5LKNA

Nmr solution structure of human fniii domain 2 of ncam
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
103
structure length
103
Chain Sequence
b'MQPVREPSAPKLEGQMGEDGNSIKVNLIKQDDGGSPIRHYLVRYRALSSEWKPEIRLPSGSDHVMLKSLDWNAEYEVYVVAENQQGKSKAAHFVFRTHHHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Neural cell adhesion molecule 1
publication title The N Terminus of the Prion Protein Mediates Functional Interactions with the Neuronal Cell Adhesion Molecule (NCAM) Fibronectin Domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 14
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2016-07-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5lknA00
3U9PH 3OF6D 2ZCKL 3MRBA 1A1OA 1AHWC 4FFYL 1GC1H 5CUSH 4W6WB 2OTWA 1TJGL 1LP9A 3RIFF 5HPOA 1T1WA 3U4AA 1J8HE 2RAMA 4YXLL 3BSZH 2EYSA 3KXFE 5KTEH 4TPRH 2CQVA 1YJDH 3ZT5A 4ZAKD 4ZOCA 1HQ4B 3D39E 1NBVH 2A77H 5IHUL 1A3LL 1M6OA 4G80A 1AGFB 4JG0L 3UBXA 4NQCA 4QOKA 4X4ZA 4NKMB 4KHTH 3LN5A 4OCWL 3U46A 1HKLH 3QIUD 4HUUB 4HWBA 4PRHE 1KEML 4O4YL 4JRXB 5EZIH 1HKFA 1EX0A 3NFNA 2ZNXA 2CRYA 4A2MA 4IRSA 4LVNB 3IU4H 1HQ4A 4PP2A 3JWDH 1O7SA 3W9DB 4LSRL 4E5XA 4LQFH 3UTSB 2ZCHL 3D9AL 1U8NB 2IG2L 3T0AA 1T1YB 1CDBA 4NKMA 3WL9B 1HHHA 3SKMA 5HHQA 1FL5B 1YN7A 4I9WE 2W07A 3L3DB 1VPOL 4M7ZC 5DLML 1NFIB 4Z7VA 2AJZB 3B43A 3PJSB 1KCVL 43CAB 1CE6B 4S1DD 5C0BE 4JPWH 4QO1A 5HYJD 4OLEA 5IP4A 5IT2H 5EOCJ 5FHBH 4RFOH 5E8OB 3UTSA 3R1GL 5D2NE 1HOCB 1T1YA 1G6RA 4LHUD 4FQIH 5KVGL 1NC2B 1AGCB 3GZKA 3ORJA 3ALXA 4URTB 1NFIA 1C16B 3GJEB 1P4LA 2HTKC 2NW3B 1CE6A 4WW2A 5DJ0B 3C6LB 2ADIB 2XA3A 2BNRE 5FA4B 3DURA 2P48B 3BPOC 3HZKA 4ZG1A 5I1LA 3VFUA 1T7ZA 4M4PA 2XQYK 4RWYL 2UV3A 4YBQC 3WV0A 3IU3B 5DUBB 3VFVB 4HJJL 3F7YB 4ODXA 1AGCA 2H6PB 4JJ5A 3RTQA 1OTTC 5FF6A 4ELMA 4L3AA 1E0OB 2RHEA 5F9JB 1QSEB 5JPMB 2B4CH 4NZRL 1IMHC 5ITBL 3KLAB 5TDPA 1RIVH 4IHOA 3IU3A 4MDJA 5DUBA 3VFVA 4YX2L 1Y6MR 4GRWB 5B39G 2OZ4H 2DS4A 5IMMB 3IFOA 4GG6E 2IAMC 1SJEB 1T5WA 4XMPL 3MLZL 1ZK9A 1YEJL 4Q9CA 4Z7OF 5F9JA 4RX4A 1U3HB 3TBWA 3E3QE 5IQ7L 5LXGH 3QZWB 1BM3H 4HG4K 5BS0E 5FUZH 5KAQF 3AS0A 3SO5A 3MLXH 2NR6C 5E8NA 2R23B 4ONHA 4RSVA 3RL1A 1PBYA 3T09A 2GTZB 1II4E 3VXMB 4WY7H 3O6LL 3PV7A 3FFCD 4FQHA 3EO9L 4KKCC 1QFWH 4NWTL 4JKLA 1WTLA 1FN4A 4NJ9L 1YC8A 2F53D 4L4TE 1LE5B 4P0DA 5I9QB 2VLKA 2IANB 1KJ2B 3GK8L 1OPGH 4N9GA 5DUPH 2MFNA 3DV6B 4Y5VA 3VXMA 2DYPD 4OZFB 3HHRB 1FE8L 5FYLL 1CTNA 3INUL 5C6PB 3ZYIA 1J8HA 4DW2H 5ELIA 3KXFA 4J1UA 1LE5A 4OLZL 5C7XH 3DNKA 3VFNB 2H45A 5IB1A 3T0DA 3V52H 4O51A 1KCRH 3VXUB 3BKYH 3TT3H 3H3PL 3LN4B 4PGBB 2NY7H 3ILQC 3MV11 3VDBA 3P0VL 5KVDH 1AIFB 5F8QC 1RURH 4JHAH 4RNRB 4PRHA 1JRHL 2W91A 3BKMH 3OR6B 4H26A 3RZCB 5EO1A 3TT1L 5I8EB 2VH5H 3VXUA 3ISWA 1EGJL 3BH8A 5E2WL 4FTVD 5E1HB 1NKRA 1RJYB 2R29L 4OD2A 2P45B 3QXDB 2GK0B 1AE6L 5HJ3A 1AIFA 1IKNC 3V4VH 2BY2A 1NL0H 2AK1H 3SDDC 1T21A 4FXKA 2H9GB 3R8QA 4JQVA 3DX7B 2XG4A 2HTKD 4KHXH 5I8EA 1YEKL 1CGVA 3IJHB 4I18B 5K9KA 1KB5B 3P9LB 2YK1L 1YY8B 5HYJE 3QXDA 4YBQD 4EVNB 4JPIB 5L2JA 1NCBH 2R56H 3PWNB 3AM8C 5IOPA 5T3XE 3VG0H 4OM0L 3HG1D 4XHJD 1BREA 4JZJA 1IAMA 4M5YL 5HDQL 3DX7A 1FFNA 1OTTD 3H9SB 1NLBL 2F5BH 3I02A 4PBVC 5CGYC 2NX5D 2R0ZL 2AK4B 3WUWG 4NO5A 1XIWA 4UTBH 3S88L 2GQHA 1N6QL 4BH7B 5EO9A 3K1KC 2R69H 2EH7L 1YY8A 4JN2B 2BNQD 4EVNA 5DQDH 4JPIA 5D1QA 4EDWL 4U1IA 4G7VH 1UGNA 2E9IA 4WU7A 2IAMD 4OCRH 3H9SA 2EEBA 5IMOA 2AK4A 4JEGB 1U8KA 4CADA 2C1PB 1I85A 1PQZB 4ACPA 1CFVH 3SDXE 3VXPA 1FL6B 2NR6D 1NMAL 1KELH 4GG6A 1L7IL 4EOWL 7FABL 1DR9A 1UWGL 3G5XA 3KYOA 4NRYB 2M1KA 1Q9WA 2EDHA 3O3EB 5L7XH 5EA0L 2E6PA 3Q5YA 5DWUL 4KKCD 3P9MB 1G7QB 2YPKA 1FL6A 5DJCB 4IMLA 5H94A 4RRPA 4AMKL 2JIXA 1CDIA 4PJ7A 1UJTA 4GXVH 2A9ML 1X6LA 3WFEH 5I1AA 5DMIH 1Q0YL 3KPRB 2IBBA 3CFCL 4MCZA 3OKNB 4NRYA 1A4KB 3T2PA 3FMGL 2E9BA 3KYKH 5DJCA 2ICWJ 1YECL 4M8QA 5JOFA 4PUBH 4IMKA 3FFCE 2P46B 4L4TA 3IAQA 3KPNB 3NAAH 3WO3B 3PWPB 3BP7A 1X5FA 3FB6A 2YPVH 4JFPA 2F53E 1DFBH 3FT4B 3V0VB 1ZHLA 1P5UA 2K7PA 1MH5A 3OKNA 5E9DD 1A4KA 3SE3A 3RL2B 1P7QB 3ILQD 4FMKA 2GW5A 3W81A 5DJZB 4XC1L 5D7JC 5GS1C 1T80A 4RGNC 3RIFK 2OI9C 5E08H 3GKZA 4JN1H 3SKNB 3H42H 3SEPA 4JO1L 3HE6C 3HZYA 5ITFB 2FX8H 4ZXBC 4P57B 2RBLA 5TE6H 1ZVSB 2EDTA 3V0WH 2COQA 3ZHDA 4L8SC 4JFQB 4F58L 3CNKA 1R5WA 2Z8WC 3IYLW 1CGSH 5ADPL 3B2VH 1NCWL 2AJVL 4WEBH 4WTZG 1Q9KB 4JLRA 1NGZB 5CJOH 4UNVA 3QNZB 1CFTA 3D6GA 5B3JF 3LMJL 3NN8B 4S1SL 4NC2B 4YHOL 3N85L 2V2XB 5FO8A 1WITA 4P57A 5FCUL 1BFVH 5F70A 4Y19D 2VAAB 2P8LA 5FKPA 3PHSA 1IC7H 5KZCD 3C09B 3GBMH 2D7MA 4FTVE 3HUJF 3C8HA 2WK2A 4G6KL 5JOEA 4YHKH 4JFXB 1A9BB 2NY0B 3MQIA 3GMLB 3HNVL 4NPYB 5CGYD 1AGEA 3QWRD 3L5JA 2QR0A 2A6JA 2Y06H 3SDYL 4F8TA 2VR9A 4U1GB 5IMLA 5BCAA 3OHXB 1ACZA 2WSKA 4DFHA 2OSLA 2YZ1A 2K3TA 1HZHH 1A9BA 4DGYL 3RWIB 4LHUA 2VSCA 4S1QL 3PNWA 1AI1H 4UNUA 2ZUTA 1GGTA 3HG1E 4RCAA 4LDLB 4QYOB 1B4JH 3B9DA 1KBGL 3ARYA 4OZIF 3RHWF 3OHXA 1T20B 1CGXA 1FH5L 3VGAB 4X6CA 3G08B 6FABL 2IH1B 5DD6A 3VGEA 2BNQE 2IBGA 2HLFC 4HWBH 1J0ZA 1W72L 3LHPH 1MAML 1UKSA 4ZNEA 3UTZB 4LSTH 2Z8VC 2C3HA 2DD8L 3SDXA 9CGTA 3VD7A 3T3MF 3BOVA 2IBZY 1Z5LB 3JV6B 3FAXA 5HYSB 3V79C 1TTUA 4WU5B 4LHQB 3TA3B 3I3EA 2CUHA 3NA4A 1CBVH 3GJFK 2XWBA 4NUGL 4YHMH 5FGCE 4HEPG 2KZWA 1WBXB 2DWDB 4EQ2A 1OARH 5HHOD 4MQTB 3BW9B 5D9SB 4N90D 2OR9H 1Z5LA 1JF1A 2MQ0A 2YD2A 4GMTH 5MEOA 4GKZB 3ULVF 5GGTL 1G6RH 2F74A 4WU5A 1I7TA 3TA3A 4M5ZL 3PDGA 3NCYS 1IARB 5D7KD 2CR3A 3SGDI 4X4XA 2DIAA 3O6FA 1UWEH 1NGQL 2J6EL 3CZFB 2CK0H 4HPYL 4NRXB 5F97E 5JTWA 2EIDA 2EIZB 1WBXA 4OCLC 4YNYA 3GB7A 3O11A 1JHKH 2YXFA 3SDAB 5D7JD 5DMGC 4RGND 5D1ZC 1K2DB 3S36X 4GKZA 4JHWL 4AK1A 4L9LB 2XG5A 3MREB 4DVRH 2FGWL 2YRZA 3HE6D 5HYQB 4LPWA 1U8HB 4ZXBD 3RDTA 2F53A 4MAUL 1MCSA 1P69B 4NRXA 1HI6A 1ZT4A 5E9DE 3SDAA 2FYYB 1PSKH 4MQXC 12E8H 3L3OA 5ICYA 2IMMA 2ARWA 4G6JH 4IM8A 1EEZA 3MLUH 2KH2B 4M00A 1QP1A 2D9CA 1AXSB 4ONFL 1JMXA 4YHLH 2NTSP 4UU9A 4XVUD 4TNVF 3S6CA 3ULVL 4FOMA 1J1OH 2E27H 1LK3L 4PJHE 5JUEL 1BZQK 4JY4A 1F90L 3PDDA 2AJ3A 3QIBB 1AO7D 5TE4L 1F4YL 2R0LL 4NYLA 2DQCL 3U4BH 3D3VB 2O61B 4QT5B 3NACL 4C56B 1F3DH 1EFXD 4IIQC 1JL8A 3GM0A 1RJLA 5ALCL 3WFDH 1CVRA 1IGIH 1HH6A 4JFDB 4KXZI 4Y19E 5F1NA 3O2VL 1RZIB 4ENEC 3BRFA 4G6FD 3CFDB 3ZKQD 5I1IH 1PLGH 4PJIF 2XTJC 2O61A 4D3CH 4C56A 4JPVL 4U6XB 4HULB 3UBXG 3DJ9A 2FLBT 2YUWA 5I8KL 1F3JB 1CFNB 5HSFA 4YAQB 5JQ6H 4GAJL 1ND0B 2HP4A 1G7HB 2PW2B 4LPVA 2C4FT 4NC1C 2X7LB 1JMZA 1RZIA 5F44A 3OGCB 2HLFD 4OD1L 4BUHA 1A7BA 4R90L 4BZ2L 1YEIL 2OCFD 3GBNL 5BVPH 5GGQL 1OP9A 5TDOA 5ANME 4XBGB 1F3JA 3T0WA 2EDKA 4RMTA 2AJXL 3MFFB 4XNMB 1NGYB 4YPGB 5ECJE 1CR9H 2YRLA 2GSIB 4Y88A 4LGSB 3BI9X 2X1WL 2YD6A 5IK3A 1I8MA 5C9KA 3ZSTA 2X44D 4PRID 1J0HA 3T2NH 4NBXB 4U1KB 3CX2A 3NPSB 1A64A 3WJJC 5E2VH 5DDHB 2QL1A 3W0WE 2R1XB 2P5WD 4EN3B 1IAIL 2GSIA 2X09A 1NFDE 2Y36H 2VKWA 4PRPA 3VFMB 1YDPB 5DMGD 5D1ZD 1U3JA 3DMMB 1CVSC 5HHOE 1MJ8L 2ITDB 4N90E 1G9EA 3AAZB 3EOAB 4NQUA 1MOEA 2R1XA 5SWZD 3L3IA 3BH9B 2IFFL 4TVPH 5D7KE 1EJ6A 5SWSD 4GAFB 4KMTL 1R3JB 4P23C 1JWUA 1S9KC 1MSPA 1CU4L 1AGDA 4JKKA 1MRFH 1UXSB 1HIMH 4FXGA 5B21A 4U7SA 2KL6A 1TLKA 3DXAB 4YHZH 3ZYOA 4CVXB 2A73B 4GW5B 5F6HI 3EYSL 3LKNB 4B50A 1U3HC 1KIQB 1DEEB 2ZZUT 2AEPH 3MOBH 4KTEL 4K7PY 1R3JA 4MVBC 1JYXA 1FNSH 1HDMB 1UCBH 1Q94B 3NFSL 1Z0MA 1SM3L 1TVDA 2JK5A 2YA2A 3ZL4L 2WZPD 3BHBB 3PGCB 4XWGH 3LKNA 5HDLA 2PO6A 5BV7L 3HZVB 4R7NB 1DEEA 1DE4B 2A6DA 1IQWL 4XBEL 2HRLA 3BPLC 3UYPA 4ENED 5I9QC 3LZFL 1ACYL 2GJJA 1K3ZA 3QFJD 4OZGB 4UDUB 2BOBA 2IMNA 2A6IB 1AO7E 2XTJD 4CJ0A 3VFWB 1Z3GL 2JCCF 5DTFB 2E7LC 3PGCA 4NNYB 3NTCL 2PF6A 4G6AC 4R7NA 1KN2L 3HLAB 3TC9A 4HIJB 1LO3H 4PJ9B 2F8OA 3VXSD 1N5AB 4JRXD 4KY1H 3MRMA 4UDUA 3NFPB 1M7IB 3CC5B 2FWOA 1OQXA 5C2BH 2N7BA 2IPUG 4OLXL 4OI7A 2DQEL 1CN4A 1KLUB 3BP4A 4NQDE 2AKRB 3P4NA 2HN7B 3HLAA 3WNKA 1JZ5A 4HIJA 1Q9OB 1TJHH 4LLUA 4KK8C 4X6DF 3GKWL 5T5NG 3RZCC 3WIFB 1A22B 1M7IA 3CFBB 4AH2A 5CZVL 5D71H 1OP5K 5HHVL 2OL3L 3I9GL 4KAQH 1KPVB 3GNML 5IB3B 3BDBA 1LEKA 5SWQB 3K4DA 3LEVH 3RHWK 1IM3A 1NC2D 3CGTA 1E4KA 4ZUUA 5BXFB 4P46A 1U95A 1CIDA 3KYAA 4OSUH 5ENWB 3L3JB 4HDIA 1J8KA 4RZCA 1FFOA 5HPMB 1RFDL 2XFXB 4I18C 1IGMH 4MNHB 4Q6YA 4U3HA 5J12B 1KPVA 2FL5A 5F7EH 3V6BR 4BSVA 5IB3A 1UEYA 5SWQA 5I8OH 4KUCF 3O45B 2J2ZA 1RUQH 2DJSA 2EH8L 4KV5E 5EG6C 5DVOA 3M8OL 4V1DA 3WN5B 4XXCC 4PRIE 2DLFH 4UIMB 5HGHB 1YNTA 3VDAA 4KDTC 3SGEI 1QPPA 2XFXA 3W0WA 4WNQA 1QNZL 1MFBH 4MNHA 2X1OA 1QSFD 4U33A 3MBEC 4EI5B 1FCCA 1ES0A 5ID0B 5LWYL 2IPKB 5FYKL 2P5WE 2OJZH 4P23D 3PGFH 3U7WL 4ZUSA 2FO1A 5T3ZH 1GXEA 4BSWB 1B0GA 3CMOL 5DI8B 1M05A 1Y6KR 3FQNB 4TYUA 5T3XH 5F7HA 2DLIA 3WN5A 1D3CA 3LOWA 2VDQH 4JB9L 3WIIH 3RWJB 1U3HD 1ZT1A 4ZD3L 3OKYA 5DD0L 1BF2A 4YEEA 2AGJL 1C5DB 1UH2A 5ID0A 4ORGB 4QXTB 4Q2ZB 3UPRB 5L0QC 1P9MA 4PJFF 5F71A 1RJZA 4M8VA 5D70L 1I9JH 5SWSE 5C9JB 5GS1A 3FQNA 4GW1B 3RIAF 3U7YL 1AP2A 4PJBE 1UWXK 5LCVL 3RWJA 3TNNB 3TO4A 4PY8J 5IBTH 4I3GA 3Q6FA 1C5DA 4KFZC 4L29A 4O9HH 4RRPG 3QIWC 2VC2L 1UACH 1PEZA 2GIYA 2IAND 5DF0A 1XGRA 1NDGB 4YGAB 3KPPB 4EJ1C 5BVJB 1KJ3L 3DSNA 3T65B 2HKHH 4XNQB 2C3WA 2XZCL 4WI2A 4EIZC 3VXNA 4TNVK 1CT8B 5IFHL 1T0PB 3F7VA 3CJJA 5E8PB 3DVGB 1NDGA 4ZQKB 1DBKH 1C7SA 3KPPA 4YDKL 3OAYK 1WIPA 3QFJE 1A6UL 4Z76B 4P3CH 2XTJE 4PTTB 3RX8A 2GK2A 4HS6B 2QQLL 5IGXL 1YNLH 4FQ1L 5GGSY 4Q58C 5C0GB 1D6VH 5GHWL 3WKML 1U8LB 4KK8D 3SCMC 2GY5A 5CEYA 3RZCD 5IESH 4ZQKA 3SY0A 1X7QB 2I07B 3IXAA 3NCJH 2BCKA 1KPUB 3VXSE 4P3DB 4BFEA 1UB6B 4M6OH 4JRXE 4F7MB 4NQDA 5CLWA 3EFDL 5IF0B 3K8KA 4MB5A 4O58H 5ALBH 2ZUVA 1TETH 5C0GA 1PAMA 1U8LA 1DQTA 2J8UB 1TZHA 4PJDB 3IDGA 1P1ZA 3TPKA 4EXPX 1GIGL 1YPZB 1X7QA 3O2WH 1KPUA 4I3RH 4YXHL 3BO8B 2HA1A 1UB6A 1P7HL 5FHAL 2XWTA 3FT2B 1DUZB 4D9LH 3MRGA 1IEHA 3WFCH 3I6GA 5CJQL 1QKZL 5IF0A 3C09C 1RIHH 4BSJA 1BQLL 5L2KD 1QA9A 3RBGA 2A74A 3MNVA 4UTAH 2J8UA 3O9WC 1ZTXL 3I3DA 2NY0C 4R96A 3CSYA 5I73B 1RUAH 3BT2H 3VJ6B 1NCDL 2HH0L 1FRGL 3MBED 2YOCA 5T1KD 4E0RB 2AJUH 3FT2A 4U1GC 4OV5B 1BBJB 3E6HB 4RMWA 3F7QA 3RKDC 5T1LD 4KPHH 4NQXB 1LD9B 8FABA 2MTPA 4JAMA 4MJIB 1JFQL 3WDJA 5DVMA 3EDDA 1RI8A 1JP5A 1WEJL 5LBSH 2AV7A 3BYTA 4HJGA 2L0DA 2Y07H 1EAPB 3CVHL 3EYFB 4OTXL 4JY6A 3RRQA 5MEND 1HN1A 2NCMA 3CDGB 1RZJC 3QCTH 3QT2A 3AXLB 2AP2A 3MJ9A 2BRRL 3CAFA 4GKSA 1QSFE 4HK3J 4MJIA 4ODHL 5K9QG 1IGCL 5DRNA 4LBEA 2G75B 2HYMA 2E7HA 4Q9RH 1UKTA 3MRDA 4UOJA 2JTDA 1BLNB 1EAPA 2PYFA 4L9DA 3BPCB 3FQXA 2GYSA 1FP5A 3QIWD 3A6BL 4M02A 4WDIA 4ETYA 2XT1B 3SE9L 1RIUL 1S7WB 2Q87A 3FRUB 4OM1H 4ERSH 4OLYL 1MLCA 3KLDA 4MA7H 3KPRD 4MDIA 3MUGA 4KVCH 1G0XA 1U8JA 1XFPA 3O3UN 4LGRB 4N0CC 2ZKHL 3QDAA 2Y1VA 2IQ9H 4X7SL 3U0TB 2CMRL 4PR5B 1S7WA 1UXWA 2VDNL 4DKAA 2D03H 3FRUA 2VLMD 3MV9B 3FO1A 1KLGB 5J4MA 5CJ8A 3PWPD 2OK0L 4Y1AB 1X4YA 5CP7A 4TSCH 1YEHH 2CLVA 2IANE 3SDCB 3GMPA 4ZFGH 4ODWB 1P7QD 3BDYL 4KKLC 1QBLL 5FKAB 5HVGB 4LEXL 4PR5A 3G6DH 4IIQA 5GS0H 1YYLL 2VXSH 4KGJA 2VZUA 4Y2DA 3IJYB 1ETZB 4AEEA 4TSBH 4L9LC 5MHSD 3SCMD 4AIXA 1X3DA 4Y1AA 4GMSH 5JZ7C 1F5WA 1FZOB 1RK0B 3VD9A 2AI0H 1QFOA 4OAWB 4UIKL 1GGCL 1UKQA 43C9B 4E42A 1U8OB 4IRZH 1T3FB 4AL8L 1WICA 5ILTL 4QY8B 3VFTA 2V2WB 3F6LA 3GMMA 1T89C 3E2HC 2ZUXA 4ZDHB 1BAFH 2EDXA 2YMXH 4PY7A 4RQQB 2ZSVB 1V7NH 3V4PL 1T66C 4OAWA 3KPSA 2L4OA 1F2QA 3UJTL 3BN9C 1B3JA 1A7PL 1U8OA 5BO1L 3S34L 1E28A 3SQOH 1T3FA 1R24A 2XZAL 1G9NH 2HWZL 3O9WD 3QIBC 4QY8A 2NY0D 3PIQA 2FX9L 4ZDHA 3O2DL 1CS6A 3MODH 1FGVH 1A6VL 2P5EB 4ZYKA 1FPTH 4QHNA 3IDNA 2V7HA 3IKCB 1KJMB 4OJFH 5DD3H 3ZTNH 1G9MC 1S9WA 3P30H 3S3SA 4BQCA 3ILPA 3RKDD 1R3LA 4Z0BL 4BZ1H 5J6GB 2JJTA 5CINH 4QRTA 1TCMA 4XPAH 1F42A 5L2KE 2FHFA 4Q9QL 4PRDB 1F8TL 3VRLF 5AZEH 2Q86B 2X1QA 2PW1B 1GPOH 1IAII 2VXQL 4GBXB 5SX4H 3ALPA 4H0IA 3H8NA 3HMXA 4JDZB 4U1HB 2ZCLL 1NC4A 1QTYT 2R2EB 4LAQL 5KSVB 4X80H 1DUYB 1RY7B 5TE7H 3NZHH 4PRDA 5D2LF 2X6MA 4OCXL 3MCLH 1P7KB 2YS4A 4XCNA 2PW1A 1ZLVH 2RR3A 3REWA 1S7TA 1N0XL 4N8CH 2YKLH 3UPCA 5MENE 4ZS7L 3GJFB 15C8H 4U1HA 1JHLL 2P1YA 5IJKC 2UWEF 4JO4H 5HHPB 1BJ8A 5CBAA 5I1EL 3KNBA 4PRNB 4J6RH 2OQJB 4Y4FB 4OQ1A 1AQDB 4XVSL 3IDIB 1FVDA 2VTFA 2N56A 3WFZA 3V95A 4JZOA 2DMCA 1LHZA 5GGSB 4QTHA 1IL1A 1T2QL 4LASL 4XP1L 4M6NH 3TYGL 1KTKE 3LV3B 1GYAA 2J4WH 3FO0H 3MNZA 4XBPB 4JM2C 1V7ML 1I1YB 1Y0LB 5HGAB 3RIAK 2JB5H 5E94A 1KYOK 4Y4FA 1LE9A 1AQDA 4U0QB 4EN3C 4KKLD 4HC1H 5DZLA 3TNMB 1GC1L 2PYEA 3UX9B 5CUSL 1XGPA 1X5LA 4H5SB 1A4JB 5E6ZA 3DMMC 3TYFB 1JI2A 2Q7YB 4UV4L 4ZFZA 2VLME 3VA6A 5JZ7D 4MJ4A 4UOW1 5FYJD 5KTEL 1K6QH 1QLRA 1I8LA 1Y0LA 5HGAA 4Z7WE 4YDVB 1YJDL 1EGJA 4G9FD 3U2SB 1BX2B 2F54D 4F37F 3ZKNC 1NBVL 2A77L 2W38A 3WXWH 2E7LA 3OZ9H 3TNMA 1Z0NA 3CK0L 4NHCH 2XQBH 1JZ7A 2EICA 3ARBB 4KHTL 4X7DC 3ROLB 3AU1B 2FJHA 2DAVA 5IEKA 4MB3A 1HKLL 3ET9F 5MHSE 1KEGL 4YLQT 3AFLA 3E6FB 5C08A 3EDKA 1INDH 3RWEB 5B3NA 3IU4L 4RMRA 3BN9D 3JWDL 5CEZH 1CDUA 2QSQA 3VWKC 4AEIH 4K8RH 3RWDB 3RWCB 3QIBD 3X13B 3Q2CA 4U7KA 2J8HA 1NGPH 2R2CA 3KHQA 5TQ0H 3D3VD 5GS2H 3VD4A 3O81A 5JW5B 3H6JA 4ZSOE 5LKNA 3JVGC 1EVUA 3HRPA 5IT2L 2F5AL 3UTTA 4JFDD 3LQZB 3ZYJA 4RFOL 2HJLB 1BIIB 3RWCA 4GXUM 1SHMA 4FQIL 2VZVA 1WIUA 3VRIA 1G7IB 4JVPA 1HH9A 4TSAH 1PG7W 5DSCB 4PJEF 1AQKH 1QYGH 4JRWA 3P3YA 4OCSH 5MERB 5IJVB 1A2YA 4NKIH 1EXUB 5GRUL 3QUXB 1LWRA 3SBWC 1S5IL 3U6RA 1UM4L 3QYCA 2HJLA 1H5BA 2IADA 3OQ3B 4U1NA 4LKCB 3GMOA 5E00B 4PJ9C 2GCYB 1TZGL 5CD5C 5ESAB 4WI4A 5L2KA 1T22A 4QXUH 3CDYA 5DSCA 4M1DH 5F7DB 3N0PB 3JWOH 2EKSB 3QO0B 3OG4B 4LF3B 2ZP0T 1P84J 4OF8A 1JWMA 2B4CL 4PTUB 2J5LB 1QR1B 3GSVA 4XCEA 1WSST 5JO5B 1L9NA 5E00A 1F4AA 4HIIA 2GCYA 1RIVL 2AERT 1WT5A 2A2QT 5ESAA 3DO7A 5EU7C 1UENA 2OZ4L 3VFPB 2Y72A 5F7DA 1PG7H 5FV1L 2YRPA 3QO0A 1J0JA 2I24N 4A6YA 5GJTH 4MSWA 2BMKA 3FHQA 2X4SB 3V4UH 3IJSA 4OCMC 3OXSB 3KJ6H 5I66B 2HAZA 1QR1A 1BM3L 3QDJB 5JO5A 1OTUC 1RK1A 4X8JA 2XRAH 3MUJA 4YE4H 3MLXL 1F97A 2X4UB 1J11A 1CK0H 4JM2D 4LQ1A 3V8CA 4YK4B 3VFPA 5ISZD 4HW6A 4OD3H 1EH9A 1CI5A 4EN3D 5DYOA 1TVHB 4WY7L 3GSRA 4XGZB 2NY2B 5J12C 5KS9A 4KRPB 4NQVA 5F7YC 4PS4H 3DMMD 5ICXB 3OXSA 5C09A 3QIWA 5DHYA 1QFWL 2YWZA 1N8ZB 4AIZB 1OP3H 4QHUB 4F15B 2X4UA 4J7RA 2DQJH 2V2TA 4NCC2 5TGBB 3ARGB 1OPGL 5GZNC 5GISH 2EDQA 1IC5H 1TVHA 3PQYA 5T33H 1A6WL 3ZKND 1TPXC 4EI5C 4NN7B 5HGGS 5K33A 1P2CA 1EBPA 1FZJA 1BWWA 4J3OC 2EEDA 1RHFA 5IW6B 4JHBA 2A83A 1WVZA 3SGJA 2VDKL 5C7XL 5F9DC 3ARGA 4R2GB 4Z7WA 3V52L 1KCRL 1FDLH 4L5FL 4OCYH 3D2UB 5FYJE 3BKYL 4X99B 5C3TA 1CXHA 5GRVK 3TT3L 1G6VK 3JTSB 1L9MA 3VWKD 3ZDYF 5IM7A 3ARRA 4HKZA 4U1JB 4G9FE 2F54E 3MJ9H 5ETUA 1MIEL 1I1AB 3NA9H 5B38A 3L7FB 1NBZA 1RURL 1B9ZA 4ZUTB 3FN0H 5DMYA 1N2RB 1XZ0A 3QO1B 4HKBA 2RQ8A 2VH5L 2Y5TA 2DBLH 4ZTPH 4X99A 4XCCH 4ODVH 3SGDH 2XZZA 3HC0B 3JTSA 2ZCKH 1OTSC 3QDGB 4NQEA 1CCZA 1MHEA 4LCWD 3LKOB 1GGBL 4NP4H 5DUML 5JDJA 1EHXA 1I1AA 3VXOA 4JG1L 4AENB 5C1MB 3KPMA 1JNJA 2J12B 1NL0L 4OF5A 1CFQA 3S96B 4Y4HB 3ARFC 4G43B 1A1MA 1ZHKA 4YXLH 5FEBA 3TIEB 1N2RA 1W72B 2UY6A 3QO1A 5FXCH 2GTWA 4NHUB 4KHXL 3HUJB 3CDFA 4ZSOA 5EZLA 3EOYG 1FIEA 5FIEA 3STBA 4OLWH 4UQ3B 5IHUH 4OI9A 4UOW0 3MGOA 3MYZA 4PJ9D 5DEFB 2GAZB 1I7UB 1NCBL 3EOBB 5CD5D 2R56L 4JFDE 4NKDA 5F9WC 4HK3N 2K7QA 3TBYA 3S96A 5C71A 4G43A 2JJWA 3HUJA 3TBTB 2BSSB 2B20A 3BEVB 4HAFA 2P24B 4UTBL 2W9DH 3MRLA 2R69L 5INCB 4FN0A 3X3FL 5DQDL 2GAZA 1I7UA 3D9AH 4HBCL 5LGHL 5H2BA 4G7VL 5I1DB 1PYWB 4U1SB 4OZIB 4OZHF 4OCRL 3SHSA 4DWHA 2MHAB 2NY5H 2VRAA 2W1NA 1G7JB 5KANI 4G7YH 1HXYA 1XF4A 2CKBL 1OT1A 5C6WH 1OTUD 4R9HA 4UINH 3R1GH 3RQ3A 1E27B 5EU4A 1J7VR 4XB7A 2CDGB 4KXZH 1PYWA 4U1SA 4EI6B 4Z9KB 4OZIA 4OGYL 1EZVX 4NKOA 5CJXC 4HKJA 4QRRA 5CMAB 4JHZA 3NIDE 2J6EA 3LKSB 1OT2A 5DQ9A 2DF3A 5A16A 1T1XA 4KQ3H 2ARJB 5I1CH 4PPTA 2VZSA 3TV3L 2APFA 4RWYH 2ICWI 5I73C 5IBLC 4HJJH 4PJAF 5GZND 4QF1A 3MFGB 4C55A 5GGVH 4EI5D 5ISZE 4BKLA 1NJ9B 2DJ4A 3GSOA 3WCYA 1NCUA 3U36B 5I1HL 3WFBH 5K9OB 1U93A 1NEZA 2WLYA 4ZOBA 3EAKA 5C0CD 4JGMA 2CUIA 3WS6C 2YPVL 5JIKA 4ZFOL 1DFBL 1XR9B 3TBVA 2B5IB 1MJJB 4XMPH 3MLZH 2FX7L 4LFHG 1RZGA 5IMKA 1U2HA 3BMVA 2ZJSH 3QXVA 1VKXB 1KT2B 1CL7L 2VLRD 5IQ7H 2QJDA 3BVNB 3T77A 5E4EB 3HMXH 1KIRB 5E08L 4J3SA 1IGJA 1M71A 4JN1L 3PHQB 4AQOA 3H42L 3GMNB 4C4KO 2AQ2A 3OKOA 4LLYA 3WMSA 2BSED 2NXYB 1HHGB 1XR9A 1LP9F 1XF3A 4F9LC 3GMRA 1BFOA 4FQJL 1I4FA 1OTSD 3U4EB 3M17B 3UYRH 3V0WL 3LEXA 4G9FA 1KT2A 4LGPB 3JXAA 1CGSL 4PFEA 3MO1B 2K1MA 3B2VL 3EO9H 3BVNA 3ARFD 5CJOL 3PHQA 1LQSR 3OJDB 3L5WB 1DQLH 3B9KA 3CUPB 3GK8H 2WIMA 2Q6WB 1BFVL 1S7VA 4HD9A 1FE8H 2ENYA 4PJGE 1OLLA 5EC2B 5FYLH 3GBML 1BD2D 3INUH 1PKQA 5EBMA 5DA4A 1ZVYA 4LCWE 4TRPL 4YHKL 4Y5YC 1MVUB 4OLZH 2DI7A 3SDCC 2X4TB 3K2UH 4WFED 3PV6A 3QAZB 4NSKA 2BXYA 2Y06L 4HIEB 3K3QA 5D5MB 4Z7VF 5EC2A 3B83A 2V9TA 4PJIB 1NGWB 4FP8H 1TVBB 1MVUA 4MD5A 2P8MA 4UAOC 4PJXE 2ICEB 4GUPB 1B4JL 4NO3A 3MXWH 1EGJH 1OF2B 2CDEB 4NDMB 5DEGB 4X9IA 3EDJA 5D5MA 3HI1B 2FR4B 2R29H 2EE6A 2M2DA 4UT7H 1AE6H 4WW2F 2GUOB 1NGWA 4MNQA 5ICZB 3BZFA 5EU7E 1OW0A 5BW7C 2ICEA 2DTSA 2EYRB 1MREH 4GUPA 4XPTH 3B5TA 5D7SL 1TJIL 4X0KA 5DEGA 4LSTL 5E6IB 5JHDE 1L4IA 4BA8A 2VMFA 3HI1A 5EU6E 2FR4A 2YK1H 1N7ML 4XX1G 5D72L 3TN0A 4V2CB 4ELMF 5C8JB 4NJAL 5IBLD 1INQB 3H9HA 1AKJD 4JANB 2WMPA 4Q0XH 2XKNA 4M5YH 1CBVL 4CGTA 1NLBH 2ADGB 1EHLL 4QGYA 4GS7B 4YHML 1JK8A 4XNXH 5E6IA 5F3BA 1WWAX 3ZKXB 3QHTC 1KTLB 2VXVH 4GMTL 4IDLA 2BOCA 1G1CA 3OKEB 1D9KC 1G6RL 4JANA 1VERA 3DTXA 1ZSDA 4JM4H 5BV7B 4GBXC 1IFHL 1UWEL 3VD5A 3HAEB 2MCPH 2CK0L 1L0YA 1I9IH 3IDMA 1K4DA 4E41B 3AROA 4QCIA 5I15H 1CD1A 3UDWA 2HG5B 3BQUB 4WI7A 3BZ4A 5F7NC 1G0YR 1PDKA 1IGFL 3H2WA 4KDWA 3Q0HA 5C0CE 4UBDC 7FABH 3RY5A 4XT1C 3L9RB 1CFSB 3BGFC 1A47A 3LSOA 3C8DA 4Y4KB 2MKWA 3VXRB 3HAEA 4QHLA 2G5RA 2H41A 5DWUH 2BVUA 1PSKL 1QHOA 2Z31A 4HGWA 3RPIB 12E8L 4AMKH 2A6KB 2VLRE 2EXYC 3F62A 4G6JL 3X3GL 5D7IA 2I25N 3P11L 2BK8A 4YHLL 3CFCH 2C4XA 1AC6A 4X6EB 5IW1A 3SGEH 3GIVB 5C0RL 4A6YH 3MV9D 1BOGA 1J1OL 4H8WL 5EIIB 1S7XB 3C60A 5LJYH 5DGRA 3VWKA 5FCSH 3G5ZA 1QZ1A 1MFCL 1WWBX 1JUFB 4YHNA 4LLWB 2OL3B 2DM2A 4X6EA 1RULL 4X7CC 1S7XA 3P4MB 4PJGA 4RAUA 2VE6A 5J9PB 3ES6B 4XC1H 2E8ZA 2JCCB 4LVHC 4RA3A 2OJEA 4WUUB 5DC4B 1CLZL 1BD2E 1E6OL 1FVCB 3KPOB 5D96C 1PLGL 2X2YA 1IAOB 5HGDB 3I50H 4YBLB 1SJHA 2OL3A 4BM7A 4D3CL 2WV3A 3SJVD 4PJCB 5F89A 3WHE0 2UZIL 1H15A 2DL9A 3ARDB 3P4MA 1S7SB 3ARBC 5JQ6L 5BZWB 4WWKA 5J9PA 3UEZA 4M7JH 5ADPH 5DD1H 1NCWH 4F7PB 3U79A 5A1AA 2J3SA 1ZT7A 1JGEB 3TESA 4UV7H 1FVCA 3VW3L 4PJXA 3KPOA 2EC8A 2AJYL 5BVPL 2AXGA 2CGRH 2VDML 3O0RL 4YHOH 3UPAA 1YMMB 3L95B 4PJCA 3VCLB 1UM5H 2YR3A 4X6DB 1YQ2A 1SVZA 4IRJD 3FO9B 1MFEH 1FJ1B 4QHMB 2R2HB 2BVQB 2P5ED 3KYNB 4NWUL 1CR9L 3O3AB 2F58L 1X4XA 2FD6H 1VADA 5JXEC 3H7BB 5JHDA 5DQJB 5EU6A 3TO2A 1QLEL 2I27N 1D9KD 2GEEA 4QHMA 1A6ZB 2R2HA 1JCKA 2GT9B 2ITCA 1HNGA 3T2NL 1FZKA 4MJ5A 5E2VL 4N1HB 1E4XL 1UZ6E 1ROWA 4IS6B 4GBXD 4HLZH 4JKMA 1TENA 3CLEH 1J0YA 3QUXC 1KBGH 1ZANL 3H7BA 5E5MA 4GG6F 3W2DL 1FGNL 2C26A 5I8CA 5JOPD 5EU3B 2XNAA 2X70B 4W81A 4KWUA 4HZLB 2XV6B 4TOYL 4ELKB 4UBDD 5KSUB 1XF2A 5JXAH 3QG7L 5FM4A 5ADOH 4PJ7F 1QRNB 2ED7A 1ZGLP 3QQNA 5KSBA 3N9GL 2VJXA 4TUOB 2DQFB 4Y8AA 1U8IA 2EXYD 1ZHNA 1MRFL 2EKJA 2J88L 2DOCA 4ELKA 1MHCA 1I7RA 4GJTB 5KSUA 4YHZL 4PJFB 4I48B 3RWFA 4GAYB 1K8IB 3D48R 5GRJL 4ODUA 1H8SA 1FSKB 4TUOA 2DQFA 4I0PA 2ADJB 4U3XA 1OCWH 4OIIH 4HK0B 3QWOB 3BPNB 1IAKB 4WIQA 4LPYA 5JNYA 2J1KA 3OKDA 2ICCA 3VRJA 3QISA 2NY2C 4PJFA 1XEDA 1J86A 5EO0B 2V5RA 3QDMD 3T2QA 5C0DB 2J6EH 1LEIB 3RNQA 4K7FA 5DRXB 3CLFH 1REIA 4X6BA 4F15C 4W4NA 2BC4A 1OAUL 3S5LB 2MMXA 1WFOA 1WCBB 2KZ1B 2FGWH 3UJJH 3ARFA 1EO8H 1BZ9A 1X5HA 3DVIA 2O5YH 2ZOKB 1P4IH 3ARBD 4MB4A 1LEIA 5ERWA 3ROOA 3X11A 1DVFC 4MCYA 4P5MA 5F8RC 5IBUG 1IM9A 1FG2A 3S5LA 4KY1L 3WDIA 1BD2A 4R2GC 2E7BA 3Q1SL 5BRZA 5C2BL 3I84A 2ZOKA 3KDMA 4ETQB 2RFXA 1OSPH 4ONFH 4AYFA 4JGJA 1HYSC 5B38G 4L8CA 3ULVH 4YWGH 3IFLH 3KHOA 1LK3H 3SJVE 4AIOA 3DUSA 1S9XA 3ESVF 5JUEH 4CNIB 3AMKA 4L4VA 4NCDA 1TJHL 3QUKB 2OBGA 2Z8RA 4WCYH 2LAAA 5TE4H 3CVHB 4M3KB 3O8XB 1VFMA 3S36H 4S0SD 4KAQL 4ZO9A 5EPMB 4P3WA 3SPVB 3C87A 3NACH 3P4OA 4GQPH 4LMQI 4ALAL 5JXED 2HVKA 3LEVL 4NNXB 2SEBB 5ALCH 4Y4HC 1UWXH 1NCAH 3O2VH 5EOQL 4OSUL 1JPGB 1OVZA 3CVHA 3UZVB 2P5EE 2CLZB 1I9EA 4X6CF 3VXTB 3O8XA 3P73B 3D85A 3QUXD 4N8VB 5CJXA 1IGML 3MR9B 1UJ3A 5F7EL 5I8KH 4JKPL 5J06A 1W0YT 3ULSB 3WFHB 5I8OL 4LSVH 1DQML 5CJ5A 2KPNA 4H1LA 2NXZC 1RUQL 1MUJA 1MIMH 3I85A 4OD1H 4ODSL 3SDXF 4Z77A 2DLFL 1AKJA 1KTRL 1P4BL 1YEIH 5FDWB 1I1RA 3VXQB 1MFBL 5EUOB 3GHBH 3FOLB 4C4KT 5F1KC 1MY5A 2ATPB 1JGDA 3O3DB 3PGFL 3OAYH 3MV7B 3TWCH 2ICWA 4NZUH 2WINA 3RJQB 1R3KB 5JOPE 5T3XL 1Q1JL 4BH8A 3B5HA 4GRMA 4DAGL 4D0BB 3G04A 1EAJA 3OTTA 2VDQL 3WS6A 3WIIL 2FATH 5EUOA 1CD0A 4PY8I 3QDJD 4PIRF 1CL7I 1SMOA 2HJKA 4YDIH 4D0DB 2X89D 1I9JL 3X12B 5FM5M 3OGOE 4Z5RB 1K5NA 4LAJH 3LN9A 2NY2D 1AD0B 5CJBA 3L7EA 5GRWA 4OF0A 5IBTL 2VL4A 1IAIH 4O9HL 5DJAB 2NZ9C 3HPLA 4HFWB 4CBPA 1FNLA 1UACL 4LLVA 2YN5A 2J7LA 3X12A 1C12B 4LSQH 3U30C 3FFDA 2NY1C 1NBYA 4RGMB 5IB4A 3T1FA 1FZMA 4AEHL 4NN6B 1SY6A 1IGTB 3E0GA 1AD0A 1I3GH 5CHNB 3H3BC 5FOBA 3WJLA 4TTDD 2FSEB 2ZUYA 5FM5O 1CGUA 3TCXA 5SX5K 2P47B 1DVFD 1NEZG 4Q6IB 3DRTA 3D1MC 4ZODA 2VN7A 2W0PA 3QDME 1C12A 1PW3A 1CU4H 1QEWA 2JKXA 4R2GD 5F7WC 5GQBA 3SE4A 3VMNA 4MAYB 1PEWA 2C3VA 3JUZA 1C7TA 4M1GH 5J3HD 3JV4B 1IGTA 2IPUK 2B5IC 5CHNA 1I1FA 5J56B 5KG9B 3EYSH 1YNLL 1JE6A 4N8PA 1FYTB 1B90A 1D6VL 2WLZA 4PJ8A 3KYMB 1HSBA 1MWAA 5FECB 3IAPA 3O2DA 4U0RB 3O3BA 3NFSH 3BEWB 5IESL 4MAYA 3ZL4H 1CF8L 3KPLB 2NXYC 1G84A 5J0BA 4M6OL 3QDGD 4WI3A 3CX5K 5CAYB 2CR6A 4UDTA 4JFFB 4O58L 1D5ZB 3CPLB 1TETL 2AV1A 1G7LA 3HAEH 3SJVA 3MGTB 5BZDB 5IVXA 4KRMB 4Y4HD 2I9TA 1IQWH 1PVHA 2Z9TA 4XZUB 3UC0H 3X14B 3BKJL 1FL3A 2AQ1A 1M7DB 1J87A 5K59E 3O2WL 1ACYH 2OTUA 3QG6A 2DB8A 1FO0L 4NFCA 3QEQA 1Z3GH 1A7NH 3WFCL 1N59A 1D5ZA 2Q3ZA 3CPLA 1RIHL 3NTCH 5F6IB 5BZDA 4MD0B 2NXZD 4ZMAT 2GHWB 5H37H 5E95B 2UVEA 5B8CC 4UTAL 1U8PB 4IRJA 2XY2A 5DJXB 2AAVA 1RUAL 2FB4L 4R0LB 2ILLA 5C3LD 5I1KL 5E2TH 4YO0A 2DKUA 3I75B 4LNRB 4F3FB 5B39B 3QAZC 3O4OB 5LGJB 1ZHBA 4MXVF 3P77B 4XVTL 4HHAB 4KPHL 3NOIA 3ZLQC 4K3JH 4WO4A 5E1AA 4M7KL 4QRPB 2AXHA 5EOCH 2H3NB 1U8PA 2H26B 4M93B 3NGBC 4G9DA 3B9VA 4AJ0A 3D0VB 4PD4J 1D9KA 1WFTA 1CICA 4OFVA 2Y07L 3GKWH 3I75A 4Y8DC 3SO3B 3QCTL 4GG8B 1DDHB 2OL3H 3BXNB 3TH4T 1KN4H 4HHAA 1OY3B 1CLYH 1R5VB 4FFWD 2LTQC 5D2LB 4FQ2L 2PR4L 1IQDB 1WBYA 4QRPA 5DK0B 4OUUB 3CFJA 4LDEB 2XWJB 3MLSL 1SYVB 1ZE3C 3A6CL 2PXYC 1HQRA 2X4PB 3JBG7 2KQNA 1YEDA 4DKFH 2NZ9D 4XNUL 1J05B 1R3HB 4OM1L 5GIRB 2NY1D 1UYWH 1D5XB 5DK0A 4WHCA 4OUUA 4CKVX 1C5CL 1MCBA 5CS7A 3ZE1F 4KVCL 3VFRA 3DRQB 1FV1B 4GS7C 2VITA 2VUYA 2X4PA 5LG1A 4H25B 2IQ9L 1SEBB 3GSXB 2X9YA 1QNZH 2AQ3A 4FA8A 4JE4B 1P5VA 3ZKXC 5I0ZA 4U6YA 2D03L 4PBWD 3QEUB 1MJ7L 2E5EA 5FYKH 2VAJA 4PG9B 5CEXA 3U7WH 1R3HA 3CFEB 3CMOH 4TSCL 4P5TC 3QUZB 1YEHL 1DN2A 3DRQA 4JRYB 1H0DA 5FK9A 2MPAH 3FAWA 5BV7C 1S7UA 4H25A 3S97C 1UM6L 3OJVC 4X4YB 4ZD3H 2NQCA 1RMFL 4OB5H 1VGKB 3G6DL 2AGJH 5DT1L 1G7PB 2YUVA 3QEGH 4TSBL 2DICA 3BQUC 5K9JL 4L3EB 1Y6NR 3BN3B 5D70H 3VWJA 3CH8A 3IAGC 4BUGA 4PJHF 5IWLA 3U7YH 3HAEG 5AYQA 3M1BA 1TCRA 1DQJA 3IB4A 5IHZA 2NY6B 4FHBD 3MRRB 2QHRH 1BAFL 1NEUA 3U0WH 4HCRA 2YMXL 1P84K 1V7NL 1KJ3H 3ZO0A 4XP9H 1KNOB 1JZ4A 5H37G 4WFFD 5C0AD 1VFUA 3SQOL 3FOMA 3WUWB 2ERJB 4PREB 3WEXB 5T1MB 5J89A 2D7TH 4LL9A 3QUYA 4KROB 3UJIL 1FPTL 1A6TA 2FHCA 4NFBA 1TMCB 5DD3L 3ZTNL 1PX4A 3GUTB 2FNBA 4CW1A 1F4WH 3U9UB 1ZGLB 1D6EB 3VI3F 1MNUH 1F11B 3QQ3B 5E0QA 2V5TA 3UTQA 4PJEB 3T8XA 4BZ1L 3IDXH 5CINL 4BQ8A 5H35A 4XPAL 5EDXA 3WLWC 1YEFH 5DRZB 1E4XI 2HFEB 4QNPE 4NC0B 4R8WH 1FYHB 1GPOL 2UY7A 1ZGLA 2YA0A 1MQ8A 4HX1B 4YJZL 2N4IA 3EFDH 2BDNH 1HEZB 3QQ3A 5FA3B 3QI9B 5E56A 3CCHA 4Y0GA 5ESVB 4JFEA 3HE7B 5GJSH 5I6XB 3SKOB 3OR7A 5IEHB 3DX6B 3HNSH 4K3GA 4LLMB 4X80L 2PXYD 5TE7L 3NZHL 2HFEA 2APTA 1GIGH 1UH3A 2IQAB 3MA9L 5J6HA 3MCLL 3ULUH 4YXHH 2WIIA 1XMWA 5TPWL 2PKDA 2HLAA 3FQRB 2DWEB 5HHMB 1NH6A 4HX1A 1GZPA 1VACB 2D3VA 3QFDB 4N8CL 2YKLL 4R7DA 3WUZA 1KPRB 1QKZH 4X5XA 1EV2E 5FA3A 15C8L 1F6AA 3QI9A 2GJ6B 3MRQB 4P4KB 5ESVA 5F96H 1XGQA 4JO4L 3SKOA 1A9EA 5IEHA 3QXTA 1ZTXH 4LLMA 1UA6H 2IQAA 4HIHB 3T3ME 1KJVB 2HH0H 1XGTB 2V7NB 3FQRA 4TUJB 1HHIB 2DWEA 2ZSWA 1X5GA 4NM4L 3RUGA 2BNUB 4PJ5A 3T0EC 1TZIA 2EC9T 2HFGL 3T4AB 4YZFE 2J4WL 4P5TD 5HVHB 1H3PH 2GSGB 3FO0L 5EN2B 4P2OA 2X89A 5C07B 1JPST 1T0NB 5FO7A 5KSAB 4CDGC 2YD9A 2VIRB 1ED3B 2JB5L 4HIHA 3BFOA 4PG2C 3MGAA 3CVHH 4GRLB 4E41D 8CGTA 1S9YB 4BK5A 3TCLB 1ONQA 2OP4H 2LAGB 5D93B 1A8JH 3W5NA 5MEQA 3BQUD 3T4AA 2LU3A 1IVLA 4XCYA 5C0EB 3PWUA 3RVVC 4XP6H 4H1LH 4OV6F 1VEMA 1K6QL 5IR1B 2CD0A 1YY9C 1EMTL 3CFKB 4RGOH 3WXWL 4O2CB 3TCLA 1KFAH 4NHCL 2XQBL 1CE1H 3H9YA 3SE9H 4QRQB 3ZTJH 1JWSA 3FB8A 4JO2L 3TVMB 5IR1A 4K9EH 3VGBA 1FLTX 4JFYA 1INDL 3P0YH 2QTEA 2W59A 3CFKA 2ZKHH 3NVQA 4PP1C 3OX8B 1FSKC 4G42A 2P4AB 4X7SH 4AEIL 2CMRH 1AY1L 3MUZ1 4EEEA 1NGPL 1EERB 1EEUA 4X98B 5TQ0L 1CQYA 2B39A 5IKCA 5IV2B 5IFJB 4YDJB 5GGRA 2H32A 3ARZA 2CKBB 1X9QA 3NCCB 4Z7QE 5C2UB 2VLJB 4WFFE 1YYLH 2H2PC 1F6LL 4ZFFB 3AB0C 4U05A 4AQ1B 3MV01 4WUUD 5C0AE 1N3NB 5HY9A 2XPGB 3WLWD 3I6KB 4TSAL 5DK2B 4NN5B 4G8GA 2XYCA 4EUPA 1MI5B 1NCTA 1OGAB 4GSDH 1U3ZA 3RGVC 1H3TA 4OCSL 3JV5A 1GGIH 1MELA 1IEAB 4I3SL 1SY6H 4F33A 1WAAA 3AREB 1VFAA 5I0DA 2VLJA 3U7AA 2XN9D 1JN6B 4HKXA 3S5LG 3CH1A 4AL8H 3HS0B 4PJIE 5ILTH 1ORQB 3I6KA 4JFOB 4Y5XA 5HI3C 5DK2A 3JTTB 4QXUL 1VGEH 3BJLA 3MRIB 1OGAA 1YMMD 2ID5A 3GMQA 4JQIH 3FB5A 2DM3A 1IEAA 2MCG1 4X5WA 2J8UF 1HSAB 2Y25A 2W60B 1A7PH 4NM8H 1DL7H 2XZAH 2IF7A 4DKEH 3HS0A 2IH3B 4CVZA 2A1WL 2NYYC 3FHAA 4MA1C 1MWAH 4JFOA 3NIFE 2FX9H 2X9XA 3O2DH 4NRZB 4R4NC 5ESQA 2MQ3A 4ZFOB 2P44B 1PG7L 1U92B 3S35X 4G3YH 4CN6A 3HFMH 5GJTL 1ZA3A 4XXDB 4P2CG 2D4DA 3DI3B 3V4UL 4KV5F 4LARH 3T0ED 3PWVA 4Z0BH 4F2MB 2XRAL 4YE4L 3L3HB 3FONB 3VE0A 1CK0L 3QCUL 5KANG 4K94C 4NRZA 1X5IA 4QXGL 1VA9A 1KGCD 2G2RB 5CSZB 4DFIA 1L6XA 3MRKA 4XXDA 1C5BL 4PS4L 3F12A 4H1LG 4PJAB 3IFPA 3KWWB 4MJ2A 5F9OH 3RVVD 1Y18A 2ZCLH 5DK3A 1RZKC 4MMXC 2DQJL 4KJYB 1WWCA 5GISL 5ACMA 1IC5L 4HGKC 3QXAA 1YY9D 4P59H 4OCXH 4I4WB 2CRZA 3CD4A 4L3CA 4RAHA 3S35L 3ZTJG 3G5VA 1J12A 1D5MA 4ZS7H 1ORSA 4HF5L 4ZO7A 1MCJA 3QNYB 4H20L 4O5LL 4PJBF 1JHLH 5AG9A 1BFTA 2CO6B 4FQXB 2Q76A 1GOFA 5I1EH 2UVFA 2AXJA 3HPJA 4OCYL 5EU5B 3TGXA 4LCUA 1NGXA 4PP1D 1XR8A 4XVSH 3MRBB 3O4LD 1A1OB 3R0MA 2ESVD 3TBSA 3MJ9L 5D6DA 3NA9L 2CIKA 2OTWB 4OKVA 4LASH 4XP1H 1K85A 1T1WB 3P9WB 1A14L 2DQHH 2EYSB 3FN0L 4XH2B 2Y5EA 1MCWW 3QNXA 5J11B 3Q6GH 4ZTPL 5EU5A 3C8KA 4ODVL 1DQQA 1X5JA 2H2PD 4NP4L 4APQC 3TJEH 1M6OB 4G80B 4HUVA 1TQBB 3UBXB 2GKIA 4NQCB 4QOKB 3LN5B 4HPOH 2GJZA 4MNGA 3K8LA 1WZKA 4RGMC 4UV4H 3ZE2F 4XH2A 4MZ3A 4W4OC 3U46B 4Y16C 2HRPL 3RGVD 3L3KA 3C5SA 1I9RH 2WWKO 4YQXH 3HCVA 3IDUA 5IVZA 3NFNB 5DO2C 4IRSB 4PP2B 1MY7A 5BJTB 4Q6IC 2BVPA 4OLWL 4F9PA 4E5XB 1ZS8A 2YD5A 3CK0H 1MHPH 3LRGA 3QXUA 3VMOA 5BQ7A 5D1XD 2X4QB 4F7CA 3L5XH 1HHHB 5HI3D 2ZPKL 1ZLVK 3SKMB 3ARSA 5HHQB 1YN7B 4R26H 1JPFB 5JIHA 4WUUE 4Z7VB 5F9AC 1KEGH 1N4XH 4P5KA 4EIGB 3KJ4C 4RMQA 5BJTA 2W9DL 1BZ7B 3MV8D 1HILA 4M6AA 5D7LA 2NYYD 1G6RB 5HXMA 2X4QA 1J1XL 4R4ND 2XN9E 1JPFA 3RFZC 3DX9A 3STZB 3L5IA 3ZZ1A 3RY6C 3HMWH 1JTOA 2NY5L 5DURD 4G7YL 1P4LB 5DRWA 4WW2B 5HI4C 1YMME 3DURB 1BZ7A 3QEHA 2F5AH 3HZKB 5I1LB 1T6VN 4BZYA 2ED9A 3PL6A 1ZLUK 4UINL 1WFUA 4P2RE 2Y23A 3VFUB 3KS0J 4KRNA 1SQ2N 1OSZA 2WQ8A 4N0UB 4YEFA 2EE2A 2AVGA 4ODXB 3STZA 4JJ5B 1Q0XL 4U3CA 4HCRH 3RTQB 5FF6B 1K8DA 4ELMB 1T4KA 4I2XB 1XT5A 2X41A 4J4PD 1FNAA 3QSKB 5GRUH 1KXVC 4M61B 3ARTA 4KQ3L 1B2WH 5I1CL 1S5IH 5DS8B 1UM4H 5EBLB 1X44A 2W0FA 4N0UA 2NTFA 5TDPB 1TZGH 4IHOB 5GSRA 5T1DH 3T0EE 4D0CB 4MDJB 4RIRB 2QSVA 1XCTA 3DVNA 4R0LC 1L6ZA 4X4MA 1S8DB 1CLCA 3IFOB 1RUPH 3RAJL 5GGVL 3O4OC 4PLOB 1T5WB 2V5YA 4I2XA 4PGEA 5F3HA 2RCSH 4GXUN 4M61A 3WFBL 3IETA 3TBWB 5DS8A 4P99A 5EBLA 1VEOA 2O26U 5JW4Q 4D0CA 2CJUH 4YUEL 4BQBA 4RIRA 3G6AA 5F7MC 1T1ZB 5E8NB 3QHZL 1S8DA 4KK9C 4P5TA 4ONHB 4P2QE 4NBYB 3RL1B 3S37X 3VFGL 3C5ZA 1GC1C 3T4YA 4IBLT 4UQ2A 1GOGA 2ZJSL 1J0KA 5AAMA 4LCIL 4FQHB 3BWUC 2VQ1A 3HMXL 3IVKA 1MLBA 1FN4B 5CFHA 2R0KH 4HS8H 1QBBA 1T1ZA 5FGBC 4PLNC 1YJDC 1D5BA 1H3GA 2VLKB 1DBAL 5IUSA 4N9GB 2YWYA 2D0HA 3UYRL 2JJSA 4Y5VB 4NT6A 2GFBA 4APQD 5FAAA 4XPGH 4OBSA 1VHPA 1U2CA 3O4LE 3EO1A 3L5HA 2ESVE 1J8HB 4HWZA 4HSQA 4Y16D 3KXFB 1D5IH 4DCQA 4J1UB 5EC1A 3WE6A 2JELL 4F7EA 1DQLL 5IB1B 3JWDC 4O51B 5DO2D 2BSTB 1A6WH 4RDQG 5DC9B 3QUMA 3S37L 1JZ2A 4D9RD 5CD3A 4HV8A 3MRCA 5KVFH 2YPLD 3TH3T 3V5HA 1TTGA 2VDKH 3QUZC 4PRHB 4NO2A 2QSCH 3C08H 2VDOH 4CU8A 4LCCA 4H26B 3K2UL 5EO1B 4L5FH 3MLPA 2BSTA 1OAXH 1FYTD 3D39A 3BH8B 5D6CA 4OD2B 4AEFA 3UYOD 2I5YH 1MIEH 5HJ3B 2BVTA 4XAKD 1T21B 4FP8L 4FXKB 4Z95L 1NCNA 2X4RA 3WSQL 4R4FL 3V7AE 5HI4D 4B0MM 5CKGA 5C0BB 3MXWL 3BUYA 4WGVB 4K23H 5SX4I 5K9KB 4MS8C 2XKUA 5LGKA 1GGBH 2NY6C 5DUMH 4JG1H 4UT7L 5JQHC 5L2JB 1FC1A 4ZUWA 3MV8E 3TZVC 5IOPB 2XN9A 1XAUA 4KZDL 1A1NB 3HRZA 4JZJB 4JDVB 1FFNB 3BESR 1MREL 3ARWA 3I02B 4OT1H 4XPTL 3LEYH 2B4CC 5I75B 1OP3K 5C0BA 2XXCB 4NO5B 1XIWB 2BNRB 3DROB 2ERJC 5C0FB 5EO9B 5IROA 4P2RA 2BRQA 5D2NA 4QTIL 2EYTB 5D1QB 2Q20A 5FYKU 2H2SC 4YIQB 1GOHA 2XI9A 2XXMB 2O5XH 3OV6A 4U1IB 4WU7B 1A1NA 2WBJC 4Q0XL 4JDVA 4LOUC 3FTGA 4RFNC 1UB5A 5IMOB 2DQGH 4XNXL 1U8KB 3K4AA 4XP5H 4CADB 2BNRA 2MJWA 3DROA 2H32H 5C0FA 4U6HA 3VXPB 2VXVL 3X3FH 2EYTA 2ZG3A 4HBCH 5JLZA 5LGHH 4FQQB 4YIQA 1Q72L 1BECA 2XICA 4KK9D 4GG6B 2DLHA 2Y6SC 4JM4L 1YMHB 3Q3GA 4EUPH 3C5JA 1JYVA 2O93L 1CIUA 3G5XB 3KYOB 5DGQA 1Q9WB 2MCPL 2BY3A 4NBZB 1I9IL 1ZA6B 1I3RA 5I15L 3QH3B 2CKBH 2M8XA 1R0AL 4EDXA 3HE7C 2YPKB 5H94B 4IMLB 1QSVA 5KS9F 2JIXB 4FQQA 4PJ7B 2R9HC 4XMKL 2C9AA 1RHHB 5TF1L 4Z7UE 4OGYH 5I1AB 1LDPH 3BIBX 4P2QA 1YMHA 4ZPTA 4MCZB 3EFFB 3QJFA 3MRNA 1ZA6A 3H0TA 4JFZH 1BF8A 3QBTB 3QH3A 5ID1A 2AEIT 4P4KC 1KUMA 1DLFH 5BS0A 3TV3H 2QADB 5KN5A 4M8QB 5I19H 3AY4C 5JOFB 4L4TB 1RHHA 2EO1A 3BP7B 2CXKA 5KVEL 1VENA 3FB6B 1C08B 4JFPB 4JR9H 3EFFA 4YHYC 1S9VB 1EEQA 4NO0B 1ZHLB 1MH5B 3S98A 4A6YL 5EWIH 5I1HH 4HUNB 4WGWB 3B3IA 2Z0BA 4Z7WF 5HVHC 2DDQL 4CDHA 3EBAA 3NBNA 2R1YA 3GO1H 3QUZD 2RIKA 4LRIA 4JRYD 5KSAC 3F5WA 4CN1A 2D0FA 1C08A 5E8DH 3HZYB 3LS5H 3ARUA 4GRLC 1HWHB 1S9VA 4NO0A 2FX7H 5D93C 4GT7A 4L3ED 3V6OC 4ZAKB 3OF6A 1CL7H 2NZIA 1R5WB 3MMEB 2QKIA 4JLRB 4D9RE 1CFTB 1MCPH 3VG9B 4LIQE 2FO4B 2D7QA 4R3SA 2YPLE 3I50L 3J8F7 3T3PF 5FO8B 3U0PA 4MS8D 4FQJH 2B2XH 4N5UA 1PD6A 1R5IA 3LB6C 4JQXC 2NY6D 1GZQB 2P8LB 5FKPB 5INDB 2FZ3A 4RISL 1FYTE 4ZAKA 4MQSB 1FG9C 2FGZA 3TZVD 4M7JL 3MMEA 5DD1L 3SDDD 3B5GA 3TVMC 5E7BA 1RPQA 4UV7L 1KV3A 5D1XA 4DOHE 2FO4A 2CGRL 2QQKH 1AGEB 4R4BB 3QIUA 2QR0B 4MQ7B 1UM5L 5HI5C 2A6JB 1WC7B 5IMLB 1T7XA 1GZQA 1NSNL 5INDA 1MFEL 3OKLA 2OSLB 1GHFL 2H2SD 4DN3L 2EC9U 1MFDL 5L6YH 4OLVL 4TRPH 2WBJD 2D31B 4LHUB 4LOUD 3NCFB 4KRLB 1I3UA 2ZWLT 3PNWB 2DQTH 4G8IA 4R4BA 2FD6L 4MQ7A 4OCNC 3LD8B 1A6AB 1WC7A 2Y7QB 4MGXA 5F7KC 3PGDA 1AD9A 1F4XH 5HYJA 4X6CB 1LK2A 3LCYA 3ECBA 5DD6B 4EUPG 1CTOA 4KQ4L 2D31A 1G1YA 2Y6SD 5K93A 3FZUC 3DGGB 3QQ9C 3CLEL 3AREC 5JDSA 1A6AA 2Y7QA 3TJHC 2C1OB 2W9LA 1ZKAA 2NX5E 1WWWX 3SDXB 3HE7D 4JO3L 4J4PA 4I77H 2ZOLB 2R9HD 3Q5OA 1IRAY 4HUKB 1WCQA 4KTDL 3MZTA 5JXAL 3DGGA 3FRPA 3IDYC 5DXWA 5ADOL 4LK4A 2XWBB 3V6FA 5D7SH 2XZQH 1TJIH 4HS3A 4DVBA 2GJ6D 2C1OA 4FZEL 4P4KD 1N7MH 5D72H 1JF1B 2ZOLA 4WV1A 2OS7A 4WI9A 4XPBH 5MEOB 4NJAH 2F74B 1RZFL 1QO3A 4Z7UA 1EPFA 1I7TB 4YPJA 1BVLA 1EHLH 4X4XB 4O00A 3O6FB 2UWEE 4P9HH 3MJGX 4YNYB 2WWKT 1RZJL 3GB7B 3O11B 4MWFB 4U49A 1D7FA 2L7UA 1OCWL 4OIIL 3DGCR 5C07D 5KSAD 2YD1A 1IZKA 3FFCB 3LRSA 1MHHB 1W0VA 4M4RA 4GRLD 1JGVL 3RDTB 2F53B 2AJSH 1AJ7L 3C9NA 2AEQH 1IFHH 1KG0B 2KKQA 3RNKA 1H9VA 4MWFA 1HI6B 1ZT4B 1AHWA 3CLFL 4APQA 1F58H 1WFNA 4N0YH 3L3OB 1V3MA 5ICYB 3FFCA 3U82B 5FB8A 1ZLWH 3UJJL 1MHHA 1EO8L 1HHKA 1IGFH 1EEZB 1FO0B 3U1SL 5MI0B 2O5YL 4CMMA 4JRYE 3UP1A 3GDBA 1P4IL 4UU9B 3LB6D 1KG0A 2MQCA 4LLDB 2DYPA 4JY4B 3D69B 3TVMD 4BELD 5IFAH 2AJ3B 3IF1A 4L3EE 4J3WA 4FQXC 1Z9LA 3X3GH 4DUWA 2YPLA 1FO0A 4NYLB 2DQIH 4OGZA 5JW3H 3P11H 4M7ZB 5CIPB 1OSPL 4QGTA 1DQDH 3CXDH 1FNGA 4PYGA 3RA7L 3DARA 3K7UA 1XH3A 4POZC 5C0RH 4YWGL 3IFLL 1HINH 4H8WH 4UILH 4LLDA 3AC0A 1RJLB 4C59B 4FTVB 1HH6B 3D69A 5F1NB 4U6VL 1MCCA 1TDQA 1B0RA 4MHHI 2ZNWA 4WCYL 1MFCH 5J11C 1H3VA 2LU4A 1KCLA 5EB9A 3S36L 1DTUA 5CIPA 1NAMA 4M43L 3CU1A 5FYJL 4ISVA 4FABH 1MCKA 1RULH 1TQBC 4HH8A 4FTVA 3LPWA 4O2FA 5B22A 1NCAL 1NANI 1MI5D 3FZUD 1CLZH 4QLRA 3QQ9D 3L1OH 1E6OH 5D5MF 3HG1B 3ARED 4IRSC 5TDOB 2GITA 3TJHD 32C2A 2UZIH 3QUMH 2JB6B 4LSVL 5KJRH 4PJEE 1DN0A 3VFOA 1MCFA 1WV7T 4LP5A 2BNQB 1MIML 5SX5H 3VW3H 1W0WA 3HG1A 4CAGA 2AJYH 2VDMH 3O0RH 2Z91A 4LVNC 4L8DA 4PGCA 1IT9H 3GHBL 4ZOEA 2NX5A 2JB6A 5CGMA 5DFVC 1MCOH 2ZUSA 5IK3B 1I8MB 2Q1EA 4GLRI 4NZUL 3HC3H 3NIDF 1MRCH 3TWCL 2BNQA 2VWEC 3L3GB 5KW9L 5A2IH 4NWUH 4WW2C 2IAMA 5L88L 2F58H 5FGRA 2FATL 4PB9H 3EYOA 5E2JA 5FGCB 3S9DB 5IB2B 4PRPB 4XPFH 3UMTA 1GRWA 4YDIL 1N5YH 1J5OH 1QLEH 2G9HA 5DR5L 2GJ6E 1KCKA 4BFIB 5DJDA 3BIKA 3KG5A 3OKKA 2HFTA 3K0WA 3RTQC 3L3GA 2BY0A 3V5KA 3LAFA 1E4XH 2EIEA 5I2IA 4WTWA 2W0KA 1DBMH 3T1WA 3C6LC 5CCKH 3EGSB 3G6JE 3L3IB 5IB2A 2B1HL 3WD5H 1ZANH 4FQLH 3DX8A 1ZXQA 3PDOA 3W2DH 1FGNH 2YD8A 2Q8AL 1P6FA 1V3LA 1M7XA 4F80A 4LSQL 1JWUB 4OZ4A 4BFIA 3BZEA 1AGDB 2VERN 1RUML 1JYWA 4FXGB 2AS5M 4LLQA 5C07E 3OJMB 4C57C 4TOYH 1YYML 1JGLH 1I3GL 4U4BA 4WVRA 3EGSA 3QG7H 2AW2A 5D7IF 4CL7A 3FQUB 3N9GH 4MQXD 5JPNA 5TH2A 1RD6A 2Z4QB 4FQXD 2JK5B 3GHEH 2F19H 1Z9MA 3D5OF 4RGNE 4M1GL 2J88H 4XAWH 1BJ1J 2VLLB 5EFIB 1CXEA 3MROA 2VZTA 1CLOL 4POZD 2PO6B 4DZBB 5GRJH 5DZOA 2XTLA 3FQUA 4PJHB 5E9DA 4RWHA 2A6DB 2Z4QA 1IE5A 3MYJA 4MJ6A 1IEBB 3ZDYE 4PJGF 1NUNB 3BIAX 5EOTA 2BOBB 1I75A 2VLLA 5CSGA 5EFIA 1JVKA 4DZBA 4NQCD 4QOKD 5HTSA 1X5AA 4OFPA 4PJHA 3GBLA 4LHJB 5IIEA 1U36A 1TIUA 3W9EB 2VL5A 4Y19B 4K3DH 3UC0L 3OL2A 5KZCB 1IKNA 1IEBA 1OAUH 4K2UH 3SDDA 3MRMB 2IPTH 1J88A 4IRSD 2FWOB 1A7NL 3BP4B 1T5XB 4I5BB 2IBZX 3DHJA 3P4NB 4EXKA 1U3YA 4PJXF 1Q9LB 3GGWA 5GSVB 3W9EA 3LQMA 4Y19A 1CZ8H 2YA1A 4OQTL 2VR4A 1U6AH 3MOAH 3N50A 4S2SA 2D2OA 4LLUB 2ZUUA 3QB7C 4PJCF 3AM8A 3A6OA 1QOKA 5E2TL 5EUKA 1QACA 3OB0K 3Q1SH 1MI5E 4AH2B 3WXVL 2Z93B 3K46A 2O5ZH 1T5XA 3UTSD 3QWRA 4I5BA 5DFVD 3QP3A 1MCRA 5CSBA 1LEKB 1Q9LA 1R3IL 4K3JL 2EECA 5GSVA 1IM3B 5EOCL 1IC4H 1S78C 4ZUUB 4P46B 1U95B 1YUHB 4L1DA 4JQVC 3IRZA 2FEDC 4HDIB 3GSQA 1U58A 4RZCB 1FFOB 2Z93A 1UG9A 5ANMA 2FL5B 4ALAH 4IOFC 1PZUB 1KN4L 4LKXA 4BSVB 4OZHE 1CLYL 3MJ8B 3GSWB 2DRUA 5TJWK 2WW8A 3LKPA 5LAXA 4DQOL 5EOQH 1YUHA 3RTQD 1X5ZA 4ZUVB 4V1DB 4XPHL 3C6LD 1IGYB 4ZPVB 1YNTB 4PRBA 3D0LA 1XIWC 3W0WB 4WNQB 4DKFL 3QHFH 5J1TC 1UQSA 1RJCA 4JKPH 1ES0B 3MJ8A 5D1QC 2D7OA 4ZUSB 3GSWA 3STLB 1DQMH 1UYWL 1B0GB 4FZ8H 5HVWA 1M05B 4I0CC 4ZUVA 4AT6B 5KSBF 5GGVY 5DMKB 2VDPH 4ODSH 1IGYA 4ZPVA 1H8OA 1P4BH 3D18B 4RX4D 1QSED 1ZT1B 2PCPA 3G6JA 5CILL 1I85C 3BD5A 1NFDA 1JGUH 4ZS6C 4PJAE 2PTTB 2PUQT 2WUBH 5E5RB 3STLA 4QRSB 4XP4L 1RJZB 4HH9A 1V3JA 3THMH 4HXBL 3OXRA 5HHOA 5D7JB 5GS1B 1U42A 4AT6A 1F02I 1Q1JH 5DMKA 4DAGH 2MPAL 1AP2B 3D18A 4RMSA 3TO4B 4UUJA 3MBXH 4UZGA 4ZXBB 4OB5L 6CGTA 3SOBH 1AGBA 3Q6FB 4FS0A 2L7JA 4L29B 4MVBD 2PTTA 3G5YA 3QEGL 4JVWA 5SWZE 3MLTA 4L8SB 4QRSA 1S3KH 1XGRB 5D7JA 3PWJB 3V8OA 2W9EH 3J7HA 3VXMD 1FAIH 4YC2B 4NGHL 4NOBA 3HE6A 3MCKB 3GI9L 4ZXBA 3VXNB 2PNDA 1J8HD 4JQXA 2QADC 3F7VB 3RY4A 4L8SA 1LP9E 4IMKC 2QHRL 3U0WL 1VESA 3PWJA 1X5KA 1NQBA 3WNOA 2UYLB 1S5HB 2LFGA 3VA2C 1AO7B 1DJSA 4AEHH 5GRYA 4XP9L 3LQAH 3ZDZE 3MCKA 4KK5C 2VOTA 3SE3C 4N5EC 4G6AD 3ULUF 3A67H 4HMCA 2BVOA 1YN6B 2D7TL 5JORB 1DBJH 4NQCE 4PRHD 2JJVA 3DI2B 2VUOA 1A7OH 1LNUB 3DV4A 5CEYB 2CLRA 3SY0B 2UYLA 3IXAB 3VXUD 4PV8A 1S5HA 2BCKB 5M94B 1AO7A 1F4WL 4N0RA 5HDBF 1RU9L 4G6FB 3O41A 4NQDB 1QD0A 2KDGA 3TFKC 1MNUL 3GSNA 2VISA 5HHNA 3IDXL 4J12A 1EFXA 1YN6A 5JORA 4LCYA 2PTVA 1TZHB 3VG9C 2FEDD 1LNUA 3IDGB 1P1ZB 1YEFL 4NC1E 5J1SC 1CF8H 4Z7VE 3MACL 4G8FB 4R8WL 5HGBA 2MSPA 2UUDK 3MC0A 2XWTB 4KJQC 2ARJQ 4IOFD 3MRGB 1BGXH 3VI4E 2BDNL 3I6GB 3OMZA 4GOSA 3UTSE 1QA9B 3P2TA 2A74B 3MNVB 5GJSL 2DLGA 1RVFH 3HNSL 1ADQA 3BKJH 4R96B 3CSYB 4HJ0C 4TVPD 3ULUL 4G8FA 1XIWD 1FO0H 3RGHA 5I16A 3RJDA 1X4ZA 5TFSL 5HD8C 3OBAA 5D1QD 2UZXB 1CXKA 4FFVC 8FABB 4JAMB 5F96L 2XA8H 4N0FA 3H9SD 1UA6L 3HZMB 2FB4H 4MMZC 2AV7B 2AK4D 5I1KH 4HJGB 4Z0XA 3V6ZA 5EZJB 4JY6B 4BYHA 4ELME 4ZS6D 5CIPH 1NAMH 1U9KA 4K7PX 4S1RL 5DJYA 4XVTH 4GKSB 2P5WB 1JNLH 2NLJB 3HB3C 4LHUG 1H3PL 1EO7A 4M7KH 4PV9A 5DRNB 4J3TA 4LBEB 4ODBD 5EUOF 1JPSL 5D1ZB 3MRDB 3HZMA 4Q74A 4PRIA 3V5DA 2CRMA 2PYFB 5EZJA 2RGSA 3FQXB 1BQSA 2X9WA 2G5BA 4WDIB 4IOSD 2OP4L 1RSFA 4S0TD 4UMGA 1QSEE 3VGAC 4U1MA 2JIXD 2P5WA 5I18L 2NLJA 4NFDA 1FIGH 4RFEA 4FQ2H 2PR4H 4AM0B 4XP6L 1MLCB 2R4RH 4K71B 5D1ZA 3FRPG 5H8DA 3OKMB 4MDIB 3MUGB 4GRWE 2P7TB 1U8JB 2V5MA 3KPQB 3MLSH 3A6CH 4PJBB 1L0XA 4RGOL 1KFAL 1CE1L 2EEAA 1UXWB 2QADD 5SWZA 4XNUH 3FO1B 4L4TD 4BQ9A 1OWWA 1NKOA 5SWSA 4AM0A 1ODAA 4K7PL 3EYQC 4PYHA 2CKNA 5CP7B 3H7LA 5MP6H 3TA3C 1C5CH 3OKMA 4K9EL 2P7TA 4HLJA 3KPQA 2CLVB 4GQ9H 4KK5D 3P0YL 4LSSH 4PJBA 3GMPB 3O6FC 3C2AH 4N5ED 4D2NA 5AD0A 1EEYA 1ZEAL 3VXME 4WJ5A 4M1CC 4KMQA 3E1F1 4CN4A 4IIQB 4Y2DB 4CVUA 1KENH 1MJ7H 3C6SA 2FJGA 3C2SA 1KXQE 4LPXA 5I17A 3NMEA 1JF6A 1A7QH 2WBWB 1UVQA 3DIFA 3RDTC 2C5DC 2OR7A 2AXFA 1JHTB 1MFAH 3TFKD 4RAVB 3QFJB 1UM6H 2XTJB 4E42B 1TNNA 1RMFH 1H8NA 3SDAC 5DT1H 1LO4H 1WF5A 1KCSH 5DHXB 3VFTB 5K9JH 1YZZA 3GMMB 4Z8FL 4KKAC 4YFEA 4GSDL 4PY7B 3U83A 4WWID 5MI0C 5IVXF 3VXSB 1GGIL 2P8PB 4KJQD 1SY6L 3JSSA 1JHTA 4RAVA 5CZXC 3VXUE 3QFJA 3KPSB 3MLVH 1E28B 1R24B 1QUNA 1I1CA 1AGFA 5EBWB 5TDNB 5JMRA 2Z35B 3PIQB 4HJ0D 1VGEL 3KPTA 3MRJB 4HUUA 4ZYKB 4JQIL 4QHNB 3IDNB 2V7HB 2R15A 2VN4A 3HI5H 3VXSA 4U6TA 2P8PA 4JRXA 2F15A 1S9WB 3ILPB 5T3ZD 5HD8D 1WK0A 1R3LB 4FFVD 4NM8L 3W9DA 1DL7L 2WP3O 4X9GA 5T3XD 4DKEL 5EBWA 1U8NA 4QRTB 4LPCA 5TDNA 1NLDL 2N1KA 2Z35A 3WL9A 1MWAL 5GRVL 1FL5A 3MRJA 3SE8H 3L3DA 4G3YL 2E9JA 3UJIH 3HFML 2AJZA 3PJSA 4TNWF 43CAA 1BMGA 4TVPE 4LARL 4CU7A 1NCCL 2E9WA 3HB3D 2IC2A 5CP3A 5E8OA 3G9VA 2YD4A 2V9RA 1HOCA 4Q97A 1NC4B 4GO6B 3ZE0E 1NC2A 4D9QD 4XHJC 1C16A 3H9SE 3GJEA 3WJJA 2RB8A 5AEAA 3R8BB 4XCNB 2NW3A 5DJ0A 2AK4E 3C6LA 2ADIA 3REWB 1AR1C 1S7TB 5FA4A 1QSFB 5F9OL 4KUZL 2R8SH 1RQ5A 5IG7B 2DQDH 1O7VA 4P23B 3F7YA 3NABL 4IJ3B 5CBAB 2H6PA 3KNBB 4P59L 1X5YA 3MA9H 1MEXH 5TPWH 1FVDB 4TTGA 1AFVL 4JZOB 4O2EB 1QSEA 3QRGH 5JPMA 4QTHB 1IL1B 5C92A 3NIGE 1QSFA 3U48A 5IG7A 3EYQD 3KLAA 3TA3D 4P23A 3MNZB 4PJ7E 4H0GA 4JJHA 1C1EL 4RDQF 5IMMA 3N06B 3O6FD 4P9ML 5E94B 4B7LA 4N0CD 1LE9B 1SJEA 5GS0C 3ELAT 3T2OA 1HYRC 5GXBB 4M1CD 2WUCH 5MEPB 4O2EA 2PYEB 4NM4H 1XGPB 1U3HA 3ZHLA 2HFGH 3QZWA 5EORH 1OAZH 4XMLH 2DQHL 1EHAA 3UTPD 4ZFZB 3NPSC 3BPLB 3O6KH 4G6MH 3RDTD 1QLRB 2R23A 2W0LA 3Q6GL 1ZLUH 3BZDA 1QBMH 2FJFB 3KPRE 2GTZA 3REVB 2DJUA 2B0SH 3SDAD 5MEPA 5SV3A 3TJEL 1KIUA 1HXMB 4HPOL 2EZ0C 2FJHB 4YHPB 5IEKB 1AXTL 2AABH 4KKAD 2C4FU 1IBGL 1DZBA 1I9RL 3PWPE 4YQXL 4CMHB 1FNHA 2IANA 1KJ2A 1W8OA 5C08B 5CZXD 2FJFA 5D8JL 3REVA 3DV6A 1EMTH 4NNPL 1G9NC 1H3WM 1O5DT 4OZFA 1UZ8B 1Z2KA 1MHPL 1HXMA 3L5XL 4O02H 2DM4A 4YHPA 4Z18A 4R26L 3OJ2C 3KLSA 5F1OB 4JO2H 5A2KH 4PB0L 1N4XL 2D7NA 1T66D 3VFNA 3BJ91 2PO6C 3BWAB 2ENSA 1UZ8A 3UTTB 5K59F 1HNFA 1KYOJ 3LN4A 4PGBA 5EBGA 1EJOH 3WKNA 1AY1H 3VRIB 4RNRA 5KBNC 1HH9B 3HMWL 2FCBA 4YHIB 4C56D 3OR6A 3RZCA 4YDLB 1XGUB 3BWAA 1A2YB 3QCVL 3U6RB 1RZ7H 1OAQL 1RJYA 4U1NB 5T3ZE 1H5BB 2IADB 3GMOB 2GK0A 1E6JL 5L2KB 1T22B 1FQ9C 2H9GA 1YQVL 4YHIA 4X8XA 4HCRL 2NNAB 2ORBH 1XGUA 4I3SH 4OI8A 1AR1D 3IJHA 1JWMB 5I1GL 2QHLA 4I18A 1B2WL 1KB5A 3P9LA 1SVCP 3MBEB 4Y7MA 3LY6A 5T1KB 3GSVB 4XCEB 1OD9A 4X6CE 4HIIB 5T1DL 5T1LB 1QFPA 3PWNA 3DO7B 4X7TB 1RUPL 2I60H 2NNAA 1HCVA 4XXCA 4A6YB 3GRWA 4MSWB 4D9QE 2BMKB 3UZQA 3MUY1 4KDTA 2RCSL 4ZNEE 3IJSB 1DLHB 5MENB 5F7UA 3MBEA 4BH7A 5T1KA 3GSNH 4JN2A 1E4KC 3EHBC 1KF9B 4P46C 1GVIA 3BKCH 1MRDL 1RK1B 4X8JB 5L0QB 2CJUL 3V7MA 2A1WH 3DOSA 5T1LA 3F8UB 4X7TA 3RUGF 2EE3A 5GS0D 5DYOB 4PRPD 3GSRB 5KS9B 4NQVB 1ZVHA 2FECI 3B9AA 1KCUH 2WQRA 2APVA 1DLHA 5MENA 2C1PA 1PQZA 5C09B 3QIWB 5DHYB 4TQEH 4JCLA 4H88H 4KDVA 2R0KL 4HS8L 3QCUH 2V2TB 4J23A 1ADQH 4QXGH 3PQYB 1QLFB 2BJML 2PN5A 1C5BH 3O3EA 1P2CB 1FZJB 4XPGL 3RBSA 4KI5F 2EZ0D 3ALWA 3JUYA 3P9MA 2A83B 1G7QA 1MF2L 1D5IL 1YC7A 3CIQA 3WN5C 5IBUB 3RI5F 3UTPE 3WNNA 4Z7WB 4M62H 3KPRA 1OQOA 1QLFA 3V2AR 4K8RC 4BJLA 2FIRT 5C0NC 1F45A 2MWCA 1YEEL 5IM7B 4HKZB 3S35H 5L8JB 4LSPH 5C0IB 1FBIL 1P9MC 5ETUB 4HUXB 5B38B 4HF5H 4M03A 5KVFL 1NBZB 4H20H 4O5LH 3DXAD 1YA5A 1UC6A 2A9NH 3WYRA 2QSCL 3MZGB 1Q38A 3C08L 2VDOL 3KPNA 1XZ0B 3PWPA 3SCMB 3RVUC 4XTRC 4HKBB 3PE9A 3TO4C 2PO6D 2Y5TB 1OAXL 3FT4A 3V0VA 4UT9H 4NQEB 1JPTH 1MHEB 2I5YL 3RL2A 5C0IA 1P7QA 4HUXA 3VXOB 3KPMB 5DJZA 1KOAA 1A14H 1CFQB 3CDCA 1NPUA 2XACC 1A1MB 1ZHKB 35C8H 3SN6N 3SKNA 2EDYA 4YC2C 3SCMA 2GTWB 1M4KA 2F9BT 4ZSOB 5ITFA 1WTGT 3HNTL 5EZLB 1ZVSA 4K23L 4XVUC 4HQQH 2DIJA 3MGOB 2OR8A 4JFQA 2NPLX 1F2XK 4NKDB 3IGAB 3TBYB 3JWOC 5I1JH 1Q9KA 1WAAF 1NGZA 2C7UB 3QNZA 3O9WB 4JREB 3NN8A 2HRPH 4OT1L 3LEYL 2V2XA 3D3VE 3GI8H 4POYA 4C56E 3MRLB 1LO5B 2VAAA 2VXUH 3K1DA 4QNPF 5H2BB 2O5XL 3QRFM 3IGAA 2ZPKH 1TQCB 4HT1L 4JFXA 2C7UA 3O9WA 3LPFA 4KJWC 3GMLA 3K74B 2WWMC 4NPYA 4NZDA 2DQGL 1HXYB 3BX7C 4XP5L 4TNWK 4TN9A 1XF4B 5AZ2H 1LO5A 3EHBD 4FXLA 4P46D 2J8OA 5EU4B 5CGTA 4OBRA 1J1XH 1I8IB 3MPCA 5F88B 3RWIA 4MXVE 5ACZB 4NKOB 3K80A 4HKJB 4QRRB 1A7RH 5DQ9B 1LO2H 4QYOA 1F13A 1SEQH 5A16B 1T1XB 4P48A 3T0XA 3I6LD 2FHBA 4ZO8A