5LKNA

Nmr solution structure of human fniii domain 2 of ncam
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
103
structure length
103
Chain Sequence
MQPVREPSAPKLEGQMGEDGNSIKVNLIKQDDGGSPIRHYLVRYRALSSEWKPEIRLPSGSDHVMLKSLDWNAEYEVYVVAENQQGKSKAAHFVFRTHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The N Terminus of the Prion Protein Mediates Functional Interactions with the Neuronal Cell Adhesion Molecule (NCAM) Fibronectin Domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
molecule keywords Neural cell adhesion molecule 1
total genus 14
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2016-07-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5lknA00
3WIHL 5KN5B 5GISL 3B43A 2JLLA 1X6LA 5INCB 4K3DH 3RWGA 5I1KL 1TTFA 4M62L 3DBXB 1N4XL 5CJOH 1A47A 4LLQA 1KIQA 2G75A 1AO7B 2OXGA 4Y5YA 3X3GH 5JOFB 3BIKB 5TJWK 3VGAC 2EZ0C 5MEPA 4L4TE 1HXMB 2VLKA 3VGEA 3C9NB 1I8MA 1ORSA 3VXQB 4NWTH 3PIQA 3SGDI 3N85L 1A6UL 5DJ8A 1XF5A 3EOBB 5EU6B 2A1WL 4E41D 5CJ5A 4LFHD 5BRZB 2ZUSA 2DYPD 2APFA 3PV6B 3WSQH 1JNJA 2QR0B 1VGEL 5JORA 1DBJH 2MQCA 3MA9L 4DK6A 4GMTH 5HDOA 2B20A 4HFWA 3TCXA 5A2LH 1C16A 1U36A 4N0FB 1UACH 3DBXA 1YPZF 1N64L 1OP5K 5IMOB 1JNHB 4EEEA 5IEKB 4L8BB 1T4KA 3U46A 1GAFH 3MCKA 2XY2A 4JB9L 4LCIL 2VLKB 1DUYA 1DQQA 4M5YH 3PIQB 1UZ8B 4OAWB 1OTTC 2NX5D 4G8FB 4YE4H 1YN7B 1LE9A 2NZ9C 1A7NH 5FO7A 2VXVH 3FN9A 1JVKA 2VXSL 4K7FA 4KI5F 5JORB 2V17H 3S5LG 1E4XI 1T2JA 4X7FC 5JW4M 1ZLSL 1S9KC 5IHBA 1MJUH 1C16B 5EIIB 1RMFH 3GSNA 3QFJB 3GIZL 5DXWA 3ARBD 5E00B 1V7NL 5JW3H 2XN9B 1UVQB 3IRZA 2B2XH 4JKWA 4LASH 5IVZA 2ENYA 4FQLH 3LKNB 3BDBA 4ALAH 1AI1L 4J3OC 2MCPL 4F37K 4JFZL 4HIEB 3O6MH 3SY0B 1OARL 4IRSC 1IEAB 1EFXA 2BVPA 5M94B 5CJXA 2X4RB 5TFSH 5DURD 1I7RA 1H8NA 2P5WA 1S9WA 3QDGD 3FHAA 3BO8B 5BRZE 2YPVL 3WIIH 4K7PH 3PJSB 5E00A 1FQ9C 4PG9A 5D2NC 5IVZB 1JWUA 1XZ0A 3QZWG 4UBDD 4KK9C 5EZIH 1W8NA 4DKEH 5T33L 4KPHH 4DOHB 4OTXH 4OJFH 3WEXA 3MV7A 5GGSY 4X6EB 2ZP0T 1GGBL 5AUMA 2F58L 4MLSA 3OKYA 1FE8L 4W70A 3U4EA 5HDQH 1I7RB 2ZCHL 4LGPB 5DS8A 1S9WB 3VXTB 2K3TA 5IHZB 1QSZA 4BQ8A 4FTVA 1OTUC 4R9HA 3PJSA 4QHNA 2XKSA 2CKBB 2Z8WC 4N5EC 1I9JL 3FQNA 4PJ7F 4RNRB 3FFDA 4NQDA 4XVUC 3VXUD 3NFSL 4ORZC 3TBVA 4D9RE 4M6OL 4R0LA 5E2WH 3CXDH 3MJ6A 1LMKA 2YPLE 4GQ9H 4GXVL 3FT2B 4JPIB 1JGDA 1CDYA 2MKLC 4KQ3H 5DJYB 1EO5A 3MRHA 5HGBA 4QEGA 3U7WH 5ESVB 5DS8B 4H20L 4WNQA 5HY9A 1TQCC 4ELKB 2QEJA 5D1QB 3N50A 2CKBA 3VE0A 1D9KA 4Y4KC 3V0WH 5ITFA 4DUXA 2PTTB 2BVUA 3JUZA 4ZD3H 2A83A 3LB6D 3PWJB 2AXHA 5FUCE 5I1DA 2WW8A 5I1HH 3S5LB 3HR6A 4JPIA 3DX7A 2B1AH 4D94A 1VESA 1NBQA 2Z31C 4DQOL 3B9DA 4G42A 4LRNL 2P4AB 3L3JB 5DK0B 4OUUA 4MZ2A 1JPTL 1HIMH 5DJDB 3D3VE 4PREA 2D3VA 2R2BA 5CSBA 5EO9A 4M3JA 1E6JH 2V2TB 3QCUH 3VFSB 4W81A 3FL7A 1U3YA 3VWKD 3BHBB 1KTLB 1LO4L 5GZNC 2DQFB 2IBBA 2P8MA 4AT6B 4UUJA 2DDQL 5ITFB 4TQEH 4HIIA 1RUMH 1XF3B 4KJPD 5SWZE 3PWJA 5MENE 3TBTA 3O41A 4KJPC 1OCWL 1A02N 3RX8A 5I8KL 1WFOA 3BP4A 4TRPL 4Z7WB 5BZWA 2X1WL 4L4TB 2YRZA 5H35A 3Q6FA 4LSRH 4PPTA 2R2BB 3WLBA 1MRDL 4Q58C 5E56A 4JQVC 4D0BA 2Q6WA 3P3YA 1U8NB 4KMTH 4RGNB 5INDA 3T77A 3EDEA 3RDTC 3U4BH 4Q9RH 3RP1A 5IW3A 8FABA 3MJ9L 1EERB 4I48A 4NJAH 3SO3B 3K46A 3RZCB 2VDNL 2IPTL 3QUKB 1T89A 4DQOH 4FN0A 4QRSB 5H37G 2WSKA 1A4JA 4K55A 2ESVD 1ZHLA 3T0BA 4O2EA 5I76A 2OTWB 2PO6A 3LS4H 5E6IB 4LEOB 1B0RB 4NBYB 3PL6B 3VFTA 2JF1A 1D5BA 2B4CL 5GGQL 5CD3A 3T77B 4HV8A 4DVRH 2XZAH 3VWKB 4JR9H 4MSWA 2GJ6E 1K8IB 2BX5A 2VO5A 3G04B 4KRMB 5DFWH 5BVJB 3S3JA 4E42B 1EGJA 5DUPH 4QHKJ 4PG2C 2ZWLT 3B6SB 3X13B 4ELMF 2VDQL 3CFIC 3VXPA 2AK1L 2CDEA 3WFEH 5FK9B 5BS0E 1UXWB 4WVRA 2VXUH 5IP4A 3BJ91 2BXYA 5GJSH 3ULUC 1U8LA 1J86A 5IB2B 5FECB 4IMLB 5IVOA 5I1EH 4H8WL 3ZTJH 3L3IB 4CL7A 5DFTA 1D5BB 4Z7UF 3CXHJ 4EJ1C 3MNZA 4CJ0A 4PLNC 5C0BD 5I1JL 3C6LD 5BVJA 1ZXQA 3W39B 3PQYE 4HX1B 4PBVC 3FO0L 3EAKA 4BSVB 5D2NB 3HZMA 5ACLA 3X13A 3HPLA 4ODBD 2NY0B 4QOKA 3QNYB 1YC7A 5KAQG 1SJEB 3CU1A 3ARBC 2ATPA 1A6AB 4XP6L 1MREL 2DLHA 2EDYA 5IVNA 4OJFL 4MXQD 1SMAA 1HCVA 4PGCB 4FHBD 5DMKA 5ID1A 4MAUL 5E1HB 5K9QG 3O6FB 1WWBX 2YUVA 5F9OH 4LLYA 4CDHA 2XRAH 4UTAL 3LEVH 2X6MA 3AU1B 3ZYOA 3TO4A 4JKLA 1MF2L 1RZ7H 1T6WA 4X7CC 2BERA 5HHME 3WO4B 1FZKA 1A6AA 2AAVA 1P4LB 5DD3H 4Q0XL 1CICA 1KFAH 4ALAL 2YA1A 3MJ7B 3C5SA 5T1KA 1FLRH 4PGDA 1G7IA 1YNLL 5ID1B 3BKMH 2FJHB 5DF0A 2AV1A 1MFBL 1WF5A 4M48H 3G08A 3NAAL 3O6FA 3WNOA 4GRWH 2EE6A 5I75B 4QY8B 5JLZA 3EYQC 3GJEA 5JW5A 4NT6B 4LLYB 2HTLD 4IRSA 3OKMB 3OF6D 5F3BA 4TNVF 1VERA 2G5RA 3CK0L 5E99H 3LHPH 4MA7H 2ORBL 2JB5L 4HXAL 1Z3GL 4XCYB 4PBXA 3MRGA 2WUCH 2ARJQ 2OX5A 1EEYB 1G7JB 4PRBB 4AM0A 5IB4A 3VFGH 1UJ3B 2YUZA 1MNUL 4X6FB 1YEEH 4U1SB 1QBAA 5GSRA 1EPFA 2XG4A 4NKMA 3WDHA 1YN6A 4P23D 4HWBA 1I8LC 4NZJA 4QT5B 4ZUWA 4JQIL 1C5CH 5E2UH 4JRXA 3PE9A 4G8GB 4JM2C 4OLXH 1JGVL 1GC1H 4JQXC 4XNYH 2UY7A 5L9DH 3OR7A 3K8KA 4MYWB 3ZMRA 4R3SB 2FGWL 3RZCC 1T5XA 1KB9J 1GOFA 3A0OA 4Y5VA 3U9UB 5ESQA 4U6VH 4NFCA 3L3HA 3S7GA 4JFOB 4YBLB 1A4KB 4L1DA 4LRNH 4Q7DA 3KXFB 5DVLA 4I18B 3ZYIA 3CFDA 1IC4L 5FCUL 3WFCL 1T22A 4WJ5B 1WEJL 4E41B 1A1MA 1X5GA 1CXLA 2J8HA 3ARWA 1OD7A 5EBWA 1W72L 2J8UA 1BECA 1C5BH 5EZOH 1FNEB 1W72B 1PEWA 4PRPB 3SBWC 2DRUA 4YHYB 3F58H 3VRLE 1T5XB 4Y4KA 2F8VA 3CFCL 4QHMB 1HQRA 1MIML 4G43B 5AD0A 1AGCB 1WBXB 1A4KA 5DJ6A 4IOIA 4JFQA 5DRNB 1PLGL 2OTUB 5DR5L 3TBSB 4PJHF 3BP6B 5D96B 4OZHF 1OLLA 5A16A 1OTSD 3BUTA 2I26N 5D9SB 1B4RA 4P4KB 4TVSa 5ETUA 4ZFFA 3FMGH 3ARRA 4Z5RA 3QRFM 5CIPH 5FYJE 2J8UB 2XA8L 5LWYH 2DWEA 4R97C 2YR3A 3L5HA 4W4OC 5LAXB 4TYUA 4PRPA 4TPRL 4GBXC 1WAAF 4OFVA 4PS4H 4RSVA 1NBVH 4HEPG 3QRGL 1U6AL 1RU9L 4OLZH 3L7FB 1HQRB 4M9OA 1VEPA 2XZCH 3LOWA 5JMOC 1AGCA 5EOCL 3VFMA 3VXUA 3BIKA 1EMTH 3T3PF 3C87A 3C9NA 2O5YL 3DYPA 3BP6A 3P4LA 4LPYA 2MPAL 4OTXL 4F7TA 3FB5B 3MODH 3WV0A 3VXMD 5TDPB 3ZHKA 4YHZL 3DRQB 3FAWA 3OPZL 1BOYA 2FIRT 5F72S 1QA9A 5I75C 4P2OC 2JK5B 5AZEH 4G80B 4NQSB 4N0FA 1DQTA 3L7FA 1I9IL 5KOVC 5D93C 4HLZH 4MDJA 1YNKH 4XC1L 1JK8A 4L8BA 2CUIA 1AXTH 4FQJH 3WHE0 2P5EE 4RFOL 5EC1A 2XWJB 4CVUA 5JQ6L 1FO0B 3MQIA 1CD0A 3FB5A 4WI7A 2J88H 3QIUD 4F7MB 1YN7A 2BRQA 3C8HA 5FO7B 3W11C 3W5MA 1JTOA 1ND0B 3C08H 1KTKE 4ZPTB 4K7FB 4JFEE 4L9LC 2JK5A 3TT1L 2OBGA 5E8EA 4NNYB 5D7IB 4WTXA 4LVHB 4OGYL 4AENB 2PXYA 5C2BL 1QSEA 3U48A 3W2DL 3NGBC 1I1RA 1PQZB 2NY4D 5DD3L 3VA6A 4MD0A 3ARFA 3C5ZC 3LKNA 3F6IA 3QEQA 1S7WA 3FRPA 5EORH 3UTQA 2XWJA 1BQHB 1WTLA 1LVEA 2VZ1A 1KELH 3PNWA 4NFDA 5HYQA 2BVPB 5TF0A 4WWKA 2IH1B 1RZIB 2PN5A 4LMQI 1XF4A 1WWCA 3BD4A 1IAIH 5IEHB 2P5WB 4JDVB 4C56D 3O6KL 2A9NH 3DUSB 4GSDH 4AENA 1ZGLB 1FAKT 1N7ML 3LPWA 4PG9B 1G9EA 2R1YB 4MD0B 1JWUB 1G7QA 2E9IA 3OKLB 1AFVL 4ODTL 1CIDA 2GYSA 1LGVA 2YPKA 2D03L 5DC9B 5E7FA 3S37X 4U1LA 4UI2A 3B3IB 3IETA 2X42A 2AJVL 2IFFL 2CLVA 1OB1B 4P2QD 1MJ8H 1H15A 3CH1B 4EBQL 1OAXH 3JVGA 2BVTA 4Y4FA 4Z7VE 5HYFA 5HXMA 2LFGA 3S9DB 5IHZA 1JWSA 3DUSA 2EXYD 1HZHL 5IG7A 1A0QL 1WBYB 2JCCB 1MCNA 3DMMB 4J4PC 4QHNB 5C86A 1RUQL 4LK4A 2XTLA 1CL7I 5F89B 1G7QB 2VDLL 2HT2C 3H7LA 3E8UL 1MNUH 3FFDB 4YHLH 3SKJL 4NQDB 3QPXL 3HI1A 4D0DA 2DLFL 2EIZA 4FQ1L 5DQ9A 4R0LB 3RA7H 1DLFL 2XQBL 4GW1A 2FB4L 4QHUA 1J0YA 1E6OH 1DEDA 1U8JA 3VWKC 4KXZH 3TZVC 4RDQG 1GPOH 4EUPB 5E8NB 2DLTA 1G0YR 4MA7L 2Y07H 3LKOB 2PCPA 5FYJU 2JCCA 4Y4FD 5DMIH 3FO9B 2AJXH 2ICWB 4G9FA 2PTTA 4LDOB 5DVKA 3IXTA 1DQML 1NEUA 4HMEA 3C8DA 1GL4B 5DHVA 4LQFH 3UTSA 4MGXA 2Z92B 3DVFA 2YPLA 5IB3B 5DK2A 5KVEH 4O51A 4YBQD 1J0IA 3O3DB 2R56L 5KSBF 4PREB 5EO9B 1X6NA 5GGVL 4QXUH 5C09E 1HILA 1CLZH 2PCPB 5HGHB 2F8OA 2L7UA 4M1GH 1NCBL 2P8MB 3ELAT 2MMXA 2MQ3A 4WI9A 2L0DA 1H8SA 2BSED 2R9HD 3ZE1F 5JMRA 3KLAA 2NY7H 5F9AC 3BPCB 3QXDB 3BKJL 3S96A 2IPKB 4JQXA 4WFED 4YPGB 3BN9D 4TVPL 4R4NC 1T1YA 4P46C 3BDYH 1JPST 5H2BA 1IARB 4F58H 2VERN 5DQJB 2H6PB 2ZZUT 5C0JB 4LFHG 3IS1X 3MV01 4F15B 5INDB 4MA8H 4WHYH 3UYRL 1N0XH 4P57A 4XVSL 4I3RH 1QFPA 1E4WH 5H94B 2LAAA 5FM5M 2B1AL 4QKXB 1N6VA 3STLB 5J12C 3ULVE 3RZCA 4WHYG 4X4XA 2QL1A 4KDTC 1R0AH 4ZDHA 4QRSA 4IRJC 4ZO6A 1GRWA 4X98B 1HKLL 1JV5B 4HUXB 1AJ7H 1FL5B 4X6CF 2Q7YA 3NZ8A 1YNTA 1P7KB 1N6UA 4FQ2L 4PJ8B 5C0JA 3MUGB 4U7SA 2DKSA 4ZTOH 1T20B 2OR8A 2P47B 1BZ7B 3JWOH 1FV1B 3GB7A 3O9WC 2A73B 5H94A 4Z7OF 1NMBH 3MLWH 3CDFA 2WBKA 2IEPA 3LB6C 4LHUA 5CZVL 1AXIB 4DKFL 4WI5A 4HKZB 2F15A 2Q7YB 3K7UA 4MXVE 1R3JA 1YEKL 4PJ8A 3MUGA 4OLVL 2ZPKH 2A77H 1OARH 2F54A 1NFDB 1T20A 4NJAL 2FEDD 1QG3A 2VDPH 4LARH 5DJ0B 4NDMB 2A73A 4PB9L 1RUKH 3W39A 3O6FC 5GPRA 3TPKA 1JN6B 3WFBH 2ICCA 4C4KO 4BSVA 4KKLC 4P3DB 4LHUB 4UNVA 1DR9A 4G9DB 1MRDH 1CLOL 2VLJE 2JELL 4QOKB 3EYUH 5T33H 4DKEL 4JFFB 1YJDL 3UTPE 4MVBC 4NQEE 4HKZA 5EO1B 5E5MB 1UXSA 4ZYKB 1AXTL 1R3JB 3RIFK 5FFLA 3TYGL 2W07A 1U93A 3PF2A 2F54B 5HDQL 5DJZA 4BFEA 1MPAH 2R0KL 4NM8H 4DCQB 2EXYC 1NANH 4J3VA 1UCBH 3IKKA 2V7HB 1NPUA 5LBSH 1KXVC 2VAAA 1I1YA 3LRGA 5F9WB 3I6GB 4KRPD 2P5EB 3TO4B 1GSMA 1ZLUK 1HYRC 3NCBB 1FZKB 1CICB 1CGVA 3OKKB 1PKOA 3MJ7A 4AIZB 4ZYKA 1G7IB 3P77A 5IT2L 3DHJA 4GRMB 1A6TA 3G08B 1UKTA 1MJJA 1JPGA 2DKUA 2NQCA 4MJIA 5C0DA 4J2XA 1ADQA 2VDOL 2FECI 1GPOL 4NT6A 3I6LD 1INDL 3BQUB 5FYKD 5EUKA 4F3FA 4BK5A 2R2EB 1J1OL 1WAAA 1WISA 1FZOA 4OKVA 5JW4N 1FG2A 4XC3L 4OFYD 3I6GA 4ODHH 3TJEH 5FYLE 1N7MH 3I2CL 4PUBL 1ZA6A 4N0UB 2NY5L 3T0EE 4HT1H 3OKKA 3EOAA 2NZIA 3RVVD 3E2HC 3SDXB 3R0NA 2KDGA 3MA9H 5E2WL 2NX5E 4GRMA 2DMKA 1SYVB 5AEAA 1D5XB 1KJMA 4Q97A 1JMXA 4LSUH 1RU9H 1X5YA 2PYEA 4M61B 4QLRA 3SGJC 4R7DB 5IFJA 4PS4L 4XX1E 1YN6B 1Q9WB 1YEHH 1LEIB 2F53D 5EUOB 5T1DH 2GFBA 3G5YB 3RWIA 1QLEH 1PSKL 2E7HA 1U8MA 2E27H 2J8UF 1AHWC 3PUCA 1T04A 1UH3A 2VSDA 4OCYH 4R4FH 4HJGB 4OQ1A 1QOKA 1M6OA 2UZYB 1CE6B 1VGEH 2AJYH 4QGTA 2XIDA 3IDJB 4NQEA 4QRRB 3UZVB 4GRLB 3RKDC 1D5XA 1KJMB 1YC8A 1XIWB 3AROA 5FUCC 1KC5L 4HKXA 2VC2H 4M61A 3AC0A 3IDIB 1NMAL 1AXSB 3IDYC 3V9FA 4WJ5A 3G5YA 4E41A 3SDAD 1EZVY 1WBZB 4JPWL 4HT1L 5IGXL 1DSFL 3VD4A 3WKNA 4TULH 1PFCA 4R0LC 5KN5A 5C2UB 3GMOA 4OLWL 2C3GA 5D1XD 3LMJL 3VFWA 4GRLA 4O2FB 4QHMA 1FGNL 4HKXB 4EI6A 4HCRL 4LLQB 4KMTL 5HD8D 1KIQB 3TZVA 2EDJA 3MRBA 3MZGB 5D7IF 1AXSA 3EJZC 1G0DA 3MLSL 3TBSA 1HXMA 1I8MB 3QI9D 3IAQA 5EORL 5HYSG 3HAEA 1M1SA 2F74A 4HWEH 3EOBA 1OAKL 2QHRL 1KXTB 3GSVB 3PV6A 3UJJL 1EFQA 4KVCL 1OD9A 3MFFA 3C2AL 4XXCA 2QADC 5K9QI 2VQUA 1J12A 4JY6B 2GY5A 3WFEL 4BFGA 1I3RA 3BMVA 1KN2L 4BZ1H 3LH2H 5HHVL 5GZOD 1JZ5A 4JFPB 5T1LD 5LQBL 5IBLC 3KPSD 2X4TB 5BVPH 3IKCA 5LGKA 3DUUA 4KDVA 4WCYL 4IM8A 4M6OH 1WZLA 4K23H 3RTQB 3B8YA 4X7SH 4GS7B 3EJZD 1YYML 3IDMB 3IU4H 3T4YB 3PGDB 5D7KE 2AERT 5HD8C 4YHPA 4H25B 1QFHA 2B4CC 4TSAL 3MFFB 2GUOA 5K9JL 3W5NA 2KZ1B 1UM4L 5EIIA 3FB8B 3TV3H 3C8KB 1PEZA 1HI6A 4P46A 5IQ7H 3GJFA 4G9FD 4K8RD 2VXUL 1L0YA 2Z35A 3LS5H 4AMKL 5KSUB 2XFXB 3KJ6L 1LQSR 1JK8B 5DD6B 3V0VB 4YHML 3IKCB 4LIQH 5T1LA 4HIEA 3RTQA 5MEQA 4D9LL 4OIBA 1CD8A 1P2CB 2JIXD 3E8UH 3MBXL 5MEND 4H8WC 2N7BA 1P4BL 1CF8L 4HQQH 1TJIL 4YDLB 1H3UA 4XVTL 2PXYB 1KLFA 1QRNA 1T2QL 3U4AA 5F7KC 4LOUD 3OKEB 3BJLA 4MVBD 5B38G 4ONGH 5IR1A 1VKXA 3UTQB 1FPTH 1BQHA 1RK1A 5I0DA 1CD1A 5T3XH 4PJ8D 1G84A 3F7PC 4HS6A 3PQYB 1P2CA 1I7TA 4HK3N 3U4EB 4WWKB 2ZCKH 1PG7X 3HMXL 3SE4C 4XNZC 4JDVA 1P1ZB 2WBJB 3IT8D 1FRGH 4NNPH 4P2RB 4RA0C 4ODXB 1X5KA 3HC3H 4XPFL 4RBPH 2BNRD 4P99A 1ZGLM 1SBSL 3QWOB 1QFUL 3RAJH 4JLRB 4YBHA 5I1IH 4MQTB 2CIIA 3PQYA 4HS6B 4F7CB 3OKDA 4R90L 1NFKA 5I30H 3MRQB 5IW6A 5ELIA 4UINL 3CMOL 3NCFB 3P4NB 1H15B 3CH1A 1OW0C 5F88B 1NL0L 1RZFH 2Y06L 5ALCL 3IF1B 3BKJH 5A3IC 3B2VH 1JWSB 2C1OB 2NY2C 2WBJA 5IG7B 2G2RB 2Y5TB 1FIEA 1TVDA 4BSJA 2DYPB 3VFGL 3ZKMD 1NCBH 5F89A 3RGVC 3UAJC 1RJCA 2M26A 2IADB 4UIMA 3VI4E 5HHXH 1SEBB 4NZRL 4PRIB 4IRZL 4JN1H 1CQYA 2IAND 4IRJD 4NRZB 1FNFA 1G7PA 5D7LA 5CGMA 2DQHL 5DRXA 5C0AD 2YC1B 3MRQA 2VDNH 2ZCHH 3CVHA 5E8NA 2V2TA 3D87B 2C1OA 2DBLL 3EFDL 3D48R 1S7UB 4M00A 4G8EA 2LVEA 1JCKA 4R26L 1YMMD 4KPHL 5DEGB 3FO9A 1QNZL 3BP7B 3MJ9A 1SEBA 3OMZA 1ZA3B 4WUUA 5SWSD 3E0GA 5KTEH 1G7MA 4G7YL 1IGJA 5J13C 1TVHB 5CP3H 1R0AL 3BP4B 1DZBA 2V9RA 2Z92A 3M17A 5DRXB 5BZWB 3QQ9D 3MV9D 4HH9A 3O3DA 3T0VA 3Q6FB 4WFFE 5DFVD 4H1LB 4P5KA 4KI1A 3UYPA 2YD7A 4L8DB 3HC0B 1AGEA 2PO6C 1QO3A 1HILB 1BM3L 1KXQE 2AEWA 2P45B 2FEDC 4QTIH 3SDAB 3O2DL 3S4SG 2VWEC 1N4XH 3MGAA 1ZLWH 4NGHL 5F1OB 4HMCA 4KROB 1WUNT 3GKWH 3U82B 5A40E 4YPGA 2Q3AA 3M17B 5CJ8A 5GS1B 5EOTB 1P84K 1T1YB 2MKWA 1K4DA 4F57L 2W60A 3SE3C 4U1GC 5HYJA 2HWZH 3FOLB 4P5KB 5FDYA 2R0LH 1B0RA 4FFYH 4J8RA 4WFGD 4PJ7A 4XBEH 1EH9A 2FDBP 4HV8B 2AK4A 3SDAA 4P57B 5FKAB 2VKXA 1K8IA 3G04A 2F53B 3BE1L 3JV5A 3BWAA 3NABL 4D9RD 5JPNB 3BKCL 5B3NA 4M7ZB 1QPXA 5KANG 3VXPB 1EX0A 2CDEB 4DTGL 1SEQL 4X98A 1GGCL 1XCQB 3V6ZA 1ZEAL 3ME0A 1K4DB 3OB0H 1KN2H 1F6AA 3NZ8B 3FOLA 2J88L 5F7UA 4FQCH 1KJ2L 2AGJH 1X5FA 3BZEB 3QAZB 4J8RB 5T3ZL 4OIIH 1C5DB 1A7NL 2AK4B 3MNZB 3NA4A 3TH3T 1YPZA 4L4VE 3SEPA 4Y5XC 2F53A 3VWJD 4HX1A 3WFZA 5KZCB 3IVKB 4LNVA 3HZMB 2EYTB 4BZ2L 1YY9C 4UOJA 4Z0XA 1SJEA 4UT7H 5J1SC 3V6ZB 5IUSA 3TO4C 2NY0C 4XXCC 5F3HA 4AZ8A 1ZLVH 1IM9D 2MCPH 3VFOA 3WDIA 1MSPA 3MLUH 4QTIL 2OR9H 1MQ8A 5DMKB 1T89C 3BZEA 5T3XD 2IANE 3L5IA 4FQXD 4HWZA 4RQQA 3H6JA 3QJFB 4JPKH 4Y16B 1NBYA 2K7QA 5F1SA 2BC4A 1FP5A 1BX2B 1YPZB 3LKRB 1S7TA 5H8DA 1YEJH 1BLNA 3MRKA 1UWXH 4P3DA 1KNOA 3IU3A 1U92B 4KK9D 4OI7A 3AS1A 4KUCD 1CGSL 3PWUA 4POUB 3VFOB 5E5MA 2CXGA 2VR4A 2F5AH 4M8QA 3N1PC 5JHLH 3C5SB 1UB6A 3QFJE 5B8CC 5F96H 1SM3H 4OGXL 1NLDH 4JFEB 1WSST 2FJHA 4JJHA 4LSSH 2AV1B 3RU8L 3QJFA 1DBKH 4Y16A 3H9HA 4OCYL 3T0XA 3MV9E 3IAGC 2XZZA 4WFGE 4QGYA 5J1AB 5D1ZD 2EDTA 4DKAA 4U1JA 3OG4B 4WHDA 2FNBA 3DROB 4XPFH 3EIFA 5T1DL 4CVXB 1WIOA 2DM2A 2HH0L 4DFIA 1FBIH 4NP4H 4XCYA 2BJML 3MRGB 1W0YT 5C70A 4OCSH 4NKOA 1CFNA 1I9RL 1G9NC 2NNAB 4HIXH 2FSEA 3PHOB 4ODUA 4AIZA 4OBRA 3BGFB 4HAFA 2DLFH 4FQ1H 3SE8H 3QQ3B 4R6UA 3V6FA 4IJ3B 3P77B 1T21A 1UJ3A 4CADA 4ETQA 5EO0A 4LARL 2JCCE 4KKAC 1OWRM 2Y06H 1MJJB 5ALCH 2CLRB 5EFIB 2WIIA 3F12A 1ZANL 4K3DL 4J3WA 4YDVA 4G3YL 4U1JB 4LSQH 2DKMA 4H1LG 4EKXA 1AE6L 3GNMH 2R2EA 3F7RA 4JRYD 3T65A 1IGFL 5HYEA 4WUKH 2YUXA 1R24A 2P46B 4KROC 4CU6A 1PD6A 3QDJA 3UTTE 5ITBH 4W6YB 1ZA6B 5KJRL 4NKOB 1LD9B 1CFNB 3ZDYF 1FC2D 3R8BB 3TBYA 2JJVA 3EOAB 4N0RA 3K2MC 4ONFL 1KCUH 4XNUH 3IFNL 4R3SA 5DMGC 1T21B 2GEEA 4CADB 4ZFZA 4ETQB 5LWYL 3WFHB 1G7HB 2CLRA 1VB9A 5TE4H 5DGQA 1QFWI 4R7DA 2D7TL 4YDVB 5BCAA 4GUPB 3CCHB 2NY6B 1BFSA 5C3TA 2NY2B 1KPRB 1F11A 2R2CA 1QSED 4S2SB 5FO8A 1OW0A 3EFDH 3Q2CA 5IF0A 2ITDB 4L4VD 4B0MM 1LD9A 3WFDL 4OGAC 4W4OA 1CE6A 4DEPB 1S7VB 2OJZL 3X17A 3IU4L 4DGVL 1AR1D 4BYHA 4K71B 4HXBH 1G7HA 5DHYA 5D71H 1JRHI 3O3EA 1I8IA 2AJSH 1VFMA 5DJ6B 3PWPE 1R3KB 3HMWL 3SDXF 1A6WL 3MC0A 3VXQA 3QIUC 2AEPL 4LIQL 5D9SA 2IPTH 3TGXA 5ETUB 1VEMA 2LV4A 1XF5B 2ITDA 3KJ6H 1WCQA 5L2JA 2CKBH 4MJ5A 4QO1A 1YY8A 2QR0A 3GMOB 1AJ7L 5E8PB 2HRLA 4HFWB 4UMGA 3VFWB 4PD4J 1OAQH 4KUZL 5I18L 5IMOA 1XCTA 5E2UL 2Q87A 3T2PA 3MRBB 1C1EL 3KPQA 3MLYH 1R3KA 4O58H 2AS5M 4LCCC 1AD9A 1VPOL 4OZGE 1T0MB 3CLFH 4WV1A 2V5TA 5GGRB 4F7TB 3P11L 3HAEB 3WFDH 3LD8C 4P59L 4G8FA 5L6YL 1LE9B 3VGGA 3QHTC 5L2JB 4V2CB 1IC5L 1IRAY 2UYLB 5E8PA 3T2NH 3ZKND 1OAUL 2VDML 1IAOA 3QFJA 4B7IA 3CUPB 1NC2D 1IAIL 4KI5C 1UVQA 4KGLA 3C60D 2ZPKL 3OAZK 2X4TA 4MDJB 2VSCA 4GBXD 3KPQB 3QIBD 5ERWA 1FRGL 1G6RH 4NNPL 4WWKD 3WIFB 4UOW0 4ZAKB 4G6KH 3ZE2E 2FB4H 2ZOKA 1H8OA 2XA8H 1EFXB 2X1XR 1CFQA 4MB5A 2BY1A 2X4RA 3IFOB 4MS8D 4NWUH 4H25A 2VITA 5F7LB 5E8OB 5E8EB 2VAJA 5KSAC 3T0AA 2QKIA 1QSEB 3C8KA 5DJXB 5CLWA 1S78C 4P46B 3QUYC 2JKXA 2Z35B 3NA9H 1MCPL 5E2VH 5IESL 3QEQB 5EU7E 3ZO0A 5DD6A 3V0VA 2BVQB 4KROD 2QADB 1S9VB 3D18B 4LVOB 2P1YA 2O26U 4HWEL 3PNWB 4JHAL 1V3LA 3J7HA 4OLUH 3DURA 1I9EA 3QNXA 1IQWH 2KQMA 2VDMH 3HI5H 3QO0A 2BSTB 5C71A 1JZ4A 5E8OA 1DQDL 4NNXB 5DURB 3MV8E 4P49A 1ZGLA 5DJXA 2XA3A 1FYTE 1FFOA 4OCXH 5HHOA 4AY0A 4LSTH 3MJ9H 3BD5A 4MHHG 4JY5H 2GAZA 3B2UC 2BVQA 2ED9A 1VKXB 1S9VA 2YPKB 1DQMH 1HEZA 2RCSH 2JJTA 3B3IA 4HW6A 4XI5C 4XBPA 3VDAA 5C08D 4APQC 3MRHB 4LSDA 4U1KA 4Z76A 4JFDD 1TPXC 4PJ9D 4OFDA 2GY7B 1GVIA 1P1ZA 5KS9E 5J89A 8CGTA 5HY9B 2EDRA 4NUJA 3MLPA 3RJQB 3CNKA 3TEUA 4FZEL 1NBZB 4PLOB 3O8XA 2L7JA 3TO4D 4FFZH 4JVPA 3VE0B 4QXUL 5D7JA 3P30L 4KFZC 2JJSC 2A83B 4LAQH 3HI1B 4D0DB 5DQ9B 1T7WA 1BBDH 4Y8DC 3GHBH 4IIQA 3O6FD 5HI4C 4U1KB 4J3SA 4Z76B 5DJDA 3LS4L 2KBGA 3RNKB 1B90A 2Y36H 3LKOA 4NUJB 1TTGA 3QDMA 3O8XB 1BREA 4AT6A 4UUJB 3VWJA 3H3KA 5D7JB 4QXGL 2D03H 5CCKH 1AO7D 2BNQD 4NRZA 3ORJA 1G7PB 4NRXA 5E03A 4Z7WA 1I3UA 5CEXA 3E3QC 3FRPG 5DK2B 4R8WH 4L1HA 4IIQB 3EUUA 3KPRB 4LLDA 4Y1AA 4YGAB 2VLJD 3WKMH 1YEIH 3RNKA 2I9TA 4UQ3A 3EDJA 4LCWE 1BJ1H 6CGTA 4D0BB 1FPTL 4G8EB 1RUQH 5LXGH 1I7ZA 4EVNA 4WW2B 3QDMB 2VL5A 3GJFH 5DEGA 2OJZH 3BP7A 5JZ7C 3VWJB 1R5VB 4I48B 3WJLC 4TPRH 1A3RH 1UWEH 1X5HA 1ZA3A 5HYSA 4EBQH 2H26B 3BPCA 5JA8B 4Y0GA 1WGOA 1A4JB 4NRXB 4M7JL 3SCMD 5CEXB 1MHHB 5DGRA 1I1CA 3M45A 3ARED 1ZLWK 5D7IE 1EJOH 3B2VL 2OTWA 4UILH 4JCMA 4ZAKD 1NAKH 5ISZE 3GHEL 2EO9A 1L9MA 2OL3H 4OLVH 4F80A 2GT9B 2HTKC 2N1KA 1I7ZB 3DXAB 4EVNB 3VWKA 2XTJD 3K1KC 4NZDA 1HQ4B 3IDXL 3LHPL 5AAWA 5I19L 4J1UA 4XP4L 2M2DA 5SWQB 2VOTA 2R69L 4DW2H 1S7XB 4C54A 3QH3B 1MHHA 3MYJA 2BSSB 4NCC1 2W60B 4MNGA 4KJYA 5IB2A 2FZ3B 3RX7A 1YYMH 1FCCA 2Z31A 3QIWA 5MERB 1OY3B 2GT9A 1KFAL 5FKAA 3OB0K 4H26B 3GSNH 3RPKA 1FDLH 1XMWA 3L5XL 5CJBA 1YEGH 1HYSD 1T1ZA 4ZUTA 5HHVH 3TV3L 3KLHC 1UCBL 5K59E 1RIVH 1MI5A 4X6CB 4EIZC 3PV7A 2V7NA 1XCQA 2BY2A 5SWQA 1K3IA 2Y7QA 1S7XA 2HH0H 1PBYA 3S97C 3U0WL 5IVXB 4MNGB 4RFOH 1NFIA 4HH8A 2G9HB 5D5MA 4P2RE 3EZ8A 4X4MA 3V7AE 1BFVH 5AAMA 3RDTD 5MERA 1NCWH 3LKQA 1DBKL 1FFRA 4H26A 3GRWL 3QQ4A 4CNIB 4WV1C 2GTZB 1T1ZB 4ZUTB 3GIZH 3VMOA 2ADIB 5GS0H 1MI5B 1GYAA 4X6CA 4M9PA 4G9DA 2E9BA 4OCXL 2Q8BL 5IQ7L 4JFFA 5F3HB 5JZ7D 1GC1L 3IDGA 5L9DL 3ULUF 2Q3ZA 3C5ZD 3SO3C 2G9HA 5T1KB 4OUOA 1UB5B 5L8JB 1U93B 4CGTA 3OZ9L 2EDLA 3DVGB 5DFVC 2H2SD 2QSQA 1VHPA 3LKRA 4IRSB 2GTZA 5DRZA 3X11B 1AGDA 5F3BB 4EI5C 2V7HA 1KPVA 1BLNB 1RD6A 1NGWB 2XNAB 4K07A 35C8H 2AW2A 1K9TA 2VAAB 1KNOB 3QEQE 1A0QH 1U92A 4D2NA 2QV2A 2X4PA 3NCMA 4ZTOL 3PWUB 4HPYL 2JB6A 5IBUG 5D8JH 1NFDF 3O3BB 3S37L 5C7XL 3Q3GB 3BPNC 1UB6B 1FH5H 4AL8L 4UTBL 1F6LL 4M1CD 2IBZY 3H9HB 3R4DA 1F58L 3DVGA 1D6EA 5E9DD 2R29H 4MJIB 3V5HA 1I1AC 2DQCH 4NKMB 2G60H 2X9XA 3G6JA 4H20H 1KENH 1NGWA 2AEQH 2EXWD 3JUYA 4OKVB 5EWIL 3UTSE 4M8VA 3BEWA 4ZUWB 3RI5K 5D6DC 3WLWC 3AB0C 5FYLH 4RRPA 2G5BB 3S88L 4WRLA 2JJUA 1IJ9A 3ZKSD 5JR1L 3QO1B 4HSQA 4CMHB 2VXTH 3ULSB 2MHAB 5MI0C 1HHJB 3ARGC 1QLFA 3V6FB 4KI5D 3MRJA 2DN7A 3PP3K 4MMXC 3JZ7A 1HHHA 3U9UA 2X44D 2WIIB 3GM0A 4UTAH 4KRNA 4JFOA 1ZSDB 2AXFB 2XV6B 2CKNA 2W0LA 1T22B 4MS8C 2P44B 3X3GL 3VXME 3RWIB 2ZUWA 1JGLL 1R24B 2ZNWA 1SYSA 5JW4Q 6FABH 4NKDA 4LSSL 1S7SB 1FNEA 5ALBH 4YJZL 4HJGA 3P9LA 2ARJB 4XP1H 3T0DA 3IDJA 4QRRA 3MRJB 3KVQA 1XIWA 1DBAH 3FO1A 3GZKA 3UBXA 1TCRA 4FQLL 3CDCA 3D2UA 3KPPA 1Q1JH 5JDSA 3JTTB 2DQIH 1M05B 4JFQB 4FMKA 4FQXB 2DQJH 5EOCH 1CFSA 1Y18A 2DQEL 2X70B 4O4YH 4Q6YA 2L4OA 3UTPD 4Z5RB 1RJYA 3WS6A 5IF0B 4JFDB 3DO7A 1S7SA 3QI9B 2JJSA 4RX4A 3VXNB 2CGRH 4X7SL 3PHQB 3QDMD 2VN4A 5D1XC 4HEME 3AM8C 1S7VA 3ARSA 3O2WH 5DD5L 5EOQL 4F7PB 3TJHC 2ZUQC 4NJ9L 2E6JA 4O2FA 5E08H 1CXIA 1IGIL 3OGOE 1TCRB 3TZVB 3LEXA 4EZMA 4XC3H 1JGLH 4NSKB 1KUMA 5GGQH 2A74A 4Y1AE 2FWOA 2NYYD 4N9OB 5FHBH 2BNRE 3MR9B 2AJ3A 1D5IH 3SGJA 3QI9C 2CDGB 5IKCB 4JFDA 3EDDA 5KVMC 4Y4HA 4M93C 3PHQA 2E3VA 4XNUL 5D7LE 1WFTA 5JW4R 5T5NF 1IAKA 3E3QE 1S7QA 2HWZL 2WBWB 4NQSA 4KUCF 4B53A 5B22A 4QNPE 2QSCL 1Q1JL 4U2YA 5D1QC 1BZ9A 4JFPA 3LEXB 2HLAA 1M4KA 1XF2A 5I15L 1CGTA 5EC1B 3BE1H 1AD9B 3KPTA 1T0MA 4WV1B 1H3VA 2P49B 1Q8MA 4X5WB 4QCIB 4GAJH 2IAMA 2CDGA 1OTSC 2WINA 3B9VA 5GHWL 4F7MA 5IKCA 1VDGA 1M71B 4Y4HB 1YYLH 5I1IL 2KZWA 1ND0A 1EFXD 2GUOB 2WWMC 4LHQB 1IAKB 3ETBF 4PRPD 4PR5A 1U8PB 3QG6B 4JM2F 1IAOB 25C8L 1PQZA 2Z0BA 3GJFB 2E7CA 3CVIH 2DLIA 1ONQB 4RAVB 5KSUA 1CK0L 2XFXA 3VG9B 4PJIF 1OPGL 5T1LB 1KIUA 5ERWB 4V1DB 3MACL 3MLXL 4CDGC 1ZTXL 5MEQB 4X5WA 2IAMB 1KTDB 4N68A 1TMCB 4GXVH 4PJHB 1M71A 5EC2B 2OP4H 3HMXA 2J1KA 5E08L 5IEHA 3GRWH 3GBLA 2VITB 2I25N 1UH2A 3UX9B 4P5TD 4TSCL 3UXFA 2CK0L 1A7RH 3SE3A 3OAYK 2V5MA 4TVPD 1FFNB 5DI8B 3C09B 1Z5LB 1F90L 3IFLL 3TM6A 3OKLA 4LU5H 5IR1B 1J8HE 4HCRA 1RUAL 7FABH 3D6GA 4V1DA 3SDAC 3DGGB 5HI5D 5MHSD 3D18A 4OZ4B 4ISVA 1A6ZA 3ZT5A 4JDTH 1PDKA 1A7PH 3G6DL 4PJHA 4D8PA 2CLVB 1OB1A 2H32A 3D5OF 3QCVL 1N64H 3QO0B 2BSTA 1B6DA 2X4NB 1H5BC 4GO6B 4MAYC 5D1ZC 1OGAE 4NNXA 1YA5A 2HKHH 4J7RA 2YBRA 2OM5A 4FQXC 1VPOH 2C5DC 1DDHB 3NN8B 1ZS8A 1K85A 4OIAA 1I9RH 4XVJL 4RWYL 1RI8A 2I24N 3VXOB 1K8DB 2V5SA 3QWOA 1QVOB 5IT2H 1G1YA 4YLQT 2CIIB 1DN2A 3OGCB 1HEZB 4ZO8A 3VWJC 4E5XB 4OZ4A 4F7CA 5FIEA 3VU2A 4XBPB 5IJKA 2RB8A 1NCTA 2AK4E 1C08A 3EO9L 4WUKL 1FGVL 5J3HC 1HE7A 3IF1A 4EUPA 2FCBA 4XNQA 2EYRA 3LRSA 3V5DB 5FGCE 5JIPA 2G2RA 2Z91A 3CH8A 5AZ2H 2W0KA 4RDQF 3GHEH 1NCCH 5D72L 1JRHH 1R5IB 2IG2L 3LVEA 1LK2A 1J1PH 4A6YL 4JHAH 3NABH 3O4LB 1HHGB 43CAA 4TNVK 3K74B 5KSBB 5DO2D 1G9NL 2WQRA 5D7LB 3UTSB 4KTYA 4XPAL 4ZFGH 3MXVH 2VC2L 2A38A 1LO3L 4EI5D 2BVOB 3VGAB 4BH7A 2XWTA 3V5DA 4WGWB 4F57H 3PHSA 1EJ6A 4JRYB 4ODTH 4RFNB 3S88H 2DLEA 4TVPE 1R5IA 5I73B 5FO9A 1MLBB 3KR3H 3KDMA 1LK2B 1NMCC 1Y0LB 2PXYD 3KLAB 4K94L 4YK4C 4WUUB 4UV7H 1MHPL 2ILLA 5KSBA 2IPKA 4FQIL 1G7MB 1TVHA 3NH7L 1MJ8L 1WZ1L 4OKDA 2BFVH 4PJCF 1MY7A 4KK8C 2R69H 2X4SB 1J1XL 4HZLB 4CN1A 3MJ8B 3AFLA 1QBLH 3PDOB 4NN6B 5H2BB 4DZ8A 5C6WH 4RA3A 2BVOA 2APXA 3B4NA 1N0LA 1AGEB 1QO3B 2EIBA 4IDLA 3V8OA 2EDWA 2PO6D 4OCNC 2XPGB 4WW2A 3JVGC 4WEBL 5LJYH 4MHHI 3NIGF 1MLBA 1R5VA 3KDMB 3STLA 5DC4B 5HYSB 2H26A 4OD3H 2E6PA 4JRWA 5LBSL 2FGZA 4ZDHB 5GRUL 1ORQB 3VFRB 3FO0H 3RGVB 3U9PL 5I1CL 4NQED 2HKFH 4AEHH 5GS1A 5EOTA 2APTA 3BD3A 4L4TD 4HZLA 3CFBA 5F7YC 4ESKA 3QA3A 1J8HD 5EBLA 1MRCL 1P7KA 1HYSC 1KJ2A 3EKCA 4XNXH 3RNQB 4PYHA 4URTB 4PJ7B 1S3KH 2QHRH 2XPGA 3DX8A 1N5YL 1FV1A 3GB7B 4KK8D 1JZ6A 2CKBL 3CFJA 2NX5B 4DVBB 4MNHB 3BWAB 1OOAA 3ES6B 5C0BA 1S5IH 3ARPA 3H9ZA 4N0UE 4JZOA 1B6UA 1ORQA 1Z2KA 3K80A 5GZND 4GG6E 4Z9KB 3CFBB 3QA3B 5EBLB 3HAEH 5JQ6H 3VRIA 1CGSH 3B8SA 1BM3H 2RHEA 4RZCA 1NFDA 4KKCD 1BFOA 3DX8B 3EJYC 2X7LA 3TLRA 3L5JA 4LAJH 2X41A 2D4FA 3CFJB 2HMID 3KPRD 4PRDA 1SJHB 1WTGT 3ZDYE 5E4EC 3MRNA 3FB7B 4Y19B 5FA4A 1NGXB 3MRFB 5FYLD 3SJVD 3WNKA 4NHUB 3NCYP 3GM8A 1GIGH 1KULA 3DVNB 5GIRA 2FATH 2Y7QB 1FNLA 4JFZH 2NY5H 4XCCL 5D8JL 2R0ZL 5IVXA 2PXYC 4LRIA 1UXSB 1JGUH 3U4BL 1MCRA 4CU7A 1Z9MA 4M7LH 4UT9H 4HWZB 4RQQB 1DVFB 5DJZB 1BFOB 4EOWL 2J5LC 1ZLSH 4ZFOA 1TETH 2B7DT 2BC4B 4NKIL 3G6JF 4NZUH 4OZHB 5HGDA 5CKGA 2DQUL 1JYNA 2EDBA 2Z93B 4XP4H 1SJHA 1HSAA 4I3GA 3IDXH 2ADIA 2AEQL 5ENWB 3V7AG 4NHUA 1IT9L 1O7VA 5D96C 3OF6A 5H37H 5CFHA 2P5EA 3TH4T 4Z7UA 1U91A 1GGYA 1DEEB 1XR9B 3ZE0F 1HKFA 4ACPA 5I0ZA 4S0TD 4YGVA 3IDGB 12E8H 2GI7A 4P0DA 2RCSL 4LOUC 4M8QB 4OV5A 3UZQA 4J4PD 2NY2D 3QDME 4X5LA 1V7ML 4JFEA 5TQ0H 5D5ME 1CE1H 3VMPA 1A6TB 1U58B 1GGBH 3F7VA 4ZFOB 3TIEA 4HC1H 3SGEH 5J9PA 5J1AA 4XP5H 3X11A 3FQWA 4OCWL 4X9BA 2ICWI 4U6VL 1CDIA 5EUKB 4RGMC 4F3FB 5EZIL 1FZOB 1N6QL 5ANME 3Q1SL 3CC5B 4I0PC 3A6BH 4Z7UB 3IYLW 4XVUD 4HBCH 4LEXH 5F1IA 2JB6B 3VXUE 1QRND 1TLKA 4YGVB 4XB7A 4N0UA 1NEZB 4HHAA 1UFUA 3O3BA 4WU5B 1JNNH 1V8HA 3W0WE 1KLUB 4BA8A 1T0PB 2D7PA 2J6EH 5IMMA 4JKPH 4UAOC 1KCRH 2Q76A 2YA2A 4P9HC 1FJ1A 2ZG1A 2R1XB 3S35H 1N5AB 3F7VB 1EA9C 2ED8A 2HFEA 5CZKA 3M07A 4PP2B 4MNQA 4PJ8C 1KEGL 3MLRH 4PJBB 4M02A 3FQWB 4GKSA 3HCVA 1KCVL 4X6DA 2GFBB 4Z7NE 3T65B 2MPAH 4LAQL 1U8MB 2Y9RT 4EDWH 2ZJSH 3HMWH 3E2HB 1T04B 4FFZL 3TBYB 1FNSH 5I1HL 1M6OB 1QLFB 1QR4A 3MLZH 1VFBB 4LPWA 2X9WA 2CO6B 2PW1B 3V5KA 3AAZB 1N5AA 5HDLA 3VGDA 3WO3B 3MRLA 4MA1B 4PP2A 3IDIA 3WKML 1ZOXA 1OAUH 4MQXD 4OM1L 4LKCA 3RBSA 3LH2L 1JF5A 4OF7A 2DS4A 3DMMD 4S2SA 3PGFH 2AQ1A 5FO8B 2CPCA 5IFHH 1F4XH 2DQTL 3BISA 4S10A 4KRLB 3T4AA 2B8OT 1E4KA 1X9QA 4ZUUB 3QPQC 3BUYA 3S35L 1T03H 5C0RL 1PJ9A 5I73C 2PW1A 1IGML 2VYRE 3AAZA 1T1WA 2NY6C 5DHYB 1AC6A 3O3EB 3UBXB 4OM0L 1RVFL 25C8H 2MJWA 5GRVL 2PYED 4CBPA 5KSBE 4HKBA 3RX5A 5CD5C 2H9GB 2OI9B 1M05A 1QEWB 1UKQA 2VLRE 1ZKAA 3N1MC 2A9MH 1D6VL 2VB5A 2F74B 4GAJL 4FQQA 3NZHH 5SX5K 1F42A 3VXNA 5JIIA 2FR4B 4MJ5B 3HMXH 1JMZA 4GSDL 3C60C 1CL7H 1AHWB 5C08E 4F7PA 3IS0X 4YFLF 4NWUL 4MLIA 4LLMB 2UUDK 5FM4A 3QUYB 4JY4A 5KJRH 3VGFA 1QBLL 2H9GA 1DBMH 4PJ9A 1CGWA 4YAQA 4NSKA 1T0NB 3A67L 5IV2B 4OZIE 1NC4A 3GKZA 2H41A 3OQ3B 2AJ3B 1X5ZA 1KN4L 3T4YA 3PGDA 5FA3A 4FQQB 3MROB 4YHPB 3BPLB 2FX8H 1RV6X 2JIXB 1UT9A 2UYLA 3I02A 5GGTL 1DANU 2VDQH 1QBML 3FB8A 3CUPA 3KPOB 5GRWA 4LLMA 3O6LL 1BVZA 1TFHA 1DQDH 3QUYA 5FGCB 5KG9B 3HNVH 1YEFH 3CJJA 1XF2B 2EH8H 1BGXH 1EHNA 1T0NA 5IV2A 1NC4B 4H8WH 1AY1H 5KVDL 3WIFA 1DN0A 1AKJD 3BAEL 2HRPL 1JI2A 1OSPL 2WINB 4IS6B 1P7QA 3MROA 3IFOA 1BBJB 4MQXC 1U41A 4HKJA 4K8RH 5SWSE 3KPOA 5E6YA 3SKJH 4YHLL 1ZT4B 3MLUL 1A7BA 1JIBA 1H3PL 3OKEA 5TPWH 2AI0L 2VLJA 3CZJA 3TP4A 4M7KL 3X3FL 1OP3H 1ZMYA 3I84A 1RK1B 1DN0B 1NAMA 4JZJC 1CD1B 2UUDH 1EVUA 1KTDA 4IS6A 4NM4L 3AUVA 3DURB 3FAXA 3QNXB 2MNUA 2VN7A 4HFUH 4GMSL 3G5ZA 4P2QA 4D9QE 4K7PX 3EJJX 4PJIA 1RZKL 4ODXA 5ICXB 3HNVL 1FFOB 4L3EB 4Z18A 2P8PA 1QD0A 4L8SA 4PRHD 3SDDB 2VLJB 2WLZA 1SM3L 4JLRA 1FFPB 3DGGA 1MVFA 3B83A 3P9MB 3NCCB 4ISVB 2DB8A 3TA3C 1GZPA 5IW6B 4TTGA 1S9XB 3OXRA 5C92A 1DBJL 4D8PB 3CSPA 2VLKD 4YR6A 1MUJA 5IWLA 1RZ7L 3P4NA 4XGZB 5F88A 1AP2B 4IIQC 2X4NA 2FEEI 4U4BA 3CK0H 1L4IA 1SHMA 4HF5H 2SEBA 3QDGA 2VL4A 1RJLB 4NC0B 4LL9A 2DM4A 2YBRB 3UPRB 2Y5TA 1YEFL 3SGKC 2YD8A 2DYPA 2YN3A 4YO0A 4PRAB 3NN8A 4OD1H 4ZOBA 3RY5A 4L8SB 3VXOA 5GXBB 2IADA 4PP1C 4UIMB 2KH2B 3QJHA 1G9ML 3K4AA 4JN2B 4UB0H 4PV9A 1RY7B 3GKWL 3OHXB 4Y7MA 1CVSC 4E5XA 3FB6B 4P23C 3T2OA 2YC1A 2PYFB 4U1GB 2I60L 5TE4L 1S9XA 3OXRB 3DMMC 4KHXH 4YHKH 5HVGB 3LQMA 1AP2A 3CVHB 2AJZB 3QUZA 4YDIL 1OP3K 4LLVB 4DVRL 1RJLA 5J11C 2AXGB 3C6LB 1S7UA 3W82A 5JHDA 1F8TL 4HUWA 4Z0BH 2GKIA 1RURH 4HG4K 4YXLH 4PJGA 2A2QT 2GK0A 1TQBC 4MZ3A 1RZGA 5SX4I 3O4LA 4NQDD 3SJVA 4JN2A 5DMYA 1JWMB 5KW9L 2UWEA 1F2XK 1SJVA 1Q0YH 4KRPC 1GHFH 4H0GA 3PQYD 2HKFL 4LIQE 4HH9B 1OWWA 4HGWB 3ARDB 1KACB 2CR6A 4HGKC 4LLDB 4Y1AB 3LEYL 4MXWL 5TF1H 4Z8FL 1VGKB 4I9WD 4H1LA 1HCFX 4F58L 2VZVA 2XWTB 2I9TB 1T6VN 3JV4A 1X4YA 3HC0A 1H3TA 4XNYL 3NFSH 1R3LB 4ONGL 4JRYA 5I1JH 1PW3A 4HUWB 5IB1B 2VL5B 1BWWA 3CFKA 2R4SL 4XBEL 3L7EB 4UAOB 4UV4L 5D71L 1Y0LA 2XN9D 1RZGB 3SJVB 1SY6H 5E2TH 2AJVH 4C4KT 1EHLH 3MLZL 2AQ3A 2UWEB 4J6RH 2UZIL 5I1LB 4XPTH 1GZQB 2HJFB 2K1MA 3PP4L 2ZSWB 3KS0H 3RWHA 2X4SA 2YXMA 2UY6A 2FBOJ 1QACA 3VXMA 4FRWA 1QBBA 2P42B 5HYJB 2V5YA 4ZUSA 5IJVA 5T3XE 5CEZE 3JV4B 2QQLL 5DA4A 5EA0H 5I1GH 4OD2B 4WEMB 4XT1C 5IB1A 3DXAA 3O2WL 4XPHL 3JBG7 4YNYA 2CGRL 4WTZA 1WK0A 5JPNA 4R2GD 4KTEL 5E7BA 5F44A 4G6FB 3RWFB 4M43H 5K9KA 3VFRA 3RGVA 1YUHB 2BJMH 4HZAA 3QH3A 2VNCA 1U2CA 3MYJB 2HMIC 2BSSA 4IBLT 1F6AB 2CRZA 4OCRH 4NQUA 3VXMB 4KJYB 1N3NB 2FZ3A 3BKML 4OZFA 3LKPB 1CLYL 5T5NG 1ZHKB 3QIWB 3OPZH 4JE4B 4OD2A 3QSKB 1C5DA 2I9LA 1DLFH 2XQBH 1FL3B 3FQTB 3GRWA 4FXKB 1ZANH 4YNYB 4DVBA 1L7TH 4HWBH 4K8RL 3ARFD 1MEXH 5C0BB 1CE1L 5BOZG 4QRQA 4JZOB 4O5LH 4OZIA 1FYHB 4Z0XB 1YUHA 3AS0A 3WJJA 1HIML 1U42A 3MRIA 4HIXL 4QWWD 4U05A 1MWAB 3A6BL 1QSFA 1NFIB 2ESVA 4OZFB 3TN0C 3LKPA 1JFQH 5HYJD 4LCUA 1RUML 4RZCB 5LGHH 3FONB 2DIBA 4LLWB 4X9GA 2X7LB 2GHWB 3PL6C 1BX2A 2VXTL 1P4BH 5FUOL 1S7TB 1YYLL 3RTQC 5L2KE 2IALB 1AO7E 4OD3L 2WQ8A 4Y19A 3V4VH 1NKOA 4GLRH 1JYXA 1V5JA 5EWIH 1OPGH 2WIMA 3OR6B 1U8KB 4JANB 5FAAA 3V6OA 1NGQH 3B9AA 4JR9L 5E2JA 4QXTB 2ESVB 3DIFB 4PJDA 1URLA 3KPMB 1KOAA 5KANI 4XNMB 2CIKB 3KXFD 1DVFA 1A5FH 1MFCL 4LSVL 2IQAB 5F6HI 4HUVA 4OZHA 5HGDB 5DRZB 1EEUA 4Y2DA 1AGDB 4HF5L 3STZA 4YDKL 1HSAB 1HNGA 5CLTA 1F00I 3DROA 4CVXA 5ENWA 5CBAA 4DKDC 4RAHA 1YQVL 4QRPE 4BJLA 4GKNA 2O5XH 2X4PB 1U91B 4FQ2H 1DEEA 1XR9A 3LZFH 4DGIH 3O2VL 4QXTA 2E27L 2FSEB 2XN9E 3PHOA 4ODUB 3Q3GA 4W4NA 5FYJD 1MAMH 4A2MA 1LO2H 4ZUVB 1S5IL 2ERJB 2CIKA 4FABH 2APVA 1D6EB 3DO3A 4M6MH 5EFIA 3V5HB 3WXWH 1MY5A 3TIEB 5T3ZE 5C08B 3STZB 1MCWM 1T03L 2I5YH 3ROOA 1HWHB 1DL7L 5CBAB 2KQNA 3BEWB 1OQXA 2CUMA 3VD3A 1KCKA 4X8XA 2ICES 2XI9A 2G5BA 2NY3B 4ODSH 4AQ1B 4XAWH 3ULSA 1NCWL 2Q76B 2IGFH 1E4KC 4ZUVA 5HYJE 3WFHA 1FL6B 3DPBA 2UZXB 1CDCA 1CT8A 3SE9H 3ARXA 5C08A 3CCHA 4NC2B 1E4JA 4V2BA 2AXFA 4P23B 5E8DH 3TA3A 5DD1L 2PTUA 3WUZA 1F11B 5L2KD 5DC0A 1P7QD 2Q20A 4IJ3C 5IBUB 4NKDB 4WWID 3EOTL 5BXFB 1HOCB 4KMLB 3KGRA 4L8SC 2OS7A 4ODVL 1CLCA 1ZV5A 2V5RA 3RVUC 1JZ7A 3P9LB 3HUJF 4WI3A 3JXAA 2ARJA 3KPRE 4UV7L 4HMDA 3WD5H 3FFCB 4G6JH 2EYSA 4WO4D 1V7NH 5JW3L 1H5BA 3D2UB 4MAYA 3KPPB 3QWRD 5EN2A 1I8IB 3J8F7 1LNUB 4FQXA 3MBEB 4P23A 1L0QA 2NXZB 4J12A 1DQLL 2DJUA 1CFSB 1Y18B 1OTTD 3MOQA 4MWFB 1MHCB 1SY6L 5E2TL 5BXFA 4WWKC 1HOCA 3DO7B 1PYWB 3QI9A 5KAQF 3T4AB 2EH8L 1JZ2A 4ZUUA 1YY8B 2R4SH 1FVDA 3QDAA 2FH8A 1F58H 3HN3A 4PJBE 3VXRA 4PJAF 5D6DA 3D0LB 3SKUD 4JGMA 3FFCA 1XCTB 3ZT7A 4K94C 1VADB 1U8IB 5T1KD 5EN2B 4JO4H 4GG6B 5FYLL 2H8PA 4Q9RL 3CPLA 15C8H 1QEWA 4HJJH 4KDWA 4ZOCA 3MBEA 1NEZG 4PUBH 4MAYD 5FB8B 4GKOA 1K2DA 3T2QA 2DD8H 3KXFE 2YK1L 3O45A 3MR9A 5GGRA 1ZLUH 3BT2H 5CMAB 1ITCA 1TQBB 3EGSA 2BK8A 4MDIA 3IFNH 3ABZA 3BRGC 1EVTC 2XXCB 1RZJH 1S7QB 2DM7A 1NCDL 2HJLB 1C5CL 1BHGA 4GG6F 1U8IA 1IGFH 1UM5L 3VXRD 3FT3A 5BMFL 1L7IH 3CPLB 4L4JA 5DLMH 3DI3B 1JJUA 1K2DB 3L9RB 4ZAKA 2Q8AL 5CMAA 1MRFL 2ZOKB 3WUWG 5GS2D 1CFQB 3CMOH 4FFWC 2V2XA 2EDOA 4Z7NF 2JIXA 4ZMAT 2I27N 1LDSA 4PR5B 1U8PA 3QG6A 2P8LA 4M43L 2QKIB 3VA2C 1Z6JT 2Z8VC 4B7LA 4I77L 3MMEB 2IQ9H 1ONQA 4RAVA 4JREB 1QFWM 3HC3L 1CZ8H 1PX4A 5L88L 4NO0D 1IILE 1UQSB 1INQB 5F7NC 4EOWH 2NY1B 3QNZB 5JOEA 1P7QB 1IGIH 2V2XB 5EC2A 2FO4A 5DD5H 5L2KB 1CTOA 3L95A 5GS1C 1VCAA 3IJSB 5GSVB 2GITB 2Y07L 1UKSA 5DI8A 2WWKT 1L7IL 4RMQA 5D70L 5HHOB 4I4WA 4O58L 2A1WH 3KWWB 3OZ9H 4PJDE 5C09D 4NCC2 2J8OA 3NACH 2B5IB 2GAZB 4X5XB 5DEZA 5I9QC 3RAJL 4NHCL 1GC1C 1NAMB 4NIKB 4NO5B 1UQSA 1V3MA 4Y89A 5DK3A 3WLWD 1ZHBB 4S0SD 2VUOA 4KJQD 1GGTA 3GDBA 5C8JA 2BZDA 5JXEC 2H2SC 3FQUB 5KVEL 2X4UB 1NBVL 1FGNH 3Q1SH 2H32B 3U30B 5DD0L 4K3EH 5FHAH 1E6JL 5TE7H 4I18C 1F4AA 1NL0H 4WFFD 5LQBH 3IJSA 5BO1L 3ARBB 2Y23A 1LEKA 1PX3A 4PJIB 4BZ1L 1NBZA 4B5EA 4ERSH 1DDHA 4EXKA 2P8PB 3KWWA 2NLJA 4S1SL 4LGRB 1KCRL 5F70A 5L88H 2BY3A 3MO1B 4HLJA 3SDDA 1JNNL 1K8DA 2NPLX 2VXSH 1TDQA 3FQXB 1OAZH 3UJJH 3UJIL 3KYKH 5IHLB 1FFPA 3OGCA 4G8GE 3V6OC 3P9MA 2YS4A 1OP5H 4NO5A 3UP1A 1UWEL 1WZ1H 2GK2A 4HDIB 4YR6B 1MUJB 3GNML 4KK5C 4M4RA 1NGZB 3JWDL 4XNQB 1QFWL 3UYRH 1HH9B 2VR5A 3O6ML 4U3XA 5DMGD 3U9PH 3NIDE 4HUKB 3UPRA 4QYOA 1A7QL 4Y2DC 5GGUA 5FUZH 4N8VG 4PRAA 3LZFL 3JSSA 3CSGA 2X1OA 1CD9B 3QJHB 2GCYB 3KLDA 4P2CG 1HKLH 1HHGA 43CAB 4PV9B 3RHWK 2WUBL 2J3SA 4RMRA 5MI0B 3FB6A 4FNLH 3WCYA 4CMHC 2H2PD 1QSFD 2C4XA 4HDIA 3EYQD 3QUMH 1BOGB 1XEDA 3K81A 3KPRA 4K9EC 4P9HL 4H5SB 3QUZB 5JIHA 4OLXL 4UQ3B 4PJXE 2EDHA 2NY6D 4APQB 2AXGA 3C6LA 4QYOB 4S1SH 4KXZI 1BF8A 3TPUA 5CUSL 3RVUD 5GS0D 2CDFB 5FO9B 4YHNB 4KV5F 3S34L 1MJ7H 2COQA 3ZDZF 1PKQE 4ZG1A 2Q86A 4X6BB 4D0CA 1X5IA 3WO4C 1RUPH 3RQ3A 4Y2OA 1I75A 1F4WL 3F5WA 4I0PD 5DYOB 2YPVH 3MJ8A 3PDOA 1JE6A 3B9KD 3TWCH 1JP5A 1B0WA 3LCYA 2FECL 4JHBA 1OT1A 3MFGB 4GW4B 5F71A 1G1CA 1GJIA 1S8DB 3TN0D 1WICA 2X5PA 3CFKB 4OIIL 3DARA 5LG1A 5GS0L 3KS0J 1HQ4A 3WE6A 1Y6MR 4PJEE 5I1LA 1CICD 1P5UA 4J1UB 5AZ2L 3AS2A 4D9QD 1A6WH 2ZSWA 3F5WB 5HHQA 1N8ZB 5D2NE 1QUNA 1Z9LA 4XCCH 5J6HA 3DV4A 3CLFL 2FATL 3CFEA 1KJ2B 3GUTB 4GW4A 4CU8A 3SDYL 2Z31B 3NTCH 3RNQA 1BD2A 2FX9L 5JNYB 4PB0H 3SKNA 4AIOA 5HI3D 4RGND 3K0WA 1YEJL 4NZTL 3KYMB 4LCCA 2NX5A 2XRAL 4MNHA 1OAQL 1IC7H 5D7SL 2XQYK 3O6LH 2NTSP 3WE6B 1F4WH 4JREC 3RWFA 2V7NB 5DZOA 3V4UH 4BSWA 1J87A 5E4EB 5CP7B 3ALXA 3RTQD 4U7KA 2Q7NA 5K33A 3OBAA 2EKJA 1C12B 2DQGH 1U8QA 4I8DA 4P2YA 5D5MB 1IGTA 1YQVH 3CFEB 4X7TB 3GUTA 1WC7A 4MQ7B 2VQTA 3LKQB 2ADFH 3FZUD 2DQCL 2NXZC 3HFMH 3FQTA 4LCCB 4UQ2B 2PNDA 4JFDE 2VDOH 2UZIH 3QQ4B 4CNIA 5FOBA 2LQRA 1J5OL 2AABL 3FB7A 3MRNB 1R3HB 2W38A 2M1KA 3VRJA 2IQ9L 1FC1A 4W6WB 2CK0H 4OI8A 5GIRB 3EYFA 3QUXA 4X9HA 1G6VK 1XGQA 2HN7A 3GJFK 1E4XH 4LQ1A 4UDUA 3UTTD 5I1GL 5JXEA 4G7VH 4JG0L 1W0VA 1UB5A 2YPLD 4MQ7A 4YWGL 2A6IB 3SE8L 1LO5A 1ZT7B 1EAJA 5E94A 3RDTB 1TENA 1YZZA 2DQDH 2GJZA 3Q5TA 3QWRA 4Y88A 1BQSA 3C08L 3GGWA 4ODHL 1F3JA 5FOBB 5SWSA 4K3GA 1KPVB 5L8LB 1LILA 2XNAA 4PD4K 2QSVA 2HG5B 2GIYA 2KKQA 3VRJB 4P3CH 1SBBA 3Q0HA 3NOIA 4JQIH 2H2PC 1UA6H 1VFOA 3GMMB 3EYFB 2CLZA 1CLYH 1ETZB 1ROWA 3OAUH 4KVNH 1CG9A 3QULA 4FXLA 4UDUB 1J7VR 2VE6B 3NTCL 1W72H 3ALWA 1N0XL 3LQZA 1BVKB 2EO1A 3SBWA 4OV5B 3BWUC 4M5ZL 1W0VB 1BJ1J 5I8OL 1IZJA 1RSFA 2J5LB 3OL2A 3QEGL 3KPMA 5JXAL 5IFHL 2AK1H 4KTEH 3RZWA 3KHQA 4WY7H 5E94B 3RDTA 4YQXL 1J05B 1F3JB 1RIHH 3ZDXE 3ARDC 3G6JB 5I1AA 5L0QB 5C9KA 3MUHL 1CI5A 3GMMA 2VZ3A 1QLEL 3WL9B 5F1IB 1CG9B 2EH7H 3QULB 4N5ED 4OD1L 5DO2C 1JNLL 1FSKC 3QO1A 3QXWA 5CS7A 3TF7C 5I9QB 2MHAA 1KLUA 1RZKC 1HHJA 1RULL 2VMFA 2XZQL 4NQCB 1MH5B 3HZVA 1FJ1B 3MYZA 5DJAB 5J11B 1HHHB 1P6FA 1VSCA 2YEZB 4XRCB 2HFEB 5FYJL 5D4QA 1ZSDA 1J05A 4PJBA 3VXRE 4GKSB 3RWJB 1NCCL 5D72H 32C2B 5EULV 2AEPH 5CZXD 3KYOA 2BRRH 4G6FD 4PG2A 4P5TB 5HGAB 5AYUH 5CUSH 1SYSB 5CWSA 3FTGB 5DMIL 5ADOL 5I8OH 3QBTB 1BFVL 1DQJA 4WENB 4N1HB 3TYGH 4HBQA 1VFAA 4JN1L 1VFBA 2E7MA 1FL6A 3H9SE 3L3KB 4PY8I 3FO1B 4C58B 1T5WB 3CGTA 3EYUL 4P3CL 1CT8B 4XRCA 5D93B 1CXHA 2ESVE 5JDSB 4OCWH 3JTTA 1RURL 3SJVE 1CWVA 4LKCB 2EICA 3TA3B 4WUUE 2X70A 5J1TC 4DGYL 1LK3L 1LE5A 5CWSB 5A2IH 5IOPB 1RJYB 3RPIB 5D2LF 1J0JA 2D2OA 1K4CA 4KH2A 3SDDC 1DQJB 3TESA 4TN9A 5DT1H 4NBZB 1KN4H 5HVHB 2DI8A 4NFBA 1VACA 3TWCL 1NCDH 3C5ZA 5C6TL 1X5XA 1MCJA 2EYSB 4JO2H 2P5WE 4M1GL 4RCAA 3KPNA 2A74B 3PWLA 4N0CD 2FWOB 4GBXB 3D69B 1LE5B 4RMUA 5C0BE 1E4WL 1QQDA 2OYPA 4NPYA 4XAKD 5MEOA 2FR4A 4ZXBD 5IBTH 2ED7A 4NC1C 2IFGA 1A3LH 5L7XH 3O6KH 3W9DB 4Y16D 3VXRB 3UTOA 3QUYD 1Q9OA 4LASL 5E1AB 4D3CH 1XGTA 4LVNC 1PSKH 1BZ9B 3C5ZB 2BHZA 2QQNH 43C9B 3DSFH 2NZ9D 4FFVC 3W0WB 4PJ9B 2HLAB 4YAQB 2YRLA 4PFEA 4NZTH 4TOYL 3UTZA 4OFKA 4GBXA 1S7RA 5HHNB 1J11A 4QCIA 2WMPA 4RISH 3SDYH 4HQQL 2FX9H 2VRAA 3EGSB 4MDIB 1QQDB 2DOCA 4PRIE 5D1QD 1X5AA 2W91A 4BFIB 2YKLH 4MQSB 5A43C 3U0PA 2NY3D 1XGTB 4G6JL 2HJLA 2DQGL 2YD9A 4KK6C 4M3KB 4HUUA 3THMH 1AIFA 4RGOL 5DD0H 5HDBF 5AG9A 43C9A 1FZMB 4KQ4L 1A3QA 5KG9A 3SDCC 2B4CH 5E6ID 4LP5A 5GS3A 2UWEF 5I6XB 3BP5B 3QDJD 5JQHC 5IGXH 3W81A 1FORH 1F4YH 1E27B 2OZ4L 1B2WL 1JHLL 4GKZB 3RZCD 4HKJB 5CD5D 2VDKL 3NCYS 3SHSA 1NJ9B 1OT2A 3D85B 5I17A 2P8LB 2YWYA 2DICA 5BO1H 1FFNA 4K8RC 1Z5LA 2B1HL 3AMKA 1AIFB 3S98A 4P2OA 3HUJE 3UYOD 2YOCA 1BBDL 3O3AB 4FFWD 2W9EL 3P30H 3UC0H 4ZSOB 1F13A 5EIVA 4OB5H 3N9GL 1C7SA 1INQA 1MPAL 2R0KH 1PG7W 3QNZA 2ADJA 1A6ZB 3MNWB 1BMGA 1E27A 4Y19E 4RMSA 4GKZA 3RIFF 1ERNA 2J4WH 3G5ZB 1DFBL 5GSVA 1CLZL 1P4IL 5ICXA 1KG0B 4X99A 4X0KA 5DZLA 2ERJC 1ZS8B 4LKXA 4P2OB 1MFEL 1HINH 4Z7QF 4ZXBC 4HLZG 3O3AA 2HT4C 1QVOA 3KNBA 3I6KA 2NW3A 4XWGH 2YN5A 5CEZH 4PJ5E 4ZSOA 2OCFD 5FYJH 1JPTH 1SMOA 2ADGB 5C8JB 1GZPB 3VG9C 1PY4A 3MNWA 3FQUA 1C08B 1MAJA 3OX8B 1UM5H 5F8RC 1IFHL 4YDKH 1LO3H 3DSNA 5ILTL 3LRSB 2EYRB 2EEAA 3H9YA 3JWNC 1BD2D 2Z91B 3ZL4H 1KG0A 3O4LD 4X99B 4X0KB 3HNSL 3SOBH 2NLJB 5FV1L 1AY1L 1FNGB 3KYNB 5KVDH 4XHJC 3D25B 1EAPB 5ISZB 4UV4H 3N9GH 3ZTJG 5J6GA 3QHZH 1IC5H 3OHXA 1JZ3A 4G3YH 3L1OH 2NCMA 2X2YA 4N0YH 1ZVYA 1P9MC 1Q0XL 3OX8A 1NGZA 3DTXA 3P9WB 4OGYH 2AJZA 4BH7B 4LLVA 2F19L 4J23A 5ANMA 3BIBX 1E28B 4YHOH 1JGVH 3GSOA 4HS3B 1ZE3C 3QXVA 3NFNA 3OB8A 3Q6GL 4LCWB 2B0SL 4PJGB 2GK0B 2X09A 3EYVA 5J6GB 1NCAL 3MXWL 3PWPA 5C0IB 1K5NA 1P6AB 4F8TA 5F9WC 1UWGL 3ARDA 2B2XL 4DZ8B 1VGKA 4YX2H 2QHLA 4Y19D 4DZBB 2BRRL 1HINL 1WWAX 4M7LL 5AYUL 4P2RD 4OFYA 1CR9H 4TTDC 3U7AA 1EIBA 3CX5K 4M7LT 1D5ZA 3TPUB 2CK2A 4L3ED 5J4MA 3L7EA 3BPOC 4NN7C 4YHNA 1G9MH 3EYVB 3WS6C 1D9KC 5C0IA 4LF3A 3HPJB 3EBAA 1DVFD 1GZQA 1QP1A 3HFML 2JELH 4I0CC 2Y5EA 4QHLA 1JF6A 3RWHB 5DYOA 5I2IB 5IJVB 3RVWC 3NCJH 1CFTB 4MAUH 2OR9L 4PB9H 3ARDD 1AGFA 4O02L 5F7EL 2W65B 4IHOB 4BELD 1TJGH 3QIWD 4PRHE 3QFJD 1T1XA 4HC1L 5I30L 1CDJA 1F02I 3ES6A 1T7YA 2AJSL 5E4IA 2ID5A 4A2LA 4OF8A 2HFGL 3S8WA 2IH3B 3DGCR 4G5ZH 4U1MA 3BZDA 3MV9A 2HVJB 1N3NA 5J6HB 2DLGA 3VRIB 4MJID 3K2UH 1ZHKA 4U1NB 1AGFB 2H3NA 2YK1H 3DLQR 1LO2L 2I9LB 4IHOA 3RY4A 1EK3A 1FL3A 1OGAB 2E6QA 3KYMA 4FXKA 2VLME 4KJWC 4PRDB 1K3ZA 3INUL 4BQ9A 4NUGL 1UACL 4YFDB 2DMCA 3ARVA 5I66A 5FA4B 1NGXA 3MRFA 2DF3A 1DL7H 4HIJB 3DVNA 3LV3A 5CP7A 1MIEL 3EYOB 4N8CH 4EIGB 1HSBB 1MWAA 3N85H 3O9WD 3F6LA 3EJYD 2IANA 2R9HC 2NY7L 4IRJA 2W0PA 4LCUB 3FZUC 4Y5XB 2W9DH 2R29L 4TUKH 3WS3B 1KB5L 1OSPH 3FONA 2LABA 4QRRE 2RGSA 3HI6L 2PW2B 2ZUVA 1RUPL 3AGVA 4U49A 2Z93A 1ACZA 4M6NH 3ET9F 1M7XA 1CFBA 3UJTH 3LKSB 2YZ8A 4TVPH 3TJEL 1GGIL 5FYKL 5I8EB 3OR6A 4J3TA 1IGCH 1U8KA 2ZUYA 3GBNH 3QUXB 4JANA 1XGQB 2HN7B 2VJXA 3EYOA 4WW1A 3VDBA 3K8LA 3GMQA 4XCNB 5F7HA 4U2ZA 4XWGL 4ODVH 3DIFA 1TZIB 4LBEB 3WS3A 2XZQH 2W9LA 2A6IA 3FRUA 1MCSA 3U83A 1U58A 2YD4A 4HUNB 3V2AR 2IQAA 1AKJA 4HUVB 3LIZL 1EO8L 2BNQE 5J9PB 1DFBH 4F37F 4Y2DB 1XF1A 1B9ZA 1ED3A 5D7JD 1LP9E 4LVNB 3CC5A 4GKNB 2CLZB 3TNMB 1ETZA 2APBA 4WTZG 4LCWD 4DGYH 2VE6A 1BQUA 1NEZA 3E1F1 4HHAB 2RR3A 4WU5A 3GIVB 3WNMA 4WI4A 2NXZD 1MQKH 4DEPC 5IMMB 3GI9H 1A8JH 4NQTA 1RIUH 5GJTH 4YIQA 3FRUB 2W0FA 4WGVB 2R1XA 1BIIB 1AKJB 2ATKA 1AQKH 3ROLA 2VLRD 3CLEH 4MNQB 3D1MC 4GQPH 5JHDE 3HCVB 4P9ML 4X6DB 1NAMH 1DSFH 4PJFA 3ROOB 1UWXK 1ED3B 1RVFH 4JPWH 1FO0L 1WFUA 3ZYJA 2P24B 5KVFH 3TNMA 4ERSL 3RWEA 1W2KT 3OKOB 4NN5C 5IFAL 4RGNE 2X40A 3O8XC 1FDLL 3L5XH 2JJWA 2VDPL 4PJDF 1BQHG 4NQCA 5IBTL 1YEDB 5A3ID 3V5KB 2XTJE 5DJAA 5CBEB 3GFUA 4XP6H 2DMBA 4UINH 1G9MC 1BIIA 3MRLB 1O7SA 2EDNA 4BZ2H 3U1SH 1G0XA 32C2A 4PJFB 4NWTL 2LU7A 1CU4L 3E6HA 1DVFC 4KVCH 1DE4A 4CAGA 3SKMB 5IVXF 2HRPH 3RWEB 3MJGX 3NIGE 4O9HL 4FNLL 5C09B 3T08A 3QAZC 3BUYB 1MHPH 4ZPVA 1E6OL 4FQIH 5CEYB 1KCSH 4P4KC 3U7WL 1EV2E 2EDXA 3L3KA 1T1WB 3ZT6A 4YX2L 1TPXB 4CKVX 4NQCD 1H5BB 3LEYH 4MAYB 4MXWH 5GGTH 2FLBT 3WDJA 3CSYA 4HKBB 5ACZA 1LNUA 5DVOA 3MACH 5MENA 3DX6B 3QUZD 3N06B 3ARTA 4WEBH 3EYSH 3LN4B 5BMFH 4MWFA 1Q72H 4OCSL 5F97E 5IOPA 3BZ4A 4CN6A 1K4CB 1PYWA 1WLHA 5C09A 2Z8SA 3FKUS 4TRPH 4ZPVB 5CEYA 1QTYT 2RFXA 1AHWA 1J1XH 4G9FE 1FHGA 1CXKA 4HWNA 4IEFB 3U1SL 1VADA 3MV7D 4I2XE 5J3HD 4GG6A 4N1EA 2FX7L 4D9LH 4JY4B 1UZ6F 4HPYH 1MCPH 2OTPA 1AE6H 2D7QA 4DAGL 2ZKHH 1J8KA 2FYYA 4N9GA 4KJQC 5I15H 2EDQA 2JJTC 4PJ5D 3O45B 3WHXB 4KKBC 1NC2B 1BQLL 5FA3B 1DUZB 2V6HA 1FYTA 3HA0A 3LPGA 5CINH 1T2XA 5DUMH 4NO3B 2NY4C 4M1DH 3WIIL 4NHCH 3I02B 3QQNA 2BNRB 1HNFA 4IOSD 5DD1H 3MRDB 3P4MA 3RWCB 1F3RB 2Y25A 3GK8L 2J4WL 5D2LB 5T3ZD 4XVJH 3VGBA 5D70H 4NO0A 3RVXC 3LAFA 5JPMB 1JPSL 3MGTB 3CVHH 4JHWH 3L9RA 4NO2A 1S7RB 3QP3A 1MEXL 5HHNA 5EBMB 2VLKE 3QCVH 3BOVA 3MREA 5DUPL 1DUZA 1FYTB 3BYYA 5GZOC 1BBJA 5E9DE 2H32H 4LPTA 4NO3A 1IC7L 2WBJC 1II4E 2XQYG 4NQDE 1ULVA 5CJQL 3HRPA 1SBSH 5D2LA 5B4MC 1ZT4A 3MMEA 2C4FU 4JO1L 3TT3H 4AEIH 3MGTA 3HG1E 4WIQA 4Z6AT 5F9JB 3QHFH 2FBJL 4XP9H 3RA7L 3BP5A 3M8OL 1A64A 5EBMA 1IZKA 5DUML 1EDQA 1RUKL 4YXKL 1RJZA 1Z0MA 1WITA 3INUH 3LMJH 1FVCA 1IKNC 3VH8G 1NJ9A 5LCVL 1I8LA 4P2QB 4UT7L 5E5UB 2GITA 3UJTL 2ZKHL 3E6FA 4XWOC 1YDPA 4L3EA 2XT1B 3MLVH 1KSRA 5JXAH 3O2DA 3C60A 4X5XA 3B9KA 3NIFF 3DECA 4GAFB 4WI6A 2R4RL 1AQKL 1ZHBA 3I3EA 4WHCA 4C56E 2ADJB 3QDHA 1YEIL 5CJOL 2NXYD 2X4UA 4I9WE 1H3GA 3ISWA 5C6PB 1CLOH 4XGZA 4IDJL 1I85C 1MREH 2SEBB 3QDGB 3QFDA 3ARBA 3V79C 5DVMA 4YO0B 1PAMA 2LE9A 3B9KB 3HE7C 3OV6A 5F9DC 5F1NA 1RMFL 1UM4H 2P7TB 4YDJB 1R6VA 4OF0A 1NDMA 2A6KA 3C2AH 5F7MC 1IEHA 2PYFA 4LVEA 2VDRL 2FJFA 3D9AH 1YMMB 4LSPH 3EO0B 3FCTB 1I1AA 3WUWA 2IC2A 3S37H 5C7XH 4YH6A 4LCIH 5JHDB 1KBGL 1X4ZA 4Q9CA 4HWUA 2C7UB 5DVNA 3ULVF 1A7OH 3UC0L 4RAUA 1PZ5B 4KK6D 4NGHH 1FNGA 3KYNA 3RVVC 1KCSL 2GCYA 2NY3C 2OR7A 3GSQB 5CP3A 2P7TA 3AB0B 5FYKE 1JWMA 4PRID 1W8OA 1NDMB 3V4UL 4UT6H 4OQTA 1IBGL 4JKKA 4HXAH 1ADQH 4GMSH 2FJFB 4HGWA 1BOGA 1KF9B 4H5SA 5IMKB 3DTXB 3IJYA 4RFEB 1I1AB 3T0ED 4X9IA 2C9AA 1R3LA 5TQ2L 3UROR 4N90D 1I1AD 2C7UA 4ELME 2GTWB 2NW2A 4JEGB 5EU3B 3QDJE 1TJGL 3UTTA 4QOKD 3ZE0E 4GRWF 1CFVL 5CILH 5LVEA 1RZFL 2Q86B 1K5NB 4HPOH 2BOBB 1L7TL 2HJFA 1JYVA 5DWUL 1XIWC 2FHBA 3OG6B 6FABL 1MWAH 5IMKA 4ZUSB 3IJYB 4RFEA 4DZBA 3SOBL 3VXSA 1DCLA 2R8SL 4PJCA 5ESAA 2W9DL 4KKCC 3OJDB 3UTTB 3DYOA 4KMQA 4H88L 1WCBA 4WFEE 4PIRF 1YY9D 2J12B 4LF3B 4HWBL 3HPJA 4HK0A 4X4ME 2DQDL 5K9KB 1KLGA 5KSAB 4LCYB 3BKYH 1PLGH 5DR5H 4X7EC 5HHQB 4FQHA 1N8ZA 3GBNL 5C0CE 2IAMD 3SE4A 1IKFH 2A77L 3KHOA 4Y1AD 3DV4B 1GGIH 4JHZA 4QRTB 3VXSB 3WSQL 4DAGH 5EBGA 4TULL 5GISH 3P4OA 3I50L 3F58L 4K7PY 4WEUD 3X14A 1KT2B 3OJDA 4M5ZH 4E9LA 2YA0A 4KTDL 1WCBB 2VLLA 1MFAH 3QRGH 4A6YA 3MCLH 4FOMA 4QRQB 4HK0B 4OZIB 2FO1A 1VA9A 4BSWB 5IIEA 4LCYA 1RIHL 3MRIB 4U1MB 3MV9B 4Y4FC 1QSFB 5T5FL 2R2HA 1C12A 2FD6L 4YK4B 1U8QB 1F3DJ 3CD4A 5HPOA 4X7TA 4U1NA 4XCFL 4RMTA 2IPUK 2PTVA 3P4OB 2NR6D 5B3JE 4I0KA 4LLWA 3SQBA 3X14B 4POYA 4UQ2A 4L5FL 4M7JH 4PRPE 5CSGA 4BZYA 1EHLL 1F2QA 2VABA 3UDWA 2CQVA 5HSFA 2IALA 5I16A 4A6YB 3KAAA 1FBIL 2ZSVB 4NP4L 2X4OA 3NPSC 4Y5YC 4R2GC 1NAML 4FFYL 5TH2A 3LN9A 4E41E 4KHTH 3KJ4B 1YPZE 4I3RL 1B88A 3KPSB 4KDTA 3RUGE 1LWRA 1YNKL 4XC1H 1L6ZA 2IANB 4IRJB 4PJDB 5B21A 5GRJH 4Y5XA 4ZQKA 3I9GL 3GI9L 4OB5L 1JBJA 1V7MH 3QUMA 2UVFA 4XNMA 1NGPH 5BV7H 2FRGP 3R0MA 3BDYL 2GJZB 3ZHLA 1QKZH 4BK4A 4X4YB 4I3SL 3V4PH 1UG9A 3BN9C 4JRYE 4K3EL 5SWSB 5TE7L 1IEBB 3KPLB 5I16B 4KY1L 4U31A 1MI5D 2VH5L 2RQ8A 2FH6A 4GFTB 4PJBF 4Y4KD 2J7LA 2OQJB 3LQZB 3VG0H 5KVGL 3WXVH 3IAPA