5ERWA

Structure of hcv e2 glycoprotein antigenic epitope ii bound to the broadly neutralizing antibody hc84-26
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
217
structure length
212
Chain Sequence
MQVQLVQSGAEVKKPGSSVKVSCEASGGTLSNYVITWVRQAPGQGLEWMGGFIPTFRTAMYAQGFQGRVTITADESTSIAYMELTNLRSEDTAVYYCARGPLSRGYYDYWGQGTLVTVSSAKTTAPSVYPLAPVCSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of HCV E2 glycoprotein antigenic Epitope II bound to the broadly neutralizing antibody HC84-26
rcsb
source organism Homo sapiens
molecule tags Viral protein/immune system
molecule keywords Anti-HCV E2 Fab HC84-26 heavy chain
total genus 39
structure length 212
sequence length 217
ec nomenclature
pdb deposition date 2015-11-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5erwA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5erwA01
4GOSA 4QHMA 4XRCB 1J0IA 3OGCA 1KV3A 4FQXC 4J6RL 5TE6H 1UCTA 1RD6A 3R1GH 2DLHA 1FE8L 1S7WB 3DUSB 3IS1X 5F3HB 1A6VH 3JUYA 2P4AB 4XT1C 4PJXF 3K2UH 2MOVA 3CVIL 2HH0L 4TVPE 4RFEA 1MCFA 1NANH 3HAEA 1FBIL 2HG5A 2UY7A 1UH2A 2X6MA 3TH2T 5TPWL 3ZTJH 1JPTH 2A9NL 3RX7A 4MVBD 3BPNB 5E2UH 3UTTB 2JB6B 1P7QA 3L5IA 1FO0A 5C6WH 4I0KA 1TQCC 4QTHA 4DTGH 4IEFB 3T1FA 5JXEA 4OM1H 2APBA 1NCCH 2IH1B 2NX5E 1P6FA 1F4YL 2VITB 3QWRD 3W9EB 3HPLB 4HX1B 1WISA 1BD2E 1CN4A 4KKAC 4O2CA 5KBNC 1RQ5A 4GRLA 3IETB 4KQ4L 4OCXL 4YK4B 3VXSB 3V7AG 2C3GA 3LKRA 5E8NB 1TVBA 2IF7A 4I3SH 4C54A 4RAVA 4G6FB 3C8KB 5BRZD 1N0LA 1R5WA 1QR1A 3KPMB 2H32A 5GHWL 3T0XA 3V8CA 5D2LA 4XP6L 4WUKH 1A0QL 3T0EA 2AAVA 3VXSE 1T21B 4L8SA 1JZ2A 4L4VA 3AREB 4ZUWB 3EYUL 4KGLA 3FKUS 1MWAA 1PZ5A 4PRHB 12E8H 4YC2C 4D0CB 2HRPH 3FB5A 5LQBH 5EU6B 2ICWI 5IT2H 5DJ0A 3IFNH 1MHPH 5ADPH 2UZIL 1HQ4A 2NY7H 1DQLL 1L6ZA 1F8TH 4ZFGL 4ZAKD 4XCEA 5L8JB 3BP6A 1S7QB 3WV0A 4ZXBC 4CKVX 3U7YL 5JXAH 1H8NA 3MZGB 4P5TC 4RGMB 1NBZB 1MJJA 2DMCA 4NRXA 3FO9B 4WTXA 1G7HB 4X4YA 3DECA 1J0JA 1KCUH 2R9HC 4LSSH 1I1YB 4PJCB 1E4JA 4HZLB 3I6LD 3MLSL 4OZHA 2CRZA 3NH7H 4L5FH 5DYOB 4L8CA 5GRVK 1NC2B 2UYLA 4WW2C 2FHCA 4OZFG 4XNZC 4FXGA 2V17L 3B3IB 3TBVA 3JV4A 4Z7NE 4HZAA 5D7LB 1OLLA 5J57B 1GZQB 3BW9A 1MH5A 4FG6D 1V7NH 1DBMH 2IQAA 3NCCB 4U1JA 1JP5A 4ZYKA 4I0PC 4M62H 4DN3H 4G43B 3LN9A 4P9MH 5C0CB 4GBXB 1BF2A 2RBLA 2Q6WA 1G1CA 2OMBA 5EU6D 4MCZA 4EZMA 1YNTA 5EDXA 5T1LA 2FBOJ 2HLAB 1P9MA 4UIKL 1KC5L 1RAMA 4UMGA 5BS0B 5E08L 2DF3A 4EEEA 5I75C 2NY0B 4NWUH 4C56A 5FUCE 3S4SG 4JO3H 2ZCKH 5DMJB 4G3YL 4EOWH 4X6CF 1T03H 4HUNB 3DSFL 3L3DA 3MJ8A 1XGRB 2AV7B 3V0VA 5CD3B 5F70A 1WFUA 2OZ4H 5E6YA 1TCMA 1KEGH 3Q6GL 2CGRL 3KPRA 3PWLB 4LOUD 4HBCL 4CVXB 4MAUL 3DI3B 5DD0L 4J3OC 4F37F 4OIIH 4JG0H 1NDGA 1LO5B 1FO0H 5EZIH 4KC3B 4LPUA 1YPZE 3CVHH 3P9MB 5DRZB 3WNLA 5DD5L 3T3ME 4FFWC 5GS3A 5GGVL 1CDGA 4UBDC 2FJHA 2BOBB 4HKJA 5H37H 1A7RH 4M03A 3U83A 2EICA 3MYJA 4N1EA 1CL7I 4BFIA 3BVNB 3FFCA 1KFAL 5GGTL 3T4YA 5J12C 3UPAA 5ESVA 3LQZA 4WJ5B 2BDNH 2CRMA 3K81A 2ZUXA 4Q6IB 5JUEL 2ADGA 4R26H 4MS8D 3VA2C 1MCOH 4F7CB 4G6ML 4E41E 1EZVY 5C71A 5IQ9B 4PRAB 3TNNA 4L29A 3MLYH 5H94B 3VGAB 1I8MB 5FA4B 4NKDB 3WLWD 3G08A 4JB9H 4OF6A 1FO0L 1AKJB 2NYYC 3TO4D 2VZSA 4PBXA 2B39A 4ELMF 1GPOL 2Y5TB 4JPVH 3NIFE 3DWTA 5CEYA 1DP0A 3RTQB 1KGCD 2ADGB 2JKXA 3D85B 4Q6IA 2XTJC 3X3GL 1KXTB 4I18C 1WK0A 3HZMA 4U1IA 1J8HD 4RZCB 5B4MC 3PIQB 2Y9RT 3T4YB 3WXWH 2HRLA 3D18A 5DS8B 1L0YA 3DSFH 3FMGL 3KYMB 5F72S 1T03L 1YDPA 4AIXA 1FNEB 3LN4B 3PL6D 4Y16D 1ZGLB 3SCMD 3VRIB 2FATH 1BVKA 2XFXA 5C0AB 2F53B 2H1PH 3OR6B 4D0DB 1NGZB 4LLMA 3FQXB 1VA9A 4G7VL 1EA9C 2FSEB 3R06A 1MUJB 1V7ML 4P2YA 4GLRI 3IDXH 3R0NA 5I1LA 5IMMB 5LXGH 1TLKA 1GGBH 3T0ED 1GVIA 3JTSA 2DWDA 3VDBA 1HCFX 4DN3L 1QA9B 2RIKA 3HI6L 5SX4I 1PQZB 1DBML 3KPRB 5F1SA 2XYCA 1JZ6A 1PZUB 4H0HB 3LIZH 1MIEL 2AV7A 4DUXA 3MJ8B 4X7SL 4QHUA 4JANB 1I7TB 2V17H 3MCG1 4OZHE 1ZHBB 4HGMA 4YZFF 3RWEA 4N1CA 1E6OH 1XGQB 4NGHL 1FLRL 4FA8A 3RL2B 1KNOB 1JHKL 3ULSB 2R39A 3NCYP 2WBJB 5T1LB 2Q7NA 5EIIA 4ZSOA 2BFVL 1YNTB 3OJDA 2X4OA 4HWBL 1F8TL 2WQRA 5TFSL 4ZFGH 1CD9B 1AHWA 3QO1A 4JLRB 4ODHL 1I9IL 3O2VH 4F9PC 1RUAH 5CZKA 3TO4A 3NGBB 4K94H 4R96A 1FP5A 1A7OL 3GIVB 3ARFD 3GSOA 1FC1A 2EE9A 3E8UH 3UAJD 1TNNA 1RZJC 5AG9A 1LHZA 4MLSA 5T5FH 2C9AA 2VDLL 3C6SB 1H15A 1ZVHA 3HE7B 2PUQT 5D96C 1I1YA 4PJCA 1NUGA 4QXGL 4X4YB 3VFVB 2CK0L 1S9VB 1NAMB 3BGMB 5D7IA 4WGWB 5D6CA 4NRXB 3EYFA 1MJJB 1OCWH 3DROB 1NANI 4RGNC 5KSBE 3FRUA 3MJ7A 1S7QA 2W9DL 1PBYA 4EQ2A 4HF5H 1WZ1H 3FN0H 4U33A 4YFLF 1HOCB 5D1ZB 3TZVC 1HQ4B 1C5BH 1E4XL 1F4YH 1T2JA 3C5JA 4EUPG 4OM1L 4PRHA 2R1WB 3EGSB 2VAAA 1OTUD 4MNGA 1BFSA 3V8OA 5CJ5A 3HG1D 4PY8I 3BQUD 1JIBA 1T21A 3SGDI 4TSBL 4DAGH 1A4JB 2AJXL 4OZFB 5DRWA 4YJZL 4XB8A 1DVFD 3KHQA 3NPSB 4KK8C 1CLOL 2NY2D 4KKNA 5IB2B 3HMXH 5I66B 5E9DB 1QSEA 4J3TA 4OFYA 3OAZH 4GRLB 3RY5A 4XP5H 5EUOA 1AGFA 2P47B 4HX1A 1DN0B 3TNMB 1AGDA 4FFWD 1BIHA 4XH2A 2VITA 2N56A 3GSWB 2CLVA 3WCYA 4DVBB 3VGBA 3BIBX 2FGWH 1JK8B 4BH7A 1F3RB 3DVNA 2RAMA 1BECA 1TTFA 1WZLA 2QL1A 2JB6A 3TJEH 1CTNA 1EH9A 3HZYB 3G6DH 3NCMA 1FGVL 3WFCH 4QXUH 4LGRB 5MEND 1LO3L 5IP4A 4XHQA 2XZCL 4GKOA 5GS0C 5J3HD 4K9EL 3QQ9D 1J0HA 3INUH 4HPOH 3PDDA 4QRQB 3NVQA 3QSKB 4JZOB 4JFZL 3PL6A 4XVTL 1LMKA 4RRPG 3RWDA 3CSYA 4RISL 3C5ZB 5CILH 2GT9B 1DFBH 4LSVH 2DLTA 2ADFH 4C4KT 3KVQA 5FO8B 4GRLC 4B7LA 3VD7A 1H3UA 3OKEB 2A9ML 3SCMA 5FUZL 1ZS8A 1J05A 5I76B 3LKQB 1Z3GL 1OD7A 1E6JH 1G6RL 2EKSA 1UJ3A 2FWOB 2E5EA 4Q2ZA 1UC6A 1UM4L 1NQBA 1WBXA 3DMMA 1Q0YH 5FGBA 2R0ZH 2ESVB 3HTLX 1VGEL 5C07D 4HXBH 3W9DB 4Z77A 2GT9A 1UZ6E 3HE6A 3GBNH 4QWWC 1DDHB 1KXVC 4MJ6B 4EBQH 1UXWB 4G6JH 2NY1D 1QBMH 1QRNB 4JZOA 2JCCA 1HHHB 4OTXL 2XWBB 1G7LB 1BJ1J 3DX6B 4PG9A 1M4KA 3OKYA 1W72B 4WY7H 3FJTA 4O4YL 4M9PA 5CGTA 2ZPKH 2VLKA 1EJ6A 3GM8A 1ONQB 1RURL 4O2EA 3DYMA 4G8GD 1L9MA 2DTML 4Z5RA 5CCKH 3B9DA 3ARZA 5I1HH 1BJMA 5EPMB 4ZFOA 4M43L 3P4NA 2D03H 3P0VL 4XH2B 3MRCB 3BH9A 2XPGA 3K46A 3TNMA 1MVUA 1DN0A 3RA7H 1BFOA 3EJYD 5J8OA 3IS0X 1R24A 2V5SA 5D71H 3CFDB 3OXRA 1MJ8L 5IB2A 3RUGF 4LLUB 5H37G 1I8KB 4LLWA 5JOPE 4ORGA 2LFGA 3F7QA 2NY5L 3FTGB 5C08A 4OZFA 2J8HA 4KK9C 1ZKAA 3WD5L 1N8ZB 4WY7L 1A6AB 2DQIL 3FCTB 5BVPL 1X6NA 3BGFC 1UQSB 3UDWC 3FHQA 1CTOA 1HYRC 3PDOB 3KPOB 2NY6D 5D5MB 5CSBA 3D3VB 5BOZG 1U8OA 4RX4D 3GBNL 2YPKB 2EDJA 2XKUA 5C0DB 4NQCB 3DUHA 3FRUB 3MJ7B 4WIQA 3MMEA 1UM4H 4K23H 1CGSH 4LHQB 4IMKA 4EI5C 3EYFB 5JIKA 5I16A 5BQ7B 4JPKH 2NTSP 4WUUE 2DQCH 3SKNA 1NC4B 3TYFA 1XH3A 5IHBA 4ODXB 1TZGL 4MD0B 1ULVA 1CFTB 2YSSB 4PRIA 4M7JL 1MAMH 2IADB 4HIJA 3IJSB 5GRUL 3GSOB 2NX5D 4XGZB 5E99L 5I2IA 3DYPA 4XMPL 3HC0A 3RY4A 4PJDB 1KTDB 1P4BH 3G5ZB 3MCKA 1R3JA 2YPLD 1KIRA 1MQ8A 3KJ4B 4X9GA 2DQTL 2D2OA 4FQXA 4P46D 3TT3L 3QUXC 3F7VB 2HMID 2VISA 4OBRA 4YX2L 1WZKA 2V9QA 4NQCD 3G6DL 3RU8L 2G5BA 2AJVL 3TBTB 3ZE2F 4RGNE 1CLCA 2P44B 1JNNH 4F80A 1OAZH 4WUUB 2OBGA 3L7EB 2X10A 4UAOC 5HI4C 1BZQK 3NPSC 4N0FA 3JTTA 4LDEB 2HT3D 4OB5H 4YO0A 5GRYA 5I6XC 3AU1B 3WN5B 1T2QH 1N7ML 5GS1C 5LWYH 1RUKL 2FZ3B 1RFDL 2J8UE 1I8LC 2VIRA 5I1KH 2NMSA 4WEUD 3CXDH 1A9EA 2MPAH 1FIEA 4YR6A 4OLXH 4YHLL 4PUBH 5ITBL 1N64H 4X6CA 3KPNB 1BD2B 1NMAH 3FQXA 2DBLL 1JF1B 2BY0A 4TSBH 3FT2A 2XFXB 5C0AA 1BVKB 4J2XA 1K6QH 4CW1A 3Q5YA 1PKQB 1MIML 1WCBA 3OF6D 1FNSL 1YDPB 4UV7H 4XNXH 5FYKL 3SBWC 3MLRH 3E2HB 1A3RL 4MQXC 1OAQH 1BEYL 3AS0A 4XNUL 5FFLA 3SBWA 4NO5B 3HMWL 1KJMA 1ZLSL 3VFOA 1P9MC 5HHMD 2Z91A 5F89B 1TQBC 1IC7H 3D85A 2YPLA 2PXYB 3OG4B 1PLGH 4CVWA 2VDML 2X9YA 3IDYC 1G9NH 4ZFOL 1N26A 3MA9H 3BKMH 1RZIB 4QXGH 2Q86A 4C55A 3L9RB 5IMKB 4UI2A 1BBDH 3HE7C 5D96B 3TNNB 4Y4HD 4NKMB 2YD4A 3MREA 2VXUH 1C5DA 4H1LA 3JV6A 2BY1A 3UTPD 2WWKT 4G8GA 4KY1H 2EEBA 5C2UB 4WJ5A 3PWNA 5IF0B 3U36A 4HS6A 1EEYB 3EDEA 5AUMA 3VFTB 4Q9RL 1MHEA 3LV3A 5MEPA 1DANU 2YEZA 1MF2L 3ARGB 1CFQB 3S88L 3MYJB 5T3XD 4XCNB 4RWHA 2AERT 5EO9A 5GRXG 4WI9A 5DVNA 5A2KH 5DC9B 4U6TA 1MOEA 3T0VA 4N90E 2AJUH 5JORA 3WMSA 3NFSH 3GK8L 2B1AL 2P5WD 2CDGB 2FRGP 4NZUH 1FLRH 4KK9D 4PGBA 2FB4L 1CXIA 4NFBA 1KT2B 1VACA 3LD8B 4XXCC 3SGKC 3BP5B 3D2UB 5EA0L 3P11H 4KFZC 2NTFA 1XGRA 1CU4H 3GMPA 5ID1A 3G9VA 5ENWB 4QRPD 2ZUQC 3RFZC 4Y8DC 4YBLB 1GGBL 1AE6H 1D5MB 1HH6B 1YEDB 3GSVB 3MRGB 1NGXB 3ARGD 1HHJA 1BWMA 3O45A 5IKCB 5IIEB 4G7VH 2EDEA 1G7JA 1OPGH 1QFUH 2H8PA 4AMKL 4MCZB 4FN0A 2JE8A 1EJOL 2B1HL 2JJSC 4RBPH 5C0NC 3BIAX 1ZSDB 4WHTB 4Z0BL 4PRIE 3FL7A 5HHNA 2P5WB 3FMGH 3FQTA 2IQAB 3B83A 2QQKL 3WXWL 1U8IB 2KZWA 5K93A 1GZQA 3BW9B 1F97A 5KSAA 5C7XL 3JV4B 3TBVB 2H6PA 4NQVA 5CWSB 4L8DA 3MLPA 4QWWD 4WI2A 2P8PA 4LKCA 2NZ9C 4LCCB 3SDAB 4LRNL 1MCIA 5IJKC 1CZ8L 2AQ3A 3MLYL 2I5YH 5D1XA 4HDIB 5J6GA 5A1AA 3VFNB 4KV5E 1ZE3C 4Z6AT 4MXVF 4TUOB 1MCOL 4JFOB 2XWJA 3QUZC 5KSBF 3QIWC 4PGDA 3CD4A 4JFFE 5HHPB 1MCWM 2WIMA 4H25B 2FNBA 2X41A 1V05A 2XT1B 5JNYB 5F7KC 4JZNA 4NQDE 5EC1B 5CIPA 3BHBA 1PZ5B 3O6KL 1A7RL 5IMOA 3SQBA 1MFBL 2NY4B 3S7GA 5I15H 1M1SA 3SDDC 4DVRH 3WUZA 5GQBA 4TRPL 1RJZA 1XZ0B 3BD5A 3E6FA 1Q94A 2X4TA 3WYRA 5D2LB 4K7PH 5DK0B 1U3HA 3IRZA 3KPMA 5LJYH 1C1EL 4RGOH 4HFWB 3QQ9C 1CFSA 4FFVD 5CD5D 3BKCL 2B4CL 4I3RH 2PCPA 4R4BA 3SDAC 2YKLH 4JRXD 4HS8H 5F1IB 5F7EH 4HLZG 3HC3H 4YEEA 4JGUA 1IGML 3AS3A 4JY6A 3J8F7 1EZVX 5AYUL 4MAUH 2P5EB 1O0VA 1P6AB 3MA7A 1PJ9A 4M61B 5ISZE 3W9EA 4JDTL 5IHZA 3MRFA 4LLAA 5ETUB 4OKVA 2ZCKL 5FYJU 2B5IB 4DFHA 4M7ZC 2VXSH 5CSGA 1CICB 1T3FA 4Y4FD 5HYSB 5E08H 5TF1L 4YGAB 4V2CB 1YEHL 1XCTB 4YBQD 2R56L 3HLAA 4J3WA 4JO4H 1ZTXL 4Q0XH 3CNKA 5F6HJ 2AJ3B 3KDMB 4OZGA 3MV9A 4P9ML 4CDHA 5IJVA 3NZ8A 2XQBH 1FN4B 5GRVL 4HUWB 4M62L 2YD7A 4GAJL 1OWRM 1AQKL 5LGHL 3MBEB 4HJJH 1IAII 4Y19B 1OY3B 3JWDC 3LN5A 1CBVH 4QHMB 1Q1JH 1S7RB 1IGCH 3MRKA 3RJDA 3TVMA 2YN5A 3V6OC 4WFGD 3GMOA 1CD0A 4M93B 2CKBB 4BZYA 1I75A 1BZ9A 4YHOH 4HIXL 3W2DH 4L9DA 3RDTB 2OR8A 2PW1B 1ROWA 3ZDXE 3ZE1F 3R4DA 1X7QB 4ZS7L 1I3UA 1N6UA 1NBVH 1I3RB 2Y4SA 2OL3A 3CFBA 3QB7C 1KLUB 4OQTL 2WIIB 2D7TL 3VFWB 3P9LB 1DQLH 1HSBA 1R3HB 3QXAB 4KRMB 1NFDB 2AJSL 3PJSB 4HFUH 2QSCL 43CAA 3FFCD 1NFKA 5EULV 4PJIE 4PR5A 4Z78A 2J4WH 5E24E 3V79C 3ZHKA 3V5DB 1NCBH 1ZEAL 4MWFB 3U0TA 3L95A 2A6KA 4Y4KC 3WJJC 1CLYH 5DHYA 2WP3T 4Y0GA 2QHRH 4FTVE 4MZ2A 4ZPTB 2Y5EA 1N5YH 1Z6JT 1HI6A 4P2OA 1U8QA 3CH1A 2VR5A 3IDNB 1OL0A 1JV5A 4G6AD 4XCCH 1A7QH 2PYFA 4BK4A 4KQ4H 3EYOA 4OCXH 2I9LA 5F3BB 2B2XH 2FJFA 3MFGB 5JHLH 3C2SA 3MR9B 3L1OH 4JKMA 3PABA 3JXAA 3PHSA 3QP3A 1T4KB 3WHXB 4H20H 5GS2D 3WNMA 3U9UB 1NCCL 5KS9E 1V8HA 3TV3L 5F9AC 3OKMA 4OBSA 3G5XB 1EAPB 3LKOB 4JG1L 4NQUA 2E7CA 5CHNB 4WW1B 2BOCB 4N8VA 1Q0XL 3MJ6A 1F5WA 3RVXD 3T0EC 1NFIA 5TPWH 1TVHB 5IBTH 3TN0B 1H5BB 3MJGX 2J8UF 3GBML 1FBIH 1P4LB 3P3YA 4Q9QL 1KIQB 1OF2B 2OZ4A 1SJHB 3RNKB 1LP9F 4FZEL 5FO9B 1A5FL 1RUPL 5D1XC 4N5EC 3T4AB 1FE8H 1U8MB 2MHAB 5ELIA 4F57H 4DUWA 5C07E 3R1GL 1YJDC 3K8MA 2CLRA 4YDVB 4NPYA 1LK3H 2ITCA 4K2UH 1N4XH 5DK2A 1YY8B 3RIFK 2AJYH 2XWTB 4WENB 3S5LB 2IFFH 5C6TH 1YY8A 4LPTA 1ADQH 3FQNB 4U3HA 3D25A 5JXEC 1IQWH 2ITCB 3R8BB 1CXLA 3DI2B 4JJ5B 1YNLH 5I0DA 4MCYB 3T8XA 1H0DA 2XTJD 2G75A 1A1NB 2F19H 1T5XB 1S9YA 4YE4L 1K4DA 3DO7A 4LCYA 3RVVC 3FO1A 3RKPA 5DLMH 3WLWC 3WKNA 1CVRA 4M5YL 1N5YL 3RNKA 1J1XH 4LSQL 5SWSA 2QHRL 3R0MA 1WIOA 5HI3C 1KJ3H 4I5BA 2P24B 1KN4H 4MA8H 5ESAB 4NNXA 5DUBB 1U42A 3T2NH 4NWTH 2X09A 1PGRB 4L4TE 4MXVE 2A6DA 3VH8G 4AENB 3EYSL 3WFBH 2A6JA 3REVA 2X4UA 7FABH 1IT9H 5DJAA 2AJSH 3ARPA 4WCYH 4NP4H 5D72L 1FVEB 5CMAA 4DKFH 4ETYA 3MR9A 2X70A 1TJIL 3ZLQC 4MJ5A 1IKFH 4IRZH 4OQTH 5SWZB 3SGJA 4XPGL 4NQSA 1MI5B 2AGJL 2BNQD 1WAAF 3C6LC 3BJLA 3RGVD 1HI6B 2X1PA 4P3DA 4LSTH 2DLGA 2N1KA 4HK3N 5DHYB 5B22A 5E56A 4K8RD 1REIA 4KRPD 1ZT4B 2XN9E 3TA3C 1URLA 3WXVL 3OX8A 4MJ4A 2GUOA 2O61B 1RK1A 5KVDH 4K3DL 4L3CB 3MC0A 1IGCL 2DLFL 4GJTB 4NSKA 2QADD 2V7NA 1QFWL 1G9ML 1QFPA 3U0PB 1CGXA 1QRKA 3QUZB 1ZA6A 4IDLA 1RUQH 3NA4A 2CIKA 2EDNA 2JIXB 4XVUD 1ND0B 5TE7H 4WFFE 3RY6C 5E00A 5L88H 1K85A 4PB0H 5GZNC 5TF1H 4JGJA 2PW1A 3H8NA 4JM2F 3VXOB 5DJ2B 1MI5D 4LNRB 4F3FA 3GMOB 3MROB 2Z0BA 4G5ZL 5HI3D 2BVQB 4HEME 2ADIB 2VLJA 4LCCC 1BJ1H 1MRFH 5C2BL 2OTUB 4FFYL 1LP9E 1T6WA 1AD9A 2XTLA 5IJVB 4JHBA 3TBSA 4PRNA 4XC1L 1CDCA 1XF5B 1IZJA 2EDOA 3T3PE 1AY1L 1RY7B 2YRPA 2ZNXA 5FAAA 1FORL 2WK2A 5FOBA 2IG2L 4U6XB 1T6VN 4L4TB 4K7PL 2NPLX 3RWGB 2JJSA 1X5IA 1LP9B 3OZ9H 4B41A 1F58L 2EDWA 3QI9A 4N5ED 1BF8A 5IM7B 4HIHB 2GJJA 4M5ZL 4LVEA 4D8PA 6FABL 1KPVA 1JZ4A 4KMTL 3ECBB 2F54B 3LSOA 5JOFB 4IRSB 43C9A 5F97E 3RWIA 1G1YA 3O2WH 2GFBA 3NPZB 1BD2D 1YYLL 3MRBA 3CLEL 2R1XB 4GO6B 1IGJA 3GMRB 1VGKB 1YN7A 3BN3B 1MJUL 2H9GB 4U0QB 5DJCA 5ERWA 5B3JE 4HFWA 5AWNH 2PO6B 4HQQL 1OAKL 3MXWL 3BPCB 1VERA 4LQ1A 3E6FB 2DYPB 5FKAA 4MDIB 2E6PA 3MXVH 2EE3A 4KKAD 1UM5H 2A1WL 4LLDA 5C70A 1FFOA 4GKZB 5EN2A 5I9QB 4G9DA 1OSZB 4LDLB 4PJBA 4L9LB 4XPFH 1BVLA 5JNYA 3HE6C 1QNZH 4U49A 3KPLA 1K8DB 4V1DD 2J5LB 5L2KE 5D1QA 1T89A 4CU7A 4H1LH 2FLBT 2WM0A 1EBPA 1D6VL 2DKUA 4F2MB 4RFOL 2AEIT 2FL5A 2AI0L 1J8HE 1CE6B 3OGOE 4XCFH 5DRNA 1P7KB 4Z7WE 1F3JB 2KBGA 4R4FL 1J0KA 4U1KA 3SDAA 3MRNB 1IM9A 4QOKE 3PV6A 2P8PB 2GYSA 5FKPA 1GHFH 1A7PH 4DW2H 5IEHA 5CWSA 4NQVB 5GIRA 3B4NA 4RFNC 3AVEA 4U1KB 2V9RA 4RX4A 3E2HC 1P7KA 2Z9TA 3P11L 5DRNB 2HTLC 3EKCA 5EWIH 4K7FA 1HQRB 2NY4D 4N90D 1OWWA 4IOSD 4QRUB 3D85D 4Q74A 2J1KA 3BEVB 4EXKA 1A1MB 1F00I 4XWOC 5A2IH 2OXHA 4K3EL 3F7PC 3QFJD 4RGNB 1MNUH 2EDYA 4F33A 1GIGL 3QDJD 5J7CC 1F6AA 4IJ3C 1UACH 1FL5B 2B1AH 3MV8E 3D0VB 1BVLB 3BDYL 2BCKA 2AJUL 4L9LA 4PJBB 3ZE0E 1TQCB 4M1GL 3QXVA 4I77H 2CDFA 1NGXA 1FFOB 3MRGA 5GGSY 4PYGA 2V2TA 4FMFA 2FDBP 1DBAH 3LB6D 4QT5A 1NFDF 3SDYH 3S88H 5ENWA 5AAWA 1RVFH 4QEGA 5DR5L 5MP6L 3DETD 2RCSL 3ZKMD 3D2UA 1YEGH 1B0GA 3MLTA 4XC3L 2R0WH 5FM8A 4LP5A 5D9SA 4JN1H 1C12B 3HG1A 3QPXL 1KT2A 2GFBB 4L3EB 5DFVC 1MFEH 4HGWA 5HTSA 1RUML 5C0EA 1A6ZA 4YHML 3L3IA 4X4ZA 4ESKA 4OCRH 1K8IA 2ZNWA 5JPNA 1KCRH 5JHDE 5D7SL 1NUFA 3QI9B 1IL1B 2LV4A 1LQSR 4LPCA 1AO7D 4MHHG 2BRRH 5SX5K 2R8SL 1RZ8B 2W0KA 1U8JA 5EO0B 2AABH 2K1MA 3HMWH 4XCNA 3MUGA 2WP3O 4ZPVA 1S5HB 4XZUB 1BEYH 1CFQA 4CMHC 1VDGA 3WKMH 3CPLB 4CN6A 1NSNL 4JZJA 4TPRL 3SDAD 3VWKD 2Y06L 4DEPC 5ID0A 1P1ZB 1YA5A 1EEYA 4HS6B 1OB1A 4GQPH 2I07B 4ELMA 2YPVH 1K6QL 4WU5B 4X6FA 1UA6L 3RUGE 5EB9A 3MREB 2HJLB 4LIQL 1DUYB 1I9JL 2F54E 3N06B 2OTUA 4J4PC 3ULVF 1EO7A 1CGYA 3L9RA 2Q86B 2VLJB 2OP4L 3RAJH 3TT1L 3V6OE 1A7BA 3LZFH 2P5EE 1LE9A 4WGVB 5JHDB 2IC2A 4Z7OF 2FD6L 3MROA 4OD2A 4KI1A 4Y7MA 5CINH 5DTFA 5ESQA 3ZKNC 4ZO8A 1U8HA 2W0PA 1MQKL 2ZUYA 2Z35B 1LGVA 1T2QL 5LWYL 2ICES 4P4KB 1XEDA 4XVJH 2WAHA 1GYAA 3CFIC 5E00B 4QRTA 3UTSD 5AZ2H 3QWOB 1WIPA 4HWZA 1SBSL 1INQA 2X40A 4QRRE 1JNNL 4JRXB 1S7UA 3UJIL 1R3IL 3C60D 3RU8H 2JF1A 1JF1A 3TVMD 3LHPH 2F58L 1Q9WA 5DMIL 4U05A 4U1SA 1AFVL 1JCKA 4NSKB 4P57A 3FO2A 4YR6B 1YUHA 3TO2B 4PREB 1A3LH 2YRLA 2HFTA 1C5CH 4YWGH 5BV7L 3PHQA 5C0AE 4E5XA 2PKDA 1DVFB 2BVPA 4JE4B 5L6YH 1JFQH 1T66D 2DQDL 3MLUH 3RNQA 4ALAH 5BRZA 5B39B 2C1PA 4X6BB 4UT7H 2FEDD 4QHLA 2VDKL 5CEZD 3JTTB 5LBSL 3WLBB 3ULVE 3L7EA 4M6AA 4Y88A 2RHEA 4LP4A 3PWPD 1J11A 3STBA 1TJGH 2XQYG 4N0UE 4U1GC 3DURB 2A74B 4PREA 3F58H 1YUHB 3TO2A 5TDPA 1H9VA 2E6QA 5CJQH 1T2XA 4AENA 3GUTB 5TGBB 3C60B 3T2QA 5T1MA 3WO3B 1DQMH 1QFWI 4PJBF 4XPHH 4JRXA 4OQTA 4PJIB 4GXUN 4YHIA 2P24A 5BS0E 1INQB 1JYWA 1ZGLP 1JL8A 1P69B 4X7FC 2YA0A 3QWOA 3RX8A 1MLBB 3HS0B 3PQYD 3SGEI 4HIJB 3L3OA 4R2GB 3DO7B 4P4KA 3CVHB 1JZ5A 3WHE1 4YIQB 1A1NA 1U8HB 1H0DB 5E8PA 3KG5A 3QT2A 4JDZA 3RIFF 5A3IC 3P4LA 1CFNA 4UQ3A 2RQ8A 1OAXL 1SM3H 5KVMC 5HHOA 4LU5L 4CNIB 1NGYA 3HCVA 5D71L 4UOW1 4XWGL 4PJ5A 4IRJD 4Y5VB 4PRPB 1FVDA 5IMLA 3SKJH 2YPKA 4JQXA 4DOHB 3P30L 4WU5A 5EZJB 1U8MA 3QDMD 1OB1B 5IVZB 2CXKA 3RZWA 2HTKD 4LBEA 3DRTA 4Y4HC 1P1ZA 3OKDB 2ZZUT 1SJHA 5JIHA 4O02H 4XP1H 1N8ZA 3MUGB 3BH8B 3ES6A 5J89A 1NFIB 2NY1B 3EAKA 2VR9A 2BOCA 1QLEH 1YZZA 1IL1A 2BNQB 2V7HB 3EJZC 4O4YH 2FX9L 5TF0A 4LNVA 3SGDH 1P4IL 4PJGF 4OTXH 3UPRA 1BVZA 1GGCH 4UUJA 5IBUB 1ZLWK 1NCAH 2EDQA 3PABB 1JGDB 2BSED 1NLBH 4L3EA 5HHOE 1WT5C 3VDCA 4WI4A 4DOHE 2PNDA 4HXBL 1VGEH 3ARWA 5F3BA 2I9LB 3GSQA 1B0GB 1XF4A 3VRJA 3IDNA 4KH2A 2QQLH 3SJVA 3OHXB 4M8QA 1I7ZB 4DKAA 4ZFOB 2XG5A 5IG7A 1M7XA 5DQDH 1OGAE 4X7DC 3BKYH 1IAIL 3BAEH 4JCMA 3V5DA 4GXVH 3WSQL 2X4SA 4B53A 4RWYH 4GG6E 3LKSA 2E27H 2ID5A 1KENL 2ZKHH 3ZT6A 2Q8BL 1UWXK 1NMBH 4JFZH 3LRHA 4Z95H 1LE5A 1YPZF 3VFPB 2BSSA 1HN1A 3M17B 4OZHF 1OARH 1MRDH 3IT8D 3V0WH 4QRUA 4CMHB 5EBWA 5JIPA 4HPOL 4P23A 2NY6B 2OL3B 4K9EH 1KLFA 5EIVA 1SYVA 2H2PD 4PV8A 3QUXD 3T04D 5SWZE 4PBVC 5EBLB 3WFCL 4JO2H 1FLTX 4Z8FH 5GIRB 3ZKXC 3MLXL 3CFCL 4JFEA 3BEWB 3G5VA 3K4AA 1J05B 2IANE 2IPUK 1BZ9B 2Y23A 3MRNA 2W07A 4OF5A 5FECA 3E0GA 4F58L 3OKEA 3ULUF 5K59F 3VW3L 1YEKL 3MRKB 2B4CC 2FL5B 1XT5A 2AK1L 4A2LA 1A7NL 3QDGE 4UNVA 1YEIL 4EDXA 3CSYB 1JZ7A 4OGZA 5MERA 3ARYA 4N0UA 4D3CH 4FZ8H 5GGUA 2FX7L 4ISVB 2Q20A 3QUMB 3FONB 4YDKL 3GJFK 2YD9A 4QRQA 2FHBA 1BQLL 4YLQT 2A0LC 3P40A 2NX5B 2WMPA 5DI8A 3MOAH 1PSKL 4PJHB 2Y72A 1LO2L 3V4VH 1UVQB 3QNZA 4EI5D 4GLRH 1TIUA 2DMBA 1T5WA 1INEL 2DYPA 4JHAH 4ODSL 2R4SL 5AAMA 4BH7B 4LFHD 3BPCA 3UZVB 5L9DH 1JNHB 3KPSB 3QUXB 4Z7VF 2PO6D 4KAQH 2ATPA 5ETUA 2QKIB 3U1SL 1EHAA 3QEQA 3MA7B 4LK4A 5JO5B 15C8H 5GGSB 2P8LB 1E4KC 4N8CL 5EUOB 1IEHA 4PJ8C 4RSVA 4HF5L 5I8KH 3VXNA 3LS5L 2D7NA 2F54A 1Y6KR 1EBAA 4YDLB 5JO5A 4WEBL 1N0XH 1NLDH 4WV1A 2CK0H 3Q5TA 5GSRB 1MREL 2QKIA 2JIXD 4X83A 4FQ2H 5CGYC 4AEFA 3HRPA 4ZOEA 2P46B 4Y4KB 4NBXB 3BSZL 1HKLL 4IIQC 4PJGE 4NN6B 4P4KC 1QO3A 4I9WE 3DXAE 4M7KL 5IMOB 4PJHA 4KJWD 5FOBB 5E5UB 1IEBA 3ILQC 2JK5B 1P7HL 3GIZL 1FFRA 2V2XA 2R4RL 1RUAL 2IWGA 1A21A 2EDLA 3O2VL 3NCEB 4ODHH 5D1ZA 4ISVA 2MSPA 2SEBA 2FEEI 5DUPL 4NCC1 3QA3A 3DO3A 1NBQA 4QNPF 3O6FD 4U1NB 15C8L 4EUPA 2BSRB 4XBPA 4PRHE 1NAMA 5D93C 4LEXH 3U1SH 1CF8H 2BVQA 2ZUTA 3MBEC 1JHKH 3T0DA 1TXKA 3LRGA 3O9WA 4PBWD 4QRSB 4XNYH 1HWGB 4NGHH 4F3FB 4Q6IC 2Z8VC 4XTRC 3HNSH 4ZD3L 4WHDA 1U3YA 1WEJH 4FABH 2WUBH 4JHAL 4P48A 2VN7A 4RMSA 3B9KA 3LEXB 1LO2H 2VDPH 4RQQA 2DJUA 4GG6A 3GIVA 1EUUA 1ND0A 4M4RA 4UZGA 1KIPA 3GHBL 4JFFB 2P5WA 3L5JA 2JIXA 5FCUL 2CIKB 3UEZA 4YXHH 3SE8H 1I7RA 4JKPH 1AHWB 4JLRA 4UOJA 1LE5B 1SEBB 3TH3T 5DK3A 4X6EA 1GXEA 3I50L 2V7NB 4ZSOB 4AH2A 3ULSA 4TSAH 2GUOB 1X4ZA 3TCXA 3BO8A 1KPUA 2HFEA 3IU3A 4QHNB 4ONFH 3RL2A 3EW3B 2OLDA 1BBJA 1L7TH 1R5IB 1RULL 2RB8A 1A6PA 3JWOH 2AK4A 4QHUB 3OJVC 4P3DB 1BP3B 4U7MA 1B88A 4NZJA 5ANMA 3SE9H 3UC0H 1XF4B 3GSQB 3V0WL 3O8XC 2Q1EA 3MOBH 4X80L 2AQ2A 1CD1B 2HAZA 3JTSB 5E6ZA 1D9KD 1JGDA 3RRQA 3NMEA 1GPOH 3ZTJG 5DFTA 3WFEL 2EDTA 2YOCA 3DVGB 3GDBA 4OLUL 1OT1A 4J4PA 4Z7WB 4ZTPH 4O2FB 3L3HA 4B50A 2Z8RA 5JORB 4NM8H 1AR2A 3W0WD 5IWLA 1D7FA 4YBLC 2CPCA 4R26L 2BNQA 4JY4A 4MSWB 4AIZB 4I2XE 3VRIA 3MPCA 4PJHF 4DWHA 5ESAA 4RMRA 3BIKA 5HDQL 1FNEA 3LN4A 2ORBH 5KAQG 3BH8A 3QZWG 2HFFA 3PGCB 4MX7A 4E0RB 1RIUH 4P5MA 2H45A 4LCYB 1R0AL 4J4PD 4X4XB 5IVZA 1S9YB 3QHZL 4KKCC 4XNMA 2OSLB 4Y5VA 4FNLL 3LEVL 4MQTB 2Y5TA 4NKMA 1NCAL 2MKWA 3KLAA 3O4LE 2PW2B 4HCRH 4NKDA 5IMKA 4NNPL 1QFOA 4BK5A 3VRLE 4WO4C 5IQ9A 1CFNB 4HSQA 2QQNH 4XMKH 3QHTC 1TENA 4AY0A 4F7CA 2FBJL 2CLRB 5E8PB 4O9HL 4LHUD 4F37K 3JV5A 3ZDYE 4UB0L 5DD3L 3OBAA 2MHAA 1WF5A 3L5HA 4HJGB 4HBCH 3CVHA 4LQFH 4Y89A 5I8OL 3ARQA 4OT1L 3OKOA 3HC4L 35C8L 3BPLC 1V5JA 4U0RB 1P4LA 1LNUB 3RZCA 3UP1A 3TN0A 4JHWL 4GKNB 4J7RA 2FJHB 3LEYL 5E03A 4C59B 5D5ME 3CK0H 1XR8B 3I6LE 2IPKA 3P30H 2DIJA 4XCYA 1T1XB 3LKOA 4KZEL 5L0QC 5DRZA 3GUTA 3DXAA 4YPJA 1IBGH 5IB5B 2XY1A 1RIHH 2KQMA 4X98B 2VDRL 3ARFC 1P2CB 1U58B 4MJ2A 3LB6C 4RA0C 2H26A 3GO1H 1J9CT 1VHPA 2FJFB 3V6BR 5E5RB 2ATKB 3QYCA 1HIML 4CVXA 3TWCH 3FT4A 2BY3A 3WLBA 4GG8B 3MLZH 5AZEH 4X6BA 3DHJA 4HPYH 4YBHA 3VGAC 3WUWG 1WJ3A 3SO3B 3RNQB 1A6UH 1WUNT 4C56B 1N6QL 1DVFA 4E5XB 2A6KB 1QVOA 5CEZH 4OI8A 4PRBB 2W60B 2E3VA 1S9WB 2VXTH 4R2GD 5DUMH 5D2NB 2VMFA 5HDBF 3ULUD 43CAB 4OLEA 3I6GA 5JXAL 1KCVH 3F58L 1FZJB 5C0CA 1KIRB 4WFGE 3HNVL 1KTDA 2WIIA 3S6CA 3VFWA 1B4RA 5IB1B 4U1JB 3CFBB 2XZQH 1UZ6F 3ALPA 1BOGB 1T1WB 3H42H 3UX9B 4AEHH 4PJ5D 1XFPA 4X9IA 4I8DA 3TN0C 2W9EL 5I8CB 2QHLA 2VDKH 1U9KA 4UT7L 3OKNA 5D2LF 3QJFA 2YSSA 4PRIB 2VABB 1DQDH 4I4WB 2FIKB 3JUZA 1ES0B 3VXTA 4NZTH 2VDQL 4HZLA 1XH3B 4OZHB 5ESQB 5BV7H 5DTFB 4OD2B 3S36L 1EMTL 4WFHE 3TVMB 1LE9B 1U91A 3ULUH 1S8DA 5I16B 3LN5B 1MCCA 4Q6YA 5DMYA 5EOQL 5KVGL 5IBUG 2HJLA 2ICWA 2VZ1A 4PY7B 4U1HB 4U6VH 3UJIH 3NZ8B 4S1QL 4HS3A 2VQ1B 3G6JE 3FB5B 5D5MA 5ID0B 1D5ZA 1KXQE 5AZ2L 4EJ1C 4MMZC 1XCTA 5I73C 4PPTA 2F5AH 2R2CA 4MS8C 5L8KB 2HP4A 1T3FB 3HG1E 4NNYB 1JPTL 1A2YB 3V95A 2H32B 5C08B 5CINL 4JQIL 2NR6C 2EH7L 3FOMA 2DRUA 4BZ1L 2HN7A 3K2UL 3LKRB 3L3IB 1SVCP 1Q9OB 1R24B 3VXSA 2Y25A 3B2VL 4XNQA 5HYJE 1UA6H 3C09C 1ED3B 4KI5C 3BH9B 3V9FA 4PJCE 3MLTB 4R7NB 4OM0L 1P84K 5M7QA 3BZ4A 1YNKL 2O5YL 1UXSB 3MLWH 3DX8B 2IH1A 1CFSB 5EPMA 5DK0A 3MBXH 3QNYB 1FO0B 1Q94B 2X4TB 1XGPB 4Y1AA 2VERN 3BI9X 2MMXA 3GMQA 2R8SH 25C8H 3RVUC 1GAFH 5A43C 2G9HB 3VXMB 3BHBB 2YXFA 2Q8AL 4M6NL 3S97C 4MB3A 4OLVL 3BT2H 2BHZA 4OCRL 4X0KB 1FV1B 4JKKA 1HHHA 1F6AB 5JLZA 1MEXL 1J1OH 5F3HA 1UXWA 1RUMH 1MFAH 3GI9H 1PG7X 5GZND 4JKLA 5ILTH 2DD8H 1MY5A 5ADOL 1YEGL 1I1FB 4MMXC 1CK0H 1WBXB 2EXYC 3Q6FA 5D1XB 3EYVB 2MCG1 4OLZH 3HB3D 1RVFL 1I85A 3ZE1E 3WFHA 4JQXC 5CLWA 1F11B 1FNFA 3LKQA 5I76A 1Y6NR 5FKPB 4L8DB 3DYOA 1WZMA 2QBWA 1U8IA 4FG6C 3WNNA 4GRMB 4FQLH 2VKWA 2AJZB 2XICA 3GHEH 2W65B 4X9HA 2YMXL 3C08L 5FM5M 3TA3D 1LEKB 2IPTH 3SO5A 5BO1H 1IAMA 1SEQH 2F5BH 2DQJL 4HT1H 4K8RC 1YEJL 4YDLC 4P9HH 3GJEB 1K8DA 1CGUA 1JRHH 2H8PB 3MCLL 4JFED 4OCSL 3TYGL 5A40E 3O45B 1HHJB 1H3VA 1KN2L 1PY9A 4N8VG 5ICYA 3PG2A 4GKZA 3BUTA 4GSDL 4P5TD 1HH6A 2UVFA 1I3GL 4CAGA 1FZKA 5FKAB 1GHFL 3BZEB 1RZFL 3DVNB 1JK8A 4NM4L 2E7BA 5KVEH 2R15A 4YZFE 3X3FH 4HAGA 4S1SL 3UTQA 4LEOB 4KDTA 4M6MH 2AI0H 1MCEA 2WUCH 1AGDB 2R1XA 1AGFB 2HYMA 3PGFL 4NO3B 2LTQB 1GC1L 2WWKO 3RWIB 2FECI 3CIQA 2DAVA 3IXAB 1KPVB 2EC9T 3WN5C 4OIAA 3V5HB 2EDXA 4JDVB 4WHYG 1HSAA 3ARBA 2XRAL 1ACZA 3AY4A 5EU4A 2XA8L 5AG8A 3QDJA 4QLRA 1LP9A 1J86A 5I1CH 3QEUB 5E8OB 3EBAA 3K1KC 1RMFH 4RNRA 3EGSA 1OAKH 2EDRA 2YEZB 3MXWH 1NPUA 4Q9BA 4XPAL 4XI5C 3UYRH 3VFTA 4KXZI 3LH2H 5T5NF 4QRRA 1RV6X 5I19L 2MQCA 1F4WL 4R0LA 3CLEH 4OD1H 4HKZA 1PW3A 3GSRB 4PRPE 5K59E 2J6EA 1HNGA 3JV6B 1D5IL 2A73A 5E9DE 3TPKA 3HUJE 4J1UA 1B2WL 3RZCD 1DUZB 4PJFF 1S9VA 3BGMA 5SWSD 4PJ7A 5D6DC 4PJXE 2EYSA 2D0FA 1ZT1B 3C6SA 5EOCL 4X4MA 5F89A 3BMWA 1DQQA 4EI5B 4RAUB 3VXOA 1NJ9A 4PP2B 2E9BA 5T33H 4UV4H 2IG2H 3FN3A 3ULVC 3GMNB 4X5XA 1EHLL 1Z2KA 2DI7A 3VGFA 1PKQA 3F65A 3QO1B 5I1CL 1T20B 3O0RL 1BD2A 3C2AL 3KPNA 5CSZA 1IVLA 1QSFD 5EFIB 1MRFL 4KUCF 4L4TD 5DXWA 1FYTA 4TTGA 2NY3B 1CIDA 3UO1H 1OTTC 5F1NA 2PYEB 4KWUA 4Y4KD 5FHBL 4TQEH 3MGAA 1VADA 1FG2B 5IW1B 3AU1A 2W0LA 1JWMB 2GSIB 4MXQD 2BC4A 3B2UD 5TE7L 5IW1A 5I71B 4NO2A 5DA0B 3X3FL 2R29L 1LK2B 5KVEL 3CDFA 1CXKA 2JB5H 3TBTA 2G5BB 2X70B 4RMVA 2DWDB 5T3ZE 4JY5L 1QBAA 4NKIH 2VH5L 2VZTA 5IMMA 1G9MH 3F7VA 2CQVA 3RBSA 2W0FB 4APQC 5KANI 1FYTB 3BESR 1H5BC 2DLFH 4KTYA 4PRHD 5JZ7C 2PXYC 4K3DH 1KBGL 1NGPH 2DJSA 2AK4D 4HBQA 2VNCA 1FG9C 4GRWE 1NGZA 2DIBA 3OR6A 4D0DA 3G5ZA 3MCKB 3VGHA 3QEQD 3KR3L 4NNXB 5I2IB 4QOKD 4YXLH 3TCLB 5IBLD 3THML 1X5ZA 1OM3L 3QIBC 3GHEL 1FYTE 3IJSA 3BWAA 3T0EE 3D18B 2ZSVA 1DBJH 3HR6A 1UT9A 1NJ9B 4RZCA 5DGRA 1T5XA 4MDJB 1DQQB 2F53E 5CGMA 4UOW0 5CEYB 4JJ5A 5D72H 2NY0C 3PDGA 1IFHH 2E9WA 3K4ZA 3QCUL 5FA4A 3MODL 1I8MA 3QXTA 5ADOH 3MRHA 4P23D 4OZFH 4YDVA 3VRLF 4Y4FC 1NCDH 4HKZB 4CL7A 3KYOA 4PLKD 1U8OB 5CZXC 4MA8L 1PKQE 3QISA 3NFPB 1KJ3L 5GPRA 1IGYB 3P73B 3IFPB 4LSQH 4OLVH 2Y36L 3WUWA 3GSNA 3ZTNH 3EOTH 4NN7B 3WIIH 4TNVK 4XAKE 4YXKH 1TVHA 2EYRA 5HYJA 3QDJB 1UKQA 1JTOA 3QEGH 5HJ3B 4N8VB 1HDMA 2ZG3A 3RI5K 1MFDH 5IROA 4ORGB 3JWDH 2L0DA 1FFQA 3MGTA 2CDEB 4P2QA 2HKFH 3G5XA 5CD5C 4TYUA 1P5UA 1SMAA 4FFVC 5F93C 3CLFH 1RZKC 3OXRB 3QWQB 4LSRH 2VZOA 1N4XL 4OM0H 4U7SA 4W6YB 3FB7A 3P0GB 5DWUL 1U2CA 5C09D 5D7IF 3H6JA 4JM2D 3QCTL 3H9YA 2PYFB 3P4NB 4YDIH 1JV5B 3VXRD 4PB9H 4LEOA 3UTQB 3ZO0A 1RZKH 3VG0H 4BZ1H 3L7FB 3LRSB 4OQ1A 4AJ0A 4Z5RB 4ZPTA 4Q9QH 2GTWB 3BZEA 5GZOD 3WO4B 4NUJA 4HUUA 3QCVL 4P2RD 3GBLA 1AGEB 3AGVA 4OCMC 4PJDE 4W6XB 5DQ9B 2C4FT 5J0BA 5DO2D 4NIKB 3PJSA 4GT7A 1U3HD 3A6BH 4PJAF 1HSBB 4YPGB 3ARDC 1QR4A 3W9DA 4Z77B 5JHLL 4XTRD 4PJEB 1XMWA 5KVGH 4XCCL 4LVHB 2R0LH 1MH5B 1UJ3B 4X4ME 5D7LA 5GJSH 4ZAKA 1BREA 4FXGB 3ARDD 2ZOLA 4Q7DA 5J11C 5C0ND 1A6TB 3CCHB 4HIEB 2P45B 5KJRL 1CLYL 3VXUE 5D8JH 5DO2C 2VLJD 2PR4H 4LGSB 1WIUA 5J13C 2YD8A 1J8HB 3FB8A 1I1FA 5E4EC 2YBRB 4KJPC 1E4KA 2YD1A 2W9EH 4KJWC 2HLFD 2F9BT 1Q72L 2XZQL 5T1DH 4XCEB 5C08D 3SE4C 4P4KD 3PL6B 3RWHB 1J12A 5C0AD 2V9TA 4HUKB 2IAMA 2AJ3A 1W72L 5KTEH 4GQ9H 3TH4T 2L7UA 3N1GC 4EKXA 4XNZB 5F7DA 4JM2C 5GGQH 4L4VB 4H1LG 3IU4L 4FOMA 4UNTA 5B3JF 4LCWB 1CE1H 3T0EB 1CICA 3CSGA 4HIXH 3W2DL 3QNYA 1N6QH 4Y5XA 2FLRT 1A6UL 4MLIA 4GW1B 4P59L 4AQ1B 3S37H 5ICZA 4HPYL 4DVBA 5MI0B 2W91A 1UXSA 1N5AB 3QG7L 4RAVB 4M61A 5E8NA 2VDOH 2CRYA 4U7KA 5LCVH 4HMDA 1HYSD 1QSEB 4GAJH 4TSCH 3VXMD 4DGIL 2K3TA 4O2CB 2XQBL 1QPPA 4Y1AD 3N50A 3HPLA 1JGVL 2GAZA 3TEUA 3FOMB 3TESA 1JPST 2WBJD 2X89D 4GW1A 4S1DC 1XAUA 3T1FB 5GS2H 2IANA 1WICA 4KZEH 3IKCB 4P23C 4MNQB 1DBBH 4JHZA 1HH9B 4NJ9H 2HG5B 5CIPB 2IMMA 4ZNEA 1GRWA 4JZNB 3W5NA 4OT1H 4UDUB 3RKDC 5JA8B 5I1EL 3F7YA 5CS7A 3ROLA 4KPHH 2ZJSL 5LCVL 3GRWA 2DI9A 2D7QA 2EZ0C 5E2VL 1OTSD 5D6CB 5F7EL 5D7IB 4UILH 1S8DB 1U91B 3QG7H 2C1OB 4OGAC 1MPAH 4HDIA 5J6GB 4TUKL 5IK3A 4LAQL 5IBLC 4LSPH 5FYJL 1G6RA 3NACH 2BXZA 3HZVB 3KJ4C 3S5LG 3W11D 4HIEA 1CE1L 4YAQA 1Z9OA 1F90L 3HHRB 4TRPH 1QACA 3NIDE 3QJFB 3SQOL 5FGCE 2R2BA 5I15L 3ZYIA 1TMCB 5I8CA 1S9XB 4PLNC 3SJVE 2DQEL 2Q76B 4PGZA 3GKWH 4APQD 1KJ2A 2ZG2A 1MCBA 4GQ9L 4P5TB 1RIUL 2M1KA 3MO1B 1X5GA 3ZDZE 5IB1A 3STZB 1HILA 2BNUB 4OIBA 4WHTA 1U8PB 5ACZA 1YEFH 5CBAB 3QDMB 5F8RC 2EO9A 1FZJA 5T1DL 3ALXA 4C83B 2JCCE 3DX9A 2X4QA 3LQAL 3OXSA 1G7JB 4MA3A 5E1AA 1MCRA 2B7DT 2WBJA 2X89A 5HI4D 5JQHC 3AB0B 1SMOA 4NRYA 2AXFA 1D5MA 5KJRH 4GG6F 5F9OL 1KELH 1JPSL 2CD0A 4M7ZB 1I7TA 1DANT 1E27A 2DTSA 3LRSA 1KPRB 4NZRL 2NTFB 2XNAB 3O6LL 3FT4B 1JWSA 1MFNA 1INDL 1NGWA 1H3PL 1KJ2L 4HHAB 4U3CA 4Z0BH 2JELL 2XKNA 1RPQA 3ARBD 1RULH 1SYSA 1EJOH 1UH3A 4WU7B 5E5MB 4KUCD 4PGBB 1IGIH 2CDGA 2VXVL 3Q3GA 1OP3K 3M8OL 1ZXQA 3D39E 3RHWF 5I18L 1QHPA 4M9OA 2NW3A 2G60H 2EEDA 4P2QB 1UGNA 4R6UA 5GXBB 4QXTA 1T1XA 1NUDA 4JR9L 3QCVH 3BPNC 1BFVH 2DQHL 3AAZA 3RZCB 2B20A 3KYMA 4JRYB 3GSNB 1CQYA 1YEEH 4XBGA 1CU4L 4J8RA 2CKNA 1CDUA 1JGLL 1LD9B 5EA0H 5AUMB 2VDPL 5FUOL 1MHHA 1PY4A 5E8DH 3UROR 1GGTA 4GMSH 4ZUSB 5T3ZH 1C5DB 2Q7YA 4H1LB 4OCYH 4XI5D 3KYNA 1AKJA 3G08B 1E4WL 3KLAB 3CLFL 4PRAA 3NFSL 4WTZA 5ALBL 4LEXL 1XIWC 4LCIH 2BZDA 2ZG1A 5C07B 3QEGL 1KJMB 4P2QE 4WVRA 3LQZB 5DUPH 3VFOB 2DQGL 4QXWA 2NY3D 3O4OC 4AYFA 2R2EA 2AXJA 1QRND 1QSVA 3PGCA 4MX7B 1PG7L 3QXUA 2DQFB 4RDQF 2IJ0C 1OAYL 1R3LB 4HXAH 4CW1B 2BOBA 3EJYC 5DHVB 1J88A 3PUCA 4J3XA 1I9RH 3VFGH 1WQVT 3FT2B 3OJMB 2W38A 2Q3ZA 4UQ2A 4ZO9A 1KCSH 4XVSH 4HWBA 4O2FA 1MCLA 4P4RA 3DVGA 3QCUH 3MRJB 1LO5A 2C4XA 1NDGB 2NXZD 1A9EB 3AM8A 1T66C 4BQ9A 1JRHI 2IH3B 4HLZH 3QXDA 3EO9L 3DMMC 5I1JL 4NO2B 5I30L 2ZOKB 3NA9L 1OAQL 3L3DB 5CD3A 2AK4B 1CYGA 4KJQD 3UYOD 2DJ4A 2NY1C 4Q97A 4B5EA 4W4OC 3UXFA 1R5IA 1NL0L 3C60C 1OGAD 5DJDA 1I1AC 1HKFA 4HC1A 3K2MC 5HGAA 5DC0A 5CJXC 5FGRA 1TPXB 3WFZA 4O51B 3QG6B 4I1NB 4TOYL 2UV3A 4X6EB 4KROC 2MPAL 4KKBC 1FFPA 1SEBA 1T20A 3FAWA 1WC7B 1I7RB 4M7LL 1UWGL 4I48B 3T3MF 2ED9A 1RFDH 5F96L 5DQJB 1AXTL 4LSUH 3QQ4B 3WIFA 3D48R 4GG6B 4X5XB 2AEQH 3ILPB 3UJTL 1FL3B 4G42B 3B3IA 3HKFA 5KOMC 2HKHH 4PP2A 4EI5A 5B8CC 4KMLB 1Y0LA 4NO0D 2AJVH 1ZT1A 4QRSA 4K94C 4FFZL 2IBZX 3PNWB 1J8KA 4W4NA 1RJYB 4PJ7B 5E70A 1IARB 3KAAA 5BQ7A 4MB5A 5J3HC 1DUZA 2FJGA 3EYQC 1NBZA 3K4DA 1VENA 4OFKA 5B38B 4YFLI 4NQCA 4UT9L 5C0DA 4NHCH 3GSRA 4ENEC 4G6KL 5F7WC 2WBWB 3OV6A 2JK5A 4ORZC 1EHLH 1MWAB 5ICXA 4RWYL 4P46B 4C4KO 4RNRB 4UV4L 3FCTA 1A6AA 3AREA 3WO4C 2VLRA 4WWID 4GXVL 4U6YB 2OJEB 5TQ2L 1TZGH 4D0BB 1AC0A 1DCLA 3ET9F 4BH8B 2XQYK 2Z8SA 2V2WA 3TIDB 4YGVB 1T0NA 2DQCL 1HSAB 3U4BL 4JPKL 4KK8D 5DT1H 1YQVL 5GSRA 1TVBB 3GSNL 2QQLL 3VXNB 2PF6A 4PJ7E 4BUGA 1JTPA 4ETQB 1D5IH 5IFHH 5JW4N 2NW2A 1BFOB 4FRWA 5K9JL 4NBYB 2XPGB 2VWEE 3L5WA 1UB5A 3QEQB 1HINH 4ZNEE 1RU9H 4XPAH 3MUY1 2X4RB 5LAXB 5CJXA 3EUUA 3V52H 3QUXA 1JNHA 3BXNB 4P2OC 3TZVD 4C58B 2I9TB 1BAFL 4XB7A 2H3NB 3WD5H 4O2EB 3UTTA 4JREC 4H0GA 3SOBH 2A2QT 5ITFA 3I6KB 3VXSD 4FHBD 3DXAD 3TF7C 4OD3H 5DI8B 3OKKB 2JTDA 3HAEB 2ENYA 5AYQA 3CAFA 4G6FD 4BFGA 4D9RE 3QUYD 1RZ7H 2DQUL 4EDWH 1MCPL 3GJEA 3CX5J 3PGFH 3QUMH 1T22B 2W65A 1IAKA 3W39B 3DMMB 4XWGH 3O3AB 1VEMA 4YHKL 4ODTH 1BQHA 2EKSB 2CKBL 3GNML 4S1SH 4DUVA 2COQA 2VO5A 2O26U 4LHUA 2AS5M 1VFBA 2HVJB 4PTTB 1QBLL 4NM4H 3QUYA 3IB4A 4N9GA 1UZ8B 2F15A 4XAKD 3BEWA 4PS4L 5GRJH 5C8JB 3FB6A 2DIAA 4CN4A 5CIPH 4FQIH 2MCPL 3HZKA 3RJQB 3K8LA 5J06A 4RIRB 1ZHNA 5FO8A 2EEAA 1EV2E 1M71B 3C5ZA 1AR1C 4IS6A 5CFHA 4ZUTA 3N0PB 2F5BL 2AVGA 1A8JH 1TETL 3O2DL 3WDHA 2I60L 3LKSB 4Z7QF 3VI3F 3ARDA 3O8XB 3ZDXF 1Q0YL 3D0LA 4FQLL 4OUUA 5CJOH 2D7OA 5CJQL 1JGUL 1X5FA 3VXMA 3L3JB 2C7UA 1E6JL 4X6CE 3VGEA 5HSFA 4Y1AB 1TJGL 4ELME 1YMMB 2OCFD 4NQED 4M48L 4PD4J 5I75B 2A9MH 1BJ8A 1I7ZA 2O5ZL 3OHXA 2HT4C 5JW3H 3SGEH 5EU7C 5TDNA 3DX8A 3BD4A 3BZ4B 2YRZA 2IEPA 4LARH 1ED3A 2DD8L 5BW7C 1JFQL 3GI9L 5T3XE 4LARL 1O5DT 3IAPA 1J7VR 5TH2B 1J1OL 1C5CL 5TQ0L 2HN7B 2DDQH 4LFHG 2P7TA 3FT3A 4DZ8A 1TPXC 4W4OA 4O00A 2V7HA 4ONHA 1CT8A 1AFVH 3WEXA 5MEOB 5DMIH 1A2YA 1S7VB 5I8EA 5TJWK 3RUGB 1A4JA 4WWKC 2GI7A 4Y5XC 1R3IH 5JW4M 4MD4A 4WW2B 5I1DA 1I9EA 5JQ6H 5C09A 4MNGB 2VAAB 2NYYD 3TO4C 3WL9B 3EYQD 2F8XC 4S0SD 3Q1SH 3DRTB 2VQ1A 4LBEB 3KYKL 3MLWL 5J6HB 5GSVB 3U6RA 4DQOL 5D93B 4KHXL 3VXPA 4XHJC 4KKCD 2XACC 5L2JA 1MQKH 4I0PA 4K55A 2DLEA 4PJ5B 2VUYA 4APQB 4OUOA 3QIWA 3MGOB 2RGSA 3HCVB 3H9SE 4CNIA 5HHOB 5B21A 1IM3B 2GJ6E 2EH7H 4NHUB 4JDZB 3T08A 3HE7A 1JBJA 1H15B 2X4NA 5DJYB 1CFBA 1YJDL 1IC5H 4J23A 4YIQA 2FIKA 1FIGH 5BVJB 1F45A 3GKZA 3ARFB 1AHWC 1KTKE 4KHXH 3C87A 3HS0A 1MLBA 1X5XA 5BJTA 4BKLB 2OS7A 2LU3A 4U1LB 4R96B 3TO4B 1TNMA 3WKML 5DEFB 4YHIB 2I25N 4S1QH 5JQ6L 1VFMA 3Q0HA 4QTIL 1ITCA 2GY5A 3NAAL 3RTQD 1KTLB 3FN0L 3F12B 5T1MB 1R5VA 4JFXB 2X4OB 4O5LL 3I6GB 2DI8A 2X05A 1OCWL 5HHXL 1NKRA 2QEJA 5D2NA 5EH1A 4QCIB 3ULUL 3CFJA 1UENA 3I75B 3KNBB 2A74A 3S36H 2DDQL 4PRBA 3BOVA 1QYGH 1KNOA 5KANG 4HIIB 4M3KB 1QVOB 4D2NA 5IEKB 2GK0A 2NY5C 4X5WB 3U7AA 1YN6A 4JRYE 5DMGD 2R0WL 4JANA 4GG8A 5MP6H 5DR5H 1TZHB 3NCBB 4RA3A 1FGNH 3HA0A 5DVMA 5F9DC 2C1PB 3TPUA 1VEOA 2R1YA 4X9FA 5FGCB 1PQZA 4HK3J 2JJTA 5FXCH 4NN5B 1T7ZA 3CU7A 4PJ8A 4QHKJ 1EEUA 4I0PD 3GSNH 1D3CA 3UMTA 1ZVYA 1P2CA 1EUTA 4M1GH 4YHNB 3ALWA 3VH8A 5IB5A 4LLQB 5DUML 1MUJA 4HKBA 1NBYA 5H8DA 3BDYH 1Q9WB 2Z93A 5DJ6A 4AEIH 2I60H 3AC0A 1B9ZA 4LLMB 3G04A 5BZDA 2M8XA 4AM0A 4NZDA 2R9HD 3MBED 1A1OB 4P49A 4Y19D 1G9NC 3MLZL 4X7SH 5DS8A 1MIEH 5EWIL 3LIZL 3MV01 3PIQA 1RZGB 4NHCL 3H9SB 4UT9H 1HIMH 4WRLA 1FSKB 4E42A 4JFHD 2VZ3A 1TZIA 3B43A 1IMHC 3OR7B 4QHKI 5D1XD 5A2JH 1I4FA 1JHLL 3ILQD 5J1AB 4WI5A 2FR4A 2VOTA 2PW2A 1F6FB 4ODTL 2QLVB 5D5MF 4XAWH 4Q9CA 3LKPA 4MNHA 1EXUB 3TGXA 5JW5B 3ZSTA 4PJ9A 1D6VH 2OSLA 3QUML 4XNMB 4F7EB 1Q38A 1U8LB 5FYKU 2FATL 5HYQB 5ESVB 3FQUA 3UJTH 4X4XA 1RZ7L 1X5YA 1QNZL 4HWEL 35C8H 4XPFL 3FFCB 3V6ZB 4E0RA 1HHKB 4OD3L 4P5KB 4ZFZA 5I8OH 4LMQI 3SDCA 5EC2B 1U8JB 5EO0A 2ITDA 4PJ8D 4JFDA 1XF2A 4HKJB 4XHJD 4MSWA 2YK1L 4UB0H 5DD3H 4AIZA 3F5WB 4WFFD 3RVTD 3S3SA 4JPVL 4RGMC 3L3HB 1K8IB 1G7QB 2FO4B 4NNPH 4HCRL 1J87A 1FZOB 3BJ91 1A6ZB 1QEWA 1OGAB 3HG1B 1CD1A 3CSBA 1CIUA 5JUEH 3X13B 4K71C 5IFHL 3O2WL 3TP4A 4D9QE 5ANMB 1IEAB 1BLNB 5I1AB 1FNGA 1FZMA 5D7JB 1AI1L 5IOPB 2A0LD 2VB5A 5C9JA 3JSSA 3V0VB 3VFSA 5I1JH 3EO9H 5JDSB 1HNFA 1XGTA 4JQVC 3L6FA 3VFUA 2ORBL 2PTVA 4QT5B 5D7KE 5HDQH 4FQHB 1F02I 2VXQH 4WDIA 3PE9A 4QHNA 2CDFB 3IU3B 4JM4H 1CCZA 2CUMA 3AS2A 2V5YA 3UTSA 3ZYOA 1U95B 2YUWA 3ELAT 4FTVD 1FL5A 1AY1H 1AP2B 1I9RL 4GBXA 5FGSA 3X14B 4DK6A 1D5XA 1A1MA 5EORH 3BEVA 3MOBL 2BNRE 1X44A 5DD0H 4ZYKB 4JFFA 3UC0L 2DWEA 4OGAD 4IOFD 4Z76A 4G3YH 4EOWL 3QDGA 2VLLA 5IEHB 4FFZH 2N4IA 4NUGL 2UYLB 1AR1D 1NC2A 3EDFA 1PG7W 2EIEA 5ALBH 3DGCR 4HH8A 4YHPB 1KC5H 2X7LA 5HY9B 1WBZB 2GIYA 1G7HA 5C0GA 4XBPB 2AEQL 3QIUA 1GSMA 3I50H 1WT5A 1AXTH 4LSUL 3BP6B 2XZAL 5CEXB 1ZMYA 3PWJB 5E8DL 3OF6A 1UWGH 4RMTA 3E6HA 3DBXA 5HPOA 5FUOH 4JKPL 5B38G 4F9LA 1NMCC 4YDJB 3VGDA 3MRIA 1XGYL 2BXYA 2V2XB 2VSCA 3BE1H 1KOAA 5EU6A 1QFWH 5IVXE 1OSZA 3BPOB 3TLRA 1BFVL 4ZUWA 4KDVA 5K9OA 4P3WA 1LDPH 1NL0H 3H2WA 1FSKC 2UUDK 4JJHA 1HEZA 3PXHA 2C5DC 1YMHB 1QR1B 2VXVH 2X1WL 2BVTA 2H9GA 5DJCB 2Z92A 3C8KA 1MLCB 2OL3L 2D0GA 1MSPA 4WV1B 2EECA 1HXYA 1U3JA 4ODVH 3MRBB 3NA9H 5I30H 1WWAX 3H7BA 2JELH 3P77B 1AJ7H 1TJIH 1SQ2N 1Z0NA 2P8LA 5GGSA 4F15B 1Z5LB 1NC2D 2UZIH 3C9NB 4HV8B 4WCYL 3ECBA 1DR9A 2R4RH 2IAMD 4D8PB 4H8WH 2ATPB 4HIHA 2CUHA 2HTKC 2XN9B 12E8L 5HHME 3KPSA 4LASL 2QADB 3EYUH 5JOPD 3QUZD 3VFGL 1HKLH 4X6DB 4OGXL 1UVQA 3QNZB 3H0TB 5C0CD 1HHIB 5HGBB 2GJ6A 2FYYA 4KJPD 5F8QC 3LQAH 1J1XL 5SV4A 1XF5A 3EFDL 2CXGA 1AD9B 1I1CA 4XXDA 5KG9A 3LS5H 3HUJF 3VXQA 4AG4H 4N0YL 5GGUB 4GAYA 2HWZH 2AV1A 3TBWB 3RVWD 4WW2F 4EDXB 4N8CH 3LKNA 3KXFD 2P8MB 2ADIA 4OF3A 5AD0B 4G8GE 2KL6A 4MB4A 5DZOA 2AJYL 4ENED 4H8WC 1F90H 3NCFB 4I18B 4PD4K 3RGHA 3EO0B 1ORQB 4K2UL 4LNRA 5C3TA 3T2OA 3NFNA 4LSPL 4MD5A 3G5VB 3EDDA 1BGXL 1MPAL 4JAMB 1H3TA 5FA3A 1WV7T 3MOAL 5E2JA 4PV8B 3QIUC 2OMNA 4DCQB 4FZEH 3VFMB 5GJTL 4P23B 1YEEL 3PWUA 2ZJSH 2QQQA 4WI7A 5KSVA 4OV6F 3M17A 2BSSB 3MV7E 3E3QC 1J18A 1S78D 1A6VL 5IBTL 5I1EH 1N59A 3VGGA 1ZA6B 2DQHH 3DV4B 4JR9H 5TE6L 4J3VA 4OKDA 1QBBA 2ARJA 4XBEH 1J5OH 1OOAA 1YEKH 5I18H 5ECJE 3OX8B 1CDBA 2PTTA 5DD6B 3PGDB 1ZT4A 1X3DA 1DE4A 3TZVB 3L1OL 4KKBD 1AQDA 1S7TA 3B5TA 4UIMA 3NZHL 5F7NC 1H3PH 4R3SB 3IDUA 2AXGA 4ZO6A 3U4EA 3IFLL 4M8QB 5IG7B 3LPGA 2VZUA 3O41A 1AIFA 4I0CC 5F71A 5SWZA 5IQ7H 3TFKD 3EDJA 3V5KB 4UTAL 1BM3L 3MJ9A 4GW5B 1VKXB 4I2XB 4PJGA 4KUZH 3VXRB 5DJAB 2ZKHL 4E41A 1NCBL 3IDIA 2EC9U 1JF5A 3UPRB 4H0IA 2X4UB 3S4SB 1DLHB 3S35L 3DMMD 2CLZA 1JNLH 1P53A 4K8RL 3QUKA 3L5XH 1JUFB 1IAIH 4I5BB 4L8BB 1MVFA 2D7TH 5GS1B 1F3DH 1PX3A 1AC6A 3HPJA 3N9GL 2NY0D 3RQ3A 3L5XL 4G9FA 4U2YA 2WWMC 3B5HA 4XPBH 1LEIA 4QF1B 1Q72H 4I3GA 5IMLB 5JR1H 1FVDB 4R8WH 4OF8A 2H2SD 3D25B 1CQKA 3VWKC 1NGYB 3JV0A 1FNAA 4MQXD 4UQ3B 5DK2B 5FYJD 2NNAA 4UILL 1U41A 1TFHA 3E3QE 3DOSA 2FX9H 4KUZL 4NPYB 5EU5A 2ILLA 1M7IB 5E2VH 4CN1A 3WDIA 1BM3H 1NH6A 5KVFH 1QLEL 4HUMB 3NCYS 4G9FB 3T4AA 1EGJH 3QPQD 2PXYD 4XP1L 4LVHC 2GJZB 4C57C 1OSPL 5BCAA 5ISZA 4MJID 5J9PB 3NZHH 3NIDF 3MNZB 1ZTXH 4Q0XL 4JO4L 1MCSA 1JUFA 2R56H 2XXMB 3QQ3B 1DBBL 3GJFB 4WW1A 4K7PX 4JM2A 5FB8B 2J8UA 1JHTB 3BWUC 5DJZA 1C08A 4DKEL 3ZKMC 1EAPA 3DETC 4XBEL 2YR3A 3OKMB 5E4IA 5CP3A 3NABH 4HK0B 3WS3B 4LCWD 1VFAB 1ORSA 3VU2A 2YD5A 4I2XA 1VKXA 4DGIH 5AYUH 3O11A 4WTWA 3VMNA 2VLRE 5GJTH 1AKJD 1W0YT 1AIFB 3O41B 3T77A 3CH1B 3W5MA 3HRZA 2PTUA 4PB9L 4HS8L 3U4EB 4YDIL 5EU6E 1UEMA 3QCTH 3QO0B 1BGXH 4BM7A 4UIMB 3RP1A 1QFWM 3S37L 4NRZA 1W0VB 2ERJC 2E7LC 3REWB 3PGDA 5DD6A 3PHQB 4RDQG 4XPHL 4IMKC 4MWFA 1L7IH 3QAZC 3U0TB 4Z7OE 1L0XA 4GKSB 1DEEB 3UTZA 4IHOA 1MFBH 3FO2B 3ULVL 1NGQH 4Y16B 3H9SD 3JWDL 5CZVH 1SJVA 2P5ED 2HJKA 1T0MB 1SY6H 2P49B 4N0YH 1N59B 1X5AA 4AG4L 4BYHA 2BSTA 2K9UA 3EFDH 3WIIL 3EO1A 4IOIA 2VRAA 3MRMA 5I6XB 1KLUA 2XY2A 2EIBA 2Y36H 4HWZB 1OQXA 5MHSE 3RZCC 3FQWA 4F7PA 5DEGB 1JMZA 2I27N 2NY2B 5JHDD 3NFNB 4MD5B 1UADC 2Z35A 5L7XH 3MLVL 4I18A 5IW6A 3HE6D 5D70L 2X9XA 3UYPA 5GJSL 5I74C 3G6JA 5I1IH 2MNUA 4LL9A 1FVCA 3QPQC 3TBWA 3MBEA 1NDMA 5A16B 3DUUA 4HUWA 5M94B 3RWCA 1MRCL 2NCMA 4ODVL 2B1HH 4ELMB 4OZGB 3A6BL 4S2SA 2OL3H 5J1SC 4WI8A 2GJ6B 2OX5A 1G0XA 5D1ZC 3LQAC 3QULB 5FUCC 4XZUA 1Q8MA 4NCDA 1I85C 4IDJH 5HYSA 5LGJA 4LVOB 1KBGH 3NCJL 4OKVB 2J88L 4OJFH 3MRFB 5JPNB 5FOJA 4NC1C 4HV8A 1IGTB 5FK9A 4MXWH 1BQSA 1MAJA 5FDYA 2P5EA 5FGBC 2XZAH 1GOHA 1C12A 1AGCA 1NEZG 4QYOB 4RAHA 4FTVA 5DFWH 2Y07H 1BX2B 2YPVL 2C1OA 2FB4H 2PCPB 4N1HB 1I7UA 3VMOA 5IV2B 1T7WA 4F9LC 3K7UA 4TPRH 1HEZB 1FL6B 4EIZC 3KS0J 5K9OB 1MFDL 5GGVY 1MFCL 2R23A 4K3JH 5HYIA 5J11B 4BZ2L 2GQHA 3FFDA 1KCRL 5EC1A 3EOTL 3ZTNL 3MRRA 3C2AH 4H25A 3D0VA 3MSPA 5CEZE 4Q9RH 4MAYA 1WWWX 5INCA 1NCDL 4MQSB 2OR7A 4X6DF 1GCFA 4WFEE 2BRQA 2WV3A 1QKZH 3MX0A 4TUOA 2Z31D 4EVNA 5C0GB 1ZT7A 1BBDL 4P2CG 4CBPA 2EXYD 5TDOB 4GRLD 1IFHL 1RZJH 1U93A 2VXQL 4S11A 4ZG1A 5JW4R 3UTTE 3H3KA 1ZA3B 2HT2D 3MV11 3QWRA 1IC7L 1S78C 2BY2A 2H6PB 2FH8A 2VLLB 3PV6B 2YD3A 1UWEL 2CIIA 5BOPA 4RMQA 3DVFA 4M4PA 3S3PA 1T1ZA 1AI1H 1F42A 4XNUH 1DBJL 3OB0H 4GAGL 3BP7B 4MQ7A 3HN3A 4QNPE 1A3RH 5GS0D 5HHNB 1UYWL 4F2MA 1Y18B 1FNSH 4UV7L 4I9WD 1O7SA 1D5XB 1ZSDA 3HR5A 3RVUD 1GIGH 1MIMH 1FAIL 1FCCA 5I19H 2APFA 4JQVA 4N5UA 3DX7B 3V6FB 3N1FC 3UYRL 5DD1L 1NMAL 2YD6A 1JYXA 3QI9C 1F4XL 5IIEA 3RGVC 2A77H 4G9DB 5CP7A 2LTQC 4YHLH 5GGTA 4OLXL 3KHOA 5J56B 1PAMA 1T83A 4ZUUA 4WI6A 3RVWC 4WDIB 4P9HC 4YNYB 1U3HC 2JB5L 5BMFH 2Y6SC 4HUVB 1RUKH 1FL6A 2XN9D 5IV2A 5ERWB 4XCFL 1R3KB 1CDJA 2NR6D 4OB5L 5H2BA 3RL1B 1XR9A 4JZJC 1FNHA 3BP5A 1YN7B 1NCWL 1YYMH 2LU4A 3VWJB 4FTVB 4QYOA 4OFDA 3X13A 4JO1L 1UEYA 3VI3E 1LWRA 4Z7QE 1OGAA 3BKJH 1NCWH 4TQEL 4OI7A 3LAFA 2ESVE 2WUCL 4PV9A 1FZOA 4XAWL 1WGOA 43C9B 4IRSA 1A22B 1IGTA 1OTUC 5FK9B 5GGRY 4ZNCD 2GCYA 3DIFA 4YX2H 2E7LA 5FHAH 3F5WA 1ACYH 1ZHKA 5DJ8B 4OAWA 4X9BA 5EO9B 3EOAA 5IJKA 5EC2A 3SDCB 1FYHB 3ARGA 3GB7A 1F4XH 5KSUA 5DD1H 3LV3B 5D4QA 4Z7VA 1OLZA 3FQUB 4S2SB 1EDQA 3PWNB 3U36B 2YXMA 5IF0A 4H88L 4G8GB 4NFDA 4EN3D 4R90H 1I8IB 5D7LD 1PYWB 5KS9A 3LKPB 2EXWC 4GAGH 5C6PB 1Q9KA 1RZIA 4UTBH 5EZLB 4ZDHB 6FABH 4M5ZH 1X4XA 5IW6B 2PXYA 4NO0B 2ZUQB 2R69H 4E42B 4CADB 5EUKB 1IKNA 4XPTL 4NO5A 1T83C 5GS0H 1RJCA 5DEGA 1WITA 3IDGA 4IRJA 5HI5C 4X8JB 1QKZL 5E95B 2JLLA 3BUYB 1N2RB 1MFAL 2YPLE 4HAFA 2DQIH 3MRMB 2LQRA 3EO1B 4IOIB 1TTUA 3K1DA 2E9IA 2I26N 1MEXH 2XA8H 1QPXA 5IR1A 4HKBB 4RMUA 5C2BH 1JPFB 1JPGA 2Q8AH 5HHXH 3EHBD 4BZ2H 3V4UH 2ED7A 3VJ6A 1MJ8H 3UTZB 1DEEA 1MFCH 4K3JL 1MWAL 3N1QC 3NAAH 4QTIH 2VIRB 5JMOC 5ALCH 4NBZB 2IBGA 5L88L 3JVGC 3I02B 5IHUL 2D03L 3PXJA 2VL5B 3UBXG 1NC4D 4PJBE 1H3WM 2PYEE 4NDMB 4M43H 3T77B 4X5WA 4ZS6C 2OK0H 1IC5L 3O11B 1YJDH 5IEKA 4OZ4A 1RUQL 4MXWL 4ZS6D 2CSPA 2XTJE 3KNBA 1VFAA 3B2UC 1QP1A 4GSDH 4JQIH 4TULH 2LVCA 3IFOA 5CJBA 3ABZA 1G7PA 1C08B 3F12A 5B4MD 5D6DA 3RWFB 5C0FB 5DSCB 3GJFA 4PJDA 3BN9D 1J10A 3HC0B 2ED8A 4P9HL 4DQOH 3WNKA 1SEQL 1U8NB 8FABA 2YMXH 3EHBC 2J7LA 2R0ZL 3CZJA 2IADA 1MRCH 1CG9A 5KS9F 3BRGC 3TJHD 4ODXA 1B0WA 1IKFL 1EGJA 1FRGL 4MCYA 3T8XB 2VLMD 1PVHA 1LDSA 3KPQB 4FQQB 5EU5B 4MJIB 4GBXD 3ULVD 1IM3A 1IT9L 5HI5D 4S10A 5D70H 5TQ0H 3MGOA 3MMEB 1CK0L 2WW8A 3UCRA 4LCUB 2QR0B 4NZTL 4NWTL 3SE3C 4AZ8A 1YECL 4ZMAT 5JPMA 5JW3L 3HPJB 3KPOA 3HFMH 4WI3A 4UAOB 3WL9A 5I1GH 4M5YH 1OAUL 2EXWD 6CGTA 2XZCH 4MD4B 4WW2A 3JVGA 5FYLD 3O9WC 4H26A 2CR3A 3ZKQD 4NKOA 3ZZ1A 4KVCL 1KCVL 3PP4L 3RHWK 3WEXB 3O8XD 1K5NA 1KG0B 5F9WC 2CLZB 5CJOL 2OXGA 2FGWL 4LOUC 4MHHI 3B9EA 4G8FA 3SY0A 4PIRF 4FQCL 1DLHA 4CU6A 3RBGA 3QNXA 5F88A 1C7TA 2B8OT 2FO1A 3O2DH 1A9BA 3ZHLA 1TETH 4RRPA 3CFDA 3U9UA 1JYVA 3VI4F 1MCDA 3B9AA 1LK3L 3MTRA 5C0JB 4PJGB 3ZHDA 3LDBB 3SDDD 1CI5A 1NEUA 1ODAA 4ZXBB 3L3GB 1J1PL 1ERNA 3EYOB 3MRCA 3S34L 4POYA 1D9KB 5TDNB 4ONGH 1A5FH 4KVNH 1OD9A 2AXGB 1XCQB 3C6LB 5GRJL 2F54D 1WTGT 4NQCE 1KEMH 1ONQA 5F6IC 2NXYD 4N9OB 3L95B 2VLKB 1U2HA 3NABL 3K74B 4AIOA 3UJJL 1CWVA 5C92A 3D0LB 2ARJB 2FCBA 3DX6A 4U6HA 4JFPB 4F7MB 4KK5D 4DGVL 4ZUTB 1NFDA 4ZODA 1MCPH 3HE6B 4U6VL 5IFAL 3OKLB 5KSVB 4XP4L 1RHHA 1OSPH 2W9DH 3K3QA 3VFMA 3QI9D 1YPZB 1HHGA 1EGJL 2XI9A 1I3RA 4IBLT 5C8JA 1QD0A 1X7QA 2DM7A 5KVFL 4ZXBD 4O9HH 3KYAA 2VDQH 3CDYA 2QQNL 4XMKL 4PJIF 1VFBB 2HVJA 4LHUB 5IESL 3VI4E 3SCMB 3X12B 4JPIA 3IDJB 5JIIA 1JNJA 2EC8A 1K4CA 3IKKA 1HINL 1S7RA 4KRNA 3G6AB 3BQUB 5F44A 2P8MA 4R8WL 4Y19A 5CP3H 1RJLA 2F8VA 4HFUL 4K94L 1U3ZA 3RWDB 2YUXA 1M6OA 4FXKA 3C5SB 4DKDC 1I9IH 3AUVA 4OF7A 3N9GH 4XXDB 5KG9B 3MV9B 1GZPA 2EDKA 4BFEA 2VLRD 3NOIA 5CGYD 4PJ7F 1L4IA 3U4BH 2FYYB 3LOWA 5ITFB 2OR9H 4OGYL 4K8RH 5TQ2H 3SKMA 4M1CD 1E6OL 3PWPE 2F74A 1T7YA 4OLUH 3ROOA 1X4YA 2CLVB 1QSZA 1Q1JL 5IHZB 1QLFB 1UB5B 5T1LD 3C9NA 4L4JA 3QR2A 1OP5K 3CC5B 5SWQA 4IJ3B 4G80A 2APXA 1VB9A 3Q48A 4WWKD 2YUVA 3HI6H 1SY6A 4JY6B 1YMME 5HGHA 3GO1L 4C56D 4MVBC 5MI0C 3MACL 3PQYE 5E9DA 3A6CL 5I66A 2CUIA 3IFLH 4R4BB 2VDRH 4YGVA 2KDGA 2V2WB 3TIDA 1F4AA 3FOLB 3Q5OA 3JWOL 3FHAA 1YEHH 5DRWB 4AK1A 2GY7B 4ELKB 1XZ0A 3MV9D 1RJZB 1JZ3A 2YWZA 5C09E 2VLRB 2VXSL 3LEYH 1J5OL 2XXCB 4FQXD 4P46A 1YC7A 1KB5H 2R1WA 3ZL4H 4CVZB 4M1DL 3PWPB 1FFNB 5F96H 3G5YA 5B8CA 4POUB 1GC1C 2CR6A 1HOCA 3SKOA 5L0QB 3PWJA 5CEXA 5EO1A 4TOYH 2XKSA 2EDHA 4JFOA 2J5LC 3HC3L 5D1ZD 1YY9D 2YKLL 4I3RL 2H2PC 1CFVH 1RJYA 2X7LB 3ESVF 4JB9L 4LGPB 4RGOL 4CMMB 3KLSA 3NN8A 1IC1A 2GJ6D 2WUBL 4HMCA 4LCCA 4FABL 4LKCB 5GGRB 4G6MH 5INDB 3G9AB 3QDGB 4MA1C 5BRZE 3V4PL 1FL3A 1UKTA 3O6KH 4Y4HA 4FQ1H 2DWEB 3VWJC 3AREC 5JMRA 3WFDH 5E6IC 2HWZL 1CLZL 2X1OA 4YHYB 3GM0A 4QRRD 4GUPA 1ETZB 3EOBA 3JZ7A 4JFYA 1LILA 1VSCA 5FO7B 1AO7E 1AP2A 3QG6A 3OJDB 4Z0XB 4PRDB 4Y2DD 4PLOB 2APVA 3V6OA 3TN0D 2WLYA 3I3DA 2HT3C 5D7IE 3OB0K 5EIIB 2IALA 3UDWA 5DRXA 5KSBB 3UTSB 1KCSL 4XVSL 5HGAB 2I5YL 3DRQB 1CZ8H 4NT6B 5EOTA 4W6WB 1YEDA 3GSVA 1XGQA 4OIIL 5GRWA 4HXAL 1O7VA 3RWEB 3HI5L 1PG7H 1ZHBA 4X80H 2R2HA 3QDAA 4LPWA 5JDSA 1MREH 3ULUC 4F15C 5C7XH 3GMPB 3SE9L 4R2GC 4WEBH 1FJ1B 3Q6GH 1K3IA 3DNKA 2DQGH 1RIVL 3RDTD 5I8KL 3EJZD 1S7SB 4R7DB 1EFQA 3IXTA 3QZWB 2ZUSA 2LVEA