5ERWA

Structure of hcv e2 glycoprotein antigenic epitope ii bound to the broadly neutralizing antibody hc84-26
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
217
structure length
212
Chain Sequence
b'MQVQLVQSGAEVKKPGSSVKVSCEASGGTLSNYVITWVRQAPGQGLEWMGGFIPTFRTAMYAQGFQGRVTITADESTSIAYMELTNLRSEDTAVYYCARGPLSRGYYDYWGQGTLVTVSSAKTTAPSVYPLAPVCSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Anti-HCV E2 Fab HC84-26 heavy chain
publication title Structure of HCV E2 glycoprotein antigenic Epitope II bound to the broadly neutralizing antibody HC84-26
rcsb
source organism Homo sapiens
molecule tags Viral protein/immune system
total genus 39
structure length 212
sequence length 217
ec nomenclature
pdb deposition date 2015-11-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5erwA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5erwA01
4X6FB 4P3WA 3MREA 3QIUD 1QD0A 3F7RA 2APTA 1KLGA 4PG9A 3RGVA 2PW2A 4LOUC 3O9WA 2VDPH 5FYLD 1DL7L 3MNZA 1OPGH 5D9SB 1SBSH 1JN6A 3RJQB 3T2OA 4IRJD 4S1RL 3PWVB 3F5WA 1PG7W 1CK0L 2GQHA 4FMKA 2J8UB 1S7RA 4ALAL 1GAFH 1QVOB 2VL4A 4F9PC 5FYLH 3BH9B 5C70A 2P1YA 1DP0A 4BJLA 5T33L 2VWEE 3MUY1 3TV3L 1AKJA 1QSFA 4KKLC 5E8NA 5DEZA 5F88A 3FQNB 1JK8B 2YPVH 4X98B 5D1ZA 3RA7L 1VEOA 4S1DD 5KVGL 4KQ4H 4ZFOA 1I3RB 1AGBA 4XZUB 3X3FH 3OWEA 3QIUA 3FN0H 4MCZA 1CLYL 2DMCA 1CFSA 1ND0A 1BIIB 1QFPA 1U8PA 2JJVA 3P30L 4V1DE 4YFLF 1RIHL 3MBXL 1IKNA 5H37H 4O51B 3TH3T 4IRJA 1ZT1A 2DM7A 2WBJD 3OXRA 3U46A 4CJ0A 4I0PD 1NFIB 1TNNA 4HPYH 4OF6A 4NQSB 5DRZB 2EEBA 1N5YL 4ZUWA 3OL2A 4LVNB 4L8SB 1CXFA 4NJ9L 5CD5C 5F7UA 2ZUQB 1KXQE 1EAPA 3SDDD 2PO6B 3CLEH 4LARH 3RTQB 2HWZH 3GKWH 3A6OA 2PTTB 3MV11 5L7XL 3QRGH 3QWQB 3FO9B 1N59A 1D6EA 3NN8A 5F71A 4WEUD 2FJFB 5GRXG 4XP6L 2QR0B 3HC4L 4ZS6C 3HKFA 3X12A 3AREC 5I1DB 5KS9B 1YEJH 3U9PH 1H8OA 1N4XH 4POUB 2GTZA 4LLWA 4QRSB 4WFEE 3AFLA 3ZO0A 5I8KH 3E8UL 2ESVD 1CE6A 1OSZB 3QEUA 1AO7E 4I0PA 4HUVA 1ZVSA 5E99L 4PRDB 1U91A 3UTOA 3OBAA 5FKAA 2ZSVA 3SDDA 2GJ6A 3MLTA 4M1CD 3TPUA 3BUYB 2VE6A 2AJXH 1NFDA 4HGWA 1I9RL 1Q38A 5C09A 5JMOC 1IC7L 4Z7VF 5JW4N 4XPAL 3REWA 4NQDD 3MXWH 1CLCA 3O2VL 5TQ0L 1XGRA 5ECJE 5IK3A 3ZKSD 2X4QB 3SDXF 1J88A 4JRXE 3MLVH 5FYLE 3EOAA 2ICEB 5D7KE 4R90H 4XRCB 2A6JA 1JWUA 2F5AL 4P4RA 5J6HB 3C5ZD 4PB9L 3RWGA 4ZSOA 1KN4H 4YQXL 3MJ9L 4OSUH 1DBAH 4PFEA 1CN4A 5IB2A 1JUFA 2MHAA 2DM2A 1DQLH 2VJXA 4CVZB 4JJ5A 4UT6L 3TBVB 2VZUA 4PJIF 1H3UA 5FCSH 4GKNA 3PABB 4X6CA 4R96A 3KNBA 1Q0YL 1J87A 2ZNXA 3PDOB 5ICXA 1F2XK 2OR7A 3NZ8A 4FFWC 3DO7A 1FVEA 1F6AB 4Y1AB 1IAIL 1JVKA 3N1MC 4JQXC 2WWKT 1IAII 3SKNA 3KYKL 1T0NB 2OZ4H 4LCWD 5CGTA 3KYNA 4GKOA 3ZTNL 3F58L 3R1GH 1FE8H 2XZAH 2BVEA 1TJIL 3FB7B 4CVXB 3C8KB 5BS0B 5E1AA 3AREB 4HGKC 4TNVK 4K8RD 5KSAB 5I18L 2PCPB 1CF8H 1I1CA 2NXZB 2R2HB 4UT9H 1TDQA 3PHOB 1G7HA 4LHUB 1REIA 2FSEB 5I1LA 4X6BA 4U1NB 2DQEL 2GJ6E 4K8RH 3UO1H 3RWFB 2VABB 4YBQC 3MGTB 5KW9H 2OZ4A 5C09E 3ILQD 4PREA 1A14H 4PJHF 2D31A 3BGAA 4OLXH 2FEEL 5JR1L 1AQDA 4K3DH 3MBEC 1E4KA 2BSTB 1DQTA 4JN2A 4L9LC 2XTJB 2V2XB 3MV7A 4LCWA 1K6QL 4HEME 4Y4KD 4LHQB 2JE8A 5D7IB 4ZSOE 4DKEH 4ELMA 2H2PD 3Q5TA 5C9JA 1VFAB 1MCPH 3MLZH 1V05A 1IC4H 5EBMA 3OHXA 3OPZH 1P9MC 5HGDA 2XRAH 5DRXA 3FT2A 2X5PA 4KFZC 4XWOC 1GGCL 4X6CE 2X89D 4OI8A 3P73B 3BHBB 1Q9KA 5JPNA 5FUCE 3WJJC 1KT2A 2HTKD 5HD8D 4KZEL 1JMXA 2FX8L 4YHLL 4OAWA 2XYCA 3QUZD 4H0IA 1EEYA 3B9EA 5GS1C 2HFGH 3FQWA 4E42A 5DJ6A 5I1JL 1HQRA 3U2SB 1AGDA 3RP1A 4JFEE 3G5VA 2K3TA 3G04B 4L1DA 1LE9A 1Z9MA 1YJDH 2IH1B 1U3YA 1BWWA 3QPQD 4Y4KA 4M4RA 3L3DA 1QLRB 3R4DA 4UMGA 5C1MB 1A64A 1PW3A 4E41B 5TE6L 3MRHB 2DYPD 4ZAKB 5TPWH 4KDTA 1T7ZA 4P46C 1WZKA 3EYQD 4GG8A 5CLWA 4OLUH 4X4MA 3BOVA 5F8RC 2EEDA 1RZJH 2X89A 1K5NA 3C08L 1FHGA 5IMLB 2YWZA 2OL3L 5CIPB 5FK9B 1RULL 1MCOL 4NCDA 3VFWB 1KNOA 1INEH 2DI8A 4JO1L 3UTSB 4H1LG 5F9OL 4X5WA 3VXNA 2P8MA 3RAJL 3QFDA 1MWAB 5L88L 3QUZA 3MV7E 4N8VB 2CRIA 2MQCA 4QXWA 3G08B 3MR9B 4JPVL 3MBEB 1T2QH 1ZVHA 5GIRB 3T04D 4L9LB 1RZFL 3WN5B 4RFEA 4BELD 5DGQA 1WISA 4UBDD 3JV6B 3NFSL 5J6GA 1RK0A 3BIKA 3QH3A 5FGRA 5JOFB 3W0WB 1EIBA 1X5HA 3S5LA 3STBA 2PTUA 5KG9B 3DUHA 4NRZA 3QI9C 2AV1A 4U1SA 5JMRA 4YGVB 4PJ8D 5D7LD 3VXQB 2A38A 4JHBA 2P5EB 3RY4A 2QQQA 1OAXL 3WE6A 1YYMH 3QXVA 4DGIL 4EI6A 2Q76B 3THML 4ZUVB 2X4OA 4Q74A 3C5SA 3BKJL 3RWDB 1Z5LB 3OF6D 2CKBL 3M17B 1A8JH 1ZTXH 4S1QL 4HUUB 3UJIH 1B88A 3CXDL 5IM7B 1JGUH 3FB8A 4XHJD 2EKSA 4G8EB 4UTBH 5ESQB 5GS1B 3O2WH 4CVWA 3SGDH 4H20H 4W68A 3OR6A 4IOFC 2QSQA 5LAXB 1LGVA 1GC1H 3TO4C 4IIQA 3C87A 2J2ZA 4H8WC 3D48R 3MYJA 1FZKA 1OF2B 3ALXA 4GMTH 4XP5L 2GY7B 3SE9L 1P4IH 4AH2B 3U30C 2E7LA 1AXTH 2UZXB 3BZEA 4OQTA 2CR3A 4MJ5B 3H3PH 4PJ8A 3O6ML 5D7LA 1JP5A 3QHZH 4Y16B 4CN4A 1W0VA 3VFTB 4UDUA 5EO9B 1WCQA 4XBGA 1CU4H 3NABH 35C8L 3TA3B 1PG7H 3VWKD 1F3DH 4HJJH 2OP4H 2WANA 3QUXC 2V5YA 3MRIA 5KAQF 3OF6A 1XFPA 1XR8A 4Z7NE 3B5TA 4XNUL 3BT2H 4IS6A 5F7KC 3O3EA 5MEOB 4JY4A 2GTWB 2E7MA 3EDFA 1HHKA 2B1AL 2IPUG 4JO4L 4W6XB 1JE6A 1JV5B 1MLBB 1LD9B 5MP6H 4C55A 4F7CA 2ITCB 4B50A 4WUUA 2KPNA 4RMQA 3G6JA 4MLIA 3MCLL 4GRLB 4UOW0 5DYOB 1FAIL 4OIIH 4XNYL 2R4RH 3SE4C 3MLRH 4DEPB 4ZS7L 5DJZB 1E4XL 2NPLX 3OMZA 5DQDL 1E4XI 1MRCL 1UENA 1I3GH 3BQUA 4DFIA 2FBOJ 1RZ8A 1T20B 3OQ3B 4W70A 2DLFH 3VWKA 5BO1L 3GM0A 3KPNB 5J3HD 2FEDC 3ZDZE 1I7ZB 2D7TL 4J12A 3L5XL 3S8WA 1T6WA 4X4YB 4QYOB 1JNHA 2QKIB 2W0PA 1RV6X 1ZT7B 3MSPA 5IT2H 2X9XA 4DTGL 4AIZB 5JLZB 4HS8H 1S9YA 3RVXC 4Y5YA 4XPBL 3UDWA 1TZHB 4YDJB 3JV0A 3H9ZA 5K9KB 3FQTA 3TJHD 1KUMA 2G5BB 4U1GC 3BPCA 4LFHD 1NMAH 1BBDL 4OCSL 4CUCA 4UOW1 5JPMB 3TCLA 3I6GB 1QOKA 1CTNA 4JG1H 1XCQA 3U30B 3S9DB 2NY1C 5IGXL 3GBNH 2EC9U 2FLBT 1JF6A 1H3VA 4LEOB 4KK5C 3A6BH 4X0KA 2C1OB 4LGPB 1I75A 4EN3C 1OTTC 4X6FA 2ICWA 5C86A 1QFWI 4R26L 5EC1B 5CEXB 4P5TC 3HA0A 5E4EC 2XOTA 5CJXC 3QUXB 4WRLA 5F1NA 5D9SA 3PWVA 3QEQB 2BCKB 4JY6B 5TF1L 2B7DT 1ZGLB 4WUUE 5K59E 3KS0H 2J8UA 4MD0A 1P84K 1X7QA 1CTOA 3BH9A 4TOYL 3RU8H 2PO6D 4YHYC 2XQBL 3RTQD 1OP5K 3KG5A 2JJSA 4YHKH 2D0HA 3W81A 4C56B 3FQNA 1JK8A 3VA6A 3NA9L 2ZCLH 5DF0A 5F7WC 5INDB 5E8EB 3HFML 2W59A 1I3RA 1BJ1J 2XKNB 4XZUA 4O02L 5FYJH 4GRWH 3FHAA 3DGGA 1CR9H 1HHHB 3UYPA 1NJ9B 4PJXA 1E4WH 1BIIA 2D03H 3VG0H 2EIZB 5TGBA 4O51A 1UM5L 2P49B 4OCXL 5B3NA 2Z31A 3FKUS 4M7JH 5AEAA 1U8LA 2HLAB 5FB8A 1NFIA 1H5BA 5JXAL 1AGEA 1HKFA 1DE4B 4NQSA 5DRZA 2ED9A 4ZTPL 4L8SA 5T5NG 5E6IC 3S5LG 1IM3B 2XA3A 4KY1H 5CAYB 4P23C 5DFWH 5IESL 3RTQA 1CLOH 4HAGA 3VMPA 1FNSH 2I07B 2R0ZH 4ZNCD 1WBYB 3DPBA 3DX7B 4JFHE 2NY1B 3FO9A 1QZ1A 3TWCH 1BD2E 1UQSB 3KLHC 3ZE2F 4U1KB 3WSQL 2FJFA 3BKMH 1NLBL 3CK0L 4EN3B 5I1DA 3GB7A 4YXHH 4JFXA 4ZNEA 5J8OA 4QRSA 1NFKA 3MRDA 4OKDA 1W8NA 3BXNA 1RPQA 4L3EB 1BVZA 3WD5L 1OSZA 2P48B 3LKNB 4MWFB 4G43B 1SBSL 4ZFOL 1GOGA 4B53A 1N7MH 2YR3A 1VSCA 3CGTA 1KEMH 5FYLL 4YHYB 1QFUH 4TNVF 3BUYA 4Y1AD 4FTVB 1CZ8H 4Z7QF 1OTUC 1NAKH 4PLKD 4PJXE 1VEMA 2VR5A 3EYOB 1OW0A 3NIFF 3WFCH 2BY2A 2ICEA 5BS0D 1UJTA 4ZS6D 1NCDH 2DMKA 4XRCA 3L3GA 3ARED 4KQ4L 1XF4B 3HI5H 5FCUH 1DCLA 5KSAD 1I1RA 2R8SH 3QAZB 1KB5H 2NXZD 2EH7L 3X3FL 4TVPD 3FN0L 3IAPA 2HN7B 1WFOA 4LHUD 2JCCF 4KMQA 4CVZA 3Q3GB 4X9FA 3TBVA 3UTPD 5FYJE 3PABA 4GRWE 1RD6A 5IEHB 5EU6E 3PDOA 1ADQH 4HPYL 5E6IB 1VCAA 1MSPA 3TBYB 2AJZB 1I1YA 3NIGE 1AD0B 4FQXA 4Y1AA 2XTJD 3V9FA 3CLEL 4LARL 1T0NA 5ID1B 2HWZL 3GKWL 3B2UD 2CDGB 1R6VA 4QRPB 4GRMB 4MCYB 4ZNEE 3QRGL 5AAMA 2WWKO 4YBLC 5ADPH 5CHNB 3FB7A 4CVXA 3C8KA 4FG6C 2IFGA 4N0FB 5JOEA 5KSAA 3RL1B 1YEJL 2VXSH 1YECH 2R2HA 4LIQH 5IVNA 1N4XL 5HYQB 2PF6A 4L8DB 4RISH 1ADQA 3PHOA 1FORL 2ADJB 3MXVH 5I8KL 2FSEA 1EERB 4U1NA 3U48A 5MENB 4U6YB 4XC1H 4M6MH 2VABA 4APQB 2HTLC 2WUBH 3MGTA 3U9UB 5GZOD 4K07A 4HSQA 1K3ZA 4JDTH 3OKKB 4JAMB 2DM4A 2DD8H 1CBVH 4FFWD 5DD0H 2BSTA 2UZYB 5KBNC 2UWEB 2V2XA 2IGFL 5KS9F 2AJXL 1AR1C 3DBXB 2F58L 3BMVA 2BSSA 2H8PA 5FYKU 3MXWL 4E41D 4ZAKD 1VFAA 4FXKB 3HE6C 3VD3A 4G9FB 4HFUL 1AHWA 4R90L 1YMMB 3HHRB 1A6PA 1PZ5A 1WTLA 3K0WA 4XCEB 3P73A 3T0DA 1KN4L 3DROB 3BHBA 3OSKA 5DQJB 2OYPA 1DBAL 4MXQC 1FGNL 3UTSD 2DL2A 4XHQA 4AMKH 3C6LB 1DQLL 4YBQD 1T4KB 5JDSB 4OV5A 4LFHG 2OX5A 3L3IB 4PJEE 3T77B 1CD0A 2EH8H 2G75B 4R0LC 3U2SA 3DX9B 3T3PE 1MAKA 3MBED 3G04A 3N1FC 2IH1A 4JQXA 4LU5L 2ICCA 3TO2B 4NFBA 4Y8DC 3W0WD 1QLRA 2DKMA 2OZ4L 4E41A 2NW2B 3KJ6H 3MRHA 1T22B 1YY9C 4YBLB 1HE7A 4EBQL 4ZAKA 3R1GL 3KPLB 1FE8L 2XZAL 3Q0HA 1BQHG 4B5EA 4OZFB 3PDGA 5A2IH 2P5ED 1UXWB 5IMLA 5FK9A 2X4PB 4UT9L 3VFWA 3VRIB 3EHBC 4N68A 1MWAA 2XTJE 4K8RL 3UO1L 4N8VA 3CPLB 3E6FB 5KW9L 3G08A 1A14L 4LIQE 3QJHA 3MBEA 4OLXL 4NUJB 1GJIA 1OGAB 4K3DL 4M1DH 5GIRA 5MI0B 4QOKE 1CE1H 4S0TD 3WN5A 1B0WA 2FATH 2VH5H 2APBA 5JOFA 3W0WA 1BFTA 3DVNB 1BECA 2BVOB 1QKZH 4KAQL 4NHUB 5KG9A 3SBWA 4CGTA 1P4LB 4YGVA 3DYPA 3VXQA 3WFEH 4J2XA 1JTPA 1OP3K 1MCPL 1ONQB 1MCDA 3MLZL 4Y16D 1NGPH 1MJ8H 3OPZL 2P5EA 5CZXC 5TE7H 2YN3A 1DUYB 3LN5B 3TA3D 1KIPB 5IW6B 3GSOB 4JZJB 3ZE1E 4ZUVA 4B0MM 1XF5B 3LPGA 3QZWA 3SDYH 3RWDA 1Z5LA 5EOQH 3M17A 4HUUA 5IROC 2R1YB 3G5XB 3TN0A 4G8EA 4OCMC 3CLFH 4K94C 4PRPE 4R0LB 4PIRF 1A2YB 2HFGL 5D7IF 3K1DA 3FJTA 5LAXA 4E41E 3KPSB 4M61B 2A9MH 5HHVL 1OF2A 3L7EB 4UIMB 2M2DA 1KLFA 3OXSB 1MCKA 2UVEA 4GRLD 4AH2A 1T04A 2DN7A 3QBTB 1NAMB 4MJ5A 5E24E 4Q9RH 4FA8A 4Y5VC 5TPWL 1J0ZA 1U8NB 4Y16A 2VRAA 5EO9A 2VERN 5I1IH 1VB9A 4OLUL 3TA3A 2G60H 1U92A 1B0GB 5HDOA 1F4XH 1RZJL 4GW5B 3ARFB 4X7FC 2X41A 1FLRH 1KENH 4I2XB 2GT9A 3TH4T 5MEOA 1T83A 5EIQA 2DQIH 4AQOA 2VAJA 3QYCA 4RMUA 3W0WE 3IDYB 3WEXB 4IOFD 1ORSB 3EO0A 4KH2A 4RFNB 4ACPA 1NUFA 3HNVH 1TCRB 1JV5A 1MLBA 3RY6A 4DAGL 1LD9A 1KJVA 4J7RA 2FH6A 3G5YB 2ITCA 5GGUB 4MQXD 3VI4F 1KF9B 3OZ9L 4GRLA 5DYOA 5I1AB 1D5BB 5IFJB 4NKMB 4HS3B 2VXQH 1C16B 4JPWH 5J12C 3HS0B 5E8OB 2NR6C 3D9AL 5A3IC 5KN5A 1PX3A 4LHUG 4NQEB 5BXFB 1T20A 1RZIA 3L3HB 4K71B 5T3ZD 4NDMA 1KULA 4UILL 3VFNB 1P69B 1A6AA 1YYML 1ZEAH 3C60B 5EC2B 4FNLL 3QUXD 4YPGB 4X4YA 2VLRE 2QKIA 4G7YH 4QYOA 1CDYA 4GBXC 3VFPB 3QEQD 3UJIL 4U0QB 2DJ4A 4AIZA 5T3ZH 1JGUL 4NM8H 4UTBL 4F33B 3HAEB 2CMRL 3O2WL 3VXPB 3PHQB 1TZHA 4YDJA 3SPVA 3SGDI 5K9KA 1VDGA 1VPOH 4P9ML 1YEHH 2G5BA 1U3ZA 1GC1L 4F9LA 1IKFH 4RQQA 4QRRA 5JPMA 2YN5A 3I6GA 2HG5B 3EDJA 3RX7A 4MZ3A 4DZ8B 2C1PB 2DL9A 3KPPB 1MCWW 1P4IL 3N85H 4C56D 5BQ7B 5HI3C 4HG4K 1AXTL 1BBJA 2X4UB 1E6OH 4OZIA 3O3DB 4LEOA 3G6AB 3H3PL 3VH8B 2C1OA 4JLRB 3FRPA 3QHZL 3FQRB 1WWBX 1X4ZA 5EC1A 3NABL 4XB8A 5I74C 1PG7L 5IHZA 3QUXA 4HJJL 4OBRA 5FFLA 2OP4L 2DWDA 3RVWD 4TTGA 3QEQA 3K2UL 4RGNC 4ZOEA 1GOFA 1V7MH 1ZGLA 2DBJA 3VMOA 3BT2L 2A1WL 3MJ7B 2HRLA 1GGTA 1I9JH 1CICB 4QRQB 1GH7A 3MFGB 3LPFA 3V8CA 1HHGB 2AAVA 4M7KH 2QQKH 3AMLA 4WENB 1DBBL 1S5HB 3STZB 2NY6C 1EUTA 2P44B 2L7JA 2NY1D 5EULV 2Q86B 4H88H 3UYRL 4C56A 5J12B 4OIIL 2R4RL 3MLRL 5INDA 5E8EA 2XKNA 4TUKH 4XTRD 4EN3D 5DEFB 3RDTC 1OTTD 2IPTH 4CU8A 3OGCA 1HHHA 1DBJH 4DCQB 5FOBB 2DLFL 3QDGB 2DQHH 3RL2B 4N8VG 5DD5L 2XA8L 4L3ED 4GBXB 4MXVF 3B9KC 3DUSB 2AEIT 4KTDH 4BH7B 1JZ4A 2HLAA 3NBNA 4YK4B 2FLRT 4QRRE 3BX7C 1UG9A 2JIXB 5IT2L 5F9WB 5IUSA 1HWGB 5J9PA 4HS8L 2EICA 2RGSA 1NGXB 2ICWI 4B7LA 2BSRA 1MIMH 4PJFB 3V0VB 1IM3A 1ZLWH 4M48H 4OZIE 2Z93B 1CCZA 4FTVD 2I07A 1NMAL 4NYLB 1FG9C 4XVJH 2RB8A 1WBYA 3DX7A 4U05A 5T3ZE 4JG1L 3HMWH 1TQBC 1UQSA 4NN5B 5HGHB 1N26A 4KVCH 3K4DA 3A6BL 1KYOK 5I74B 4AENB 4YDLB 4XGZB 3FCTB 3NIDF 2W91A 2Z35B 4PJ9A 3O41B 4L3EA 3GM8A 4MWFA 5D71H 2X6MA 4RGNB 5LKNA 4G43A 1LP9E 5I0DA 1G9NC 2VDNH 3O45B 3PWNB 5E6ID 3SDCA 2R2CA 2GSGB 2HT4C 4HW6A 1S7QB 4NT6B 3RU8L 4FTVA 3ZKNC 1J8HE 5IB4B 2EDWA 1F3RB 4WFFE 4QRPD 4OV6F 3KLHD 3BZ4B 1DSFH 3EYOA 3BP7B 4YHKL 4PD4K 2EDYA 2ZCLL 4X7TB 1NBZA 4GAGH 1JGLL 4MS8C 2BVPB 1KB9J 5BOZG 5FUOH 4M02A 5FYJL 4Y4HC 4MA7L 1CR9L 4XI5C 4W6WB 1M7IB 2HN7A 1MJUL 3B9KB 3GIVB 3KR3L 2D03L 3IAGC 3VG0L 3Q3GA 4WHYH 5MEND 4X9IA 4APQD 4NKDA 2HVKB 4R7DB 4L4TB 4M7JL 3SDXE 4LK4A 3UBXI 2X42A 5IEHA 4WI4A 2Q1EA 4OLEA 1AD0A 1D9KB 1U2CA 1HXYA 4KY1L 1OTUD 2OQJB 1WK0A 2R0LH 5ID1A 1X5IA 2CDGA 2R0ZL 3MROB 1CT8B 3EYSL 4QRPA 1TQBB 4GRMA 4MCYA 2VN7A 1T7YA 5CLTA 3CDFA 3T0EB 5GRWA 2D4FA 3TWCL 5K9QG 5CHNA 4KTEL 4N0FA 4HPOH 4DGVH 1Q72H 4G9FD 1YMMD 3QDMB 3RL1A 3E3QE 3OR7B 4BM7A 4ZODA 4YXHL 5HYQA 1EJ6A 3CD4A 5IEKB 1G0YR 3JTSB 2ADJA 3LKOB 3ULVC 3RQ3A 1TQCB 2CLVB 5MENA 4NC1C 3C6LD 4APQA 3V6OA 3U9UA 5E94B 1KTLB 4IDJH 1LQSR 1N7ML 2ZUYA 3K7UA 3OKKA 4P2RE 4JAMA 4KJWC 3MRBB 4XCNB 8FABB 3FOMB 2W65B 4LLYB 1EHNA 4XXCA 1AGCB 3FQXA 4PV8B 2UWEA 2BFVH 1DN0B 2X1PA 1Y18B 3MJ8B 5FUZL 1MPAL 3FRPG 1MELA 3UTQB 2WAHA 1NAKL 3K4ZA 1FL5A 1X3DA 4GXUM 1GGBH 2OJEA 2UY7A 3WFCL 2OJZH 4PJHE 4HMEA 5CSBA 4OLYH 4G9FA 1AE6H 3L3KB 1NCDL 1T1ZA 3HI5L 4O2EB 4XCEA 4Y4HB 5FCUL 4NBZB 4P5KB 5I30H 2R8SL 1GHFH 5F93C 2XT1B 3DROA 1J1XH 2R39A 4M93B 2YXMA 2Y1VA 5EZLB 4OZHB 2MKWA 4KK9D 3C6LA 2CUIA 4OZFH 1T4KA 2HTLD 5JDSA 4KUZL 3UTZB 4G9DB 2YA0A 3U83A 3DX9A 4QRPE 1ADQL 1OGAD 3M1BB 4NUGH 4C83B 3QXTA 1DQQA 1OAZH 3DURB 1KPVB 3HG1B 1OAKL 3JSSA 4GQPH 1Y0LA 3ELAT 1EVUA 1T22A 1PY9A 3HZKB 3JWNC 3HPJB 3DI3B 4FXGB 3KPLA 4JQVA 5CJ5A 3LQZA 1DFBL 1J0IA 5ADPL 1ITCA 3IU4H 1U8JA 4JQIH 2DAVA 4OZFA 5MENE 3V4UH 5I66B 2YA1A 2X4NB 1UXWA 3NCJL 2VXSL 4RWYH 4LIQL 4PJGB 2X4PA 4RISL 4EIZC 3VRIA 1B2WH 3MXVL 5CJBA 3TYFB 5IB1B 2UWEE 5EDXA 3V0WH 4XC1L 5IIEA 3CPLA 3MLSH 3E6FA 2WUBL 3DRTA 3DUUB 4JDTL 3KDMA 2C4XA 4NUJA 3L3OB 1OGAA 3ARGB 3KPSD 3O3AB 2ZSWB 2DD8L 1CBVL 2OBGA 1OSPH 2NY5L 4X9BA 2AP2A 5ITFB 5KVFL 3H9SB 4MVBC 1G84A 1QBAA 5TFSH 3DVNA 2DIJA 2VLKB 3ARXA 4G7VH 2BVOA 4NHUA 3WHXB 2F54A 5JZ7D 4M1GH 1P4LA 3ARDC 5GXBB 1S3KH 1N0LA 2QV2A 1ONQA 4NZDA 5F8QC 2WUCL 1IM9B 2XI9A 1XGTB 4NIKB 1DUYA 4UQ2B 5IW6A 3OKNB 3GSOA 4JZJA 5CMAA 5D5MF 4AT6B 3ARFD 1XF5A 3EHBD 3WL9A 4NZRH 5EUOB 3IJYB 3TM6A 1WT5C 1HK6A 4G6AC 2R1YA 3G5XA 4AMKL 5LGJA 4CW1B 4R0LA 1MAJA 3VI3F 3BPNC 5EORL 2EH8L 1MCWM 3KPSA 4XVTH 4Z77B 3SE3A 3Q6GL 3NPZB 2V5MA 4M61A 4U1MB 3LD8B 3L7EA 4L4JA 1FZJB 1UM4H 3SO3C 1NAMA 1DBML 5IF0A 3DIFB 2YRLA 3QEGH 3R8BB 4JN1H 4WDIB 1U8NA 3AS2A 4NQED 1JRHH 4G8FB 1F02I 1O0VA 5HSFA 1QYGH 3QCUH 1B0GA 4F3FB 4LNVA 4TPRH 1FG2B 4ENEC 2FIRT 4Y5XC 3C60D 1FZMB 3ARFA 1A6TB 3GJFK 3QRFM 4I2XA 4HKXB 2IPKB 1M71B 5FO7B 4HKJB 4M5ZH 3EDEA 4HGMA 3WEXA 2FRGP 5I6XB 1ORSA 5ALBH 32C2B 2F54E 3VE0B 4HQQL 1T89C 4POYA 3G5YA 4M1DL 5GGUA 1CE1L 5HJ3B 5FA3B 2DI7A 3DLQR 2FATL 3GFUA 3PG2A 5IJKA 2VH5L 3HAEH 1S7XB 4YBHA 1FFOB 5IFJA 1D5BA 2R1XB 4NKMA 3ARDB 1C16A 1QKZL 4WHTB 3HS0A 4DQOH 3CVHH 1ZA6B 3QIBA 3KPOB 1ZV5A 4ZO7A 1N6VA 3WFEL 4NQEA 4N1CA 5HY9B 2PKDA 3L3HA 1NGPL 2H9GB 4TSBH 1EPFA 1M05B 3VFNA 2QQLH 5TE7L 5DMIL 4WGWB 3CMOL 3RZCB 2N1KA 2OK0L 3C60A 5BV7H 4YPGA 4LEXH 4RRPA 1A1OB 3IDJB 2Y4SA 3RIFK 3KPSE 4YWGH 5IROA 3SKOB 3SDYL 3VFPA 2CR6A 3BRFA 5TQ2H 2BK8A 4MD5A 1I7RB 5EO0B 3HAEA 3CLFL 3ZSSA 3QCTH 2PTVA 1CICD 3QCVH 3RFZC 4OGAC 3CVHA 2CXGA 4JB9H 1NCCH 2D9CA 1UH2A 2EKJA 5CP7A 4U1IB 2A9ML 3SO3B 2C1PA 4DZ8A 3KPPA 1PD6A 3MRNA 5BQ7A 3SGKC 3PDDA 5A3ID 3O3DA 3VH8A 3G6AA 2YUXA 4NKQB 1CGTA 1SJEB 5FKPA 4W4OC 4FQ2H 4WVRA 4ZDHB 4OCWH 3FQRA 3LDBC 2YD2A 5T3XD 1OT2A 3V79C 2R0KL 5I1IL 3QDGD 4Y5XB 3VWJC 2OLDA 3HRPA 1UJ3C 1F4XL 1L0QA 4GBXD 1BAFH 1KENL 2YPKB 3QNYB 1A7OL 4NKIH 1AP2A 4U2ZA 3MJ7A 2JIXD 3RPKA 4ONHB 5KSBF 1CICA 2DQIL 4QRQA 5C6TL 5HHOB 4UB0H 3M8OH 1W0YT 1HHGA 3HNVL 4GS7B 3BN9C 1MCCA 1S5HA 1QBLH 4LSUH 4DZBB 3VW3H 3GRWA 4NQEE 4UUJB 1QO3A 3HCVB 1VACB 4YO0A 2Q86A 1RJCA 3C6SB 2VXVH 1A1NB 1U2HA 3BI9X 5JIPA 2EZ0C 4P4KB 5DTFB 4L8BB 3STLB 1GXEA 3BDXA 4MHHG 3MYZA 3NVQA 4AG4H 1KC5H 4OI9A 4MX7B 5FOBA 4HLZH 3LKSA 1MH5B 2VLLB 1CGYA 3RL2A 1YNTA 4GBXA 4KHTH 3ULUH 3DUSA 4Y4FB 4RGND 4BH7A 2J8HA 1MVFA 3MQIA 2UYLA 4YEFA 4KZDH 4NQTA 2JIXA 3OJ2C 3P9LB 5T3ZL 2KH2B 4WCYH 4NM8L 2P46B 1NGXA 3Q5OA 5D7JA 3PWUA 4PJFA 3V0VA 1BWMA 2R23B 1CVSC 5GHWL 5HVGB 2Z93A 1YEHL 3MRKB 4OGYH 4QHKI 1I3UA 4ETYA 4XCCH 3G5ZB 1F97A 1IKFL 1IEAA 1G9ML 2GCYB 1BOGA 5F3BB 3KXFB 3IETA 4HDIA 4I13B 3N85L 8CGTA 3AC0A 2Y6SC 4WUKH 5HGHA 2V6HA 5HI4C 1QLFB 2IBZY 4AEIL 1H15B 3U4EB 2B0SH 1MOEA 1JMZA 3LDBB 4LCIH 2GKIA 2C3GA 3EKCA 4C54A 3MRJB 4X7CC 1L7IL 5KOMC 2Z35A 4N8PA 3O41A 3B9KD 4WFHD 1MFAH 1T1WB 5K9JL 4IRSB 1RUPH 2AJ3B 4L5FH 4FRWA 1NL0L 1V7ML 4L4TD 4Z95H 1U3HC 3O45A 5LGHH 3ZE2E 3PWNA 3EZJB 1Z2KA 1I9JL 2C3VB 1IQDB 2GSGA 1D9KD 5ENWB 3AM8C 3P9MA 4NT6A 1MFCH 4NNPH 4ZYKB 3B9VA 3RWIB 5IB4A 5B8CB 1TETH 4NN6C 5CSZB 3S37X 5EPMB 2CSPA 4Z7OF 3BZ4A 4JFDB 3T0ED 3VFOA 3L5WB 3O6FC 5GGTH 1OHQA 4H88L 1SY6A 4X7TA 5DR5L 3CZJA 2BVPA 3QDMD 2XY2A 4TUKL 2BNQE 2EDQA 4DN3H 3GMMA 3O4LE 4WO4C 4XNXH 4L3AA 3IF1B 1M7IA 4QHUA 3ARPA 2DQHL 3GIVA 4PJFE 3WS6C 4P9HL 3W39A 1UA6H 1RUKL 1R0AL 3SQBA 4KTDL 1AH1A 4ESKA 2HVKA 4R7DA 4P48A 5IBLC 2VYRE 1W8OA 3NIFE 1N5AB 1FVCB 1H9VA 1F3DJ 5GGTA 4G6MH 1D9KA 1MIML 3B5GA 3ULUE 4M48L 2VC2L 1RU9L 3LQAH 1D5MA 1C1EH 1CT8A 4XVJL 4HEPG 4J3OC 5C0CE 2JCCE 2NXYC 3T0EA 3JVGA 1F2QA 3HMWL 1MREH 3UZVB 3WHE1 4JFZH 4HWEH 2JJTA 4M8QB 5AWNH 3UAJC 3PWJB 4MS8D 4AY0A 4KVCL 3QDMA 4RRPG 5BZWB 1AD9B 3OR7A 4Y4HD 5ACMA 4HIEB 5IEKA 3HZMA 3JTSA 1PKQA 4ZUSB 3HAEG 3LKOA 3BE1H 1T7XA 1RIUH 4LSDA 5D71L 3N1GC 5GRUH 2Y5TA 5E94A 3ZHLA 3FQUB 1KTLA 1I9EA 2VDNL 4XX1E 3MRBA 4XCNA 8FABA 3FOMA 2W65A 4LLYA 1AGCA 4FZ8H 4J1UB 1HYSC 1DN0A 3MJ8A 1Y18A 4NN6B 5IVXA 3VH8G 3HG1D 5AZ2H 3V4PH 2ICWJ 2HLFD 3UTQA 1DSFL 5L2KE 1G7IB 1D5IH 1KCSL 2QBWA 3MOBH 5DK2B 3L3KA 3QIWA 3W2DH 4GAGL 4L3CA 4O2EA 5DC4B 4P5KA 1T0PB 4RSVA 5FUOL 5C0BE 1ZLVK 5JNYB 2VSDA 3ULVD 5EZLA 3CFKB 2EXYC 1UCBH 4OZHA 3U0PB 4K9EH 3UTZA 1JI2A 2W0KA 4G9DA 5DJ0B 4KJWD 1YPZB 1II4E 3ARGD 1H3PH 4L9DA 3M1BA 3K81A 3PP3H 2PW1A 4C83A 4H0GA 4QTIH 2ZUXA 4PRIB 3DURA 1UZ6F 3HUJB 3RUGF 1CLZH 1UKQA 4YHIA 1K9TA 5DD1H 5E2UH 3H9SD 2R0LL 3L95A 5IB3A 2NXYB 2VLKD 3KS0J 1K8DA 3F12B 5F97E 2NLJB 3HZKA 3HPJA 1PKQE 4L4VA 4Q0XH 3IGAB 3S34H 3RI5K 3TGXA 1NLDH 2VIRB 2AJSH 3QWOA 4HPOL 5I66A 4DGVL 1NANH 1IM9D 1IILE 2WV3A 1Q72L 2X4NA 2ZG1A 3ZE0E 3PGDB 3QQNA 4NBXB 2P24B 1KCLA 1EFQA 4WIQA 5D2LF 4KKCD 2YD4A 4AEFA 1BREA 2BHYA 2DOCA 2PNDA 3TYFA 2RJMA 5IB1A 1YEEH 1G7LB 3SDAA 1A6VH 4R8WH 1CFVL 3DUUA 4URTB 5IVXE 4IDJL 4D9LH 2DM3A 2E6JA 5HYJB 1MLCB 3ARGA 3O3AA 3FMGH 2ZSWA 3TBWB 4NO5B 2VO5A 5ITFA 5AUMB 4FQIH 3H9SA 3T2PA 4GOSA 2BFVL 5FIEA 2VLKA 1NCWH 5MEQB 4RMWA 4RNRB 2XZQL 3CH1A 4OZ4B 1GGBL 4UAOB 4Z76B 5JHLH 1I9IH 2OJZL 4U0RB 4OLYL 1XGTA 1AE6L 5E8DH 1PJ9A 1K2DA 4UQ2A 4N0RA 3QULB 5I30L 1GHFL 4AT6A 3D39E 5CEZD 5EUOA 3IJYA 3VRLF 1XF3B 4LCCC 4LSSH 3P11H 3ARZA 4CW1A 4PS4H 1FV1B 2ZUTA 1OP5H 1SYSA 1ZOXA 3ZKXC 1MQ8A 9CGTA 1NUDA 4Z77A 3C5JB 3LKPB 4U1MA 3KGRA 4L4VE 3SQOH 4JKPH 2AABH 3PGCB 2ERJC 4R4BB 1OAZL 2QSCH 1FZJA 4H25B 4LLAA 4NBYB 3V7AE 3ARDD 3J7HA 3MV8B 3RIFF 2M26A 3DIFA 4PJBB 3UZQA 2BHUA 4YC2C 2XY1A 1G0XA 6FABH 3IU4L 5DXWA 4JQIL 4WJ5A 3V4UL 4G8FA 3KJ4C 2QJDA 1Z9SA 4F3FA 5D7SH 3RZCD 1FG2A 1FZMA 4QNPF 1A6TA 1ED3B 4RWYL 4OFDA 5GS2H 4U6VH 4G6AD 1W72H 1B2WL 4F37K 1M71A 3I6KB 3I02A 5FO7A 4HKJA 2IG2L 3WMSA 4OCNC 3V0WL 1M4KA 5DC0A 3MLSL 2VLKE 2LV4A 5IFAH 3QG7L 1J1OL 4U6HB 3VE0A 2P8LB 4FFYH 1CXEA 4ONGH 2E5EA 1OSPL 1I85C 1SEBB 5FA3A 4MAUH 4XAKD 3QNXA 1S7XA 1FFOA 2R1XA 3DX8A 5TFSL 3BISA 4G7VL 4WHTA 4PJGF 1WQVT 4M1GL 5EIVA 3ULVF 1ZA6A 3BAEH 1KFAH 1W72A 3KPOA 4HIJA 3RNKB 2VUOA 2FO4B 5HY9A 4PY8I 5GISH 4R2GB 1VERA 2H9GA 2WM0A 1M05A 4GG6F 3RZCA 2CLZB 2CIIB 1L0XA 1NAML 5DJ8A 1A1OA 3IDJA 1S7VB 2NY3B 3VI4E 1T2JA 3EFFA 3SKOA 5CP3H 1GZPB 4LCCB 4NZRL 1BVKB 4X6DB 5FOJA 1I7RA 5EO0A 4JM2C 3NPSC 4EUPB 5ILTH 3A0OA 3ZKXB 1EA9C 2B2XL 5HHOD 5CZKA 5I1EL 3HI6L 2YBRB 2AI0H 2GSIA 5ICZB 4XVTL 3MOQA 3KYOB 5AG8A 2ERJB 3MV9E 5JA8B 4U1IA 4N5EC 4WEBH 4NKOB 1JPTH 1V7NL 1UM4L 4BZ2H 1A7QL 4ZO6A 1N3NA 1EZVY 4FQ1H 4P4KD 4YC2B 3QQ9C 1ZMYA 4M03A 1URLA 3QEGL 1SJEA 1UT9A 4JFPB 3CFCL 4JN1L 3EJYD 4Z8FH 3U4AA 1JRHL 1KTRL 1NKOA 3IXAB 1QYGL 3QCUL 4J4PC 4MA1C 4TPRL 2YRPA 4Y4FD 2HYMA 2VZ3A 2YPKA 3PQYA 3QNYA 5ITBH 5J06A 4G6JL 1O7SA 4OF7A 2YKLH 3MZTA 4KJQC 4M5ZL 3OX8B 1KJMB 3I6LE 5HHOA 1TVHB 2FJHB 4Z7UB 3VGDA 1L7TH 5ALBL 3GMRB 1XH3B 3RWCB 1J10A 1TVBB 4MA3B 3H7BB 5EU4B 4DZBA 5KJRH 5C07B 4UUJA 1CI5A 1UXSA 5EU3B 1VACA 1BFOB 3KXFD 4XXDB 2B1HL 4JR9H 1EEZB 2DDQH 1KIUA 3C6SA 1A1NA 4PBXA 2Q6WB 4P4KA 5DTFA 4DQOL 4L8BA 3STLA 3CVHL 4NO2B 4YX2H 4PJCB 4Z18A 2MJWA 4MX7A 3SCMB 1MH5A 2QQLL 2VLLA 3SJVD 1DTUA 5BV7L 1U3JA 4XPFH 4Y4FA 4LEXL 5F1SA 4OCRH 4JGMA 4IRSD 4YWGL 2OXGA 1WAAF 3DVFA 4F8QA 4JM2B 5TQ2L 1EHAA 3V6FA 5M7QA 4Y89A 4JVWA 1YC8A 4DKFL 1A3QA 1R3HB 3BKYL 2R23A 3QCVL 3LS4H 5D1QC 3MRKA 4EQ2A 4KJYB 4WTZG 2H32H 1NCCL 3G5ZA 4HFWA 2FBJH 1BZ9A 2CDEB 2XG4A 4PY7A 2IANB 4UV4H 4PGJA 2GCYA 2BY1A 3OJVC 5HHPB 1P7QB 4MXVE 2Y7QB 4JFDD 5L8KB 2JJUA 1NCAH 4M62H 2EZ0D 3W11C 1J86A 1H15A 1EO7A 3PQYE 1S7SA 5LGKA 2XIDA 1G7QA 1FH5L 4FQ2L 4OCWL 4DKDC 2D7QA 3GRWL 3AY4A 4AM0B 1F8TH 1DQDH 5FF6A 2FCBA 5DMKB 5L8JB 4MA1B 3SJVA 1I8LA 1WIUA 5EUKA 5E9DB 1OAQH 3T8XB 1A3LL 4IRSA 4XAWH 3VXMB 2AJ3A 4I3RH 1DBKH 1BAFL 5D93C 3DX6B 4X8XA 1DVFA 4X9HA 4NKIL 4XBEH 4LVOB 1G0DA 1RJZB 1CFNB 2C3VA 3DMMA 3VXRE 4HC1H 1A4JB 5ENWA 5I76B 1H3TA 3TYGL 1HKLH 5F9AC 4KPHL 4E5XB 4HCRA 4Y2DB 4K7PH 1QBLL 3RWIA 1T7WA 5B8CA 3TNNB 3QEHB 1T0MB 1CD9B 5CSZA 3WFDH 3VW3L 3KPQB 5EPMA 1GSMA 4WHDA 4JFDA 3HR5B 1U6AH 1KCRH 2VXVL 4DOHB 3CNKA 2VDMH 5HI4D 5T1DH 3RGVC 3X14A 2CRYA 1RIVH 2YD1A 4AG4L 2GJZA 2XZCH 1CDJA 1ZE3C 5EG6C 4LLDA 4KWUA 3IF1A 3VD7A 2VDKL 4D0BB 1GIGL 3T3MF 2NW3B 4JRYE 5D72H 1A9EB 1FNHA 4MDJB 3GSNH 4KHTL 2X1QA 3ULUL 4U49A 5IOPB 1RUMH 2C7UB 3GJEA 4U6XB 4KZDL 4Z5RB 1N5AA 1U93B 4WCYL 4KK6C 5LBSH 2JELL 3RVUC 5D1ZC 4JFOA 4OGYL 1H3GA 4S2SB 2KUTA 3CX5K 3GSRB 3VGGA 2A6IA 5ACLA 3L1OH 4PGEB 3QIUC 3SJVE 4M8QA 3JTTA 3PWJA 4RIRB 3GSNA 4HIHB 4WUKL 1IKNC 1A7BA 5BZWA 3BN3B 4IRJC 1AD9A 2EECA 3FRUB 4ZUSA 3OB0K 2O5ZH 1SY6L 1UB5B 2HKFH 2HKHH 1MFAL 4OB5H 5IBLD 3FQUA 4N0YH 2EDTA 2DLGA 1HCVA 4Z95L 5LGHL 4DGYH 1S8DB 1G6RB 4FZEH 3V0AC 3RI5F 4Z7WF 4O00A 1QEWB 3DYMA 2WK2A 4LLVB 5A2FA 2Z92B 4S1DC 4PRID 1VFBB 1F90H 1MFCL 2X70B 4NNPL 5HVHC 1MFEL 2NXYD 3DSNA 3O2DH 4JANA 3TFKD 3TLRA 3MREB 3DYOA 3AS1A 4CN1A 4PG9B 1CG9A 1G7IA 4HBQA 2A6KA 5GGTL 3UAJD 3FL7A 5DK2A 2GUOB 1JN6B 3B3IA 1CXHA 1X9QA 4F58H 3Q1SH 3D3VB 2X09A 5DI8B 4I0PC 4ERSH 1XR9B 5D2NE 4DN3L 1FL6B 1C08B 5JNYA 4JPKH 1PFCA 1Z6JT 4XPHH 3LMJH 4EZMA 3CFKA 3VFSB 4ZD3H 1AO7B 3F6LA 1YEFH 4MNHB 1Q94B 2Q20A 2GAZA 5DJ0A 3TT3H 5DUPH 1YPZA 2CO6B 5HYJD 5DZLA 5F88B 4N1EA 5SWSB 3DI2B 2EC9T 4G6ML 1TTUA 1NGYB 4LBEA 4PRIA 3HUJA 3VFGH 1LILA 1V8HA 1CGSH 4D3CH 3E2HB 3LQAL 1C1EL 3F12A 4HIXH 2DTMH 2NLJA 1CFSB 1NDGB 1ND0B 4JRXB 3IGAA 2CH8A 5AZEH 4JGJA 1I8MB 5LQBH 2VIRA 4JFZL 3GGWA 4HWEL 1JFQH 5AWNL 2D7PA 4G5ZH 5CWSB 2IALB 4MD4B 5HVFB 4PTTB 2XWBA 4MJ4A 1LHZA 1J1PL 5HDBE 4NSKA 3OG6B 5BVJB 3BE1L 3MRQB 5FHBH 1RI8A 3WIHH 4ODBD 5GRUL 1KN2H 2XV6B 3R06A 5HYJA 1MLCA 3CX2A 2QHLA 3GMOB 4OGXL 2XPGA 1FPTH 4NO5A 1MCNA 5AUMA 3S35H 5I16B 4FZ8L 4HWZB 3ZT6A 5HVHB 1NQBA 2DQDH 1KIQA 1VENA 1IGMH 5I75B 4HXBH 3VXTB 3UCRA 4AYFA 3E1F1 5AZ2L 3MV8D 3V4PL 1AI1H 5MEQA 5JW4Q 5BMFH 4RNRA 4OZ4A 1JJUA 1U95B 5E95B 1FC1A 4F37F 1D5IL 3B8YA 4Z76A 1S7UB 5ABDE 2CLRB 3MOBL 3WIHA 4O9HL 3QULA 3W9DA 1LK3H 5I1KH 5HI5C 4X5XB 3KHOA 2WQRA 3BP5B 4YXLH 4I77L 2GJ6B 3B9AA 1XF3A 1E4KC 1UCBL 3TPUB 3HUJE 5C09B 1FV1A 1FC2D 3REWB 2O61B 1IEHA 1CIDA 4AL8L 4YGAB 3BP6A 5IK3B 5L8LB 1T80A 4PRHA 4JHWH 4HK0B 3LKPA 3EOAB 4J8RA 1OVZA 4OFVA 1Q9OB 4P59H 3PGCA 3VMNA 5I8CB 1PBYA 2E6QA 4QTIL 2Z91B 1JWUB 4R4BA 1ZLUK 3W5NA 5GGQH 5D5ME 1CLZL 4H25A 4K8RC 5DD1L 2BVQA 5CUSH 3RWGB 4ZSOB 3BGFC 3MV8A 1RHHB 2PYEE 3INUH 1FZOB 4PJBA 2NCMA 1MUJB 1XT5A 3BDYH 5CGMA 4Q0XL 1A7RH 2MHAB 4RGMC 1P5UA 4YDIH 4R2GD 4UTAH 2X9WA 2P8PB 1NANI 3ILQC 3KNBB 4QKXB 2JKXA 1ED3A 3OKDB 1BVLB 2NY3D 1J11A 1FNLA 2Q7NA 3I6KA 5IMKB 3CZFB 1YEEL 2D7MA 4TULH 1A6VL 4Y4KC 3GMQA 5F9JB 3SOBH 4JFEB 4U6HA 2Y36H 2H2PC 3FMGL 4KDTC 4EOWH 5FDYA 4U31A 1SEBA 2E8YA 1WZ1H 4FQIL 4EUPH 3H3BC 1RUAH 3BD4A 3U4BH 4NOBA 1NCWL 4E9LA 5E56A 5KANI 3RNKA 2CUMA 2AQ3A 3LIZH 5I1LB 4EQ3A 1YJDC 2VAAB 5HD8C 2FO4A 2YUVA 1I9IL 4RA3A 5E8DL 3QUZC 2CLZA 2CIIA 1AQDB 4YXKH 2X05A 2Q3ZA 2I9LA 1S7VA 5DVNA 5DLMH 5E1HB 1GZPA 4PRHE 3DGCR 4D9RD 4AEEA 1BVKA 4X6DA 5KSVA 1J7VR 4LSSL 3MV7B 4EUPA 2F19H 4P5MB 4PS4L 1YZZA 4NWTL 1RZJC 4A6YB 3MRGB 4YIQB 3WKMH 2MQ3A 5H94B 5ICZA 4PJBE 5C9JB 5CEZL 1EJOH 1EDQA 3EYUH 3KYOA 3SQOL 4JKPL 3OHXB 1KEGH 2H1PH 4NO0B 5HGDB 5C07D 1DEEA 3QO1B 3EYQC 4NKOA 2EDBA 2QSCL 3MOAH 1EEQA 4KRLB 4KTYA 4FQCH 3FT3B 3T0BA 3NGBB 4JFPA 3O8XB 1UWGH 6FABL 3FN3A 3P4NB 5HYFA 3IXAA 3SCMD 4E42B 1HINL 5D7SL 1X5XA 1AGDB 4K94H 3G5VB 4IIQC 4U6VL 1W72L 3NA4A 2L4OA 4JM2D 1SQ2N 2P7TB 4UBDC 5IQ7H 4PJDF 1T3FB 4I4WB 5BJTB 3OX8A 2WNGA 1KJMA 1TVHA 2FJHA 2VMFA 4M9OA 2E7LC 5IFAL 5IMOA 4JDVB 1XH3A 3RWCA 4MA3A 5DJ2B 3V5DB 5EU4A 4EVNB 1RK1B 1ZHBB 5C0ND 4FFYL 4OCYH 4ONGL 2IAND 5C07A 2ADIB 4GG8B 5EU3A 1HN1A 1P7QD 1BFOA 4MAUL 3TEUA 1AFVH 2V7NB 5SWZE 2C3HA 1EEZA 4U1LB 2X1OA 5E2JA 3PHSA 2Y25A 2Q6WA 1GC1C 2ZPKL 4LPXA 2WP3T 5KSUB 2RFXB 3BAEL 2O93L 4NO2A 1KFAL 5JHDE 3QFDB 5GISL 3SCMA 3TJEH 4G6KH 3HE7A 4TRPH 5AG9A 5E9DD 1F3JA 4B7IA 2MCG1 3VXMD 1NCTA 4UINH 3IDUA 1NEZA 3EDDA 4JM2A 2M8XA 4KJQD 3NCMA 2YC1B 3IDNA 3BIKB 3HZYB 1ZSDA 5ILTL 1P2CA 4RAHA 2EDFA 3UC0H 1KACB 1R3HA 2A6DA 3QWRA 2AV1B 4K55A 2AI0L 3O6LL 1AQKH 4Y2DD 1NKRA 2IANA 3BQUC 1DQMH 1PLGH 5ERWB 1UEYA 3WNMA 2PYFB 1JPTL 3VWKC 2X4OB 5DUBB 3C5SB 1UKSA 4FQ1L 4GKZB 5GJSH 5JOPD 4OT1H 2LU4A 5L2JA 5K9QI 4BYHA 4AM0A 1KCVL 5DMKA 1KJ3H 4X7SH 4KQ3H 4Y5YC 5E9DA 3T8XA 3UDWC 3ZDXE 1A4KA 3MODL 1ZXQA 3VXMA 4HK3N 1RUQH 4AIOA 4PY8J 4YZFE 5ITBL 5HGBB 1H8SA 4GW4B 5C07E 4LSRH 3EJJX 1RJZA 2IPUK 1CFNA 2G9HB 3GSXB 2ZOKB 1L7TL 2B8OT 1A4JA 3TVMA 5I76A 1BM3H 4E5XA 4Y2DA 3Q2CA 3TNNA 1QFWH 4HBCH 3QEHA 1T0MA 5KJRL 1W0VB 4MAYB 3KPQA 3MLUL 4UDUB 2E7HA 2BY0A 2QQNH 5DURB 3HR5A 1ROWA 2OMBA 4JR9L 3UJTL 2DDQL 5J3HC 2W9DH 5HDQH 2EXWD 1KSRA 4LQFH 4MQTB 3ESUF 2I5YH 2P43B 4NC0B 3RZWA 3L9RA 2JK5B 4FQJH 4YX2L 4IS6B 3O3EB 5B3JF 1HQ4A 2P5WE 1F4HA 2BHZA 4JY4B 4LF3B 4G8GB 2OM5A 1HHKB 1XGUB 3QUMH 4D0BA 4Z7UF 2NW3A 1A9EA 4G80B 5ETUA 1S9KC 2B4CH 4MDJA 4OTXH 4S1SL 5IOPA 4OCRL 4WUUB 1EO8H 4U6XA 1JF1B 4Z5RA 1VGEL 1U93A 3BESR 5FHAH 2JJSC 3P4MB 2DQGH 2XFXB 4OZGE 4QY8B 3LS4L 4S2SA 3B5HA 1ZAGA 5TDOB 3BQUB 3GSRA 4AIXA 4PJCF 2XNAB 4JDZB 3CSPA 1RZ8B 4UV4L 5FEBA 3T08A 1U8IB 3JUYA 3QUMA 5M95B 4LNRB 3HLAA 5E9DE 1MF2L 4M62L 4HIHA 3W82A 3VXME 1FN4B 5GS0D 4IOIB 4HCRL 4JM2F 2Z31C 1PQZB 2CDFB 3D3VD 3GKZA 4P2YA 2YD9A 1S9YB 2WINB 1H5BC 3FRUA 3TF7C 2EDOA 4LVNC 4L8SC 1UB5A 2ZUQC 1G6VK 1JCKA 1AO7D 4XAWL 5GS0H 1PX4A 4I3RL 1DBKL 3RTQC 5HHQA 4K7PY 1OLZA 3LQMA 4XBEL 1S8DA 1G6RA 4KK6D 5JQ6H 1OQOA 5SWSD 3RVUD 1QEWA 4Q9CA 3OGOE 2AJYL 4LLVA 1UCTA 4LSPH 3NAAH 4HC1L 4AJ0A 2Z92A 3B4NA 1VFBA 2X70A 1IBGH 4NFDA 2Y07H 4R3SB 4K7PL 5IKCB 2FX7L 2ICWB 2F5BH 1J0YA 3WFDL 2BNRA 4GT7A 1BD2B 3LRSB 5MERB 1U6AL 2EDNA 4JRXD 1KCRL 5D7KD 3HN3A 5F1NB 4MGXA 4NCC2 3GJFH 2VDML 2GUOA 5T1DL 1RIVL 5GQBA 4BK5A 3D3VA 5DI8A 3ARBA 1XR9A 2XZCL 1FL6A 1C08A 4MD0B 4NN7B 1IZKA 5GGVH 3MRLB 1X7QB 1UADC 1F6FB 3L5IA 2APWA 3VFSA 1LO4H 5D72L 3MZGB 3O81A 1AO7A 4DK6A 1DQJA 3GSNL 4MNHA 5DMGC 1Q94A 1RUML 1V3KA 12E8H 1JBJA 1W0WB 3BD3A 4EDWH 1U8QB 3MUGB 4GMSL 2CRMA 1PY4A 4YAQA 5SWSA 1RFDH 1NGYA 1OW0C 5LBSL 3C2SA 2ENYA 3G9AB 3HNTL 3WS3B 3DGGB 3HC0B 4PJXB 5L6YH 3WDHA 3L1OL 4QXUH 3FO2B 1NDGA 2NY7L 4LPUA 2PXYB 5JW4R 4JRXA 2F53B 5DZNA 1I8MA 1R3LB 5TGBB 1N8ZB 4N0UE 2Z31B 5CWSA 2IALA 4MNQE 1U8LB 4MD4A 5FB8B 5DJDB 4PTTA 1H5BB 3ZDYF 3UZEA 1AGEB 5IG7A 2NY0B 1CFTB 3RUGE 1UZ6E 5EOCH 4XMKH 2ZCHH 3QUYA 3ZL4H 3L7FA 5A43C 3KYMB 5BVJA 3MRQA 2GJ6D 2O5ZL 2H3NA 4FQXC 3CSYB 5C09D 4GRWB 4RMTA 5EU6B 1I1AA 2BNRE 4PLKC 4DGYL 3GMOA 2KZWA 1NC2A 4FZEL 4KV5E 1YQVH 2COQA 2A0LD 5I16A 5CZVH 4HWZA 1QFOA 4IBLT 5EOTA 3GEWB 1CDIA 3GB7B 3UBXB 1PG7X 4YHPB 1R3JB 3D3VE 3FO0H 4IHOB 3VXTA 4JFXB 4FFVD 4WI2A 5KSAC 4FP8L 1FFNB 2J5LC 2NXZC 4JKWA 4NQUA 1FJ1A 3MRDB 3CUPB 4NZUH 1U95A 3BXNB 2A73B 3DNKA 3T0XA 1K8IB 1S7UA 1YNKH 2CLRA 3WIFB 3LZFL 4ERSL 1NBYA 4X5XA 4JPKL 3QUKB 1IQWH 5SWSE 3BP5A 3LMJL 5DVOA 1F4AA 2FJGB 4OF5A 1Z3GH 4ZD3L 2XTJC 1LO5B 1YEFL 1FFQA 4K3EH 2O61A 5DS8B 4HUWA 2QSVA 3B2UC 5FGCB 3TT3L 4MQSB 5KTEH 4JFED 5DUPL 1VHPA 2VLJE 3BEWB 4HK0A 2FH8A 1Q9OA 1HHIA 5I8CA 3L3GB 2Z91A 1L9NA 1AHWC 3QXAA 4IRZH 2P45B 4F2MB 1CGSL 3FAXA 1RHHA 4I18B 2BSED 4HIXL 1FZOA 2DTML 5CJ8A 1MUJA 3JWDH 4HJGB 4PLOB 1WCBB 5HYEA 1FGVH 4HHAA 3DXAE 1Q8MA 5GRJL 2NY5C 5FYKD 5LQBL 4XPGL 4G5ZL 3ROLB 2P8PA 3RPIB 1P4BH 2DKUA 5GZOC 1KOAA 5HI5D 1JPSH 3OKDA 1BVLA 4KK8D 3GHEH 1I1YB 4FQXB 4NP4H 2HJLB 2JTDA 5FYKH 5IMKA 3CSBA 5FHBL 3CZFA 3GI8H 3MV7D 2GK0B 4PJEB 3WIHL 1B4JH 1KB5B 1N64L 3GMPB 1KN2L 5F9JA 4JFEA 1WFTA 3D85B 1NCBH 3QXDA 5JIKA 4ZAKC 1FPTL 1UWXK 4KI5D 2YEZB 4NO0D 3S35L 3QHTC 2DQDL 2BRRH 3E0GA 3VFMA 2J5LB 1IGML 4HXBL 3V8OA 4A6YH 1H0DB 1AI1L 5BMFL 5IJVA 5DK0B 3O8XD 4OD3L 2VAAA 3UPCA 5CGYD 4OLZH 5C7XH 2HA1A 3FT4B 3FFDB 2LVEA 1XGQA 1LK3L 1RHFA 1DDHB 2GFBA 5TH2B 3MNVA 5I1KL 1RAMA 2EYTB 3P0YH 5KVDH 2WLZA 4ETQB 4YXLL 1FL3B 3WN5C 1Z0NA 1IAMA 3VG9B 3GUTB 4P5MA 1BFSA 3I75A 4HMDA 4NOFA 1F4WL 1NUGA 2BSSB 2H8PB 4LAQH 3MRGA 3KPMB 2YZ8A 4YIQA 4A6YA 5H94A 2AK1L 2IBBA 3SBWC 4QOKB 3ECBB 4JHWL 4GG6E 4ORZC 4D0CA 4NO0A 1AHWB 1JTOA 4P59L 2DB8A 3QO1A 1PZ5B 5GGQL 1CGXA 1UVQB 1KIRB 5CUSL 2ILLA 5C0DB 4PB0H 5E4IA 3MA7B 3FT3A 1FRGH 3BDYL 1FNAA 2LTQC 3O8XA 1A7RL 4HZLB 3IFPA 1NFDF 3TN0C 3P4NA 4OV5B 1GCFA 4XVSH 4UTAL 2YPLA 3LEVH 5DT1L 5BCAA 5I8OH 2DQCL 5E2VH 3QO0B 4HF5L 3TT1H 1QLEH 3CSGA 5D1XB 3X13B 3S37H 2P7TA 1BFVH 4PRPB 1HZHH 5F3HB 4HUXB 1T3FA 4I4WA 5BJTA 4R4FH 2ZKHH 3UP1A 4TULL 3UTTA 2AEQH 4WI7A 3MV01 4WW2B 5D70H 5F6HI 3SOBL 4JDVA 2BJMH 4WY7H 5DJ2A 2FECL 3CFJA 3V5DA 4CDGC 1S78C 2FECI 1RK1A 1ZHBA 4EVNA 3GDBA 1B0RA 1J12A 5FYKE 2ADIA 4EOWL 4Y16C 4DWHA 1A9BA 5EZIL 1G7PB 2V7NA 4X6CF 4U1LA 1HIMH 2Q8BH 1RUAL 1N2RB 3O6KH 3TA3C 4U7SA 3KLDA 3U4BL 5KSUA 4C59B 2RFXA 3LIZL 1ZHKA 3DWTA 5KVEH 1T83C 2WP3O 2DBLL 3LRGA 1UB6B 3K74B 4M4PA 3QJHB 4WHCA 4YXKL 3O3BB 2J1KA 2RQ8A 3EUUA 3RX8A 1ZKAA 5DLML 1F6LL 3RY6C 4KI5E 4X80H 2YC1A 5H37G 3HZYA 2R2BB 1S9VB 1OM3H 2F19L 4GRLC 4PJ5E 1TPXB 3CFEB 4UNTA 2GIYA 1DLFH 5D96C 5M94B 1XAUA 3I2CH 4DEPC 3EOYG 5IBUB 2MPAL 3K8LA 2VZOA 3EYUL 4N1HB 4LGSB 1KEGL 2H1PL 4MAYD 5ERWA 1R24B 1WIPA 2AKRA 5DURD 2PYFA 2YPLE 1J0KA 1G7MB 1WAAE 3MOAL 4MNGA 5DUBA 1ZLVH 3JXAA 3PGFL 3QZWB 5C3LD 4GKZA 3ARRA 2LTQB 4ZUUB 5FV2A 4FQCL 4NPYB 5IW3A 1IGIH 3TN0B 1OCWL 5HHME 2IFFH 3IDMA 2DLIA 4X4ZA 2W38A 4G8GD 2R1WA 5L0QB 2LU3A 4N5UA 1X6LA 1L6ZA 3UTTE 4ELMF 2VLRB 1IVLA 5HGGS 5CKGA 3OAYK 1KJ2B 5CCKH 2KBGA 5HGBA 4WUUD 4F9LC 4GW4A 4MQXC 5I71B 2F15A 3MRCB 5IQ7L 1T04B 2G9HA 5B39A 1A5FH 3GSXA 5LXGH 2ZOKA 2C3XA 3GSQB 4JZNB 5DD3H 2WSKA 4FQHA 3BVNB 3BQUD 1UYWH 4MAYA 1OAYH 4OCYL 4PJ7A 1TZGL 2EC8A 3D25A 1AR2A 1U92B 1YEIH 3EBAA 5EB9A 3GHBH 2IADB 2HVJB 2CIKB 2JB6B 4J6RL 5GRZA 5F7FA 5CJQL 3LB6D 5FGSA 2BC4A 2GT9B 4XC3H 2JK5A 5ESVB 2IAMC 1G9MC 1E6JH 1L0YA 4LF3A 4G8GA 3N50A 2V9RA 1XGUA 3TJEL 3EO0B 4G6KL 3W5MA 4NC2B 3WFBH 4TRPL 5CEYB 5GJTH 4G80A 3QB7C 1AY1H 3EOBA 1KJVB 2H41A 4UINL 4M3JA 3T2NH 1JF1A 3GMNB 1R3IH 2FYYA 2FNBA 5D96B 3P4MA 4KKBC 4DVBB 1VADB 2XFXA 4LP5A 5CINH 2UUDK 1FO0B 4MNGE 4QY8A 4YDVA 5KN5B 5TDOA 1AQKL 4TYUA 2XNAA 4JDZA 1RZIB 3T3ME 4PGDB 4JFHD 4NDMB 1IAKB 4OM1H 1DQML 1PLGL 3B2VH 1BD2D 1U8IA 1A6AB 1OD9A 4LNRA 4R4NC 5BRZA 2APXA 1FVDB 2DMBA 4D0DB 1NMBH 1FN4A 3HB3D 2GHWB 5E5UB 4Z7NF 2ZUUA 3RVWC 3VXSA 4IOIA 4NHCH 4OT1L 5IHUL 1PQZA 2CDFA 5T5NF 2WINA 4P3CH 4YHMH 4HT1L 1MJJB 2NTFA 3SPVB 1BPVA 4OUUB 4X7SL 1MFDH 4KQ3L 2EE3A 5B22A 2I9TB 1FNFA 1RUQL 2R15A 4OF0A 4QRRB 2BVTA 4RQQB 1DL7H 4PJ7E 4UZGA 4LSRL 5C0RH 4ZTOH 4PLJC 1P7KB 5FGBA 2AEPH 2AW2A 5GGSB 1BBJB 2W9LA 4P9HC 4OZIB 4PJAA 1BM3L 4XTRC 1HDMB 4R3SA 1K4CB 5IKCA 3V52H 1QFWL 4HBCL 3CH8A 2ITDA 4UNUA 1BD2A 3LRSA 4G8GE 2QQNL 5T33H 4DW2L 2PXYD 1L4IA 5MERA 1HHJA 5IHZB 5A2KH 2AK4A 2F53D 5GRVL 1JTTA 2W9DL 1LEGB 4PJ9C 2D9QB 5J0BA 5HDQL 2DWDB 4HIIB 2VN4A 2HT3C 2Z31D 2IAMB 1SHMA 4YUEH 1A1MB 4FQJL 4D9QD 1NH6A 1IGYB 1X5KA 2NY0D 3MRLA 2ZUSA 5DWUL 2V2WB 5C0AA 2KL6A 3T4AB 2BY3A 3QUML 3T0AA 3SDCC 5E5RB 1LP9B 2B4CL 4OTXL 3A6CH 5LCVL 1K85A 5FYJD 1RIHH 1EO8L 1W0WA 1U8QA 3MUGA 5EU6D 3GI9H 2Y23A 3N1QC 5FHAL 5BRZE 3U36A 2DQGL 2CXKA 4IMKA 2KQMA 5H2BA 5ACZA 1N5YH 3AROA 1J8HB 2HAZA 3WS3A 3VXSE 3AGVA 2VXTH 4RZCA 3HC0A 3OGCB 4I0CC 2I27N 3QAZC 3FO2A 1G6RL 2PXYA 3B6SA 2I26N 4N0CC 2F53A 5L7XH 1LE5B 1R3LA 1N8ZA 3UJJL 3MLXH 4XNZB 5SX5K 2YD8A 5KZCB 4MB5A 1ULVA 3F8UB 5K59F 5DJDA 1YEDB 3G6JF 4HX1B 4XP4H 5F6IC 5J9PB 2YSSB 2DIAA 4ORGB 1CFTA 2BSRB 4EI5B 4Z7VB 3KYMA 1ZLSL 3D87B 1CXLA 3MC0A 3U0TB 5DMGD 3CSYA 4PJAE 5GS0L 3SDXB 4ODWB 2MQ0A 4JO3H 1FSKC 3ZTJH 5EU6A 5I19L 3U7AA 4JREC 4LSQL 2EE2A 1RJYA 3BZDA 1AC0A 3KHQA 1MHHB 2AK4E 3NAAL 5FO9B 3UBXA 4BUHA 4YHPA 1IBGL 1R3JA 4IHOA 4I8DA 2Y07L 1F58H 1FFNA 4W6YB 1I9RH 3CUPA 1OT1A 3SO5A 2YUZA 4PJIB 5C0AE 4PJ9B 2A73A 2VDPL 5E6ZA 3O2VH 1K8IA 1OPGL 4Q6IA 1LEKB 3WIFA 1U8HA 4M6NH 4APQC 5FECB 4U3HA 3V6OC 2QEJA 3GSVB 1BHGA 3T2QA 1GAFL 2N7AA 4FQQB 4NRXB 3QUKA 4IDLA 5GGVL 3SDCB 4H5SB 2FJGA 4PB9H 4FQXD 4XXCC 3S98A 4YEEA 1Y6MR 1LO5A 4LAJH 4P2RB 5DS8A 4UOJA 12E8L 2E8ZA 4EDWL 3D85D 3NFPB 3BEWA 4LLUB 3ZT7A 4X99A 1NCNA 4I9WE 2F53E 4KKAC 2YPVL 1RFDL 1NBZB 3KAAA 5JUEH 1BJ8A 3OKEB 1IAIM 4F2MA 4ZXBC 3ME0A 5EA0H 4D9QE 2J8UF 4I18A 1KLUB 3DARA 4BZYA 5L6YL 4QXUL 4HJGA 4DUXA 1WCBA 3KLAA 1U8KA 4PJHB 3F58H 1I1FB 3C6LC 1N0XH 4LPYA 5DA4A 4NKDB 4YR6B 3ROLA 3RPIA 5F6IB 2Z4QB 4LASH 2C26A 1DUZB 1EHXA 2D7NA 3LS5H 1D7FA 2ZCHL 4XMKL 2HJLA 3ZL4L 4MDIA 1HEZB 1HXYB 4CMHC 1FSKB 1CDBA 2GK0A 4PJEA 3QT2A 1KB5A 3GMPA 4JREB 2DQEH 2F9BT 4J3UA 4PJXF 1W2KT 5LWYH 4XNQB 3D85A 4QOKD 2NQCA 2DLEA 3Q48A 4NZJA 4JQVC 5JR1H 1YQVL 3BO8A 2YEZA 4JM4H 5SX4I 4P99A 4PRNB 3U9PL 1WWWX 3FO0L 1H0DA 1QSEB 2IBZX 3FAWA 3V6BR 2BXZA 2EDKA 4NZUL 5DK0A 1U9KA 5FM5O 4X4XB 5JDJA 4KK9C 2BVYA 5MHSE 1YNKL 3K3QA 3FT4A 4PGZA 5I8EA 4B41A 1MFBH 3FFDA 5FGCE 3BRGC 1DDHA 2ED7A 5TH2A 2EYTA 4OF3A 1IQWL 1I8IA 2E9BA 4ETQA 5D1XD 3FQXB 4F8TA 5MI0C 1FL3A 1JWSB 2CPCA 1Z3GL 4PRPD 3GUTA 2WLYA 4K3EL 3H9HA 4YHLH 4BSWB 1NPUA 3EJZD 3KPMA 5KTEL 4QOKA 1RZGB 1YYLH 4MB3A 1FL5B 3ECBA 2OJEB 5I1JH 3MLVL 4LPTA 4DJMA 4MLSA 1T1ZB 4ZXBB 5TJWK 1UVQA 1MEXH 4IRZL 1KIRA 5C0DA 4Z6AT 4OSUL 4MZ2A 4JZJC 1S9XB 3ES6B 3MA7A 1A02N 3JWDL 1BLNB 3QDAA 4HZLA 3CFBB 5FAAA 3WLWC 4KRMB 4KC3B 2O5YH 1QQDA 1FIGH 3QO0A 4O2CB 3GHEL 4JJHA 5D1XA 3VGFA 3X13A 4XCFH 3SE3C 1DQQB 2OL3H 4CMHB 2YD7A 5FYKL 4PRBB 1BQSA 4PRPA 5IHLB 4PP1C 5F3HA 4HUXA 3RAJH 1B4JL 1CDUA 1Y0LB 4WW2A 2HMIC 5JZ7C 2YS4A 3OKMB 3K1KC 5E08H 1NCBL 3LQZB 4QXTB 4JPVH 1X5AA 1U8JB 1G7PA 2ADGA 5CBAB 1CF8L 1N2RA 4GW1B 4A6YL 3ARFC 7FABH 4PJDE 1N6QH 3RJDA 4O2FB 4JVUA 3TN0D 3BWAB 1CWVA 3QQ3A 5IIEB 1J5OH 4NWUH 3DRTB 4OLZL 1UB6A 5C7XL 3R8QA 4ZUTA 5F7HA 3T3PF 3IDYC 3KDMB 1FP5A 4RFNC 3O3BA 2VLRD 3K2MC 3P0YL 2D0FA 5KVDL 4G42B 4HUMB 1JZ7A 4CU7A 2R29H 1GZQB 3VXUE 3UROR 3S88H 2R2BA 2YWYA 3HR6A 1S9VA 2CKBH 5IJKC 5H35A 4LLQB 3UBXG 3EGSB 2F54B 3CFEA 4DKEL 1LO0H 2Y72A 4LAQL 1S78D 4CJ1A 4Y8AA 1KJ2H 5IWLA 1CD1A 3QHFH 2XWJA 3QIBC 1IC4L 2XRAL 1R24A 3CC5B 2AVGA 4K71C 3QDHA 1G7MA 3O0RH 5CMAB 4PB0L 3C60C 1XIWA 3WL9B 3SE9H 4ZUUA 1R5WA 4P2OB 4EXPX 3V2AR 4RWHA 4NPYA 4EDXB 1FRGL 4HG4J 3VGAC 5ADOH 5LGJB 4U2YA 1BF8A 4ZFZA 1AC6A 1EH9A 4LCUB 4XVSL 5HDLA 3D6GA 1EFXA 3LEVL 5I8OL 2VLRA 4LRIA 3E6HA 5E2VL 35C8H 3TT1L 1KJ2A 1QLEL 1YJDL 1KXVC 4Y19A 3MRCA 1BFVL 1QSVA 1HZHL 3QR2A 4R4FL 1KELH 4U7MA 2ZKHL 2NNAB 2OCFD 5IF0B 4TTDC 3SN6N 5BV7C 4I5BB 3GSQA 4HH8A 5D70L 5IFHH 4JZNA 2B1AH 4WY7L 1Y6KR 2NZ9C 2R4SH 3BVNA 3RKDD 4JO4H 5F9DC 43CAB 2UZIH 3B9DA 3LEXB 2IADA 3ZE1F 2Q8BL 2HVJA 3O6KL 2CIKA 1FO0H 3MCLH 2JB6A 4J3TA 4PV9B 5D4QA 1B6UA 1INEL 3BPOB 1FAIH 2I25N 4XNYH 5ESVA 4QHLB 1DANU 5KVEL 3QNZA 4Q6YA 5GGRB 3MCG1 1CICC 5CEYA 1PYWB 1T2QL 1MJ7H 3H0TB 5SV4A 1KGCE 4YHNB 1G1CA 4QRRD 4X80L 3OAUH 3O3UN 3GMNA 4GO6B 4JKLA 3BKCH 2WW8A 1P7HL 1OM3L 4DVBA 4MQ7A 1AJ7H 4DTGH 1VADA 1FO0A 1DLFL 5JORB 1C7TA 3K46A 1RZ7H 3QIBB 4XPBH 5DJXB 2HT2D 4PGDA 1IAKA 3UEZA 3FOLB 4OCSH 2DQTH 4YE4H 4ODXB 2VZSA 1FVDA 1KG0B 1IFHH 4D0DA 2EYSB 3O4OC 2Y9RT 3VGAB 4LPWA 1P1ZB 4F57H 4R97B 2ATPB 3CFIC 1ZTXL 2IAMD 4MD5B 5IHBA 1IGIL 4Y19E 4YK4C 5AYUH 1A7NH 2IFFL 2NY2C 1IC1A 5F9WC 1QACA 3QDJB 4H20L 1MJJA 1MFNA 4OUUA 5D6CB 5D7JC 4RX4D 1YMHB 4JFFE 3CVHB 4R26H 4WWID 2I9TA 1QPPA 5CP7B 5CCKL 3TBTB 4WWKB 1XGPB 4GMTL 4PLNC 1ZLUH 4KKBD 1P7KA 3MRNB 5GGSA 5BV7B 4JY5H 3LH2H 4NN5C 1A5FL 1CL7H 2C3WA 4PG2C 4QRTB 3FO1B 3N06B 5DD3L 4WV1B 3ULUC 2X4SB 4HH9B 5FKPB 3C8HA 1J8HD 1HDMA 1K4CA 4WFFD 1UYWL 1OAYL 4N90E 2XQBH 4IOSD 1CU4L 4R4ND 2HH0H 3WLBB 4YDLC 1YEIL 2J4WH 4ODVH 1BX2B 1JHKH 3GHBL 3CXHJ 1LEGA 4KVNH 4HIIA 3H8NA 5KZCD 3OG4B 2IAMA 4LVHB 2ZWLT 3R0NA 4PD4J 1A1MA 1AP2B 4XC3L 3HFMH 3NTCH 1IGYA 1E6JL 2V2WA 3T4AA 2XTLA 4RX4A 4EI5D 2X4RB 4ZO8A 1BGXH 5GJTL 1LK2B 3T4YB 4CVUA 1LP9A 3NH7H 1AY1L 5MP6L 2VZVA 2WWMD 3REVB 1QO3B 3T2NL 4OCXH 4PLJD 1SVCP 1FFPA 4YO0B 1R3IL 1EBPA 2HFFB 3GSUA 1WITA 2P42B 3MACH 4RMVA 3JWOH 1FBIH 1PKOA 4ZTPH 1EXUB 4G8IB 1J8HA 3IS1X 4GAYB 1I3GL 1MY5A 1FYTA 3LKSB 4OM1L 3B2VL 5IMMB 5DMJB 2NY4C 1YNTB 4PJ9D 1LE5A 3O4OB 3WFHA 1B3JA 2ENSA 3LY6A 2HT3D 4L29B 1IGCH 1NMBL 2UYLB 4TQEH 2BNQB 3O4LB 1YEDA 2NY2B 4NHCL 3ETBF 4HX1A 5L9DH 4JGUA 2YSSA 4P3CL 4OFYD 4ORGA 2ZG2A 5D7JB 3PWUB 5CSGA 3MFFB 1EMTH 4EI5A 3SDCD 2W0LA 3OKOB 4Z7VA 1MHPH 4WFGE 1D9KC 3U0TA 2DJUA 5BW7A 4W81A 5IBUG 3SDXA 4ODWA 1IEAB 1JYVA 4P2RD 3WD5H 1BOGB 3ORJA 1ZT4B 2DQFB 3IETB 4HDIB 3P3YA 4CKVX 5C0RL 4ZTOL 3T0EC 1MVUA 2AEPL 3GBNL 3DV6B 1VGKA 3JVGC 3MRRA 1MHHA 4LLMB 3ZDYE 4QWWD 1IJ9A 2JJTC 4LGRB 1DJSA 5FO9A 4P57B 3QZWG 1ZGLP 4F80A 1EZVX 5C0CB 2JCCB 3V52L 1HXMA 4N0CD 2CQVA 3ARUA 4PJIA 2AXGB 4NNYB 5JTWA 1TQCC 2IBGA 1LEKA 3EYVA 4H1LH 5FECA 4ZOAA 3SGJA 1CDHA 4XB7A 4YUEL 4OFPA 3LQAC 3GSVA 1G1YA 2MCPH 4WTXA 4OFYA 5DFVC 4FQQA 4NRXA 3BSZH 2F74B 1IT9H 4H5SA 3T09A 5EBGA 2BOBB 2EH7H 1IGFH 4OZIF 3P9MB 2EE9A 4RAVB 4ZMAT 5HPOA 1BQHB 3A6CL 1RSFA 4P2RA 4I1NB 1XGYH 3CDGB 1FYTE 3VFOB 3GI9L 2LE9A 3NFPA 4LLUA 3ZT5A 2NMSA 1X5JA 2XQYG 3ZYZA 4H1LA 3OKEA 3QIWC 3GMMB 2VXTL 2RBLA 4AQ1B 1KLUA 2ADFH 1GGUA 4RDQF 2NY4B 4IMLB 1QSED 1E4WL 5L2KB 4QHUB 4R7NA 1ZHLB 4M93C 4PJHA 4Z7VE 2CUHA 3W39B 1LP9F 1I1FA 4Q9QH 3NFNA 3MLXL 4YR6A 2EIDA 2OSLB 4GLRH 5C0BB 2Z4QA 4M7LH 2ID5A 4XP4L 1DUZA 4U1JB 2WBKA 3ARWA 1SVZA 3O11A 1HEZA 3AXLA 3BJ91 5GSRB 1FORH 3V5KB 3BJLA 1CLOL 1FNSL 1D5MB 3TCXA 4JO3L 2HLFC 2WBJA 4XNQA 1YN6A 2YOCA 4KKAD 5IB5B 4MXWH 4PJIE 2VNCA 1TTFA 2DWEB 3BKML 2FD6H 1QSFE 4PRNA 4ZXBD 4KGJA 4K9EC 4BFBD 4HXAH 3PWPB 1F58L 1QSEA 4O58H 2IGFH 2J88H 3AAZA 3HZMB 4D2NA 1PKQB 2F58H 3I3EA 3FN9A 2D0GA 4P3DB 4X4XA 4A2MA 1MNUH 5JW3H 2YD3A 2Y5TB 1INDH 2XICA 1YUHA 3SDAC 1NDMB 4M6NL 4HFUH 1KEML 1LVEA 1D5XB 2OI9C 4H0HB 3ARGC 3DSFH 2N4IA 1JWSA 1QFUL 3EIFA 1CZ8L 1FGNH 1ACYH 5DA0B 3VXOA 5IVXB 1C5DB 2ESVA 2AXJA 5E7FA 4RBPK 4BSWA 3M07A 4BFIB 2JB5H 3RKPA 1RZGA 5IBTH 1U8OB 3QIWB 1YEGH 1RZKH 4ZXBA 4L3CB 5JUEL 4KDWA 5EA0L 1KB5L 4LU5H 2Q8AH 1MQKH 4KKCC 1LEIB 1S9XA 3ES6A 4RDQG 4IEFB 4NQDA 4F7PB 1BLNA 3IXTA 4E0RA 1JPGB 3CFBA 1FCGA 1A21A 4LDOB 4EBQH 2KQNA 1N0XL 3GBMH 1XCTB 3JV5A 2A2QT 3D39B 4LASL 3I9GH 4O2CA 3NACH 2PW1B 3C5ZA 5DGRA 3LS5L 2FR4B 1Q1JH 5GRYA 3LD8C 4BA8A 4PRBA 4GQ9H 2H26B 4YHIB 1BEYH 4F7MB 4YPJA 3L95B 5IB3B 1J05B 1U36A 3ZKMD 1K8DB 4S10A 2F54D 2DI9A 1F4YH 3OKMA 1QSEE 3ILPB 5LWYL 4L4VB 5BOPA 1NFDE 4QXTA 1DN2A 3QWOB 3K8MA 3RWJA 5C92A 2FEEI 4JM4L 1T7VA 5CBAA 1C12B 3LEYH 1EK3A 1YECL 4GW1A 1CDGA 4OFKA 1V3LA 4KAQH 1LMKA 4P2OD 3U7WH 4O2FA 3V5HB 1OAUH 3BWAA 3WLWD 5F7EH 5F96H 1BP3B 4M6ML 3SDAB 4LKCB 2ESVE 3HTLX 1MFBL 5I6XC 2OI9B 3H3KA 4RFOH 1OARH 5DD0L 4G42A 4PP1D 4XNMB 1GZQA 3WNLA 4LLQA 3EGSA 2HMID 2EDHA 2VQ1A 2FIKB 2IQ9H 1MCIA 5EOCJ 2C4FU 3CH1B 1YYLL 2HJFB 3QSKB 5FA4A 4NQDE 6CGTA 1CFQB 2FWOB 4LCYB 3CC5A 1K2DB 1MEXL 5HHVH 3RZCC 4P2OA 4UNVA 4OLVH 4EDXA 1HH6A 2UWEF 5DHVB 4WU5B 5GZNC 4LCUA 2Z8VC 1SYSB 3ABZA 4KXZH 2O5YL 3DRQB 3OJDA 3SE8H 4LKXB 1FIGL 2VDRH 5JW5B 1VA9A 4XCFL 3DVIA 4QGTA 4U7KA 4YFDB 2AEWA 3ZYIA 4AK1A 2E9JA 3LVEA 3EW3B 3IT8D 5F89B 2NNAA 1U41A 4I5BA 3KJ6L 2F8XC 5E08L 4YNYB 2VR4A 3QIBD 4LCWE 3MV9B 4OBSA 1JNLH 4WJ5B 4DAGH 4ELME 3QA3B 43CAA 4U6TA 5B4MC 3LEXA 2QHRH 2Z8RA 4YLQT 4NGHH 3OZ9H 4LP4A 4PV9A 3MUZ1 4OUOA 7FABL 1N6QL 3I02B 4QHLA 4ISVB 2DYPA 3D9AH 3S4SB 1J5OL 4NWUL 3QDJD 1BZ7A 5GGRA 3SKUD 1PAMA 1PYWA 4UILH 4GKSB 2EO9A 3H0TA 4GS7C 1OTSD 4YHNA 4FNLH 1WWCA 2E7BA 4OQTH 4NJAH 1AXSA 2R29L 3QNXB 4WWKD 2X1XR 4N9GA 4WHYG 3S88L 3DX8B 3LAFA 5IVZB 4TTDD 1OL0A 5JORA 1LO0L 2CMRH 4QGYA 2NZ9D 1W72B 2X9YA 4HIJB 4P4KC 3VFRB 5DJXA 1KJ2L 4GUPB 3QHFL 4P0DA 3EJYC 4P9MH 1MJ8L 5HHNA 2FB4H 3FOLA 3SGEH 2VSCA 3MRMA 5CS7A 4BQ9A 5T5FH 2ARJB 3AS3A 5HVWA 5DJ8B 1R3KA 3O0RL 3T1WA 4ODXA 2VOTA 1KG0A 2EYSA 3EFFB 3S3JA 4Y4FC 1P1ZA 2K7PA 4X4ME 3WYRA 5EOQL 3U6RB 2ATPA 1T2XA 2E27H 1O7VA 4D94A 3QFJB 5ADOL 1K4DA 5C2UB 2NX5B 3H2WA 3QDJA 4P46B 4UI2A 1AIFB 3GK8H 5D6CA 5I1GH 2GSIB 1YMHA 2MTPA 5SV3A 4QXGH 1DEDA 3TBTA 4BSJA 4WWKA 1XGPA 4UU9A 5J1TC 3K2UH 5A16B 2XWTB 1KELL 1N3NB 2A1WH 4GAFB 4Q9RL 2VITA 3FO1A 4GH7B 4QRTA 4XCYB 1KPRB 5IFHL 1PGRB 4WV1A 2X4SA 4HH9A 2KZ1B 3IDGB 4O4YH 2R4SL 1DBBH 1WZMA 5JXED 1A22B 3AY4C 3DO3A 1HH9A 3WLBA 2G60L 2GITB 1NGWB 3ZYJA 4L8CB 2UZIL 1BX2A 1I8LC 1WBXB 1FO0L 1FLRL 3PQYB 4KDVA 3UYRH 4IRSC 3PP3K 1JGVH 3QI9B 4RA0C 2BNQD 3O4LD 3B83A 1DVFC 2NY2D 5I17B 4IJ3C 2X1WL 3BIBX 2WBWB 5D7JD 5F7DB 3WNKA 3TIDA 2X4RA 1BQLH 5ELIA 3DMMC 5C08B 1LK2A