5LKNA

Nmr solution structure of human fniii domain 2 of ncam
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
103
structure length
103
Chain Sequence
MQPVREPSAPKLEGQMGEDGNSIKVNLIKQDDGGSPIRHYLVRYRALSSEWKPEIRLPSGSDHVMLKSLDWNAEYEVYVVAENQQGKSKAAHFVFRTHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Neural cell adhesion molecule 1
publication title The N Terminus of the Prion Protein Mediates Functional Interactions with the Neuronal Cell Adhesion Molecule (NCAM) Fibronectin Domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 14
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2016-07-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5lknA00
1KB5B 3RZWA 1INEL 3RWGA 1BOGB 2NY1B 2VXTL 4TUJA 2DYPA 2FEDC 3Q6FA 4JO1L 4GAGL 4MCYB 4N90D 5DZOA 4JGUA 3P4OB 3D3VD 2W9DL 3F7PC 1PSKH 4KJPD 1J8HD 3R8BB 4XX1E 1ZSDB 1EZVY 3BEVB 5F89B 3T0EB 1FYTD 3VE0A 3ILPB 1XGPA 4RMTA 4TRPH 3S36L 4Z76B 2HTLC 2P5EA 1XZ0A 2HLFC 4PJCB 1ZLVK 5CJXA 2DN7A 1UCTA 1KCSL 5L6YL 5EU7C 1MCPL 2FL5A 5CGMA 1U8LA 1KLUB 4WU5B 5DDHB 4YC2B 1DUYA 1QO3A 4QCIA 2FATH 1LO3L 3MLYL 3O6KL 3WDIA 4FQPA 2XN9E 5GZND 3I6LD 3LVEA 4WO4D 1M7DB 1FJ1A 4RWYH 3W2DL 3RA7L 3HE7A 5EH1A 3W5MA 4MA3A 5ESAB 5C08D 4OCLC 4HAFA 3DURB 4GOSA 2F53D 1IQDB 2OZ4L 1DEDA 2AKRA 5ETUA 2P4AB 4O02L 3P4NA 5I1EH 2V2XA 3PABA 4AMKH 3U30B 3QUMH 4FQIH 1MHPL 1RHFA 5DJ2A 1NMCB 5C1MB 5E2VL 5KW9H 5GZOD 3EO0B 3UAJC 4XP5H 4NKIH 2O93L 4QRTA 1J0IA 1AE6L 2OTUB 5TQ0H 3ULSA 2P8LA 3SDAC 1NANH 2HG5A 4YK4B 12E8H 3H9SE 3GSUA 4F3FB 5F7EH 1HINL 3B9VA 1T6VN 1D9KB 4Q7DA 5D7LE 4OV5A 2NNAA 4OI8A 3ELAT 1DQML 3VWKD 3LH2L 3V5DB 3GKZA 1YECL 1NKOA 3UZVB 3QYCA 3F6LA 1TZGH 4JO3H 2P5WA 3UO1H 3PGCB 4WFHE 2R1YA 4KWUA 2OL3A 2PTTB 4F58H 4XMPL 2WP3O 3B8SA 2APTA 4ZS7L 3RIAK 4QEGA 5I1GL 1K8IB 2J3SA 4QRRD 2XWTB 2DQFA 3TA3D 3A6BH 5J9PA 3SDYH 4TUJB 4Z7WE 2D9QB 5F9WB 5TH2A 5TDPA 5KSBF 2ZCKH 4Y8AA 2R9HD 5DJDB 4PLJC 4E41B 1FFPA 4H1LH 3V5KA 1UACL 3IGAA 1C5DB 2DQJL 1MCOH 1NEZA 2IBZX 1B0RA 4RMRA 4DKFH 1XZ0B 1JFQH 1KPUB 3HUJB 1RZ7L 3VG9C 4P23B 3MRFB 4NZJA 3KPRB 4YBQD 1IQWH 2FL5B 3UBXG 4OF6A 2OS7A 5DRXA 1T89C 5ERWA 1QLEH 1S3KH 1DUYB 3J8F7 1SY6H 3GBNL 1JL8A 3TBVA 2BVUA 4K7FA 3GSQB 2CGRH 5IB2A 2HP4A 5L2JA 5HI5D 1MJUH 2DMCA 3MRJA 1IC7L 1R5VA 1U91A 4OTXL 4D3CL 2CRZA 1MREL 1FJ1B 3DYMA 3EUUA 5JUEL 3QJFA 3HNVH 1CIUA 4MA3B 4X9GA 2WSKA 4RRPA 4MVBD 4G6JL 2XKNA 3MBEB 4JHAH 2LTQC 5ETUB 5HHNA 4XRCA 3OKMA 1PZUB 2VDRH 3PABB 2X4UA 4JCMA 1VFAA 2WBJD 5TJWK 4P2QA 3MRKB 4X7SL 2A2QT 5DJ2B 4G6AD 5H94A 5CGYC 1ZLSL 1Q0YH 4MAYA 5FM4A 2F19H 1JYXA 1KTKE 2MCPH 1FFQA 4C55A 1P5VA 2WAHA 4YE4L 2EDTA 3GUTB 3ULSB 1W72H 2P8LB 2HG5B 4KDTC 4GSDL 3I2CH 1RVFH 5ALCH 1E6JH 3FAWA 5ADOH 2R0LL 1JTTA 4OV5B 2NNAB 2NYYC 5CLTA 4UILL 2D31A 5JW5A 1A7QH 3MZTA 1CL7L 2G5RA 1IGFL 5D2LF 5JIKA 4FQJL 4PGEB 3CFBB 2BY1A 2J1KA 3GMQA 4C59B 1RIHL 4XI5D 1C12B 4I3RL 1KGCE 4JPIA 4JZOB 5BQ7A 1AIFB 1J9CT 5J1SC 3ROOA 3QUZD 1P53A 1VFUA 3CMOL 4Y5VA 3LMJH 4LNVA 2QQKL 2J8OA 4HC1H 5IQ9B 3VG0L 5J9PB 1A6WL 4X5XA 4KV5E 1BQHG 3AREA 1SVCP 1GVIA 3MXWH 3P0GB 3W81A 5GGTH 1F4YH 1S7WB 5TH2B 4I0KA 5TDPB 1Q9WA 4IRSA 5DD5L 1G0DA 4KUCF 4OD1L 4BQ8A 3WUZA 1F90H 1GZPB 4YHKH 5LJYH 1OW0C 2Q3ZA 3CFJA 1A6VL 5LGHH 5JOEA 2NZ9D 4QNPF 3QDME 4Z0XA 4JFFD 1B0RB 1JF1A 2QKIA 3RBGA 3ARBD 2QJDA 4KROB 4UTBL 4PJEA 2J8UA 4LCIL 1FC1A 2A77L 5I73B 2YZ1A 1RSFA 3H9ZA 4S1DC 3FT3B 5A1AA 1GXEA 3LPWA 5LBSH 1LILA 2FYYB 4NO0A 5CD5C 2GFBB 4R0LC 1NMCC 3P0VL 4ALAL 1U91B 3O2DH 3TBYA 1D5BA 2MMXA 3PWLB 1U42A 3TWCL 4G3YL 1XAUA 4WW2F 5D96B 5D7JD 4IMKC 3Q48A 4P46A 5EIVA 4ZXBD 3RUGF 3SJVE 4X6DB 5JOPE 1RZGA 1T1XA 3MV11 3PE9A 2NY2D 3OKMB 2X89D 1CDUA 2BFVL 3BKCL 3LKQB 4YHMH 3TBWA 1XGQA 4P2QB 1QBBA 4LLQA 3LRHA 2OSLB 4K7PY 2P46B 4ZO8A 3HC0B 5T5NG 4M1GH 4YHOL 1XR8B 4NNPL 5SX4I 2ARJQ 3RIAF 2F54A 1OM3L 4LAQH 1HWGB 4MA7L 5DF0A 1IGCL 4X8XA 5TE4H 2HTKC 1G6RL 1F3DH 4URTB 2Q8BH 4QRSB 5BS0D 4KK8D 4JRXB 2VWEC 2CRYA 4DW2H 4PB9L 3SE9L 2D7OA 3FZUC 2ZCLH 5AAWA 2F5AH 3FQWB 2BVPA 5TF1H 3KPNA 1FCGA 1ZT7A 2D31B 1FZOB 5JW5B 2OJZH 3GIZH 4PJFE 4XNXL 3QNYB 1A14L 5FGCB 3FB5B 1S7RB 4LVNB 1DQQA 5ITFB 1ZKAA 1Z9LA 3GMQB 1KB5H 1OF2B 3CDFA 4M9OA 3TT1L 5IF0A 2YWZA 4L4VB 6FABH 5MHSE 2FBJH 4F8TA 5CJXC 4JVPA 2HJLA 4HKBB 2LVCA 3TCXA 3O6LH 4LGRB 4DOHB 2UYLA 4M1CD 1GGIL 5FOJA 1NSNL 4KK9C 2VC2L 1ETZB 1K4CB 1AY1H 3BO8A 4QTIH 3PGDA 2VDNL 2X4NA 3SQOL 4PJDA 3E0GA 4MNGA 2CR6A 4Z0XB 5I1IL 3DBXA 1WZKA 1AGFA 1VFBB 2VR9A 1JF1B 1OTSC 2QKIB 3HE7C 4I0PA 4OZFA 4NN5B 1XF4A 3ARFC 4PJEB 5HHME 3I9GL 3DXAA 2J8UB 4R8WH 4P4RA 1HHHA 5BVPL 1T04A 2AJZB 4F15B 3ZSTA 1PLGL 4TTDC 1WV7T 3QWRD 2GSGA 4FFZL 3X14A 1MOEA 4BSVB 5IUSA 5KZCD 3VXTA 5F3BB 3TVMB 4NO0B 1QUNA 1NBZA 4ZPTB 4LMQE 2Y06L 1TCRB 1TJIH 1A1NA 2APVA 1XH3B 3UXFA 3MUY1 3WEXA 1HKFA 2WUCH 5T1LD 2BCKB 2AXJA 4ZO6A 5HVHB 1NC4B 1LP9E 1K6QL 4MHHG 1JCKA 3V6OE 4GRLC 3QR2A 1YUHA 4KPHH 1T1XB 1QOKA 3HE6A 5ICXA 2GITA 3V7AE 3TBWB 1NGPL 3QPXH 5EZOL 4YDKL 4MNQD 3MNZB 3K8LA 3S7GA 1BQSA 4Y1AA 1J5OL 1EDQA 2CR3A 4L5FH 1D7FA 1IILE 3FO1A 4GAYB 1RPQA 5FHBL 5D7IA 3GDBA 4CU8A 4M7ZB 1CFSB 1ZGLA 5I8EB 3AU1A 3ARDA 3AVEA 2AV7A 4Q9BA 5LGJB 1JPTL 3IETA 5F9OH 2FECL 3HRZB 1X5HA 1E4WH 1ZT7B 4HUUA 3O0RH 1L0YA 5EBLB 4PFEA 2BHYA 1DQQB 2D7TH 3DX8A 4K55A 1QD0A 3GO1L 3GNML 3C6LD 2B8OT 4XHJC 3QG7L 5IBLD 2HJLB 3PWPD 4D0BA 2HJFB 1CK0L 3EO9H 5I73C 2FJFA 3T77A 4CRPA 4YHIA 1RUPL 4OGXL 1IAKA 4IRZL 2WWKO 4ZUTA 2V5RA 3AXLA 2DLIA 2V17H 3BO8B 2DBLH 3PGDB 3UBXI 4RAUB 3MV8B 4MNGB 2FCBA 1WEJH 3IT8D 1JK8B 3DBXB 2B1AL 2HVKB 5JW4M 3QDJB 1EHXA 4OZFB 2BHZA 3H3KA 2BJMH 4NM4H 4IS6B 5D96C 4NKDB 3B9EA 2XTJC 4RGMC 1HHHB 1A3LL 4V2CB 1T04B 2EIDA 4YDJA 2O5ZL 2GSGB 5E2UH 3SN6N 1FVDA 3OGCB 1AD0B 2XQBL 1BZQK 1I9IL 4L3EE 4P4KA 3FRUA 1EJ6A 1SM3L 2VISB 2X9YA 3I3EA 1NBZB 4MAYC 1H15B 3T8XB 1A8JH 2XRAH 4HG4K 1UC6A 3U1SH 4IOIA 4M7LH 1CGXA 1NMAH 1T21A 2NY1D 4HIEB 3WEXB 4YX2H 3MFGB 3TYGH 4BZ1H 4QO1A 4BQBA 2IQ9L 2AEIT 1J1XH 1DBJH 1QBLL 4LLAA 5EIIA 1EEYB 4FQXD 3MR9A 1FVCB 4FXLA 5I74B 2GITB 4I0CC 3T0ED 5K33A 2DQGL 2GJJA 2PYEE 4HV8A 2X10A 1CD9B 5CZVL 3JTTB 1YMHA 2FH8A 4WHTA 1XCQB 2ERJC 3QQNA 1U8KA 3FO1B 1F42A 3K2MC 1H8SA 3HI5H 4OZ4B 5D7IB 1V3KA 4TVPE 1KELH 3ARZA 4Y5VC 5IB3A 4GXUM 1ZGLB 4FXKB 4F7TB 3AREC 3IETB 4M43H 1T7ZA 2DQCH 5DI8B 4IRSC 4NP4H 3FQRB 4NQXA 1LE9B 4HUUB 2G75B 3D69B 2X1QA 3TNMB 5I8OL 4HK3J 5JR1H 4P5MA 3HR5B 4XMLL 3ZO0A 4NHUA 4PGBA 5FYKE 1ZGLM 1WFTA 3C5JA 4OUUB 2P43B 2E27L 1HWHB 1P6AB 5FGRA 5IEKA 1AJ7L 2DJ4A 1GAFL 4XTRD 5KTEH 3JV6A 4YXHH 5IOPA 1UJ3A 2VQTA 3CDGB 4NGHH 4YHIB 2R39A 1CGSL 5IKCA 3VJ6B 3BKML 3MJ9A 3AXLB 1A7PH 2D9CA 1JGLH 4G80B 4LHUB 5FDYA 2VZOA 4ZNEA 2VL4A 1A7OL 3SDCB 2VZVA 2X9XA 5IHBA 1T2QH 3RX8A 2BNRD 4UIKL 3UJJL 3QRFM 5CFHA 2L7JA 1D9KD 4P46C 3F7RA 4GLRH 3M45A 4Z18A 1JF5A 5KANG 1VGKA 4LPVA 1N59B 5DHVH 1KFAH 4YDJB 5J12C 3TGXA 4MDJA 2D7NA 1OARH 5DD0H 1BECA 2OTWB 4DN4H 4OSUH 2DKUA 4JFZL 4XNMA 4P4KB 4M03A 2PO6A 3EYUH 2IGFL 4GG6B 4ENEC 1FH5L 5E2WL 4XAWL 4X6CB 4OAWA 4R26H 1HQRA 1DBAL 4LRIA 1T21B 4B7LA 3IU3B 5JW4N 2LE9A 1EH9A 4M7ZC 4W4NA 1MCDA 3IDXL 2A73A 4Z7UA 5FYJL 5EIIB 4AY0A 4NO3B 4E41D 1KB9J 4AYFA 5GS0H 4KK5C 4Z7VA 1X5FA 2YN3A 1FORL 2BP3A 4GMTH 1HH6A 3CFCL 2DKMA 4D2NA 4Q97A 1IEBB 3NACL 3QEHA 1TCMA 2ZOLB 4P23D 5IVXF 5IHUH 3KPRD 1UZ6E 4QRPB 1J1OH 4PS4L 4ZOCA 4BUGA 1TVHA 3NPZB 4H26A 3VGBA 2VOTA 4BKLA 5CJ5A 1MAML 3UTOA 3ZL4L 3UBXA 1AD9B 2W9EH 2FHCA 5GRVL 5B21A 2P7TA 3RNQB 3ORJA 3BQUB 3S37X 1FG2A 1SJHB 5C0BB 2DWEB 2IAMA 5TDNB 3ULVL 1U2HA 1HHJB 1CDCA 5FA3B 4TSAH 4G8GD 2GUOB 3O3AB 15C8L 1XT5A 4JHZA 4L8SC 3MV7B 1YY8A 3UTTA 4KJPC 4P5MB 2OCFD 1KPVA 4AEHH 1SEBA 3WBDA 4PJAE 3WO4B 1J10A 4GH7B 3IXAA 4LSTL 3MBED 4G6KL 3VW3H 3TJHC 3VFSA 4I0PC 1ZAGA 3KGRA 4F80A 1QEWA 2AXHA 4OCWL 1BAFH 4HKJB 1U6AL 4XPHH 4HUWB 1HXYA 3JV6B 4D0CA 1PGRB 4GXUN 5IOPB 4YLQT 5CP3H 5HHOA 2BDNL 2CLZB 5I1KL 2YKLL 1TJGL 2IH1A 2ZOKA 5IKCB 1VESA 1DDHA 5SWZE 3GMLB 3WXWL 3LV3B 2QSVA 5JNYA 3CGTA 3OKLA 4WEBL 5HI4D 1KN4H 1XF5A 5GZNC 1BIHA 2W0LA 3O81A 2CLVB 5JIIA 4B53A 2ICWJ 1P4BH 2CDFB 2AJYL 1CGUA 1LO2H 4JDZA 1J1PH 1AXSB 3V5HA 1I3RA 2YSSA 3KPSD 1U9KA 4OQTA 2Z4QA 2OLDA 4IHOB 1EO8L 5HPMA 1VGKB 1JN6B 2P45B 3HE6C 4G9FE 2ENYA 3QDGE 1WIUA 4OCXL 5E56A 5IQ7H 4D9QE 4XNMB 3GRWH 3RKDD 3MRMA 1BJ1J 2PO6B 4MHHI 4GRMB 1IM3B 3E1F1 4P5KA 4OAWB 5GZOC 1QR4A 3DECA 4NWUL 2OI9B 3BSZH 4RFOL 1J87A 1FNGA 1OLZA 4OFYD 5IWLA 3FO0L 5I1CL 1ODAA 4HUVA 3ARDC 1ITCA 3MUJA 5L2KA 2A73B 2UUDK 4Z7UB 2A9ML 5GRJH 1QYGL 5ISZA 4Y4KA 4K94H 3IDJA 1LP9F 4CN1A 5HXMA 3O6MH 3QCTL 4P3CL 4Z7VB 5GS1B 1QRNE 5I76A 3T08A 1HH6B 2IFFL 3JV5A 4FZ8L 4XH2B 5D6DA 4N0FA 1DBML 1DN0A 3HB3D 4KROD 4F2MA 5ACZA 3L9RA 4Y88A 3OG6B 4L4TE 1FNEA 1MIEL 4S1QL 3WFCL 1M7IA 1JNJA 3MCG1 3KLHD 4H26B 1D6EA 3UBXB 5DQ9A 3WFBH 2DOCA 5DS8B 3IFPA 2P7TB 3ESVF 4UINL 4WWKB 2IAMB 3GJFK 3LN5A 1SHMA 4NKOA 1B6UA 1RUQH 1A2YA 3A6CH 2R1WA 1OCWL 4S0SD 2EDBA 2FX8L 2F74A 2UZYB 5T3XH 2DLFH 1KPVB 3NOIA 1SEBB 3WCYA 3IXAB 2QL1A 4JY4A 5DFWH 2EC9T 3VFSB 3DVGA 1HSAA 1U8QB 5D71H 4S0TD 5GJTL 5EU4B 1FQ9C 1U8MB 5GS0D 4U0QB 1ZA6A 5HGDB 3KPPA 3FRPG 4YBLB 3TV3L 5C07B 4P4KC 3C2SA 2CKBB 3WFDH 3OPZH 1YQVH 2ITCA 4CNIA 1CDYA 4PB0L 1T7YA 3O2VH 3OKLB 2Z91A 5IROA 2OP4H 2Q7YA 3HMXH 3GSVA 5D1XB 4JRXD 1A9EB 4OZFH 1EBPA 5KBNC 3UTSB 1RUKL 1NGYB 5FIEA 4U1IB 4NRXA 4NUGH 4NOFA 4PTUA 2YSSB 3LN4B 1YYMH 4Y2DA 1I9EA 4MVBC 2IC2A 4ODXA 3H0TB 5EZIH 4OIIL 1CR9L 3I6GA 2BRRH 2ADGA 2CMRH 1K5NB 5DGRA 1UWEL 5JZ7D 4G6AC 5KAQF 4L4VD 5F6IB 4P5TB 4MNHA 3KYKH 4CJ1A 2NLJB 4P5KB 2CSPA 5DJYB 2NX5E 5D93C 2WK2A 1FNGB 1EAPB 3H7BA 4HHAA 3OB0K 3WL9A 1BQHB 4FQHA 5JPMB 2D03H 1PEZA 4Y4KB 4IDJH 5IFHH 3IDJB 3OF6D 3O9WB 3DSNA 5DJ8B 5I76B 4RWHA 4PD4K 3NH7L 4N0FB 1DN0B 1IBGL 2AI0L 3WO4C 3LD8C 3L9RB 4K71B 4U6VL 4LRNL 2PN5A 4D9LL 1C1EL 1M7IB 1EHNA 3L1OH 1Q9LB 3WSQH 5EFIA 1MQ8A 3VRLE 1CF8L 5DQ9B 1L9MA 4WNQA 1YN7A 1UJ3C 1C08B 3TVMD 4WHDA 1MF2H 1QHPA 3RDTD 3GKWH 4NKOB 1V3MA 4AG4L 1A2YB 1OTTD 3CFEB 1FL3A 3QISA 1BZ7A 2R1WB 2F74B 1MQKH 2UZIL 4Z78A 1MLBA 2RHEA 1NAMA 1WISA 4LAJH 3G5VA 4GJTB 5B38A 3HTLX 2V7NB 5JXAH 1NC4D 4I8DA 3H9SD 4NZRH 4JY4B 4TOYL 5J06A 1MLCA 4DUXA 2NY7L 3EKCA 3QHFH 5D7LD 1HSAB 5TGBB 4M8QA 5CCKH 1IGIH 2J5LC 3D85A 4HGKC 3ULUE 5D8JL 4P9HC 3P73B 5IEHA 2XWBA 5EULV 3VMNA 1ZA6B 1ERNA 4WFHD 5I16B 1A3RL 4HJ0D 4JG0H 5INCA 4CNIB 5JPNA 2AJUL 4LOUC 5KANI 1WICA 4NZUL 2EDNA 1EMTL 4LRIC 4ZMAT 5KVGH 1TPXC 5F1NB 4C58B 1L7TL 4M7KH 4YGVA 5KSBA 2HRLA 1MIML 2ESVB 5D7JC 1T83A 4Y2DB 1N6QL 5F9JA 3MOBH 3B9KD 2H2SD 4ODXB 2O5YL 3GK8H 4KKAD 4DUVA 5T3XD 3ZYOA 1E4XI 1I4FB 4JRYA 3VGEA 1WITA 4Z5RA 4RQQB 3OB8A 1AP2A 1DCLA 4LFHD 4WHCA 3ZKNC 2V2TA 2H45A 4Q6IB 4MX7A 1DQDH 5AUMA 3WHXA 3WXVH 1GGBH 2VDOL 4B41A 3H7BB 3ARGB 4HHAB 5DZNA 2FR4A 3BPCB 3L5XL 5T1DH 2IAMC 1SQ2N 2X4TB 4FXGA 3MROB 1HIML 4XPBH 4W6WB 2WZPD 3VWJB 3MV8D 1FO0A 1QSFE 2R2HA 5L8KB 4XPGL 1RUMH 4NC2B 3C08H 3QDJD 2BVTA 3S96A 1RJLB 4OI7A 5IJVA 4Y4HA 4PRHE 4RNRA 3FO2A 3AAZB 1MI5B 4OD3H 4PGZA 1LDPH 1F4WH 5EFIB 4WUUB 2UY7A 4KY1H 1JZ3A 1H3WM 1UZ6F 3FHAA 4WNQB 2YUZA 3MACL 2ZUYA 4LARH 4PY7A 1UM6H 3D87B 5C0GA 3PHOB 2DQTL 3L3GB 4QGYA 1K2DA 4K23L 3SPVA 4NQCE 3AM8A 1FL3B 1TNNA 2AK4A 3BP4A 4YBLC 3WNNA 3BN9C 1MLBB 1NAMB 1H3PL 3PF2A 4PP1D 1G7HA 3G5VB 1FSKB 3FQNA 4QXTA 1YN6A 1Q9OA 2FSEB 3QG6A 5CSZA 1OLLA 3QXVA 1TFHA 1MLCB 1YY9D 5D2LA 4PJAF 3FOLB 4XCCH 3D9AL 4M8QB 4F33B 1PKQA 2Y23A 2OL3L 3T2OA 3MJ9H 2AJ3A 3NN8B 1IC1A 2H9GA 1YNTA 1FL5A 1ORQA 2R8SL 3HI1A 1KGCD 4KZDH 5HY9B 5INCB 1UQSA 1BM3L 5A40E 4QXGH 5LAXA 3BE1H 2OX5A 2B7DT 4EXPX 4JFYB 1VEPA 4YGVB 4GMSH 4O5LH 5BMFL 1S9XB 5IWLC 1JV5A 2JCCB 1MCHA 2Q86B 2CIKB 5F9JB 4ZPVB 1MCWM 4M6NH 3NFPA 3W9DB 5L88L 3KR3H 3QNZA 4XPTL 5DD1H 4PREA 3MJ6A 4Y16D 4JRYB 1HCVA 4KXZH 3HCVA 2F5BH 4PJBE 1INQB 1AP2B 3MLWL 1N64L 2YHGA 4G8FA 5ID0A 4AEIL 4YIQB 1EJOH 2DMKA 3QXAA 2NY5C 1JI1A 4KU1A 3WHXB 1DSFH 4JAMB 4F9PC 4JPWH 5DTFB 3HFMH 1WJ3A 5CINL 5DFVC 4M93B 4MAUL 2KDGA 4LHUD 4A6YB 4WW2A 1VGEH 3GM8A 1Q9KB 3SDCD 3C5ZB 4UTAL 4QOKB 2RFXB 3RUGA 4GFTB 2F15A 1U95B 5EO9A 3U46A 2VLKE 4MSWB 3X3GL 4LF3B 4WRLA 1MH5B 1TXKA 2VXUH 5CMAA 1VSCA 1G7MA 1Q72L 1Y0LA 5HHPB 4EBQL 1BIIA 1F3JA 2HMID 4LSQL 5FM5M 3VGFA 5IBUG 1HEZA 3OWEA 1RURH 2IMMA 1NLDL 1GGCL 5BRZA 2W9LA 3NA9L 3CK0L 1M6OA 1NCDL 1A6TA 4M5ZH 4PY7B 2BVOA 1FFNA 5C9KA 1OPGH 4Y19B 5AZ2H 1OSPH 4U1SA 3SPVB 3LIZH 2GY5A 4UQ3A 1YA5A 1H3TA 1U3HA 3SOBH 4BYHA 5L7XL 3NAAL 1G7HB 2C3VB 5IROC 4IM8A 2E3VA 3FQNB 1J0KA 4QGTA 4EQ2A 2A74A 3TM6A 1U8JB 2APXA 1CD1A 5BXFB 5CSZB 5GS3A 3UTPE 5D2LB 4HFWA 1YPZF 3OMZA 1CIDA 4DGYH 4N5ED 5D7SL 2VSCA 4XVTH 2VDQL 2CJUH 5B3JE 1X5JA 1JHTA 1YMMA 2CKBH 1S7XB 5JW3H 4R4FH 1EV2E 1JPSL 2H9GB 5IHLB 5MEPA 1ORQB 2KZ1B 4YPGA 4UBDC 4QRPD 1TETL 3P9MA 4NCC2 1JWMB 5MHSD 5HHXH 1UQSB 4M6OL 1WGOA 4HJGA 5F7LB 3BQUD 1UYWH 5C0BD 1P4LB 3KYNA 3OZ9H 4IEFB 3NIGE 2AJSL 5I1AA 2KBGA 2FB4L 1SYSA 5GRVK 3EOAB 1JYNA 4KI5F 3MV7D 1N7ML 3BD4A 3NFPB 3SY0A 3BOVA 3VXUE 4FQXC 4DZ8A 3QIUA 1AI1H 4MB4A 4PREB 4DGIH 4P2YA 3MYJA 1QNZH 3MC0A 3TBSA 2XIDA 2XA8H 3PJSA 4ZFOB 2GI7A 2DIAA 5DMIL 5ID0B 5A16B 3KWWA 1TMCB 1JPFA 4G7VL 3U0TA 2C7UA 3EJZD 1MCEA 4JFDA 2BOBA 1QA9A 4MJ6B 3LKRA 4POZC 4K8RH 4ODTL 1L7IH 4LVOB 1FZMB 4MA8H 3QFJE 3QO1B 3OAUH 3CX2A 4HSQA 4PJ8D 1BJ8A 4XBPA 2Z35A 5I8CB 4LLMA 1A7NL 2XN9A 5F93C 3S35L 1XCTB 2DQEL 5HGHA 2CUIA 3MODL 4K3JH 5CZXD 5EO9B 3UJTL 2V9TA 4LU5L 5CMAB 2VLLA 4HS8H 3FMGL 2G9HA 1Y0LB 3LKNA 2VXVH 4OIAA 1NMBL 2OQJA 4CUCA 2FO1A 3S34H 5BOZG 4LPCA 35C8L 5JIHA 4KMTH 2O26U 1F58H 1Z0MA 2YPKA 2BVOB 1FFNB 3HAEA 1A02N 4PIRF 5H8DA 4OLYH 3VRLF 4M6MH 4ODHH 3ECBA 2IBZY 4U1SB 5GGQH 2HFEA 4JPKH 1ZMYA 4HEPG 1NAKH 1MCIA 2UUDH 4APQA 5FO8B 4M62L 3KLDA 1SVZA 1VHPA 3GMPA 1TVDA 3OKDB 3MOAL 4JQXA 2VKWA 5HYSA 1KN2H 3ZDXF 1T83C 4ZUWA 5ICYA 3RWIB 1R3KB 4OM1L 3PNWA 2FD6H 3PGFH 1MFAL 4OCRH 4M1DH 4X8JA 2CRIA 4DAGH 3CZFA 2C4FU 4U7KA 4JCLA 1BHGA 5F72S 1KF9B 5D9SA 4YPGB 3R1GH 3ULUF 2EDQA 1FV1B 2FJGA 4PR5B 1BBJA 5D1QA 4KMLB 4WDIA 2I07B 4JLRA 4HJGB 4HMDA 1XGYH 3MNVA 4WWKD 4U49A 1MEXL 4P9MH 2GHWB 4HWBA 5FUZH 5HYQA 2MSPA 2VH5H 4WTWA 1C7TA 1ZGLP 3GHBL 4F57H 1UB5A 3SY0B 3R06B 4LEXH 5HTSA 5TQ2H 1NGQL 4JO2L 4ZS6D 2GT9A 1F4XH 3F7QA 4LSVL 3VXRE 1IC5L 1J18A 3MYJB 4HS3A 2L4OA 3NTCH 1Q1JH 5EC1A 2VDLL 1HILA 1ACYH 4NT6B 3VCLB 3SDDB 5EUKB 3QULB 4JDVB 4Y4HC 4PRHB 4EXKA 1T7WA 2AK1H 1KBGL 4ETQA 2BY2A 5IB1A 2C7UB 5CHNA 1SYVA 3MJ7A 4JFDB 1OD9A 5TE6H 1QA9B 1UA6L 5J89A 1JPST 4LSRH 4EI5B 1MJ8L 5E5MB 3UJIH 1A6AB 5DK0A 1NCUA 3G6AA 4L3ED 4NRZA 1DQLL 5C07D 1V05A 2JJTC 3NGBB 4H20L 1MFBH 3RWEA 3W11D 5ACMA 3BGMB 4O58L 2QSCH 1BD2A 2Z35B 4JR9H 4LLMB 5KVDL 1BFOB 1L0XA 4J3TA 5D1XD 5HGHB 1BLNA 4ERSH 1YEGH 3U36A 5JO5B 4G9DA 1PYWA 1FRGL 4L1DA 3LKNB 3T65A 4HH9B 3RVXD 3MCLH 1YEJH 3VFGH 2A6JB 4ONOA 3DGGA 3SE3A 1KC5H 1KJ2B 2VDMH 2D2OA 3NCJL 3DTXB 4E0RA 5C09B 3J7HA 2PYED 1WVZA 3DSFH 3RBSA 3HAEB 5C70A 1R6VA 1U8IB 3DX6A 5DD3L 4P5TD 1NBVH 1T3FB 2HFEB 3GI8H 3HHRB 2JELH 4FQ1L 5SX5K 4MQXC 4XNYH 4JQVA 3W9EA 4NN7B 2OBGA 2FGWH 1A9BB 4HXAH 4XPAH 1BGXL 3STZA 4NQEE 4K8RD 3GGWB 1AGEB 5E1AA 5MI0B 2CDGA 2YC1A 3O9WD 5ICYB 3ULVF 4PJHB 1F6LL 4WI8A 1H3VA 3FFCE 4YQXH 2CH8A 4P2RE 5DRWB 4OLUL 1UB6A 1NL0L 4LSPH 2OXGA 3SGEI 2G2RA 1NJ9A 3CLEH 2FJGB 4WI7A 3U6RA 1BBJB 1S9WB 4OLXH 1MSPA 4P2CG 1T66D 4LLVB 4JLRB 1CG9A 4D9RD 5CD3A 2AW2A 3QAZB 5C7XH 5GGSA 2VLJB 4WCYL 4OFVA 4QXUH 1CE1L 2ATKB 4KK6C 1OAZH 4FQ2H 1G7PB 3E3QE 1YEEH 1ZS8B 2H2PD 3NCYS 3QIWD 4MLIA 4PRPA 2HKHH 1UZ8B 5L0QC 4WW2C 2VABA 4YO0B 1FCCA 2GT9B 2IF7A 2X4OA 4YFDB 1EO5A 3QDMA 1JMZA 3AC0A 5EC1B 1HILB 1FAIL 4FNLL 4GRWE 4KC3B 5ILTL 2MTPA 4X6FB 4ZTOL 4ETQB 4PV9B 4N8PA 5AG8A 4R3SB 1GC1L 4HT1L 3AMKA 4HWUA 3AS3A 3DX7A 1I3GL 2JK5B 5DK0B 3QQ3A 4A6YH 3HZKA 4MXQC 5EZJA 1KEGL 3RWEB 4OLWL 2WV3A 1INDL 5AZEL 1BD2B 5J6HA 5EOTB 3QUKA 1C5BH 1U3HC 2NY6B 4X0KA 2BNQA 3BW9B 3F7YB 4AL8L 4TSCL 1N3NA 4EOWL 2AEPH 2ESVD 1PYWB 1Z5LB 4YWGH 2XT1B 1TDQA 1PSKL 2YD8A 4BSJA 2Z93A 2NZIA 3SJVA 1NFDB 2ADFL 1E6OH 2IQAA 1RV6X 1JPGB 4R4BB 5CZKA 3NIFE 2E9JA 5IVXA 1OWWA 5IBTH 5F7YC 2R69H 3ZYJA 2IPUG 3L7EA 3ARRA 4S10A 3D0LB 3QHZH 2XZZA 2XNAB 4WFFE 4D0DA 4H0IA 5GISH 4BK4A 1IL1A 1ZLWK 4HPOL 2NY4B 4E42A 3IKCB 3AB0C 2E8YA 2YD7A 2FATL 4CDGC 3ARGD 3V4VH 5IB4B 3VXMA 1P6FA 1DR9A 3STZB 4CN6A 4K3GA 4W4OA 4IJ3B 1HHGA 3IDMA 4QHLA 2ZJSH 5E1AB 2YC1B 3QRGL 5C0DA 3VGHA 3VWJD 2JIXB 1EHLH 2CPCA 5FO9A 5AWNL 4JREB 3QIUC 3UPRA 4GKNB 4PJIB 1MCSA 2I9LB 4UAOC 2G2RB 5D72H 1NJ9B 1MI5D 5I1EL 5B3JF 3HS0A 1RZFH 1WWCA 1QBMH 1LDSA 2ZSVA 4FP8H 4WUUD 4FQCL 1YNKH 5CD3B 5D2NE 3HZYA 1ZEAH 1MCKA 5E99L 5H2BA 1IAOB 2X2YA 3RJDA 1A4JA 5JA9A 2X70A 3VFOA 5EBWB 3WHE1 7FABH 5TQ0L 4PRIB 4UV7L 4PRPB 1N8ZA 3NIGF 3PHQA 1RJCA 2ZUQB 3RGVA 3CH1B 2X4OB 5F7EL 3BPLB 2AJXL 3EHBD 1CZ8L 3EJYD 4L29A 2FZ3A 1MHHA 5DGQA 3PQYA 2HAZA 3OSKA 4P9HL 4XXDA 2Q87A 2UY6A 3BH8A 3LS4H 5FAAA 5ANME 4EJ1C 5HHQB 1TZGL 4ODUA 2HA1A 4LP4A 4G9FD 2GJZA 4QHMB 5DC4B 5I9QB 3UO1L 4H0HB 3NCCB 4BQ6A 2EKJA 4M5YH 4CMMB 5FOBA 3QQ3B 1IM9A 1ADQA 1I7ZA 1T7XA 5EZJB 1G9MH 2B4CC 3FQUA 5A2KH 3T4YB 2EDYA 4OUOA 2NY3C 4KHTH 3LZFH 3A6BL 3Q0HA 3SDYL 3QUKB 1G9NC 3RWDA 1CL7I 3TFKC 1LD9A 4X0KB 4APQC 2JJUA 5T3ZL 1ZT4B 5FYJU 3ZDZE 1I1YA 2EC9U 4NJAH 4Z7NF 1CI5A 3SE8L 3GSNH 3I6KA 2ZCKL 4JQXC 4UIMA 4X7CC 3V6OA 5E2JA 3NZHH 5J7CC 2ARJA 5MEOA 2BY0A 5MI0C 3S88H 5C2BH 1QRND 5IVXB 4YFLF 4P57B 2BVYA 3OR6A 3L7EB 1JHLH 2FGZA 4MGXA 4DCQA 1QFPA 1KJVA 4ZFZA 4F7MA 1Z3GH 1RUAH 2AVGA 3CFDA 2WWMD 4ZD3L 1I7UB 4HZLA 1QLEL 1S3KL 4K3EL 1LO0H 5D1QC 3RX7A 1E4XH 4E42B 3F7VA 3T2NH 2CGRL 3VXMB 1RZJH 3QAZC 5MENB 1CE6A 3OJDB 4KKBD 2MQ0A 43CAA 1HHGB 4QHLB 3WFZA 5DT1H 4G7YH 5C0DB 3BWAA 3O6FB 3B9KC 3C5ZD 2H2SC 2YOCA 4QOKD 3U82B 3L5HA 3Q1SL 3CDYA 4KKAC 4YPJA 4LIQH 3KDMA 5IMMB 4Z7QE 4LCWB 4GKSB 5GGVH 4A2LA 5I15L 1HH9A 2ZSVB 5BV7B 3EO1A 4MD4B 4YNYA 5CBEA 3BPNB 3HZYB 1TJHH 5IIEA 2HWZH 2IH3A 2MCPL 2EYSA 3B6SB 5C0IA 4EDWH 4Y19D 4DQOL 1HCFX 3WUWG 2X70B 1S78D 2X42A 4IOFD 2A6IB 4O4YH 3VFPB 3FT4B 1NCBH 5DMKB 3H42H 4PGDA 1GGUA 3CUPB 4N90E 1RIVL 4C56E 1RVFL 2VDPH 4NBYB 3SE4A 1VACA 4L29B 1XIWD 3PQYB 4L3CA 4HXBL 5A2FA 4L3AA 3C60D 2XKUA 1FYTE 3C09C 3B9AA 4KJWD 1TTGA 4K7PX 1PY9A 1L4IA 5IW1A 3RU8H 2IG2L 3QWOB 3RJQB 4CU6A 2OR9H 3U4AA 2GJZB 3SE3C 5FV2A 5MERA 1VEMA 5EU6B 2IBGA 4JY6A 5AG9A 4H88H 5LKNA 3LMJL 3TCLB 3MQIA 2QTEA 3FQUB 3BP5B 4QWWD 3QPQC 2VTFA 1QPXA 4HC1L 1DEEA 3PUCA 4K9EH 3RWDB 2XZAL 3MXWL 4S2SB 5EO1A 3IAPA 4JQVC 3STLB 2H3NA 2LAGB 1I1YB 3PP3H 1F90L 1XR9B 3X3FH 3I6KB 4UNVA 1KB9K 2XQYG 4UIMB 3DVFA 3DX9A 3OV6A 4JZNB 5DWUH 4NZTH 5LGHL 1CLZL 5C08E 1KJ2H 1Q0XH 2ARJB 1YY9C 5MEOB 5T1KD 4DEPC 2NXYC 2F53E 1ZHBA 3QXDB 3QQ4B 3LQAC 5HD8D 1JZ8A 3CVIH 4RGNB 5KVFH 4MXVE 3RWJA 4CVZA 3CFDB 1ED3B 3WLWC 1QSEE 3GJEA 2V5MA 4J8RA 2LVEA 4GUPA 4QF1B 3ROLA 3FQXA 4NKMA 2MKWA 5IT2H 2UV3A 3EYVA 5ADPH 2BVQB 4HWZA 4OFIA 1CE6B 3B5GA 5K9QG 5I8KL 1OGAB 3VFWA 4YXLH 3BEWA 3W82A 5D1ZD 3NVQA 2XZQH 1E4KA 3BWAB 3QCUH 4XP1L 5D70L 1F6AA 3G5YA 1MCRA 2R0ZH 4N8VG 2BC4A 3DRTA 2LAAA 5DEFB 3KDMB 5HDOA 4Y16C 4XCNA 8CGTA 1KCVL 3BMVA 1QVOA 2Q8AH 3SKJH 4AEEA 1DUZB 4PV8A 1YEIH 1RU9L 4RX4D 4OZIE 2XYCA 1SJVA 4YNYB 1RHHA 5IBUB 3UROR 5C0FA 5IIEB 2IH3B 4M1GL 5I9QC 1H3GA 1CDIA 5FK9A 2WIIB 2AERT 4XBGB 4UU9A 5TE4L 2APBA 2Q8BL 1ZXQA 5KS9F 5E70A 1KCLA 3AY4A 2ZCLL 4HS6A 2F5AL 4LLUA 4L3CB 5TF1L 3MJGX 2OJZL 5I75B 5HYJA 5TE7H 1KCRL 1X9QA 1FNAA 4UV4L 1D5XA 4GRWF 3AMLA 4UI2A 3U4BH 2FJHB 4XNZB 4EUPG 4ETYA 1UM5H 1KB5L 1CQYA 1KLFA 5MERB 2NY0B 2H6PA 3BPOB 3FN9A 3L95B 3NABH 2FECI 3ARXA 1QRKA 2A83A 4ZO9A 3GJFA 4UOW0 2BSTA 4V2BA 5EOCJ 5B4MC 5EO1B 4FABH 4PLNC 1S7TA 2H3NB 3SDXF 1BBDH 3H6JA 1JIBA 1AY1L 5DJZA 3QA3A 1AHWA 3ETBF 4J6RH 4OZGB 4QTIL 5FO7A 1OVZA 3Q6GL 5JLZB 4UT9H 4C57C 4W4OC 1ZHBB 4JM4L 4EN3B 2J88H 1AGCA 4XCYA 1BREA 4R8WL 1IC4H 4NUJA 3NIFF 4XP9L 5JHDB 4YAQB 3SDDD 4N0UA 3RWJB 4PRHD 4I9WD 2Z8RA 3MRBB 3JWDC 3GJEB 2XXCB 1FLRL 3H9HB 1D5ZB 2G5BA 1EK3A 4NKMB 5ICZA 2M8XA 1IZJA 1MFDL 1OSZA 3O4LE 4EI5D 3EDDA 3MLVL 5EPMA 4HWZB 3MV9A 4U3CA 1S9YA 3OJMB 3VFMB 4NQCD 5C0RH 2JJWA 2WUCL 1F6AB 4YHLH 1AXTL 1TVBA 1G6RA 3DYPA 3C8HA 4ZSOB 3DRTB 4PJAA 4ODSH 3HNSH 3RGVC 3LRSA 4UUJA 3QBTB 3SO5A 1QVOB 4CADA 5I2IA 4PV8B 4BM7A 4LPYA 1L6XA 5I18H 3VRJA 3QPXL 1RHHB 3CC5A 3EJZC 4WY7L 5C09D 4W70A 1HI6A 1WZMA 1U0QA 4OJFL 1KOAA 1DFBL 1ZV5A 2A6DA 1EGJA 4UU9B 5SWZA 1BQLH 3P77B 5IP4A 3BD3A 4PJ8C 1B4JH 5IMKA 3MREA 1KJMB 4PGCA 4C83A 5FHAL 5I66A 4NQTA 1NCAL 3WIHH 5F9OL 1MAKA 3BAEH 4R97B 2Y5EA 1E4WL 2F58H 1NC2D 3O0RL 4AIXA 1T03L 4JFFE 5HYJB 1C5CH 3V6OC 3CXDL 5ID1A 1JF6A 1M05B 1LEGA 4OCYH 2CRMA 4KQ4H 3QDGA 3KYOB 4RMUA 3Q5OA 3IXTA 3B3IA 4RGNC 2X4PB 4IRJA 2R15A 3TN0B 4IDLA 5I19H 4RMVA 3EO9L 5EORL 3VXSA 4KJYB 2EECA 1ZANH 2VLJD 1VPOH 4JKLA 4FFYL 1F97A 1S7TB 4NQDE 4S1SL 1BVKA 5DJZB 4J4PD 3ZKXB 3ZTJG 3V0WH 1I1RA 5FO7B 4X7TA 4HG4J 1N5YH 4L9LB 1WEJL 1MRCH 3RVVD 2C1PA 2L0DA 2ZG1A 2EXWD 2NMSA 3QFDA 1AC6A 1AGCB 4XCYB 3UEZA 3U7WL 1YEKH 4NUJB 3W39B 2X4QA 3B8YA 3GHEH 4RISL 4N0UB 4J12A 4L4TA 4XWGH 3DUUA 2P42B 4DGVH 5E2UL 2G5BB 4JHWL 5ICZB 3MRHB 3K74B 2R2BA 1OSZB 4HLZH 4NO2B 5EPMB 3FO9A 3MV9B 5GGVY 3EW3B 5EC2B 3DJ9A 2C3WA 5GRUL 3C5SA 1CTNA 5BS0E 3HNTH 3U1SL 4M7LL 1NMAL 3RWCA 4IMLA 4ZAKA 3U0WH 4DKEL 4YX2L 3MRQB 1Z6JT 4BZ1L 2NY6D 5K9JH 4F7PA 4FTVE 3LSOB 4RA0C 2EDFA 1J1XL 1DBJL 1YPZA 3LRSB 3PDGA 3VFNA 5J11B 2PYFB 5BV7H 1FFRA 1VFOA 2DMBA 1I9RH 3O41B 2XI9A 5EU7E 4ODWB 1MCBA 3CC5B 4Z7QF 4NJ9H 5KSAD 4QKXB 1HI6B 3VI3E 5IVOA 2YA1A 3BPOC 4X5WA 1INEH 2DRUA 1RK1A 1T1WB 2NY4D 2XA3A 5CGTA 2VL5A 4XBEH 3MFFA 1EFXA 2VXTH 4R90L 5HVFB 5HJ3A 3QB7C 4GAGH 3UTZA 3MRRA 4C83B 3VD4A 4M43L 2EEBA 1KTLB 1AGDA 3QSKB 2DQCL 3I02A 4UMGA 1ORSB 1T2XA 1MELA 2Q76B 3CDCA 4TVSa 2JIXD 3LB6D 2HH0L 4OZHB 5IFJA 4XPFL 1LEGB 1JJUA 1J0ZA 5HGAB 3PL6A 3VFRA 1KCSH 1VADA 2QADB 4WW1B 1MCPH 4GS7C 3SGJA 1KTDA 2D0FA 2ZSWA 1A5FL 4YXHL 1XMWA 3O2WL 3TO4A 4Y4FD 3REVA 3VXSB 2NX5A 4NGHL 3VI4F 5F7DB 3L3DA 3RX5A 4BQ9A 3T04D 1JGEA 3O6KH 5D5ME 1BVKB 4U1MB 2Y9RT 4PJ9A 1JGLL 5JA8B 4G5ZH 4PRID 1T5WA 2P24A 5CWSB 3RA7H 2IEPA 5DUMH 2ADJB 1E4KC 1T2QL 2C1PB 1KXVC 5MEQA 1CICB 2OZ4H 2Y36L 4WV1A 5K9QI 4O02H 1KNOA 1MFEL 5E00B 5I1DA 1KFAL 1H5BA 1OP9A 4AQOA 4DN4L 3L3OA 5ABDE 4OSUL 3TZVB 1MHPH 4ODVH 2ED9A 1UFUA 2R2BB 4QLRA 5EUOB 1MHCA 3TH2T 4V1DA 1JGVH 4YHNB 4PG9B 3VFVB 4PJ5B 3R8QA 5F8RC 3MGTA 4IMLB 5F88A 3G6JB 4U1GB 2H2PC 2CUMA 4F7PB 3QIWC 3MRNB 1CTOA 3E8UH 4IIQA 1P69B 5IVNA 1YPZB 5JTWA 4LASH 2Y25A 4J1UA 1NEZG 1ONQB 4R97C 5GS0L 4ZDHA 3LH2H 4GMTL 2AJVH 2X05A 4U7MA 1WFOA 4I48A 1JNLH 1IMHC 3BZ4A 3PWPE 5IHUL 3W0WE 4XMPH 2KQNA 1J1OL 4ZS7H 1SEQH 5I1GH 1A6UL 1RK1B 2ZPKH 3BH9A 2W9EL 2ATPB 1EFXB 4Y5XA 4GBXA 1KJ3L 1DE4A 5MEND 3MRRB 2H8PB 4TSAL 1X3DA 1U8OA 1LK2B 3NIDE 5DK3A 4NN6B 1CT8B 3I02B 5ALBL 4RDQF 4ORZC 3P9LB 1AHWC 1UACH 4RRPG 3O6FD 4AEHL 3RZCA 4LQFH 2YRZA 2DQJH 2GCYB 3ZTNH 1IAIL 5BW7A 4QT5A 3QUYB 3VW3L 2XY2A 3PL6B 1RZ7H 2Z9TA 3VXRD 2C4XA 3KAAA 3CFKA 4LCWD 4XPHL 2ZSWB 1IJ9A 2ENSA 4NDMA 1RZ8A 3TIDA 5BJTB 4X83A 2Z8WC 2VE6A 2NTFA 3REVB 3V9FA 4MQ7B 3VGDA 4K3DL 4KKLD 3L3DB 1AGBA 3DMMA 4LKCA 1JGEB 3UZEA 1VENA 1IC7H 1T7VA 4X9BA 4OTXH 4D3CH 5F9AC 5CJOH 1MREH 5JUEH 3MLXH 4X98A 5HVGB 3KJ6H 1P4BL 4M3KB 4YJZL 1QSFA 4QXWA 1VKXB 4G6JH 2APFA 4YXKL 3IFLL 4PJ7B 5JIPA 1R3LB 3BYTA 4WV1B 4I5BA 2OM5A 4I3GA 3T0EE 2BVEA 1KNOB 5FYLE 2Z8VC 2DTSA 1H5BB 3RWHB 4OGAD 4AENA 3FOMA 3QQ9C 2C3HA 5IQ7L 3DRQB 2B4CL 4X7SH 3L3IA 1ZLSH 1P7QB 5EU6D 4V1DB 4YEFA 1YYLL 1IVLA 1OTUD 2Q6WB 4HK0A 3D2UB 3MGTB 4ZTPL 4WU7A 5GGRB 5HGBA 2N56A 2NXZB 4ZFFB 5DA0B 5FM5O 4BA8A 1K3IA 3EJYC 1DL7L 3NPSB 4UILH 5FUOH 4J1UB 3WFHB 3O6ML 3O3DA 4NCC1 4ZDHB 2R29L 1CL7H 2Z31A 1IGFH 2WINB 3RTQB 2V2WA 4FQJH 3QIBB 2KH2B 3U0PB 1DLHA 1N5AB 1HZHH 4U1HA 5TPWL 3QNXB 1IEAB 4YFLI 3MRPA 4KMQA 4IRJC 4XP6L 1B6DA 4OFDA 2BSED 3LDBB 5E4EB 1A6WH 4O2FA 3LKPB 4WI2A 4HWBL 4QY8B 4M61A 1DE4B 3QZWA 4G8EA 3HKFA 4NFDA 5DXWA 1U8OB 4GW1A 3O3BA 1OGAD 3DLQR 4GG8A 4OD1H 4ZQKB 3A6CL 2WMPA 4PLKD 5B39A 3CU1A 3DVNA 4LKXB 3LPGA 1I1AB 1WAAF 1EPFA 2VMFA 1CD0A 2Y72A 4PJXB 3B4NA 3L6FA 4U6TA 4QT5B 5CEYA 4LPWA 4UTBH 1U92B 1AR1D 1MJJA 2HLAA 4LCIH 5AD0A 4M3JA 2C9AA 3F58L 5D71L 1WC7A 2YPLA 3TIDB 2P48B 1MCQA 2P8PA 2GK0A 1CLOH 4MJIA 4RBPH 3ARSA 5AAMA 2LV4A 1OQXA 2CDEA 3DMMB 5MP6H 4L8DB 4LKCB 2RAMA 5IESL 2HJKA 4ALAH 1AR2A 1YQVL 3JWOC 4ODBD 3CPLA 5ENWA 3O2VL 3WUWB 1BEYH 1OD7A 3HMXL 3NFSH 3EOBB 3TWCH 4G3YH 2EYRA 1SJEA 4X7DC 4ZAKC 4HIIA 3HZMB 2GJ6B 1OGTB 3VXNB 1BVLA 4E41E 2VLKA 4I5BB 1VCAA 1RJZB 5DVOA 2CD0A 4U1NB 2A38A 5DO2D 1KLGA 3BKCH 3P11L 3GEWB 1HDMA 3FOMB 5H35A 2J6EH 3HUJE 2DTMH 2CMRL 3F65A 4ACPA 3KPRE 4PRNA 4R7NA 2NY0D 3EDEA 1RY7B 4EUPA 2IPKB 1YJDC 2H32H 2FLBT 3KYKL 4LLYA 4HK0B 1OM3H 1LNUB 4MA7H 1TQBC 5CILL 1IGCH 2VR4A 5A3IC 4WU7B 2DWDB 3HI6L 3CZJA 3SE9H 4LDEB 2I26N 2QQNH 5HGBB 4IBLT 4RCAA 3OKNB 3RPIA 1QFHA 4KI5C 2W38A 5IFHL 4MQTB 4PG2A 3MJ8B 3WLBB 5SWQA 4XNXH 4OLVL 4OCNC 1JP5A 4KJWC 4MWFB 3WIIH 1DLHB 3L7FA 4EN3D 1VEOA 5EOCL 3HMWH 4J3SA 1HXMB 3OXRB 3TO2A 1DVFD 5JHDD 1PG7X 1BP3B 3PL6C 1P9MA 4JFEA 4PJGF 4AH2A 4ELMF 3HC4L 4QRUA 1U93B 5SWSA 3SGJC 2NW3B 3VI3F 5FB8B 4HKXB 1FAKT 5HHVH 3VRIA 1AH1A 4HCRA 2X4RB 4BZYA 2FHBA 3QI9A 3TO4C 2W65A 1WZ1L 1MF2L 3GMNB 2W60B 1U2CA 2MHAB 1IE5A 4FFVD 2A0LD 2VDNH 1GZQB 4PJ9C 1CQKA 4I13B 2FIKA 2EZ0C 5JXAL 5I1IH 2VAAB 3VXUA 1GH7A 3RVUC 2VLRB 5HYIA 5CEYB 3ZKMD 3PDOB 1YNLH 4N8VB 3I9GH 1MJJB 4ZUVB 2HLAB 4HWEL 3NFNA 4KTEH 4WV1C 1F45A 1WC7B 2YPLB 1PLGH 5DVMA 1AKJB 3SCMA 5CCKL 1OB1A 5E9DB 2UWEB 4FFZH 4FFWD 4MJIB 1FGVH 2N7AA 4XGZA 2CDEB 2YN5A 3BXNB 3U2SB 4U0RC 4ORGA 2FO4B 4TNVK 4RZCA 1X5YA 2MPAH 5EBGA 1ZVSA 2Y06H 3QFJA 4WI6A 4N9GA 3E2HC 5IR1B 3KNBA 4HJJL 4HMCA 1QACA 3OX8A 3V2AR 5E0QA 4H5SA 3WJJA 1AQDA 1S7VB 3L5WA 4HIIB 1CCZA 1HQ4B 2EIEA 1K6QH 1OW0A 1SBSL 4RAVA 2DJSA 5C0CB 5BOPA 4IIQC 1PD6A 4EIZC 2BXZA 5J1AA 4PBXA 3X11A 2NXZC 3D39B 3NPSC 1KLGB 1FNHA 2QR0B 1XGRA 1NGPH 5EIQA 3VG9B 4YDKH 4H25A 3LEYL 3FQTA 1ND0A 1Y6MR 3BHBB 5C0AA 5JDJA 5JXEA 4PRNB 3IFOB 4R7NB 4EUPB 3ULUC 3U79A 5A2JH 4OD2A 1KT2A 3TN0D 4YHYB 1FIGL 1X5ZA 2NR6C 3KPLB 5FHBH 3WXVL 1W0WB 4HKZB 5DUBB 4JDTL 3SGDI 3KXFB 2FWOA 4Y5XC 4JB9H 1JPTH 5T1DL 4GBXC 3UTQB 3PWNA 1MWAL 4XPBL 2ITDA 1G6VK 4BFEA 5IFAL 3GSRB 4I18A 3WE6A 4NRYA 2B2XH 4IMKA 4OM0L 1RUML 3N9GL 2LTQB 3RZCC 3SKMA 1DLFL 3JWDL 4NC0B 4ZYKA 2I27N 4UNUA 3O8XA 4BH8A 5BW7C 3GO1H 3RPKA 3GNMH 3F62A 1U41A 4KJQD 3QG7H 4JFEB 1LDPL 1F4WL 1NGWA 4P2QE 4JGJA 5SWSB 1CK0H 4KY1L 5ESQB 1GJIA 1G84A 2WBWB 4LARL 4MA1C 3T3ME 1RUPH 1ZHKB 4OGXH 1AXIB 5IK3A 4AIZA 3DMMC 2RIKA 4CVWA 1HHIA 4JRXE 4QYOA 4BSWA 1WFNA 5HI3D 3SKOA 3TIEA 3NIDF 1HNFA 2FIKB 1RI8A 1JNNH 3QO0A 4P3DB 4C56D 1PZ5B 4XZUB 3VFTA 2I9TA 5FGCE 4XCCL 3CVHL 4KKCC 4NNYA 1YEHH 2EEDA 3CSBA 3QUXA 1OB1B 1ZHNB 1A21A 1FVEA 3IKKA 4DKAA 4OF3A 5FKAA 2EDWA 1ADQL 5DZLA 4L4VE 2XQBH 1A3QA 1YDPA 1I9IH 1N0LA 5DJ0A 4ORGB 1JRHL 1T1YA 1Y18B 2VXSL 3EAKA 1ZVSB 1RZKC 4DOHE 4LBEB 4YDVA 4RGOL 3BE1L 5KG9B 3B5TA 4WI4A 5K9OA 1IFHL 1P7KA 3OX8B 4PUBL 4TTGA 1BF8A 1AQDB 4GMSL 4O5LL 2IQ9H 4KRPC 4U1LA 1AO7A 4RAVB 3UYPA 1T0MB 1BPVA 3X11B 5J1AB 4JQIL 1FFOA 4OKDA 3ULVC 2VO5A 3KR3L 5BCAA 1MNUL 2DQGH 1XGRB 3U83A 4GO6B 3ARFA 4KRNA 4PJEE 2Z31C 2J8UE 5C0AB 2BSRA 4F37K 5LXGL 2F5BL 1ZWIA 2QADD 3GSOB 4BFIA 5CZVH 1OAXL 4PJCF 5KSUA 2ZCHH 4K2UH 4X99A 1KT2B 2VQ1A 4XNQA 4FN0A 5FDWB 1UXSA 3JZ7A 2GAZA 2PW1A 1IEHA 2YEZA 3ARVA 5GIRA 3V6FB 1QSED 3FJTA 2AGJH 4R0LB 2FWOB 4N1HB 4HF5L 4U6YA 3VXOA 1M71B 1MPAL 3PWNB 2GTWB 1MY7A 4PTTA 3PWVA 4NQEA 3QEQB 3WE6B 4NRYB 2H1PH 4LVHC 1I8IA 4GRLA 2EH8H 4BH7B 1OAQL 3FFCA 3SKMB 5EBMA 4JM2D 2IANB 1CICD 3IFNL 4P2RA 2E27H 3O8XB 4ELKB 4AT6A 5FCUH 3KPQA 3ZE2E 1AJ7H 2P44B 2JKXA 1RURL 2ZUXA 3MO1B 3TZVD 5DMGD 2Y5TA 4R7DB 3DUHA 5E94B 2FBOJ 2QHRL 2F54E 3BKMH 1CGYA 1OSPL 4J3VA 4R2GD 4TNVF 3UMTA 3RWGB 5KS9A 5FA4A 4QYOB 3MA9L 4PJ5D 1FBIL 4UNTA 2VN4A 3LKSA 4BSWB 5EU5A 5E8PA 3L3JA 2DYPB 3HG1A 2VUOA 3Q6FB 5FUCE 4UIKH 3UJJH 2E7HA 5EA0L 1JGUH 1G0XA 2ICWI 2YUWA 4KHXH 3VFTB 1BWWA 1WBYA 1CGTA 3GIVA 4XCFL 4DGYL 3BWUC 5T3XE 1ZE3C 4MS8C 3VE0B 1XGPB 1S7UA 5I1JH 1UWGL 4XVTL 4FZEL 2P5EB 1LO5A 3CD4A 4JFZH 2R23A 4S11A 2MWCA 1YDPB 3Q3GA 4R4FL 3WNOA 2IGFH 2QSTA 4U7SA 5DJ0B 3ZDYF 1U8LB 3JV4A 4GKZA 1DBAH 2VZTA 4XVUC 4YHYC 1QO3B 2XG5A 3SDXA 4QCIB 5DYOA 1UYWL 2X4SA 3RWFA 1HHKA 4KZEH 3IDXH 4XC1L 1AO7B 5KN5B 4PJDE 2XZCH 3BP6A 3MV8E 1HN1A 4MNGE 3HE7B 3QDJE 4PG2C 1X4YA 1AI1L 3BIKA 3G04A 3ARFB 5GRXG 1UCBH 4DGIL 1CU4L 1PQZA 2BSRB 3QUYD 2D3VA 5C0ND 2AKRB 2XA8L 4WFED 5KSAC 3P4NB 2J7LA 3HUJF 3DETD 4AM0A 2V2XB 4PS4H 5GRWA 1V8HA 4XNQB 4TVPL 1TZIA 1UXSB 1P9MC 5J57B 3ZL4H 2YEZB 5GIRB 4RFEA 3RL1A 3QI9C 3O4LD 3GBMH 4MA8L 3VXOB 3THMH 3I50L 3N1PC 1JZ7A 3PWVB 2OK0H 5I6XC 5C0EA 1NDMA 1B2WH 4QRTB 3HZVA 1ZTXH 5FYKL 1JWSA 1IKFL 4P2OD 3GSUB 1I8IB 4GRLB 1VERA 1WFUA 1MRFL 3N0PB 1JYWA 1NKRA 2GTZA 2PTVA 4UDUA 3L3KA 1WK0A 3BKYL 4AT6B 5GRZA 2VXVL 4OCWH 4M7JH 1G1CA 1U6AH 3S34L 4KMTL 2R4SL 3FL7A 4YHZL 4O2CA 3SCMC 2BDNH 2P5WB 5I1KH 2YKLH 2R1YB 1P7QD 2HN7A 2OL3B 4M6AA 3ZHKA 4ODHL 4TN9A 5D7IE 4JPKL 3M8OL 2V6HA 5KS9B 1P4IL 1NAKL 4QHKJ 3LKSB 2DQFB 5DMJB 1NH6A 3D2UD 4TUKL 5J13C 5EU5B 3L3JB 3HG1B 4Q2ZA 1FHGA 5IW3A 1NGXA 1F8TL 1S5HA 3WJJC 4G6FB 4JJHA 5DRNA 1KN2L 1FFPB 4PBWD 4R4ND 3V5KB 3GIVB 4I77L 3IGAB 1S7UB 4XNUL 1NEZB 3RTQD 2FD6L 3PGFL 5DURB 3PP4H 5LWYH 3CMGA 1ZOXA 3QIBD 2R56H 5ANMA 4M1DL 4F37F 4DAGL 5C9JA 4JFOA 5CEZE 5JXEC 3R1GL 2ICEA 5J3HD 2ED8A 2FX7L 5DRXB 1NPUA 4ISVA 1CFVH 4GKZB 1D5MA 5ERWB 2EDDA 4NWUH 5EG6C 3ES6A 4AIOA 3SDXB 3FO0H 5DYOB 3TBVB 4K7FB 2XV6B 3BDYL 2X4SB 5I1CH 5IB2B 5L2JB 4P9ML 3O45A 3MRJB 1WBXA 1R5VB 3EGSA 1EHAA 5FUZL 4NQDD 3TH4T 3BP6B 1QYGH 4F57L 1U3ZA 1HSBA 3QJFB 3QCTH 4P3CH 1AQKH 1RAMA 1I1AD 3QXTA 3BUYA 4I18C 2IFFH 5IGXH 2B1HH 4FZ8H 2GKIA 4UT6L 2BNUA 2XKNB 5DQDL 1DBMH 1PQZB 2XTJB 4RGMB 4NIKB 1WT5C 4B7IA 1ACYL 5HHNB 1PDKA 4DN3L 1MIEH 3WFCH 4XRCB 4AM0B 2XTLA 3O8XC 2WLYA 2X4UB 1VFAB 2E9BA 5CBAA 4YZFF 3TYFA 5TE6L 1D5IL 4GG6E 4LSRL 5H94B 4WEMB 1YQ2A 4MAYB 2IADA 4MDIA 4X6CE 2VKXA 3BKJH 3MGOA 3FONA 1MFBL 2CO7B 1TIUA 2ICWA 2YBRA 3KVQA 1OCWH 5C0EB 5DHYA 1NDMB 2FEDD 3HZVB 4HDIA 5E6IA 2JB5L 4ERSL 3HN3A 2GJ6D 4FTVD 4CMHC 5HSFA 3MXVL 2KL6A 5EOQL 1R3JA 4ONHA 3VFGL 4NFBA 5T1MA 1YEJL 5GJTH 3C2AL 4X6DF 1KC5L 2HLFD 4BJLA 4O2CB 3T0AA 3QUXC 3S3SA 4NO5A 4HGWA 1E27A 2PXYA 3JUZA 3QDHA 4WI3A 3DSFL 1EGJL 1QPPA 2ERJB 3PXJA 4JPIB 4QRPE 5BQ7B 3ROOB 4OBSA 3GI8L 4Y5VB 2JELL 3T2PA 3OJ2C 3T3MF 3S6CA 1JZ2A 4XNYL 5C0BE 4X5XB 1T20A 3AREB 5C6TL 1RUKH 4Q2ZB 4N8CL 1NGXB 2NTSP 2FGWL 1K4DA 1Q9WB 4XPAL 2D0GA 4IRSB 4BUHA 1CBVH 4L8SA 3MV7E 1ROWA 3D3VA 5DRNB 3NMEA 1J8HA 5FYLH 2DD8H 1CWVA 3CFJB 3D18A 1FYTA 1DJSA 4L9DA 2VZ3A 4YHPA 4HWNA 2YS4A 4M4PA 2YD4A 4OLEA 2V7HA 4PP2A 1GYAA 2Y4SA 1SMOA 4R9HA 1DANT 4D8PA 3DUSA 4ISVB 4OLXL 1D5MB 3SO3B 3L3HA 1NDGA 3WJLA 3ES6B 2AEQL 3KJ4C 2DICA 1G9EA 4WFGE 3IU4L 3V4UH 3BRDA 4Q9QL 4LCYA 1R3IL 1WBXB 3UAJD 1YEEL 3TBYB 4C54A 1D5BB 5GGRY 4WO4A 1HSBB 3SDAD 4X5LA 2GIYA 1WTGT 3MPCA 3DIFA 1IT9L 5B38G 3EYOA 5C08A 1JE6A 3NH7H 4P46B 2F53A 1EXUA 2VLRD 2ZNWA 2AI0H 3DGCR 1F4AA 3KLAA 5J12B 1RZGB 1QFWL 4D9LH 4PJEF 2FEEL 1F13A 1HOCA 2J8UF 2C3GA 3GMOA 1AKJD 1UEMA 5E9DD 1NLBH 5CIPA 1KCUH 1XGQB 1CF8H 3JWOL 1J11A 2EYTA 3KPMA 4LLQB 5C0JA 4KQ3H 3K46A 5HGGS 4HBCL 3T0WA 4MDIB 3GB7A 2VIRA 3ZTJH 2YMXH 2F54B 4X7EC 2ICWB 2YBRB 1A7RH 4DVRH 3IJYA 3V8OA 3S37L 4HDIB 3DV4A 4JFXA 3L5JA 2R1XA 3E3QC 4WUKL 2EH7L 4J2XA 4HQQH 4Z7UE 2XWJA 5ESVA 3CSYA 3GFUA 5E6ZA 4HK3N 1F00I 4PLJD 2BVPB 2E5EA 5C0CD 3KPNB 4Z7VE 1AR1C 1R3JB 3VWKA 3M17A 1E6OL 3D39D 3EOTH 1GPOL 3G5ZA 1YJDL 5E8OA 4NO5B 5IBTL 4HGWB 1P2CA 3ZE2F 5FGBA 4ZG1A 5IF0B 2P49B 4XMKL 1ZLUH 3UPAA 5GISL 3W0WD 4QRRA 1IGJA 4MCZA 1V7ML 3TA3A 3K0WA 2MJWA 2UYLB 3DROA 1T20B 1EMTH 5GJSL 1YEDA 3KXFD 4WWID 4L8SB 3ILQC 3D3VB 1CDBA 5ACLA 4UQ2A 1J8HB 3IDIA 1WCBA 4Y89A 4Z7WF 2X4NB 4X6EA 4PJDB 4K07A 4Z0BL 5TDOA 2O5YH 1EHLL 1IGYA 2D7PA 2VNCA 5DO2C 1AGFB 3O4OC 4I0PB 8FABA 1XF4B 3JXAA 1FZKA 2XXMB 3T3PE 3O11A 3BDBA 3DXAB 4P4RB 4Y8DC 4D8PB 3DUSB 4X4ME 4FP8L 5GSVA 4PRBA 5CGYD 2DIBA 3H3BC 4N0YH 3X14B 1KSRA 3LHPL 2VDOH 4NOBA 3VXTB 5ITBH 5C07E 2C4FT 3A67H 4Y5YA 1NFIA 1LK3L 4U6XA 3OKKA 3MRDA 5FFLA 7FABL 1A1NB 1HIMH 3ZE0E 3UTSE 3DIFB 1S7QA 3MRGA 2EICA 2R0KH 3EYOB 1A1MA 4XPGH 4MXWL 3MLSL 4UZGA 1CXEA 4YDIH 1EXUB 2WW8A 1I8KA 2NYYD 4KI1A 1YUHB 5CEXA 3HE6B 5ICXB 3LS4L 6CGTA 3GMOB 5GXBB 5FYLD 2EXYC 2WBJA 3BIBX 3KPMB 2DQHL 3RIFK 4Y1AB 5EO0A 4M5YL 4OFPA 4OLZL 2CK0H 2DQTH 3KHQA 5IW6A 4X80H 4K23H 2JJVA 2PUQT 3IJYB 4U1JA 4KHTL 3KPOA 3BUTA 3DV4B 4JFXB 1H3PH 2EKSA 3AU1B 3ARDB 2AV7B 4X4XA 5AYUH 2MCG1 3CSYB 3GSNL 2W92A 1TQCC 4N1CA 3VWKB 2RBLA 4GW4A 3S3JA 5LCVH 3P0YL 3ULUL 5C2BL 2OMNA 2OL3H 5E8OB 5F71A 2J4WH 3GBLA 3ESUF 1JHLL 3OKOA 3DX8B 2JB6A 5DRZA 3QUZA 1Z3GL 5GHWL 2R8SH 2HT3C 5E4IA 4D0BB 4QRRB 4S1DD 4D9RE 3G08A 3E6FA 4LP5A 1BM3H 2DL2A 1LO0L 2FJFB 3T77B 5CD5D 3F5WA 5JHLL 3SO3C 3T2NL 1IAKB 2HT4C 4RSVA 1RZJL 2L7UA 4ZUTB 3HC3L 4KV5F 3WFEH 2CLRA 4UQ2B 1WAAA 1WCBB 3QEQD 2GEEA 4X6EB 1F11A 3G6DL 4O9HH 5L88H 5TDOB 1IGYB 4JFFA 4OCSL 5M95B 3ARBA 4BZ2L 1FZKB 2IAND 3EDKA 3S4SA 1YEFH 5E2TL 4AEIH 3I85A 3MLRH 1QTYT 4PRBB 4AK1A 1FVDB 1I1FA 3V7MA 2D4FA 2HWZL 3FRUB 2AABL 1MFCH 2EDLA 2EIZA 2HTKD 3MRDB 3WD5H 4MAUH 1I9JL 1T2JA 4JY5H 4IOIB 3VGAC 1NCBL 1A1MB 2ADIA 2DYPD 3FZUD 5D7JA 1LWRA 2ESVE 5E6IC 2CKNA 5I0ZA 1DN2A 3HLAA 4ZXBA 3DO3A 4EBQH 3HPJA 3MR9B 2X89A 4GW5A 4LSQH 1H0DA 2OMBA 3T0BA 4KJQC 4Y2OA 1NLDH 3OR7A 1GGCH 4H1LA 1U8HA 4HV8B 2P5ED 1RZKL 3CK0H 5H37G 3INUL 5EO0B 1RFDH 3LEVL 4NC1E 1PG7H 4B5EA 5IW6B 1YMHB 2PXYC 4HIHA 4WHTB 2A1WH 1J88A 5D93B 1U8KB 2FDBP 4R96A 4GG6F 2DQDH 4NYLA 5IB3B 5L7XH 3NAAH 5BS0A 4X6CF 5K93A 5HI3C 5CJBA 1SY6A 4FA8A 3ARUA 1CDJA 3EYFA 3MCKA 3BVNA 4NQXB 3IRPX 4U6HA 4NZTL 4XX1G 1Q0XL 4GW4B 4LNRA 3HE7D 1M1SA 1OTSD 4NHUB 4PGBB 5C6PB 3PG2A 3LD8B 2VDQH 2MQCA 3C5JB 5TFSL 5J56B 3B2VL 3OKOB 1MI5E 1UG9A 4PJFF 4PJGA 1JPSH 4ELMA 5DRZB 3QUZB 4TTDD 5IHZA 4WUUE 5IEKB 1TETH 2XPGA 3IVKA 5EU3A 4ONFL 3V0VA 5F97E 1ZHLA 3N50A 2PTUA 1CXKA 1UJ3B 4WI9A 5IT2L 3WJLC 3RNKA 5ADPL 4EI6A 2AJSH 2H26A 2WBKA 2CLRB 4YXLL 1K85A 4I3SH 2O5XH 4WO4C 1NBYA 2HVJA 4JANA 3U7YL 4P99A 5FECA 1W72A 4F7EA 4U33A 2I60H 3V4PL 3VMOA 4X7FC 2Z0BA 4MJ4A 4JVUA 2Q8AL 3S4SB 5CP7A 5DMIH 5JDSA 3X12A 1YEIL 2J5LB 4G7VH 3QWRA 4MDJB 5D6CA 3OAYH 5INDA 3HAEG 2P5WD 3V52L 2OYPA 3DHMA 1HQRB 2E7LA 1TPXB 1A7NH 3S35H 3CLFL 5T1LA 3BD5A 2ADIB 4HC1A 3MODH 1OAUH 2JCCE 5D7JB 5HYSG 4MB5A 4G6FD 4JN1L 4LU5H 1KENL 2EE2A 5GGTA 3LQMA 4JM2C 4KVNL 2NY2B 4GW5B 1NMBH 4JRYE 3VWKC 4H8WC 5DURD 4HFUL 4MNQA 3MLZL 2X09A 5LG1A 3QEHB 4L8CA 1L9NA 4XHJD 2X1WL 3P2TA 5JMOC 4XCEA 3NABL 5DEGA 5FGBC 3CCHA 1TVHB 4R96B 43C9A 4R2GC 4BKLB 5E8EA 1UVQA 3WN5A 4F9PA 4TNWK 5GSRA 4AZ8A 3TA3C 5C86A 1FG2B 3IS0X 2DM4A 3MOAH 1BBDL 4WJ5A 2ID5A 1Q94A 4EKXA 3BVNB 3K8KA 1OWRM 4UT9L 3O2DA 4QOKE 1YY8B 3UTTB 3WV0A 2R9HC 4LNRB 2BRQA 4OM1H 2J8HA 1MFAH 2XTJD 1OP5H 3SKNA 4G43A 4PJGB 1IC4L 4ELMB 2ZP0T 3C6LA 2DM7A 3D25A 1QEWB 3RAJL 2PCPA 2XPGB 1DBKL 1U58A 2B39A 1HXYB 3PWPA 4HCRL 2W0FA 4YBQC 5EU3B 3V0VB 4D0CB 3IAGC 1ACZA 3IDGA 1ZHLB 3I75A 4P2QD 5HHOB 2YZ8A 4Y19E 4KAQL 4UDTA 3RNKB 2IH1B 2ZOKB 2ZNXA 1MEXH 4MAYD 3WIFA 1DDHB 4U31A 1GC1C 1XGUA 3WKMH 9CGTA 1JBJA 5JNYB 5HI5C 4Y5YC 3PWUA 5F3HA 1XF5B 2SEBA 4W6XB 3NCEB 1CFQA 4Z95H 2HVJB 1NGQH 2CIIA 1XF3A 4JKKA 3OKYA 4HMEA 4F7EB 4JDZB 4LSVH 5CJQL 1IC5H 3V5HB 1CD8A 3HNSL 5D2LE 1FNSL 1I3RB 1X44A 2Z4QB 3S3PA 1PBYA 1KIPA 4AJ0A 4KH2A 4C4KT 4PRDA 5HPMB 3PV6A 2UZXB 3JTSA 5D6CB 2JTDA 3T3PF 3LCYA 4ZUSA 5INDB 2WUBL 1UA6H 1I85C 1X5XA 1JWUA 3NCFB 4HIXL 2WBJC 3MRMB 1J8KA 3AGVA 5KVEH 1KB5A 4H20H 1BOGA 1BQLL 4O58H 5DR5H 1B4JL 3ARED 5T1LB 4MCYA 4HUVB 4P2OC 4HUXA 4IRSD 5L2KB 4GQ9H 3P4OA 1FRGH 4I4WA 1F6FB 3WYRA 5ISZB 4FQXA 2R2EA 2VDKL 1ZSDA 5F89A 5KSVA 3T0EA 1Z9SA 3RY5A 3UX9B 2IFGA 4TPRL 3ILPA 3VDCA 4I2XA 3IJSA 4PJCA 4F2MB 5ACZB 4L8CB 1LEIA 2JJSC 4MZ2A 1JHKL 5DMYA 1FNEB 3NCBB 4WTZA 4XI5C 3BZEA 5E08L 4HLJA 4FQ1H 3QUZC 1KLUA 1MRDL 4WU5A 5E8EB 1D6EB 5DDHA 5EB9A 1OT1A 3IFPB 5GSRB 3PHSA 3ISWA 3S98A 1ZANL 3ZLQC 1VPOL 4UT7H 3WS3A 3LN5B 5GQBA 4NO0D 3DOSA 3BGFC 1BGXH 1Q94B 3KHOA 4W81A 2Y07L 1REIA 1IGML 1N5YL 4QRQA 5F7HA 2NZ9C 4ZO7A 1DBBL 4G6MH 4P46D 4NHCH 2V5SA 4OLUH 4NWTL 3MV01 3ARBC 4G43B 5CEZH 3DVGB 4I1NB 4Q58C 3GHEL 5I1HL 4XWGL 4OI9A 1T1ZA 3I75B 4TQEL 3ZZ1A 2EDRA 4U3HA 4ENED 1GOFA 1KCKA 1Z2KA 3KPPB 1OAYH 4JKMA 1GIGL 2F54D 2ITCB 3EO0A 3HNTL 4K3HA 2Z91B 5F3HB 2Q7YB 3U0WL 5FV1L 2SEBB 3GSVB 2CIIB 5HVWA 3H3PH 2PR4H 2BNRA 4NRXB 1O7VA 1VA9A 3N85L 4PTUB 1D9KA 5SX4H 4FNLH 1KIPB 4KK5D 4ZXBC 1FZJA 1S5IH 4CN4A 3R0MA 1I9RL 4WHYG 3V5DA 2NY2C 4RFNC 3I6GB 4FQLL 4ZUSB 4HT1H 2ADGB 2WP3T 4NJ9L 5F1KC 4LIQE 1WF5A 1I3GH 4KVCH 4M4RA 4MNHB 3B83A 5FF6A 4L1HA 4YFEA 1KEGH 1J86A 1K8IA 4OLWH 3R0NA 2XWTA 4NBXB 1YZZA 1INDH 5AZEH 4QHNA 4XBEL 4TNWF 5T5NF 4PBVC 2VXQL 2F8OA 4KK8C 2AS5M 3WL9B 1P84K 1I7RA 4AL8H 4TSCH 3UC0H 4EOWH 4HUXB 4FQHB 1QKZH 4I4WB 2B5IB 3EDFA 5F6HJ 3VGGA 4FQXB 5DJDA 4E41A 2R2EB 4HH8A 3MBXH 5KSVB 2ADFH 1CN4A 1C5DA 5CJ8A 3OL2A 3ARWA 3IJSB 4I2XB 3TJHD 4I0PD 1KPUA 3HUJA 1A0QL 3V95A 4P23A 25C8L 1LEIB 3MRFA 3DXAD 4I9WE 3K8MA 1RZIA 2VITA 3KPRA 3BZEB 2COQA 4LLDA 4JFDE 3TH3T 3W5NA 4HPOH 5T33L 2R4RH 3CX5K 1YN7B 3WS3B 3GSQA 3CH8A 2JJTA 4M1CC 1IAII 1X5LA 3EYSL 4G8GA 3BYYA 1BZ7B 3QWQB 1IKNA 2MNUA 4G5ZL 4Z78B 5HYFA 3QRGH 4QRQB 2W0PA 2I5YH 3IF1A 5TF0A 5DUML 5B38B 4OF0A 3CIQA 5AWNH 3MBEA 2YUXA 1PX3A 1FGNL 3HE6D 4U05A 4MLSA 2Y7QA 1T1ZB 3D85B 4FQCH 5C09E 4ODVL 3MRKA 1L6ZA 1IAMA 4Y1AD 5IEHB 2XWBB 5E99H 3RHWK 1JGVL 5F96L 5JPNB 3GUTA 4YDLC 4UV7H 2FX9L 3ARDD 2ARWA 2E7LC 2BNRB 5KSBB 2DQUH 2AJXH 3E8UL 1CZ8H 3KPSA 3BX7C 4LCCC 1NQBA 4LASL 1FZJB 4PJHE 4P9HH 4NFCA 3SKUD 1E0OB 3V7AG 2AJVL 1HKLH 4PGEA 3CFBA 4CJ0A 4GT7A 4Z5RB 5GPRA 1WLHA 1JNLL 1C12A 3QHTC 4JZOA 1AIFA 1OT2A 5FF6B 1SEQL 1OHQA 2V2TB 2HFGH 4KUZH 3ZE1E 5CEZD 1QFUL 3T1FA 2ZPKL 4MX7B 5IQ9A 4QHNB 2VLJE 5AUMB 4OFYA 3WN5C 5T3ZH 2FR4B 1S7WA 1I7RB 5LQBH 1CGVA 1QHOA 3A6OA 3SE8H 4PRAA 1GZPA 3TJEH 4FXGB 2JCCF 1TENA 3C87A 1EX0A 1FO0B 2R2HB 3EFDL 4LQFL 1CGWA 4PY8J 1JUFA 1V7NH 3ZTNL 3P30L 1QG3A 1MCLA 3S96B 1BOYA 5IJVB 4Y4HB 4RNRB 4HPYH 1IRAY 3FO2B 1RZIB 2VITB 4DK3A 4LLDB 4MD0A 1HYRC 1O0VA 1QSVA 5DLMH 3C6LC 1BFVH 4ZD3H 5IBLC 1KULA 4K3EH 5DHVA 2JE8A 3FT3A 5D7KE 2YD5A 1RMFL 4Q0XL 2YK1L 5C0GB 2FYYA 4P4KD 2GFBA 1G0YR 1K2DB 3VXPA 4G8GB 3VDAA 1BD2E 4XP4H 2AK4B 3BP4B 3PWLA 5F8QC 5FYKU 5CJOL 3MLXL 1M4KA 4LSSL 3IF1B 1T0PB 3KJ6L 4YBHA 4QXTB 3K1DA 1YN6B 1NCNA 3Q1SH 1Q9OB 3P4LA 1PW3A 3QG6B 1X6LA 1NFDE 4X6DA 4O2EA 1DANU 3LKQA 2Y7QB 1S7SA 1PKQB 5I15H 5KAQG 4J3OC 2AJ3B 2OSLA 4DZBA 4XVJH 3HC0A 1YNTB 2DIJA 1FL5B 1XR8A 4DQOH 3HI1B 4PGJA 2QBWA 5LAXB 4FMFA 4QRSA 4JRXA 4Q74A 1RIVH 2NY1C 2XOTA 4OQTH 2KKQA 5F9DC 1GSMA 1R24A 3H9YA 1RJYA 1B9ZA 1JV5B 3KPSB 3FQWA 4HXBH 5FUOL 1FZOA 1QQDA 1LO4L 3LEXA 2C26A 2B5IC 1FLTX 3QNZB 3F12A 3QNYA 2IG2H 3FB5A 3GSWA 3T0EC 3PP3K 1S7RA 4PJIE 5ITFA 1HZHL 3HCVB 1OF2A 1P7HL 1AC0A 4L4VA 1QBAA 4G8FB 3GI9L 3QXAB 4HKBA 1FE8L 2E8ZA 3T1FB 5C71A 2XZAH 1BQUA 4Q9CA 4CU7A 2E6QA 1U8PA 4YC2C 2DLEA 2DDQH 5CP3A 5IVZA 3ZKSD 4JKPH 1ETZA 1K4CA 1EERB 4PRAB 4PRIE 4WFGD 3P40A 4PRPE 5L0QB 1KG0A 4WW2B 3OF6A 5B22A 1CLZH 3TP4A 4OCMC 1JUFB 5I30L 4JRWA 1VFBA 3RUGB 4HULB 1RIUH 1DZBA 3S36X 3U46B 3TT3L 2NY5H 1BF2A 2VLMD 4JKWA 1G7MB 2C5DC 2YPVH 1FDLH 1F3DJ 1BIIB 1F3JB 5T5FH 4NQVA 4MD0B 5JW4R 2AJZA 1HEZB 4NM8H 2A9NH 3WNLA 4XTRC 5BRZB 1CLOL 5DHVB 4BSVA 3U30C 1M6OB 1A6TB 5MP6L 2J2ZA 5F3BA 3TVMA 3RHWF 2PO6D 3RDTA 4LOUD 4ZPTA 3VXPB 3GRWA 5I8KH 1TCRA 4UQ3B 1U3HB 1BEYL 1XH3A 2BNQE 3NFSL 4XP1H 4DKDC 3JWNC 5D70H 2DQIH 3LS5L 5DA4A 2BCKA 2YA2A 1NC4A 4YK4C 2A74B 3H9SA 1CD1B 1PJ9A 5T3ZD 3JVGC 1KCVH 4O2EB 4HFWB 1D9KC 5D7LA 3ME0A 1RU9H 1S7SB 2KZWA 5IVXE 2J6EL 2DTML 3MNZA 5IMOA 1JHTB 4DZBB 1YMMB 3V6BR 3RI5K 3ZKND 2IBBA 5MEPB 5HDQL 4OB5H 3I3DA 4LGPB 3P9MB 4GAYA 1ZT1A 3AB0B 4XC3L 1CFSA 1AFVL 4XB8A 5I8EA 3VXME 1O5DT 5MENE 2QQNL 3OAZH 1R24B 2IAMD 1RJYB 4ESKA 3KYNB 5LGJA 2K3TA 4Z7WA 2R2CA 3IB4A 4JO4L 4U2YA 5F9WC 5I1AB 1R0AH 1SYSB 3HRZA 3B9KA 1SMAA 1QQDB 3QEUA 3LEXB 5EBLA 3UTTD 2IPTH 4Z8FL 3F12B 5HDBE 4DZ8B 3QIUB 2ZUVA 1KCRH 3GSWB 3JUYA 4UV4H 5CSBA 4UAOB 3WIIL 5L9DL 1BFTA 4KTYA 3HMWL 3TBSB 2YXMA 4LCWE 3PJSB 4P23C 3KWWB 3A0OA 1JPFB 4JPVL 3U0TB 2HJFA 2WWKT 2BOBB 5HHVL 5HHOD 3LKRB 5BZWA 1U8PB 4CDHA 1KACB 3WNMA 3UZQA 5IVZB 3BN9D 1IAIM 3FT2A 1KG0B 3Q6GH 4XBPB 5I71B 2ICCA 1Y6KR 2XN9B 4RAUA 1IKNC 3MV8A 1NCCL 2GQHA 3UTSD 1JK8A 3K3QA 1N4XL 2HVKA 3HMXA 3KYAA 3QDJA 3PQYE 4JM4H 4P3WA 2HKFL 4IS6A 1YNLL 2VLLB 3ARQA 4NKDA 1FG9C 2G9HB 3MBEC 1D6VH 4XP9H 1CVRA 4KTEL 2OQJB 3MRLA 4NQVB 4S1RH 5J4MA 3OQ3B 3V79C 7CGTA 2ZUUA 4HIJA 1FLRH 2DI7A 3OGCA 2YPKB 1FGVL 1AD0A 5EU6E 3T4AA 3BRFA 1MFDH 1B4RA 3MLVH 3RDTB 2VISA 3B5HA 3ECBB 1B3JA 3T8XA 1H15A 2MPAL 2NY3B 2QLVB 1NAMH 4YUEL 5E95B 1UT9A 4M48H 4APQB 2AXGA 5EWIH 4HIEA 1F2QA 4F8QA 5HI4C 1AXTH 3GMPB 3UYRH 3U9PH 3H9SB 5L2KD 1OAKL 4H8WL 5HYSB 5CUSH 4LMQI 5ISZD 1JRHI 1EEYA 4Y4KD 3RVTD 1FVCA 5D7LB 4ZUWB 4LCUA 3PNWB 3BI9X 4RGNE 5IMOB 4X8JB 3ZYIA 4WY7H 2VAJA 4GXVL 3CZFB 3G9VA 3JTTA 4OJFH 3RKDC 1XCQA 5D9SB 1DFBH 5J8OA 2DLTA 4OZ4A 5D1QB 1ZT1B 4WDIB 2AQ3A 3MNVB 4FXKA 1B90A 4LSUL 4F7TA 4O00A 2ORBH 1OGAE 5DFVD 4KXZI 4JB9L 4Z7WB 5FHAH 5HYQB 1NCAH 5DI8A 3B9KB 3FQRA 3X17A 1LE9A 1UB5B 3QEUB 2G75A 3TNNA 2OR7A 3D69A