5ERWA

Structure of hcv e2 glycoprotein antigenic epitope ii bound to the broadly neutralizing antibody hc84-26
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
217
structure length
212
Chain Sequence
MQVQLVQSGAEVKKPGSSVKVSCEASGGTLSNYVITWVRQAPGQGLEWMGGFIPTFRTAMYAQGFQGRVTITADESTSIAYMELTNLRSEDTAVYYCARGPLSRGYYDYWGQGTLVTVSSAKTTAPSVYPLAPVCSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein/immune system
molecule keywords Anti-HCV E2 Fab HC84-26 heavy chain
publication title Structure of HCV E2 glycoprotein antigenic Epitope II bound to the broadly neutralizing antibody HC84-26
rcsb
source organism Homo sapiens
total genus 39
structure length 212
sequence length 217
ec nomenclature
pdb deposition date 2015-11-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5erwA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5erwA01
5FYJH 2CJUH 3SKOA 1CZ8H 4JM4L 3BUTA 3CFDB 5EZLB 1RIVH 5F3BA 3T2NL 4AMKL 4JJ5B 1AC0A 4RQQA 5CIPA 1V7NH 1CLOH 4P4KD 1J9CT 3ISWA 4ZFOB 5LXGH 1JZ5A 4YZFF 4HKJA 5T5FH 4QNPE 5FF6B 5CHNA 3WUZA 3N50A 1MRCL 5EWIH 3RZCB 1HH6B 2B0SH 2R4SH 1YEDB 2YD7A 3K8KA 5DJ8A 5ISZB 5I73C 1AP2B 4CJ1A 1MHCA 4AEIL 3CXDH 4ODHH 3DVGA 4Z5RB 4NNPL 1D5MA 3U7AA 2YZ8A 3ZKND 5E2UL 3DYPA 3V5DA 1UM4L 3I2CL 1LK3L 3T4YB 4YDKH 5KAQG 4G8GD 4ENED 1SY6L 3VXUE 1JV5B 4A6YA 1JHTA 5T1KB 3EJYD 3VWKA 2X4OA 4XP4L 4EN3B 3PL6C 4U7KA 1FN4A 1J0HA 1S78D 3G08B 4KH2A 4U1KA 2VZTA 2Z8VC 5D7LB 1A2YB 3BKML 4GG8B 1YNLL 5BMFL 4YR6A 5HHME 4OZ4B 2Z92A 2VDML 2VDLL 3G6AB 2QSTA 4MQ7A 3VD3A 2MHAB 2NQCA 1P7QD 2VLMD 4P2OB 5EZIH 1E4WH 5GHWH 4QEGA 3VCLA 5J1AA 2VL5B 4HAFA 4YBQC 3R06B 3ZT6A 4AIZB 2P8MB 3C9NB 1S5HB 1PAMA 1IGTB 3VXSE 5EO0A 2VN7A 4E5XB 4I48B 5C0FB 1SHMA 4NUGH 4AENA 4DFHA 3MXWL 2O5ZH 5C3LD 5JOFA 1R3IH 2BNRB 2D7TL 5CP3A 5F9DC 1MFBL 3IU4L 5DUBB 4JHAH 4JFED 1EERB 2BCKA 3JWOH 2X4PA 2VXVH 4D9QE 1OF2A 3UP1A 2IANE 1CL7I 2VXTH 3RIAF 5GJTL 4J7RA 4NRZA 2GSGA 4MJ2A 4UOW0 5D7SH 1WIPA 4UT9H 5ACLA 2XY2A 4NKOB 3W0WB 2CO6B 4Z0BH 2R2CA 1K4CA 5TDNB 5D1ZD 4P9MH 4OAWA 3BPOC 2B8OT 1LK2A 3VA6A 1TETH 2PR4H 3BQUD 2R2BB 5JORA 3QDGB 2CIIA 3FT2A 3PJSA 1WBZA 4P59L 3U4BL 2MOVA 3SJVB 4WHDA 4O58L 1U8NB 1L0YA 4XVTL 2VXQH 1PLGL 3V0WH 2IBGA 3FQRB 4IBLT 4C4KT 3EYFA 1BVKB 2FBJL 5BV7H 1EFQA 5F7YC 5I8CB 3IKKA 4YAQA 4PRNB 4MQXD 4PJHE 3GRWL 5AZEH 2B1HL 4S1DD 1UM6H 4FG6C 3VI3F 1ZLWH 4WV1B 2CLRA 4U6YA 1WF5A 3CC5B 1EO8H 1XR9A 4ZUUA 3IDJB 1CT8B 3STLB 3QP3A 4UAOC 1BZ7B 4OLYH 4E0RA 1TZGL 4UOW1 1U8MB 4KKNA 3NFNA 4K3DL 4FXGB 1AD9B 2OTWB 3MYJA 3EDDA 3VFVA 3TVMB 2GCYB 2XQBL 1FIGL 3ARDA 1OLZA 5E2JA 5AYQA 3TO4A 5E2TL 1LO3L 1SBSL 2C1PA 1CTOA 3GI9H 2VH5L 1FO0H 3MYZA 5IVXB 3FO2B 3M17B 2R2EA 3H0TA 2P5WE 2D4FA 3ZE2F 4I4WA 2XWJB 3HA0A 4P9HC 1A7OL 3BSZH 3WKNA 5BW7A 2CDGB 2JJSA 2DLFL 1ZHKB 4PRPA 4R2GB 3TESA 1BX2B 3UTTB 5DJYB 4JFDA 2B7DT 2FL5B 3QJFB 1NCBL 3DJ9A 5GSVB 5IQ7L 2I9LA 2NX5D 3HI1B 5C0RL 4K55A 5D7JB 2AJYH 4NJ9L 5GRUL 1EK3A 3QZWA 3E3QE 4J3UA 2ZSWA 2CUMA 5T1LA 1UZ8A 1XR8B 3A0OA 5EDXA 1DFBH 4PGEB 3MCLH 4NZUL 2DYPD 1KV3A 2QQKL 3GSXA 4KJQD 4FXKA 4PG9B 3UPCA 4LLMA 5LCVL 3L3KA 1JBJA 1T03L 5I1CL 3OB0K 5EZJB 1DP0A 1NUNB 5HI4C 4EI5B 4LSVH 4HEME 1BBDH 4ZTPH 1FZMB 4XHJD 2WIMA 2H45A 2C9AA 3AUVA 2PO6D 1WVZA 2Z35A 2PXYB 1FL3B 2OSLB 3QNYB 3SDXA 1ZHLB 5IV2B 3ARGB 4NQVB 4XWOC 4LMQE 4DQOH 3BPNC 2FX8L 3S4SB 3RU8L 5J6HB 3TFKD 3BEWB 4BK5A 5C07A 5L2JB 3JV4A 3MRJA 4CNIA 4OCSH 1ED3A 4YGVB 4WNQB 4P4RA 2DQUL 2DDQL 4PS4H 3PGCB 2OM5A 2ICWB 4RZCA 3S37X 1CDGA 2WW8A 2YK1L 3DOSA 4KAQH 5EIQA 4NZJA 3IJSB 4ZXBA 2V5SA 2NXZD 3D3VA 4J1UA 1S7RA 3VI4F 1IM9A 1WIOA 1NAMA 1ROWA 4NSKA 1FAIL 2DI8A 3ULUD 2ESVA 1LVEA 1H8NA 3CSPA 5GZND 5EULV 5T1MA 3LCYA 5A1AA 1Z0NA 4OZFB 1ZSDB 3S35X 2XRAH 1M7XA 1FFPB 3QCVL 4X8XA 4HUVA 4H26A 2A9NH 2R0LL 5DJAA 3VXUB 2A6IB 2EYTB 4HCRH 4FQHB 3V5KA 2GTZA 4GT7A 1KCVH 2VITB 4FQXB 5TDOA 2DBJA 1BIIA 5ADPL 1IC5L 4UMGA 1KN2L 3GKZA 4JGMA 4R7NB 2C1OB 5IMMA 5HGHB 1A4KB 3JTSB 5I30L 3WNLA 3F6LA 2DWDA 2R8SH 1ITBB 2NY5H 3CFBB 3OBAA 4JPKL 3KJ6L 1GOHA 2HFEA 2OXHA 4OIBA 4OZFH 4GOSA 4JB9L 3FOMB 1YYLH 4OD1L 3HS0A 4ELKA 2VOTA 5IF0B 2CDFA 4PJXF 4NKQB 1I8KA 1G7PA 5BZDB 1ADQH 1OTTC 4NOFA 3MGTB 4OBSA 3HAEA 2AW2A 1JPFA 4X5XB 3BO8A 4L3EA 3T77B 1WZ1H 1U8QB 3MBED 1NPUA 1FFRA 2B5IB 5TE7L 4M7LH 4G5ZL 2RAMA 3MV7D 3AU1B 1S7QA 2BSSB 4GS7B 1FL6A 5E4IA 3ZLQC 2VAJA 3F12B 4X4YB 4NNYB 3EYOB 3OR6A 3GMLA 2AJXL 4KPHL 2UYLA 4HWNA 1EEYB 3RTQB 2Q86A 4YFEA 1KTDB 1NDGA 5CEZH 4RFNC 4UV4L 5F7FA 3RGVB 5H37H 4G8IA 4M62H 5L8JB 4HBCL 3MNVB 1QSVA 4MAYC 4ZAKB 3MROA 5E8NB 4AZ8A 3GSRB 4IMKA 2EYSA 1S7XB 4G42A 3ULVE 5F7LB 4PRDB 1VFMA 4JVUA 4LHUA 3RDTB 4UV7L 1CU4L 4BQ6A 1KEGL 4HJGA 3O9WB 3GHEL 3CXHK 4YHMH 2YA0A 4UINH 2CLZA 4WI7A 2WP3T 5TQ0H 1HDMA 4I18A 2CR3A 4QCIA 2YHGA 4Z77B 2FR4B 2DMCA 3ZTJH 3MUJA 2J2ZA 1K3IA 1VFBB 2KZWA 1F8TH 2ZPKH 4M6NL 4WW2F 2JJUA 2OR8A 4JY5L 4KUCD 3RNKB 3VFTB 4M8QB 3IXTB 2F53D 5I15H 1B0GA 3QUMB 3HNSL 2GTWA 2PN5A 4I5BB 2AXFB 2JJTC 3OPZH 3L6FA 4U3XA 1HHHB 3OX8A 4PRAB 1UJ3B 3W9DB 2VQTA 2R1WA 1AGBA 3C60C 2H1PL 1QSEB 2P8PB 4Y8DC 3RY4A 3TH2T 2ZKHH 5ACZB 5SWZA 4BH8A 5LBSH 3RIFK 5IOPB 1I9RH 1XGYL 1CE6B 1XGTB 2OBGA 5GS0L 3MJ8B 1DVFA 2W9LA 2IQ9H 3WIHH 4FQLH 3BX7C 1RIUH 5EZOH 4FFVD 3SGKA 4WWKC 3TV3H 2H3NA 3FAWA 3MA7A 3MR9B 4ZSOA 4K8RL 3OR7B 3OKEB 5LQBH 4WWID 4XNQB 4OJFL 3LQZA 1RUQH 4U6HB 2HWZL 4JFQB 4HGWB 5D5MA 5F6IB 3G6JA 3LN4A 4R8WL 4JVWA 5F71A 4HJ0C 4PP1D 4OF5A 5KSBF 3THML 3P0VH 4DGIL 3IF1B 3FN0L 4B0MM 1Q9KA 1QSFB 2KQNA 4HUUB 2E6JA 1YMMA 1AKJD 3E6HA 2CK0H 3T0XA 2ZUUA 1U8LB 2E9IA 1KIQB 2W91A 5DHYA 5DDHB 4HW6A 4LSRH 2EO9A 4XI5D 5D2LF 3T2PA 5HYSG 3GIZL 4KZEH 1KCRH 2RB8A 1IQWH 1MEXH 1A7NH 2V17L 1RZ7L 3PDOA 4X6EA 3QEQA 5FEBA 4IDLA 2VLKA 2AJUL 4GRMA 5KW9L 2W0FB 1A9BB 4F7TA 4LSSL 2W9EH 4HAGA 2DTSA 5J11C 3QXVA 3KPNB 4I0KA 4R0LC 2XZQL 1XH3B 4IRJC 4PPTA 3QXAA 2WBJB 1XIWB 1JN6A 3WN5A 5T3ZE 4P2QB 5CJOL 5DJ0A 3HC3H 3O6FD 2VKXA 4MA3B 1BF2A 3MLWL 2VJXA 4U1JB 5I1IH 1RUPL 1BPVA 4N8CL 1BQHG 5FO8A 3HZKB 4P57A 1MFDH 4JY6A 5FUZH 4DFIA 2NY6D 1CDIA 1J88A 2DLHA 2B39A 3TZVB 1CXHA 2ICEB 3ET9F 2PCPA 3CDCA 4PRPE 4QHNA 2ZUWA 3LS4H 2VISA 5I1GH 1C1EH 4JFDE 1PDKA 2IADB 4JDZA 4LDOB 1BD2B 3WO4B 3MRBB 3WE6A 1RZGB 2CUHA 4OLVH 1LNUA 2YPLA 3P0YL 1DBKL 4JRXA 4EIGB 3QIWC 1CDJA 3U9PL 3T08A 5IJKA 3TO2A 3KPMB 4EKXA 2ATPB 2WUBH 4N9GB 3TP4A 1I3RB 2R29H 3BPLC 3D48R 1J1OH 2LQRA 2AK1L 3BKYL 4R7DA 3K46A 4QRUA 1KPUB 3TH4T 2ZCKL 4YDVB 2QQQA 3X3FL 1KXVC 3ZYIA 1LO2L 3DXAB 5A2KH 1Z0MA 1LO5B 3QI9A 2Z9TA 5DJXB 3QHFL 4B41A 1M7IB 3OXSB 3S96B 4FQJH 1MJUH 4JGJA 3NIDE 1F4WH 1P6AB 1I8MA 3L3DA 3ES6A 1P5UA 2W0PA 3SDXE 1FNEB 4LRIC 3SKOB 1MAKA 4BFIA 1HEZA 1DSFH 3S36L 4G43A 2DD8L 4JAMA 5I8KH 3WKML 3MUGB 4FQPA 4LVHC 3S5LB 2ZZUT 1KENH 1HKLH 1MY7A 2QBWA 4LPUA 4TULL 5GQBA 2F5AH 3KHQA 3KXFB 2V7NA 3V8OA 5AWNH 2GIYA 2UWEA 2ZUVA 4PGBB 1VGKB 3PP3K 4XGZB 3DRQB 6FABL 5ID1B 4X7SH 1F42A 2ESVE 3WHE0 5DVLA 1GAFL 4ZPVB 4RGMB 2QHRL 2NYYC 4JM4H 4LP5A 3RL1A 4KK6D 2EDHA 2AABL 4PJ8C 5CIPH 3QXDA 2FIKB 4L4VA 3G9VA 3WS3B 3DV6B 4K71B 5CLWA 3FN9A 4A6YB 4MVBC 1JHTB 3SE9H 1JGUH 1D9KD 4M43L 2CKBL 1NMCB 3Q0HA 2CKBA 1WZLA 5CJ8A 1ZGLA 4HJJL 4Y16C 1GZQA 3VDCA 2EDNA 2Q8AL 3TBVB 1T04B 3I75B 2VE6B 2Z91A 4YR6B 5JOEA 2I5YL 1DR9A 4ETYA 1KNOA 2A73A 4AEIH 1PGRB 3SDDA 4NQDD 4BJLA 4NNPH 4X8JA 4LLVA 4YHPB 3IFNH 1BFOA 2Y72A 4KMLB 2ZSVB 4S0SD 4PBWD 3ULVH 4YK4B 5GS2H 1QKZL 1ACZA 1NEZG 2EDOA 3VCLB 1S9WB 3UJJH 1ZHBB 3ESUF 2V2WA 3PF2A 4A6YH 1LHZA 3HC0B 4P4KC 4APQA 1CFNA 1HXYB 5EO0B 3NAAL 3BYTA 4MNGA 5CGYD 4U1NB 3TN0D 4C54A 4JGUA 1KN4L 1U8HA 3B9KD 4RX4A 3FT4B 1CLZH 3C87A 4QGTA 3H9YA 5E4EC 2APBA 4PJXB 4UNTA 2VDMH 3I02B 5BVPL 5F1SA 3E0GA 1KG0A 4ZOCA 4XP5L 5I9QB 4GQ9H 3LRGA 3UXFA 5JUEH 2GYSA 3ZKNC 4EVNA 3ARRA 3H3KA 3PWVB 1KSRA 5LGHH 4HT1L 3K81A 1LEKB 3R0NA 3QUKB 1NBVL 2GK2A 4ENEC 1YDPA 1N6QL 4LP4A 2AJVL 3IETA 4JPWH 1NEUA 3V6OC 4Y1AE 3HG1B 2VO5A 4X4MA 2IH3A 5KZCD 1H3TA 4R3SB 4OB5L 5DF0A 1S78C 3VXTA 5IWLC 3TBTA 4NM4L 3HC4L 3K1DA 4IJ3B 1G9NH 3MXWH 1K4CB 4XH2B 1K8IA 4QT5A 4KKCD 3X13B 4DCQA 1A3RL 2X4NA 3HNTH 1WLHA 4WW1A 5I1DB 5CP3H 5FA4B 5L0QB 1LEIB 4FQCH 3F6IA 2D7TH 5DHVA 3L3GA 3IU4H 1EGJL 4PY8I 1F2XK 4KI5E 1JZ8A 5C7XL 3BQUA 4RWHA 1I7UA 1JMZA 1P4LB 5DRZB 4TQEH 3MGOA 4PV8A 4JKKA 4RAUA 5HGGS 2GFBA 4MZ3A 4HKZB 1JYVA 1G9MC 1VEOA 1KTLA 4ONFL 4XX1G 5F96H 3TF7C 4GRLB 1OGAA 4DTGL 2DLTA 3IXAA 2BVPA 3WXWL 2AEQL 4MNQB 2MPAL 4F7MA 1E28A 3F7YA 2H8PA 3TNNB 3LKQA 1CICA 4FQQA 3FCTB 4LFHG 3ZDZE 3GB7B 4D0DA 4N90E 2V5RA 2XT1B 2BSRA 4Z78B 4F8QA 2ED7A 4X6CE 1U95B 4AL8L 3L1OL 1I8LC 2EO1A 3NZHH 2FGZA 2NZIA 2VXUH 5SWZE 3VD9A 4H1LG 4P5TD 5L2KB 4YIQB 4MYWB 3UTZB 3HMWL 2ZUYA 1NGYA 4XBGA 5IQ9A 1MCEA 4LLQA 1EEZA 4KXZI 2FBJH 4QO1A 4MCYB 5D1ZC 5EO9A 1HNGA 4OCYL 2C3VB 5BQ7B 4PJ5D 4ZSOE 5FV1L 5CP7A 1I9JL 2AKRA 1PZ5A 4JZJB 4F37F 4JFDB 1S7VB 2DQFB 4LBEA 3KNBB 5D5ME 3VXPA 5KJRL 1UCBH 4YHLH 5C9JB 3QXUA 3G6JE 5K9KB 1D7FA 1ZLWK 3HCVA 2WLYA 3WD5L 4MSWB 1FZKA 1JIBA 4IHOB 1DQJB 4PTUA 4OQTL 2X42A 4KV5E 5E2TH 3FZUC 1UZ8B 5GGUB 1FFNB 1UG9A 1A64A 3BH9B 3LS5L 4OFYD 1YMME 1N3NA 2E6QA 1RULL 4MQXC 1ORSA 4FXKB 2JB6A 4PRBA 3QEHB 4R6UA 1H8OA 2V9QA 4G6AD 2JLLA 3MSPA 3SE3A 5I17B 1S9VB 2DLFH 5KSBB 3HPLB 4LOUD 5HHOA 1YJDH 3QEQE 2Y36H 1UXSA 5FHBH 3QUZB 1NCBH 3DRTB 2EZ0D 2BVEA 3QRGL 1IQDA 4GKNA 4AJ0A 3RWCA 3WLBB 4GKOA 5D2LB 1JP5A 2DKMA 2H26A 2FH8A 3O3EA 4W4OA 2PO6A 3SDXB 3E6FB 4JO3H 5E00B 5MERA 4TUOA 4NZUH 2CO7B 3DVNA 2XICA 1ZLUH 1KJ2L 4KJPC 4XCYA 1KELH 5ITBL 4LKXA 1CFQA 5F1OB 1KJ2A 1YEJL 3KPTA 1F58L 1V3KA 4UB0L 4HF5H 1DLHB 4WJ5A 5C8JA 4P4RB 1NLDL 1FH5L 4DN4L 1T4KA 2D7QA 4M6AA 4Y2DD 4HWBA 1GZPA 1JWMB 1MVUA 4JZOA 1MJ7L 4IIQB 1SEBB 1BFSA 1KYOK 3LQAL 5IW1A 5F7HA 3NTCL 2CMRL 5FKPA 3SCMC 3ULUL 4XRCA 1FLRH 1OCWH 1K6QL 1N64H 1BZ9B 4JREC 5LGJA 3N85L 4HUVB 1YQVL 1KJMB 3EFFB 2UZXB 5E70A 5E56A 1S3KH 1SMAA 2EH7H 2YPLE 5B8CB 3HE6B 2FYYA 2A6JA 2IAMA 3QDAA 4JRXE 3D18A 2DQUH 2MQCA 5EBGA 3ME0A 4ZUWB 4MS8C 1WFTA 2HG5B 5IMMB 2LU7A 4PB9L 2AGJL 1JWSA 5IHZA 2DWDB 4IS6B 3VRJA 1NAMH 1NGZA 1A3LL 1UM5L 4Y5YC 3BJ91 3QCTL 1GGIL 3CLEL 1FAIH 4HEPG 3EOTL 1QEWA 4L8SC 4PJ9C 2HLFD 4L4JA 1N0XL 4BH7A 4ELKB 4NWUL 3VFMB 2YN3A 4MB5A 2BERA 3K1KC 3OKDA 4YPGA 2XG4A 3GBMH 4OKVA 5ADPH 1MIEH 1TXKA 4OV6F 1EX0A 3VWJD 1ZT1B 4LIQE 4N1HB 1L0XA 1KB5L 1PBYA 4HIIA 5IW6B 4Q9QH 1KB5A 1S7QB 2NW2B 5EOCJ 2XA8L 3WNOA 2NXZC 3VH8G 1EHNA 1AIFA 4JPKH 3MRNB 2F15A 4NC2B 2RHEA 3X14A 5GZNC 3GMLB 3PP4L 5SX5H 1UEMA 4D9LL 3IDMA 2UWEE 5BOZG 4OD1H 1MCNA 3ZTNL 4Y1AB 5DJ6B 4I9WE 3GMOA 4QHLA 3UX9B 1T5XA 2JCCE 1ZVYA 2G2RB 3HAEH 5K59F 5FECA 2CPCA 1JPTL 3MLZL 5FM4A 3MRQB 4N0CD 4QTHB 4NZDA 5JQ6L 3ZE0E 2ZUQB 4Z7OF 3MV11 1SJEA 4KK9C 5C2BL 5TE7H 4JRWA 2A6DB 4L4VE 4G5ZH 2VR9A 4KWUA 3V4PL 5J57B 4V1DD 1OAXH 2GUOB 5DI8A 4HJGB 3L9RA 2DIJA 2AJXH 2DQCH 3EUUA 5JA8B 4ZS7H 4C56A 5A2JH 3TPUB 1MI5D 3NA9L 1J18A 2XXMB 4UV4H 5EBLB 1KACB 2BJMH 4TNVK 4ZODA 3U6RB 2O5XH 3VRIB 3L7FA 4HBCH 1YEIH 1Q9OB 4FTVD 3MBEC 4HK3J 2W65A 4P46A 4ALAL 1JMXA 4HIXH 3O8XA 4XZUA 5CBEA 5EU6A 2GI7A 3FO9B 5FYKD 3UZEA 1WTLA 4NN5B 5HYJD 4UV7H 1CU4H 4PP2B 1XGQA 4ONGH 1HH9A 4MNGE 3T3PE 2R1WB 3GHEH 5TGBB 4X6CB 4MA7H 4JHWH 1TQBC 1ODAA 1WWWX 3PWNB 5J7CC 1UYWL 4F7PA 15C8L 2HT3C 4UOJA 4OCMC 1FGVH 4IRZH 4WUUB 1A6UL 5ERWB 1U6AL 4N5ED 4YC2C 4RNRB 2X2YA 5SWSA 2L0DA 1KCLA 4K3JL 3DX6B 3V79C 4WFEE 4RA3A 1ZEAL 4BQ8A 4PLKD 1N5AA 4X4ME 1R5WB 4TVPL 1JGDB 3BIKB 3GSWA 5LAXA 2OMBA 5B21A 1RJYB 2AAVA 3R4DA 4OUUA 1CTNA 3IT8D 5D5MB 1A6AA 3P73A 1TNNA 3WUWG 3BZ4B 4YO0B 2F58H 5MEOB 3ALXA 3JWNC 3ARUA 4OFDA 5A40E 5I1AB 1QFUL 3SGDI 4KZDH 3S9DB 1P4IH 1P84K 4NC0B 4URTB 3KPRA 3OG6B 5L9DL 1RK1A 5GS0H 2R1XA 3A6CL 4PRHA 1T1YA 5EIVA 1RZ8B 3GGWA 1NBZB 3T8XA 4HUWA 4J3WA 5DHYB 1CGVA 2FX7H 3EZ8A 5JPMA 2BY3A 4K8RH 4HIJB 3SGEH 5AZ2L 1MRFL 3BGFB 5IHUH 5DGQA 4X99B 4PJCF 1OGAE 2HWZH 3AXLB 1XFPA 3QO1A 5A2LH 3D5OF 2X4TB 5SWQB 4UQ2A 3CSGA 3MV8B 5I75B 4R4ND 5E5MA 1A6VH 3VG9C 3EGSA 3X12A 2EH8L 4BKLB 1JF5A 1U42A 4NOBA 1JJUA 2CGRH 3KPQA 5B3JF 1MCQA 3MOAL 1F4YL 4I2XA 2FHCA 4Y89A 5KAQF 1RZKL 2EDXA 4FFVC 4I8DA 2GY7B 1ZLSL 2ITDA 2R1YA 3OKNA 3O6FA 5DTFB 4P57B 3OJMB 2V17H 1ZWIA 5CEYA 4UTAH 5IESL 3QDME 1B4JL 35C8L 4LCCA 4PP1C 4MQSB 4HHAA 4YBHA 2F9BT 4YDLC 1X5ZA 4XT1C 4LEXL 2ARJA 4JDZB 1I1AD 1OD9A 3N9GL 1UB5B 2AV1A 3IFPB 1BVLA 4KROB 4XI5C 4WO4D 4ESKA 2HH0L 2HJKA 3FFCA 1J0ZA 3B6SB 2OTUA 4ZOAA 2APWA 4QWWD 1FVEB 1ND0B 2GW5A 3L3JA 2WV3A 5HHVL 3MLRL 2N7AA 1JNNH 3JWDL 4M1DL 4YHZH 4XPBH 3D69A 4Q7DA 4ONOA 3LKSA 4Z7QF 4GXUM 1RZKC 4PJBF 4JZNB 1IGML 5C2UB 1EAJA 1MPAH 5C0CA 2XN9D 2H32A 2OJEA 1A6TB 1KBGL 3FQTB 3W9EB 1ORQB 1BFTA 1WAAA 2ZUXA 2ZCLH 1AFVL 3P0YH 1U41A 2P5EA 4R90L 1QRNA 1CD1B 3L3HB 4H20L 4JY4A 2NY6C 1HEZB 3U9PH 1NGXA 2VZUA 4BFIB 3T0EA 3L95A 1JI1A 2VQ1A 3C6LC 5EFIB 3QDJB 3A67L 3P4MB 3V52L 5ALBH 5D1QB 1PKOA 4LGRB 3HUJF 3MJ6A 3WIIH 2YRPA 3VD5A 1UXWB 4OM0L 3JV6B 4HG4J 1EXUB 4U1MB 1BFVH 5JIKA 3WXVL 1W72A 3ZE1F 1VFUA 5CAYB 1MNUL 4O4YH 1X5JA 1DQQA 8FABB 4HPOH 4ODVH 3WV0A 3QNZA 3KJ4B 5HGAB 3D0VA 5ICZB 1OARL 5AD0A 5J1SC 2JCCB 3QUXB 4OIIL 5I74B 3GSUA 5TH2A 3C5JB 2P24A 4QY8A 2WZPD 1M7DB 43C9B 25C8L 3RL1B 3S36H 3C2SA 3TA3D 4X0KA 5CKGA 3VFGL 3MLVL 3LRHA 3JWDC 2G5RA 2F54A 3BZFA 5F9WC 4FNLL 1I85C 3BDBA 4DZBA 4DOHE 1OVZA 1MHEA 4GLRI 1ZGLB 3B2UD 4D9RD 5IT2L 5FDYA 1HWHB 2LFGA 1N6UA 2YPKB 3QQ9D 1M4KA 4MMZC 3SOBH 5ILTL 1MFEH 3GSQB 4LF3A 2H2SD 4DZ8A 1EBPA 3MPCA 5F9OL 5J4MA 3VGGA 1EVTC 5D2NB 5T5NG 1HZHH 1I4FB 3OAYK 2Y06H 3MRCB 1WT5A 5EOTB 1DQLH 1GAFH 2EC8A 5EUOF 5E9DA 3DMMB 3CH1A 3EDFA 1KIUA 2XWTA 1A7PL 5MEND 1KFAL 1R3LB 5DJDB 1DQDH 4PJIA 2F19L 1C16B 3TJHD 5DK2B 1RZJL 3RL2A 4M43H 2CKBH 3CVHB 5C08D 2FEDC 1MFAL 2UY6A 3KVQA 3O4LE 1TVHA 3HPJA 1QFOA 1AGEA 4EXKA 1UVQA 1KLGA 1UACL 1J1XL 1I7RB 2EC9T 3GBLA 4P5KA 4Y19A 4XAKD 4CKVX 5EOCL 3STBA 1DL7L 3KPLA 3QIBC 2HTLC 2P1YA 4KK6C 2JK5A 3VRLF 3QR2A 1AGDB 3IETB 3UC0L 4ISVA 4YQXL 4PBXA 3QEGL 2X4SA 3HE7A 2X09A 2EEDA 4CVXB 1ZTXL 4F7CB 3QQ3B 4XNXH 5EBMB 5GS1A 3FQNA 1ZHNA 4LLUA 1VSCA 3QIUA 1K8IB 3HFML 1KN4H 4K9EL 1HXMA 1ZT7A 1AO7D 1YUHB 1FYTA 3ZKMD 4NO3B 1ZANL 1VACA 5H94A 1FG2B 3UTSD 1TJGH 4W6YB 3LB6D 3LEYH 5A43C 5I76B 3RVWD 3PHSA 5TPWL 4C56E 1MRDL 3ARFB 4MAYA 1N6QH 1E6JH 4QRSB 3BEVA 4M1CD 2ZOKA 3C5ZC 4PY7A 5DS8A 2CLVA 3Q6GH 5CGYC 4F9PC 5MEPB 3HC4H 3UBXI 3TN0C 3BP7A 1QLEL 4R96B 3B9KC 3IDUA 4O2EA 2IALA 5EU6E 3SDYL 3F7YB 1NMAH 3LKQB 1BM3L 4ZOBA 5DHVH 3C5SB 1A0QH 1F11B 2AJZB 2BY0A 4G3YL 1IGIL 2LABA 4NM8L 4GJTB 3W5NA 3B9AA 5ETUA 4LQFH 5C7XH 1NC2B 5FYJD 2FGWH 4FZ8H 3LQMA 5C09D 2RR3A 4HV8B 1TQCB 1OAKH 5EORH 3HI6L 4YUEL 4YH6A 4LCWD 3GUTA 3DURB 3T0WA 5I16A 1CK0L 2H6PA 2NY3B 3MUY1 4OLXL 1UA6H 2E7HA 2JJTA 3QDMB 5SWSE 4G9FE 3WHXA 3QCUH 2QV2A 3ARBB 3MRHA 1E27B 4KKCC 1IGCL 2AEQH 4X80H 1NKRA 2K7PA 1RK0A 1NMBH 1GGCL 3QUYD 3ZKXC 2V7HA 4OGZA 2LVCA 2Q6WB 4OI9A 1G7LB 4F7EA 1R5IA 3REWB 1KCUH 2RGSA 3BP6A 5ESAA 3KDMB 3UZQA 3L1OH 1XZ0B 1YEFH 4NHUB 3IKCB 3P77A 4PG2A 1A21A 4ODTL 1T7ZA 4YDJA 2ZOLB 2C7UA 5ELIA 1ZK9A 2XQYG 1NANI 2GITA 3RGVC 3KPRE 3WJLA 2C3WA 4G6FD 5ITFB 5J12B 2XTJD 4MD4B 2Y5TA 4U1IA 1N3NB 5JHDD 1G7IB 4MD5B 4D0CB 4ZUTA 3KR3H 4XTRD 5ICYA 2IFFL 5EN2B 3RKPA 1JPGB 1TENA 5ISZD 4CDHA 4LCUA 3PV6A 4Q6IC 3LD8C 1R24A 5B4MD 5INDA 4JR9H 3S3SA 3BDYL 4Y4KB 1A1NA 3O9WC 4RMTA 3SDCB 3IYLW 5DSCA 3D39E 5F72S 5GXBB 4L8CA 4P5TC 5DFWH 1R0AH 3CFCL 5I18L 2BVUA 3LRSA 1UB6B 4EN3D 1NSNL 4I2XE 3O41B 3O4OB 4Z7UA 4K7FA 5JA9A 2ADGB 3FQXB 1RULH 4UUJB 1DN0B 1D5IL 3C08H 5DMIL 1A14L 2G9HB 1N6VA 2R2HA 4HIHA 3I50L 4MDJB 4WEMB 1R3KB 1TIUA 2ATKA 1VFAA 5E6YA 1CDUA 3ILPA 4MJID 5EC1B 3SKMA 1UJ3C 4KQ3L 4JDVB 1Z9MA 4NQTA 3QJHA 4F33A 3AGVA 3CZFB 4P2OD 1VA9A 5IMLB 4I0PC 2WM0A 3GZKA 4RFOH 1J8HD 2E7BA 4G8FA 3BZEA 1C5BL 4Q9CA 5KOMC 2NY4D 5CD3B 3MCG1 1H3UA 4P2YA 3TBYA 1MUJA 3SDAD 2Z4QA 2ARJQ 1I1RA 2NTFB 3Q5YA 4G6AC 3OXRA 1IL1A 4DOHB 2CRYA 4LOUC 3FFCE 2IAMB 1IKNC 1U9KA 1F58H 4UB0H 4QXUL 2YPVL 2BNRD 3HMXL 4WY7L 1JPSL 1NLDH 4IOIA 1FH5H 3LPWA 4CMHB 4DN4H 4HWBH 1FFOA 3HMXA 4PJEA 4WFGE 1YNTA 3L7EB 2EIBA 4LSPL 4HUKB 4LLWB 4ODSH 3U36B 3NABL 4UT7L 4ODBD 2XYCA 4YNYB 4LLYB 1IZKA 4M9OA 4M02A 2DBLH 3U0TB 4JG1H 4ZNEE 4YXKL 5EBWA 5T3XE 3LQAH 1L7TH 1EZVX 3N85H 3WIFA 3WO3B 1EDQA 4KJWD 4OI7A 3QIWA 5C0CE 3RFZC 4XC1L 3KPSB 4Y4FB 1WAAE 1IM3B 3CSYA 4CVZB 5IFAL 1NFKA 2P5EE 4HS6A 3RNQB 4F9LA 3ARVA 1QRNE 3O4LB 4NN6B 4Y2DC 4C59B 3T0EE 2C4FU 4G80B 1GYAA 3RUGE 1WBYA 1FJ1A 2E9JA 1ZT4A 4NRXA 5DA0B 5EG6C 4ERSH 3SJVD 1PD6A 1ZE3C 1QNZH 3QCTH 2Y1VA 1Q9WB 1F4AA 1T0MB 2PYED 1UH2A 4XMKL 3BE1H 4O5LL 4EDXA 1JHLL 4LRIA 3UBXG 1MCJA 2HA1A 4TYUA 1DQML 3GMOB 3HUJB 3NACL 1K2DA 1NUFA 2BHYA 4Y5VA 1BGXL 3EDEA 3C6SA 5HHQB 4JDTH 4NQXA 2Z31D 1EHLL 2YA2A 1OPGL 1KB5H 4J3TA 5KS9A 1U93A 1FGNL 2F54E 2IGFH 4LASL 1CXEA 1CVRA 4RBPH 3P11H 5DI8B 1ES0A 5DVMA 3TVMD 5I73B 3L9RB 5IR1A 5E8PB 1LWRA 4V1DA 2P8LB 3FO1B 3PP4H 1ZLVH 4PGZA 5DVNA 4TRPH 1DBJL 5DD6A 4JO2L 4MAUL 3FB5A 3T09A 2B1AL 3CX5J 4JANB 4NYLA 5T1DH 2I9TB 1MI5A 2HP4A 3F7VB 2WINB 1KIPA 4WEBL 4JFFB 1QACA 2NW3A 2FJHB 4WU5B 5DK0B 2EXWD 3UTTD 3VWJC 3PL6B 3ZDXE 5JQ6H 1WWCA 1T3FB 4GAFB 2BVOA 1WISA 4L4TA 1MHHA 5E8DL 3CFJA 5E9DE 4HXAL 4E41A 3PNWA 1JL8A 1JK8A 5FYKL 4H1LA 1U91B 4LQ1A 3TIDB 5D7JD 1N8ZA 2CKNA 3KWWA 2YMXL 4KMQA 4XVSL 4C58B 4N0RA 1JZ4A 1MCBA 3G5VA 3AC0A 2OS7A 1YECL 5ESQA 4MXWH 1U8JA 3QYCA 2HVKB 3UAJD 1E4XI 3MNZA 4Y19E 1NAKL 4HGMA 2HFGL 4JQXA 4G9FB 1W0WA 3IDXL 4ZFFA 4OZHE 1U8KB 5HYFA 4XP1L 4ODUB 3X3GL 2RFXB 3GSWB 5DA4A 2G60L 4JLRA 4YWGL 1EH9A 3O3DB 4YXHH 5A16B 1FYTE 1R5VA 5JPNB 4R4FH 3HZYB 3L3OA 4DW2H 1NGQH 1OSPL 2DL2A 4ZYKA 4DKFH 4D0BA 1OP5K 1QVOB 2P7TB 3K8MA 2IG2L 3GGWB 3LAFA 3FQUA 1EFXA 3RWHA 3VXOA 5JHLL 4K3JH 3HI5L 3SQBA 3HR5B 1QBBA 3WEXA 1EAPA 2IH1A 3FONB 1ZEAH 5IB3B 3UPRA 2VLRD 3N1QC 4ONHA 4TSBL 4TVPH 3MOQA 3BPOB 1BQUA 5CJXC 3S36X 1P1ZA 4D94A 3GNML 2HAZA 3VXQB 4HUXB 2CR6A 3D39B 3KS0H 4PJAF 4U33A 1PKQB 3IAGC 3L3IA 4P2RB 2D7NA 5E5MB 4I3RL 5I8EB 1Z2KA 3VXUD 1CWVA 1QFUH 3CVIL 1J1PH 4Y4HD 1D5BB 4FQXD 5ID0B 3KPPB 2ADJB 5DD3H 3QRFM 3R0MA 4OD3L 3RX8A 1RJLB 5F7MC 2V6HA 5HHMD 1XF2A 2O5YH 4E42B 1OWRM 4K3EH 5AZ2H 1JCKA 2KH2B 4UU9B 4AIXA 1ZWIB 1QBLL 3BHBB 1G7HA 3EOBB 1N7MH 1MAJA 3H9SB 4G7YL 1TFHA 4UAOB 2FLBT 4Q97A 1S7WB 4ZPTA 5D70L 1G7JB 3WNMA 5CEZD 5BS0A 3MMEB 7CGTA 3VXSD 5HY9A 2PKDA 1T21A 3U46B 4JPVL 3KPOB 5IEKB 4PGCB 3L5HA 2J4WL 5L7XL 1WQVT 4J6RH 4GFTB 1PY9A 2XZAH 5IJVB 5KTEL 5CINH 5IMKB 2E7LC 3FFCB 1Z5LB 2BNQA 1JRHI 5HTSA 3VMNA 2X1PA 4WO4A 5C86A 3DO7B 5F89B 5F21B 3SQOH 3SY0A 4NGHL 4S0TD 4M7ZC 4KVNL 5FHAH 3RWGB 4M5ZH 3RTQD 4D9QD 1TZIB 3ZKSD 3DROA 4UQ3B 5FGSA 2IAND 5GISH 4POYA 1IAIL 4A2LA 4GW5B 3DX9A 2G5BB 3DECA 4ZD3L 4XXCA 1NGPH 4KRLB 4LVNC 1A1OB 3N9GH 5FO7B 3TCLA 4NQEB 5ICXA 5I1JL 1HSAB 2EKSB 3O81A 4P9HH 3VH8A 2HH0H 4KHTH 3MRKA 3HZMB 4UDTB 3JVGA 3O6KH 3S37L 3BRGC 3DHMA 4M6MH 2FLRT 3S34H 4ELMF 2YBRA 2GJJA 2F74B 3OZ9L 1ZKAA 2EECA 3GIVB 4RGOL 3GMQA 3RUGB 1WC7B 5HHVH 3LY6A 3KYKL 2VDQL 4M1GL 5T3XH 1PSKH 1XEDA 3H8NA 5DJZA 4XCCH 3S35L 1DE4A 4AM0A 2HRPL 2WLZA 4WW2C 4NO2B 3GBNL 5IG7A 1P7KB 1DQQB 4ORGB 3WFHA 1T0NA 3AREC 2H32H 2JB5H 4XBPA 3P9MB 3BPNB 1LO4H 3BUYB 2XZCH 3TBSB 1L7IH 3PHQA 1CCZA 1JTOA 2NY0D 2BC4A 1VGEH 3BZFB 4H8WL 3V52H 3MLYH 3Q2CA 4LKCA 4PGJA 3LDBC 4NFBA 1U58A 1T1XA 1MSPA 1U3HA 1W72H 1G1YA 4LDLB 3RPIA 3SKNA 1EPFA 5GIRB 3I6GA 5HDOA 3VFSB 1MNUH 2MJWA 3ZYOA 1MCIA 4PJEE 1GGUA 2E7CA 2P5WD 5C0ND 4CMMA 1GGBL 1S9XB 1Q9LA 1G6RA 1SM3H 5BO1L 3WFEL 4NC1C 4X9BA 1K3ZA 2GK0A 4RGNC 5GGSB 4CADB 1F4XL 4NHCL 4H0IA 1IAOB 5D72L 1JGVL 1PYWA 1KC5L 5FB8A 12E8L 4HC1L 3MO1A 4LSUH 1Y0LB 2M1KA 2DAVA 4QRRA 1W2KT 1NC4D 3RI5F 3B9EA 3IRZA 4KJYB 4MDIA 5IT2H 4QRTA 5T33L 2QQNH 3V4UH 1AGEB 5F9AC 3UYRH 1FIEA 1Y18B 4PJ9A 4Q9RH 2K7QA 1NGWB 4Z7WA 4GBXD 1LEGB 5L88L 4HMEA 3D85B 3PWPA 1LE5B 3ZSTA 2DQGL 4NBZB 4P23D 4MJ5B 4GG6A 4X6DF 3RJDA 2FSEB 3QPXH 2JK5B 3WUWA 4H8WC 4OZHB 4HK0A 5ESVA 1DUYB 5CS7A 1EIBA 3BWAA 3E2HC 3O11A 3MJ7A 1A7PH 1EHAA 5I66A 2F19H 1RZJH 3RWDB 1IEBB 1Q1JH 2UV3A 4NNXB 3DBXA 3B2UC 2JF1A 4WI9A 1T20B 1IEHA 5EOQH 4NPYB 3QQ9C 4XAWH 1B3JA 1YEGL 3H42L 3FJTA 1ZT7B 1R3HB 1IGYB 2EEAA 4OF6A 3GI8H 2H2SC 2P44B 1BLNA 1A47A 3BIBX 3MZTA 3P4NA 5E8EA 1F4HA 1IARB 3FT3A 4PRIA 4OLZH 5HYSB 4N1EA 4OZIA 3STZA 1NCAL 1RV6X 3W2DH 1FZJA 4XX1E 3EO1A 2BXZA 4ZUVA 4TNWF 1DL7H 1S7UA 4UI2A 1LE9A 4JRYA 2EYRA 5DD0L 4PJDF 5KVDH 4MLIA 3SO3C 2B4CL 2YOCA 5ADOL 1NL0L 2ZOKB 4L5FL 4YQXH 3TJHC 1SJVA 4ORZC 1CFBA 3QFDA 4U49A 5I1EL 1T2QH 5EPMA 1N59B 5D6CA 3MRPB 3UDWC 4L4TE 2EIDA 4K9EH 4E41E 1FQ9C 1Q0YL 3DUUB 1FZOA 4ZUSA 2X4RA 1ZANH 3LKNA 1Q94A 4Z0XA 1INDL 3OB8A 1I7ZB 2OJZL 4L9DA 1FV1B 1BQHB 3BP5A 3T4AB 1O5DT 2G75A 1MFCH 3GSNL 1WZKA 3GSNA 3RVTC 5TPWH 1TJIH 5FYJL 1AJ7H 2CJUL 1T2XA 5KVGL 1ZVSB 1TCRB 2DQEH 1RIVL 2B2XL 2H6PB 1V7NL 3FFDA 2AEPH 2VAAB 4ACPA 1WCQA 2VR4A 3IS1X 2WIIA 1V8HA 3SDYH 5C6PB 3RY5A 4JM2D 4PBVC 2B0SL 2R4SL 3C60B 5HI5C 4ZTOH 2J8UA 4NDMA 5HJ3A 3LB6C 4G3YH 4L1DA 4CDGC 5LGKA 1JNHA 3VXRA 3CXDL 4ODHL 3G5ZB 2H9GA 3RVWC 3BP6B 2I24N 4YE4H 3PV7A 1EBAA 2Q8BH 3VMOA 3AB0C 2DMBA 3ZHKA 3OF6A 4M1CC 3TPKA 4G8GE 3BPCA 4YDKL 1TLKA 2GITB 5EZLA 4WWKB 3B43A 1MJJB 2IJ0C 4ZFOL 4JJ5A 4CGTA 4OLXH 3WJJA 3C8KB 1V7MH 4ZFOA 2J6EL 2OQJB 5FF6A 3CSBA 2J6EA 4KTDH 5DUML 1BZQK 2BVQB 3RZCA 3G04B 4G8EB 4LCUB 3QT2A 1HH6A 2FBOJ 2NR6D 1YEDA 1R24B 1J0JA 5ISZA 5JXEC 1AP2A 4IEFB 5C0BB 5KOVC 3DV4B 4Z7NE 4KTYA 4Z5RA 1FCGA 1JGEA 1PQZB 2JE8A 4KC3B 3CK0L 3ULVD 5GS2D 3TM6A 2DI9A 4KKBD 3C8HA 5GRZA 1J87A 3T4YA 5GHWL 3VWKD 1BQSA 1N2RA 3ECBB 3HRZA 1P84J 3Q1SH 1CDHA 1JV5A 4UNVA 3OKKB 4KKLD 1CIDA 5T1KA 1TZHB 4PJAB 3K3QA 4JN2B 4NUGL 4XPTH 2ATKB 1A2YA 5D7LA 2OK0L 5J11B 2O5ZL 4GG8A 3DI3B 1MVFA 3N1PC 1J11A 2OYPA 3IJHB 1H5BC 4R0LB 3LPGA 3BDYH 4OZ4A 3PGFH 1MLBB 1R3IL 4IRJB 5TFSH 3G6AA 5KSAB 4NQCB 5H2BB 4JHAL 5DFVD 1F90L 1ZVHA 3JWOL 2MHAA 5FYKU 4P2OA 2VXVL 3Q3GB 3B4NA 5DMKA 5H8DA 5BS0E 3MUZ1 3HTLX 1AXTL 2XTJC 4U6XA 3R06A 1HHJB 1T5WB 2X70A 4AIZA 2P8MA 3C9NA 3TBYB 2VDNH 1S5HA 1FCCA 5D7SL 2Z4QB 1IGTA 3DVFA 4UT9L 3ZKQD 2DL9A 4XTRC 3NIFF 5C0FA 4FS0A 4I48A 2VR5A 4Z0BL 5B4MC 5I19H 4P9ML 5F93C 4RRPG 4KQ3H 1TETL 2PR4L 2VLJB 2BNRA 3V7AE 1NEZB 1MLCB 3J8F7 4MXVF 5DUBA 1HWGB 3VFUB 3WSQH 1DBAL 4DUWA 5E5UB 1KPVB 3PDDA 4HH8A 3ALPA 4OFPA 4FQIH 2LV4A 2EDEA 3WMSA 2IPUG 3QFJE 4ZDHA 1FC2D 1JF1A 2X4QB 5GRWA 1FNHA 3V0WL 2ADFH 1HILB 3X17A 3TNMB 3LSOB 2ZG2A 4NKOA 3W0WA 3BPLB 4MCZB 5AZEL 5C3TA 5TDNA 1UM6L 1JHKH 3HMXH 1XCQB 3NZ8B 4LSPH 2R2BA 2H41A 2J1KA 5DC4B 3QDGA 4OLYL 2HTKD 1C7TA 3VG0L 4ELMB 3SJVA 2NY4C 4XMPH 5KG9B 1U8NA 2EDKA 4D3CL 3WDJA 1VADB 5GRVK 3ULUF 5C0GB 5EU7E 4GRLD 4FFWD 3SDAC 3Q6FB 3FQRA 1BVKA 4UILH 5I8CA 1QPPA 4PIRF 3C6LA 1S7SB 4PRNA 3BSZL 4LVHB 1T66D 4WV1A 3CC5A 1LP9E 5DQJB 5KVEL 5DRWA 3IDJA 1CT8A 4PJFF 3STLA 1BZ7A 4U6TA 5MHSE 1U8MA 1JYXA 4ZO8A 3ARDD 4FXGA 1AD9A 2OTWA 2VUYA 3TO4D 2AJYL 4XPAH 2GCYA 3IAQA 1DBMH 4NO5B 3V6ZB 4KJWC 3T3ME 1OAZL 5BV7C 5IVXA 2I07B 3M17A 5F1IB 3MCLL 2Q3AA 3V7MA 4PJ8B 4YPJA 4BSVB 2XWJA 4PRPD 2RCSH 2FEEL 4Y5XC 2CDGA 4JFDD 1BX2A 4TUJB 5KSUB 3CFJB 4XPGH 4E41B 1FGNH 1BEYH 5DJYA 2FL5A 3QJFA 4Y16B 5GSVA 1AGCB 1BBDL 4ZTPL 1DQTA 3HI1A 2DTMH 3MREB 4JO1L 5T1LD 1CDYA 1EO7A 3NPSC 2BVYA 2D0FA 1H3PL 4U1HB 5D7KD 3GMNB 5IUSA 4RBPK 4BA8A 4Z7WE 2GKIA 3WL9B 1B0RB 5ECJE 4PGEA 3MNZB 4NWTH 1ZLVK 2DI7A 3IB4A 3HB3D 4P4KB 2Z8RA 4PG9A 4X6BB 2Z31C 1HHGB 4WHYG 2W0LA 4OCSL 4GG6E 3QUZD 3U7WH 1T80A 1YNKH 2WQRA 4PS4L 4YHOH 4H1LH 4MA1C 1HYSC 1WFNA 1FNAA 3NFPA 1J0KA 1RURL 3NCEB 4EI5A 1XGUB 3E8UH 4KAQL 1FZMA 2FRGP 5E4EB 3UTQA 4JLRB 2YMXH 4HBQA 1R3JB 4XVSH 4X6DB 3UO1L 4MWFB 4UDUB 1YECH 2PXYA 2YSSB 4FN0A 1FL3A 2OSLA 2KQMA 3QNYA 1ZHLA 2KPNA 2EXYD 4G8GB 5IV2A 3ARGA 2XRAL 4NQVA 4PRIE 5C07D 2EDWA 3I84A 4OZIE 2A9NL 2R56H 2WWMD 3S4SA 2EXWC 1ZA6B 5L2JA 1KCVL 4YGVA 4KGLA 3IDXH 4JRYE 4KUCF 4WNQA 3WEXB 3C2AH 3PGCA 2ICWA 1I75A 4ZXBD 4F57H 3X3GH 1UWGH 1OWWA 2G60H 5KSVB 5D96C 2AV7B 3IJSA 1BF8A 2ESVD 1YN7B 2R8SL 4NN7C 2NY5L 1A7RL 3S88H 2DICA 4PJDB 4PREB 1P7QB 1PEWA 3A6BH 4OGAD 5FUOH 2HN7B 4OZFA 5D1XC 1ZSDA 5IFHH 2R0KH 5DD5H 1FFPA 1YYLL 2CUIA 2VSCA 1U2HA 3HE6D 2PTUA 4Q6YA 3ILQD 5AUMB 2A6IA 2EYTA 3GMMB 2IG2H 4FQHA 3UTPE 3C5ZA 1ADQL 1JNJA 4FQXA 2VITA 4OT1H 3OQ3B 3PWLB 5SV4A 3KLHD 3SGJC 5D7IE 4R7NA 4M7LL 2C1OA 5HGHA 1A4KA 4WDIB 2FJFB 3MJ9L 3P40A 4A2MA 8CGTA 1HQ4B 1MREH 3GNMH 3CFBA 3BKJH 5GRJH 3MJ9A 4JFEB 2BDNH 4MXQD 3FOMA 4W70A 5MI0B 2FWOB 1RUKH 3RWFB 2VYRE 5IF0A 3MV9E 4NRYB 1Y6KR 4LEOB 2OTPA 4L3ED 4M62L 5IGXH 5BZDA 4YEFA 1WBXB 4GSDL 4BM7A 3MGTA 2HKHH 4X5XA 1MH5B 3T77A 3U4EB 1U8QA 5FOJA 5D1ZB 2VERN 4OLUH 1DUZA 4L9LC 1K85A 3AU1A 3MRDB 2BSSA 4JN1H 3F12A 4X4YA 4NNYA 5DVKA 3EYOA 1EZVY 3DROB 4UINL 5DQ9B 5TQ0L 2MCG1 5CGMA 1EEYA 3I85A 4Y4HC 3RTQA 3DHJA 2J8HA 3QFJB 1KTDA 3LOWA 5CWSB 5TQ2H 5KVFH 5GJSL 4F58L 3BMVA 1IGFH 5ANME 3RGVA 4JPVH 1SMOA 2PW2A 4P3DB 1F8TL 2ZPKL 3RA7H 3MNVA 3QWQB 2J4WH 5FOBB 4HWEH 4ZO7A 4ZAKA 2DQHL 5E8NA 3OV6A 5I15L 3GSRA 4LHUD 1NUGA 1S7XA 4U1GC 1Z3GH 4PRDA 4QF1B 5F9JB 5HGBA 4KI5D 3ZYJA 3RDTA 2Y9RT 1UZ6E 3O9WA 1BJ8A 2KL6A 3N06B 1QO3A 5D7LE 5DJZB 3T1FB 1U8PB 4DVRH 1DE4B 3LKOB 2NNAB 2Y6SD 2ZKHL 5CMAB 3FRUA 4J12A 4Z77A 2HFTA 4RISH 2NY2C 2FR4A 3AS1A 1VFBA 1AR1D 4TTDC 2V2XB 5GGRB 2IQ9L 1NDMB 3WIHL 3RNKA 3VFTA 4U2ZA 2VIRB 1TQCC 3QUML 4M8QA 3IXTA 1SYVB 1RIUL 5EZOL 2FX9H 3QUMA 4EI6B 4N90D 2NY3C 1A6ZA 2CIKB 4I5BA 1LP9B 1CFTB 2AXFA 1ZGLP 4KTEH 1EVUA 1HHHA 5LQBL 3ARBC 1AY1H 4PRAA 1RUQL 1UJ3A 3ARTA 4HFUL 5E2WH 4EOWL 1QQDB 2NX5B 3W9DA 2VDQH 1KTKE 5SWZD 2OX5A 1T1XB 3W39B 2Z8SA 2R4RH 1QSEA 3VFWB 2P8PA 4I0PA 5ACZA 1DVFD 2ZCHH 1A8JH 5IOPA 2NY1C 4NO0A 5GS0D 2RIKA 1CE6A 1XGTA 3SCMB 3MJ8A 3VFNB 4JREB 2DYPB 3AMLA 1QA9B 2GK0B 3AVEA 5F7DB 3LN5B 3TJEH 4AG4L 2V5TA 5A3IC 3HR6A 4LSRL 3GFUA 1A5FL 4K8RD 1C12B 5J12C 3MR9A 1KCRL 3CDGB 3OR7A 2KKQA 1IQWL 1MEXL 1A7NL 2K1MA 1NCUA 4XNQA 4U6HA 4PYHA 1F3JB 1RHHB 3NOIA 1CXIA 4JFQA 5H35A 2AS5M 4KDTC 3W0WE 3MRMB 1KCSL 1AHWC 1DANT 3PXHA 4PD4J 5DMGD 2XY1A 4Y5YB 1CFSB 1YMMD 1G6RH 3IF1A 4L8SB 1YA5A 4WTZG 1QSFA 4WI5A 4HUUA 3WFEH 4KRMB 2I60H 3BFOA 1U8LA 4CW1B 5B38G 1KIQA 1CLYL 5DDHA 5GGTA 4JFHE 5I1IL 2KDGA 2PW1A 3QEQD 5D72H 1B6DA 2O61B 2VLKD 2NY0C 3WUWB 1OY3B 3NCYS 5E6IC 5I66B 1M71B 3DX8B 3EZJB 2W0FA 3EYQD 4AYFA 1L0QA 1A9BA 2HT4D 2NXZB 4BSWB 4N0FA 5DQDH 3BJLA 2DLGA 5T33H 1XH3A 5CEXB 1C1EL 1BLNB 2WBJA 1EA9C 3P4NB 1XIWA 4RCAA 2J7LA 1UT9A 5HHPB 3FN3A 1CG9B 3L5XH 4OZIB 2IQAA 4P2QA 3MLXH 4NQSB 3WFZA 4JQVC 4OLVL 4MA3A 4Z7VE 2ICES 3OL2A 4U1JA 4JRYB 5H37G 4PJFB 3HZKA 5IVXE 3QG7H 2FD6H 4N1CA 4TSAH 2HJLB 4PJIF 1XF4B 3E3QC 2R29L 3MODL 2GAZB 3HZVB 1J1OL 3TZVA 2ICEA 4QTIH 1I3VA 1P9MC 2YWYA 2EICA 2IADA 32C2B 4GBXC 4ZNCD 1BD2A 4KROD 2YPLD 4OIAA 4MHHI 4M00A 3MRBA 4UIKH 4P23C 1RZGA 1T7YA 4FQJL 2BK8A 1MJUL 3D1MC 4JRXD 5JO5B 4GKSB 1SEQH 3CLFH 5E6ZA 1F4WL 1AQDB 4PGDB 3T1WA 2GJ6E 5D7IB 3MBEB 4FFYH 4YEEA 5FYLE 2B4CH 5CSZB 4OCXH 3TWCH 1DSFL 5DD1L 3BAEL 3KPMA 4L5FH 3MV7B 3JXAA 2ATPA 5I1HH 4N9GA 3SBWC 1I3RA 3CFEB 2EDDA 5I1EH 1KENL 1HKLL 3X11A 1HKFA 1KPUA 3C09C 3BW9B 2BNUB 2F5AL 4YDVA 3DXAA 3IGAB 1HNFA 5AWNL 1IGJB 1LO5A 1TQBB 2HKFH 3R8BB 5DJXA 3EBAA 1M6OB 3MV9B 1M7IA 3OXSA 3S96A 4X7SL 4EJ1C 4YC2B 2AXJA 1FNEA 3VW3H 3BPCB 2EE3A 4L8BB 5KVGH 5HDQL 5EO1B 5D1QD 3BRFA 3SO5A 4EBQL 2B2XH 3RWIB 2WUCH 3MUGA 3NIGF 4YHNA 1GOGA 3SE9L 5B39B 1JGUL 3S5LA 4KHXH 43CAB 2FECL 4LU5H 3KXFA 4HD9A 4PGBA 4DVBB 1VGKA 4XGZA 3DRQA 5ANMB 4UZGA 2MQ3A 4OKDA 4N5UA 2IMMA 2VDKL 1JGEB 5ID1A 3IFNL 3RY6A 2F53B 4L4VD 1HOCB 4P49A 4ZPVA 4EDWH 3ULVL 5DMJB 1TTFA 3G6DL 4KK8D 1N2RB 3UJJL 3HRZB 1Z9OA 4A6YL 3BXNB 2FIKA 3WS3A 5I1KH 3DV6A 1N5YH 4IRSC 2A77H 4RMRA 4PJGF 4LPWA 3OAUL 3O2VH 5F70A 3S6CA 2J6EH 1GSMA 1MCFA 1L6XA 4LVOC 5DUMH 4JM2C 1UKQA 3SDDD 1CLZL 3TBVA 1T04A 1DEEB 2VE6A 3I75A 3VG9B 4L29B 1OB1B 3RWEB 4CUCA 3RRQA 4GQ9L 5JUEL 1H0DB 3SPVB 4PLJD 4C83B 2EDRA 4YHPA 3DMMD 3CK0H 4JCMA 4CU7A 5LGHL 2ZSVA 4GAGH 5GS3A 1B9ZA 5DMKB 4APQD 4XP6L 1S9WA 1ZHBA 3H7BB 4JPWL 3HC0A 4U6XB 3ROLA 2X70B 3BYYA 3D9AH 4U6VH 4FABH 4Z8FL 1HXYA 2VC2L 4M3JA 4QKXB 4RX4D 4U1NA 1G9NL 4XWGH 1FNLA 4Y7MA 1CGYA 2EDQA 2OK0H 3IDYC 3FT4A 3HNTL 1PY4A 3FRPA 4YDLB 4PJXA 1UC6A 4FQCL 3I02A 3W5MA 2E27L 2VXSH 3DUSA 1AKJB 2AVGA 1ZS8B 5HVGB 1F90H 4KKBC 4RMSA 3PWVA 4WFED 4JO4H 1LEKA 3VWKC 5E1AB 3QUKA 4TQEL 4ZDHB 1JF1B 1QD0A 1RVFH 5GGVY 5JIHA 1AXTH 4KKLC 4B7IA 3HG1A 4YZFE 4Z7UF 3P0GB 4BZ2H 4R3SA 2RQ8A 4KRNA 5F96L 5C0EB 4N8VG 2P43B 4HKBA 4XH2A 1RFDL 3X13A 1HIMH 2HVJA 4OZGF 5I1DA 5FA4A 5JDSB 1LEIA 4JVPA 5DFVC 5E7FA 1DBAH 3UMTA 1P4LA 3P3YA 5K9OB 5DRZA 2ZP0T 1P2CB 3QBTB 3SGDH 3NZHL 3DX7B 2VXUL 2NLJB 1IILE 3UZVB 1OGAD 2GT9B 1WEJH 4HKZA 3PIQB 4LARH 4U1SA 2NY6B 3KAAA 3OWEA 4GRLA 5BVJB 2YC1B 3V6FA 1I1YB 3C6LB 1CICD 2CSPA 2FO4B 4MNQA 2MSPA 1KPRB 1FLTX 1ZXQA 3TNNA 3VFPB 4MHHG 1WJ3A 3FCTA 2VDOH 2VMFA 1YPZF 5DRWB 5T3ZL 3GB7A 4WW2A 1TVBB 3BDXA 3IFOB 3ZT5A 3H6JA 4Z78A 1UCBL 1Q8MA 3RKDD 4YHLL 3AREA 1I9IH 1SVCP 1U95A 3VG0H 4KVCH 1QSEE 4DGVL 4Z7VB 3GJFB 4D3CH 5L2KA 4YIQA 3UTZA 1YEEL 2X1OA 4NQUA 4KUZL 5DRNB 1CLCA 1IT9H 4TUKL 4MCYA 5DHXB 5F9WB 5I71C 2C3VA 5BQ7A 3GJEB 1ULVA 1BAFH 4S1QH 1OAQL 2YD5A 1X5GA 3MA9H 3CCHB 1FDLL 4JZJA 5KVEH 1YJDL 5DJ2B 1S7VA 4KY1L 2Y36L 5FHBL 5F97E 2X1WL 2DQFA 3KNBA 5E94B 1DDHB 5D6DA 5C9JA 1XMWA 5K9KA 4KMTH 4GW4B 2EKJA 4MSWA 4U3CA 4IHOA 1DQJA 4FFWC 3BVNB 2GJ6B 4OF7A 1OAZH 5GGUA 1FFNA 4JO3L 5TF0A 1QSFE 3BH9A 5EU3B 3K2UH 4JPIA 4J3VA 3GO1H 1WCBB 1QFWH 1KELL 3QEHA 1CDCA 1LDPH 4S10A 3NBNA 5HHOD 4BSJA 5I17A 1S9VA 5KSBA 4HF5L 4Y4KD 3HPLA 2H2PC 4JFZH 5KS9F 3SDCD 4QRPA 2ENYA 4BELD 3NFPB 3QUZA 3DRTA 1FSKC 3ARDC 2EDJA 3GKWH 3TO4C 4H5SB 3UTQB 4HQQH 3CMOH 3WLBA 4JO1H 5D2LA 5FCUL 1FPTH 1H3PH 2JTDA 1EUUA 4MB4A 5FYLH 2HMIC 1FLRL 1OGTA 4N0UB 1OCWL 3QIBB 1N64L 3E6FA 4NCC1 4OTXH 4I77H 5E00A 5BW7C 2JJSC 1YEHH 4P2QE 1JTPA 5DURB 2NCMA 1S3KL 2EH7L 1H8SA 1JYWA 1D9KB 3VI3E 2YUZA 3AFLA 1OL0A 1X4ZA 5C0DA 1DLHA 2R69L 1EUTA 2EE9A 3GMRB 1RURH 1WWBX 1JWMA 1S8DB 1RJZB 2Z8WC 3DSFH 5DWUL 3ZDYF 4IIQA 5J9PB 3CDYA 1NAML 2BY2A 4NQDB 4FMFA 1SEBA 3IDIB 4JHZA 3UO1H 3RVXD 4YX2H 4MJ6A 4NBXB 5F7EH 1Z6JT 1BZ9A 3ZE2E 2EDFA 1BD2E 3HB3C 1KJMA 1IZJA 1V5JA 3EFFA 2DQTH 2IAMD 4G7VL 5EA0L 2AQ1A 3C5ZB 5B8CA 3HE6A 4OBRA 3GBML 5F8QC 1MIEL 5IMOB 2FZ3B 3TN0B 3RI5K 3B9KB 2WBKA 2DN7A 4R4BA 1RMFH 4ZUWA 4Q9QL 2HG5A 4HLJA 2X5PA 3B2VH 5DLMH 3LV3B 2X9WA 4KDVA 4IS6A 2YZ1A 1YY8B 5LWYL 1A7RH 4GLRH 5CCKH 3TT3L 3DXAE 5EB9A 3BGAA 1U8OB 2WWMC 5DUPH 3VFMA 2BFVH 5KZCB 2YD9A 4ZFGH 1X5XA 4P99A 2YXFA 7FABL 1HCFX 4ZXBC 1ZT1A 2KUTA 1V3LA 4JE4B 5BXFB 1DUZB 4YJZL 5IW6A 2A0LD 4LAQL 2DF3A 2NW2A 3ZKXB 3MJ9H 3SKJL 1OAXL 3MRNA 4OGAC 2DQCL 1A1MA 3KXFE 4ZS7L 4JFYB 2EE2A 5TDPB 4G6JH 1F3RB 4YHKL 4Y1AA 2BJML 5DJ6A 4WUKL 3ARXA 3CU7A 2O5XL 2PW2B 1YEIL 2G2RA 3KLHC 4GSDH 1B88A 3MRQA 1T83A 4QTHA 4HIXL 2BHZA 2MWCA 5F88B 2A6DA 5CZXD 5HGBB 2L7JA 3N1FC 4Q6IB 3VI4E 1HQRB 3LD8B 2VDRH 3MBXH 4ONGL 2E9WA 5JDJA 2GUOA 4KFZC 4C56D 4WCYL 3UBXB 4NCDA 2XXCB 1BBJB 1QO3B 1NH6A 1YN6B 4MA7L 2X41A 4JHWL 3AS3A 3TPUA 3FRUB 4P5TB 5GJSH 4PLNC 2HLAB 4PJGB 2UVFA 5EBLA 4F58H 3QZWG 4YFLF 3U6RA 1FGVL 4IRZL 4H0GA 4Q2ZB 5F44A 3H9ZA 4GRWF 3VRIA 4P46D 3PL6D 3R1GH 2R39A 1QFWM 3O8XD 3IRPX 5EU6D 1Q9OA 1KIRB 2DQHH 3H2WA 3GK8H 1VENA 2VDPH 1HHIB 5GGQH 4PJ5B 3FO9A 2OLDA 1A6ZB 4FQ1H 2F8VA 4PP2A 5TGBA 4X6CA 4EUPB 1OD7A 3PWNA 1B2WL 4I0PB 2F58L 3SGEI 1C7SA 4QRQB 1RUAH 3WDHA 4KZDL 4PJXE 1P4IL 4NO0B 3MLTB 2XKUA 5SWSD 2DM7A 4IMKC 4WUUA 5ERWA 3VGHA 5IB2B 4RNRA 3ZZ1A 3EYVB 1E4KC 3QUMH 4U0QB 3MACH 2FX7L 3DX6A 2DQIH 4TVPD 1NFDF 3HG1E 5DRXB 1NCTA 2JELH 5DZLA 1R5WA 3B5HA 4HWUA 1JGDA 3DYMA 5EU4A 3BIKA 5IHUL 4I18C 4HFUH 1RJYA 3TYFB 5J1TC 4EOWH 5H35B 3CMGA 3IVKB 3LZFH 1IKFH 3TT1H 2Y6SC 5CD5C 4PR5B 3BZ4A 3KPRD 4YO0A 2YKLH 2N1KA 4OCWL 5MEOA 1A6VL 5I1AA 4PRHD 1AR1C 4GW1B 2CGRL 1UGNA 1RZ8A 1NBZA 2QSCH 4ZQKA 4AG4H 5JLZA 5BJTB 1A5FH 1NANH 4LDEB 4OZGB 2PW1B 4YDIH 1C8PA 1TJHL 4HIJA 1Q38A 3PDGA 5LJYH 1CR9L 1K4DB 3D39D 4Y2DB 4X99A 3RHWK 4UTAL 5J6GB 3AXLA 4JFOB 3D25B 4BUHA 1QUNA 3VXNB 2X4TA 5SWQA 2D03H 1KCSH 4MNQE 4N0FB 3MV8A 4X7DC 1DVFC 5GS0C 1CXLA 4BKLA 5FM5M 5KSAC 3SGKC 1INQB 2QQLH 2IQAB 4XC3H 2DWEB 4K3GA 3DWTA 4U1LB 2JJVA 5GGTH 4K8RC 1CLYH 4QHMB 4FG6D 4Q0XH 5JW3H 5L2KE 1YPZB 5DTFA 3UROR 2ITCB 3HAEG 3TIEB 4HS3B 1S9YB 1D3CA 4JG0L 1JNNL 4NKDB 4YHZL 4XPBL 2ZG3A 1D5ZB 1QBMH 2J88H 5SX4H 3PG2A 3LEXB 3ZL4L 1KJ3H 3AM8A 2E5EA 1MPAL 3K4ZA 3FFCD 2ZUTA 4GUPA 3MRGB 1F6AB 1F6LL 1UB5A 3IFPA 4NC1E 2EIEA 2ZCLL 1X9QA 4RGNE 1HN1A 3EOYG 1FBIH 4KKAD 4WFGD 3B6SA 3VWJB 1VPOL 4AEEA 1TPXC 1FVEA 3EYQC 1ND0A 2BVTA 3KYMB 3MODH 2HT4C 5B22A 5T3XD 5ALBL 1HK6A 4OCRH 5FGBA 1ACYH 4LHUG 3WN5C 1CIUA 3WIIL 2BSTB 3X11B 5KSBE 1RY7B 1BFVL 2OL3B 4OCNC 4QRPE 4UT6L 5ALCL 3U0WH 5C0CD 4O4YL 3QWOB 4HPOL 4ODVL 4F15C 4DK6A 4JZNA 2FATH 2P5ED 1A6TA 2OZ4L 3FQTA 3W9EA 1ORQA 5D2LE 1QRND 2WMPA 4Y88A 2OZ4A 2P48B 4LIQL 3T0ED 1CD1A 3PWUB 3L3HA 3PHOB 2X89D 1ONQB 5DD1H 3BAEH 5IM7B 3P4OB 1RIHH 1FNGB 5EFIA 3TYGL 1A4JB 3QDJA 4YHNB 3P4MA 1PG7L 5D1QA 1J12A 1UXWA 3JV6A 1EXUA 4U1MA 2EE6A 3OAYH 8FABA 3SOBL 3HLAB 1MFEL 5HGAA 2MMXA 4P2CG 4QOKE 5ICZA 4XNYH 5CBAB 2JCCA 3QUXA 1FFQA 5IJKC 1HZHL 4BZ1L 2Y06L 2NXYC 5C0IB 4FTVB 3C5JA 4FHBD 1DQLL 4HZAA 1RZIB 1M7DA 2V2TB 2F54D 43C9A 3OGCB 5HDQH 1GC1H 4I3GA 4BFBD 5MENE 4EBQH 1DQDL 5HYJB 5KANI 3QI9C 4PLOB 4CRPA 3VMPA 4QXGH 1SYSB 3KLAB 1KEMH 3ZSSA 1MAML 3EOAB 3OMZA 2YPKA 4X7TB 1OOAA 5FCSH 2J8UF 3GSQA 2R23A 1GVIA 5D1XA 1QBAA 3QEUB 4X9IA 3CNKA 1KCKA 5D2NA 4CVWA 3OKMB 2VDKH 3W11D 3BD3A 1I4FA 2BOBB 3FB7B 4HUMB 4HSQA 3MRCA 5E9DD 4RMWA 3K80A 5EOTA 1T7VA 3MQIA 4OQ1A 3G6DH 5DO2D 3U0PA 3DMMA 3OKOB 3CUPB 3ROLB 2DM3A 3QA3B 1R3LA 5DJDA 1C16A 1QFPA 3CVHL 5DK2A 2PYFB 3OAUH 2VN4A 3CVHA 4KDWA 4XNXL 4FP8H 3QULA 3D0LA 1YC7A 1W8OA 1P5VA 2VWEC 4Y19D 1T1WB 3NCFB 1PZUB 1I7RA 2XFXB 3G5YB 1TJGL 1OTTD 3DUSB 3LEYL 4AK1A 4KK8C 2HT2D 2IPTH 1E4XH 1QLRB 3HE7D 4XP6H 1E6JL 1AGDA 3EJYC 2WQ8A 4Z8FH 3Q6GL 1H9VA 3KS0J 3LMJL 4CVXA 3QIUD 4L9LA 2VC2H 3REVB 5IB4B 4HKBB 3QQ3A 4F7CA 2XZZA 5EBMA 1FYTD 1X7QB 4M7ZB 4HWZB 1NCWH 3SDDC 4YHIB 4X9HA 1YUHA 1S9KC 1NMAL 2HVJB 3JV0A 4NO3A 1A0QL 2E27H 1FG2A 4XXDB 2FNBA 4PLJC 4LQFL 4AT6A 2J12B 4LVNB 4MAYD 2FGWL 5I76A 4FZ8L 3ARFA 4M7KH 1UH3A 4QRSA 2FDBP 4LPYA 1OAKL 1PX3A 4QYOB 5EORL 3F7QA 4U1SB 2XKNB 1MELA 1N0LA 4NFCA 1UA6L 5HPMB 5HDBF 4GKZB 3CIQA 5MEPA 3V6FB 3QCUL 4JFPB 4U4BA 4R96A 1CBVH 1RFDH 4X80L 5F3HB 1BQLH 2EDYA 1JPST 1NMBL 2J5LC 3C5SA 1F11A 4YXLH 2AJZA 3KYOB 4WW2B 1I1AB 1X6NA 2UVEA 3MFGB 1KCUL 1NC2A 3AREB 1X4XA 4WI6A 3LH2H 5MI0C 1YEFL 5CZVH 4PTTB 4HV8A 2BRRH 1KGCE 5E8OB 2Z93B 3LKRB 5GGVL 4HLZH 1A9EA 3DURA 1AQKH 2XTJE 4WUUE 5IVNA 1OW0A 4K2UL 4GMSH 5BCAA 3QDMA 3ARBA 3RZWA 1E27A 3KR3L 5LKNA 3LDBB 3BQUC 4ETQB 4ODWB 4YBLC 2Q6WA 4JR9L 5T3ZH 1G7LA 5FGCE 3REWA 3EO0B 1I8IA 2XN9B 3ORJA 1JI2A 3KDMA 4DGVH 1XZ0A 3L5WB 4NHUA 1HSBB 3IKCA 5IHLB 5I2IB 4P48A 1NFDB 2ZOLA 4RGNB 1R0AL 1H15B 5IFJA 2W92A 4PJ7F 3QHZH 1FL5B 4IOFD 1YEEH 5JW4Q 5ITFA 5D93C 5DEGB 4W6XB 1J05A 4MD4A 5LVEA 4KUZH 4WI3A 3SE8H 1G7IA 4IMLB 4JPIB 1CICC 4MD5A 4TUKH 3SE4A 3U2SB 1FG9C 3C08L 4D0CA 4S1DC 4HJ0D 1JRHH 5EN2A 1JPGA 4TOYH 5CGTA 1OAQH 1NBYA 5F1NA 4QRPB 4QXTB 1FDLH 1F45A 1VKXB 4KY1H 1F5WA 4Y4KA 3SDCA 3FB8B 3L5IA 3RVVD 4M48L 1BREA 2AK4A 3MV8E 4RFOL 2DQJH 5M94B 1OGTB 2K3TA 4I13B 1UB6A 1IMHC 5KANG 1GHFH 3GJFK 3T2OA 2O93L 2WANA 3O41A 5HGDB 2ADGA 3FQXA 3E2HB 4UUJA 1DN0A 5DT1H 3WNKA 3VFOB 1NKOA 2BX5A 5ENWB 2G9HA 4MDJA 1R3KA 5C0DB 1J0YA 3DGCR 4P0DA 4IRJD 5EC1A 1JF6A 2ARWA 1BWMA 1OSZB 4HWBL 1AH1A 1V05A 2ZNWA 4JDVA 4X6FA 3C8DA 4ODSL 4N0YL 3T65B 4LHQB 3CZFA 5JIIA 3MRLA 4QOKB 3PXJA 5IMLA 2DBLL 2F5BH 1E4JA 4JG1L 3DTXB 1EV2E 4M7JH 3CD4A 5FCUH 3U7YH 4MJ6B 5HVFB 2VTFA 5CD3A 1AI1L 1L7TL 3SE3C 2IFGA 4KJQC 5MENB 3SO3B 1YYMH 4GXVL 2FO1A 4RFEB 2NTFA 5CJ5A 1TVDA 3O2WL 5C08B 5HYQB 4HS8H 2R69H 4XNUH 3DARA 1OTSD 5C0JB 4R4BB 3L7EA 3U36A 4XHJC 4LLWA 3O6MH 4ERSL 5DWUH 4YNYA 4LLYA 4E9LA 1UKSA 1CQKA 4W4OC 2PO6C 3U0TA 4MA8H 3MRFA 9CGTA 3IU3B 1QNZL 1IFHH 3U9UB 2XQYK 3GMPB 4J4PA 5JOPD 3BE1L 3QIWD 2Q7NA 2GSIB 4JKPL 3TFKC 4LK4A 4D8PA 4G7VH 5EA0H 3KPSA 1IC4H 4Y4FA 5B3NA 1IM3A 4CVZA 4QNPF 3RNQA 4GAYB 4JDTL 1INEL 1D6EB 2C3GA 2QADD 3O4LA 3BT2H 1AO7B 1H3VA 2X40A 4G80A 2IGFL 3QDJE 3FHQA 3LQAC 3D2UB 3VXME 3QQ4B 3UTSB 3RVXC 3P11L 3ULUC 5LWYH 1OT1A 4JHBA 4LAJH 1Q9WA 1T0MA 3TT3H 5IB5B 1A1MB 1UEYA 1NFIB 1G7MB 1WWAX 4TRPL 3AB0B 4DN3L 4F3FB 3MLSL 5T1DL 3HUJA 1W8NA 5JR1H 2FIRT 5HHQA 3PQYE 5GSRB 2A1WL 7FABH 2ED8A 3O3AB 4QHUB 1U92B 4LRNH 4LAQH 1NCCL 4PYGA 2IMNA 3HNVH 4I3SH 3SKJH 5CLTA 3G5XB 1OM3H 5E8PA 2P8LA 3FO1A 4TNVF 5IB1B 1XGPB 4MXWL 5C09B 2R9HD 4HKXB 5BZWB 1J5OH 5FKAB 4LFHD 4PJ8D 4YHKH 4XMLL 4WUKH 4JANA 2YRZA 4LCWB 2D7OA 5FV2A 5D2NE 2I9TA 3F7VA 2WINA 4WHTB 4JFFA 1FNSH 1RU9L 2FJHA 4WU5A 5DK0A 4IRSA 4L4TD 1QHPA 4E41D 1XF1A 5CJQH 2AJ3B 3PL6A 3F5WB 3KYNB 1T3FA 2A0LC 4FQ2L 4Y16D 1KJVB 1N4XL 3QUYB 3QNXB 5DEFA 1U91A 4KRPD 3TIDA 4XP9L 4K7PH 3O45B 1H5BB 2XI9A 4JCLA 5A2IH 4WCYH 1FE8H 1OP5H 3EJZD 5EUOA 2Q76B 1GL4B 3HN3A 4YXHL 2HVKA 3OJVC 4R4FL 4AY0A 3IDNB 4Z76B 4DW2L 4OF3A 1NGQL 1G0YR 4DKFL 4G6FB 5E24E 2N4IA 3ELAT 2XTJB 5DJCB 3VGBA 5JHDB 3LPFA 4G9FA 4LCIH 4HZLB 1GJIA 1BJ1H 5CZXC 3V5HB 1U8KA 4BYHA 4CVUA 2VLRE 4ODUA 5EU4B 1A7QH 2RFXA 1P69B 5FGCB 3MXVH 4G6KH 1CN4A 1B2WH 3O3DA 5A16A 5JPNA 3HZYA 1SY6A 1J1PL 1I1FB 3V6BR 4P46C 4AEHH 5K59E 1EFXD 3NA4A 1C5DB 5FGRA 3O8XC 1UQSA 1QVOA 2P7TA 5JMOC 3U1SH 5DD3L 5TF1H 5BRZA 1EJOH 2QEJA 2QR0B 4ZQKB 4Z7OE 5JLZB 3QISA 4PJHF 3HR5A 5GRYA 1QLFB 3FONA 1Z9SA 4MJIB 4HX1B 4EZMA 2O5YL 4K3EL 5IB3A 4UBDD 4QLRA 1MCDA 3JV5A 1RQ5A 4OFIA 1N7ML 3VXQA 5C1MB 4HUXA 3D39A 1KT2B 4DGYH 1PKQA 4WHYH 1J8HB 4P2RA 2X9XA 4XPHL 4OCWH 5I8EA 5CEZE 2QKIB 3BH8A 4OGYL 1ERNA 2NY4B 4EEEA 3VDAA 5L8LB 3RBSA 1D5BA 1L9MA 4X98B 2R0ZH 5ID0A 3KPPA 2ADJA 4RIRA 3SDAB 3A6OA 1A6WH 1RJLA 3OSKA 4J6RL 2XZAL 5CINL 3V4VH 5JZ7D 1TJHH 4E42A 1C5CH 1FVCB 3MRIB 1RI8A 4UU9A 1CR9H 1I3GH 3BHBA 1IAKA 3EOBA 3SQOL 5HXMA 5FHAL 2X4UB 3B5TA 4M5ZL 3H9SA 1KULA 5BS0D 4HDIA 2V9TA 1GRWA 1S7WA 5GISL 1G7JA 3FQWB 2D31B 1J10A 4POZD 3MMEA 1U8IB 5GGRY 5F6HJ 2DJSA 1NGPL 3U46A 1NQBA 1ZV5A 3KPOA 3RIAK 5BV7B 2AERT 5IEKA 3MCKB 4PGCA 4DEPC 4GUPB 2BNQD 5JW5B 2AP2A 4WGVB 4HFWB 2OMNA 4P9HL 5IJVA 4KHTL 3T0DA 1X4YA 3O6KL 5IMKA 3TBWB 1Z5LA 1DLFH 1CL7L 4M6ML 3S34L 3OJDB 1MCHA 3WS6C 3R8QA 3MX0A 4Y5XB 1CFVH 1UWXH 4P3CH 3D6GA 1MCOH 4LSTL 5F89A 3DO7A 3SEPA 5A2FA 2A6KB 3RWGA 4JG0H 1OAUL 1TZIA 2DM4A 5T3XL 1PSKL 3QFJD 4ZNEA 4UQ3A 4OSUH 2PYEB 4PJ7B 5EC2B 2VB5A 4XCCL 3FZUD 4GW5A 3V95A 1FO0B 2G5BA 3NPSB 4PFEA 5B39G 3ZL4H 2WSKA 1UWEH 1TCMA 1A1OA 2JB5L 3O6FC 2XPGB 5FO7A 4FFZH 2AK4E 2X7LB 4NQEA 1HSAA 3GRWA 4RAHA 1LO4L 2EKSA 1CQYA 4UDTA 1CD0A 3HZMA 4AH2B 2VNCA 2XZCL 3OTTA 2Z31B 1L7IL 3AAZB 1AXSB 1NLBH 1VPOH 1EMTH 2F74A 4LCCC 3K0WA 4PJCE 4XCNB 3GIVA 1LD9B 4LPTA 3WFCH 5D9SB 2JKXA 3GDBA 3MFFB 1XCTB 3RUGA 1WC7A 1VGEL 3BGMB 4MA1B 3QG6B 2X89A 3MLYL 4U7MA 3VXMB 5DZNA 4HH9B 2MKLC 4ZS6D 1W72L 2FCBA 4XPFH 5B3JE 3VFRB 4RAVB 4UT6H 5ALCH 4NO2A 1P7KA 4ORGA 2HJFB 4HMCA 2PETA 1SM3L 3P9MA 2I26N 3O6LL 4KJPD 2OZ4H 3TH3T 2MCPL 1X5FA 5DYOB 4KKAC 3PABB 3BUYA 3TBSA 3PQYB 4LIQH 5IBTH 1ITCA 4KK5D 5MHSD 4LSUL 2Z0BA 3FOLA 1U3HD 3TYGH 4WFHE 4X4ZA 1PG7H 2DS4A 1V3MA 3QAZC 1FRGH 1G7QB 3NN8B 2QL1A 5D96B 4NN7B 4G9DB 1IC7H 3SCMD 2UZIH 5GIRA 3BWUC 3VFSA 2QQNL 1JUFB 3V4UL 5HHXH 1UFUA 2W9DH 3UYRL 5I8OH 2R23B 4GAJH 4Q9RL 1S9XA 4JM2F 3MLUL 5D1XB 1XF3B 3VJ6B 4HG4K 2A83B 3CGTA 4NZTH 4LLDB 2DIAA 3M8OH 2ORBH 4BZ1H 4XB7A 1GPOH 3T0EC 5GGSA 3QO0B 4CADA 3NMEA 1VCAA 3QPXL 1IAOA 3U0PB 1X6LA 4ZOEA 4QRRD 4MS8D 1C08B 3GEWB 1Y0LA 4OM1H 4XCFH 3KPSE 5JW4M 1Q1JL 2BOCB 3B8YA 5IEHB 3QULB 3QWRA 3D0LB 4Z7QE 4KJYA 2VZ1A 5EOQL 5C6TH 4PJ9D 5I0DA 1MAMH 4PJBE 4XAWL 5HVHC 1JNLL 4G6ML 2WNGA 3GI8L 4B7LA 3MRRB 3PWPD 3B83A 1Y18A 1NGWA 1T22B 4OLZL 3BKCL 1LEGA 3D85A 5E1HB 5I6XC 1RZFH 3W2DL 1LE5A 4F2MB 1KXQE 5C0AE 1IJ9A 4MJ5A 2XNAA 2FSEA 4OZHA 5KVDL 3ULVF 4MNHB 1DUYA 2D2OA 2ZJSL 1K5NB 2VLRB 1HI6B 3ABZA 1D9KC 3HUJE 3NCJH 1MF2L 3CVHH 3NFSH 3RWDA 1IEBA 2YRLA 4L9LB 5HD8D 4NNXA 3ZE1E 1T2QL 1T20A 1D6VH 5J3HD 4NPYA 4PRID 5B38B 1R3HA 1IGYA 5EIIB 1OLLA 4RA0C 4Y4HB 1WT5C 4HIEB 4B50A 1LILA 4S11A 1JFQH 5HYSA 4WU7B 5L6YL 4S2SB 3W11C 3O0RL 4M03A 1OAYH 4AT6B 4JRYD 1U3ZA 4OD2B 4U0RC 1MFCL 1M05B 4ZG1A 2IBBA 4H88H 5DO2C 1F97A 3BP4B 4X4XB 1LO0H 2X6MA 5HSFA 1TJIL 4KK9D 4YLQT 1AJ7L 1MHPL 4OLEA 5HHMB 1RZJC 3PWJB 3DNKA 5JTWA 1MCKA 2DQEL 4U1GB 4XVUD 3LMJH 4JFFE 4WI4A 2AEPL 1N59A 3MRPA 5JW4N 4ZO9A 1U0QA 4FOMA 3OG4B 3DUUA 4RDQF 1CE1H 4ZTOL 2LE9A 3S8WA 3UTPD 4O2FB 1I7ZA 1FV1A 3VXSB 1BQHA 1HHKB 2NY2B 3T4AA 1D5XB 4O9HL 5FO9B 3I6KB 4EUPG 2HT2C 3BESR 3JTTB 4YE4L 2OP4L 1TDQA 3CXHJ 3HE7C 3M1BB 5EUOE 2Q8BL 4HPYH 1JGLL 4DKEH 2K9UA 2ADIB 1ZVSA 1TCRA 5GS1C 3QIUC 3KHOA 1A9EB 3U83A 2VABB 4O2CB 5IVZB 4ZFZB 2WWKT 2VAAA 1V7ML 4K9EC 1Y6MR 5FFLA 3ARSA 4KTDL 2IANB 1X3DA 4JKMA 3C60A 3ETBF 3MV9D 1WITA 3VXRD 2HT3D 2YUVA 1K8DB 3LHPH 2I27N 2Q1EA 2W0KA 3F58H 2NY1B 1I8IB 3G5ZA 4PV9B 3OF6D 1IEAB 4I0CC 4N68A 4ODXB 1S5IH 3VRLE 1BOGA 3B8SA 1LDSA 1LGVA 4NT6B 3U30C 1E4KA 5IFJB 3GSOB 4TTGA 4JFXB 5GGVH 4WWKA 3TCXA 3Q1SL 1MJJA 1A6PA 4K2UH 5FDWA 1J05B 3EO9H 2GHWB 5BRZE 3C8KA 3RZCD 1T2JA 4FRWA 2OQJA 3DGGB 4XPTL 2BVQA 3VGDA 1IAMA 5FA3B 3G04A 4G8EA 4PY8J 4MGXA 2JIXA 1NBYB 1AHWB 1MWAB 3CAFA 5F1NB 1ETZB 3I6LE 3PGFL 1MIMH 5C0BA 5TFSL 3DV4A 2DQDL 4PJHB 2GY5A 1PQZA 1U3JA 2AK4B 1PKQE 1W0VB 4P2RE 1BHGA 2D7PA