4JFDE

Preservation of peptide specificity during tcr-mhc contact dominated affinity enhancement of a melanoma-specific tcr
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
245
structure length
245
Chain Sequence
MSQTIHQWPATLVQPVGSPLSLECTVEGTSNPNLYWYRQAAGRGPQLLFYWGPFGQISSEVPQNLSASRPQDRQFILSSKKLLLSDSGFYLCAWSETGLGMGGWQFGEGSRLTVLEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQDPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords HLA class I histocompatibility antigen, A-2 alpha chain
publication title T-cell receptor specificity maintained by altered thermodynamics.
pubmed doi rcsb
source organism Homo sapiens
total genus 45
structure length 245
sequence length 245
ec nomenclature
pdb deposition date 2013-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4jfdE02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4jfdE01
4ZUUA 1JPSH 3HE7C 4JN2B 1M71A 1XF1A 4NGHL 4UI2A 1K5NA 4MNGB 5FOBA 2ESVA 1M4KA 4G8IB 3WEXA 5AG8A 1MIML 2NY6D 1JZ5A 1XR9A 4PJCA 3C9NB 2X4OA 2V5SA 3KHOA 4GRWE 2LU7A 1S8DA 5D1ZD 4YDJB 2JK5B 3B9EA 1FSKB 3QXDA 3OAUH 1QBMH 3T2QA 4L9DA 4EDXB 3MODL 1Q72H 1YQVL 4K2UL 2FHCA 4DZBA 1MI5B 4S0TD 4FQHA 1A22B 1H3VA 3V6OA 2EO1A 1TJIL 1HOCA 4JQXA 3C8KB 4XPHL 3WNOA 4U1IA 4FQLH 3EJZD 1F8TH 5JZ7D 3OKDB 4HGKC 3KJ4C 4ALAL 4OD1H 3WCYA 3I02A 3W9EB 3WUZA 1F4WH 1KN4L 1F42A 4K94H 3WNNA 3OKNB 4EN3C 3RPKA 1U8KB 1T2QL 4I18B 4FMKA 15C8H 3DLQR 3IDMA 4XPAH 5A16B 3O41B 1VFOA 4X6BA 1YN7B 4GRLD 4OT1H 3NA9H 2VERN 4MQ7A 1KEGH 1IMHC 3L95A 5DDHA 4XP5H 1U58B 1TZGH 2DLGA 4QCIA 1GL4B 1OAUH 2AJUL 3SJVD 3H3BC 3ULUE 4HG4J 3BGMA 3CVHA 1CE6A 5DD5H 4YHZH 1IFHH 5J1AB 2PW1B 3QCUH 1NC2B 1T22B 5E2TH 3BYYA 2F9BT 4DK3A 4YK4C 1IC7H 1MLBB 2WINB 3AUVA 1JGLH 3VGEA 2EDBA 4BZ2L 4Q9QL 3V4PH 1RSFA 1SM3H 2J1KA 3SDXF 2HVJA 3RWEB 5JLZA 4GQ9L 1U8QB 4U1JA 1JPGB 5DD0H 3G08A 4OZ4B 2WBJB 4BSJA 1AFVL 1VESA 1DP0A 4NZTL 2EYTB 4U6YA 4LSQH 4MA1C 5I73B 1FYTE 2OR9L 3IDNA 5T3XL 2HRPL 1MCOH 4JO1H 4S1DD 2NY3D 3QPXH 4PJ5A 3KYMB 2F74B 4P57B 5DWUL 5J12B 5DHXB 5KVFH 5HYEA 2GY7B 3ZTJH 5I1GH 4YDKH 3RL1B 4HH9A 2ED8A 4ZXBD 4BELD 1JHTB 3T2NH 5D7IE 2J8OA 2EECA 4FXKB 4G8GD 2D7OA 3NCMA 4I0PD 2PTTB 3TYFA 4RDQF 5C2UB 5F7YC 5ITBH 4U2ZA 3BW9B 3QEQE 4GRLA 3UTSB 4QOKA 4H5SA 2HT4D 5DD1H 3C6LC 3NN8B 4L1DA 1KSRA 1YJDC 1AXSB 1O5DT 4JDTL 3K2MC 3R0NA 4LHUG 3MNWA 4KI5D 4LRNH 4PRDB 5AZ2H 1ZLWH 1LDSA 4KHTL 5SWQB 1I3GH 4LPCA 1T0PB 4HIHA 1L6ZA 3QXAA 4Y2DB 2R2CA 1WAAA 2XKNB 4K3JL 5DQDL 1BOGA 3IU3A 4I1NB 1J8HB 1AGFB 1OGTA 4HT1H 4PTUB 3VDCA 3REWB 1AGEA 1MAML 1TZIA 2X1QA 5GGQH 8CGTA 2R2BA 3HG1E 3O9WC 1OVZA 4QWWC 5D2NA 1OAYH 2DQGH 3JV6A 4XNUL 5CP3H 5FKPA 3C8HA 5DD3H 2NPLX 3P9WB 3QQ4B 4WTWA 1RMFL 1MVUB 5F88A 4LPWA 1WZ1H 1U8PA 2QADB 2G2RB 4AG4H 3DTXB 4I3GA 5DVNA 5AZEL 3SGKC 2R2EB 3MRJB 3O8XB 4ODWA 4JPKL 3RU8H 4ZUVB 3QHFH 4TNWF 5EZJB 4L8BA 3NZHH 2PETA 2DLFL 4IBLT 4YHIB 5HVHC 3DUHA 4PGEB 4F15B 1C5DA 1QLFA 3P11H 3GSWB 1JNHA 1YMME 4Y4KB 2O61A 1C5BH 1V3JA 2KUTA 5E03A 4WWKC 3KLHD 4A2MA 3DGGA 4PRAA 4X4YA 3EKCA 5E4EB 5FM5O 1FVEA 1CICC 2GAZB 4URTB 5T3ZD 5DHVA 5E4IA 1MCWW 1MFEL 1S5IH 4YDIH 5JO5B 2NQCA 4YR6B 2VWEE 3IDYB 3H3KA 1ZKAA 3MRCA 5IEHA 5J3HD 3WKNA 1EGJL 3CMOH 1JTOA 1CE1H 1RZ8B 4DAGL 2COQA 3KXFD 3CSYA 5FF6A 4MD0A 1M7DB 5J9PB 3QA3B 2HKFL 5DD6B 1UG9A 4R6UA 4J3WA 5BZWA 2W0FA 3B5GA 3VMNA 1BECA 3O2VH 3AFLA 1ZANL 3CSGA 3PWJB 1HHIB 5JA9A 1MHEA 2ZJSH 5EIQA 1JF5A 3CAFA 3HE6A 1TQCC 4XWOD 3ALPA 3K1KC 2P4AB 5IFHL 3TIEB 3U7YL 4NP4H 4JDZA 1FORL 5BRZB 5JHDD 3W5MA 5DTFA 1G1CA 1MNUL 3BSZL 3QDJE 1CGYA 5HYQB 4OCXH 1KJ2H 5H94B 4U6HB 1I8MB 3O2DA 3PGFL 4K7FB 1WT5A 4MAUL 3GSUA 2DS4A 1FO0L 2EDNA 4ZNEE 4GG6B 2X41A 2HJKB 4C56E 2VO5A 5GJSL 1MQ8A 1IEAB 1OWRM 1FZJA 5JOFA 2CIIA 4LP5A 4YDLC 1ZHNA 3P4NA 3MJ9A 2ATKB 3WBDA 3HPJB 4P3DA 5I8OL 3O6FB 3VXOB 1MH5B 3N0PB 2IALA 3PDGA 4W6WB 2BFVH 5DS8B 4Z7UB 3BXNB 4NN5B 2MJWA 1TTGA 1ZHLA 1OTSD 4XNXL 3VFSB 2AK4E 5I1AA 1QRND 5JPMB 3MJ6A 1O0VA 1U92B 4PBVC 1MEXL 3DVNA 2WLYA 4TUKH 3RWIA 3GMMB 4LOUC 5DHYB 3LS4L 4JY6A 5DVMA 5HI4D 5BOZG 2MNUA 3UTTB 1FGVL 1MAKA 5I17B 4TVPE 1BVLB 2VQUA 1WBXA 5JHLH 1F4YH 1N3NA 1RZJC 2GK2A 5FKAA 4NCC1 2Y4SA 1RJZB 4R3SB 1G9ML 1WEJL 2FO4B 4JJ5A 3DMMA 1FL3A 4HCRH 4LLQB 3CXHK 3BDXA 1B0RB 3L3IA 4GRWH 2CIKA 3H9SD 2CLRA 1KLFA 1FG9C 3V5DA 4GW5A 3U0TB 4P5TB 1OT1A 4P5KB 1J18A 5I66A 3ARGD 3HA0A 2YUVA 5JHDA 2DQHL 3GSRB 1SHMA 3QUXC 5J13B 1DLHB 5GPRA 1VENA 2VAJA 3HI1A 4X8XA 5FK9B 5BO1H 1NEUA 5FGCB 3QNXA 1MCNA 2Q87A 1S7TB 1F6AB 4HIXL 5AYQA 1XZ0A 3NH7L 3CH1B 3C60D 1P84J 2X7LA 4R96B 1D9KB 3V0VB 1QR4A 4MA7H 4S1QH 4XMPH 5D1XC 1NMBL 2EE3A 4JM2B 5E7FA 5K9JH 4OZHB 2OZ4L 5C0CB 4ORZC 5D8JL 3PQYE 1TVDA 3VXSE 2P42B 2IQAA 3T8XB 4HWNA 3SDDC 5DJ0B 5T5NF 2MHAA 1WV7T 2Y5TA 5DK0A 5LWYH 5I76B 5MHSE 4NN7C 5C0IB 5BCAA 2G75A 1FFOA 2YWYA 4GAYB 1IGJA 3RIFK 1U8MA 3OR6A 5F1IA 1UACL 4ELMF 3KYNB 4OQTA 4RRPA 2C1OB 3BZFB 1T66C 1QRNA 1F02I 5KJRH 3BKYH 3L3JA 1YN6A 5DK2B 3ULUH 12E8L 1D5MB 4WHYH 5JNYA 2CRIA 3NFNA 5IQ9B 4Z8FH 3P4OA 2GCYA 1DVFB 5IKCB 3ECBA 3GBNL 4Y1AD 2HA1A 5TE4L 1CFVL 4OTXH 5D1QA 3L5IA 3T3MF 2ZUSA 4QO1A 5GZOD 1YY8B 5EU4B 4KXZI 5CEXB 4ZPVA 2EIDA 3MLXL 4QXTA 4PS4H 3MLSL 1TVBB 5EUKB 1JPFB 1T3FB 1LDPH 3H9SA 3QUKB 5DLML 1SBBA 3N1MC 2ITDA 4UUJB 4XBEL 2XA3A 3F12A 4CDHA 5T1KB 4EJ1C 4HG4K 5IJVA 1J0YA 3B2UC 2GTZB 4KAQL 4HWZB 3ARGA 2QHRH 3UTQA 3MLZH 1IQDA 2PCPB 3O0RH 4PJ9A 5E8OB 1QFUL 43CAB 3VW3H 3BIBX 3HCVA 3TA3A 1G6RH 5EU7C 2CO6B 2XQYG 2A9NL 3BH8A 1PQZA 2P8LB 4PJAF 3ZKQD 4OCRH 5GGSB 4DOHB 3C60A 5CINH 3V6FA 4PJFA 4WUUD 4Y5XA 1DR9A 3L7FA 3MACH 4YGAB 2A83A 2VN7A 2GSIB 3KPNB 1P1ZB 4DEPB 4JPWL 4R26H 3TCLB 3MRRB 3QAZB 2NR6C 3IFLL 3WJJA 2YC1B 2BERA 1RULL 1T04B 2P5ED 1JYWA 1MHPL 2VLRD 4NNYA 5E00B 5HTSA 1P9MC 4CU8A 1AQKH 1XF5A 3JWDH 1RUQL 1A3QA 3ARDD 2NY0C 1NFIB 1MFDL 1HXYB 3ESUF 4DN4H 4G80B 1RZKH 3V0AC 3G5VA 3LEXB 1Q0XL 3FQNA 2JCCE 4R4FL 4KQ4L 4MDIB 1BJMA 4G6KH 3TZVD 4X7CC 3HNTL 4APQB 1RU9L 4PRHB 4FQ2H 3N9GH 4UQ2A 4BUGA 5HHNB 1IM3A 1NBYB 4LCYA 4AIXA 3WLWC 5ALCL 1QLRB 4L8SA 1CD8A 3L3KA 3NIGF 1YPZF 1BFTA 1ZLUK 1BD2D 4AENA 2MTPA 2VLKA 3LZFH 3OAYK 1FL6B 3CD4A 3DROB 5F7HA 5HGAA 2ICWA 5F9OH 2H3NB 4FQXD 5DA4A 1RD6A 2UWEA 4JHWH 5GGSY 3S96B 4BUHA 5DRWB 2AV1B 5D7LD 1R3HB 1PX4A 5FGSA 1ZSDB 1CU4H 1Z3GL 4P59L 4H1LG 5EFIA 4GXVH 3LS5H 2AQ3A 3VMPA 4Z7VE 1AGCB 3IYLW 5GXBB 5EU6E 4O58H 4BH7B 3C09C 4KY1L 5IK3B 1U3HB 3IXAB 3QEGL 2DTSA 4ZODA 4IOFD 1S7SB 4LGRB 5HHOD 3C2SA 1ZHKA 2PXYB 2HKHH 2I25N 1CFSA 2ZPKH 3DV6A 3JBG7 4OF3A 4C59B 1XCTB 1F3JA 1TCMA 4K8RL 1CLOL 2KKQA 1T2JA 4Q9RH 5FCUH 4FA8A 3GIZL 3MFGB 1QFWI 1Z9LA 4X6CE 2P5EA 4ZO6A 5C09E 1KC5L 3VG9C 4Y16B 1QLEH 5BZDA 1BAFL 1ED3A 3U36A 3SDCA 4PRPB 5ID0B 1FZKB 3F58L 3UYOD 2F53D 1JTPA 1S3KH 3BH9A 1NUGA 3DUSA 3WMSA 5F1SA 3VFGH 2UYLB 4IRZH 1MHCB 4NSKA 4ISVB 4PY8I 3HLAB 2XIDA 3HS0A 4NJAL 3RRQA 5HHME 2CRZA 1XGTA 4ZUUB 5FGBC 4FFYH 2NY2B 5JQ6H 4KUCF 4PFEA 2J88L 1M71B 1B4RA 5I15H 3TO4B 1K5NB 2OP4L 4MNQE 5FOBB 3K8LA 3WEXB 4ZAKC 1XR9B 4PJCB 4D0BA 4RFOH 5C6PB 2X4OB 2QV2A 4JFEE 1QVOA 5E95B 4WFED 1S8DB 1FNAA 4FTVE 4FQXA 2NXZD 5I1KH 3QXDB 2X9XA 3BT2H 4KTDH 4GMTH 3OB0H 4DKEL 4O5LL 3TIDA 4U31A 4DZBB 2XYCA 4XB7A 4FQHB 3JUYA 2FH8A 5C2BL 5CKGA 1HOCB 1PAMA 5FUOL 1S7VA 1QNZL 1W0VA 3BE1L 4U1IB 1PKOA 3LD8B 1VEPA 2FEEI 5CP3A 1HK6A 2D03L 2WANA 1BQUA 1QTYT 5HHOA 2YMXH 1A5FL 1OLZA 3CDYA 1LMKA 3BYTA 3M17A 3RY5A 3DI3B 3LKPA 2FJHB 3W2DL 5D96C 2AI0H 3TT3H 1U93A 2YZ8A 5JR1H 2N4IA 3MV9E 4TOYL 1A1MA 3IDMB 4TVPH 4U7MA 1VCAA 1R3KA 4X6BB 4F80A 3H7BA 2JJVA 5DJ6A 4MQ7B 3ZE2E 4KK6C 2B1AH 4JG1L 5DDHB 4OKDA 1U8OA 5GS2D 4QCIB 3STBA 1RFDL 2ADJA 1CGSH 4ZOEA 4K07A 4LVOB 3QRFM 3LB6D 3RTQD 2HTKC 3BGMB 3CVHB 5C07E 1CE6B 1GC1C 5IT2L 2FCBA 3UZEA 3GNMH 5I1EH 2YA2A 4XTRC 4L3ED 1U6AH 3SKJH 3SE8L 1WBYA 2X2YA 4IDJH 1NCWL 2A6IA 2NY6B 4F58H 3JWNC 3CC5B 3TVMC 1KCSL 1BZQK 1A0QH 5JW3H 4IRSC 4PRNA 4PREA 2R2HA 2YKLL 4U1JB 3G08B 3V52L 5DVKA 3RX5A 2VXUH 1J0HA 5E7BA 4LDEB 4Z6AT 4ENEC 1L7IL 2ARJQ 1MFBL 4U6YB 4XCCL 1R3IH 1OTUD 3IDNB 1NCAL 4MXWH 4N8CH 1KJ2A 1L7TH 3QEUA 3T1WA 4PB0H 4PJ5B 3MLVL 1IT9H 5ILTL 2ADGA 3N1PC 3U79A 5E8DH 5HJ3A 2VDML 1CGXA 2IG2L 1AD0A 1I8LC 3BD3A 2IADB 4PJBB 4HWEH 4LLAA 1UFUA 4UT7H 1CK0H 4HH9B 1A6WL 1G9NC 2IFFL 1K3ZA 3J8F7 4OZIF 3HTLX 1J8KA 2GJZA 1DLFH 4F3FA 1QG3A 3TYFB 5BS0A 4FN0A 4FHBD 5C3TA 4W4OC 1JL8A 3NCEB 4M1DH 4WHTA 4GRLB 3IAQA 4QOKB 4ETQA 2Y6SD 1OTTC 2YRLA 4H5SB 2Z8RA 1JNNL 1IQWL 2NTSP 2EKSB 3MNWB 3S98A 2R4RH 1QFWH 2D9QB 3SJVB 5DF0A 3CVHL 2A6JA 1SQ2N 1KIRA 4KKBC 4JN1L 1NFDF 3RTQA 4HIHB 4WEBL 3IU3B 1FRGL 1OGTB 1Z0MA 2P47B 2PW2A 4JY4A 3P2TA 3VXME 1Z0NA 1AGEB 1TZIB 3DVFA 4MA8H 1DQDL 4R0LC 3PGCA 4P3CH 4HCRA 5E6ZA 2XZAH 2D7QA 3Q1SL 2LE9A 5FKPB 1F6FB 4E0RA 3S37L 3GHBH 1NL0L 5F88B 4M4PA 3S34H 1LO4L 2OCFD 3U48A 4WO4D 3TBSB 3P73A 4MWFA 4ODWB 3FO0L 4RBPH 3MV8E 4JRXD 4QXGL 3S35H 4L8BB 5IOPA 2ZSVA 5EZOL 3FMGH 4AEIH 3QZWG 1JNHB 4LP4A 4OCWH 2O61B 3O6LH 1ZV5A 3ARBC 3D18B 2EDFA 1T6WA 1PLGH 3BMVA 3DGGB 4PRAB 3THML 4ZXBB 2R0WH 4X4YB 5D7SH 1J1OH 1FVEB 2GHWB 2Y36H 3SE4C 5DHVB 5CZVL 4LF3A 4I0PB 4YX2H 3U1SL 1BQLL 1CD9B 5KZCB 1BFVL 1LE5A 5F8RC 3QEQD 3HZKA 1LO2H 2CUHA 3MRCB 5IEHB 4OBRA 3RGVC 2DM4A 2ZWLT 5BJTB 1MFAH 1PY4A 4YXKL 4MD0B 1OCWL 2NY5C 4JAMA 1AXTL 5BZWB 5E0QA 4KPHL 2Q7YA 2W0FB 1DQTA 4JZOA 1OD7A 2XICA 5EOCH 5EOTA 1KLGA 2VDPL 1EJ6A 3OJVC 4Z7QF 4ONGH 1MHEB 2JIXD 1A7PL 2DN7A 3HE6B 4L1HA 3BP5A 4OUUA 1YUHA 4NWTH 4JDZB 5DTFB 3KPRE 3RDTA 3HG1D 3MRPA 3QDMD 2DJUA 1D3CA 4XMKH 1LVEA 1QD0A 1ITCA 1QRKA 2AXFA 5D2LE 1H9VA 3GSUB 5C3LD 2UZXB 5L7XH 1J11A 3E6HB 3BWUC 3K0WA 1D5XA 3BO8A 5FYLE 3VI3F 1NCDH 4I9WE 4WJ5A 2AJYH 4K3DH 5JOFB 2CIIB 3CFKA 5HI3D 1FYTA 2APFA 2BRQA 4NC1E 3P4NB 1RIHH 5CILH 4WTZG 3S4SG 3U9PL 4JPVH 4PJ7E 5JXAH 3DRQA 4JZNB 4OZGE 4P3DB 1MJ8H 2IALB 2VKWA 4BFEA 3GI8H 1FNFA 4MS8C 4M93C 1IBGH 3ZDYE 4FABH 5LQBL 2EZ0C 2MQCA 2EEAA 1ZHLB 1ADQH 5EU5A 3KYKL 5MP6L 2UZYB 1QFPA 1FNGA 1RJYA 4ONFL 4BQ8A 5I1AB 3QEHA 5D7IA 5F9DC 5I74B 4OGXH 2DIJA 1PYWA 3HRZA 3DVNB 1I1AD 2XG4A 3RWIB 2XV6B 4JY6B 4YEEA 2CUMA 3RJQB 2JJWA 3T65A 4QRRE 3T3PF 3QEQA 1CF8H 1N0XL 4GQPH 1N3NB 3MLRH 3EFDL 4KJQC 3D85A 5FKAB 1EFQA 2CKBH 3SGEI 3PDOA 3DMMB 1FL3B 1G6VK 5CLWA 1D5BA 1Z6JT 2BOCA 3QHZH 1P6FA 5CD3B 4CGTA 4IOIA 1IGFH 1DQLL 4TSBH 2CIKB 5TE7L 2O5XL 2CLRB 1VEOA 2XZCL 3FB8A 2N1KA 4JGMA 3V5DB 1KJ3H 1SBSH 4GW5B 1JF6A 3TP4A 4J12A 3DIFA 2R15A 5I66B 3QIUC 5JHDB 2J6EH 1WFUA 2WAHA 1WJ3A 3O2DL 3FOLA 1MF2L 2W60A 1YEDA 3QNXB 4ZMAT 4MJIE 4G42A 3U6RA 3EYOA 3RI5K 1JMXA 1XZ0B 3EYQD 2X7LB 2X1OA 3H42L 3MCG1 4HMEA 2XTJE 4ODVL 1YEJL 4Y8AA 3MJ9L 1FFPA 5F9JA 4HEME 1OAQH 2EEBA 3N85H 3ISWA 4FQIL 4LCIL 1TJGH 4QLRA 2WQ8A 3JXAA 2IQAB 4OFVA 2EDWA 2MHAB 2Y5TB 5DK0B 1XFPA 1HSAA 4L5FL 4LLYA 4YXHH 1YMMA 2G75B 1RZFH 1LO0L 1FFOB 2XY1A 1IGJB 1U8MB 3OR6B 5F1IB 5H2BA 4D3CH 4HV8A 3QH3B 2DQCL 1RVFH 4F7CA 1QRNB 4OD3H 2CMRH 5J11C 2OJZL 3RHWF 3L3JB 2A74A 1ZT1B 1OP5K 1YN6B 1RUML 4E9LA 1GIGL 2ORBL 5C0JA 5LVEA 1NAKH 5GHWL 5JNYB 3NFNB 5T1LD 2O5YL 3P4OB 2NZ9C 2GCYB 3F7YA 1MY7A 3ECBB 1KJMA 4NHCL 1CR9H 3BZ4A 5L2KE 3GK8L 5F7MC 3SE9L 2R8SL 2A9MH 5D1QB 2FRGP 1R24A 4RWYH 2XQBH 4G6JL 2Z31D 1S7XA 3T1FA 3TBVA 4ZPVB 1TFHA 1I7ZA 1NGQL 4WU5A 4U3HA 3WXVL 4DZ8A 3DOSA 5I0DA 3H9SB 1N8ZB 1EAJA 2ITDB 5IJVB 3F12B 2CK2A 4ZYKA 3VDBA 4Z0BH 5FFLA 3ARFC 4MAYD 3TH4T 3ARGB 4NQEE 2XI9A 3UTQB 3H3PL 1IQDB 4PJ9B 1UQSA 4LCWE 1UEMA 3HCVB 4ZOAA 5FGRA 3QDJA 3TA3B 3STZA 4C83A 5JXED 1A1NA 3BH8B 1PQZB 2Z35A 4PJXF 2WP3T 2ADIA 5CHNA 4ZNEA 1MCJA 5L9DH 3C60B 1I9IL 5LJYH 3O4OC 5FUCC 3V6FB 4PJFB 4C56A 3ZYJA 3OX8A 4Y5XB 3L7FB 4HBCH 1IAIM 1TQBC 3L5HA 3D3VE 3CCHA 1XGPB 1DN0A 2VXQL 3VXSD 2M1KA 4X7FC 1ZLWK 5B39G 3BN9C 5EO1A 1W0YT 4NNYB 5KVEH 4FFVC 4OQTL 4EDWH 3DBXA 2YPVL 4I2XB 1XF5B 5F3BB 4UTAL 3RVWD 3NIDF 4PLJC 2Q3AA 3W9DA 3HC3L 1HKLL 2B0SH 4GG6F 2AK4A 2LFGA 3G5VB 4M3JA 4X7TA 1XF3A 3FQNB 1MUJA 4YFEA 3TT1H 4TSCL 3QI9C 1EMTH 1A7RL 1IC4H 4H25A 3G04A 4HPYH 1GGBH 5D7JA 3B83A 4OGYH 4QHUA 1IM3B 1J86A 2EIZA 4LCYB 1F13A 1ZEAL 3VRLF 1H3TA 1E4KC 3MRDA 4L8SB 2P8MA 3L3KB 4Z7UF 2CLZA 4U6VH 4AENB 3B5HA 2VLKB 2AXJA 3KPPB 3ROOA 3GM8A 4CL7A 1BQHG 4JFDE 1JPSL 1ES0A 3T0EE 5HGAB 2ICWB 5HHVH 2ED9A 4Q0XL 3IAGC 2UWEB 1WZKA 3V5HA 2H1PL 4HKZA 4IMKA 1B3JA 4LMQE 3SGEH 4O02H 3U7WH 5EFIB 1M1SA 3EOYG 3U9UA 3TJHD 4GXUN 3W11C 3PL6D 4IS6A 4UILL 4M02A 4PGDA 4XC3H 3QISA 2BJMH 3QUYD 2NX5E 2GSGA 1ZHKB 1CFSB 3DV6B 1YC8A 1F3JB 5BW7A 3PQYA 1FNEA 3VU2A 3VXSA 2C9AA 3MBED 2M26A 3JWOH 4C57C 4DN3L 1B90A 2P5EB 3DETD 1JVKA 2R0KL 1RUKH 1F8TL 2GEEA 1J05B 1VFAA 2FGWL 4OD1L 1ED3B 3U36B 3SDCB 3ARDB 4AM0A 2DQDL 1F4WL 1GZPA 1JPTL 5IBUB 3A6CH 1XCQA 15C8L 1YEHH 3BH9B 2WWMC 3QCVL 3DUSB 1IGCH 3VA6A 3VD7A 4U1SA 4NSKB 4Z7NF 1YYLL 2YUWA 3HS0B 1KCRH 2VB5A 4QRQA 3NA9L 2VLJA 4NKQB 4WHDA 1XGTB 1KEGL 1J1XH 4RFEA 1D5IH 1VGEH 2MPAL 4XP5L 1RI8A 2FHBA 1TZGL 2XG5A 1LQSR 5B4MD 1OAUL 4JANA 1BD2B 4I18C 1UM4H 1DDHA 4Y4HA 4D0BB 4IIQA 4DGVH 4UQ3A 4HXBH 1IFHL 3IFOA 4IRJA 4YHZL 1QVOB 3SCMD 1HHKA 5E2TL 5FYLH 2M2DA 1ZLVH 4FQXB 5CEYB 43C9A 2AS5M 1JGLL 3MRFA 5D7LB 4AH2A 1U95A 2EYSA 3TIDB 3FN0L 4JY5H 2FHFA 3VWKA 2VUOA 5F71A 4XAWL 5CS7A 1S7VB 2Z93A 1W0VB 1VPOH 5DD0L 3ZYIA 3NAAH 1FBIH 5LGKA 3E2HB 4XBPA 3QUYA 5HHOB 2BHUA 1BWMA 5E70A 3M17B 5M95B 5ESAA 5K59F 1TCRA 3LKPB 4JO1L 2VR4A 1DSFH 1U93B 3QPXL 4N8PA 3MXWH 2FB4H 5C09D 4N0FA 3I6KA 1A1MB 3AB0B 2WBJC 1HXMA 3UDWA 1ORQA 1R3KB 5I1GL 4PJ8D 4YDKL 3GKZA 3H7BB 2EO9A 5T33H 5I73C 5DJ6B 1CN4A 1U8IA 3MJGX 2VXTH 3VXQA 1YEEL 4LMQI 3PF2A 2JCCA 1U8OB 2A2QT 2G60H 4PLKC 4X9FA 5L88H 2QHLA 5TQ0L 2ADJB 4NUJA 2R1WA 5SWSD 5ESQA 5E24E 5J12C 1EXUA 5H37G 4MD5B 4PPTA 1G9NH 1FNLA 3FAXA 4J7RA 3L6FB 3GJFH 1WBYB 1E6OH 4MNQD 5AZ2L 1QQDA 3TJEH 3OG6B 4LFHD 4CNIA 2A6IB 4OFKA 5ETUA 5F7FA 3AS2A 3ARSA 3MZGB 4X5WA 4PRNB 4PREB 3W0WD 3FQTA 3AS1A 2NXZB 2DBJA 2R2HB 1QEWA 3FFCE 5DRXB 5GS1A 3CFCH 1F3DJ 4Z7VA 2OL3A 1KJ2B 5EU6A 4Y2DC 1MIEH 3MA7A 2VZ3A 5TFSH 3O81A 1WZ1L 3QEUB 2OSLB 3RVUC 4TULL 3LPGA 4HS8H 2ADGB 5DMYA 4OGAC 2BNRE 5HJ3B 2IH3A 1BQSA 1AD0B 1JZ4A 2DQTH 2XTLA 5IQ7H 5TF0A 1IAIH 5EORL 3RIFF 4J4PC 1BJ8A 4X6CA 3NZHL 5C09A 4YE4H 4OGZA 2GJZB 2QSTA 4F3FB 3L3HA 3PP3H 2OR7A 3QUXA 5BS0B 1C5BL 1OL0A 2LU4A 1VFMA 3VXRE 4PJ8A 2QADC 3VMOA 3TPUA 4WHTB 4ETQB 1ADQA 3O8XC 1INQA 1N5AA 4J3TA 4OIIL 3TN0D 4POYA 5HDQH 4YDIL 1NFKA 4NZUL 2A6JB 4HJJH 4ERSH 1KIRB 2OQJA 4F15C 3RTQB 4Y4KC 3DSFH 4PJIE 4WW2A 3T2PA 3ZE0E 3IDIA 3IU4H 3UPRA 3MCKA 1U8NA 3WIHH 4PJHB 3STLA 4F7MA 4JY4B 3RGHA 5E4EC 2CKBA 2IAMD 5A2IH 3O2VL 3PGCB 4HS6A 4PJDE 1ZA3A 1MHHA 2EDYA 5K9QG 4JFEA 2JB5H 3IDYC 2ZJSL 4GRWB 3GHEH 5GRJH 4FTVA 5CBAB 2NY5H 4BH8A 4NP4L 2MMXA 1KCVH 4E0RB 5I2IA 1HCVA 2P49B 4OCXL 2J6EA 3FB5A 1KJ2L 2VIRA 4OLWL 3A0OA 4NFCA 1G9MC 2YD4A 3ARED 3P73B 4GLRI 4D9RD 5FECA 4EIZC 3ZDZF 3QIBD 1A21A 4OAWA 1UJ3A 2UZIL 4PJCF 4BFGA 2X9YA 5IOPB 2ZSVB 3RVTD 4PP1D 5GS0D 5IV2A 1MPAH 5GQBA 1F4XL 1MCRA 2NW2A 4J3UA 1P4BL 3UP1A 2HT2D 3MV9A 3ULVF 4UOW0 1Y0LA 2BFVL 4LF3B 4JDVA 3I3EA 1JZ2A 3CLEH 3MRBA 1LE5B 3HZKB 1A6TA 4HPOH 5DJCA 3T08A 5IROA 4V2CB 4QTIH 4TUKL 4XVUC 1B9ZA 1YMHA 3TV3H 4JAMB 3O6FC 5GRWA 5L8LB 3EUUA 2FL5A 2Q7YB 1ACZA 3IJYA 1W72H 4JZOB 5C07A 3QFDA 4NN5C 2BC4A 2OJEB 1F4YL 1KLGB 4WW1A 5CFHA 5JORA 5CD5C 4PY7A 2BZDA 3BP5B 5E8NA 4OUUB 1YUHB 1HHGA 3VXMD 3RDTB 1NAMH 2VLMD 1CDIA 1JWUA 4UBDD 3MRPB 4PR5A 3FO9A 3EJYD 2AXFB 1BGXH 4OCLC 2EH8L 4MB4A 5CJOH 3VI4F 1D5XB 3BO8B 2HLFC 3MCLH 1KN2H 4WJ5B 5BO1L 1F00I 3CFKB 1FYTB 4RMSA 4LU5H 5LXGH 3CSBA 3DRQB 3U7AA 2B8OT 3IFNH 4P5TC 2EDKA 4HLZH 4WFHE 1QSFD 2Z8WC 4B53A 5HHQA 5EBLA 4HQQL 3I3DA 2ENYA 1N2RA 4UB0L 5K9JL 4NKIL 5D70H 3S9DB 5J13C 4QGTA 4KJPC 3BIAX 3VWJD 3LN4A 3RZCD 4PGJA 4YHKH 1UM5H 4H0IA 1FNGB 1RJYB 3QEHB 5D7IB 3UTSE 1TDQA 4NNXA 1D9KC 2CXKA 4N1EA 4KQ3L 3T65B 5CEZH 4HF5H 3QEQB 1UXSB 5KJRL 3OB0K 2FJGA 3BKYL 3MRKA 3EW3B 4X6DE 3D85B 3VGHA 6FABL 3ULUL 3FONA 1TXKA 2QJDA 3GUTA 1D5BB 3PXHA 2BOCB 4KROD 2H32H 4JFQA 4XP1L 3BQUD 4RGND 2DI8A 5I1HH 5C0ND 3DIFB 3VXMA 1OPGH 3DVIA 4EI5A 2VR9A 1R5IA 4M5YH 4PS4L 3HG1B 3FOLB 4OB5H 3WL9A 5IVOA 2W60B 4DVRH 1DBKL 5DR5H 1YEDB 1KJVA 5IHLB 4AT6A 4HJGA 4G42B 3U6RB 3EYOB 1X9QA 1DVFC 1HKFA 2QHRL 3HUJE 3VRJA 3MLZL 3VW3L 4JKWA 3P0YH 4JFFD 4EUPG 1FFPB 1WAAF 5F9JB 3BVNA 1T83C 5JW5A 2WV3A 1PKQE 4OCRL 1S9XA 1PG7H 3MV8A 5CINL 2H6PA 2XACC 2YK1H 4KV5E 1H3PL 1ND0A 4LLYB 1ZVYA 1MCWM 4J8RB 3MACL 1YMMB 3PABA 4JJHA 3KPLA 4WFFD 5H2BB 3JV0A 3X14A 4HV8B 4NPYA 4Z95H 4R26L 1AE6L 4LHUA 4F7CB 1YNLH 3C5ZA 4GLRH 5DJZA 3FB7A 1OAZL 5C0JB 1AY1H 1B0WA 1AQKL 5A2KH 3ARPA 1U8HA 3JWDL 4QRRD 2ZUXA 3VJ6A 2YBRA 3IJHA 4R4NC 4P48A 3F7YB 1LD9A 5AAWA 2X89D 1KJMB 5I16A 1RZKL 3BZ4B 5DFVD 4DEPC 3S3SA 2FLRT 2BSED 1R24B 3U30B 3CZFA 4OIBA 4G6KL 1RIVH 4K8RC 3T1FB 3TBVB 3D0LA 1I7ZB 3HMWL 4FQ2L 2C3VA 4WU5B 4XVTL 3MODH 4DZ8B 4U7KA 3GSXA 1S7WA 3BQUA 3NFSH 4ZYKB 2N56A 2WW8A 1KUMA 1DUYA 1UWXH 4PG2A 3AM8C 4KTEH 1TJIH 1MCBA 2DQJH 3VCLA 3KPRA 1UQSB 1NKRA 4V1DE 3QDJB 3STZB 1F3RB 1A1NB 3ILQC 4NO3A 4PUBH 4KK5C 5D2LA 2Z35B 4APQC 1ZVHA 5F9OL 3QT2A 1RUAH 2ADIB 5CHNB 3BD4A 2Q1EA 4HKJA 4ALAH 4ODTH 5DEGA 1KN4H 4C56B 3OX8B 5F6IB 1T2QH 3IF1A 4G9FE 4GXVL 1P53A 3LS5L 3S5LG 2YOCA 3CCHB 1DN0B 4X4XA 3BWAA 4O58L 4PJ7A 1NLBH 1UC6A 1ZS8A 4OZGA 4J1UA 5EO1B 1IGTA 3CJJA 1JGEA 1KYOK 1NCTA 3G5XA 4B5EA 1LK2B 4HFUH 2HKHL 3DBXB 4FXGA 1ZOXA 2QTEA 5IBLD 1A6ZA 4HKXA 3W9DB 4Q9RL 2AK4B 3PG2A 3RWDA 2D7PA 1CFNA 3CDFA 1XF3B 5E6YA 4ZFOB 1QLEL 3B8SA 4YGVA 2L7UA 2H2SD 3H2WA 5F9AC 4QRRA 2P24A 3LKNA 4XPGL 5D7JB 4QHUB 4BQBA 2PXYC 1ZAGA 2EIZB 2X89A 4KHXH 5GISH 2EH7L 4S2SB 3H0TA 4RGOH 4BZ2H 3IVKA 4Q9QH 1MSPA 5DYOA 3MRDB 3GSOA 2QQLL 1BWWA 1I8KA 3VFGL 1JWMA 4IRZL 4Y4FD 2CLZB 5F96H 3LPWA 2Z92A 4L4VD 4GQ9H 5FIEA 3ROOB 3UYRL 3ME0A 4RBPK 4Y16C 4GKSA 1HN1A 4I5BA 1EZVX 5SX4I 4G3YH 5JQ6L 1ES0B 5DSCB 2WIMA 4AEEA 5T3XH 1OHQA 2HRPH 4A6YH 3SGDH 3V5HB 4HKZB 5DI8A 4XP9H 3GJFA 2XZZA 4RFOL 3EO9L 3B3IA 3IB4A 4MJIA 2IPKA 5DWUH 3U9UB 1MFCL 3IT8D 4IS6B 4YHLH 4MCYA 2NY2C 4PGDB 2YD1A 3HMXA 4KTDL 2W65A 4GMTL 2IQ9H 1UZ6F 1JIBA 4GMSL 3TO4C 4AZ8A 5HD8D 2GSGB 4F7PA 4NKMA 3D3VD 2C1PA 3PQYB 3VXSB 3PWLA 1PD6A 1A02N 3BJLA 3FZUC 2VTFA 3T0WA 4NIKB 1OLLA 1VFAB 1X5ZA 4JDTH 1QA9A 1T80A 4KHTH 2I60H 3V6OC 3JV5A 2QEJA 5JR1L 3KPMA 3VFOA 1XCQB 3LD8C 3UTPE 4U1SB 4TVPL 3FN9A 3MGOA 1K8IA 4QRQB 3JUZA 1MAMH 5C70A 2B1AL 3FTGA 4RFEB 3IRPX 5L2KA 1HNFA 4JHAH 2C5DC 4JANB 1CGSL 3OXSA 2DLEA 1KTLB 4Y4HB 4JFDD 2C26A 3ROLA 4IIQB 4DGIL 5BVJA 1VADB 4IRJB 5I1EL 4KZDL 1UEYA 5AZEH 1HHKB 4PGCB 2DTML 1U6AL 3GBMH 4LSPL 1VEMA 1M7IA 4NQEA 43C9B 1XF4B 2DKUA 5SWZA 4IDJL 1NDGA 4ETYA 4JPKH 4LCWA 3U2SA 3MRFB 4AH2B 4ODSL 1U95B 2EYSB 4WIQA 1D6VL 2HTLD 2Y06H 4GAJL 4M1CC 3WSQL 1CDYA 5JW3L 4UIMA 3VWKB 4LVOC 4R2GD 2K9UA 1J5OH 2Z93B 3SGJA 2XWTA 3TGXA 3W81A 5MERA 1DE4A 4XBPB 3QUYB 1R3IL 1NLDH 2XFXB 2NY6C 3D3VA 3QPQC 25C8H 1TCRB 1L7TL 4GW4A 4OZFG 1A9EA 5D7KE 4PB0L 2X4NA 4HUNB 1EGJH 1IT9L 4N0FB 5E9DD 3I6KB 3PP4L 5E8DL 4DAGH 3D0VA 3WHXB 1HXMB 3AS0A 3S36H 1ORQB 2A77H 3IDJA 4HWEL 4PP2A 1TETH 1CK0L 1U8IB 5HI5D 4Q9BA 2W0PA 4PJFF 4YZFF 2JCCB 2CRYA 1LO5A 2MKWA 4NUJB 3HZMB 1TNMA 3PE9A 5ESQB 3U7YH 2JELH 3DYPA 1XT5A 1EXUB 3EJZC 2UY7A 2X4TA 5HXMA 2V7HA 3BSZH 5ESVB 4NQSA 2V17H 4RNRA 5EIIA 3PGFH 4DUWA 3K8KA 2ICEA 1QFWL 2Q7NA 1J0IA 3HAEB 4MAUH 1QQDB 5MENE 4MD4A 4CNIB 5ETUB 4JFDA 4LARL 4M61A 3OKLA 5GJSH 1W72A 4X5WB 3T0EA 3BPCA 4GRLC 1MCEA 3FQTB 3T04D 4GKZA 5I30H 2D7MA 4MA8L 3RI5F 2ADFH 3B9DA 2EDEA 2XN9D 4DKDC 5I8OH 2V5RA 5GS1B 2XZAL 5I8CA 1FLTX 3IXTA 2F8XC 1W8NA 3G9AB 4Z7VB 2WP3O 2OL3B 5EU6B 3RA7H 3DHJA 1L9MA 1NMAH 1M7XA 1NANI 3GHBL 4XNXH 5E8PA 1X5IA 3UBXG 4BQ9A 1NGXA 2NX5A 3S34L 3IKCA 1MEXH 1DFBL 2IH3B 4U3XA 2F54D 3LS4H 1I1CA 1V7MH 1V3MA 2UWEF 4X6CB 3O3BA 1QO3A 2CLVA 5C09B 5DZLA 3C2AL 3FMGL 4AEIL 4POUB 5L0QB 3B9KA 2NYYD 3ARUA 3AC0A 3L3HB 3O6LL 2D7NA 4PJ8B 1G9MH 4GS7B 4R4BB 3TPUB 3D39E 4Q6IA 5EO9A 1G84A 1A1OA 1IVLA 1INQB 1KIPA 5E56A 4C4KT 1N5AB 2AJZA 1AKJA 4X7DC 2Y07H 4NQDD 4UNTA 1CD1A 4S1DC 2FEEL 4YX2L 2JE8A 5KW9L 2OQJB 4LKXA 1LO2L 2CUIA 2DQHH 3M8OL 2Q8AH 5E5MA 4E41D 5C0BE 3NGBB 4WW2B 2DBLH 3IDIB 3UPRB 3MCKB 4ZPTA 4PLOB 1U8NB 1KGCD 3VH8G 3HE7D 4FXLA 3O4LE 1K2DA 4ZXBC 4HIXH 2O26U 4DWHA 3BP4A 4PV9A 4MNQB 1G0XA 4JG0H 4H1LA 2CKBB 4TYUA 4H8WL 1I3VA 1PX3A 3FT4A 4D9LL 3V95A 4XWGH 3RVVC 3X11B 4I0PC 5EOCL 3MV7D 1ZA3B 4WDIA 5EU3A 1URLA 1MHHB 2F58H 1FG2A 2H32A 4JFEB 4EOWH 1CLZH 2EIBA 4NT6A 1CLYL 1FP5A 2VDQH 4FTVB 4QRTA 4ZTPH 1DCLA 4NWTL 4BH8B 2OZ4H 1N0LA 5I2IB 1CTNA 5J8OA 1P69B 2ERJC 4G7YH 2BSRA 2OL3L 3FB5B 1BP3B 2VIRB 1D7FA 5AWNL 3ES6A 3BX7C 5FECB 1UACH 4QRPE 3ARWA 1UJ3B 4P9MH 1NCDL 3HE6C 3GIVA 4JFYA 4Z7WE 5IV2B 3RQ3A 3BDYH 4AL8H 12E8H 1KULA 2NW2B 3UAJC 3VXNB 1MJ8L 3MV9B 5IB3A 2I9LA 1WT5C 4LCUA 5DQJA 3BDBA 1Y0LB 4EN3D 4U6XA 1OSPH 1IBGL 1S9KC 5TE4H 1CFVH 1AC6A 4FABL 2LV4A 3I85A 3VXRD 2VISA 4N5UA 1ADQL 1P4LA 3MRBB 1KBGL 5DJCB 3MLXH 4XP6L 5CJQL 3UXFA 3MLSH 4JO3H 4OGXL 4P2RE 1HEZA 2V5MA 4YJZL 1NUNB 5DLMH 3SBWA 4XBEH 2GUOA 1YMHB 2XNAA 4KAQH 3MV01 2V9TA 3T0XA 2FL5B 1CF8L 3IJYB 3NABH 3QXWA 4XNQA 1QFUH 5C07B 4U6TA 1BHGA 3QFDB 3V9FA 3MLRL 3Q2CA 5IEKA 3KLHC 4BM7A 2CKBL 5JORB 2J8UE 4JFXA 4PY7B 5E8NB 1HHGB 5I74C 5DVLA 3QHZL 4ELKA 1IGFL 3SDAA 1JWUB 3WUWG 1C5CL 4PR5B 5GRVK 3RWHA 2PO6D 5J3HC 2YXMA 5CZXC 2J6EL 4JPWH 4ODBD 5ADOL 2DJSA 3FFCA 1RK1B 5F1NA 5DJAA 1RULH 3DMMC 2GI7A 4F57H 2P7TB 1X4XA 1MFNA 1EEZA 4LSVL 4PJBE 1MFDH 1UVQA 4FFWC 1JHLH 2EDRA 4K71B 2F5AL 4XWOC 5HHQB 2BNRA 5EBLB 1N2RB 1OAQL 3AAZA 1JYVA 3MRLA 1HILA 35C8L 4KQ4H 4JEGB 4R4FH 1TJGL 4CW1A 3BRGC 1NCUA 3LN4B 5CWSA 1T0MA 2H41A 4ZD3L 1FNHA 2BVUA 4U1HA 2QSCH 1I7TA 4YXHL 4NNXB 5MI0B 5ALCH 1NANH 1OARL 4D3CL 1OB1B 1ZLVK 2Q3ZA 3PWUA 4NQCD 4QHMA 1RVFL 3DNKA 2CMRL 3FCTA 4LNVA 2FJGB 3MRKB 1OQXA 1IRAY 1NCCH 3FONB 3IGAA 3C6LD 1NAKL 3BKCL 3GUTB 4XMLH 4TNVK 1P7KA 4NQTA 4JFQB 5CJXA 4PJIA 1UM6L 1BMGA 3MRHB 1OTSC 3CX5J 3EDJA 1Z3GH 4RWYL 2XQBL 5KVMC 1AP2A 3VXMB 4EI5B 5ISZE 4YDJA 1R5IB 1H0DA 3NBNA 4PJDA 3QEGH 1PEZA 1ZWIB 3WL9B 3O9WD 1WFNA 4N1CA 4Z0BL 1KJVB 1LWRA 4AT6B 4HJGB 4U1LA 5KSBE 5B3JF 2XOTA 5CIPA 2PO6A 3VRJB 1U8LA 1EFXD 1CLOH 5D1QC 2DJ4A 3GIZH 4A6YA 3ET9F 3BVNB 5HPOA 1KC5H 5HGBA 5JW5B 4I13B 3INUL 4LHJB 5K9QI 1S9XB 3NCJH 1BAFH 5ERWA 1UKQA 3MV8B 2H6PB 3U0WL 1YNKL 4K7PX 3ARGC 2BRRL 2Y7QA 3PABB 4HBCL 1JI2A 4PJ9C 2LAAA 3SEPA 4G8GE 4LPUA 3EYFB 4GRWF 3KPLB 3TA3C 1FC1A 1QSVA 4RCAA 3X14B 3MO1A 3GJFK 3RZCB 4LHUB 4WWKD 4NJAH 3C5ZB 3D9AL 3TC9A 5DJZB 3FB7B 3O11A 1CICD 3C60C 5F21B 5E6IA 1IARB 4PRID 4EDWL 1Y6KR 2J88H 3EYUH 2NY1B 1U8HB 3VJ6B 4KI5E 3IJHB 1G7PA 4Y5XC 1JRHI 1LD9B 5EZIH 2APXA 4BK4A 5I16B 3DARA 4TVSa 2FIKA 1V7NL 5J1AA 3TT1L 3CZFB 3WJJC 2X9WA 3HKFA 1EMTL 3D0LB 1IC4L 1GGBL 3FN3A 3CGTA 4X0KB 2C3VB 2NMSA 4OGYL 5F7WC 3K4DA 3GSXB 4DKEH 3BQUB 4P46A 4U33A 1DUYB 4Z5RA 2PYED 4RQQA 5FUOH 3VCLB 1AQDB 3KPRB 4N9OB 4M5ZH 1U8QA 1JPGA 2BK8A 2Y5EA 2C4FT 2HFTA 2J12B 1U2CA 2F19H 1D5ZA 1WGOA 2D03H 4NO3B 1CT8A 5D2LB 1J7VR 4HKJB 3PP3K 3QZWA 1JFQL 5H35B 4M7KL 3ORJA 5DEGB 3ULUF 4L8SC 2HT3C 3C5JA 1Q38A 1UWGH 2DD8L 3KYMA 4I8DA 4TOYH 1F90L 2F74A 3IF1B 5E1AA 4CDGC 4X4XB 5I1DA 3BWAB 2E8YA 1ZS8B 4OZGB 5H37H 1X7QB 4J1UB 1BLNA 4TSAH 1IGTB 1JGEB 4JG1H 2D7TH 3G5XB 4FXKA 4JRYD 1KFAL 5DMIH 3EDFA 4FXGB 5T3ZE 4W68A 5B8CA 3NACL 3AVEA 4HKXB 4UT6H 1KPUB 2GIYA 1JCKA 1INEH 3JWOL 3RWDB 3P40A 3UTSA 1CFNB 5GRVL 4AJ0A 1RUKL 2P48B 3KXFE 4YGVB 4HIJA 4LOUD 4QRRB 2P24B 3LKNB 1QSEE 1NCWH 3ZMRA 1G7LA 2PYFA 2NXYB 3A6CL 3H0TB 2CRMA 1YEHL 2XKNA 4X6DA 3IVKB 5DYOB 3GSOB 1I8KB 1JWMB 4DUXA 1AGFA 1HHHB 2FZ3B 4XZUA 2AJ3A 3KYAA 3BPOB 3GM0A 4GKSB 4I5BB 1CL7I 3AMKA 1D5IL 3SDCC 5D7IF 1VGEL 1YZZA 2MSPA 1AHWA 4XCCH 5LGHH 4AIZA 1RIUL 3UJTH 2ZCHH 1W0WA 2R29H 2V9QA 1UM4L 3SKMB 4V1DD 1SYSA 5DI8B 4WTZA 3S4SA 4DGVL 4MX7B 3K8MA 4MQXD 2XRAL 3H9YA 2AW2A 1A7NH 7CGTA 4MJIB 2IPKB 5FYLL 2R2EA 4BJLA 4MB3A 3A6OA 2C4XA 4MCYB 5E5RB 2W65B 4ZUVA 2XTJB 5ICXA 1EBAA 1A6WH 4HWUA 4M7LT 1F4AA 4OF7A 1QHPA 1S9YB 1ZHBB 4G9FD 2XQYK 3MLYH 1J12A 4F7PB 3WFDH 1NEZG 1PKQA 2L7JA 2C1PB 4JHZA 1VPOL 4YBQC 5HY9A 1HWGB 3KDMA 4FQXC 3O2WL 1H15A 3SDDD 2YR3A 2PTVA 2GAZA 2CQVA 4MXVE 1GCFA 1B0GA 1FNSH 3UZVB 1DSFL 3QQNA 1YNTA 3KPMB 3MXWL 2FB4L 3UC0L 1T66D 5TE6H 2HJLA 1S7QA 2XXCB 4JZJA 4N8VG 3E2HC 5T33L 1K8IB 4GRMA 3FTGB 5L2KB 5IP4A 2G60L 1Q9OB 2W9EH 4X83A 4Y4FB 4GW1A 3OXSB 1SY6H 4CU6A 4L3CA 5F9WB 3S37H 3AB0C 3RWCA 1NL0H 3QWRA 3V6BR 1JRHH 4K23H 4K7FA 3SQBA 3B2UD 4M7LH 1M7IB 4NQEB 1E6OL 4Y5VA 1NDGB 4LCWB 2ZSWA 3FO0H 4V1DA 2AVGA 1CGUA 2QQNH 1E28A 1A6VL 4UIMB 5EZOH 1CVRA 1U42A 3HMXL 4QNPE 4OCSL 4Z7OE 5FXCH 4Z9KB 3THMH 2XWTB 1X6NA 2V7NB 4NFBA 5MERB 4G9FA 1MLCA 3D3VB 2ZOLA 5DRZA 3BXNA 3O3DB 5FO9B 2FR4A 1L0XA 4I2XE 4PD4K 4U0QB 1J1PL 1YC7A 1BOYA 1MIEL 4GW4B 4ZS6C 1BFVH 1A9EB 1GOHA 5TFSL 3WFHB 5IF0A 3NPZB 4HULB 2NR6D 2X4NB 2NXZC 3RZWA 3I50H 4HEPG 3D0VB 5F89A 1OCWH 1JTTA 3IDJB 3UTZB 1AXTH 4WFGD 4PP2B 5IQ7L 1BVZA 2I27N 3FO2A 1BVLA 3GRWA 2F8OA 4L29A 4Y1AE 1N6QL 3QDAA 2DI9A 3UTPD 1LO5B 1PEWA 2FO4A 1FV1B 2VDKH 2X4TB 5K9OA 2V7HB 4P0DA 4RNRB 4RAVA 5EIIB 1C12A 3WLWD 4P3WA 4ZO8A 4ERSL 4MD4B 3LPFA 4JFDB 2H8PA 1FVCA 3OKLB 1DLHA 3IU4L 3T0EB 3BPCB 3CX5K 4P2YA 4G6AC 5DJYA 3EOAA 4R96A 5LKNA 2W91A 5I8CB 3IXTB 5B39A 2JB5L 1EPFA 4M1GL 4WUUE 3RTQC 4JM2A 3CLFL 1PBYA 4OZHA 4RMVA 4M7JL 1JV5A 2CPCA 3FT2A 5MP6H 3NCYP 4ONFH 1BJ1J 4YO0B 3GMPA 5E8PB 5DJ0A 1A3LH 1NGXB 2NX5B 2VLRE 2H2PD 1JP5A 3FOMB 5J6GA 5K33A 4O2CA 3K7UA 4WI2A 1XMWA 2VN4A 2DLHA 3GSVB 2UVEA 3EBAA 3WIFB 1E6JH 1QO3B 2EDQA 1W2KT 2CDFA 2CLVB 3O3BB 4LVNB 4UAOB 4JM4L 4BSVB 5F44A 3B9KB 1A6PA 1OAKH 5HSFA 1D5MA 3H7LA 1UWXK 3X12A 1CZ8L 2OYPA 5KAQF 5IVNA 4Q6IB 3RIAF 4QGYA 5EO9B 1A1OB 5TE7H 1KIPB 1NH6A 4HFWA 1WICA 2AJZB 1BQHA 1OGAD 2JJSC 1AKJB 3CFIC 3LEYL 2VUYA 3D6GA 5F6HI 3CLEL 4LKXB 4HPOL 3QIWA 5E5MB 4XCFH 4P2OD 1INDL 3O2DH 3QUKA 5E2WL 4ZPTB 4UUJA 1N6UA 2YD7A 3TV3L 1K2DB 2VDNH 3BP4B 4H1LB 3RP1A 3FT4B 5EOQL 2YD8A 4ZAKD 5D7LE 5EU3B 4WDIB 3HB3C 4ODVH 1FG2B 1YEJH 2H32B 4HZAA 4NT6B 2DL2A 3DXAD 5DVOA 4TTGA 5BOPA 4QRTB 2YD2A 3RKPA 3EYVA 3HRPA 4LCIH 1LO3L 1O7VA 1CCZA 2D3VA 2BSRB 4YFDB 4L5FH 3ULUC 4DQOL 4OI8A 3ES6B 1ZGLA 1LO0H 4J3VA 5D72L 4MCZA 5CJOL 2ED7A 3SN6N 2DQCH 3TCLA 2D2OA 2DYPA 2LVEA 1KN2L 3MCLL 5T3ZH 3GIVB 4JFYB 4OFYD 5AG9A 3RDTC 1I9JH 5BXFA 3ARXA 4OLZL 2ORBH 3OZ9H 4NZRH 5KG9A 3R1GH 1FN4A 5GGRY 3V4UL 2O5YH 5IB3B 2I9LB 4LCUB 2F53E 5KS9E 1CVSC 4WVRA 2BXZA 3SE9H 4P5MB 2R8SH 5E2UH 1RZIA 5F97E 1P4LB 1XGQA 4LIQE 4HC1L 4AQ1B 3M07A 1UM5L 1NGQH 1LP9E 4YHKL 3MUZ1 3WXVH 1GVIA 1HEZB 4KK6D 1Q1JL 2GUOB 2XNAB 3SPVA 4HF5L 4XNQB 2FO1A 4P2OA 1X5JA 3TLRA 1IKFL 3EDEA 4JFXB 1VB9A 5MENA 4MJ5B 2VNCA 1I9IH 4ELKB 3S96A 3SDAB 1G7HA 4JQIH 2QKIA 4U49A 3MV7B 2XWBA 3N1FC 3TVMD 3RWHB 4KRPB 2JCCF 4S0SD 2ZNWA 4LFHG 3JWDC 1A9BA 4PRBA 1OPGL 2OM5A 3NVQA 4M5YL 1PDKA 1U3HA 3FFCB 2L4OA 3V8CA 1RZKC 4LQ1A 5DJAB 4B50A 5DEFA 2MOVA 4DVRL 5DR5L 4ENED 5CUSL 1HI6B 5SV4A 5J57B 1PG7W 4ODUA 4UTAH 4QRPD 1HYSC 1XCTA 5JIKA 1MRCH 1EX0A 1DL7L 1UVQB 3MUJA 2E6PA 4BKLA 2BNRB 2BHZA 3GMQA 3AAZB 3EOBA 3MRLB 1HILB 4O9HL 1U3YA 3IS0X 4CW1B 2A73A 4TSCH 2FWOB 5ID0A 3DVGA 1T0MB 2YK1L 3LRHA 1IKNC 4U1HB 5I1CH 1I7TB 3I6GA 2OR8A 1ZEAH 2IGFL 4ZS7H 4HGWB 3VXRB 4HUVA 3UBXI 3CXHJ 1JUFA 3CFDA 3PWUB 3UEZA 3D39A 1SMOA 5E94A 3FCTB 1Z9SA 2B4CH 3EDKA 1AY1L 5D4QA 3IGAB 4L3EE 4PJHE 2Q8BH 1ZVSA 3TO4A 4LEXH 4Q0XH 2FSEA 1P7KB 2X05A 5C0BA 4KKBD 2H1PH 4PJIB 1LEIB 1YEIH 3I9GL 1N26A 1FYHB 4X6CF 4XC1L 4CN4A 2FATL 2PN5A 3O4LA 1NMCB 3ZE1E 3NCFB 2P8PA 1AP2B 1RIVL 3OKYA 1HIMH 4UILH 1H0DB 3QP3A 4PJDB 4XBGA 3PNWB 4OI9A 3U0PA 3NFSL 2VWEC 4ODHH 4ZUWB 4U1LB 5CIPB 5DC9B 1AJ7H 2PO6B 4KTEL 2VR5A 2YN5A 2DQJL 1IC5H 1U8LB 3B6SA 1N64H 4QRSA 4LLUA 4I48A 3U30C 4DN3H 4A6YB 1ACYL 2E7BA 2IAND 1RHHA 5GIRA 1WUNT 3GSQA 4WW2F 4PUBL 2WNGA 4X7EC 1X5YA 2R0KH 4CMHB 5HGBB 1FH5H 1RUAL 2FGWH 2BCKA 4ODTL 5ERWB 3V79C 4QRPA 3TF7C 2DQDH 2VSDA 1RURH 2FJHA 2DLIA 1JPTH 3TH3T 1NJ9A 4X8JA 2FH6A 2QBWA 2Y7QB 4Z7WA 4FQCL 3QCVH 1CDHA 1MVFA 4U3CA 3MO1B 1NLBL 3DX7A 1AI1L 1YYLH 1YDPA 3RHWK 2FDBP 3G6DL 3LY6A 2VYRE 3VD3A 3O11B 5E5UB 3EYQC 2MPAH 4HFUL 5E6IB 5F6IC 5L2JA 5CGYC 1G7PB 3NIFF 3BFOA 4IHOB 5DXWA 4MB5A 2QR0A 4KRNA 4P2RA 4U4BA 3RGVD 5JW4N 2FIKB 2OBGA 2IJ0C 1T1WA 3S7GA 3KR3L 3GKWH 4XCEA 3D5OF 4JGJA 4WRLA 2MKLC 3VE0A 3EO0A 1UH2A 4F7EA 4KHXL 5GISL 3CC5A 3OKOA 4P46B 4RAUA 4RGOL 3VD5A 2VXVH 3FN0H 4GJTB 1A2YA 2J8UA 3TNMA 4Z5RB 4XAWH 4RQQB 5F96L 5B22A 5ISZD 5D1ZA 2BVPA 1UCBH 4KC3B 4OZFH 4BSWB 5HHXL 2W9DL 1SY6A 4G3YL 5JUEL 1D5ZB 3ZE2F 1CT8B 3TBWA 5D7JC 4DKFH 5IR1A 5EB9A 3QZWB 3DSNA 4A6YL 2W92A 5EDXA 2X4QA 4NRXB 2JB6A 4JRXE 4XP9L 2EXWC 3C5JB 2GT9B 5DT1H 3RL2A 4WV1A 3OKEA 3QNYA 4GSDL 3W5NA 3WLBA 5E1AB 4OM1L 3KPSD 1TIUA 4YHLL 5I1DB 2IADA 4PJBA 3LVEA 3TYGH 2H45A 2IQ9L 1WTLA 1BLNB 1YEEH 3E8UL 3LH2H 2R4SL 4MS8D 3ZSTA 3GMNA 4IMKC 5B8CB 5TQ0H 1PFCA 1XGUA 4K55A 4YFLI 5HHPA 2FEDD 1NC4D 3MTRA 1JMZA 2EE6A 4K3GA 2CDEA 5GJTH 4HIJB 1WCQA 2EKSA 3QFJD 3B9AA 1E4JA 3ALWA 3SJVA 3MROA 5FCSH 4N5EC 2I60L 1G7LB 2PYFB 3QQ9C 3H9ZA 1T1ZA 4X6DB 5BW7C 5I8EA 4RSVA 4CN1A 5IIEA 5DURD 4XXDA 4XZUB 2AJ3B 5KOMC 1RJLA 4KUCD 1QACA 4NJ9H 1IGIL 4Y2OA 3B2VH 3RVWC 2P5WD 3AMLA 3QDME 1AHWB 4XPBL 4JHAL 3OB8A 4AIZB 1FPTL 2PYEB 5ISZA 1W0WB 1Q9WA 2WWKT 3QIUD 1SYSB 3S4SB 4J3SA 4LASH 2YPKA 4TULH 1H3UA 2EICA 2HVKA 5JMOC 2O93L 5KSBA 3VFMB 3GBML 3TBSA 3HUJB 2CXGA 3DGCR 4ZUTA 5EORH 5ICXB 2W07A 2Y06L 3NCCB 1YA5A 3ZTJG 4Y4HC 1PKQB 1J5OL 3QXVA 4IIQC 2BX5A 1ZT4A 4IRJC 3D18A 2C4FU 1NCNA 1CWVA 5HY9B 4ZXBA 5C08E 4ZO9A 3L3DB 3KDMB 1FZOB 1H15B 3JVGA 1G0YR 1NLDL 4G8GA 4OIIH 4I0PA 25C8L 3L9RA 4NZUH 5HGGS 1B0GB 1J0KA 1YNTB 3VWKC 3TJHC 3BPLB 3AROA 2HJLB 2X4SB 1S7QB 5BJTA 4JZJB 1IM9D 3S36L 2A77L 4I3SH 2IF7A 1FFNA 2AERT 1TETL 1QSED 3QUYC 4GRMB 4YHMH 2IC2A 1K4CA 4FS0A 5INCA 5C0EB 5T1MA 4EBQL 1GXEA 5HYJE 3B9VA 2RAMA 5IESL 3LQAH 4GW1B 1J88A 4XXCC 1SJHA 4KMLB 2JELL 4L3CB 2YPLD 3RWCB 2C3XA 3T09A 2BDNH 3UDWC 2V17L 1WZLA 5LCVL 4OLWH 3GJEA 4N0YH 4EUPA 3FRUB 5DJXB 4Y5VB 4MDJA 4QHKI 4XX1G 2ZSWB 1FIGH 4V1DB 2OK0H 3N1GC 3E6HA 1E28B 1H5BA 1IC1A 2UZIH 3CFEA 1TJHH 2FJFA 2VXSH 4MYWB 2RGSA 4QHNA 4KUZL 3VG0H 2J8HA 4PYGA 3DWTA 2BY1A 3EFFA 5I30L 1F4XH 2ADFL 3D2UD 1P4BH 4JZNA 4P2QE 3ABZA 4G9FB 1MLCB 2ZOLB 5DRZB 5IM7A 3HZYA 3RA7L 2FR4B 1NMAL 4H8WC 5IF0B 5GS2H 3BN9D 2JF1A 2NLJA 3TFKD 4EIGB 1XH3A 4MGXA 5F89B 4FFVD 5D2LF 4OBSA 1V7ML 2Y72A 5GS1C 1WISA 3CPLA 3MOBL 3FO2B 4JVUA 5JPNA 4L29B 4LSRH 1PJ9A 2A38A 3KXFA 3RY6A 4NO0D 1IM9A 3U4BL 1RUPL 4QTHA 1EO5A 1T2XA 1QSEA 3QI9D 4X99B 2B39A 4PJ7F 5CD3A 5K9OB 3GI9L 2I07A 4OZGF 4X5XA 2UUDH 4TNVF 4RAVB 3RWGA 1C12B 4QXUH 2D4FA 2Y07L 1E4XI 2EH8H 2Q76A 3WHE0 2A6KA 5L0QC 2Q8AL 3T77B 2H8PB 5C86A 1FVCB 4BK5A 4C58B 2DBLL 3Q3GA 4PJ8C 3LKQB 1C1EH 2WIIA 3EDDA 1PZUB 4JG0L 3IDUA 5DJYB 4F2MA 3S5LA 4IEFB 3EOAB 4XWGL 3PV7A 3TEUA 4EQ2A 1AIFA 2F58L 5B39B 4EOWL 4G8FB 1CLZL 3LEVH 1QUNA 4HQQH 3VXTB 2VDQL 4UB0H 4NKIH 4ZTPL 4GUPA 3W11D 1DEDA 3NGBC 4WW2C 2GW5A 1JV5B 3FT2B 1F58L 4Y89A 4G7YL 3F7VA 1SJEA 3GMPB 2X70A 5FYJD 3ULSA 3OR7A 5I1IH 1MCKA 4OLEA 4KJWC 5J6GB 4KQ3H 4O2CB 3QH3A 4P9ML 2CDFB 3NZ8A 3RPIA 1ZT1A 5AAMA 6FABH 2BY0A 3BDYL 4AL8L 5FEBA 1G7MA 4I77L 1MWAH 3GRWL 3X12B 4LBEA 1IEBB 3GGWA 4KKLC 4H0GA 1CDBA 3VDAA 4M6OL 4XP1H 5ADPL 4HFWB 1BQHB 1OSPL 5TH2A 1UJ3C 1WWWX 2WWMD 5T3XD 4F9PA 2GJ6E 2X1WL 4WI9A 3QIWB 1EZVY 4KI1A 3BKJL 4P23D 4JO3L 3PHSA 1N8ZA 3BGFB 1DBKH 4R7DB 2QLVB 4U1MA 3DX9A 2I5YH 3NABL 4WY7H 5DFWH 1OT2A 4LCCA 4AEHH 4PJEE 1KXQE 4L8DA 3TWCL 5D9SA 5ECJE 4KH2A 4M6MH 5DMJB 3Q48A 3EYVB 5IROC 3L7EA 3MBXL 1NDMA 2Q6WA 1NSNH 3VFVA 1H3PH 1Y6MR 2BVEA 1ZGLB 2AEQL 3F8UB 4AMKL 1ULVA 1XGPA 4IM8A 4MCZB 2ZUUA 3HI5L 1AE6H 2DYPB 1K85A 1JHKH 1NC2D 1OAZH 4F57L 3MREB 5BXFB 2F15A 2E3VA 2R69H 4XNYL 4XGZB 5KG9B 3T0AA 4I2XA 5F3BA 1FN4B 3QO1A 2DAVA 5JIPA 4KKNA 5D2NE 1JHLL 1QFWM 2GITA 4ZUSA 1DEEA 4DKAA 1GHFL 1RZIB 2WBJD 4YQXH 1XGQB 3R8QA 4JHBA 3HMWH 1FDLL 4XVTH 2QSCL 4X9BA 4Y1AA 1F45A 4WI7A 1KB5A 4EZMA 3SPVB 1X5HA 1EERB 4K71C 3VA2C 1PZ5A 2RBLA 3G5YA 4XNMB 3MLTA 3KPPA 2LABA 1NQBA 4P2OB 3WN5A 4P23A 3OJDA 3PXJA 2VZUA 2ZG2A 3O6ML 5D71L 5IVXE 1NCCL 4G6FB 4OF0A 3LIZH 3SDYH 2HT2C 2ZUQB 1RQ5A 1V3KA 4XMLL 5MENB 1WIPA 2P45B 1G7HB 1WZMA 5MI0C 2QKIB 1FFRA 2XWBB 4P9HH 4WI5A 1A7OL 4W81A 2VL5A 4P99A 4G8EA 3MA9L 4EQ3A 3H9HA 4YWGH 2V2WA 1A9BB 4PRBB 3MMEA 4K9EH 2NY7H 5DEFB 4OZFA 2HLAA 3P30H 1DQML 4WUUA 1RZ7L 4X80L 3Q6GL 4ODUB 5GSVA 3ZHDA 2AQ1A 4Y2DD 5A2JH 1J8HD 5E99L 4BKLB 4EI5C 4L3AA 2OXHA 2VLRA 3BP7A 3GMQB 3EOBB 4OGAD 4UBDC 1J05A 1SEQL 3NCJL 2A73B 3E3QE 3ARDA 4Q97A 2YRZA 3DVGB 3EJYC 4XPGH 2P46B 5FYKE 4J4PD 3I6GB 2EH7H 3WFEL 2QQLH 3CH8A 4HUVB 5TDPA 1JUFB 3CFDB 3TZVA 1K6QL 3D39B 5SWSE 2JLLA 2QADD 5E94B 5T5FH 3UYRH 1BREA 3ZT5A 4KZEH 5C9KA 4JO2H 2DRUA 3O8XD 4FQJL 3IDXH 4LAQL 3EYUL 4Q9CA 4HLJA 4RWHA 1ZVSB 2YD5A 3CFBA 1BD2A 1T03H 2FSEB 5HYIA 5EZIL 5C0BB 4V2BA 4TUOA 2G5RA 3EO9H 3FQXA 2GJJA 1MQKL 4U0RB 5F1KC 3RZCC 3O4LB 4JVPA 4KKCC 2P8PB 1B4JL 4ZQKA 2CO7B 2YUZA 1MFCH 3C5ZC 5TGBA 3W0WE 1GSMA 5CEYA 3WFBH 2YXFA 2B2XL 3JWOC 4XBGB 5J0BA 5D7LA 3U0PB 4B7LA 2NY1C 4GMSH 4KXZH 2X4UA 4LRIA 3UBXA 4FQPA 4JO4L 1JE6A 3MGAA 5IW1A 3B6SB 4M5ZL 2VE6A 4QRSB 4LLUB 4I48B 2ZOKB 2ICWJ 1RHHB 2F19L 5FHAL 5GIRB 3GSQB 2HG5B 2FBOJ 5HGHA 3OXRA 2BCKB 4QRPB 3BQUC 1I1FA 4YC2B 4A2LA 4MA3A 1A3RL 1UWGL 1NJ9B 4X8JB 4PG2C 3T4AB 1I1RA 4Z7WB 4XVJH 1CQYA 5BRZD 3NFPA 2FLBT 1WITA 1NCBH 2AP2A 3DX7B 1YDPB 4KVNH 5J7CC 4KRLB 4TSAL 2F53A 5KS9A 2D7TL 4UV7H 1DBMH 1Z9MA 5DMIL 2E5EA 5ACZA 4NO2A 3VH8A 5L2JB 3D69A 4UT6L 1LP9A 1INEL 4M43L 4NC1C 1QBBA 2EDHA 2QR0B 1DBAL 4HUWA 4YHPA 3Q5TA 4MD5A 4P2RB 4DGIH 4KZDH 4R97C 1KIUA 1T1WB 4XCEB 4UDUA 2DTMH 5DO2C 4EI6A 4LSPH 1UB5A 5KVGH 3L6FA 2WMPA 1U0QA 4L9LA 3VE0B 3EO0B 3RWJA 1KELL 4QYOA 1GC1L 4F7EB 4ODSH 1D6VH 3OKOB 4RAUB 4GAJH 3WSQH 4E42A 2CJUH 1A2YB 2J8UB 3ARYA 4HK3J 3TNMB 5CGTA 5FDWA 3L1OH 1VERA 5D1ZB 5CD5D 2BVPB 4XNZB 1TZHB 4R0LB 4LLVA 5DRXA 4HJ0C 1BF2A 3TBWB 2DLTA 3QO0A 5LGHL 3UTTD 4H0HB 3UJTL 5IR1B 3U4AA 1I8IA 2ZCHL 1LILA 4WCYH 2R29L 2NXYC 4D9RE 2X4QB 2JB6B 4HHAA 3CFJA 4U1GB 3RL2B 4WV1B 1MRFH 2OSLA 2BVYA 3LAFA 4LSUL 5GRZA 2HLFD 1A7NL 3OKEB 3QNYB 4S11A 3WLBB 3PP4H 3SHSA 4DVBA 3BPOC 1E4WH 1ONQA 4ESKA 2J5LB 3DPBA 5SX5H 1VA9A 1OWWA 1HH6A 4NDMA 5ICZA 3MLYL 3WFDL 2IPTL 3GMNB 4Y19E 5C0AD 1XGUB 4KJPD 5HHPB 4WGWB 1IZJA 1MCCA 2CDEB 2YD3A 2W38A 4NC2B 2AJXL 2XTJC 1D9KD 3MROB 1FNSL 2R39A 3PWPE 5D6DA 4LARH 5JOEA 3VD4A 1T1ZB 1T7WA 1CD0A 5TE6L 5I8EB 4JFOA 3TH2T 4F9LA 3WUWA 5IIEB 5C0CD 4XXDB 4L3EA 1JYXA 4PJHA 1RJLB 3BZDA 3WV0A 5MEPA 1KENH 4UIKL 2VLME 3Q0HA 3KPOA 1EUUA 4Q58C 2PTUA 4DW2H 2W9EL 1HINH 5ISZB 3IRZA 2X10A 5CBAA 1SY6L 1Q9WB 3UYPA 2WBWB 4H88L 2Z4QA 3KLSA 1YEKL 1O7SA 4K3HA 2YPKB 2HVKB 1JRHL 4K23L 5KSBB 1DFBH 2F5BH 4M7LL 4TPRH 4ZFZA 1DVFD 4X6EA 2JJSA 4ZUTB 2QQNL 5GGVY 2NY3B 1MREL 4PJIF 3ZE0F 3C2AH 1QSFE 5F9WC 2AEPH 5GGVL 2YD9A 4ZTOL 1ZT4B 1SJXA 3EGSA 5T1KD 2WK2A 4PJDF 5LBSH 1KLUA 3QCTL 4X98B 4G8GB 5AEAA 2JJTA 3NTCL 4HIEB 1I9RH 3PHQB 3L9RB 3NPSB 3HNSH 3WYRA 3SQOH 5KW9H 2C3GA 3KLDA 3M8OH 3OG4B 3I50L 3HAEH 1AH1A 3SGJC 1N7MH 4P4RA 1L6XA 5MEQA 1FFNB 2ICCA 2OX5A 2FGZA 3BHBA 4R4ND 4J3OC 5DRNB 4H8WH 4RA0C 1K4CB 5INCB 4D9LH 1MWAA 5IHUH 5I9QB 1U91A 5JQHC 2OJEA 5T1MB 4HAGA 5DURB 3RBSA 4RGNE 1CLYH 3S3PA 1J9CT 4EKXA 1TMCB 1SJHB 4K8RD 2VDKL 1TENA 4YDVB 4LVHB 2APVA 2HMIC 5JDJA 3LDBB 2OL3H 3LKSB 3GJEB 4EUPB 3QG7H 5AWNH 4MDJB 3P3YA 1TNNA 1OAXL 4JFFE 1H5BB 3CFEB 2FJFB 4ONHA 4YBLB 3DURB 4QHNB 4H20H 3ILQD 4YIQA 4JFPB 3MLUL 1G9EA 2IBBA 4WO4A 2CR6A 4UU9A 3EFFB 4JRXA 3C87A 4POZC 3ZLQC 4M7ZB 2KDGA 3ARTA 3UO1H 4LEOA 5IM7B 1CL7L 3HZYB 5DMKA 1VACA 4WFFE 2X6MA 3K4AA 1KBGH 3T0EC 1AXIB 1CXLA 5C08D 3FL7A 4XP6H 1WFOA 5CJQH 1KB9K 1A3LL 2NLJB 3B4NA 5IMOA 4LVEA 1XH3B 3PJSA 2MQ3A 4HBQA 4MVBD 5J4MA 3P4LA 3KGRA 3CPLB 3ARQA 4NCC2 1E6JL 1UXSA 1EH9A 5JPNB 3MJ8A 3H6JA 1OAKL 3KXFB 1IM9B 3QYCA 4QTHB 2E7CA 3UMTA 5HYSG 1QSEB 3G6JE 3V0WH 4AYFA 4P4KD 2I07B 4X5XB 4XX1E 2PXYD 1C5CH 3RWGB 3BZEA 4KGLA 5HYJD 2JIXA 4BZYA 2Q76B 3L5JA 4LVNC 3WO3B 4UAOC 3CNKA 2A6KB 3PUCA 2VLLA 2BNUA 1NBVL 3B9KC 4XCFL 5ADOH 4Y16D 3HG1A 3Q3GB 3QDMA 2PKDA 3BUYA 3GEWB 3M45A 4Q74A 3TO2A 1PGRB 4PRPD 2VDNL 4N68A 2WIIB 4Q6IC 1IKNA 5H8DA 5B21A 1WC7A 2HH0L 5FO7A 2C3WA 1IAOA 4JRWA 4F2MB 3S5LB 4LSVH 3PHOA 1NGWA 4XH2A 2QSQA 1VGKA 2NY4D 1AIFB 3MYJA 2F5AH 3S97C 3RBGA 2JJUA 4X6DF 4NN6C 4GUPB 1FJ1A 35C8H 1KPRB 1VFBA 4FZ8L 5TPWL 2VMFA 2NY2D 3D2UB 2VABA 2Y25A 1SJEB 3F7VB 4N0CC 4ZD3H 2X70B 5I6XB 4P2QD 3RNQA 4J8RA 3UJJH 3ULSB 3OR7B 1II4E 2ESVD 1OARH 1HSBA 2BVQA 4PG9A 3P0VH 5C08A 3MZTA 2OI9B 5GRYA 1C7SA 5T3ZL 3EYSH 2V5YA 3NZ8B 3FZUD 2I9TA 3RPIB 1I1AA 1I9JL 5IMKB 3PIQA 4NKDA 3OZ9L 4NZRL 2DMKA 3BKCH 4HUUA 3ULVD 1G7MB 3OGCA 3R1GL 4OCYH 5EBMB 2KH2B 4LBEB 3V5KA 3GGWB 3HI6H 2OTUB 1U41A 1UM6H 3MUY1 2Z91A 4D8PA 5TH2B 2DL9A 3ELAT 2I24N 5E2UL 5B38G 1OM3L 2FD6H 4CN6A 1F4HA 4L4VE 3A6BH 4P4KA 1OSZA 2N7AA 4UINH 4KV5F 5HVFB 3SKOA 5HYJA 1A6AA 3JZ7A 3LN9A 5DGQA 3REVA 4U1MB 1GAFL 1S9WB 3DX9B 1T7XA 5D93B 4PJGE 1C16A 4JPIA 4LCCB 5ACMA 4JREB 4HDIA 1DQJA 3NA4A 4L8DB 5D9SB 2DDQH 5KVDL 3INUH 3L7EB 3SBWC 1NEZA 2KBGA 1NDMB 4JQIL 2Q6WB 3U0WH 1YNKH 1JF1A 4NWUL 5GS0H 3VFVB 2Q20A 2BRRH 5I1JH 3MSPA 4OFDA 1T7VA 1U3ZA 5D5ME 5KBNC 3D9AH 4UNUA 4P2QA 3X13A 1LK2A 3SDAC 3ZDXE 2MWCA 3QPQD 1T20B 4N8VA 5EZLA 1MRCL 3WNPA 3RFZC 3QO1B 3OGOE 1WSST 4KRPC 1JJUA 4WWID 2G5BB 1SJVA 4NKOA 2GITB 1TVHB 4ZUSB 4RIRA 1DEEB 4ZFOA 1V7NH 3RAJH 4F7TA 3ZYOA 2R23B 1UENA 1Q0YH 5FO8A 5T1LA 1MELA 5ACLA 5I1CL 3CK0H 1YEFH 3BISA 4UNVA 4Y1AB 3RKDC 1A47A 1KB5B 4RFNB 4S2SA 1P6AB 4ZS7L 3WXWH 1WQVT 2Z31A 4PLNC 3ZT7A 2GJ6D 1PZ5B 4UDTB 3G5YB 4PJ5D 4RDQG 3MLTB 4KDTA 4FP8L 3WN5B 3ZKNC 4P23B 2B4CL 3OJDB 3MXVL 2BNQE 1VFUA 5DSCA 2R0ZH 2VZSA 4LLMA 1BBJA 1V05A 4MAYA 1G7IA 2Q8BL 3HFML 1JFQH 4LEXL 2BMKB 3BI9X 4M7KH 1JN6A 3LV3B 1WLHA 1YEIL 5FHBL 4OQ1A 5JMRA 2DD8H 5JXEA 1CYGA 2VL5B 4NOBA 4G8EB 1F90H 3H9HB 2V2WB 5IVZB 2HJFA 3MMEB 5C9JA 4YHOL 1HIML 3GSNH 4QOKD 1NUDA 3F6IA 3G6AA 4NM8H 3SO5A 4OZFB 2HLAB 4ODHL 4WUUB 3VD9A 1AJ7L 5CJXC 1KFAH 5GSVB 1UKTA 1IC5L 4D9QE 3NACH 1N64L 5EUOE 5FYJL 1NMCC 1MY5A 3BP7B 2VLRB 5E9DE 1FSKC 1FH5L 1FLRH 1QBAA 5EC1B 1DZBA 1UT9A 1UB6A 1RURL 1OP5H 1OW0A 3SY0B 2PO6C 4UV4H 1RK0A 3VFUA 1EHLH 1FCCA 1Q9KA 4EVNA 2DQIL 4K3EL 4FMFA 5IFJA 5E2VH 1UYWL 5TDPB 1ZLSH 4JM2F 3TZVB 4OZHF 1KB5L 4CMHC 1WBZA 3AS3A 2VDOH 3DYOA 4JKKA 2B5IB 4MJ4A 4R90L 1BIHA 1RIUH 3KNBA 3ZYZA 5J89A 3CFBB 2GJ6A 3D87B 1KTLA 1QFHA 1LK3H 2VZ1A 1R5VA 1NBQA 1P2CA 4TUOB 3FQXB 1B6DA 1VADA 3C5SA 3O6KH 2XRAH 3GKWL 4PGCA 4ZQKB 5TGBB 4PGBB 2FECI 2X1PA 1JBJA 2E9IA 1XF4A 5E6IC 2BY2A 5CP7A 3RVVD 2XN9E 2VXVL 4PJEA 5F7NC 4TQEL 2X4UB 2WM0A 5KZCD 3UBXB 5ANME 3PL6A 4NBZB 1UCBL 5IW1B 2PNDA 2VE6B 3I75A 5A40E 4CAGA 1T1YA 5BMFH 3O2WH 5HGHB 4DKFL 2XFXA 3OXRB 5DUPH 2F54E 2BHYA 4P46C 1I1FB 1CIDA 2OTWA 5LAXA 3MBEA 1CFBA 4MA3B 5DT1L 2PF6A 4U2YA 5DJ2A 2OS7A 3CVIL 3UC0H 1JYNA 3HE6D 4XXCA 2UUDK 1NBZA 3NFPB 2AABH 3WHXA 4DTGL 3Q6FA 3IETA 3TYGL 5FYKD 1R6VA 2DICA 2F53B 3UAJD 5KS9B 3LH2L 3SO3B 2EC9T 4Q7DA 3AU1A 4GBXD 2ZKHH 4NQDE 5ACZB 4NO2B 3VH8B 1ROWA 3HZMA 3D69B 4MLSA 1FO0B 1EEUA 3P0GB 1GPOH 5HBBA 1LP9B 4OSUH 1F5WA 4YHPB 4HUWB 4E41E 2BY3A 2EYRA 5ESVA 5GJTL 3DJ9A 5DK3A 1KGCE 2BVOA 4UDUB 4EI6B 3T0VA 1UB5B 3N1QC 3KG5A 3HAEA 4L9LB 3RWJB 2EE9A 4QYOB 4YHYB 2X1XR 1V3LA 2M8XA 4OLYL 5B8CC 3U82B 1A6VH 3MV7E 5IVXA 4E42B 3BKML 3MRNA 1EUTA 4KK9C 3SCMA 2EE2A 3HMXH 5FDWB 4XHJC 4OCSH 4PV8A 4JFZL 3WKMH 4NJ9L 4HAFA 4LLVB 3B2VL 4GT7A 2ZCLH 4AEFA 3QO0B 2VDRH 5EWIH 4HK3N 1I8IB 4R9HA 1J1PH 2ID5A 4HHAB 3CFJB 5CZXD 4HIIA 4PJXB 4PBXA 4LASL 5ID1A 1KYOJ 2DKSA 2GFBA 3DMMD 4X4ZA 3P77A 4ZSOE 4DVBB 1BX2A 3MJ7B 3ARVA 4JQVA 1ONQB 4OF6A 1AHWC 1QR1B 1HH6B 4FFWD 4NDMB 2X42A 5ICZB 2E27L 4PY8J 1N6QH 1ZA6A 1T89A 5F7UA 4WUKH 1KNOA 3QXUA 4R4BA 5JDSA 3SE3A 5IWLA 2YA0A 2DM2A 1J0ZA 1CGTA 2E9JA 4QT5A 5M94B 4LIQL 1FCGA 5T5NG 4GBXA 5SWSA 2YEZA 1ETZA 32C2A 2CKNA 4S1RH 5TJWK 4JFOB 4RMWA 3WUWB 4L3EB 3GZKA 4LLDA 3LOWA 4I3SL 3LHPH 4J2XA 5JW4M 3RVXC 2C3HA 4MNQA 3EHBD 4FFZL 4YHML 3IKKA 5MEPB 1KCUH 4OV6F 4Z0XA 3X11A 3KPOB 4XI5D 1FIEA 1LEKA 4M1GH 1FGNH 4F37K 3AY4C 3W0WA 3LQAL 5EC2A 3CLFH 3BPLC 2Z4QB 3ZHLA 4JZJC 4M7JH 1B88A 2BDNL 3ZHKA 4OLXL 4Y5YB 1CFQA 5DMGC 4AK1A 4NYLA 2NW3A 5I19H 4N0YL 2W9LA 3CUPB 4XVSL 4S1SH 4ZFZB 1CXEA 4TTDD 2MFNA 4X6EB 1FIGL 2OK0L 1AGBB 1MCPH 1QOKA 4J6RL 1MJJA 5D1QD 1TJHL 5EOCJ 3H8NA 1Y6NR 2VXSL 4W6XB 2VH5L 4JM4H 3J7HA 3BPNB 1BBDL 3VG0L 3AGVA 4X9IA 2DMBA 1YY9C 2XXMB 2EC8A 4HWBL 4LSSL 1CZ8H 3EGSB 5KN5A 2ARJA 2HN7B 3VXNA 1I1YA 1KLUB 4Y5VC 1AD9A 3KYOA 4Y19D 5C0AB 3LEYH 2AXGA 4PJ9D 3TA3D 4MQXC 4JR9H 4RX4D 3WO4B 2DI7A 5BQ7A 5EIVA 2FBJH 4NQCE 5GSRA 1INDH 2LU3A 5E2WH 3TN0A 4OI7A 4P4RB 1SMAA 2Y9RT 5MEQB 1A4JB 4FOMA 3BHBB 1LEGA 1UJTA 5L8JB 3PWPD 5EOQH 3FQRA 1U8JA 1MWAB 1U91B 2DIAA 4LSRL 5DUML 4UT9H 4HSQA 2ZUYA 3LQZA 4Z7WF 1RZGA 1LO3H 2IAMA 4ZFFA 4ZFGH 3L3GA 4LPTA 2E6JA 4F33A 4DCQA 1CFTA 4QXUL 4DQOH 3WJLA 2VAAA 1EO7A 5D72H 3P9MA 2YZ1A 2H26A 4YAQB 1RK1A 1UA6L 4ONHB 4BZ1H 3UJIH 2IPUK 1C1EL 4YIQB 2AGJH 4WU7A 4OLVL 2P7TA 4OLZH 4WO4B 3AREA 5IB4B 4HS3A 4UU9B 5FB8A 1ODAA 2VLJE 4JRXB 3V4UH 3QIBA 4OUOA 1SEBA 2HT3D 2IBZX 3LEVL 3WD5L 2FX8H 2Y23A 4LEOB 2VLKD 2J8UF 5DMKB 1VACB 5A3IC 2AV7A 4Z76B 1G0DA 4HC1H 2ZCKH 3T2OA 1A7QH 4GG8A 3B8YA 1T21A 5IMOB 1YECH 5I1IL 3PJSB 1Q1JH 4Y19A 4PRIE 1Z2KA 1C08A 1OB1A 4RX4A 1T5XA