4JFDE

Preservation of peptide specificity during tcr-mhc contact dominated affinity enhancement of a melanoma-specific tcr
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
245
structure length
245
Chain Sequence
MSQTIHQWPATLVQPVGSPLSLECTVEGTSNPNLYWYRQAAGRGPQLLFYWGPFGQISSEVPQNLSASRPQDRQFILSSKKLLLSDSGFYLCAWSETGLGMGGWQFGEGSRLTVLEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQDPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class I histocompatibility antigen, A-2 alpha chain
publication title T-cell receptor specificity maintained by altered thermodynamics.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 45
structure length 245
sequence length 245
ec nomenclature
pdb deposition date 2013-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4jfdE02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4jfdE01
1PJ9A 3ABZA 1YN6B 2VXQH 3O2WL 2BOCA 1CN4A 1MRFH 2NX5E 5DEZA 4OZFG 3U7YH 4U49A 1QLEL 4OF8A 5E5MB 3RWJA 5I15L 3R1GL 1MWAH 1F8TL 1EHLL 3IETB 4W68A 1T66D 2EDNA 4HUWA 5MEQB 4I0CC 4BK4A 3MLXH 4IIQA 3X3GH 5BVPL 4YWGL 4UILL 2DKSA 3Q2CA 5GPRA 2OI9C 4JDTH 4HFUH 32C2A 1ZXQA 2OR8A 3U7AA 1BWMA 2E6PA 3Q5OA 1U8OB 1C1EL 4M6NL 2B4CL 2VSCA 4H1LA 3S3PA 2J8UB 2ORBH 2C7UB 1ZS8B 3TPUA 3E8UH 3FT4A 3WFBL 2A83B 2FX8H 4UOW1 4X4YA 3B9KA 2FEEI 5HYJA 3U83A 5JDSA 3MRJA 1CXLA 4A2MA 1NCDL 3B9EA 3RWHA 4IDLA 3HG1D 1IEAA 4MCZA 4Z7OE 3VDBA 1BHGA 4LKXA 3S3JA 3QUYC 4UNUA 5HDLA 1B4JH 1BJMA 1ZANH 3QXAA 2R56H 4FFYH 3P0VH 3V6OC 5HHNA 3BGFC 2J6EL 1GH7A 5C8JA 1A3LL 1I9RH 3B8SA 1ZLSH 1CQKA 3OR7B 5F9JA 5DD6A 2BNQE 3ZE2E 1PX3A 3CH8A 1NJ9A 4XBEH 2B5IC 4BSVA 2PKDA 4R97C 1CVRA 1UWGH 3JTTB 4JN1L 3QXWA 4JZOA 4OF5A 4UT6L 4LVOC 3MJ9A 3ZHLA 5EUOF 1X5JA 2HMIC 3GKZA 1MAJA 1KN4L 3PE9A 5BS0A 2N1KA 4MD4A 4F3FB 5I8KH 1E4XH 3EOAA 3NTCL 1AHWB 2FWOB 4RA3A 3BPNC 1I3RA 2VDPL 1NBYB 3QIBC 1ZLVK 1WZKA 3K1DA 4P23A 1KFAL 3PQYD 3PV6A 2H32B 3FB6A 3REWA 5F1NB 4I0PB 2EIEA 1I7ZA 4ZOEA 5GS1C 1W72H 2FX7L 4QNPF 5DWUH 1B9ZA 1XGTB 1REIA 4K8RD 3Q1SH 4CVWA 2ICWB 4CJ1A 5E00B 4FQQB 3A6CL 3O4LB 3L3GB 4HEME 3ARGB 4WFED 1IFHL 3KPTA 4U2ZA 4J3TA 3AU1B 3UPRB 5DJ8A 4YE4H 3CCHA 4O2EB 4KKCC 2YUWA 3IVKB 5C0CA 1GHFH 1INQA 3W2DL 5KSVA 1G9NH 4JRXD 2FYYB 4KDTC 3EYVB 3QQ4B 5HY9A 5K59F 4PGBA 4PRBB 3T8XB 3L5XH 3FQWA 1DLHA 2A9NH 1NFIA 2B1HL 3QO0B 2ZUTA 2R23A 1OPGL 5B38B 4OZIB 1IT9H 2IEPA 3CLFH 5EFIA 5J13C 1DTUA 1D5BB 3RJDA 2R8SH 1LO0L 3QWRD 1RVFH 4NKOA 4YHIB 5DMGC 4ZFGL 3OKMB 4PJ7A 5FDWA 3QDMA 4K3DL 3MLPA 5DS8A 1U8MA 3BDYL 3D85B 1EZVX 1JWSA 4QRQB 2VH5H 3KR3H 1D9KB 5C6WH 1MCHA 4HPOL 1S9XB 3QDGA 4K07A 2DLIA 4MDIA 5C0AA 3TA3D 2IWGA 4KJWD 2KH2B 3LMJL 4GBXC 1KC5H 5E2WH 4JKKA 1OGAB 4GW5A 4HIXH 4PJEE 4XMPH 4BZ1L 3CMGA 4O58L 3RA7H 3W39B 1UEYA 4NUGL 5D7LA 3NIFE 3ZKSD 4H5SA 4L3EE 1N5AB 3HUJA 2Y5EA 3X3FH 4HUVB 2NLJA 3MRCB 4NGHH 2WANA 2KQNA 2ITDB 3ETBF 4XX1E 1B88A 1D6EA 3PWPE 4OLVL 5JOPE 1RAMA 3C87A 1MHHB 1PYWA 2GSIA 4K71B 3VXRE 3E3QC 2EEBA 4H20H 1I7UB 3VFGL 2H9GA 2P45B 1TQBC 3ILQD 3LN9A 4G6AD 5C08B 3S4SB 1T2QH 2Z92B 3ESVF 3CNKA 1HILA 3ARSA 5C1MB 4POYA 4EBQH 1AR1C 3RGHA 4W4OA 1U3HB 2XV6B 3PP3H 1DUZB 3V8OA 3QXDB 3TN0B 3MLYH 4PJFF 3NPZB 2GFBA 4HGWA 5HVWA 4FXGB 2X4NA 3H42H 4U7SA 3MA7A 3OKNB 5GHWL 1AXSA 3QFJD 1BBJA 1RZ7H 3IAPA 5LG1A 4PRHD 3AUVA 1R3HB 2D7TH 2PF6A 4IRSD 1S7QB 3FB5A 4J3SA 4HDIB 1CDBA 3BOVA 4W6YB 5DJYA 4Y19B 1FFRA 3KPQB 1JZ8A 1A3QA 2FR4B 4E42B 2VR5A 1A0QH 1INDH 3FQXA 5B8CC 4LLVB 4Q97A 1IGTB 2O5ZL 5CJXC 3F12B 1NCWL 4MDJA 1MCOL 4GO6B 2HTLC 3EYFA 1OVZA 1K6QL 2RIKA 3QCVH 2FEDD 4N8CH 1G7PA 4MAYA 4PJ8C 1QSFB 3P11L 4LCWA 5DUPL 1MREH 2QQLH 4JR9H 4OFIA 1VFAA 2CQVA 2J8UE 3ZE0F 1A6TB 1C08B 1LGVA 4EUPA 1T4KB 2JB6B 3EHBD 2DWEA 1ORQA 1XFPA 3GFUA 2P8LB 4MHHG 1OAKL 4JFZL 2JELL 3SJVA 4X6FA 4LMQI 5DUMH 5H94A 4OI8A 4WI4A 4LSUH 1II4E 1NAKL 2XZAH 4UNVA 4FABL 3KPNA 3NAAL 3O6FC 2R2BA 3OKEA 3B2VL 4KQ3H 4PTTA 2APWA 2XZCH 4RCAA 4Q7DA 4EQ2A 3DTXB 3LDBC 4Z95H 1PD6A 2A38A 4OCSH 1XEDA 5E95B 4EXPX 4G8GA 4NQVA 4R26H 1HYSD 5LQBH 4X7TA 1CDCA 4X6EA 1IE5A 5I2IB 5AZ2L 3LAFA 4O2CB 1OARL 4RDQG 3GMRA 1XCTA 2K7PA 1ADQH 4UNTA 3DBXA 4FRWA 4QXWA 3MJ9L 3W5MA 1WC7A 5EC2B 4WY7L 1CGXA 3L3JA 2XZZA 2NXZC 3RY4A 5DYOB 1GGTA 2UZXB 3TYFA 2YRZA 3LQAC 3MCG1 1NANI 1G0YR 4LCUA 1QLFB 2V5SA 2FHCA 5BRZD 1GVIA 2OMBA 4PLNC 4ZFOB 3O4LE 5JZ7D 5A3ID 4KI5F 4HKBB 5CEYB 3F7QA 3UJIH 1QKZL 1MLBA 1MAML 5KW9H 4HS3B 1NUFA 4QHNA 1OGTA 1AE6H 1DBBL 3O0RL 4YDJA 4YHPB 4ONGL 1KJMB 4I9WE 3QIWB 4PGEA 2ZKHH 4X8JA 1KIPB 1LO4H 3V4UH 1NBZB 1E6JH 4OZIE 4XVJH 2SEBB 1QD0A 1JHKL 3LV3A 4LAQH 3SKMB 4ETQA 1D6VL 2G5BA 2UWEF 4I48B 5C0RL 4FXLA 4NO3A 5EU6B 1JGEA 3UBXI 3RIAK 2ZJSL 4QXTA 2H3NA 3QQNA 5J6GB 1A8JH 4ZAKC 3HPJB 2BFVL 5IW3A 4BZ2L 1I1FA 4WI6A 2CXKA 1BQHA 3ARDD 3N1PC 2R0WH 3QG6A 4JZJB 1QQDB 5IBLD 4ODXA 3QDMD 3QCTL 2VDNL 4QWWD 4XT1C 1OGAE 1BZQK 1J1OL 4G42B 1OAYH 2N4IA 2VDMH 3IDUA 3UAJD 4UV7H 1ZA6A 1V05A 2FECL 4FZ8H 3WL9A 3U0PB 5IQ7L 2DOCA 2IBBA 4WI3A 1EDQA 3O41A 2WBJD 1DVFA 5CJQL 1T6WA 2H41A 4R7DB 2D4DA 1C5CL 5C08E 1G7LA 3RL2A 1R3JB 5KSAA 4DZBA 4XXDB 1YYLH 3ECBB 1N26A 5D5MF 1G7MA 4R4FH 3PWNA 3BEWA 3JV6B 4X7SH 1S7TB 2H26A 3P73B 4N5ED 3FMGH 4XWGH 3LVEA 3T3PF 5B4MC 5JOFB 2VUYA 5HHVL 4F57L 3T04D 5EIVA 3OXRA 2VLRD 3NIDE 3OMZA 4YHNB 1QR1B 2EDXA 1HCVA 4KY1H 5IKCA 1QNZL 1JNHB 4ALAH 1OCWH 3WMSA 5DXWA 2P7TA 4I0PC 2DM3A 5GRJH 1CICD 1JWUB 4X6CE 4Y19E 2V2TB 2DLFL 5BV7C 1W0VA 3RWGB 1AC6A 3GBNL 3EOTH 2Y72A 1OAXH 1A6VH 3WEXA 3EJYC 4F80A 4X80L 5FCUL 1WLHA 3LPGA 3QEUA 1T0PB 3ARGC 3BEVB 1JUFB 3WIIL 4OSUL 3L1OH 4YBHA 4K3JH 5F88A 2WSKA 1MWAA 3U48A 4RSVA 1UZ6F 3CVIL 4EEEA 4LSSL 5TGBB 4OLYL 1I1YA 2VXSL 4RGMC 2XN9B 5IV2A 5JNYB 1F58H 2VE6B 2BVQA 3D0LA 3QCUH 4M7JL 2FBJH 4X4XA 1KT2B 2NX5A 1B3JA 1QZ1A 4ELMB 5J1SC 2ADJB 5IM7B 1T1ZA 5K9QG 1U8PB 1ZHKB 1K5NA 2R0LH 1A4JA 5SWQA 3TO4D 3FB8A 4HS8L 4WCYL 3ARQA 3NCJH 2BCKA 2DQEL 1NPUA 3QZWG 5FO7B 3VFOA 3MLSH 4PY8I 1YN7B 3MQIA 5E5UB 1AGEB 3TJHC 3HKFA 5IEHA 4NHUB 2W91A 1F6FB 4MJIB 5D7KD 2AJYH 2XWBA 1HI6A 1XF3B 5GZOD 5ESVB 5AZEL 3UTQB 5GS2D 2Z8WC 4HS6A 1JP5A 4RFEB 3EZ8A 4R2GD 2X6MA 5DHYB 4AG4L 3VXPA 3W5NA 1WCQA 1MCSA 3JVGA 4JHWL 4XBPA 3V0WH 2BHUA 4GBXA 3L3HB 3HFMH 2WLZA 3GSVA 4PB0L 4YK4C 3RNKA 1KN2H 3E2HC 1YEFH 4DK3A 3AS2A 2O5XH 1YMME 4WENB 4K71C 1N4XL 2O61B 4XPFH 5FF6A 2JTDA 4MZ3A 3ULUL 2BHZA 2A2QT 1A2YB 1JHLH 2GUOA 3VFSB 2GTWA 4YLQT 1NGQH 3WIHH 1FFOB 5L88H 1OSPL 3MBXH 4ZFFB 3I6KB 4S2SB 1N6QH 2BNQA 3TH3T 4HULB 3U82B 1DLFL 4O2FA 5IWLC 4J6RL 4Q9RH 4X98A 1ES0B 4G8EA 4WEMB 4YBQC 1WT5C 3QRFM 4XMKH 5EU3B 4D9QE 1DN0B 4K23H 1W72A 2WUCL 3EFDH 1QFWH 5DK0A 1HE7A 1TNNA 3BXNB 4OF3A 3CJJA 2DI8A 3KNBB 3P0YL 5DLMH 2R39A 5F7MC 4N90D 1I8LA 1VFUA 1RZ8A 1T20A 5E1HB 5ESAB 5CFHA 1H8OA 3JV4A 3QG7L 4PGDA 1NCNA 2AK4D 4F9LC 5C9JA 2BNUA 1EEYB 1JN6A 3F7YB 5EU6E 1CBVH 3K2MC 2J8OA 3W9EB 2VISB 5HGDB 3C08L 3ARUA 1DEEB 4S0TD 4DVBA 4U3HA 3BE1H 4UAOB 1HSBB 4I4WB 4R7NA 4B7IA 1RJLA 4P2QB 3U6RA 4PYGA 3K8KA 2XIDA 1NBVL 5E8DL 3FN9A 4GRMB 4GAYA 2CSPA 3QWOB 5EUKA 3M07A 2DQGH 1MQ8A 1K85A 1RZIB 3STZB 3OKLA 4WRLA 4NQDE 2AXFB 2YKLH 1OTTC 3DLQR 3B83A 5ILTL 4PJ5D 3SE4C 1R5IA 1YMHB 4AENB 4RNRB 3HZYB 3SHSA 1HDMA 5ID1A 5JW4Q 3MRPA 1WWBX 3RBGA 1KCUH 5E9DD 1NCAL 4M6OH 3JSSA 2FX9H 1DUYB 2AV1B 3MRIA 3PDDA 3RKPA 3NGBB 1OAQH 4HLZH 2AAVA 2EO9A 4XNYL 4Z0BL 3C2SA 4PJEA 5EC1A 3DHJA 1W0WB 1U91B 3QNYA 3IKCA 4HQQH 3TP4A 1VCAA 1NLDL 4X6BB 2V2XA 4PJ7F 4HBCL 4L3EA 4QYOA 2HVJB 4FQPA 3PWPA 4ZNEE 4PJAE 5BCAA 3VXRA 4WUKH 4DAGL 4HK3N 4GKZA 2OP4H 4GW1A 1BJ8A 1RUAH 3VWKB 5TPWH 3TBSA 2JB5H 2AK1H 2EXWD 3HUJF 5DJCA 3GIZH 1RK1A 5E6ZA 5FYLH 1BREA 2GYSA 4HHAA 4X5XA 3DRTB 1AD9A 4ODVH 1BMGA 4APQB 1AQDA 2R9HD 5K33A 1P4BH 1FGVL 2VXQL 3WJLA 4Y4KC 1MRFL 1NEZG 1TTUA 2BSTB 5KAQF 3U7YL 1JF6A 4PJ9C 3SKUD 2XN9E 2J1KA 4GXUN 3O2VL 3QIWC 4OCLC 1YN6A 1A4KB 3KPOB 3MLXL 2GK2A 3X3GL 2VDRH 2X89A 4ELME 5E5MA 1LD9B 3GSOB 4S10A 3IETA 5I1IL 1F3RB 4WHTB 4JDTL 1U3ZA 1AO7B 4HFUL 5I1HH 5MEQA 5E56A 3VGGA 3SDCD 3HPLB 3UJTH 4NWUH 1INEH 1FCCA 4BQ8A 4OM1H 4JY6B 3MCKB 5E4EC 4L8SB 4MJIE 2ORBL 4P5TD 1MJUH 2IF7A 3WNKA 2FX8L 4JZJC 1U8OA 5CP3A 5E2VL 2RBLA 4DQOH 2DDQH 4Y4FC 2APBA 2J8UA 1T0MB 4LDEB 5DO2C 3OXSB 2C7UA 1ZS8A 1XGQB 2VTFA 2ARJQ 2A83A 3ET9F 3ZSTA 2HT4D 2ATPB 1B4JL 4HK0B 5E2UH 1ZANL 4FQXD 3TNNB 4FFYL 4PV8B 5TE6H 2OM5A 1I9RL 1ZLSL 3VFPB 4JDZB 2YRPA 2BZDA 3LD8C 3H9YA 2I60H 4XBEL 1DQDH 1G0DA 3FQRB 5JXED 1UWGL 4ODTH 1QA9B 3RRQA 5T3ZE 1ADQA 3OR7A 4FQLH 4NNYA 2VNCA 2IQAB 4NZUL 3AAZB 1F6AB 1YJDH 3V7AE 5F7FA 5I8KL 1E4XL 1KLFA 1OB1B 4U1LB 3JTTA 2BNQD 5CEZE 3I50H 2DQIL 3RWFB 5T3ZH 4YAQB 4JM2C 4F3FA 2YOCA 2I25N 3QUMB 2X1WL 1W72L 1AHWA 2FWOA 5I8CB 4AY0A 3MUZ1 3IFLH 3Q1SL 1NBYA 3MRMB 4PJBB 2H32A 4LVHC 3MCLL 5F1NA 2QADB 4I0PA 5CEZH 1FBIH 2PW2B 5JW4N 1P7KB 3DJ9A 2A73B 1XGTA 2ICWA 5DVMA 4YE4L 2UVFA 5E00A 4FQQA 4KTYA 3O4LA 1YEHH 2QHLA 3L3GA 3ARGA 1GHFL 1E4KA 5ISZD 5CJ8A 3O3AB 4WW1B 4RMTA 3AU1A 3L5XL 3UPRA 1P7QB 4O2EA 5JA9A 4K55A 3IVKA 4AMKL 2A9NL 3P40A 4P2QE 1GOHA 1HNFA 1IT9L 2FYYA 3EYVA 1H5BB 3CLFL 3QQ4A 4PRBA 4YGAB 2F53B 2R8SL 4QGTA 4GKOA 4OZFB 1V7ML 1RVFL 3UYPA 4NNPH 3LN5B 3VWJD 3QO0A 1T7ZA 5DC4B 5B38A 4OZIA 3KPPB 4DK6A 4NO2B 3G5YB 3SO5A 1D5BA 2DBLL 4MA1C 2VH5L 3DX7B 1KCKA 3GRWH 2YSSB 2XKSA 2CUIA 4YHIA 5L6YH 3CFKB 5I6XB 1DZBA 1FZOB 1CD8A 5E2WL 4HIXL 4XMPL 2A6IB 1BQLH 2MSPA 3RA7L 3D85A 1IC4H 4QRQA 4DJMA 1D9KA 1JBJA 3T0WA 1CGUA 1D3CA 1S9XA 4KZEH 1JGVH 2EDDA 3NIGF 2W07A 4NGHL 2LFGA 1OGAA 3BQUD 3QT2A 1S5IH 2CGRH 3W39A 1IKFH 1YJDC 3GJEB 1I9EA 4IHOB 1N5AA 3QUZC 3HE6D 5T3XH 4HUVA 3MRCA 5KSBF 2VRAA 2ITDA 3BDBA 1T2QL 1CU4L 1LP9E 1KNOB 1MHHA 1T1XB 3ZT5A 2XPGB 4EBQL 5MI0C 4TNVF 1VADB 1I7UA 3FHQA 2ENYA 3UBXG 5C08A 4F37F 3S4SA 3MLYL 3GMQB 2Z92A 4GLRI 3BN9C 1EHXA 1A7BA 3TYGH 2X4SB 3H42L 5IVNA 4G9FB 3VXQB 3GHBH 1N64H 3LQAL 4KMLB 1RZ7L 1U3HA 2NY2B 1SM3H 2I24N 2NY6C 3BPLB 1DUZA 2D7TL 2YD5A 3OV6A 3QXDA 4MLSA 4OI9A 1Z0MA 3TN0A 2YD3A 2BNRE 1P1ZB 4FXGA 1AI1H 3NACH 3OKNA 2CRMA 2JF1A 2JCCB 3PWVB 1INDL 3QRGH 1R3HA 5HJ3B 2LE9A 3P9WB 3TBYB 1DQJB 1S7QA 2UZYB 1T83A 3HB3D 4HDIA 4OD2B 4Y19A 3KPQA 3CFDB 4I8DA 5JTWA 2FR4A 1LVEA 4E42A 5ACLA 1S5HB 4LLVA 3QCVL 4J12A 1AO7E 1IGTA 1TLKA 3F12A 2QSCH 4ZG1A 3D18B 1MREL 2NY1C 3B5HA 4HWBH 4JR9L 5JHDD 2W65B 1I85A 1WGOA 3E1F1 4TNWF 3IJYB 1QSFA 4UQ2B 2I5YH 1V5JA 2M8XA 5EO9B 4C56B 4M4PA 5DUML 1PY9A 2CKNA 2XZAL 4LSUL 5DD1H 3ZTNL 3OG4B 4NM4H 2NW3B 5C0BB 1A6TA 4GRLA 3VGEA 1C08A 5KSUB 4CJ0A 1T4KA 2JB6A 1IQWH 1NMAL 3ARXA 5DURB 3FB7B 2G60L 3DXAD 3ARBD 4G43B 5INDB 4KQ3L 1UACL 2QQKH 3K3QA 5C7XH 1EFXD 4TULH 5KJRH 4POZD 4DKFH 1BEYH 1QP1A 4Z95L 4TVPE 4OCSL 5HSFA 4R26L 5ADPH 5FKPB 5LQBL 2QHRH 5HDBE 4UINH 2P24B 1X5IA 3DTXA 5F6IB 4I3SH 5GGSB 1SEQH 5H2BA 1ADQL 5T1KD 1AKJD 3I84A 3WIHA 4Z7UB 2EDQA 2XTJB 3FKUS 4NN6C 4QT5B 5IB1B 5TF1H 3LS4H 3UTTB 5I2IA 4O2CA 3DMMB 4IOFC 4TSBH 4M61B 4HWNA 4LEXH 4UT9H 5EC2A 4YXKH 4RAHA 5J1TC 1R5WB 1WFTA 1JZ7A 5DYOA 3S9DB 4PJBE 1CDHA 3SO3B 3SDYH 3CVHL 2H2PD 1N6VA 1QLFA 5CGYD 5D9SB 1NKOA 4ELKB 5KW9L 3V8CA 3QUMH 5EORL 1Z9OA 4ZFOA 4WIQA 4APQC 1HXMB 2KUTA 4HKXB 1L7TL 4Q9BA 4F2MB 1AE6L 4HKBA 4NQCB 4MNHB 1NSNH 4OGYH 5CEYA 5SX5H 3OAYK 1IAIH 2D2OA 4HS3A 1XZ0B 1WAAA 3TJEH 2ZKHL 3MLWH 3PGCB 4P59L 4YO0B 1LO4L 1E6JL 3TFKD 4XVJL 4YHPA 1KJMA 3QIWA 1ZLUH 4LAQL 4FTVD 1UB5B 2VC2H 3DO7B 4H26B 4MXVE 5C71A 4TN9A 1KIPA 1NBZA 4N1CA 1SBSH 3ZKMC 2SEBA 4Z7VB 4ZXBC 3MRBA 2WWMC 1E4WH 3BDXA 2R0WL 4I48A 3WS3B 3QNZB 5EU6A 4PYHA 3RVUC 1WWCA 3LQZB 5J6GA 4WGWB 3HPJA 4OZFH 3EDKA 1T0NB 5LGKA 1OAYL 2VDML 4JZJA 3N0PB 1OHQA 4UV7L 1QQDA 3B6SA 4S11A 5EU4B 4FZ8L 1ZGLM 2YPKB 1IL1B 3D85D 1EJOH 3K7UA 3ARRA 3WHE1 3CH1B 4RFNC 3BKJH 1D9KD 5DEGB 4G42A 2DYPB 4JHAH 3RNQB 5TH2B 4WEUD 4LRIA 4R0LB 1FO0B 4LLMB 2NY4B 3VXMB 3FFCD 3U0PA 5I1JH 4KC3B 5DK3A 5DD5H 1EK3A 3VFWB 5DZOA 2Y5TB 1YYLL 3EOBB 2RAMA 5F21B 4X7SL 4MD5B 5IEKB 3BW9B 4N0CC 4FS0A 4FQIH 1RUPH 1XGYH 3FRPG 3LKRB 4R7DA 3FMGL 3ILPB 3RVVC 1R3JA 4OCYH 1MELA 4XXDA 1X3DA 3ECBA 5DFVD 3V0AC 1RSFA 1YEEH 4QRTB 4G9FE 3JV6A 1S7TA 4RAVB 5I1DB 3P73A 3BYYA 4KY1L 2W60B 4KI5D 1OCWL 3GJFK 1J5OL 4CW1B 5JOFA 5GRJL 3VMOA 2YXMA 4S1QH 1EXUB 1QEWB 1CXFA 3IDNB 4LLDB 4YHNA 1QR1A 2ESVE 4DTGH 3MJGX 1OAXL 1JNHA 5HHPB 4YPGB 4M6MH 1JWUA 3UC0H 2V2TA 2DJSA 1IKNC 4ODBD 4HWZB 5ACMA 3RWGA 2VDQH 3DO3A 4NQED 1YNKL 5IJVB 3BEVA 2VL4A 1JUFA 3DSFH 3MACL 1F58L 4RBPK 3AM8C 4OKVB 3VRJB 2FBJL 1UG9A 1MFCH 5TGBA 5EPMB 1L0XA 3RGVB 1I3VA 3PG2A 2XN9A 2R0LL 5JNYA 4OJFH 1TJIL 2VE6A 1CD1B 1KT2A 2BDNH 3BP4B 5C0BE 2YR3A 1ACYL 2X05A 3NCJL 4ZUTB 4P4KB 1HXYB 2E8YA 4ELMA 3MLSL 1X5FA 2ADJA 5IM7A 1XF2B 1U8PA 2AJUH 4YHYB 1ZHKA 1DSFH 4GRLD 5AD0B 3C60D 2XG4A 3I6GB 2F58L 1U8NB 1HKFA 1S8DB 2OR7A 5FO7A 1V3KA 2PETA 1YN7A 1XF4B 1AGEA 1ZVSB 4NHUA 4MJIA 1XF3A 4CU7A 5ESVA 3UTQA 3IAQA 4RFEA 3N50A 1U36A 4LGSB 5DHYA 1ZT4B 5D1XC 1KN2L 2HYMA 2O5XL 1MQKH 4P2OA 5D1ZB 4XPFL 3GBMH 3HHRB 4Z7UE 5GQBA 3UTTE 3W82A 3L3HA 4V1DD 1JHLL 2EYTB 2EDLA 2X4RB 1NGQL 4LHUB 1ZWIB 1FZJB 2Z91B 2DMCA 2X1OA 2O61A 3MBXL 4QOKD 2ENSA 4S0SD 2J8UF 5ELIA 1N6QL 2ADIB 4N1HB 3FQTB 1A2YA 3VFSA 1JK8B 1YMMD 4Q9RL 4MB3A 5DA4A 3UROR 3GIVB 3MYJB 4XMKL 1P84J 4XHQA 5JORB 4ZFFA 3V9FA 3I6KA 4K23L 4S2SA 3S97C 1S7UB 3EFDL 5C0JB 1QFWL 5HPMB 3BPLC 2GJJA 3VXSE 1ES0A 3KPSB 4NQCE 4IRJB 2HFEB 5EU3A 5DLML 4ZFOL 2RFXB 3WN5C 1DN0A 2Z35B 1LO5B 1A7OH 2XRAH 2NY0B 2JJTA 3BXNA 5F7WC 2BOBB 3I3DA 1JJUA 5L2KB 3KNBA 3SGJC 3PIQB 4BFGA 5DRXB 5FOBB 2HH0H 5I74C 5DI8B 2AERT 3MUGB 3BD5A 2EDWA 5ESAA 4D0DB 4N8VB 4NZJA 1MVUB 2V9TA 4LOUC 1EEYA 3X17A 1BFOB 3BE1L 3F7YA 1KJ2B 5C6TH 1L6ZA 3W9EA 1MLCB 2VISA 5TQ0H 1CE1H 5HGDA 4PGZA 1UB6B 4XNQB 3WNMA 4WJ5B 1DEEA 1KB9J 2DQGL 2PYEE 4HIIB 1HSBA 4I4WA 1F6LL 4XP1H 3KLHD 3GRWA 1SMAA 4WHYG 2AXHA 4HF5H 4P2QA 1A9EB 2MHAA 5FYJH 4JG1H 4JFFD 5A2KH 2YKLL 3RY6C 5DUBB 1FAIH 1YEKH 4GRMA 3HE7D 3QWOA 5GGSY 3CDGB 5D71H 3OB8A 1RZIA 1ZLVH 3STZA 3VXME 3UTSE 2AXFA 1TVHB 1NCBH 1YMHA 3IFPB 4M6OL 2FX9L 4AENA 4NN5B 2V5YA 4RNRA 5HVHC 3IU4H 1N2RB 1MAKA 3HZYA 4NQDD 3PV7A 4MXQC 5F6IC 1QOKA 1DQLH 1DUYA 2AV1A 4ZUUB 2XQBH 1RQ5A 2XTJC 1M6OB 1G6VK 3JV5A 3LKPB 4R6UA 1W0WA 1U91A 2IPUG 1I4FB 3O8XB 4P4RB 5GJTH 1HK6A 4DGIL 4X6BA 3OGOE 4WUKL 5BOPA 2GKIA 3T0EC 2OP4L 3VH8G 1UM4H 2HVJA 2I07B 4A6YB 4H8WH 1JPTH 3LZFL 2JB5L 2AK1L 5GGUB 3LKOB 2GT9B 3QUXD 2PXYB 3EW3B 3GIZL 5FYLL 3FOMB 4ODVL 4MJ4A 1P4BL 4X7EC 3VWKA 3O4OB 3HR6A 1OP5K 3U79A 3GBLA 1M4KA 4LU5H 4J3WA 1D5ZB 3DRTA 4PJGB 5JO5B 2CK2A 4APQA 5MEOB 3NABH 5DSCB 4PLKD 3DROB 3EIFA 1U8IB 4OF0A 1MCRA 4HWBA 5I1HL 2UY6A 4YZFE 3IDXH 2B8OT 1A4KA 3KPOA 3QQ9C 5E7BA 1KIRB 3UJTL 4NWUL 1INEL 2BVTA 3VI4E 1LD9A 3WDHA 3GSOA 4OM1L 3DETD 4Z7QE 1H8NA 1KCSH 4WHTA 2X42A 1XGRB 3O6KH 1AO7A 3NCBB 3ZE1F 1MJUL 4TPRH 2HN7B 3HPLA 4K3HA 4DN4H 4Y5XC 4DQOL 2DDQL 4AEFA 4JY6A 3MCKA 4L8SA 2AQ1A 4CN1A 5ERWA 4JVWA 4WWKB 5E2UL 3L3DB 1X6NA 5ITFB 2PCPB 4HT1H 5I76B 1W2KT 4PG9B 5C0ND 4U0RB 1T0MA 3OXSA 3IYLW 3OJMB 2V17H 1XGQA 4MS8D 4PJIF 1FDLH 4AQOA 2YEZB 2ZOLB 4LRNH 2IPKB 5E99H 2ATPA 5D7JB 4OB5L 2I60L 1BF2A 3SGKC 3WLWC 2GW5A 3DVNB 3TNNA 4PV8A 3IFOA 4HD9A 1J11A 4P2OD 4ODTL 2J8HA 4X6DB 2C3VB 1ITCA 2A6KB 2D7PA 3VFPA 4FQLL 3ARFD 4JDZA 4N0FB 4MAUH 1CVSC 3KAAA 2Y6SD 1YJDL 3FQRA 1BM3H 5F8QC 7CGTA 1QA9A 3OJVC 5E6ID 2DLEA 5F7NC 2IQAA 3I50L 1A6ZB 1FFNB 3AAZA 1F6AA 3VFMB 3RL1B 1XF1A 3KPSE 1OB1A 4U1LA 5D93B 3IFLL 4PIRF 3Q3GB 1RHHB 3HN3A 3OTTA 3RWFA 5BJTB 4OCXH 5E6YA 4YH6A 4YAQA 3RWEB 4HUUB 4M1CD 4CMMB 4TTDC 5CEZL 3QUMA 5L2KE 5I8CA 1E28B 1MCPH 3MRMA 4PJBA 2VITB 3HTLX 4KK6D 1CLCA 1YEHL 1HKLH 4I18B 4TRPH 2PW2A 1P7KA 2X1QA 2A73A 1KG0B 2VLMD 1KTDB 2JJSC 3IDYB 4PRDB 5CGMA 4Z77B 3PL6C 1QPPA 4N9GB 5JXAH 1CE6B 4WW1A 3L95B 5IJKC 1NEZB 4XCCH 2Z31D 1P7QA 5CZXC 1T7YA 4EI5C 3RZCD 4NNPL 5ESQB 1PG7H 4RGOH 3SDAB 4WWID 4Z7WE 2R4RL 1NAMH 4LLWB 1H5BA 2BSED 1S7VB 2F53A 1KJ2H 3A6BH 3GRWL 4OZFA 5I71B 2V7NB 5L6YL 2NTSP 3LN5A 4WUUE 4PBXA 1LK2B 1N0LA 1WAAF 1H3PH 3KPPA 4Z5RB 2IAMB 4U1GC 5AWNH 1P69B 1BQLL 4NO2A 3G5YA 1IC4L 3DX7A 5EULV 2YSSA 4HBQA 1DE4A 5K93A 2M1KA 2DIAA 3QDHA 3CFKA 1BQHG 1PLGH 1EO8H 4KZEL 1JGVL 1N0XH 3DNKA 1FZOA 3O81A 1LDSA 3MJ6A 2MJWA 1EVUA 2EDHA 3U9UB 2A6IA 1S5IL 2CGRL 2P5WE 5DMJB 4RX4D 5FO8B 4LARH 4IMKC 4N1EA 5T3XL 3CK0H 5EH1A 2DKUA 4UQ3B 2JK5B 3IU3B 4AEHH 4L1HA 3GJEA 1MUJB 5EZIH 4DZ8B 4IHOA 5KOVC 3QPQC 1YECH 5IVXF 5MHSE 5FYKU 2OYPA 1KNOA 4FMFA 5EU7E 4QRRB 5LVEA 1T1XA 3TYGL 2XPGA 1VADA 3GHBL 4OZGF 3P4NB 1N64L 1SM3L 1QRNB 3NCCB 3GMQA 1MPAH 2X4SA 1BVLB 2RHEA 4YC2C 1AI1L 2DN7A 4G9FA 3VXQA 5F72S 5EO1B 3QRGL 4JHBA 1L0YA 3RUGE 5DFWH 1KPUB 4D0CB 4PJDB 2ID5A 2Q8BH 4YPJA 4K3GA 1P1ZA 3UTZB 2E8ZA 3BIBX 1YY9D 3F7PC 1U3JA 3S37H 1JZ3A 2JCCA 3PWVA 1CL7H 1SEBB 1MCLA 4LK4A 4P2RD 5HJ3A 1SBBA 2HTKD 5CIPB 2BNRD 3TBYA 2XACC 5FGCE 1DQJA 2QSCL 4LIQE 3AB0C 4HWBL 3DGCR 4OD2A 4KKNA 1JGLH 4NQTA 1S5HA 3FZUD 3D18A 1NGPH 1NEUA 2D9CA 2NY5H 3NZ8B 2I5YL 2W65A 5FA3B 4JM2F 5ECJE 3MNWB 4M7ZC 4LIQH 5HHOB 5DD1L 2DQTH 3IJYA 4NM4L 4TUJB 1YQ2A 3FAXA 1IQWL 4UQ2A 2P1YA 4OI7A 5EO9A 4C56A 2JIXD 1W8OA 4QKXB 5FEBA 1NGYB 1GGUA 1VGKB 4ORZC 3CZJA 5C0BA 2QQKL 2NW3A 2MWCA 5KSUA 4EVNB 1WEJH 4R90H 4ENED 1SY6A 5C7XL 1LQSR 4TULL 5KJRL 4DKFL 1BEYL 3FB7A 5D96C 3BHBB 2IH3B 4G43A 2QSQA 5INDA 1GZPB 4X6DE 3D25B 3O45B 4XP9H 4Z9KB 4NN5C 4UINL 5GISL 1EMTH 1JL8A 4I3SL 3T4AB 3MV9B 1SEQL 4X8XA 5L0QC 2IANB 4GS7B 4UB0L 4RGNE 4YX2L 3WFCH 5FKPA 5GGQH 4TVPD 2P24A 5BXFB 5DRZB 5TF1L 3LS4L 1ZTXH 5GGSA 3Q6GH 5JUEL 4TSBL 3EO1B 4U05A 2V9QA 3MZGB 3QJHA 3ZYZA 3MBED 5BQ7B 3I6LD 4JREB 4PRAB 1H3XA 5MEND 1F45A 4YXKL 4Z7UA 4QT5A 5IB1A 4Q9QH 3S34L 3UTTA 3QUYD 1MCWM 3DMMA 4DWHA 4M61A 3SDYL 1CQYA 1F4XH 5F7DB 1SVCP 2AJSH 2E7HA 3DX6B 3L3KB 2CR3A 2PXYC 4M1DH 5JR1H 1R5WA 3BKCH 1VENA 4CNIB 3QUML 5IG7B 3MLTB 5E8OB 3ULVD 3O4OC 1NUGA 1WIPA 1NSNL 4OGYL 5I73B 5D9SA 3N1GC 1IAIL 3K1KC 5CLWA 3SCMB 3TJEL 2GJZB 3MLWL 1HXMA 4LHJB 4HKXA 2HMID 2IQ9H 4F2MA 2FJGB 4NQCA 5I66B 4MNHA 2G75B 1TNMA 1R6VA 3QJFB 4JEGB 5IESH 1XZ0A 5GS3A 2VC2L 3QIBD 3R4DA 3PGCA 4LCYB 2A74B 2FH8A 2RQ8A 5E8EB 4E41E 3MA9H 1JPFB 2VMFA 1SBSL 1FNGB 4HIJB 4PBVC 1HINH 3X13B 3ZKXC 2Z8SA 3HAEB 5JQ6H 1UB5A 4U7MA 3OJ2C 5DFTA 3DO7A 4M8QB 4GJTB 4H26A 3KYMB 4HX1B 4NQSB 2E27L 2QV2A 3N85H 4Z7VA 3EYOB 2NZ9C 4AJ0A 3BAEH 2GI7A 3M17B 3WFZA 4LSTL 4LSVH 4Q6IA 3WS3A 3QNZA 3EYQC 3LQZA 3OKDB 1WFUA 1EAPB 1EJOL 4Y2DD 1QBLH 1T0NA 3BKJL 4U0RC 3RJQB 1CIDA 4JHAL 5AAMA 1G7HB 2W9EH 2VZSA 2W9LA 5EU4A 3X14B 4XVUD 5F7YC 3BUYB 5I1JL 5D7JC 4HG4J 2YPKA 1IL1A 5DD5L 3GI8H 4ONHB 5DEGA 1J7VR 2DYPA 4M48H 5TH2A 4XNXL 3RNQA 4R0LA 1FO0A 4LLMA 1RUPL 1XGYL 5DMGD 3VXMA 4AL8H 5JW4R 3ARPA 4OCYL 1IEBB 5CKGA 3H9SD 1ETZB 4LP5A 3VFWA 2Y5TA 3EOBA 4QRRE 1N5YH 1GL4B 4OZHF 1YEEL 3FT2B 4MD5A 5IEKA 3BW9A 3LKRA 3C6LC 3ILPA 3QIUC 3NZHH 4KTDH 4Y5VA 3HNTH 5HPOA 4BELD 3EO0B 4KKAC 3HG1B 4R8WL 4QRTA 4WTWA 2V5TA 4RAVA 5I1DA 1RZKH 2BSRB 1H3WM 2PN5A 4L3AA 3VFRB 3S37X 4DTGL 2W60A 2AV7B 3MV11 4XX1G 4CW1A 5EOTB 5EBMA 1UH3A 4M6ML 3UC0L 1EXUA 1QEWA 4LLDA 3IDNA 3UZQA 4G7YH 2VDQL 3I3EA 4LMQE 4WI2A 2NXYD 3AY4A 4JFED 2X70B 2EDTA 5HHPA 3IDJB 4KK8D 4YPGA 3DSFL 4RWYH 3VA6A 3G6JB 2ESVD 4GXUM 2CD0A 4HWZA 3BWAB 5DJDB 2PR4H 4M93B 1YUHB 2AEIT 3IDYC 1MFCL 5IJVA 3WSQH 4RFOH 4UBDD 1G7JB 5KTEL 5CIPH 2HKFH 4OJFL 3KHQA 5HHOE 3AS0A 4OKVA 3VRJA 1XIWC 3PQYB 4G6KH 5EPMA 3RGVA 3G6AB 3O9WC 3ZLQC 3L5JA 2AJUL 2A6JA 1DSFL 1CD1A 4OFDA 3BP4A 1MEXH 2WK2A 2VQ1B 3MO1B 4ZUTA 4P4KA 1HXYA 2ZOKB 1MCDA 4U1NB 5SX4I 1RHFA 1Y6NR 2HTLD 2Z4QB 1XF2A 4KZDH 3IGAB 1CD9B 4IOSD 2IAMC 3SDDB 3PDOB 4JO1H 1YYMH 5AD0A 1WZ1H 4PP1C 4LLUB 4P5MB 4P2YA 3TT3H 3I6GA 1MRDH 1A14L 4K9EH 1U8NA 1CTOA 1S8DA 4PJ8D 5D7IB 4NWTH 5HHQB 3LEXB 4NJ9H 1XF4A 2HT3C 1ZVSA 3MV9E 5BZWB 1ZOXA 4JRXB 1MCCA 2IANE 1JFQH 4LFHD 4PV9B 5J0BA 1MQKL 1MY5A 3V7MA 3GBML 1G9MH 1D5IH 3H0TB 2IFGA 2D3VA 3WNLA 3OKKB 5D1ZA 1AGBB 5IVOA 1JZ2A 5JA8B 3O6FD 2EYTA 1PBYA 2X4RA 4KVCH 4LHUA 4WI5A 2X1PA 1ZWIA 1FZJA 2Z91A 1EGJA 2ADIA 3TA3B 5GXBB 3FQTA 9CGTA 1LK3H 1JK8A 3UYRH 5DRNB 3MYJA 4YBLB 5JORA 4W81A 4UV4L 1C7TA 5BO1H 4CDHA 1S7UA 4Q0XH 5C0JA 4ODSH 5HPMA 2EEDA 4S1DD 1Q72H 3KPSA 1TQCC 5JW4M 1C12B 4I3RH 2HFEA 2VZOA 4IRJA 2YMXH 4L4TD 4E9LA 2RFXA 2HH0L 5T5FH 2Z35A 3VXSD 1LO5A 2Q3ZA 2NXZD 3AS1A 1CG9B 1RU9H 5FHBH 1JF1B 2BOBA 4OM0H 5L2KA 1JF5A 2QSTA 4P49A 3PIQA 5CBAB 5DRXA 1I8KB 1GGYA 2C4FT 1ZLWH 5FOBA 4J8RB 1KOAA 5HGBB 3CX5J 5BVJB 4OBRA 5D8JH 5DI8A 2EH7H 5SWZD 1A6WH 5C6TL 3MUGA 2B1AL 4B7LA 5TQ0L 5IOPB 1CE1L 4D0DA 2XQYK 4N8VA 4K7PH 1Q8MA 4PJHF 4LSPH 3OX8B 4NOBA 3CU7A 3QFJB 5ID0B 5IW1B 1BFOA 4PRHB 3OB0K 4IRSB 1KJ2A 3HAEH 4HF5L 3SBWC 3NFNB 4JQVC 2YZ1A 2F8OA 1MLCA 4JG1L 5FYJL 4K9EC 4U2YA 1UB6A 3HRPA 4XNQA 1IRAY 1FAIL 1YEKL 4WJ5A 3LS5H 3SDXB 5JQHC 4HIIA 5D71L 1T1YA 3RWJB 4LEOB 1K9TA 1A9EA 1UH2A 2GAZB 2PO6C 5D6DC 5B38G 4YHZH 5DUBA 1S7SB 1NCBL 5EZLB 2PYED 4HGMA 1JNNL 4YEFA 5KVDH 1YPZF 3IU4L 3CDGA 3NPSC 4TSAH 3QWQB 1RZFH 4XVSH 2DYPD 1TVHA 1DQLL 4ZAKD 1ZV5A 3IFPA 4IMLB 1F3JB 2MFNA 4WFFD 3UTSD 1N2RA 2XQBL 5E5RB 3F7VB 2WIMA 5IBTH 5GJTL 2D0FA 4RAUB 3HG1E 4ZUUA 1J10A 1U95B 4JFPB 1UM4L 4JPVH 1M6OA 1CDYA 1HHHB 3LKPA 4H8WL 1JPTL 3HLAB 3EYUL 3O8XA 4P4RA 2XZQH 1I1AC 1HNGA 4Z76B 1R3IH 4G6FD 3TNMB 4OGAC 5GGTH 2I07A 4A6YA 5D4QA 3V5DB 1WZLA 3LKOA 4GRWH 2GT9A 4MVBC 3RDTC 2PXYA 3PGDB 1UWXK 3G6JE 3FOMA 4P46C 2PTUA 4POUB 4WV1B 1Y6KR 3QP3A 3SCMC 1FYHB 1T5XB 3RI5F 4Y5YC 5C0IB 1TJGH 3O2DH 5B4MD 3DV4B 4RWHA 4Y4HC 4DN3L 1EEUA 5KVGH 4FZEH 1D5ZA 5JO5A 3IDXL 5MEOA 3U0WL 5DJ0B 3PQYE 3WFEH 3E6HB 5DSCA 4HK3J 3S6CA 3DROA 1U8IA 2DI9A 1KCSL 5FUCC 4CU8A 3CZFB 5BRZB 3Q6FB 4L8CB 3O6KL 3E6FB 1FZMB 4OCMC 1NC2D 4TPRL 4XCNB 1KIRA 4DN4L 3EJYD 4JGMA 2LABA 4WFEE 4NZRL 1M7DB 4PJXF 1VSCA 5GSRB 1QFUH 3SGEH 2YS4A 4JPWH 5C6PB 3BZ4B 4O4YL 4P4KD 5TE4L 2HN7A 5E94B 5DRWB 5DA0B 3TZVC 1U0QA 2JCCF 3GJFB 2CLVB 3JTSB 5D7IE 3SKOB 4K8RH 1URLA 4XXCC 3B2UC 5GSVB 3WUZA 4JRXE 5D2LB 2GEEA 1IC5L 2V17L 1FDLL 5CMAB 4YFLF 3EDFA 4LRNL 3D9AH 2R0ZH 4WWKA 3QSKB 3L3DA 5ITFA 5I76A 4NO0D 4PG9A 3MRNB 2ZG1A 3JV0A 1OTUD 4HKJB 2HLAB 1ND0B 3BX7C 2VABB 2YEZA 2ZOLA 3DI2B 2IPKA 1FPTL 4MAUL 2FB4H 3UP1A 3KDMB 5DC0A 1BM3L 1NDGB 3TJHD 3DVNA 2VZ1A 2H2SD 5AUMB 3MROB 2DQCH 4X6DA 2C3VA 2A6KA 5F1IB 3VFUB 1OY3B 3ARDB 2R4SH 1UKQA 4N0FA 2JKXA 3QDMB 2EZ0D 1MRCH 1CFVH 1QR4A 2XXCB 2EIBA 2HA1A 4Y1AE 5J1AB 4UIKH 4KROD 2DL9A 1A6ZA 3SE8H 1MNUH 1FFNA 3VFMA 5CZVH 3RL1A 1RD6A 2PNDA 5SWSD 4XGZB 1F11B 5DDHB 1KLGB 3OZ9H 5FYKD 1X4ZA 4FFZH 3Q3GA 1RHHA 1MCPL 2WBJB 4LAJH 1NCUA 5BJTA 4L9LB 2VWEE 3W0WD 5I8OH 3RWEA 4XCFL 4CMMA 1YEDB 1HKLL 8FABB 3U9PH 4TRPL 3VH8B 1E28A 5HBBA 2VR9A 3G04B 4K7PX 1MCFA 4MA3B 4QHUB 3GKWH 2Q6WB 2RCSL 4I18A 5JXAL 3X11B 4OZ4B 4XZUB 4YBQD 5GS0D 4M9OA 3JUZA 1KG0A 4MMXC 2V2WB 2WINB 5F97E 4XCCL 3QFJE 2VLRB 1KTDA 3MC0A 3K80A 1A7NL 4PRDA 4Z77A 4U6VH 1PG7L 4RGOL 2P5ED 2KZWA 2NR6C 5IF0B 4N9GA 4UDUB 1NAML 1IBGL 1ULVA 1CE6A 1CICB 4F7PB 2P42B 3REVB 3L95A 1NEZA 1KJ2L 3A6BL 3SDXE 4MB4A 1HH6B 5ESQA 3SDAA 3BH9B 5DJYB 1QFHA 1UXWB 4LLWA 2E9JA 1RFDH 3ARVA 5AWNL 1LEIB 4QRPB 3B43A 1L9NA 4NYLB 3KJ4B 4MXWH 3RX5A 4PRNB 2MQCA 5E08H 2EDFA 2V7NA 3KXFD 2GY7B 1SQ2N 4JY5H 1PLGL 1EO8L 1LK2A 3EYFB 1N0XL 4Z5RA 2IAMA 3MMEB 1OTSD 3VG9C 1LE5B 3DUHA 4JKWA 4WUUD 1MCWW 4LARL 1KTLB 4HZLB 3CK0L 2ZSWB 4FQJH 3U9UA 1UM6H 2ZUQB 2P47B 4AEHL 5FO8A 3TO4B 4NIKB 4Z7VF 4GQ9H 5EZIL 1NCTA 2XWJB 3OAYH 1KTKE 2P5WD 4RA0C 4UQ3A 5DJ6B 2JK5A 4NC1E 3IU3A 3WKMH 2MPAH 4NN7C 1MUJA 4W6XB 1JCKA 4DZ8A 4HUKB 3U0TB 2DLGA 3OKYA 1X5YA 1K2DB 5FGSA 4R2GB 2ICWJ 4QRRA 4ODHH 1MPAL 2VKXA 1EEZB 5IMLB 3QDJD 1CIUA 3P4NA 3LRSB 1HZHH 2EE6A 1QRNA 5FUOH 1CLYH 2Q8BL 4HJGB 3UZVB 4NJAH 3MRHB 2VO5A 5EO1A 5LKNA 3QHFH 3FAWA 5I1GH 1KPUA 1TZGH 1V3LA 3QO1B 3AMLA 4D0CA 4PJDA 3BSZL 3CIQA 3ILQC 4G6AC 3RIFF 5IUSA 3KPRE 4U31A 5DK2B 4NFCA 3UTZA 3MRRB 4I1NB 1U41A 1S9WB 1JGLL 4ZPVB 5BRZE 1SEBA 3NCFB 1PW3A 4XNUH 1Q0YH 5CIPA 2MTPA 1NGPL 2FEEL 2NY5L 3ZDZE 2VR4A 3K81A 5F9WB 4LIQL 2C9AA 4P99A 2DQTL 2ZG2A 2W59A 3MFGB 3PXHA 3NZ8A 2E7LC 4RDQF 1WFNA 5FA3A 1R3KB 5KVMC 4PJ9D 3MNWA 2KDGA 1GGIH 5HHOA 4TVSa 2XYCA 4QHNB 4TUJA 4B41A 1WEJL 3B8YA 4R90L 5FM5O 4XTRD 1RZGB 4C4KT 1Y6MR 1IGYB 4X9GA 4YEEA 1FLTX 1B6UA 4X5WB 3IDGB 4YXHH 3QAZB 1GC1H 1NGYA 1VGKA 3GJFH 5EBWB 2AK4B 3WDIA 3MRKB 4XP9L 1OM3H 4EVNA 1CFBA 3PHQB 1GPOH 3OHXA 4IIQC 1EMTL 5J06A 4O02H 5D6DA 3BHBA 3HC0B 2IH3A 4XP6H 1GZPA 4DUVA 3WFCL 3D25A 3O45A 5GGQL 1NQBA 1JGEB 1ZTXL 3L7EB 3Q6GL 3T4AA 3ZDYE 3MV9A 3VW3H 4WHYH 4Y4FD 2D9QB 2IANA 3VI4F 3ZT7A 1BQHB 1LNUB 3UJJL 4BFIB 5BXFA 1TCRB 3B9KC 1HHJB 5DRZA 4Q9QL 4RBPH 4FXKB 2XWTB 2YK1H 1IAOB 4O51B 3EO1A 4GH7B 1I9JH 1F4XL 4UI2A 4HG4K 4RGND 3TBVB 2AJSL 2I27N 2WUBH 5BQ7A 4PJ5B 1GZQB 4PRAA 5DVNA 4M1DL 4WW2B 2O5YH 1OT1A 5JR1L 3BKCL 1YEJH 1M1SA 4PTUB 2CK0H 2Q8AH 4QXUH 5F7DA 3DX6A 1DANT 1MVFA 5E9DB 3ZT6A 1CTNA 4NZTH 3L3KA 2V5RA 1F5WA 3H3PH 4CNIA 4WFHE 3KG5A 2NCMA 1FRGL 3P0GB 4G6JH 5IG7A 2IQ9L 3MLTA 5E8OA 3V7AG 1IILE 4K94H 4KV5F 3SGDI 2BJMH 4M7LT 2VLRE 3SCMA 2GJZA 1XT5A 3DVIA 2FJGA 5I66A 3MA9L 5I0DA 2G75A 1F90H 5JPNB 2V9RA 3QJFA 5JQ6L 1TTGA 3DV6B 1BZ9B 2R15A 4WNQB 4LCYA 2A74A 3H8NA 5E8EA 1MFAH 1JPFA 3N85L 4HIJA 1FNGA 2DRUA 5JZ7C 5A3IC 3X13A 1U8HB 3HRZB 3HAEA 4QRPE 3BAEL 1MHEB 5TE7H 1SJVA 4M8QA 1IGMH 3OF6D 4E41D 4LSVL 3S35X 3KYMA 4HX1A 4NQSA 1I9IH 5DJZB 4Y89A 3QI9B 1ZVYA 3EYOA 1QBLL 3M17A 4KTEH 4TNVK 4PJCB 2W9EL 4F37K 3OKDA 1EAPA 4AIXA 3ZTJG 3GI8L 3VA2C 1IGCH 3RKDC 4M48L 1J8HD 1PSKH 2NY3C 4FQ2H 5J3HD 1G7HA 4G6ML 3SDCB 1O7VA 3X14A 3FTGB 4AL8L 3DVGB 3BUYA 4GG6B 4GLRH 4ONHA 1FVDB 1N5YL 2C3WA 2P49B 3KPLB 5D7KE 3PWLB 4P5TB 3QB7C 1EX0A 5F9OH 2K1MA 4HUXA 4HWEH 3ARDC 3I02B 3FO1B 5IBLC 3NZHL 4OUUB 4EQ3A 1IEBA 5FHAL 4P2CG 1ETZA 4QWWC 3DRQB 5ITBH 3HNTL 5BW7A 5F44A 3FT2A 5ACZB 1RZKL 2IBGA 3UAJC 2EE3A 5DD3H 1PVHA 4FQXB 5GGTA 1MFDH 3EO0A 5GS2H 2DS4A 3HG1A 1YC8A 3ZDXE 4TNWK 1F2XK 2BSRA 3VFRA 1W0YT 4G7YL 4PG2A 2WBJC 4K94C 3QUZD 3K46A 4L9LC 2AV7A 1RULL 2HRLA 4WI7A 5EOTA 4RWYL 4U6XB 2W38A 3O2DA 1OSZB 1DL7H 2PR4L 4N5EC 1XR8B 1JRHI 2X70A 4RFOL 3VRLF 3WSQL 3IDJA 1AIFB 5IB5B 5CD5D 3G6JA 2FO4B 4PGJA 2HKFL 5F89B 2BNQB 4J4PD 3BWAA 5DJDA 2CR6A 4G6KL 5ABDE 1YUHA 2NY6D 3L3IB 4NBYB 3MV8D 4OLZL 1G7JA 4LPTA 3HNSH 4DUXA 4LCIH 4OIAA 3PQYA 1MEXL 4HAGA 2VYRE 1IC7H 4N90E 5I30H 3G6AA 4NRXB 1A7RH 1FNLA 1J1PL 2HG5B 4KZDL 2CIIB 4JO1L 1YYML 1WZ1L 2AK4E 4HXAH 1CFNB 1LO2H 1MRDL 4GXVH 3CX5K 4K9EL 2VQ1A 4LHQB 2Z93A 3MO1A 2ZOKA 2R0KH 3DUSB 4NWTL 4PJGF 4U1NA 4NJ9L 4HPYL 5ISZB 2Z4QA 3CSGA 2NY1D 3IS1X 4M1GL 3IGAA 4UTAH 3SDDA 3PDOA 4LGPB 4PRPD 1JFQL 2QLVB 2EC8A 1F4AA 4LLUA 3HS0B 4P5MA 3VI3E 4MAYC 4NNXB 1G9ML 3T3MF 5E2TH 1F13A 4DEPB 5D7IA 5HHQA 2IFFH 3LEXA 4BYHA 5BZWA 1Q9KB 4FQ1H 4JRXA 3RVWC 4PV9A 1MIMH 3P9LB 4M7LH 1OP5H 2EO1A 1HOCB 5B39G 3H0TA 3VWJB 3VMNA 3D48R 2AJXH 2IAND 4KVCL 4LSQH 5KS9B 4BH8B 3OKKA 4PJ5E 1S9VB 3LEVH 1CGSH 3QWRA 1AGBA 5GZOC 5CILH 5J11B 1YEIH 2OTUB 4XHJD 1A6AB 1FNAA 1QVOB 3HZKB 3LPFA 4RRPG 3UYRL 1J12A 1AY1H 1WVZA 5EA0H 2IJ0C 3LB6C 4Q0XL 4ODSL 4L1DA 1OAUH 3TA3A 5E24E 4YDKH 1BLNB 3BQUB 1UC6A 3NA4A 1Q72L 2RGSA 5HDQH 5DRNA 4R4NC 1CDJA 5KVFL 4I3RL 2YMXL 5JMOC 3J8F7 5T5FL 5EUOB 3ROLB 2BY2A 3M8OH 3HE6B 1RU9L 1F3DH 3ULUC 4OM0L 5FECB 4OCWH 1JNJA 1C12A 5DZNA 4RMUA 2ITCB 3U4AA 2BRQA 2ZUVA 1J88A 5D8JL 1CG9A 2EH7L 1JF1A 1O5DT 1A6WL 2ZNXA 5CBAA 1I8KA 1UJ3B 4J8RA 4LSPL 1OW0A 5F9WC 1PG7W 5HGBA 1SVZA 5GIRB 5BVJA 5DJCB 1JIBA 5IOPA 4MNQE 2HT2D 3MGTA 3CX2A 3PF2A 4M5ZH 1BGXH 3QFJA 5ID0A 5IW1A 3ZHKA 4PJCE 4PRHA 4QRUB 4IRSA 3LHPH 5K9OB 4UT7L 3NFNA 1MJ7H 1BJ1J 4GAGH 4YUEL 4YHOH 2J88H 2DJ4A 1IAMA 1TITA 5J12C 3BISA 3QAZC 3SDXA 3OGCB 5FXCH 1SMOA 1OD7A 2D7NA 4TSAL 3IRZA 3RVTC 4LEOA 4JFQB 2ZPKH 2GAZA 1RZFL 4GG6E 5JHDB 3LH2H 4XVSL 5I1EH 3BZEB 1S7SA 5EZLA 4BH7B 2WWMD 4PRIE 3VXTB 2R2EB 2MMXA 3V4VH 2FBOJ 1CL7I 5IBTL 1TPXB 3I75B 4IMLA 1F3JA 4BFBD 5C0FB 5CCKH 3F7VA 4JPVL 4KUCD 1EZVY 3IF1B 3TWCH 3DXAB 3HCVB 4AEEA 2XZQL 3ARBB 2HJFB 2P43B 1R3IL 4RAUA 2WNGA 1U95A 4JFPA 1WISA 2JJVA 3TIEB 1EFXB 2YN3A 5GGTL 1HHHA 3UPCA 4ZUSB 2HFFB 4FA8A 3HLAA 1J8KA 3P9MB 1VEOA 4Z76A 1A6UH 5FGBA 2ED8A 1KUMA 3CXDH 3TNMA 1DVFC 1K4CB 1J0ZA 5D2NE 4N0CD 5KSAC 1MCQA 3PP4L 3V5DA 2VLJE 4JFHD 4FFWC 4GMTH 3M45A 1TJGL 5T1KB 1AKJB 4NCC1 3PGDA 5KVGL 4NNYB 4FZEL 1DQMH 1E27B 3GDBA 4WV1A 1DQQB 5DGQA 3WFEL 3HR5B 4PJFB 2NY7H 1Z9SA 1T5XA 3IT8D 5C0IA 3L9RB 3V52H 3DV4A 4MSWB 4KUZH 2F8VA 1VGEH 5DJ0A 3E6HA 3CC5B 2VDOL 4OT1H 5ICZB 2EYRB 6FABH 1QFUL 1GIGH 4JPWL 2Y23A 3CZFA 1L6XA 3Q6FA 5BRZA 4L8CA 3E6FA 1FZMA 4XPAH 2VAAB 4XCNA 3FONB 4JM4H 5C09D 4CADB 5ISZE 2YN5A 4K8RL 4PLOB 4Z0XB 1M7DA 5F9AC 3BZDA 5GSRA 2IBZX 3LKSB 4PJDF 4L5FH 5F8RC 1YEGH 3BZ4A 1AR2A 5E94A 5DRWA 4D0BB 3D9AL 2R0ZL 3GJFA 2CLVA 3JTSA 3SKOA 3SDDD 1WQVT 5GSVA 5D2LA 2VLKD 1D7FA 1RUKH 2J4WH 4FTVB 4L4VD 1ORSB 3LRGA 5CMAA 1XF5B 2JLLA 5LAXB 2CLRB 3RX8A 2FB4L 4UOW0 3O6LH 3BWUC 1M05B 3MRNA 5KS9E 3DECA 3LKQB 5JIIA 1KTRL 4HKJA 2DQCL 1ND0A 2HLAA 4GAJH 1U93B 2VABA 4P5TC 2R4SL 3EZJB 4TSCH 3KDMA 2J5LB 1MRCL 1CFVL 1NDGA 4L3CB 3DI3B 2A6DB 5AUMA 3MROA 3WKNA 2Y36L 1PZUB 4UIKL 1LEGB 5D70L 5F1IA 1Z3GH 3VFUA 3ARDA 4JQXA 3SE8L 1MNUL 4ZS6C 4RMWA 5CZVL 2P8PB 1AC0A 3RTQD 1BFTA 2AI0H 4QHMB 1D5XB 4P3WA 4FQXC 5I19H 5D1XD 5J1AA 3JVGC 4NRYB 3JWNC 4ZS7H 3T08A 1G1CA 4JKLA 5L8JB 5EUOE 3FFCB 4XGZA 5I8OL 4Y1AD 4CMHC 1F11A 2G2RB 5DDHA 1KLGA 2EDOA 3WNOA 2WBJA 2EE2A 4AIZB 4L9LA 1HIMH 8FABA 1NL0H 1YEDA 3GKWL 4GQPH 3QDAA 3P4OB 5I18L 4HH8A 4QNPE 1ZK9A 3B9AA 3VH8A 3BRFA 1QSZA 3T0BA 1XH3B 3IKKA 3G04A 5JW5B 2XOTA 4MA3A 4QHUA 4U6VL 2Q6WA 2PW1B 2WP3T 3X11A 4OZ4A 4XZUA 4YGVB 3D3VD 4CVUA 1LE9B 2V2WA 2WINA 2VLRA 1AJ7H 5IBUG 2D03L 5IB4B 4PFEA 7FABH 2ADFH 5IF0A 4UDUA 1NFDF 2X40A 4XPBL 1CICA 4F7PA 1RFDL 3REVA 5K59E 1G84A 3CSBA 4MXWL 2X10A 2C4XA 2DQJL 5E08L 4NQEB 1I8LC 1RI8A 1HH6A 2W0FB 3BH9A 4JY5L 4X6CB 1UXWA 1JGUH 5JHDE 4I0KA 1LEIA 2Q20A 4Q6YA 4QRPA 1Q1JH 4NYLA 3WFDH 3P4MB 5GRZA 1G9NC 2UWEB 4PRNA 2QL1A 3GMLB 2WLYA 3ORJA 4FQJL 4U7KA 3MMEA 1UM6L 5IB3B 1ZGLB 1LE5A 2C3GA 4GKSB 1KTLA 4GQ9L 5DVKA 3TO2B 4GOSA 4HZLA 2ZSWA 3ZYIA 5DQDL 1X5HA 3DXAE 4N68A 2YD8A 5EG6C 2AJ3B 1JPGB 4GRLB 4IOIB 3WKML 2MPAL 3TO4A 3C60B 4JY4B 2XWJA 1GGBH 1UADC 4JPIB 2BERA 1V3JA 2X4PB 4GFTB 4LPCA 5DJ6A 4ODHL 4I2XB 5CP3H 3KLAB 3U0TA 1CXIA 1K2DA 1HZHL 4E5XB 5FUOL 4MXQD 1CLYL 4JAMB 5D5MB 1KCLA 4NJAL 2UYLB 2IGFH 1EEZA 5IMLA 4OD1H 4O9HL 1B0RB 3LRSA 3QHFL 5I1GL 1PY4A 1TZGL 3I3BA 4PJFE 5H2BB 4V1DB 1CDGA 4HJGA 3QEGH 4U1KB 2HFTA 1LILA 3MRHA 4QOKB 2VUOA 3OL2A 1HCFX 3T0ED 1Q0YL 3QO1A 1PZ5B 3QEQD 5DK2A 1RUMH 3K8LA 1NMCB 4L8DB 1YMMB 1BOGB 3MRRA 1I8MB 5DMYA 1S9WA 3EJZC 5DC9B 4ZPVA 3MRLB 5MP6H 3KPRD 3QBTB 4PR5B 4P57B 4DVRH 1ZAGA 4GRWF 1MFBH 2FIKB 1TXKA 4JE4B 1GGIL 2OTPA 3RWDB 3WJLC 5BMFH 3P77B 4Z7NF 1IGFH 1T2XA 4BK5A 1R3KA 1RJZB 2H32H 3ZE0E 4YXHL 4XNZC 4YDLB 1GC1L 5F96H 5IMMB 4FTVE 1OM3L 2EDEA 2IALB 5I1CL 2E5EA 3G6JF 1RZGA 4FN0A 1UZ8B 4O02L 1VEPA 5B3JF 1IGYA 2VN7A 2E7BA 4X5WA 1N7MH 3IDGA 3F5WB 4XP6L 3JWOH 3HZVB 5EBWA 2AK4A 1F4WH 4C55A 3MRKA 3VXNB 1TVBB 4V2BA 1WBYB 3PHQA 5E0QA 3U2SB 1KLUB 2GCYB 3VW3L 3MRBB 1MI5D 3EUUA 3HC0A 1BPVA 4XB7A 1TPXC 4HUMB 4ETYA 4XCEB 5L8KB 1L7IL 2WQRA 3P30H 2B20A 4FNLH 3O2WH 1WWAX 2YK1L 3L7EA 1I9JL 2ATKB 4JFFB 3GHEH 2WUBL 3D2UD 2OJEB 1LNUA 3HE7B 4BFIA 3B6SB 2O5YL 1WIUA 1TCRA 1HHJA 1YEJL 1A02N 4FXKA 2XWTA 2CK0L 1IAOA 4KFZC 4O51A 2Q8AL 3FFCE 4POZC 5HYSG 3MRQB 4QXUL 3WLWD 3TBVA 5C2BH 4PJ5A 1KJ3H 4LHUG 1GZQA 4UILH 4WW2A 5HHXH 3S5LB 4NQDB 4PTUA 5C0EB 4X4ME 4B5EA 2APXA 4G6JL 1GGCH 5E9DA 4K94L 3A67H 4YFDB 2BJML 4ZQKB 1UENA 2A1WH 4KKLC 1KCVH 2APTA 3KYKH 3MOQA 1VACB 4KI5E 3B5TA 3VGBA 4HJJH 1F90L 4WFHD 2UUDK 3PHSA 1IM3B 2X7LB 1HH9A 4YHMH 1RZJH 3LPWA 4TTDD 1AHWC 4MD0B 3QUXB 2QR0B 5JPNA 5LGJB 1AD0B 4FP8H 2J6EH 3G5VB 1IGML 3DV6A 3MJ7B 1BZ9A 3HMWL 4PJAB 4NQEE 3TV3L 4WNQA 1I9IL 3BYTA 3FO9B 1U8HA 3HRZA 2M2DA 4N8VG 1MHEA 4KTEL 2UWEE 3C09B 4UT6H 1E4KC 5DJZA 3JWOC 3PL6D 3QI9A 2OSLB 2X4TB 4QRPD 4ISVB 1IGCL 3TFKC 5FO9B 1CS6A 1PSKL 5DHXB 4PJCA 2WIIB 4FQ2L 1MFNA 2DICA 1QO3B 2VDPH 4EI5D 4TOYL 2AVGA 5FV2A 4KGLA 4R3SB 2FNBA 3GI9H 2FX7H 5KBNC 1U92B 4D9LH 3IJSB 3SDCA 2ZCKH 3FTGA 3DVGA 4P0DA 1OP3K 4GG6A 4KH2A 1UXSB 1FVDA 5ITBL 1FC2D 3LIZH 3KPLA 1SJEB 4I2XE 1IFHH 3PWLA 4P5TA 2Z9TA 4XC1H 4LNRB 1I3UA 3I02A 4JGJA 3FO1A 5FOJA 1VB9A 4OUUA 5DD3L 3MRGB 5D5ME 2OLDA 3DRQA 4Y16D 1IC1A 1MJJB 4YQXH 1D9KC 2F19H 5ACZA 1DBJL 3Q48A 4QGYA 4V1DE 3SGEI 3T3PE 4DOHE 3ESUF 3OB0H 4FQXA 4LL9A 4J23A 4P2OB 4PD4K 2NTFB 5TJWK 4QOKE 3ARFB 1DL7L 1QTYT 2DM7A 1FG2B 4WO4D 3QPQD 2OCFD 1FL3A 1H0DB 3ZL4L 5JXEA 4U3CA 4U6XA 5DFVC 5E6IB 1OSZA 3N1MC 5F7KC 5DR5H 4RMRA 4J3OC 2OTWB 5L9DH 1XR8A 1G9EA 2A0LD 1CZ8H 3C5JB 5IHUH 1AIFA 4NPYB 5IB5A 2FO4A 3HNSL 5F89A 5JHLH 4LCIL 1U3HC 1UZ6E 4Y2OA 2Y06H 3TN0C 3L3IA 1FGNH 3H9HB 1IC7L 4HJ0C 1MCIA 1A7RL 3RVXD 1WZMA 4EN3D 1NGWB 4KPHH 5E70A 3VCLB 1CLZH 3RY5A 4BKLB 4OCRL 4HXAL 1LO2L 2FIRT 1T83C 4P9HH 2R0KL 4LVNB 4NRXA 3D87B 2HG5A 2VQUA 1U2HA 4UTAL 2CIIA 1IGIH 2EKSB 1GCFA 5ADOH 1CFNA 5H8DA 5CJOH 5MERB 5E1AB 3DUSA 2IFFL 1I3GH 5ISZA 1I85C 2YA0A 2DTSA 4FQ1L 4ZFZB 1MIML 2ARWA 4M7LL 4DFHA 3OAZK 3HS0A 2Z31B 4XH2B 4X7CC 1NGZB 1UWXH 4NNXA 3RZCB 1A47A 1A3RH 4J3XA 3BUTA 4YR6A 1Q9KA 1I1CA 4LSQL 4JFFE 4OCNC 2C4FU 4RQQB 3P9LA 2BHYA 3LEVL 4GRLC 1CGSL 1HOCA 4JO2H 5CILL 5HI3C 3VWJA 1YEIL 2MHAB 3ROOB 4CDGC 5GRUH 3V4PH 5KS9A 4LLYB 4BH8A 1AY1L 1S9VA 3ZHDA 3C5SB 2FGWH 3C5ZD 1RPQA 1FIEA 5D2LF 5E7FA 5KOMC 1OAUL 2OTUA 5IFAH 1A6AA 4YDKL 1QVOA 3WXVH 3HZKA 2B2XH 3QULB 2XG5A 5HYJE 5HDQL 5FGRA 5CHNB 4N8PA 4HMDA 2CDEB 3M8OL 12E8H 2FHBA 1BLNA 3BQUA 3EBAA 1T1WB 4YFLI 1BOYA 4OCWL 1S7RB 4M7KH 5DZLA 2W92A 3JWDH 5EUOA 4KK5D 1UWEH 3ROLA 4M5YL 3IDIB 4ZODA 3HE6A 4FABH 1FJ1B 4X9FA 3VGDA 3KS0H 5FECA 2QTEA 1I7RB 1NMCC 4K3EH 2GSGB 2ITCA 1B90A 3Q5TA 5CINH 3U1SL 4JFDD 1RIVH 1LP9B 4LKCB 1U8LB 4NCC2 1NLBH 3SE3A 1UJ3A 2BMKB 4XAWL 4M5ZL 1BGXL 4Z78B 4FG6D 5GIRA 1YDPB 2MOVA 4MJ5B 2DLTA 1KJVB 3PABB 3LHPL 5AZ2H 1MJ7L 4GAGL 1OARH 1F4YH 4YHOL 2VDLH 5FUZH 4YDLC 2QBWA 4QRUA 1A1MB 4P2RB 3QI9D 2D31B 2BNRB 4MNQD 1MWAL 5K9OA 2ZPKL 4Y7MA 1Z0NA 1VPOH 3LH2L 3PDGA 1K4DB 5C70A 3OGCA 5GRYA 5FM8A 2NMSA 3UDWA 4JFQA 4L8BB 2Z8VC 4LF3B 4HCRH 5JHDA 4WU5B 3BZEA 5C0CE 3EOYG 4BH7A 1OL0A 3TESA 2NZ9D 3EDEA 1FCGA 3VXTA 1XGUB 2R2EA 2LQRA 2B7DT 5CCKL 2CLZB 3KLHC 2BVYA 4PRID 1KSRA 1U6AH 2JIXB 3I75A 4G3YH 4MA8H 3E8UL 5ERWB 4OAWB 4ONGH 3KYOB 4IM8A 3SY0B 1MHPH 5C0FA 3IF1A 4LLAA 2C26A 1R3LB 4X5LA 3DXAA 3HCVA 3ARBA 2HJFA 1A6UL 4AM0B 4PJ7E 5B39B 3ME0A 4LRIC 3TIEA 2FO1A 1EFXA 5KSBB 2ICCA 2R56L 1CXEA 4HWUA 4ZUSA 3D6GA 1XCQB 3IFOB 2HFFA 3P0VL 3MUY1 5C0AE 3P9MA 2ZJSH 4GMTL 1QSED 3WO4B 1X4YA 2BFVH 1DQML 1K4CA 2OS7A 1V7NH 3FFDB 4EOWH 2NY7L 3C6LD 3H6JA 3QIUD 3V52L 3HUJE 5T1KA 3BZFB 1AKJA 3QCTH 4N0UB 3MBEB 3PHOB 4KKAD 4MMZC 3MLUH 1G7QB 1E27A 5MENB 4KUZL 1DQQA 2VLJD 3QUYB 1VGEL 3HR5A 4PJFA 4HZAA 2ED7A 3L9RA 4OT1L 5SX4H 4FFVC 4YDVB 5IQ7H 3T0DA 2XNAB 6FABL 4MSWA 3TVMD 1GIGL 1RIHH 3H3BC 3BGFB 3QUXC 3T0XA 4XPAL 3NMEA 4D9RD 3VFTB 3CC5A 4JM4L 5EZOH 2B5IB 1C5CH 5ICZA 5DWUL 2EYRA 4LASH 4L5FL 1P7HL 1YEGL 1OQXA 5INCB 3ELAT 2VAAA 4BQBA 2VLME 3FONA 2R1YB 2DM4A 3TCLB 3C09C 4LVOB 4CADA 4Z0XA 4PLKC 3LKSA 3ULUF 1RUKL 1X7QB 2J4WL 3MLZH 3QIBB 1AFVH 4XP5H 1XIWD 3EO9H 4M8VA 4BFEA 4D0BA 2ZNWA 4NRZB 1G9NL 5C0GB 3O6LL 3O9WD 5C07D 4YHLH 5GS1B 4ORGB 4FTVA 5FA4B 1ORSA 4GAJL 2F5BH 1XF5A 5DQ9B 5LAXA 1A5FH 2CLRA 4OLUH 4TSCL 1ZSDB 1RIUH 1QHPA 4G7VH 1M05A 2HLFD 3LKQA 2VDKH 1PEWA 3TT1H 1U93A 4G9DB 1Z3GL 5CJ5A 2BP3A 3QXTA 3FQNB 2AGJH 2YPLD 1PDKA 2HT3D 2AI0L 4L3CA 4Y2DB 3KR3L 2A6DA 2VXSH 5I19L 3ZTJH 5C0NC 1DE4B 4PLJD 1LEGA 4ZS7L 1EO7A 2BVOB 1X4XA 2BVEA 1KC5L 2AXGB 5T5NG 5J7CC 3GM0A 1Q9OB 2P8PA 4DGYH 5DQJB 1BQSA 4QHMA 1D5XA 1HSAB 4NRYA 2LU7A 3U36B 4P2OC 1WV7T 5J13B 3X3FL 1MFEH 4KJPC 1GJIA 3S98A 3FFCA 1FYTD 1NL0L 3KVQA 3H9SB 2G2RA 2W0KA 5EZJB 4ONFH 3FT3A 3OWEA 4H20L 1UQSB 3V5KB 2YXFA 4XVTH 4AIZA 5E6IC 1RURH 4X4MA 4JFOA 3P4OA 2J7LA 5DEFB 1BQUA 2K9UA 5F3HB 4NSKB 2ICEB 3MTRA 5F1OB 1XH3A 4I5BB 3MODH 5JW5A 1EHNA 5KVEH 4U0QB 4WHDA 1AJ7L 4JHWH 5DJ2B 4LSDA 2J6EA 7FABL 2WWKT 2PW1A 4BJLA 2ADFL 4YGVA 5AYQA 1LE9A 2DMBA 3G5ZB 2BXYA 2JJTC 4HGKC 5IB4A 4P2RE 5IT2H 1J86A 2NXYB 2YA1A 4JFEB 1DR9A 1FVCB 1JGUL 1A0QL 5J9PB 2W1NA 2ESVB 3FHAA 1KBGH 1UVQB 4LPUA 3HAEG 1OT2A 4MGXA 4NQEA 3WE6B 2W0FA 4QF1B 4UTBH 4X6CA 1FV1B 3VMPA 5EWIH 2AW2A 1FE8H 3P4MA 4N8CL 4ZO6A 2UWEA 3GMLA 2Z31C 3MV7D 2QQLL 3KPMB 4J2XA 2JJUA 5IB3A 3IRPX 5D72H 1ZGLA 2COQA 5FB8B 4GKSA 5B8CB 2RJMA 5DTFB 4UAOC 3TO2A 1GGBL 4UUJB 1X9QA 3NIGE 5F6HJ 4UU9B 1AXTH 1FFPB 3RI5K 2PO6D 5CKAA 2AJ3A 1CGYA 1JPGA 4IOIA 4NO5B 3C60A 4JY4A 5T1LD 3S7GA 5DD0H 5HGHB 5KSBE 4PJ8B 4JPIA 2X4PA 4OGZA 2OK0H 4I2XA 5FFLA 3KLAA 2IGFL 5CZKA 3D69A 2XZCL 3R06B 4OD1L 1MY7A 1U58B 3HI5H 4E5XA 4JAMA 4F8TA 4LNVA 5D5MA 2N7AA 3QEGL 3HI6H 4ODWB 2UYLA 4N0UE 1OF2B 3EFFB 3I6LE 3NGBC 5MENE 1B0RA 2HWZH 2GIYA 4V1DA 3O6FB 3QJHB 1ZEAH 2M26A 3T2PA 3L7FB 3D39D 4TVPH 1I1AD 4KHTH 4U1KA 4ZO7A 5HYIA 3V6OE 4UDTB 4Q58C 3MX0A 5MP6L 4QOKA 2HKHH 2VN4A 1KENH 4DVRL 1PZ5A 1MJ8H 1WIOA 4L8DA 4QTIH 1YMMA 4U3XA 1BOGA 1I8MA 3ULVE 3RDTD 4MVBD 4J1UB 3MRLA 4P46D 5E8NB 4PR5A 3WD5H 2AEQH 4P57A 1ITBB 3VWKC 4H0IA 1IGFL 2H8PB 1WTLA 4NQUA 5F7HA 3WCYA 2FIKA 3UJIL 1JTTA 2I9LB 4HFWB 3G6DH 1X44A 4L4TB 2DQFB 4OFVA 4Y4HD 5F96L 3RWDA 4Z7OF 3VXSB 3P77A 3ULVH 2IH1A 2NXZB 4NFBA 3STLB 1ODAA 2HTKC 3QH3B 3UZEA 1RJZA 1DANU 3BD4A 5IIEB 2F9BT 5IBUB 3DWTA 3JWOL 5IMMA 1F4WL 4DAGH 3BVNB 2IALA 1WCBB 2YD7A 3V4UL 5SWZB 3ZE2F 1UZ8A 3FZUC 4DCQB 2W0LA 3VXUD 3HMXH 3WHXB 1RJYB 3F5WA 4Y0GA 3HZVA 8CGTA 3MREB 3D0VB 1Z9LA 4ACPA 3VXNA 1TVBA 1WBYA 3ZZ1A 3U2SA 3P30L 4FNLL 4ODUB 1FGVH 1KLUA 3TZVD 2GCYA 3MYZA 3AVEA 1I8IB 2RB8A 4Z18A 5HI4D 3GHEL 5TDNB 2HRPH 4L8SC 1FIGH 2GJ6D 3B2UD 4XC3H 4Q6IB 1LMKA 4XCEA 3O2VH 4ENEC 1XR9B 1EO5A 2ATKA 3GB7B 4JFFA 3ZO0A 3NH7H 5C2BL 4ZTOH 1KJ3L 2PYEB 2OJEA 3EGSB 4MQXC 3HE7A 2HVKB 5I1IH 3DIFA 4QLRA 5HHXL 4KMTH 2EICA 5FDYA 4HMEA 4PGCB 3F62A 1UKSA 1GGCL 3MRQA 5CP7B 5I75B 5EOCH 3H9SE 4CL7A 4ZAKB 5JDJA 3B5GA 2MNUA 4M4RA 3A67L 3WO4C 4JJ5B 3S5LA 3UTSB 4NQDA 5A2JH 5C0EA 2A1WL 1KCVL 2KQMA 3KYKL 4KHXH 1FC1A 4R4FL 5E2VH 3V6FB 3V95A 4HJJL 3QA3B 3MBEC 4JKMA 5KS9F 1EJ6A 4ZQKA 3F8UB 4XWGL 4QY8B 4Y5VB 3DOSA 3ARTA 4YHML 1RZJL 1VACA 1QRKA 2ZCLH 3ALPA 3O3DA 4G6FB 4FP8L 3E3QE 2R2HB 1IM3A 2X7LA 4ALAL 3ZKND 4JFEE 2L4OA 5JMRA 5EBMB 5CD3B 4FQHB 4XI5D 4KDVA 4MD0A 4XNMB 3ULVC 3QUXA 2QR0A 4WU7B 5LGJA 1AD0A 1BZ7B 1PKQB 3EOTL 2OL3B 4OTXH 3R8QA 1A6VL 1KELH 1PEZA 3G5VA 5K9JH 3CGTA 2F54E 4KJQC 4ZNEA 3MJ7A 5J4MA 4PJAA 2QADC 4NZUH 4HKZB 3S36H 3BKMH 5K9KB 1Z6JT 1EUTA 3L1OL 4PJEF 3FO9A 4K3JL 5ALBH 3T77A 3GSQB 3NIFF 3CVHB 3VD3A 5I0ZA 2DQIH 2EIDA 1U3YA 2OSLA 2X4TA 4ISVA 2NR6D 1HQRB 4M03A 1CCZA 3GI9L 2DQHH 5CSBA 5FO9A 3QCUL 1XGPB 4HCRA 4D9LL 1NC2B 3RWCB 5BV7B 4HC1H 2WIIA 4OLWH 1QO3A 2EC9U 2ZCKL 1VFBB 3BP5B 4PB9H 3LSOB 2A6JB 3B3IB 3G9VA 3MCLH 4R3SA 1P5UA 1H5BC 3LIZL 3WHE0 2BRRH 1U92A 4XC1L 3IJSA 1L4IA 5D1QD 4GG8B 5DT1H 3RIFK 1UXSA 1RUQH 4DW2H 4JGUA 1RJCA 4RGMB 5F6HI 2AJYL 1SJEA 4Y2DC 4P3CH 4YQXL 2F19L 2CIKB 5B22A 1CDIA 1FN4B 4LNRA 5I6XC 5LJYH 2YA2A 5E8PA 4AMKH 2WBKA 1SY6H 4XVUC 3MRGA 4NO0B 1YZZA 3MGOB 5C92A 3WFHB 3AGVA 1MJJA 3M1BB 2XTLA 3BGMB 3V0WL 3ARED 2VXVH 3HFML 4WEBH 1V7MH 1JYXA 3U7WH 1OP9A 4D94A 1YEFL 1BD2D 2FHFA 5DGRA 2YC1B 2NTFA 2ARJB 3BD3A 5HYSB 3ARFA 2DBLH 3RWIB 5DR5L 4C4KO 5L9DL 1FG2A 3WIHL 1CZ8L 5L88L 1T2JA 5IHUL 1H0DA 5A16B 5JHLL 5E6IA 2CUMA 4U1JB 4KROB 4JRYD 2Y06L 4LCCB 2OTWA 1FGNL 4F7CB 3BP6B 5SWSB 3OAUH 3WS6A 4YK4B 3VD4A 3C5JA 4XB8A 2HAZA 4NPYA 2PTTB 4AEIH 1C5DB 3E2HB 5H37G 4KPHL 4L4TE 1CLZL 2NY2C 4MQTB 4P9HL 3H9HA 3W0WB 1G7IB 2NXYC 3TEUA 1GYAA 1CU4H 1NGWA 4KK8C 1IGIL 3VCLA 4CGTA 2ZSVA 4BKLA 5ADOL 5CJOL 3RPKA 2X9XA 5SWZE 1I3GL 1NC4D 4UBDC 4Y88A 1SJHB 1IEHA 2EKSA 3VGAB 1DBAH 1EHAA 2C5DC 4YHKH 3HNVH 4EIGB 5MERA 1U9KA 3LQAH 1ZHLB 1CBVL 5E1AA 2FDBP 1A3RL 1M7XA 2P5EB 2W9DH 4ZFZA 3BH8B 3RAJH 2Z31A 4XH2A 5L7XH 1NGZA 4JO2L 3RZCA 4HLJA 4DUWA 4KXZH 4PY7B 5GRUL 3V4PL 4U4BA 4PJIB 4RQQA 2FGWL 1T1YB 2Q7NA 4Z7WB 3KXFB 3OKOB 2BVPB 5FK9B 3ROOA 5IFAL 2KPNA 3WXVL 2B2XL 4UMGA 1DQTA 4LLYA 5ALCH 1QBMH 3C5SA 3SGDH 3L3OB 3T1FB 4WUUB 4WFFE 4D2NA 1C7SA 3WNNA 2QKIA 12E8L 4PY8J 1KCUL 3UTPD 1S9KC 3QULA 1JPST 1KULA 5CHNA 1OAQL 4M7KL 4RX4A 2GQHA 2CDEA 3ZTNH 3JWDL 1CXKA 1UWEL 3BPOB 4HIEB 5CSZB 3B9KD 4U6HB 5HYJD 1A7PH 5L2JB 2DL2A 2P5WB 1FO0H 1NMAH 1T1WA 4HQQL 3S8WA 4OZIF 4F9PA 2G60H 4K3EL 1FVEB 1S7RA 4H0GA 4CVZB 5CINL 1UACH 1RIVL 3IDIA 5DVLA 1FJ1A 2NYYC 3DMMC 3V2AR 1I7RA 2CXGA 3GO1H 2GSGA 1NLBL 5HHMD 3S36X 3QDJB 1PKQE 2HJKB 5LGHH 1H9VA 1RUAL 4OQ1A 5TPWL 1LP9A 3SO3C 5IHLB 1FL6B 4LKCA 4NUJB 4CVXB 2R29H 4H88H 1U8LA 4S1DC 3G08B 4P3DB 3S96B 4NP4H 1JGDB 1F4YL 2VDLL 3VDCA 1TVDA 2BMKA 5FUZL 4Z78A 1YDPA 1HEZB 2AXJA 4MJ5A 5BS0D 3AXLA 1ONQB 1EAJA 1KJVA 1LEKB 3PABA 2OL3H 1MCBA 3GMOB 1TZIB 1VPOL 3KJ6H 3T09A 2HJLB 3BRDA 3DYOA 3RUGB 1H3TA 4P23D 1A1MA 4P2RA 2D31A 2VDRL 2BNRA 2WMPA 3F6LA 4PS4H 4HW6A 2Q7YB 2X4UB 4HCRL 3CVHH 5FGCB 3B4NA 1K4DA 3NOIA 3I9GH 2DD8H 3SKNB 2X4OB 2FD6H 5GRWA 4L8BA 5EORH 4Y4KB 4BZYA 3RX7A 4LF3A 4V2CB 1L7TH 4WU5A 5BV7H 1U6AL 4PJ9B 4G3YL 4MA8L 2R1WB 4WTZG 5HDOA 3CPLB 2A9MH 1XGUA 3T0VA 1CF8H 1MHPL 4Q6IC 3NIDF 1MCNA 2CLZA 5C0CD 1S9YB 4P59H 2JIXA 1YQVH 2AJVH 4OAWA 4X6CF 3RKDD 3UO1H 3KYOA 3SY0A 3VRIB 2NY3D 2QEJA 3SN6N 4X4ZA 3V0VB 5M94B 1JRHH 1R3LA 5TE6L 5I75C 2EE9A 1CGTA 2FGZA 4NFDA 4OLXH 2ADGB