1YEHL 5JHDB 4OJCA 3OL2A 1SMAA 2A6KA 2F9BT 3VW3H 2DLEA 2P24A 4KH9A 1OT4A 4KRPB 4FTVE 3D4GA 3QE5A 1Y1UA 3RDTA 3MNMA 1RZIB 2QVFB 4DVRH 5GJSL 2R1XA 1VZHA 4QGYA 4FJZA 1KJ3L 2DM7A 3WIFB 3O3EA 4GKZA 5BUAA 3HMXL 3LXUX 3N55A 4PV8A 3QIBB 2AQQA 1KBWA 5FWRA 5H2BB 4ANVA 3ZHKA 3WTWA 1AQMA 1JXKA 4G8EB 3VGDA 4BH7A 4MJHA 2DZEA 1DVFC 1F90L 3FQ2A 3NFSL 4BH8B 3D07A 5HYEA 4CBZA 5F6IB 2EO9A 2EVGA 2H32H 3TJHD 3EGSB 4Y19A 4PY8J 3ZTDC 5EZLA 3CZKA 2HFEB 1FYHB 1KJ2H 3D12B 5DMKB 5B38B 4YE0A 2B77A 4DAGH 3BT2L 4JFDA 1M2VA 2AJSL 4Z3IA 1JV2B 4J4PC 1KC5H 4LLVB 4HKZA 4N2DA 3U1QA 3H6AA 3P0GB 2I5YH 3NZHH 1WCBA 4UUJA 5DJAB 1BQLH 5AW9B 2Q86B 4CDHA 2YKLH 2YFNA 4N20A 3BZ4A 2VDQB 3QUXA 3G6DL 3L5WA 5H4YA 2QPEB 4YO0B 3OGCB 4R4BA 1P2CA 5E99L 2VLMD 2EE9A 1F97A 3CZJA 5I0DA 3NQKA 2L0DA 1QVOB 3OKLB 4HIXH 4E68A 1KLUA 7FABH 5IGXL 4AH2A 4NO3B 4QHNA 4DP2X 3GMRB 1JZDC 2VL5A 4UM9B 4B9PA 5IEKA 5DMJB 1L3WA 1C8PA 3B1UA 4P23A 4G9DA 4F5CE 2PMZA 4MDRA 3PJSB 4JY6A 1D9KC 3IJHB 4GFXA 2NSQA 2E27H 3SPCA 1AHWB 1N2RA 1GZPB 5IJKC 3LSOB 3FULA 4CN6A 5TK4A 1LGVA 1NGQL 1A4JB 2K6ZA 1YEDB 3WS3A 4HSCX 2PYFB 4HUUB 3WJJC 3MV9A 1YMHA 4KVCL 3B9EA 2VR5A 5AOIA 1NANI 2IBBA 4J6IA 3UC2A 1XCWA 4BZ1L 4Y8AA 5IHUL 5CIPA 1MRDH 2PPCA 4UT6L 4GS7C 2EQDA 1QHOA 2JIXA 4AY0A 1UUNA 5EUOF 4CC1A 3GSRA 1SY6L 2CJTA 4YHPB 3L17A 4FQQB 5J6SA 4LHJB 3HZMA 1KBGH 2CUMA 2AJVL 1MFDH 3LCYA 4EAEA 1H8NA 1XH1A 5EU6B 4E2OA 3BX7C 1XZ0B 1TFHA 2HKFH 2R56L 1I85C 1HYRC 4DPAX 5JTWA 3S97C 1SJXA 3D2TA 2I27N 4MNQB 3ARGC 3Q1EA 2HN7B 3FH8A 4ODTH 2CO6B 1C5CH 1NLBH 5TTRA 3GIZL 2GJRA 1A7OH 5HTSA 2Y7NA 2X6UA 4MJJA 1DQVA 3QFDB 5HYFA 1G7HB 4Y1AE 4DT2A 3D4YA 3BAIA 3ZT5A 1CD1A 4XNMB 5AEAA 1SOSA 2ITFA 2NY7L 3AUVA 3QARA 2KT6A 4KXDA 1E5YA 4WU7B 4LL4A 4ZO8A 2AQ1A 2WP3T 3QVAA 4P46D 3QH3B 4H8QA 3OZ9L 1NZRA 4XR8C 5DHYB 4YHLH 3D87B 4X7SH 3SDDC 5CD5D 3ASWA 4B41A 4KK8C 2C26A 1U3ZA 4CGUB 4ZFOA 3TJEH 1T22B 4KITB 2VSKB 3NOIA 4NRYB 5D7IE 3BH8A 3FQ4A 1OAXL 1ORQB 3ETBF 1MI5E 5KSUB 3SE8L 4YHKH 5LBSA 4W81A 2WTRA 1S9YA 4P5TC 2ZPKH 3K81A 1TO4A 1BFTA 4R2GC 4BM7A 4IRJB 3CVIH 1HZHH 1BLNA 1MHCB 1T0NB 3OVUB 4WWID 1MRFH 1AQDB 5ID0B 3C5SB 4MGXA 3PP3K 1K4DA 4DZBA 5DHVA 5ANMB 2P8LA 4FJ6A 4L0YA 1TTCA 4KRNA 3P2DA 1C5DB 5DT1L 4D9LH 4AM0B 2AABL 2IPTL 3MLVH 4HUVA 2AQRA 2VITB 1ZHBA 1PLGH 1RP9A 3MNZA 4HCFA 2IDUA 3QO0B 4K94L 3ZE1E 4KGLA 4R26H 1HHGB 5T1KA 1TYEB 4RGMC 4IIQB 4Z1PA 3L3OA 3T4YB 2PCFA 2QSCH 1WA1X 2AXGB 1BIIB 4HFUH 4MKMA 5E4OA 3ATDA 4AKQA 4XNYL 4JHWL 4WW2F 4X9BA 1NDGB 3IK2A 5D96C 4PV9A 4XBGB 4YDIH 5I8CA 4U1LB 4WTZA 2UYLA 3H6JA 4F15B 3EFOA 3F65A 3RNKA 4EN3C 4D94A 2X1OA 3OWEA 2PYEB 1ZVSA 1CG9B 1IQWL 4KTDL 4PJ7B 2JELH 4PY7B 4OQTH 4XN4A 5CZVH 1NJ9A 5GGSY 2A6KB 4Z7QF 4IKNA 1OB0A 2P24B 4K3DH 3W11D 2OZ4H 4XVTH 4W70A 2EDFA 4P9HL 3T8XB 1PG7W 5LNEA 3NCCB 4XPHL 1AC6A 3ARED 1VFBB 1SLWA 2GAZB 3QPXL 1A02N 2P5WD 2OP4L 5EOCJ 2UX7A 4KX9A 3L95A 3ULVE 3K71A 3BD5A 4PV8B 5FKPA 5I6NA 5CN1A 3ZQWA 3C5ZD 3ZSSA 4RFNB 1A6UH 4Z7OF 4BK5C 3N9GL 3BW9B 5BQ7B 4ONFH 3MJ9L 1OTSD 3HG1E 2Z8WC 3BIBX 1WBZB 4M8UA 3B9KB 1AMYA 4Y19B 1BVZA 1MFBH 1WFJA 1YPZF 5EEYA 2ZSVA 1BAWA 4X4MA 5FDYA 3V7MA 1FZMA 4OD2A 4E9LA 3QUKB 3STBA 4JJ5A 5DUPH 2CAKA 1NFDA 3P0YL 2ATKA 4PJBE 4G82A 3T6ZA 4NQXB 3L5WB 4EQ3A 1HYSC 3EH1A 4K7PX 4UTBA 2LVEA 4HWBH 5I24A 4R7XA 4YZWA 5EOQL 4M6NH 1WFIA 3EO1B 5F7EL 1JHTB 3MRCA 4FQHB 1A2YA 3H0TB 1RUAH 3ZKXB 4QHNB 2YAEA 1LWJA 5I0VA 1U3NA 3MUGB 5I26A 3QQ4A 4IU3A 4XVUC 4P23B 1AVAA 4G9DB 3FS9A 4M7LT 1RXLA 3CFQA 3BIKA 2W8CA 2DKSA 1KBVA 2G5BA 1NC2D 3HHSA 1CDJA 4Z7VA 4BINA 4B6ZA 1F6LL 3DGGA 2VN7A 1MCPL 4LASL 1JZ3A 1CL7H 1YMHB 1N4XH 4JGUA 2WLLA 1VDGA 4X6BA 1IM3D 3MTRA 2QMJA 5I1IL 4KRLB 5F9AC 1LDPH 3LNIA 3K5SA 5EV7A 2FUQA 2EZ0C 4NQCB 4XPGL 4DO5A 5FFLA 1UACL 5I1JH 3GHPA 2XTJB 4FG2A 2VWEE 3GSRB 3HC3H 3SGJA 3LV3B 1RUQL 2K7PA 3SDAA 4NPKA 1U95A 2XU9A 3TBVB 2CU9A 3VI4B 1R3KA 3NIFB 3CFKA 1IGTA 2M83A 2H5UA 2QSQA 2VXUH 2BRRH 2DQFA 2VWEC 3UROR 2EH8L 3SYQA 4B50A 4TNFA 5EUKA 1XF5A 1AXSA 4OCXL 1JK8A 3BH9B 3FCTA 3O9WB 1AC0A 1K8DB 1WFOA 2JKLA 3F7RA 4QDGA 3EBAA 5T3XE 4QHMA 3VTTA 5J11C 5EWIL 4HMDA 1ID5I 1WGVA 1SFHA 4IW4C 1NICA 4BHUA 4GBXD 1R5IA 3SD5A 2VDML 4F20A 3VXUA 4FLHA 1TJGL 2F5AH 4BZ2L 3QR1A 3W57A 1Q1PA 3LXCA 3UAJA 3PAYA 4Q6IC 4MNGE 3UDWC 1RK7A 3KWWA 1CD1B 1LO3L 4JX0A 4KMLB 3BO8A 3NCXA 5CCKL 4XOAA 2CKNA 3B83A 1M4KA 4JO8A 5TE7L 2AQNA 3HE6C 5CSZA 3U9WA 3U7WH 3IDIB 1BM3L 2J56A 5C0FB 2VKXA 3GBML 5JMRA 4YX2H 5IQNA 3BPNC 4DKFH 5DZNA 3VG0H 1PY0A 1T7YA 2D73A 1GHFH 2EXSA 4XI5D 3FQXB 5FM5O 2HTLC 4GI9A 2ZOTA 1QTYT 5GPRA 4DN3H 1LYQA 4ZYKA 2OXGA 4L2LA 1NLDL 1SN2A 2A9NL 5E51A 6PAZA 1MH5A 3PAVA 2F0CA 3GSXA 4KO9A 5SWSD 5BO1H 1HSBA 4AIXA 2IGFH 5I1CL 3OKKA 4JPQA 1F00I 3OMIB 3ATAA 2BP3A 3TONA 1MAJA 5C97A 1H5BC 3BE1H 1YEGL 4YHMH 4HOMA 1IV8A 2PABA 4DZBB 3DHPA 2P8LB 4KKCD 1Q0XL 5T1LB 5T3ZH 4O51A 2YS4A 4CU8A 2V6HA 2R0KH 2LE9A 4P2OC 5JW5A 3B6SA 1MRCH 4Z0BL 4HUVB 1K5NA 3GSWA 4DP8X 3AY2A 1R3LA 5BZXA 3I50H 5MI0C 3EW3B 4F9LC 1F6FB 1O9ZA 2XYBA 2O5ZH 5D7SH 4MLIA 3IDXL 1QSFD 1TQTA 3TO4C 4AUYA 3L3OB 4TS6A 4ELMB 3KH4A 4AQAA 1HXMB 2PCFB 3IEAA 2ZOLA 2PTTB 4UAOB 3QWNA 4A2EA 1XR8A 4XXDB 2H3XC 4L4VD 1OSPH 2MHAA 2GSIB 3S34H 4WO4A 2GG1A 1S7QB 3ARWA 1FG2A 1T5XB 3N40F 4ORZC 5I8CB 4OLEA 3GSNB 3VTAA 3LQAH 1B4RA 4Y7MA 3LY6A 2R0ZL 1ZVSB 3K2UH 4OQ1A 4AYDC 1ZGLB 4MHHI 4A7VA 3ULUE 2YN3A 5HHXH 2HVBA 2XV3A 4BA8A 2ZOKA 4JFVA 3ULUC 3FFDB 3AITA 4MKTA 3UO1H 3HUJB 2G9HA 1QEWA 4GUPA 1NKGA 3DVGA 4U31A 3W9DB 2CZNA 1X9UA 4TQEL 1DN2A 4ESKA 1V3LA 1NIDA 1ONQB 4JHBA 3GUTB 4HK3N 1AR1C 4IKIA 4ETQA 4O58L 2W07A 3CVHL 4OZHA 5FKPB 1IRAY 1G43A 3BGAA 1ET8A 3IFOB 2NYYD 4UT9H 4FLQA 3LZOA 4ZO7A 3MXWH 1HILA 3GXPA 5AD0B 2EDRA 1OANA 5GISL 2V17L 2X2YA 2O6DA 4KZEL 3ULVL 5FYJD 4L5FH 5DUML 3SDCD 4DETA 2MH4A 4LQFH 4WWKC 3T65A 1WAAF 5GJTL 4X4YA 3CH8A